2D5HA

Crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
488
structure length
373
Chain Sequence
FNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISNICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords glycinin A3B4 subunit
publication title Conservation and divergence on plant seed 11S globulins based on crystal structures.
pubmed doi rcsb
source organism Glycine max
total genus 72
structure length 373
sequence length 488
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA01
5KBFA 2B8MA 4I02A 4N9HA 4L11A 2N7GA 4MGKE 2Q0AA 4AVBA 5KHHA 1NYWA 2D5FA 5J7MA 4JVAA 3PLQA 1UIKA 1Q5OA 4HSLA 2BEOA 3LA7A 1J3PA 1J1LA 3HT1A 1DGWA 5D1IA 3EJKA 1ZVFA 3FE5A 1UIJA 2P17A 4XF0A 2OA2A 4Z07A 5BY5A 5C6CA 1CAXB 4IEQA 5F1RA 1J58A 3NVCA 3ST7A 2IXLA 4FAGA 4UBHA 3LA3A 3VHRA 4XFCA 3TNQA 3DV8A 4RD7A 3S7EA 1QWRA 4QMAA 2E9QA 4ORFA 4XFFA 3E5UA 3HT2A 1Q43A 1CAWB 2B5HA 5EFUA 2I45A 1O3RA 4Z82A 3SMHA 4KWJA 3DKWA 1UD1A 3EBRA 4HVOA 1O7FA 3S7IA 3EO6A 3C3VA 3SHRA 2D5HA 2OZ6A 4PIYA 1DZTA 1LR5A 3D0SA 4XF3A 4HN1A 4HVQA 4N9IA 1UW8A 2Z69A 4BYYA 2GC0A 1ZNPA 2XLGA 1IPJA 4Q29A 1ZREA 1YFWA 4MGIE 1CAVA 4OLLA 3U0ZA 4IEXA 4XFGA 3WW2A 5CVRA 1OFNA 3GYDA 3WW1A 1OMIA 5FPZA 1X8EA 2GZWA 2K0GA 3H1MA 1YWKA 3L2HA 5KHKA 2OZJA 1O5UA 2KXLA 4QGNA 4XF9A 3KMHA 4F7ZA 2H6BA 5E1RA 4MX3A 3JZVA 3ES4A 2F4PA 4Q0PA 4IETA 3ETQA 3IDBB 2MNGA 4HVRA 4A2UA 1CAXA 1G6NA 2PAKA 3CL1A 3CJXA 3H1YA 2PA7A 2GC1A 3NW4A 3H50A 1NXMA 2PAMA 5I8YA 3HQXA 2IXIA 5J48A 2BNOA 3ZDSA 4I01A 5I93A 4B29A 2QDRA 1CAWA 1Y9QA 2O8QA 1WGPA 4LTAA 1HW5A 1ZZCA 3E5XA 3O14A 5E16A 5BPXA 2QJVA 4L2NA 4JV4A 4MGZE 5JSPA 4IEWA 3I59B 3D0JA 5KHGA 2EVXA 1EP0A 4MGYE 4QX5A 4DINB 2PYTA 2Z2SB 3U11A 4HZFA 1I6XA 4LUKA 4HSJA 5LEJA 2GC3A 4OFGA 1VP6A 2XLFA 4H7LA 3NL1A 2VQAA 3MYXA 3ACLA 4O9GA 2C0ZA 1O3SA 3R6SA 4P9GA 3H1WA 2CGPA 3M3IA 1LKNA 2XLAA 4LA2A 2GAUA 2PHLA 5FLHA 1XE8A 1XRUA 3FFQA 1LRHA 2D40A 1H1IA 2BNNA 3CF6E 2ZKLA 4QM8A 3OD0A 1UCXA 3MPBA 4X6QB 5AVPA 1UPIA 4UXAA 4ZU5A 2XKPA 2MHFA 1NZCA 4IEZA 2QVSB 4IEVA 4XFIA 4IESA 2EAAA 1SFNA 2IXCA 5I8SA 5I0TA 2PFWA 2GC2A 3MZHA 4QGMA 4I3PA 5CU1A 1WA4A 3IDCB 1X7NA 4K8FA 4LUMA 5K8SA 4XFAA 4NVPA 3E5QA 1ZZ7A 3PVBB 4TLFA 3BALA 4FT8A 1ZRRA 3UKVA 2Q4SA 5KHIA 4YYOA 3I59A 2BNMA 1YFUA 4AXOA 3FX3A 3E6CC 4PJYA 3E6DA 5FDBA 5HI0A 2PTMA 4LLOA 4MH0E 3LZZA 1YHFA 3KCCA 3ELNA 1O3QA 4YNIA 1O4TA 2BYVE 3LA2A 2OYZA 4LA3A 3E97A 3USSA 3TNPB 4XF4A 4AVAA 5I0SA 2XL7A 1NE4A 2ET7A 4EV0A 3RYPA 1ZZBA 2CAVA 2XHKA 3PNAA 2ATFA 3E6BA 2IC1A 3S0MA 1YUDA 4IEPA 4Q0SA 3HIFA 4XEZA 4KWLA 4EWDA 5BUVA 1V70A 4R8HA 3SCGA 2UYBA 2XKOA 2HKXA 3KGLA 2FQPA 3RNSA 3H8UA 3UKNA 4BIFA 1X8MA 3NKTA 3FWEA 1YFYA 2VPVA 1FXZA 2VECA 3BB6A 4BHPA 1FI2A 4LULA 4HBNA 5CADA 3CO2A 5FLJA 2MPFA 1YLLA 2ZCWA 4MUVA 4WBBA 2Q30A 4I09A 4R52A 3BU7A 3UKTA 3BCWA 4ZU7A 5LRSA 3DL3A 4ONUA 2WFPA 2XL9A 3M70A 5I91A 2QNKA 3KSCA 3EQEA 2HJIA 3OTFA 3D82A 4YSFA 1X82A 5T3NA 2H0VA 3LOIA 1RUNA 1H1MA 4WZCA 4I0BA 3NSTA 1CGPA 5BV6A 3EHKA 5I8TA 4Q0QA 4X6RB 3H7JA 1ZX5A 2Q1ZB 3B02A 3MDPA 3RZZA 3RYKA 2PQQA 1TQ5A 1EYBA 4YRDA 4GULA 3G7DA 1RL3A 1PM7A 1LB2A 5JR7B 1SEFA 3RPQA 4I0AA 1SQ4A 2UYAA 1Y3TA 3CLPA 1RC6A 2ETEA 3CEWA 2IXKA 1ZRDA 4E2SA 3OF1A 4Q0VA 1ZRCA 5I0RA 2XGXA 4MV2A 3ES1A 3IWZA 3H3UA 4ZU4A 4J1WA 2H6CA 1EPZA 4EROA 2K9ZA 1J3RA 5J3UA 1CAUB 5I0UA 1O5LA 1Q3EA 2CV6A 3H9AA 3OCPA 2QCSB 3RDIA 3FHIB 4JTOA 1GQHA 3IBMA 5FPXA 2D93A 4Q0UA 4LEJA 3SCHA 4IEYA 2V09A 4J1XA 1L3JA 4E2GA 2ET1A 5BXXA 2UY9A 4FAHA 4EWAA 4YARA 1GQGA 3RYRA 1JUHA 4AQ2A 5LEKA 3GBFA 1ZZ9A 4KU8A 3SXWA 3I54A 5C8WA 5FQ0B 1RGSA 4EWEA 1DZRA 1RTVA 4FBFA 4O9EA 4HN0A 4I2OA 5LRRA 3SCFA 2IXJA 3OGJA 5FLIA 4META 3DN7A 4HMZA 2GH2A 3FZ3A 1I5ZA 1XE7A 1ZZ8A 2UY8A 4WVZA 3LAGA 4QM9A 3BPZA 3IIAA 2IXHA 2PAEA 4QXKA 5JSRA 5EZWA 2FMYA 4KWKA 1WLTA 2Y0OA 1YFXA 4E2QA 4IERA 3ROUA 1OI6A 4F8AA 4CYDA 5JSOA 1QXJA 4UBGA 1PMIA 1OD5A 1RUOA 3H3ZA 1CAUA 2B9UA 1IPKA 4AQ6A 4KL1A 2DCTA 4IEUA 3I7DA 4D7SA 3WW3A 1ZRFA 3H7YA 1J59A 3NJZA 2EA7A 4XETA 1J3QA 2CAUA 5FCCA 2GU9A 1NE6A 4XF1A 4BH9A 3WW4A 2OPKA 4KU7A 4AVCA 1QXRA 1EY2A 3QOPA 4D7TA 5JCTA 1O3TA 3U10A 4XFBA 4MZUA 5JAXA 3KGZA 1QY4A 4HLTA 1CX4A 1VJ2A 4JTNA 5FQ0A 1FT9A 3FJSA 4IEOA 2WC2A 3QACA 1U12A 1VR3A 5KHJA 2PHDA 4XFHA 3N4MA 1DGRA 1ZZ6A 1CAVB 4PIXA 2O1QA 4PIZA 3LWCA 2BGCA 4QGLA
chains in the Genus database with same CATH superfamily
