2D5HA

Crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
488
structure length
373
Chain Sequence
b'FNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISNICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycinin A3B4 subunit
publication title Conservation and divergence on plant seed 11S globulins based on crystal structures.
pubmed doi rcsb
source organism Glycine max
molecule tags Plant protein
total genus 72
structure length 373
sequence length 488
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA01
1DGWA 1XRUA 1Q3EA 3E5UA 1NE4A 4BHPA 1TQ5A 1VR3A 4IERA 2XLFA 3LA3A 4YARA 2XL9A 1ZRFA 2PAKA 3OD0A 3U11A 4LUMA 1CAXA 1QXRA 4PIXA 4Q0VA 4CYDA 1I6XA 1LB2A 2XKOA 4UXAA 2CV6A 3H1MA 4L2NA 5FLJA 3I59B 4A2UA 2UY8A 1CAVA 2PAEA 2XLGA 2E9QA 1UPIA 4I0AA 4HSLA 2IXJA 3FFQA 3DN7A 5LEKA 3D82A 1FI2A 1CAUA 1OD5A 4XF9A 3NW4A 3DV8A 4MGYE 3G7DA 1OI6A 2PTMA 2F4PA 3ST7A 2D93A 1ZNPA 2V09A 5I93A 4HMZA 1SQ4A 4IETA 1O4TA 1ZRRA 4PIZA 1V70A 3I7DA 2IXLA 3SHRA 2KXLA 5J3UA 1SEFA 4FAGA 5LRSA 1DZTA 1Q43A 4YYOA 4B29A 4LEJA 4QM9A 5J7MA 1EP0A 1NE6A 3FJSA 2IXCA 3QACA 4IEVA 1HW5A 5BPXA 1O5UA 2ET1A 4EWAA 4IEUA 4EROA 4UBHA 3GYDA 1X8EA 3H9AA 4AVCA 4JTOA 4R8HA 4META 3BALA 4IEOA 2ZKLA 1ZREA 4QMAA 1O7FA 3O14A 4I3PA 4WVZA 1IPKA 1L3JA 3MPBA 2FQPA 3WW3A 2GC0A 4I2OA 2VECA 3UKVA 1OMIA 1CAXB 1YFXA 4KWLA 5BY5A 1CX4A 3LA2A 2H0VA 3H1WA 3R6SA 4UBGA 1EY2A 4RD7A 4LA3A 1FXZA 2I45A 2PAMA 2XLAA 4XFIA 2WC2A 3LZZA 1RTVA 5FQ0B 3ELNA 1Y9QA 4HSJA 1CGPA 2BNOA 3RNSA 3KMHA 3OGJA 4MUVA 3N4MA 4LTAA 5I0SA 2XKPA 1CAUB 4Q0SA 4LULA 2C0ZA 5K8SA 2GAUA 3ETQA 4JV4A 5C6CA 5I8TA 5BUVA 5FLHA 1UIJA 1NYWA 1RL3A 1RGSA 2OZ6A 1ZRCA 3CO2A 3KSCA 5F1RA 3CJXA 1ZZ6A 4X6QB 4LLOA 1VP6A 3EJKA 3NKTA 3NSTA 4XETA 2EA7A 4IEYA 3E97A 2HKXA 4MX3A 2GC3A 4BIFA 2BNMA 4F8AA 3NL1A 4QGNA 2OPKA 4L11A 4MGIE 2P17A 2Q0AA 2GC2A 4EWEA 2Q4SA 1OFNA 1JUHA 2XL7A 2UY9A 3E6CC 5HI0A 5T3NA 5EFUA 4JVAA 3OTFA 3SMHA 