4XCAA 5KBFA 4P5HA 4XJAA 1VRH2 4GJYA 1GFF2 1JMUB 4MGKE 2Q0AA 3N9NA 5KHHA 1NYWA 1PVC1 3IMNA 1W03A 2D5FA 4NO4A 5J7MA 3WV6A 1S55A 2LTNA 4LQRA 5GZDA 1Q5OA 4RFRB 4HPKB 2BEOA 4Y5SA 1LENA 3RJRA 3LA7A 5FY1A 3RZGA 5A7PA 3T30A 5A3WA 1EAH2 1J1LA 4CEWA 1DGWA 3KHBA 3WG3A 5FP8A 5FPAA 2YFUA 3I3BA 1V9U2 4OQ8A 1MS9A 5JPMB 3I2DA 2AEZA 4LHKA 1UIJA 5ABJC 4Z07A 3MO4A 5BY5A 5K0UB 1Q8SA 4EN0A 3TB0A 4Y33A 5FYZA 2TUNA 4CXXA 1DU3D 2B39A 1UMIA 3ZOIA 1HX6A 1RMU1 3GJBA 3NVCA 1R081 4P14A 5FTTC 2A3YA 3PVNA 4QHZA 2WT0A 2XXZA 3PDQA 5LK5A 1H8TC 2W1QA 1U5IA 1JYCA 1QWRA 2AC1A 4XTMA 5JI7A 1F9KA 4AF9A 3R4DB 2E9QA 1UY4A 4UW5A 3R0RA 2RMU2 3HT2A 5CFDB 1AR92 1RVF2 4M3CF 4Q2FA 5FY4A 4DOUA 1LCLA 4YVSB 2O8OA 4KBBA 1SHWB 2RV9A 2A70A 4CUGA 1UD1A 3EBRA 4CDWB 3T4HB 3KHCA 4OYUA 3S7IA 2YGLA 3EO6A 3OSDA 1MQTC 3C3VA 1UY0A 2VZSA 3T2TA 2OZ6A 4NHMA 3A22A 3DPRB 1AXZA 3I2KA 4LBOA 1HIXA 3ZVXA 3UGFA 1W6PB 1LJ7A 5EJ1B 3UJQA 1XU2A 3KVBA 4Y20B 4XF3A 3ZYHA 1X50A 2YPDA 1DHKB 4N9IA 1W3VA 1PGL2 2Z69A 1YO8A 1XYNA 2JXAA 1SCSA 2XLGA 4FPYA 1LU1A 4RQPA 1R1A1 3A23A 4Q29A 5DZGA 4GD4A 1WCSA 2YFZA 3VBOC 2NMOA 4DFSA 1DLCA 5DG2A 4D69A 1ZREA 2Q8EA 3J8F1 4MGIE 3FC0A 1WWYA 1DCSA 4WM8B 2PHRA 5FY8A 3RI8A 4LBLA 5A7WA 3LFMA 4E8CA 4AI0A 1PO12 4NPRA 4AI9A 4DEVA 3SISA 1VBA3 3WW1A 1X9PA 4N90A 2WNVB 3L2HA 3ZM8A 1YRZA 1YWKA 3ZDVA 1KDMA 1LOEA 1OLME 3V65A 3WP3A 5EIYB 2VQUA 2KXLA 2VOWA 2YGMA 2V5YA 3W5NA 4F7ZA 4FOQA 1UY1A 5E1RA 3MF6A 4W50A 2XDVA 3J7LA 4M4PA 3WQBA 5JZGA 1VBE1 3VBSA 1IPSA 1RUJ1 2W5FA 1SPPA 3GBWA 2AUYA 1F35A 4Q4V1 4IETA 4P5YA 1UO9A 5LWBA 4ZKTB 1CAXA 1RJ8A 3WD5A 5A80A 4JDMA 1S0CA 4IE6A 4AEDB 3CL1A 2BJSA 3H1YA 5EYYA 3OUJA 1WCQA 2PA7A 3ATGA 1Q56A 3MICA 4YM0A 2OVUA 3SKVA 1NXMA 1VBD1 2UWAA 1G9BA 1XB9A 5I8YA 4COUA 5DUXA 2W92A 1S0DA 5GLUA 1V6MA 4AW7A 2GALA 2W1SA 3G6JB 5FMDA 3U78A 1AYM2 5DZFA 2QDRA 1CAWA 1JZ4A 2QQJA 1Y4WA 2PLV2 3P3NA 5F2SA 2ZGPA 1BKZA 4LTAA 3I2OA 1SBEA 1SFYA 2WO3A 4XBNA 3Q9OA 3VD4A 4AHXA 2PELA 4YVSC 2Q1MA 2GN3A 5BPXA 2MEV1 1OF3A 3J8F3 2BERA 3B9IA 3OUIA 5LATA 4UW6A 1VIWB 5K7PA 1A78A 2EVXA 2WNUB 3KQRA 4IE7A 4QX5A 1AUYA 4XXPA 4BXFA 5AVAA 3ZYPA 1NA1A 2PYTA 3KF3A 2VZTA 5F3CA 4K1ZA 4HKLA 1I6XA 2D43A 4PQ9A 5FREA 3MLJA 2RS12 5DDJ1 1YQ8A 3W5MA 3DXUA 2GC3A 3ZSLA 2DBIA 1RYYA 4OFGA 4KBZA 2I07B 3A7QA 1IQDC 2VQAA 5L9BA 5C9AA 3DECA 4PI2A 1F31A 4O9GA 1O3SA 2UWCA 1S0GA 3WG4A 3R6SA 4P9GA 4E4ZA 4AFBA 1GZWB 2Y0IA 4LA2A 5GLZA 5LA9A 3WHUA 1MZEA 3FHQA 2ID4A 2HH9A 2PMWB 2Y26A 1PZ9A 1AL0G 4KG0A 4ASMB 3FFQA 5C5TA 3N7MA 5FMCA 4MXWB 1ZYBA 2DCKA 5BNQA 1YJLA 2BNNA 4IGPA 4W6XA 4A44A 3NO8A 2HWF2 1UZZA 1S0BA 2X5IA 4QB1A 2P5BA 1UPIA 3IKWA 4K6BA 2ILMA 2XKPA 2JX9A 3ZXJA 3AYDA 3M2MA 5IFTA 2QVSB 2OIIA 5J98B 4BDVB 4BQ2A 2P3YA 2Y33A 2QFEA 2IXCA 3ZYGA 2XWJB 1IS5A 4Y3OA 1UWWA 3M3CA 4Q8LA 1C1LA 2MEV3 5FJKA 1C8M1 3I2IA 3T4VA 1WA4A 3IDCB 2UU8A 1UNBA 2RJ2A 1X7NA 4LUMA 5LBCA 2XUMA 4XUNA 2VCBA 2V72A 4XFAA 4NVPA 4BK4A 2DF7A 4M0NA 2X09A 3B69A 4QQPA 3NMBA 1Z7S1 4GJZA 1DQ2A 4TLFA 5JOYA 3MFAA 4FT8A 4FPJA 2P3IA 2ARCA 1WD4A 2B42B 2P3KA 2ZGRA 1QKQA 4P9LA 4QU2A 1Y9GA 3VBFA 3C7EA 3LEMA 2WZR1 4M3CB 1HRV3 3ZIWA 1GOFA 2VD7A 3I59A 3FX3A 2AENA 2VTFA 5T50A 4CVUA 1H9WA 1OUSA 4CZSA 5A32A 5FZEA 3E6DA 4K3UA 3KCCA 2UURA 5C3SA 1O3QA 4EN9B 3NNFA 5H9QA 1W8OA 1RUH1 4YPJA 4WVMA 2WNUC 1O4TA 1IG3A 1YYNA 4ASLA 5LA2A 4HOOA 1DP0A 2OYZA 1M4WA 4LA3A 3VZMA 5A3TA 5I0SA 3WNMA 1AZDA 3TN91 1H0BA 4ZZ5A 1ZA4A 4EV0A 3MPPG 5FYHA 3RYPA 1UYPA 1HQWA 1ZZBA 2CAVA 2R16A 2WNOA 2XHKA 4QQLA 2BFUS 2QE3A 4LORA 1MEC1 2P4EA 3PU8A 4Z8BA 2GNDA 2JE8A 4RN5A 4XEZA 1QJU2 1QEXA 2WFF2 4R8HA 5EWSA 3SCGA 3ZFEA 4H55A 1W04A 3W20A 3RQ0A 1P8JA 1MPXA 3J7MA 1ULEA 3QD6A 3OGVA 5JR2A 1YFYA 3VKFC 4WVWA 1FXZA 3AMMA 3ZPYA 1A8DA 3VKNA 3KQ4B 2R1BA 1ZBA3 3RJ2X 4QD2A 2VMCA 3UGGA 5KXDA 3HR9A 4HBNA 1LOFA 1N1VA 4LULA 2FMDA 4YZ3A 1LHOA 2PHUA 4Y24A 5FLJA 2CL2A 4AI8A 4BE3A 4Z2AA 3LEKA 1YLLA 5GZGA 3CJIC 3TEYA 3IZOA 2B7YA 5C4WA 3UKTA 5FMBA 2WT2A 3IPVB 5JIAA 4Q1PA 1G9AA 3WF2A 3HBZA 5LRSA 1RUD3 1S4CA 3JBG1 1XU1A 3QBQA 1AF9A 2WFPA 3FN9A 3ZO0B 1HLCA 1D2QA 1H8VA 2X8KA 3SKJE 3S6PA 4IL7A 1W6QA 4PLNA 2ZHNA 4YM2A 2WAOA 5ANQA 3EQEA 4YSFA 2HWC2 1UX7A 5D8AA 2Q8CA 2Q8DA 4EZ4A 4DEQA 4UW4A 2D44A 5J1XA 2W2IA 1H1MA 1NXD1 2E33A 3TBDA 1G9DA 1O91A 1CGPA 1GNZA 2JDKA 4MGTA 1MEC3 4XJWA 3RYKA 3TRSB 2ZEWA 1PM4A 4GULA 1NX9A 2DVAA 3G7DA 1KRIA 1W6MA 5JR7B 4XBQA 1YNAA 1SEFA 1SQ4A 1WMXA 2A3WA 2R063 3AVSA 4MGSA 1WW7A 4NHXA 1OC1A 1VLNA 4NHLA 1AX2A 2ETEA 2LRPA 2BW8A 2VOVA 4A7YA 1LOGA 3ZN6A 1REFA 1BBT2 1MVEA 1EV11 3OGRA 3USUA 1JOPA 4Y26A 1QH7A 4BB3A 3BIEA 4J25A 5EHDA 5GKAC 5T5LA 3BGAA 5A3OA 3ZXDA 2VE1A 4GMP3 1BVVA 1QDOA 4P00B 5F5IA 4J1WA 2H6CA 1EPZA 4A7ZA 4Q4Y1 5FJHA 4Z92B 2VMEA 2K9ZA 1RB8G 1PMHX 1HXS2 2CV6A 4KWUA 1RUF1 3QH7A 1PGSA 2IWGB 1TMF3 1RHI1 4JTOA 4PHZA 4WM7B 1VB4A 2FDIA 2RDNA 2YC0A 2YHJA 1H6YA 1PIV3 3T2QA 5M0TA 4XJ8A 1AL23 3I2HA 4IEYA 4MGQA 2V09A 1XNDA 1PVXA 5IVBA 4XJ9A 1VMHA 2RDQA 1TEIA 3KB5A 3V56A 3SH5A 5FO7B 2UY9A 4Q26A 2EIEA 2UWBA 2VM9A 2WO2A 4IGQA 2VC9A 3SLIA 3W59A 4YARA 2RR12 1OF4A 5IAVA 1BZWA 4QPIA 2R30A 4AEJA 2WDBA 3OY8B 4AQ2A 3GZAA 3GBFA 5EJ3A 1ENSA 3N9PA 3AL6A 4XILA 4BMBA 4IUGA 5BNOB 5JMCA 4DY5A 3PVOA 5FZOB 1Q8VA 4CEYB 1NAEA 4E27A 3C7GA 1RTVA 4FBFA 3THTA 1UOGA 1ND3A 1JODA 3CQOA 4HN0A 4MLOA 1VAKA 5ACA1 2VVEA 3ZXFA 2JDHA 2CWMA 2QZ2A 3CBNA 3M8LA 2XJRA 2IXJA 1AJKA 4QHBA 5DG1A 3ZKYA 5A6QA 1E5HA 2JDAA 1JHJA 2VOTA 3FZ3A 4AWDA 3OBRA 1I5ZA 2VMFA 4LKSA 3BTYA 1PK6C 1MZFA 4QM9A 3BPZA 4PQQA 3UGHA 5LY2A 3HWJA 3NAPA 3R4UA 4AVSA 4LXLA 2W94A 5JSRA 4QPGC 1RUF3 1WW6A 1D7PM 1IS4A 3KT1A 2Y0OA 4N43C 2VZ1A 4B4QA 4FOVA 5FBJA 5FPVA 1QQP1 1AR63 3NNMA 3AJYA 3AP5A 1UZWA 1OI6A 4CEWB 4F8AA 4CYDA 4IV1C 2R071 4EYUA 1PMIA 1V00A 2HYKA 5BNPA 3MIBA 3MW3A 3ZSMA 2C1FA 1CAUA 4MG2A 1IPKA 5LASA 2VJXA 2BUKA 2VW2A 1FOD1 1W8WA 1KS4A 4D7SA 5GZFA 1BHGA 4UFKA 3UL2A 4ATFA 1YIFA 2RDRA 2ZHMA 2PQSA 1QXPA 2IVJA 2HWE1 1HB3A 3B93A 1QF3A 3NJZA 1CONA 2RS53 5FZAA 3RWKX 3UYJA 3WDTA 1RUG1 5FBZA 5FO8B 2E7QA 3VHPA 4K7JA 3KCXA 1JZ3A 2XR4A 2WL1A 1L7RA 4LO7A 3FHAA 4AAPA 2VXJA 2OPKA 2JIJA 4XUOA 2YBPA 4L99A 1TZOA 3AYEA 1QXRA 2W95A 3QOPA 5FZ7A 4FQ4A 1QJY1 1VBB1 1UQXA 1V6IA 4CRQA 3URFA 3I3MA 3U10A 1VBA2 2E63A 3LOBA 4HLTA 2JD4A 3GDBA 4NN0A 4TN7A 4CCCA 3RZKA 5CBLA 4CU6A 2CSGA 4QAWA 2XVGA 2AZ5A 3MIDA 3QACA 1VAMA 1PO23 5BNOC 2XMLA 1CQ9A 3CZUA 1U12A 4OHXA 5FXVA 3WZ1A 5JOWA 2C26A 4RQPB 5KC5A 3DYOA 4CEYC 1W3XA 2ZGOA 1QOOA 2F17A 3WQ7A 3ZYJB 3N4MA 4HONA 1ASJ3 1FPN3 1SBFA 2RG4A 4PIXA 1HV0A 2O1QA 3PTRB 2D6PA 2BGCA 4KGQA 1FNZA 4QGLA 5A7WB 2Y34A 4A3XA 2YB7A 2B46X 3PMSA 4L11A 3N35A 2EXHA 4JZRA 2WWJA 3MFCA 4P02B 4PDWC 1LGNA 2W91A 3C7FA 4JVAA 3WDWA 1GICA 3PLQA 2WSUA 2ZMNA 1R091 4CDUA 4BQYA 1J3PA 2WQ4A 3NNGA 5FXZA 2GH8A 4COVA 1RUC1 3WF0A 1W0PA 2WZEA 5F6LB 5KXCA 3VZLA 5JZGB 3HT1A 1AX1A 5D1IA 4FO9A 2E51A 3VBSB 1SPPB 4D6QA 1ZVFA 3WDVA 2G1MA 1QJFA 1O8PA 2P17A 3ZXGA 1K5MA 2VVDA 3V64A 4BU2A 2WRAA 1JU4A 5FR3A 1CAXB 4IEQA 4FPHA 3NNLA 4B4PA 3J8F2 1GLHA 1H4HA 2K2SA 3OUHA 4UBHA 5LBEA 4XFCA 1FX5A 1QJY3 2VNVA 4PF5A 4FPGA 1YJKA 4Q1RA 1U5XA 3PTYA 4RD7A 3S7EA 3CMGA 4QX2A 5FPLA 5C3RA 2WSVA 3J26N 5IAXA 5JDBA 4BPZA 2RJKA 4ORFA 3VV1A 5FPUA 1JZ6A 4CDQA 2BGOA 3AMPA 1CAWB 1DQ5A 2FCUA 2ZAHA 1SLAA 5A6XA 3ORJA 3WNNA 5JIUA 2LS6A 1OQEA 3O12A 4HVOA 5F37A 1ENXA 5T5OA 5A1AA 3SHRA 1LAJA 1LOCA 2V73A 4PIYA 1MZ5A 3PUAA 3HPNA 4OUEA 1GOGA 4JGYA 4CP9A 1RJ7A 3INAA 5A3MA 2YZ4A 2VTXA 1G86A 1NA1B 4ZS2A 1GNYA 1VBC1 4CCDA 4NJ4A 4LK6A 5I0DA 3WUCA 1ZNPA 1XSQA 1GZTA 2ZZQA 1R093 5E88A 5FZHA 1RUI1 3GCWA 4M0HA 1BK1A 2QQNA 5FK8A 1RUC3 3MW4A 4V2WA 3CIHA 2YG0A 1CAVA 4Y22A 1W90A 4IEXA 5C9AB 1QJZA 4URTA 1JI6A 5G05L 2VZUA 2KR2A 2R043 4NROA 5FYSA 1OFNA 4JKKA 3POYA 1CR7A 4NIGA 4Y1UA 4W4ZA 5KXBA 5L73A 1UZ0A 3AYCA 1NCRA 2K0GA 2BPA2 1C5IA 1WMDA 5KHKA 1H6XA 2DUQA 2GDFA 2C9AA 4NPMA 3KMHA 2W1WA 5A7QA 4CUCA 4XCBA 4Y5TA 5FZCA 5F7UA 2X5IB 2ZEXA 1RXGA 2F4PA 1W39A 4RR3C 4G3YC 3FBYA 3Q8EA 3VB9A 4IV3C 2R7EB 1UKGA 2JDYA 2MNGA 3KT4A 4HVRA 4Q4X3 3AMNA 5A1FA 3AX4A 5CB7A 2PAKA 1REDA 4BMEA 1HRV2 2R1DA 3KLSA 4KGGA 5SV8A 4AI1A 2GC1A 2QQPA 3H50A 4LO4B 3R4SA 5BNNC 3MGUA 2NN8A 1VE0A 1LEMA 2PAMA 4QQOA 1COV1 4XDQA 4BM8A 5J48A 4ISQA 5C8CA 3A4UA 4NAMA 3KWVA 1HN1A 4FXGB 1VBC3 1JBCA 1MACA 1LGCA 1Y9QA 2O8QA 2VOXA 4M4RA 2WUHA 1W0OA 4ZPIA 3U37A 2IFWA 5L7OA 5DAVA 1UXXX 2WWUA 3JB4C 1ZZCA 1OA4A 1J84A 1GZ9A 2D6LX 4ZXKA 3BVCA 3VBFB 4L2NA 4Q4W3 5T5JA 3JD72 2VMHA 4QKFA 4QPWA 4XQWA 1NQDA 3I59B 2CGNA 3O0VA 1R64A 4MGYE 1GU3A 4JKLA 4DINB 5A32B 1VB2A 2TEPA 2Z2SB 1LHVA 4XIOA 1QU0A 4L92A 3U11A 2FDFA 1GP4A 3RZHA 2ZX3A 4WVMB 4QDRA 3H0OA 1QOTA 4HSJA 5IATA 5LEJA 3OPTA 1FMD1 5F3EA 1MS5A 3MLKA 1CIWA 2DUOA 2EIDA 2FBEA 4CCOA 2XLFA 1NCQA 1ZBA2 3ACLA 1S2EA 3IAPA 3LIGA 5A6YA 1JZ5A 2CGPA 1NY71 2XLAA 2A73B 1DBNA 2GAUA 4HL0A 2DFBA 5FLHA 5A3NA 3ZFEB 3LKJA 4UFJA 5C70A 1XRUA 4XAAA 1OKQA 3VBRA 2B45X 1FATA 1RUD2 4CDXA 5CAZA 5DUUA 1ULOA 2ZKLA 3VKOA 4K20A 4QM8A 4ES9A 1UZVA 4AHWA 2ZPXA 1ZBE1 4UXAA 2GNMA 2D6OX 4ZU5A 4RSUA 3HEIA 3B94A 4JGZC 1GZCA 1NZCA 1ND2A 3A0NA 5FYBA 3RRDA 2ZGKA 3AZVA 2XOMA 1Q8PA 5CA6A 2FDJA 3ZXAC 5I8SA 5I0TA 2OT7A 4XDPA 2XVKA 1GV9A 4XQ4A 2WA3A 4QPYA 4N53C 2RM23 5CU1A 4IE4A 3LPGA 3UK9A 2VZRA 2B9VA 1CWPA 3WLUA 1UOJA 2DTWA 1UPSA 4K8FA 5K8SA 3RZMA 1BCXA 2ZHKA 5HCAA 2W68A 3T0DA 2YC4A 1BMV2 2E31A 5FZ1A 5LA0A 1W6QB 1Y43B 4AG4A 2XBO3 3E5QA 2YBKA 3PVBB 1Q8OA 3AZZA 5D8AB 2GP5A 2R062 1GNHA 3BALA 5FUIA 3ZIXA 2NLRA 5IVCA 3UKVA 4D94A 4P9XA 3LFIA 4YM1A 2Q4SA 2J1RA 1PVC3 3AMQA 5CFCA 3GHMA 5GM0A 4OHWA 3HN1A 3D5OA 3ZFGA 3ZMNA 2P1BA 5CKMA 4PJYA 3CKHA 5FDBA 3MIHA 2PTMA 2VG9A 4LLOA 1IOAA 1YHFA 3LZZA 3POSA 1F8VA 4PCRA 2JG8C 2Y8KA 3VD5A 2R32A 4CTEA 4N8MA 1W6MB 3SC7X 4B4RA 3ZYFA 4C8DA 4CXYA 5JXHA 1R1ZA 4AVAA 1TMF2 2CNAA 4NRQA 2EXJA 2XL7A 2ET7A 1XPWA 2HEYF 3WNKA 1RMU3 2VAUA 3ZSEA 1WCUA 2LALA 1R083 1PIV2 3VKMA 4PT6A 3GNEA 3E6BA 1XNBA 1AL22 3ZN6B 3USUB 1D2SA 2WAAA 3PUQA 4Q0SA 3HIFA 4KWLA 2VUCA 2WLPA 4AE2A 4LK7A 3NV4A 4XIKA 4Q5OA 4Y1ZA 5CKQA 3VD3A 2P34A 2YUEA 1B35A 2CWSA 4RHV1 5CZKA 5F39A 1W6OA 2WBKA 3WR0A 4BIFA 1RUE2 3OGSA 1SLBA 4DUXA 3VDDA 2A5ZA 4Q8KA 5K0UC 4AEKA 4LKEA 1VRBA 2VECA 4KH9A 2ARAA 2W08A 5JI9A 1AR81 1S0FA 3WNOA 4BIOA 3FUQA 4RS5A 2ZCWA 4MUVA 2W1UA 4SBVA 2XQRA 4GWMA 2Q30A 2W9XA 4GH4A 2Y38A 5FY0A 3VDCA 2VXRA 2RE9A 4ZU7A 3VKLA 4O65A 4KQ7A 1OA3A 2VW0A 3V0BA 1QJX1 1R1A3 1T6BX 2XL9A 3M70A 4OUMA 4AGVA 5CFDC 2W0XA 3PU3A 1L7LA 1JYTA 1LOAA 4QX1A 4RYDA 5FXXA 4QPIB 2HYXA 3NV3A 1H2KA 4QQHA 2BRTA 5GJ6A 1H2MA 2R0FA 4TLGA 4AGGA 4DIQA 3OTFA 4CDWC 5T3NA 1TME2 1H9PA 1RUF2 1IS6A 3DPRC 2VMDA 3QCWA 4OMCA 2XH6A 1ND3B 2JG9A 5FZ6A 1OLMA 4YW2A 5IVFA 2YU2A 3ACHA 3IN9A 1AR62 1W8FA 5I8TA 3KM5A 2WIIB 1XBFA 2TBVA 4Q0QA 1ZX5A 3B02A 1O6UA 3PIGA 2J1VA 2BOIA 5C5UA 2HBUA 3RZZA 1VBE3 1RUJ3 3RS6A 3O1MA 5FYYA 1O59A 4Q4V3 3ZSJA 1PM7A 3I2FA 4PLMA 5F5QA 5FAXA 1LB2A 2VNOA 2VOKA 2LW8A 3NAPB 5LK7B 4WM8C 4YWAA 1AX0A 4CCMA 3EXUA 3BU0A 1RC6A 2XJQA 1AR71 2OPWA 3CZJA 5C71A 1VBD3 4UFIA 2RS52 4YZ5A 2WNVC 1D4M1 3CEWA 