3OF1A 1DGRA 2PQQA 3WW1A 2PHDA 4IEZA 5E1RA 2CAUA 5AVPA 5LEJA 1O5LA 2BYVE 1Y3TA 1LR5A 1FT9A 4K8FA 2BNNA 2N7GA 1RC6A 1NZCA 4Q29A 4FBFA 3PLQA 2VPVA 5JAXA 1RUNA 3H1YA 2H6CA 4EV0A 3C3VA 3DKWA 3FZ3A 5JSPA 3FX3A 1NXMA 3LOIA 3B02A 4MV2A 4D7SA 1Q5OA 4IEPA 2ZCWA 3CF6E 1RUOA 4JTNA 1LRHA 5I0TA 5I91A 4O9EA 3WW2A 1WA4A 1CAWA 3ZDSA 1X82A 3EHKA 3HIFA 3BPZA 2OA2A 4AXOA 2OYZA 4YRDA 1ZZ8A 4HVOA 1UD1A 3PVBB 5KHHA 1O3SA 1J3QA 4AQ2A 4IEXA 5I8YA 1ZZBA 3SCGA 3LWCA 4PIYA 3LA7A 5CVRA 3RYPA 3EBRA 3CLPA 3MDPA 3JZVA 5FPZA 3BB6A 1YFUA 4QGMA 2EVXA 2CAVA 4DINB 4AQ6A 1YFYA 5FPXA 1UIKA 3RZZA 4IEWA 3EO6A 1XE7A 3HT1A 2D5HA 2MPFA 3H50A 5JSOA 1CAVB 3ES1A 1EYBA 4I09A 1YHFA 4E2SA 4QM8A 5KHKA 2QJVA 4D7TA 4EWDA 3L2HA 3H7YA 3HT2A 3FHIB 1ZRDA 3BCWA 4QGLA 2UYBA 1LKNA 1O3QA 4LA2A 2CGPA 5JSRA 4QXKA 1XE8A 4E2QA 2GH2A 4ZU4A 5JCTA 3BU7A 3E6DA 5KBFA 4AVBA 3NJZA 4XFCA 4Z07A 1H1IA 2ETEA 4NVPA 3U0ZA 2O8QA 2MHFA 3CEWA 4XF3A 4FT8A 4Q0PA 1J3RA 1IPJA 4XF1A 3LAGA 5CU1A 1CAWB 2IXKA 3S7EA 4XF4A 2GC1A 3HQXA 5I0RA 2EAAA 4HZFA 3MYXA 4OLLA 1X8MA 2PHLA 4HVQA 3D0SA 2B9UA 1QY4A 2D5FA 4XFFA 5FLIA 3ACLA 2UYAA 1PMIA 5KHGA 2BEOA 3KGLA 1SFNA 3WW4A 5FCCA 4XFHA 2QNKA 2PA7A 4HBNA 4TLFA 2IXIA 1G6NA 4IESA 2IXHA 5KHIA 2FMYA 2QDRA 3ROUA 4MZUA 4AVAA 3U10A 1O3RA 3FWEA 2B8MA 3TNPB 3NVCA 2Z69A 2OZJA 5I8SA 5LRRA 1GQHA 3RYKA 1VJ2A 3E5XA 4N9IA 2Z2SB 4ORFA 4MGZE 2ATFA 3S0MA 5FQ0A 1WGPA 3RPQA 4XFAA 5EZWA 4BH9A 4IEQA 2H6BA 4WZCA 4Q0UA 2DCTA 1YFWA 2HJIA 4HLTA 1U12A 4N9HA 3MZHA 3USSA 1J1LA 1I5ZA 1J3PA 4HN0A 5BV6A 4KU7A 2WFPA 2K0GA 4E2GA 4PJYA 3SXWA 1QWRA 4Z82A 1YLLA 2D40A 4KL1A 1X7NA 3UKNA 2QVSB 4XEZA 3H8UA 4H7LA 1WLTA 4XFBA 1QXJA 3H3ZA 4KWJA 2PYTA 4J1WA 3SCFA 2ET7A 1YWKA 4FAHA 3RDIA 2Q1ZB 4OFGA 1ZX5A 4ONUA 1ZZ9A 2Q30A 4GULA 4QX5A 4MH0E 4R52A 4XFGA 1ZVFA 4KWKA 3QOPA 4ZU5A 4I0BA 5D1IA 3IIAA 3S7IA 4O9GA 3KCCA 4XF0A 2GZWA 3I59A 1YUDA 2IC1A 3M3IA 3RYRA 4J1XA 1J59A 3CL1A 2O1QA 3SCHA 1UW8A 4LUKA 3IBMA 