1AR83 4E2SA 4XAEA 4Q0VA 3RZLA 1ZRCA 3LEGA 4QWNA 4AFMA 4FTSA 1G7YA 3TYJA 3M3EA 4H3WA 3J7HA 3IWZA 4YGBA 5BNPB 3PL0A 3KV5A 5J3UA 1CAUB 4OHYA 5I0UA 1O5LA 5DAPA 1XQNA 4YG0A 3RDIA 1REEA 4MXVA 3H8RA 1AYN1 4BLJA 4YGEA 4GXLA 1KGYA 5F9TA 4YG6A 4AEDC 3I3QA 4LEJA 3SCHA 1H8TA 2QTWB 1V6NA 1DDLA 1PO22 4XJZA 3W9AA 3LEIA 4OI2A 1QIQA 3BUCA 5DDJ3 2JB4A 1ASJ2 4Y1YA 1FPN2 2E26A 1GYKA 5AFEA 3O1UA 1GUIA 2A6VA 3LIHA 4B1MA 2KM2A 4FPEA 1RXFA 3ZX7A 1URXA 3LDRA 4HT1T 2FCVA 5T55A 1W6NA 1MQTA 3DEMA 3RYRA 4URAA 1PGW2 1ZZ9A 5KWRA 3OJBA 1VRH1 1KITA 4LBMA 3MV01 4QKDA 2YC2A 2VCMA 2RS32 3LDKA 4GB32 4ARYA 2ORXA 4EWEA 4A45A 3ITQA 1HQNA 2D97A 3MIFA 4O9EA 1YXWA 4FCAA 4DB5A 2VBDA 5FZ4A 2Y6JA 2SBAA 2BZDA 3K2OA 1AR73 4XMIA 3SCFA 4CU8A 1EAH1 1RITA 3LPFA 3ZN5A 3VBOA 1D4M3 4L97A 4FPKA 4META 2VBPA 2ZOEB 3DN7A 1CX1A 1MZ6A 1V9U1 1SMVA 3QH6A 4K40A 4XJUA 4GZ9A 3UV9A 3IIAA 3HOBA 2IXHA 4AFAA 1SLIA 1LECA 4QXKA 5EZWA 5LB6A 2XVLA 5D21A 4KWKA 4XC9A 2L9LA 4COZA 1O8SA 1OUXA 3VL8A 1YFXA 5TSWA 2KD7A 2JDZA 4CDUB 1XNAA 3BODA 1C8M3 4C90A 3BOWA 2JECA 1W2TA 4LIUA 2QKDA 2A1XA 4OHVA 2YDEA 3AKTA 2RMU1 1AR91 3D6EA 1RVF1 2ZMLA 4YGDA 1OLRA 1K5MB 1JYIA 5FZKA 1ALYA 2XJVA 1Z7S3 5IVEA 3WT3A 3DF0A 2DCTA 2VW1A 4C1WA 3RWNA 1LULA 4P9JA 1UXZA 2EXIA 3A0KA 2Y60A 3L2YA 3ACIA 5IYYA 3HN3A 2WZR3 1RIRA 2W46A 4R9BA 3OGGA 3PJQA 1ZRFA 2FDGA 3WDYA 1E57A 2Q8OA 2R49A 4R9DA 2OXBA 4CDQB 1XSRA 2WS92 1GWKA 4OHZA 5J37A 4XETA 1J3QA 2A71A 1PGL1 2CAUA 5FCCA 1JOJA 1RUH3 3VDAA 3WW4A 5FZIA 2ZXQA 5DABA 3LSDA 1N1YA 4FQZA 3SH3A 4D7TA 3TN93 1M06G 2VNRA 2R042 4QDQA 4YFZA 4JDOA 1V9U3 4JGYB 4XFBA 4ZONA 1YC61 4CP9B 4HK9A 5JAXA 3KGZA 1QY4A 4I0WB 1W2OA 1PO11 2BTVC 4D3WA 1VJ2A 5FQ0A 1LHUA 1OLQA 1FT9A 4IW3A 2A75A 4YW1A 1OHFA 3S30A 2JE7A 1KEXA 4FFHA 3VBUA 2ZACA 1BXHA 4OCTA 4R4ZA 4LHNA 2ZX0A 2CTVA 5KXEA 1W9SA 4QQ2A 4H7MA 2ZGTA 1DGRA 4INDA 3U1XA 3N7LA 1CAVB 1UX6A 4Y22B 4PIZA 4CUBA 3IT8A 3IB3A 4Q4X2 2DWRA 4FPOB 2B8MA 4BXSV 4N9HA 5FYUA 1G9FA 2WJSA 3WHTA 2DURA 3U14A 3B3QE 3I97A 1NCRB 4FFIA 5DUWA 2D7FA 1ULFA 5F6KA 3ZYBA 1UIKA 5CG9A 4LPLA 2YXSA 2VZVA 1WCKA 1XYOA 1YI9A 4DXSA 1OH4A 2QQOA 3JBG3 2WR9A 4HANA 5F2WA 4CDUC 1AYM1 1T2XA 1W99A 1TE1B 2A6YA 1H1AA 2VY0A 4XF0A 2QQUA 5T5PA 3O1SA 2PLV1 4YM3A 4YZ2A 1G8WA 1MVQA 1C8NA 1X9TA 2VH9A 3POJA 4GIQA 5C6CA 2VL4A 4GWIA 4FTEA 5F1RA 1J58A 4Q4W2 4FOYA 1W9FA 5IUQA 3ST7A 4LBQA 1IGOA 3VHRA 3TNQA 1SBDA 1W8ZA 2DDUA 1DYKA 3DV8A 5CKNA 2P6CA 2DU1A 3AXDA 4LHSA 2CGOA 3LGRA 4TZDA 2HWD2 4XFFA 5C8CB 3UJOA 4AHZA 2H0BA 3E5UA 3H3LA 3UNPA 2B5HA 2DV9A 1KDKA 2I45A 1O3RA 1KS5A 5L7OB 2VULA 4PBPA 4IXLA 2J1EA 3DKWA 1SG3A 4H2AA 1YCIA 3AB0A 3WQ0A 1O7FA 1YQ2A 3AM2A 1W8UA 5FY9A 3BKZA 3L9JT 3ETPA 3OPZA 3UT0A 4COYA 1BJQA 1ST8A 4ZY9A 3AZYA 3LSEA 4GKXA 1NT0A 1JS9A 1K3IA 1YEWA 3MUY1 3WF4A 3GM8A 3U4SA 3GCXA 1EV13 1SLTA 4D8MA 4NMIA 4HN1A 5A33A 4OI4A 3BIWE 3F2ZA 1UW8A 5EP9A 1IG0A 1YQ6A 4BYYA 2GC0A 4BQWA 2O0OA 1LHNA 4LMFA 4Q4Y3 4ZHNA 3IMMA 3I3EA 5IVVA 2JKXA 1V6JA 3ACGA 2HWF1 5FIXA 4OLLA 1NCQB 3U0ZA 2DUPA 2QQMA 4JDNA 4XFGA 1RHI3 4QX3A 2ZJCA 5IHRA 1AYM3 1UL9A 3WW2A 3MHZA 5FYMA 5FZ0A 3GYDA 3GBGA 3WG2A 1A8MA 1QNWA 5FPZA 4FPCA 2GZWA 2VVFA 5FZ8A 3H1MA 5FYCA 4D6SA 2RM22 4M3CE 2XUEA 2GN7A 1Y9MA 2VBBA 4CPBD 1O5UA 3VBRB 2EALA 4CPBA 2QUOA 4EZHA 3RZJA 4CDXB 4I30A 5IJRA 3V0AA 2ZTNA 3IIIA 2H6BA 2DVFA 4MX3A 2PHXA 3JZVA 2BP6A 3T2PA 5A3UA 1C28A 3ES4A 1W2UA 2XBO2 4Q0PA 3C7HA 3SQOA 2VR4A 3POEA 3ETQA 5FYIA 1ND2B 2WZPP 2ARBA 4A2UA 1JZ8A 5IK4A 2AREA 1PVC2 1K5JA 4XMAA 1G6NA 3O1VA 4WM7C 3VZKA 3CJXA 3POFA 2ZS6B 4LBJA 2BBVA 4HKWA 3CJIA 2A6WA 4P9IA 3WOGA 2V5DA 3R05A 4LE3A 5ACA3 3HQXA 1WMFA 2LUWA 1JW6A 2A6ZA 1OPOA 4GWJA 2BNOA 5I93A 5CIRA 1FYUA 2JB8A 2CDPA 1POV1 4XVHA 4LLFA 1GWMA 4XW3A 4OMDA 1HW5A 1JYNA 1GMMA 1OFSA 3OBZA 1RMU2 5FP9A 3W21A 1UU4A 1R082 4DNYA 2HWF3 4E9KA 2QJVA 3POIA 4JV4A 5A7NA 4IEWA 5CFCB 4L9BA 3D0JA 1MR5A 4QDSA 3ZFGB 2P3JA 1QQP3 3AFGA 5FZLA 1TNRA 2AYHA 1QJU1 2WFF1 1PX3A 4LUKA 4DXZA 2WN3A 5BYNA 1Q8QA 2EIBA 2R073 3I2JA 3JB8A 5HXVA 3PHMA 2BVBA 3P3PA 3OBAA 4AGRA 2C4XA 4C91A 5F8PA 3WDXA 1MS1A 4KNCA 5D2AA 1I3HA 4H7LA 2J7MA 2OQ7A 1FOD3 3MYXA 1VALA 4TSVA 2VCCA 4UFLA 4CSWA 5B2GB 3OPWA 4KG8A 4W8JA 3P1IA 3T1MA 3T0BA 5HV4A 4XBLA 3H8OA 3NJYA 2HWE3 3O5SA 1N3PA 2PHLA 1I9RA 4HG6B 3ILRA 3MIEA 3WP6A 2WZ8A 1XE8A 2PHFA 5F3IA 3RSJA 1RUG3 1DGLA 1B35B 1LRHA 2JIGA 2PHWA 4CP1A 4YW6A 5FKBA 1W6OB 1R1A2 1XJAA 3VZNA 4CEWC 3ENRA 2AACA 4S2DA 5FK7A 3AZXA 4BISA 4BLIA 4DRVA 3VDDB 3MPBA 4X6QB 3W58A 5AVPA 5IFPA 3VBRC 1SACA 2ZEZA 3FL7A 4K9SA 1VBB3 2MHFA 1F4AA 4IEVA 5GLVA 5J09A 1W8TA 2HWC1 3VUOA 4IESA 4A7KA 1CPNA 2EAAA 3PUIA 4RS5B 1GSLA 5ISLA 4XUPA 2PFWA 2GC2A 1RINA 2JDPA 2DBNA 4GH4B 1UYXA 2R0HA 2GSYA 4JKMA 3U07A 5J36A 4I3GA 1CIYA 2VTXJ 5JWPA 4A6OA 2JICA 5DAXA 1DQ4A 1LEDA 3V0BB 1CZTA 1F5FA 4HETA 1VBE2 3Q8FA 1TG7A 3ZXLA 1RUJ2 5FZBA 4O7XA 4Q4V2 4LIVA 4E4DX 5FYTA 3P5BA 4W65A 1YI7A 1ZRRA 3AFKA 3LD8A 5FZ3A 3K46A 4OQ9A 1C57A 2JG9B 4GALA 2P6HA 4YZ1A 1VBD2 2I74A 4YYOA 5KHIA 2XPJA 3DYMA 3I49A 2BNMA 1YFUA 4OZOA 3RI9A 4AXOA 1PMJX 2F6BA 4GQ7A 5DAWA 1BBT1 2IZWA 4MH0E 3ALQA 4OI0A 2TNFA 3ELNA 4CU9A 1IQAA 3D8CA 4MHUA 2ZGLA 4RQPC 4NHKA 3OEAA 2BYVE 4UFHA 4RGAA 5JXJA 1CZSA 1CZVA 2Q5TA 3HQUA 1PK6A 2D6NA 4FPFA 3WY6A 1HXS1 1NE4A 2MEV2 2OX0A 1MS3A 2WQ8A 1IKQA 1XNKA 3PNAA 4ZXEA 1YQ5A 3AKQA 4QPGA 4YVWA 1ONAA 4N43A 1VMFA 4RFT0 4K8RB 3HNMA 2DYCA 4LBNA 4EWDA 5BUVA 2HWC3 5GLTA 3AKSA 2QZ3A 2VZPA 1HB1A 1UYZA 2AH2A 2XKOA 2YV8A 5C3QA 2HKXA 1W28A 5DDJ2 4IV1A 1H4GA 3RNSA 5JZGC 3H8UA 4Z1VA 3FFZA 1EUTA 2A7AA 1KQRA 1QNYA 1XNTA 2A3XA 3NKTA 3VBSC 3KV4A 1NLSA 3PIJA 2VPVA 2VU9A 2Z5WA 2RR11 1HV1A 2YBSA 3K75B 4AAXA 4R9AA 1WMEA 3MI8A 4COWA 1D0GA 3AL5A 4N7IA 4AYUA 3NQHA 3BB6A 4CCNA 4R9CA 4E8DA 3DKQA 1L7QA 1OH3A 5C3OA 5CADA 3BTZA 1GOHA 1NZIA 3CO2A 4LR4A 5APAA 5K4LA 1SLLA 1H8TB 4AZZA 1H30A 4LE4A 3AK0A 3THPA 4NRMA 3BU7A 1F5JA 3BCWA 3ILFA 1UF2C 3OYWA 2EXKA 2XQXA 4RS5C 3ZYRA 1RUI3 4NWVA 3I3DA 3ZFFA 1BBT3 1PHMA 3N7KA 5LY1A 1HJGA 2QNKA 1W9WA 3GXUA 1IZ3A 1JYVA 1W6NB 1MQTB 2X10A 4OULA 3MF9A 1WLDA 3KSCA 2HJIA 2VZOA 1W8HA 1X82A 3P6BA 5FZGA 3CNAA 4BJ0A 5L19A 3LOIA 4HXCA 4QKNA 4C0HA 5A6ZA 2J1TA 1ENRA 2VGDA 4PLOA 1U5ZA 4QX8A 5FXWA 4I0BA 4OVEA 4NAOA 4RGKA 2HWB1 1LHWA 2JKBA 3K48A 5BV6A 1C8M2 2EAKA 3EHKA 4YG3A 3WXPA 3VHOA 5C7GA 1NA1C 3AJZA 4MOAA 3VBHA 4L8QA 4D6RA 3MDPA 3LF7A 3IM0A 3B9CA 1QHDA 3VBOB 2J1AA 5KC6A 2OUJA 1VMJA 2P2KA 4NE9A 5GZCA 2DFCA 1W0NA 5FKCA 3WX5A 1LESA 2PQQA 4YRDA 1EYBA 4XYXA 1Z7S2 1XNCA 3GZTB 1CPMA 4N7UA 2DCJA 3J7NA 5C9AC 2NP0A 3VDBA 2WZR2 4BWOA 4PDWA 4D0QA 4UF0A 1BEV1 2WINB 4XE9A 1COV3 1K45A 5DZEA 4ZS3A 3VHNA 5J96B 1RUH2 4MV2A 2X53S 3ES1A 2G9FA 3I2GA 3A21A 3WEZA 2I2SA 3RVHA 2X5IC 4DO0A 2BGPA 2J22A 2NZ9A 1Q3EA 4MYEA 3OCPA 3TN92 5FWJA 2O14A 2QCSB 3IBMA 3B00A 4PI0A 1F2NA 5ERLA 2D93A 5C4WB 2ENRA 2ZGMA 1MEC2 3JQWA 1JHNA 1SFPA 3VN4A 1E5IA 1VBA1 4XTPA 1EPWA 1EUUA 1I5PA 1WCDJ 1JUIA 1KJLA 4SLIA 4J1XA 1UKRA 4CUAA 1L3JA 4ZZ8A 3X29B 4B7KA 2AR6A 2YPJA 4E2GA 2ET1A 2E7AA 2HWB3 5BXXA 3VL9A 3WF1A 3UETA 3GALA 4DS0A 1ODNA 3NNJA 2XJTA 1FMD3 2FDKA 4LO6B 1XOYA 1POV0 5FY5A 5FRAA 2WQZC 1OVSA 2CY6A 2HBTA 3T0AA 3K4ZA 1S0EA 5EV7A 1JUHA 4MADA 5LEKA 5DUVA 3RMYA 1OOPA 3FUOA 2ZMKA 1HB4A 2DU0A 3KCYA 4LKFA 3SXWA 3T3YA 5FQ0B 4JRAA 5CNAA 3VBFC 2ADEA 1UN1A 2YU1A 4GAZA 4NOTA 5JPNB 1T6GC 3KVAA 2G9ZA 1D0HA 2IUWA 3THCA 1O4YA 4YGCA 1KJRA 4KMQA 1XYPA 3VBUB 5LRRA 1BEV3 3JBG2 4LO5B 5A3PA 1UYYA 3N36A 1K42A 5FLIA 3WG1A 2ZKNA 3M7AA 1XC6A 5A3LA 4HMZA 2HEVF 3C8XA 1ZBE3 4EJRA 1XE7A 4WVZA 3ZR6A 1UU5A 4U36A 3UESA 2PAEA 2VNGA 3BN6A 4ISRA 3RMXA 2FMYA 3IDEA 4A3ZA 4EQVA 4DMIA 4YFWA 4QXCA 4IERA 4DXTA 4EN7B 5FUNA 1S0JA 3ZFEC 2LM3A 1ODMA 4NHYA 4JRLA 1TNFA 4P9WA 2VO5A 4YW3A 1PNGA 5HXMA 4IGOA 1GKBA 3VD9A 1QOSA 4FFGA 4UBGA 4RR3A 2EIGA 1OD5A 5IK8A 1RUOA 4BCUA 4IV3A 2B9UA 1FAYA 2RVAA 2WABA 4NIDA 2CYFA 4NWWA 4QX0A 2KA3A 1DQ1A 4AQ6A 2FZ1A 4CCKA 3C2UA 3GZEA 4LBQB 2C24A 2Q1FA 3HAGA 3WW3A 1LOFC 4JQRA 1EV12 5IT6A 1IKPA 2E32A 5JXIA 4NRPA 3HNYM 5BNNA 1J59A 4CCEA 2ZABA 2JWPA 2OQ6A 1KXGA 1DYPA 2EA7A 5C4WC 3JUUA 4FVVA 4QB2A 3AP7A 1J1TA 3SH4A 1VPHA 1OPMA 1WBLA 4XURA 4Q4Y2 1N1SA 1GANA 2A6XA 4BH9A 4AVCA 1PX4A 1BYHA 3KF5A 1DZQA 2C6SA 3LQCA 4NUBA 1F15A 3TAYA 4DUVA 5AC91 3LE0A 3FLRA 3HJRA 1EY2A 1H2NA 1H2LA 1RHI2 3D4KA 1FV2A 2XJUA 2FZ2A 4DUWA 2QQVA 4IE5A 4JCKA 2Y6KA 5D8AC 5IK7A 4QXHA 1CJDA 1O3TA 3C7OA 4FP3A 4V1PA 1HRI1 2WYSA 2VUDA 4TXWA 3LDBA 2WT1A 2ZHLA 3PUHA 4JTNA 5A33B 2BBAA 4CP0A 3S57A 3FJSA 3K77A 3U4XA 2Y6HA 3T08A 1G9CA 3U75A 1LNSA 1C5HA 4ASKA 1VR3A 2PHDA 4RHV3 5DMYA 2VUJA 3O1TA 2QQWA 2ZZJA 3VBUC 3LWCA 5HCFA 3NJXA 3THDA 1DF0A 4XZUG 5GALA 4Z2WA 4I02A 4UOJA 2N7GA 2CDOA 4NIIA 4AVBA 2JJ6A 3EB7A 1CN1A 1F4HA 1FV3A 1WBFA 3KZ4C 4Y4RA 1NQJA 3TEXA 3RG0A 1HRV1 3WNLA 2OS2A 5JOZA 1GP5A 2WKKA 3TOJA 3MIGA 4HSLA 5ACA2 4XXAA 1YIPA 2GNBA 5F3GA 4C1XA 5ABJA 3HBKA 5JUVA 3V0AB 4FTBA 4AI2A 1I1EA 3WP4A 4LITA 1QJX3 5CYYA 3EJKA 3FE5A 4UFMA 4CA9A 3D3AA 2OA2A 2VUAA 2BFUL 2DCZA 3WINE 3KV6A 5HPOA 1ULCA 4JGZA 5FFOC 4ES8A 1ULDA 1GR3A 3APBA 2VZQA 5AC93 2WLQA 4G4FA 2IXLA 4FAGA 1UZYA 1W9TA 3LA3A 3BPSA 3ILNA 3VZOA 4WVVA 1OVPA 2GP3A 3CJIB 4OZXA 1QQP2 3JD71 3SEEA 3NKGA 4XABA 4N53A 1DYOA 1HRI3 4QMAA 1A3KA 1DG6A 4JX0A 2R072 1Q43A 3RGBA 1O4ZA 5EYXA 4NIAA 3MLLA 2IVIB 2PXJA 5EFUA 1JYXA 4UT5A 1KFXL 4Z82A 5DQ0A 3DXTA 3SMHA 3B01A 4KWJA 4NIHA 4B8EA 5EXOA 4X8NA 4QPIC 1FOD2 1A34A 2CU5A 2D5HA 4BQXA 4O61A 1W9YA 1ZBA1 2G9GA 4PBOA 3Q8AA 2Z42A 1DZTA 1LR5A 2BOJA 2HWE2 2ZA9A 3D0SA 3PUSA 4YZ4A 2EICA 1NLQA 1ND3C 4MHRA 4HVQA 1RUG2 1K12A 4EE2A 5A7SA 2JG8A 1IPJA 2XJSA 3WDUA 1UU6A 3N9QA 1RUD1 1UMHA 1QJEA 1DGWX 2BWCA 1AHSA 1PNFA 2ADDA 3K3OA 2FD8A 4JHTA 2W47A 1YFWA 1QJY2 4AQTA 1VBB2 4UW3A 4J6GA 3Q8CA 1AYN3 1B09A 1E5SA 1JXNA 2Y6FA 3NAPC 2Z79A 2JDNA 4UWDA 3KS7A 5CVRA 1Y7BA 3WVJA 2AGSA 2FHRA 4A42A 1OMIA 2YROA 4CE8A 5FOBB 4TTGA 2ZGUA 4LT5A 1X8EA 1OQDA 2DTYA 1LU2A 4BOWA 1US3A 2QQIA 3AVRA 2OZJA 3JQXA 4Q27A 1IS3A 4HPKA 3VGIA 4QGNA 4M01A 1HQLA 3HMYA 3OBTA 4JQTA 4XF9A 3FBMA 3JD73 3K51A 5A70A 4K21A 1V6LA 1YQCA 2JD9A 3N3HA 3E1F1 4AVVA 1BMV1 4F3JA 4HK8A 5BNPC 3CHXA 2EF6A 5K0UA 4CCLA 3IDBB 1J83A 3FLPA 4OI1A 2G4IA 1WW5A 4NPLA 4YLZA 2R061 1VAVA 1VRH3 1PZ8A 1GWLA 4FPLA 2HLEA 2WYFA 2ZBJA 3NRUA 1R092 2XJPA 3NW4A 3OB8A 