3I54A 2BGCA 3DL3A 4P9GA 3IDBB 5KHJA 4ZU7A 1H1MA 3H3UA 3D0JA 4Q0QA 1GQGA 3PNAA 4WBBA 2QCSB 5J48A 2VQAA 1ZZCA 3EQEA 4YNIA 4I01A 5E16A 2XHKA 3GBFA 3IDCB 4X6RB 2Y0OA 2GU9A 4HN1A 5C8WA 2PFWA 4MGKE 2K9ZA 1UCXA 3OCPA 1PM7A 3UKTA 4F7ZA 5FDBA 4YSFA 5BXXA 4KU8A 3M70A 1J58A 1EPZA 3E6BA 3FE5A 1DZRA 4I02A 4BYYA 3KGZA 4HVRA 1ZZ7A 3VHRA 5JR7B 5I0UA 2B5HA 3IWZA 3TNQA 3H7JA 3E5QA 5CADA 2XGXA 1O3TA 2MNGA 3ES4A
chains in the Genus database with same CATH superfamily
3O1MA 1MZEA 2WS92 4F3JA 1AR73 3BODA 4KGGA 1F5FA 1F35A 2DDUA 1TQ5A 2VTXA 4IERA 1O91A 2BRTA 5IFTA 1HB4A 3LA3A 2WQZC 4D69A 1BMV1 1ZBE3 4RR3C 2JD4A 4YARA 1QEXA 1IKQA 1C1LA 4SBVA 3OUHA 3S57A 4QQLA 2XL9A 4U2AA 3AB0A 3BTYA 3DYPA 4LUMA 3UT0A 1RVF3 4COZA 1P8JA 4CEWC 1I6XA 2P3JA 1RJ7A 3X29B 2B42B 3I59B 5DAPA 5FLJA 1QIQA 1PM4A 1LHOA 4IE5A 4EZHA 2Y60A 3MIBA 1L7QA 2A6XA 3VBRB 5HBAA 5FBJA 2PAEA 4CPBD 5A3NA 1QKQA 3CU7A 5CYYA 3ZXAC 1VAMA 2W91A 4FFGA 3ZM8A 2HWE3 2R7EB 3LEMA 5A6YA 2JDUA 1SDDB 3S6PA 4D3WA 1CAUA 3VBHB 3WNPA 3OJBA 1W8NA 1WW6A 4HK8A 2W94A 3RQ0A 3OBZA 5JXHA 2RS31 2WFF3 1QQP3 4W6WA 5DABA 4DUWA 4AI1A 2RR12 5LK5A 2VZRA 3DV8A 4XCBA 1BK1A 3MGUA 3NO8A 4MGYE 1OI6A 1C28A 2JB4A 4P14A 3SLIA 3CBNA 3Q8FA 1AXKA 1OLMA 2ARAA 3BN6A 4HMZA 4XMIA 3RI8A 1G9AA 4ARXA 3T0DA 2EIGA 1TNRA 1J84A 4IETA 4PBPA 2PHFA 4E9KA 1XB9A 1ZRRA 3BVCA 4AAPA 4PIZA 2WAAA 3FBYA 1V70A 1W8FA 3I7DA 4COYA 4XZUG 4XUOA 3WQ7A 1HB3A 5J3UA 1JOJA 2DCKA 2H0BA 5LRSA 1MPXA 4B4RA 5DMYA 1Q43A 5FOJB 3I2GA 5DPNA 1YEWA 2BJSA 4XACA 5FJHA 4BQ1A 3BUCA 4XABA 1EP0A 1N1TA 3FJSA 2QE3A 2IXCA 4XBNA 3ZXFA 3JBG3 2VMHA 4N53C 2RV9A 3VBSA 3N9MA 4HPKB 3GYDA 5FMOL 3ZFFA 2RMU2 1N3PA 5ISLA 5FYMA 4Q1RA 5ABJC 3SKJE 5IVYA 1ZA7A 4NPMA 4R8HA 5LB6A 4ZS3A 4QPIA 1ZREA 1J83A 5AVAA 3DYOA 5GZGA 3DKQA 1IPKA 3VL8A 1B09A 1KITA 4P9XA 3VZOA 3RGBA 5D2AA 1I9RA 2FQPA 5BYNA 3ACFA 1LHWA 3GJBA 1YIPA 2ZMLA 4AZZA 3KQRA 4N7IA 1S2BA 3VKLA 4LNVA 4ZXKA 4KWLA 2WO7A 2FZ1A 4I3GA 