3HD8B 2C9KA 1CD3G 2C5DA 1RUC2 4JHZA 1N1TA 3ZR5A 3M3OA 1WZXA 2IXIA 1JYWA 1GP6A 4GMP1 1EAH3 2RJLA 3AKRA 3GF6A 3ZDSA 2J42A 4I01A 5CFDA 4ARXA 4B3NA 2R6QA 2CHHA 5IWFA 4AI3A 4B29A 4YVSA 5FZFA 3K4AA 5IW0A 4QXBA 4BQ3A 2PHTA 1WGPA 5FY7A 5LCWL 4DY3A 3MEPA 4CDWA 1TMF1 1V0AA 2HEWF 3E5XA 3O14A 5E16A 4XUQA 5L9RA 4AK3A 1JZ7A 2QQLA 3VD7A 1HDKA 4MGZE 1DGRN 4XDOA 4XHBA 5JSPA 3DPRA 4Y4YA 3ZSKA 1OBNA 1PIV1 1W6PA 2V4VA 1HB2A 1EP0A 2D98A 1AL21 4U2AA 5KHGA 4Y1XA 4Y20A 5FZMA 4HZFA 1QGLA 3ME2A 3AXEA 2RMU3 1AR93 4Y1VA 1RVF3 3J9SA 4XPVA 3H8XA 3O0XA 1PK6B 3SEPA 1RUE1 3KT7A 4DPNA 1VP6A 4BQ5A 1ZA7A 3NL1A 1X33A 1XE0A 4WM8A 2C0ZA 1AVBA 1TVGA 2NM1A 2XG3A 2Z4FA 4QPGB 2Y6LA 4YVWB 2JDUA 1AJOA 2E53A 1APNA 3POGA 3H1WA 4JC1A 1ULGA 4N43B 3RFRA 3M3IA 3O7OA 1LKNA 2WNVA 1VBC2 4AOCA 3MW2A 4S2FA 2ZX4A 1ENQA 2ZEYA 5JXGA 1SDWA 2XHNA 4BK5A 4IV1B 4PF1A 4K1YA 1RUI2 4LO8A 2D40A 2VCAA 4CP2A 1H1IA 4QT6A 3ZMOA 2P37A 3LCPA 3CF6E 3O1RA 4AEMA 3OD0A 1UCXA 4LBQD 1D4VB 2NQYA 2GMPA 1K5MC 3GHNA 4UAPA 2E7TA 3AMHA 3AP6A 5EPAA 3OEBA 1GQPA 1W06A 4IEZA 4XFIA 2DVBA 3N9MA 5LBBA 1OQ1A 4RGGA 2X29A 1U5YA 1TME1 1S2KA 2XWBB 1SFNA 3POWA 1PO13 4AEDA 4XUTA 3WF3A 3MZHA 4QGMA 2RS11 1AR61 4I3PA 4XHXA 3OYWB 3JXSA 4XQDA 2SLIA 5A7OA 1ULPA 3TEWA 1AXYA 1CESA 1S1AA 3M1HA 3NWKA 4WZFA 3WQ1A 4CDQC 4DXRA 3ZFFB 1UY2A 4DRRA 2BU9A 3O1PA 1OURA 1ZZ7A 1JZ2A 2G19A 3AKPA 5JOXA 2DCYA 3PURA 2ZGNA 4LOSA 1RUE3 1MS0A 1WLWA 2BVVA 4JGYC 1C3HA 2VMIA 4D7YA 4A4AA 4W6WA 2WNUA 3E6CC 1COV2 2RS51 2FDHA 3KV9A 3VBHB 1OD3A 1HJFA 1JTZX 2YYOA 3PMEA 4YW7A 5FZ9A 5HI0A 3B5LB 3S5QA 3K3NA 1V6OA 2NPIA 2WO1A 2XB6C 3FMGA 4YNIA 4FI9A 3IDAA 3N9LA 4TYSA 3AP4A 3LA2A 5FP7A 1LODA 3AP9A 2W52A 2PLV3 4JAAA 5E89A 2JENA 3E97A 4WV8A 4XF4A 4UI9L 3SNMA 3BTAA 3TNPB 3TWIA 3USSA 3WCSA 4CCJA 4QX7A 2F4LA 3WNXA 1UOBA 3S5AA 4AFCA 2D6KA 4PDWB 4UF0B 2ATFA 5FOJB 1W8NA 3CU7A 1BVP1 1LOBA 1UY3A 2IC1A 2W87A 3K4DA 1BK0A 5B4NA 3S0MA 1YUDA 1NCRC 3DGTA 4IEPA 5IVJA 1GZWA 3WSOA 1C1FA 1V70A 1QMJA 1TME3 3JU9A 5E6HA 3WP5A 4B7EA 4IQPA 4QHOA 5DN2A 2OUHA 1PO21 2HWB2 2UYBA 4YVWC 3KGLA 4ET7A 4H14A 2FQPA 4MXWA 1SLCA 2JDMA 2RS13 4V2VA 1S0IA 5FZDA 1FMD2 1OA2A 3N9OA 1X8MA 4W6YA 3UKNA 3FWEA 4ATEA 1ASJ1 1JH5A 1IHMA 1FPN1 1WD3A 3VZJA 2D3PA 4R4XA 3ZXEA 1E5RA 5CG8A 2D6MA 3GZUC 1MS8A 4BHPA 1OT5A 1PGW1 1FI2A 1FNYA 2QBXA 4ITCA 1NY72 5LW9A 3BOPA 5LBFA 2MPFA 2QQKA 3GJAA 4LOTA 2RS31 4WBBA 4GB31 5FMOL 2NYYA 4I09A 1OKOA 4R52A 1CJPA 5H9PA 5SV5A 2BQPA 3SITA 5KR7A 1C4RA 1BEV2 2AEYA 5CEHA 5K9YA 1UOFA 3O0WA 1DIWA 5C8CC 5DXDA 3CDZB 3DL3A 4GA9A 4LBKA 4ONUA 1ZBE2 5I91A 1WW4A 5L7OC 3OG2A 1NLRA 3F95A 3T1LA 4QKBA 3J4UH 3D82A 1OOPB 3WCRA 3ZFFC 5L9VA 1DFQA 1N3QA 2H0VA 3ZYIB 4HKOA 1OXCA 3ZPOA 1RUNA 4AFDA 3ZXKA 2V4AA 4WZCA 4YW5A 1Z78A 3NSTA 4M3CA 2OKXA 5GLWA 3DCQA 2FCTA 2GMMA 2RHPA 2WO7A 2ZX1A 3H7JA 4X6RB 2Q1ZB 5HV0A 3T09A 1JN2P 5B4XA 2VQTA 4FXKB 4XOGA 5C33A 1V6KA 2XONA 2W39A 1JOBA 3BI3A 1TQ5A 2LROA 4NR1A 1RL3A 3VBHC 2E6VA 1HN0A 1ZRIA 3RPQA 1NCQC 4I0AA 5DPNA 5E8AA 4EN8B 2UYAA 5JLVA 1Y3TA 3OD4A 3O1OA 1W2NA 1DLLA 3CLPA 4C0BA 2JEMA 3KD4A 4LHLA 1SDDB 2IXKA 4RL7A 5F32A 5FV3A 1ZRDA 3OF1A 4FFFA 5CISA 4FSJA 1SZBA 4MSVA 5HBAA 5I0RA 2WS91 4CDXC 2RS33 2XGXA 4GB33 4ZU4A 3H3UA 5LA1A 3I4IA 4RR3B 4CXWA 4EROA 4LNVA 1J3RA 1POV3 4IV3B 3AC0A 3H9AA 3ON7A 4G9SB 4BA6A 3ECQA 5FMOS 5A1LA 2WWSA 3FHIB 1GQHA 3PJYA 5FPXA 5F5CA 3MV11 5IK5A 3QLQA 1ND2C 1WUVA 2GNTA 2R041 2VMGA 3HNBM 3Q8BA 2Y64A 4Q0UA 5GZEA 5BNNB 4L0PA 4DZGA 5L36A 3B7MA 3DUIA 3LB9A 1QJU3 3POBA 2WFF3 5G04L 5FP4A 4AHYA 4RHV2 3IPVA 2VZ3A 4P9YA 5T54A 1N3OA 4A41A 4FAHA 4GMP0 3EYPA 1A6CA 5H9SA 5EJZB 4EWAA 2D3RA 2BV4A 3GGLA 3NJVA 2IFRA 3ASIA 1GQGA 4BQ1A 4Q4X1 3WUDA 1AR82 1MS4A 1POQA 1NG0A 2DVGA 3HQRA 3ACFA 4KU8A 4E4SA 5F5AA 5FP3A 3I54A 5C8WA 3BTXA 2YMZA 2QDNA 1RGSA 2YY1A 4TWTA 1DZRA 5CFCC 2NMNA 4OUSA 3M3QA 3ZFGC 1OOPC 3ZKUA 4AVTA 2WN2A 1U0AA 4I2OA 4QU1A 1WLCA 1QJX2 3OGJA 4P08A 4UYBA 2ZAAA 5JMOA 4S2GA 1GBGA 1HKDA 3MBWA 4FP2A 2ARXA 2J1UA 3NV1A 3VLBB 3I8TA 2GH2A 5AFBA 1NUKA 3N7JA 4F83A 2WS93 1ZZ8A 1DQ0A 2UY8A 2PN5A 5FPBA 3LAGA 3PVEA 3IAQA 2K46A 5AC92 2BWAA 4MO3M 3BYWA 4AL9A 3T2OA 2OW4A 2WA4A 4Q4W1 4GWNA 3OOXA 1BQPA 4IE0A 1WLTA 4BZ4A 4E2QA 1WKYA 5ABJB 1HRI2 1JU3A 3ROUA 4AQSA 4B1LA 1QH6A 5ANNA 4S2HA 3JCIA 4MVTA 1XXNA 4A6SA 1N47A 5IVYA 1US2A 2HWD1 2WNEA 1B35C 3M4FA 3ZN4A 2ZX2A 1QDCA 1UAIA 5JSOA 1KFUL 4YW4A 1QXJA 2ORZA 3TEZA 1WA6X 3MUZ1 1CVNA 3H3ZA 5H9RA 4JGZB 4AR2A 2JE9A 3VDDC 3NV2A 1LGBA 1W05A 5LZ6A 4KL1A 5T52A 5FUPA 4IEUA 5EQUA 1NKGA 3I7DA 2X05A 1S2BA 4WM7A 4FOWA 1AR72 2VQ0A 4HFSA 2DVDA 4RA0A 1AXKA 4N53B 1D4M2 3AYAA 1SCRA 5HCHA 4IDZA 1PZ7A 3H7YA 1DQ6A 4GH4C 3AZWA 1UMZA 4LJHA 4QB6A 4E4HA 4CU7A 2BDRA 2J1SA 5HCBA 2GU9A 1NE6A 4XF1A 2ZGSA 4KU7A 4XACA 3WNPA 4DQAA 4LKDA 1W2AX 3H42B 4M00A 1HXS3 5JCTA 4EN6B 2GMEA 1AYN2 1BLZA 1NOVA 3OY8A 3DYPA 2ES3A 4MZUA 4BQ4A 3FLTA 5BNOA 2RDSA 4Y5Z0 5DAQA 3ABZA 5FO9B 1CX4A 1ZM1A 3ZLIA 5FZOA 2ERFA 5FYVA 2JG9C 2Y6GA 1STMA 4CEYA 4X8PA 5FWEA 4IEOA 2RM21 4KI5M 2D3SA 1LTEA 2WC2A 2JG8B 2W3JA 1Z0HA 2ZGQA 5KHJA 4XFHA 1ACCA 3EMRA 5JVVA 1OSGA 3HVDA 2B4KA 1ZZ6A 4GKYA 4XZPA 1KD7A 2RR13 2XBO1 2HWD3 5C3PA 1X36A
chains in the Genus database with same CATH topology
5KBFA 4P5HA 4XJAA 1VRH2 1GFF2 4MGKE 2Q0AA 5KHHA 1NYWA 1PVC1 3IMNA 2D5FA 4NO4A 5J7MA 3WV6A 1S55A 2LTNA 5GZDA 1Q5OA 3RJRA 4HPKB 2BEOA 1LENA 3LA7A 1EAH2 1J1LA 4CEWA 1DGWA 3WG3A 1V9U2 1MS9A 5JPMB 3I2DA 4LHKA 1UIJA 5ABJC 4Z07A 5BY5A 5K0UB 1Q8SA 4EN0A 3TB0A 2TUNA 1DU3D 2B39A 1HX6A 1RMU1 3NVCA 1R081 4P14A 5FTTC 2A3YA 3PVNA 2WT0A 5LK5A 1H8TC 1U5IA 1JYCA 1QWRA 4XTMA 5JI7A 4AF9A 1F9KA 3R4DB 2E9QA 4UW5A 3R0RA 2RMU2 3HT2A 5CFDB 1AR92 1RVF2 4M3CF 4Q2FA 4DOUA 1LCLA 4YVSB 2O8OA 4KBBA 2A70A 1UD1A 3EBRA 4CDWB 3S7IA 2YGLA 3EO6A 3T2TA 1MQTC 3C3VA 2OZ6A 4NHMA 3DPRB 1AXZA 4LBOA 3ZVXA 1HIXA 1W6PB 1LJ7A 3UJQA 1XU2A 4Y20B 4XF3A 1X50A 1DHKB 4N9IA 1PGL2 2Z69A 1YO8A 1XYNA 2XLGA 1SCSA 2JXAA 4FPYA 1LU1A 4RQPA 1R1A1 4Q29A 3VBOC 5DZGA 1WCSA 2NMOA 4DFSA 5DG2A 4D69A 1ZREA 3J8F1 4MGIE 3FC0A 4WM8B 2PHRA 3RI8A 4LBLA 4AI0A 1PO12 4NPRA 3SISA 1VBA3 3WW1A 4N90A 2WNVB 3L2HA 1YRZA 1YWKA 1KDMA 1LOEA 3V65A 3WP3A 2KXLA 2VOWA 2YGMA 2V5YA 4F7ZA 4FOQA 5E1RA 3MF6A 5JZGA 1VBE1 3VBSA 1RUJ1 3GBWA 2AUYA 4Q4V1 4IETA 4ZKTB 1CAXA 1RJ8A 3WD5A 4JDMA 1S0CA 4AEDB 3CL1A 3H1YA 5EYYA 2PA7A 3ATGA 1Q56A 3MICA 4YM0A 2OVUA 1NXMA 1VBD1 2UWAA 1G9BA 5I8YA 4COUA 5DUXA 1S0DA 5GLUA 1V6MA 4AW7A 2GALA 3G6JB 1AYM2 5DZFA 2QDRA 1CAWA 2PLV2 3P3NA 2ZGPA 1BKZA 4LTAA 1SBEA 1SFYA 4XBNA 3Q9OA 4AHXA 2PELA 4YVSC 2Q1MA 2GN3A 5BPXA 2MEV1 3J8F3 3B9IA 4UW6A 1VIWB 5K7PA 1A78A 2EVXA 2WNUB 3KQRA 4QX5A 1AUYA 4XXPA 5AVAA 3ZYPA 1NA1A 2PYTA 4K1ZA 4HKLA 1I6XA 2D43A 4PQ9A 5FREA 3MLJA 2RS12 5DDJ1 2GC3A 3ZSLA 4OFGA 2I07B 2VQAA 5C9AA 1F31A 4O9GA 1O3SA 2UWCA 1S0GA 3WG4A 3R6SA 4P9GA 4E4ZA 4AFBA 1GZWB 2Y0IA 4LA2A 5GLZA 3WHUA 1MZEA 2Y26A 1PZ9A 1AL0G 4KG0A 4ASMB 3FFQA 3N7MA 4MXWB 1ZYBA 2DCKA 5BNQA 1YJLA 2BNNA 4W6XA 3NO8A 2HWF2 1UZZA 1S0BA 2X5IA 1UPIA 3IKWA 4K6BA 2ILMA 2XKPA 2JX9A 3ZXJA 3AYDA 3M2MA 2QVSB 2OIIA 5J98B 2QFEA 2IXCA 3ZYGA 2XWJB 1IS5A 3M3CA 4Q8LA 1C1LA 2MEV3 1C8M1 1WA4A 3IDCB 2UU8A 1X7NA 4LUMA 2XUMA 4XFAA 4NVPA 2DF7A 4M0NA 3B69A 4QQPA 1Z7S1 1DQ2A 4TLFA 5JOYA 3MFAA 4FT8A 4FPJA 2P3IA 1WD4A 2B42B 2P3KA 2ZGRA 1QKQA 4P9LA 4QU2A 3VBFA 2WZR1 4M3CB 1HRV3 3ZIWA 3I59A 3FX3A 2AENA 5T50A 1H9WA 4CZSA 5A32A 3E6DA 4K3UA 3KCCA 2UURA 1O3QA 4EN9B 5H9QA 1RUH1 4WVMA 2WNUC 1O4TA 4ASLA 1YYNA 2OYZA 1M4WA 4LA3A 3VZMA 5I0SA 1AZDA 3TN91 1H0BA 1ZA4A 4EV0A 3MPPG 3RYPA 1ZZBA 1HQWA 2CAVA 2R16A 2XHKA 4QQLA 2BFUS 2QE3A 1MEC1 4Z8BA 2GNDA 4XEZA 1QJU2 2WFF2 4R8HA 5EWSA 3SCGA 3ZFEA 4H55A 3RQ0A 1ULEA 3QD6A 1YFYA 3VKFC 4WVWA 1FXZA 3AMMA 3ZPYA 1A8DA 3VKNA 3RJ2X 2R1BA 1ZBA3 4QD2A 5KXDA 3HR9A 4HBNA 1LOFA 1N1VA 4LULA 2FMDA 4YZ3A 1LHOA 2PHUA 4Y24A 5FLJA 2CL2A 4AI8A 4BE3A 1YLLA 5GZGA 3CJIC 2B7YA 5C4WA 3UKTA 2WT2A 3IPVB 5JIAA 4Q1PA 1G9AA 3HBZA 5LRSA 1RUD3 3JBG1 1XU1A 3QBQA 1AF9A 2WFPA 3ZO0B 1HLCA 1D2QA 1H8VA 2X8KA 3S6PA 4IL7A 1W6QA 4PLNA 2ZHNA 4YM2A 3EQEA 4YSFA 2HWC2 5D8AA 4UW4A 2D44A 1H1MA 1NXD1 3TBDA 1G9DA 1O91A 1CGPA 1GNZA 1MEC3 4XJWA 3RYKA 3TRSB 4GULA 3G7DA 2DVAA 1KRIA 1W6MA 5JR7B 4XBQA 1YNAA 1SEFA 1SQ4A 2A3WA 2R063 1WW7A 1VLNA 4NHLA 1AX2A 2ETEA 4A7YA 2BW8A 2VOVA 1LOGA 3ZN6A 1REFA 1BBT2 1MVEA 1EV11 3USUA 4Y26A 1QH7A 5GKAC 5T5LA 3ZXDA 4GMP3 1BVVA 1QDOA 4J1WA 2H6CA 1EPZA 4A7ZA 4Q4Y1 2K9ZA 1RB8G 1HXS2 2CV6A 1RUF1 3QH7A 1PGSA 2IWGB 1TMF3 1RHI1 4JTOA 4WM7B 1VB4A 2YC0A 2YHJA 1PIV3 4XJ8A 1AL23 4IEYA 2V09A 1XNDA 1PVXA 4XJ9A 3KB5A 1TEIA 3V56A 3SH5A 5FO7B 2UY9A 4Q26A 2UWBA 3SLIA 3W59A 4YARA 2RR12 1BZWA 4QPIA 2R30A 4AEJA 3OY8B 4AQ2A 3GZAA 3GBFA 5EJ3A 1ENSA 4XILA 4BMBA 5JMCA 5BNOB 4DY5A 3PVOA 1Q8VA 4CEYB 4E27A 1RTVA 4FBFA 3THTA 1ND3A 4HN0A 4MLOA 1VAKA 5ACA1 2VVEA 2CWMA 2QZ2A 3M8LA 2XJRA 2IXJA 1AJKA 4QHBA 5DG1A 4AWDA 3FZ3A 3OBRA 1I5ZA 1PK6C 1MZFA 4QM9A 3BPZA 3HWJA 3NAPA 3R4UA 4AVSA 5JSRA 4QPGC 1RUF3 1WW6A 1IS4A 3KT1A 2Y0OA 4N43C 4B4QA 4FOVA 1QQP1 1AR63 3AJYA 3AP5A 1OI6A 4CEWB 4F8AA 4CYDA 4IV1C 2R071 1PMIA 1V00A 2HYKA 5BNPA 3MIBA 3MW3A 3ZSMA 2C1FA 1CAUA 1IPKA 2BUKA 2VW2A 1FOD1 1KS4A 4D7SA 5GZFA 3UL2A 4ATFA 1YIFA 2ZHMA 1QXPA 2HWE1 3B93A 1QF3A 3NJZA 1CONA 2RS53 3WDTA 1RUG1 5FBZA 5FO8B 2E7QA 3VHPA 4K7JA 3KCXA 2WL1A 4LO7A 2OPKA 4L99A 3AYEA 1QXRA 3QOPA 4FQ4A 1QJY1 1VBB1 1V6IA 4CRQA 3URFA 3U10A 1VBA2 2E63A 3LOBA 4HLTA 2JD4A 4NN0A 5CBLA 2XVGA 2AZ5A 3MIDA 3QACA 1VAMA 1PO23 5BNOC 4OHXA 1CQ9A 5JOWA 1U12A 3WZ1A 5KC5A 2NP0A 4RQPB 4CEYC 2ZGOA 1QOOA 3N4MA 3WQ7A 3ZYJB 1ASJ3 1FPN3 1SBFA 4PIXA 1HV0A 2O1QA 2D6PA 2BGCA 4KGQA 1FNZA 4QGLA 4A3XA 4L11A 2B46X 3PMSA 3N35A 2EXHA 4PDWC 3MFCA 1LGNA 4JVAA 3WDWA 1GICA 3PLQA 2WSUA 2ZMNA 1R091 4CDUA 1J3PA 2WQ4A 4COVA 2GH8A 1RUC1 1W0PA 5KXCA 5F6LB 3VZLA 5JZGB 3HT1A 1AX1A 5D1IA 4FO9A 2E51A 3VBSB 1ZVFA 3WDVA 2P17A 3ZXGA 1K5MA 2VVDA 3V64A 1CAXB 4IEQA 4FPHA 4B4PA 3J8F2 1GLHA 1H4HA 2K2SA 4UBHA 4XFCA 1FX5A 1QJY3 4PF5A 4FPGA 1YJKA 4Q1RA 1U5XA 3PTYA 4RD7A 3S7EA 5JI9A 2WSVA 3J26N 5JDBA 4BPZA 2RJKA 4ORFA 3VV1A 4CDQA 3AMPA 1CAWB 1DQ5A 2ZAHA 1SLAA 5JIUA 1OQEA 3O12A 4HVOA 1ENXA 5T5OA 3SHRA 1LOCA 2V73A 4PIYA 1MZ5A 4JGYA 1RJ7A 3INAA 5A3MA 2YZ4A 1G86A 1NA1B 1VBC1 3WUCA 1ZNPA 2ZZQA 5E88A 1R093 1RUI1 4M0HA 1BK1A 1RUC3 3MW4A 1CAVA 4Y22A 4IEXA 5C9AB 1QJZA 4URTA 2R043 1OFNA 3POYA 1CR7A 4Y1UA 5KXBA 5L73A 3AYCA 1NCRA 2K0GA 2BPA2 1C5IA 1WMDA 5KHKA 2DUQA 2GDFA 2C9AA 3KMHA 2X5IB 2F4PA 1W39A 4RR3C 4G3YC 3FBYA 4IV3C 1UKGA 2MNGA 3KT4A 4HVRA 4Q4X3 3AMNA 3AX4A 5CB7A 2PAKA 1REDA 4BMEA 1HRV2 2R1DA 3KLSA 4KGGA 5SV8A 4AI1A 2GC1A 2QQPA 3H50A 4LO4B 3R4SA 5BNNC 3MGUA 2NN8A 1LEMA 2PAMA 4QQOA 1COV1 4XDQA 4BM8A 5J48A 4ISQA 5C8CA 3A4UA 4FXGB 1VBC3 1JBCA 1MACA 1LGCA 1Y9QA 2O8QA 2VOXA 5L7OA 1W0OA 2IFWA 3JB4C 1ZZCA 1OA4A 2D6LX 1GZ9A 4ZXKA 3VBFB 4L2NA 4Q4W3 5T5JA 3JD72 2VMHA 4XQWA 1NQDA 3I59B 2CGNA 3O0VA 4MGYE 4DINB 5A32B 1VB2A 2TEPA 2Z2SB 1LHVA 4XIOA 1QU0A 4L92A 3U11A 2ZX3A 4WVMB 3H0OA 1QOTA 4HSJA 5LEJA 1FMD1 1MS5A 3MLKA 1CIWA 2DUOA 2FBEA 2XLFA 1NCQA 1ZBA2 3ACLA 2CGPA 1NY71 2XLAA 2A73B 1DBNA 2GAUA 4HL0A 2DFBA 5FLHA 3ZFEB 3LKJA 1XRUA 1OKQA 3VBRA 2B45X 1FATA 1RUD2 4CDXA 5CAZA 5DUUA 2ZKLA 3VKOA 4K20A 4QM8A 4ES9A 4AHWA 2ZPXA 1ZBE1 4UXAA 2GNMA 2D6OX 4ZU5A 4RSUA 3B94A 4JGZC 1GZCA 1NZCA 1ND2A 3A0NA 3RRDA 2ZGKA 3AZVA 1Q8PA 5CA6A 3ZXAC 5I8SA 5I0TA 2XVKA 1GV9A 4XQ4A 2WA3A 4QPYA 4N53C 2RM23 5CU1A 3UK9A 3WLUA 2DTWA 1UPSA 4K8FA 5K8SA 1BCXA 2ZHKA 5HCAA 2W68A 1BMV2 1W6QB 1Y43B 4AG4A 2XBO3 3E5QA 3PVBB 1Q8OA 3AZZA 5D8AB 3BALA 2R062 1GNHA 3ZIXA 2NLRA 3UKVA 4D94A 4P9XA 4YM1A 2Q4SA 1PVC3 3AMQA 5CFCA 3GHMA 5GM0A 4OHWA 3HN1A 3D5OA 3ZFGA 3ZMNA 4PJYA 5FDBA 3MIHA 2PTMA 2VG9A 4LLOA 1IOAA 1YHFA 3LZZA 3POSA 1F8VA 4PCRA 2JG8C 2R32A 4CTEA 1W6MB 4B4RA 1R1ZA 4AVAA 1TMF2 2CNAA 2EXJA 2XL7A 2ET7A 2HEYF 1RMU3 2LALA 1R083 1PIV2 3VKMA 3GNEA 3E6BA 1XNBA 1AL22 3ZN6B 3USUB 1D2SA 4Q0SA 3HIFA 4KWLA 2WLPA 4AE2A 3NV4A 4XIKA 4Y1ZA 2P34A 2YUEA 1B35A 2CWSA 4RHV1 3WR0A 1W6OA 4BIFA 1RUE2 1SLBA 3VDDA 2A5ZA 4Q8KA 5K0UC 4AEKA 2VECA 4KH9A 2W08A 1AR81 1S0FA 4BIOA 3FUQA 4RS5A 2ZCWA 4MUVA 4SBVA 4GWMA 2Q30A 4GH4A 2Y38A 2VXRA 2RE9A 4ZU7A 3VKLA 4KQ7A 1OA3A 2VW0A 3V0BA 1QJX1 1R1A3 2XL9A 3M70A 4OUMA 4AGVA 5CFDC 2W0XA 1LOAA 4QPIB 3NV3A 4QQHA 1H2KA 5GJ6A 1H2MA 2R0FA 4AGGA 3OTFA 4CDWC 5T3NA 1TME2 1H9PA 1RUF2 1IS6A 3DPRC 3QCWA 2XH6A 1ND3B 2JG9A 1AR62 4YW2A 3IN9A 5I8TA 3KM5A 2WIIB 4Q0QA 2TBVA 1ZX5A 3B02A 3RZZA 1VBE3 1RUJ3 3RS6A 4Q4V3 3ZSJA 1PM7A 4PLMA 1LB2A 5F5QA 5FAXA 2VNOA 2VOKA 3NAPB 5LK7B 4WM8C 1AX0A 3EXUA 1RC6A 2XJQA 1AR71 1VBD3 2RS52 4YZ5A 2WNVC 1D4M1 3CEWA 1AR83 4E2SA 4Q0VA 1ZRCA 4AFMA 4FTSA 1G7YA 3TYJA 3M3EA 4H3WA 3IWZA 4YGBA 5BNPB 5J3UA 1CAUB 4OHYA 5I0UA 1O5LA 1XQNA 4YG0A 3RDIA 1REEA 4MXVA 1AYN1 4BLJA 4YGEA 4GXLA 5F9TA 4YG6A 4AEDC 4LEJA 3SCHA 1H8TA 1V6NA 1DDLA 1PO22 4XJZA 3W9AA 4OI2A 5DDJ3 1ASJ2 4Y1YA 1FPN2 1GYKA 5AFEA 2A6VA 2KM2A 4FPEA 3ZX7A 1URXA 4HT1T 5T55A 1W6NA 1MQTA 3RYRA 1PGW2 1ZZ9A 5KWRA 3OJBA 1VRH1 1KITA 4LBMA 2RS32 4EWEA 4GB32 4O9EA 1HQNA 2D97A 3MIFA 1YXWA 4FCAA 4DB5A 2SBAA 4XMIA 1AR73 3SCFA 1EAH1 1RITA 3ZN5A 3ZSEA 3VBOA 1D4M3 4L97A 4FPKA 4META 2ZOEB 3DN7A 1MZ6A 1V9U1 1SMVA 3QH6A 4K40A 4XJUA 3UV9A 3IIAA 2IXHA 4AFAA 1SLIA 1LECA 4QXKA 5EZWA 2XVLA 4KWKA 4COZA 3VL8A 1YFXA 5TSWA 4CDUB 2JDZA 3BODA 1C8M3 4C90A 3BOWA 2JECA 2QKDA 4OHVA 2YDEA 3AKTA 2RMU1 1AR91 3D6EA 1RVF1 2ZMLA 4YGDA 1OLRA 1K5MB 1JYIA 1ALYA 2XJVA 1Z7S3 3WT3A 3DF0A 2DCTA 2VW1A 4C1WA 3RWNA 1LULA 4P9JA 2EXIA 3A0KA 3L2YA 2WZR3 1RIRA 4R9BA 3OGGA 3PJQA 1ZRFA 3WDYA 1E57A 2Q8OA 2R49A 4R9DA 4CDQB 2WS92 4OHZA 1PGL1 5J37A 4XETA 1J3QA 2A71A 2CAUA 5FCCA 1JOJA 1RUH3 3WW4A 3LSDA 1N1YA 4FQZA 3SH3A 4D7TA 3TN93 1M06G 2VNRA 2R042 4YFZA 4JDOA 1V9U3 4JGYB 4XFBA 5JAXA 4HK9A 3KGZA 1QY4A 4I0WB 1PO11 2BTVC 4D3WA 1VJ2A 5FQ0A 1LHUA 1OLQA 1FT9A 2A75A 4YW1A 1OHFA 3S30A 2JE7A 3VBUA 2ZACA 1BXHA 4R4ZA 4LHNA 2ZX0A 2CTVA 5KXEA 4QQ2A 4H7MA 2ZGTA 1DGRA 4INDA 3N7LA 1CAVB 1UX6A 4Y22B 4PIZA 3IT8A 4Q4X2 2DWRA 4FPOB 2B8MA 4N9HA 1G9FA 2WJSA 3WHTA 2DURA 3B3QE 1NCRB 5DUWA 2D7FA 1ULFA 5F6KA 1UIKA 5CG9A 2YXSA 1WCKA 1XYOA 1YI9A 3JBG3 4HANA 4CDUC 1AYM1 2A6YA 1TE1B 2VY0A 1H1AA 4XF0A 5T5PA 2PLV1 4YM3A 4YZ2A 1G8WA 1MVQA 1C8NA 4GIQA 2VH9A 5C6CA 4FTEA 5F1RA 1J58A 4Q4W2 4FOYA 5IUQA 3ST7A 4LBQA 1IGOA 3VHRA 3TNQA 1SBDA 1DYKA 3DV8A 2DU1A 3AXDA 2CGOA 3LGRA 4TZDA 2HWD2 4XFFA 5C8CB 3UJOA 4AHZA 2H0BA 3E5UA 2B5HA 2DV9A 1KDKA 2I45A 1O3RA 1KS5A 5L7OB 2VULA 4PBPA 4IXLA 3DKWA 1YCIA 3AB0A 3WQ0A 1O7FA 3AM2A 3L9JT 3OPZA 4COYA 1BJQA 3AZYA 3LSEA 4GKXA 1EV13 1SLTA 5A33A 4HN1A 4OI4A 3BIWE 1UW8A 4BYYA 2GC0A 2O0OA 1LHNA 4Q4Y3 1V6JA 2HWF1 4OLLA 1NCQB 3U0ZA 2DUPA 4JDNA 4XFGA 1RHI3 2ZJCA 1AYM3 1UL9A 3WW2A 3GYDA 3GBGA 3WG2A 1A8MA 1QNWA 5FPZA 4FPCA 2GZWA 2VVFA 3H1MA 2RM22 4M3CE 2GN7A 1O5UA 3VBRB 2EALA 2QUOA 4CDXB 4I30A 3V0AA 2ZTNA 2H6BA 2DVFA 4MX3A 2PHXA 3JZVA 1C28A 3ES4A 1W2UA 2XBO2 4Q0PA 3ETQA 1ND2B 2WZPP 2ARBA 4A2UA 5IK4A 2AREA 1PVC2 4XMAA 1G6NA 4WM7C 3VZKA 3CJXA 2ZS6B 4LBJA 2BBVA 4HKWA 3CJIA 2A6WA 4P9IA 3WOGA 3R05A 4LE3A 5ACA3 3HQXA 1WMFA 2LUWA 1JW6A 2A6ZA 1OPOA 2BNOA 5I93A 5CIRA 1FYUA 1POV1 4LLFA 4XW3A 1HW5A 1OFSA 1RMU2 1UU4A 1R082 4DNYA 2HWF3 4E9KA 2QJVA 4JV4A 4IEWA 5CFCB 4L9BA 3D0JA 1MR5A 3ZFGB 2P3JA 1QQP3 3AFGA 1TNRA 2AYHA 1QJU1 2WFF1 4LUKA 4DXZA 5BYNA 1Q8QA 2R073 3JB8A 5HXVA 3PHMA 2BVBA 3P3PA 4AGRA 4C91A