4LOSA 1CZVA 3KS7A 1VBA2 3WG4A 1V6LA 5FRAA 3K3NA 3P3NA 3CJIA 5FP7A 3VHNA 1JODA 3R6SA 1YCIA 5LCWL 2ZGRA 4GXLA 4ASMB 4KMQA 4E4SA 1H8TC 5JMCA 2AC1A 2IVJA 2PAMA 2XLAA 4XFIA 1XU1A 4MHUA 2DU1A 3BOWA 5C4WC 4HSJA 1D4M1 1QJU1 2BNOA 2RM21 5DAWA 3UL2A 1IG0A 2E51A 2VW1A 4Z92B 5LY1A 2ADDA 4LTAA 4S2GA 3H3LA 4XAAA 4EE2A 5I0SA 2XKPA 1CAUB 3W20A 1VALA 1A3KA 4Q0SA 4CDWA 4CTEA 3ZXLA 2C0ZA 1ND2C 3ILRA 1NOVA 3ETQA 1TME1 4JV4A 4LXLA 1GKBA 4RHV2 5C6CA 5JPNB 1NQDA 3O1TA 2W08A 3U07A 1UX6A 4M00A 2RS51 3DCQA 3AZXA 2W39A 1ODNA 5FLHA 1GWMA 1QNWA 2OQ6A 5A6QA 1NQJA 4QU1A 4CCDA 3DUIA 1G9BA 4GIQA 4GH4C 1WWYA 2OZ6A 1R091 1QU0A 2NQYA 3CO2A 2Y64A 5F5CA 4A45A 1FMD3 4CCKA 3JB4C 5C8CA 1YQ2A 3LCPA 2VZ1A 3AVRA 4RGAA 1W8HA 3D5OA 1N1SA 4LLFA 3AP4A 4BOWA 3NKTA 1JN2P 3RVHA 1Z7S1 2XBO1 2ZA9A 4XILA 4QPGC 3GHMA 4FI9A 2HKXA 1XE0A 2BV4A 4MX3A 1OVSA 4CDUC 2J1UA 5C7GA 1W2OA 5F5AA 2BUKA 4LBMA 2OPKA 1CJPA 3PU3A 1FYUA 2V73A 1PVC1 1RUC3 2Q0AA 3IAQA 5FZFA 3ZFFB 4K1ZA 2HWF1 4Q4W1 5IAVA 1AVBA 4QB1A 4D0QA 5HI0A 2YUEA 3HNMA 2E53A 2GNBA 4QPIB 2JIGA 2W1UA 5EFUA 1G9DA 2VQ0A 1GP5A 5E88A 4IV1B 3BPSA 4QXCA 3A23A 3B7MA 1UY3A 3THDA 1REEA 3IMMA 5AVPA 4HONA 2HWC1 2CU5A 2HBUA 4RQPC 3S30A 4GMP3 1ASJ3 2EIEA 1LGCA 2BNNA 2DUOA 2N7GA 4NHKA 2EIDA 5B4XA 4BQWA 1CIWA 4Q29A 3PLQA 1RHI3 3LEGA 4AYUA 3RS6A 3T2QA 2Q1FA 5BNPC 1H2NA 3K48A 4JGZC 5SV5A 1JU3A 1DP0A 3C3VA 3CJIB 3HAGA 3Q8CA 3DKWA 4FP3A 1VE0A 3VDDA 4AVSA 5IVCA 1MVQA 3Q8EA 3WNOA 5EJZB 3FL7A 4MV2A 1PO22 3RRDA 2ZEZA 4IEPA 3SQOA 3FUQA 4HKOA 1RUOA 1LRHA 2A6VA 4B7EA 2NPIA 5I0TA 2QDNA 3DXUA 1OOPC 4F83A 2R49A 4TTGA 1WBFA 1WCKA 2MEV2 2PLV1 5A80A 4Y1VA 4AQTA 4IE0A 5LBBA 1V00A 3EHKA 3HIFA 3BPZA 4CDWB 4AXOA 2OYZA 4ZS2A 1O4ZA 1UD1A 5DUVA 3THCA 3ZYBA 1LTEA 2PXJA 2AYHA 3CHXA 1RJ8A 5FAXA 3AKQA 5I8YA 2VO5A 4RR3A 2ZHNA 4DFSA 5CFDC 5L9RA 5CKQA 4CDXA 4ZKTB 2E7AA 4K8RB 2ZBJA 1UZVA 3JXSA 1US3A 1VBE3 4AOCA 4DXSA 5C8CB 5HV4A 3THPA 1BBT2 1Q8OA 1H9WA 2VXRA 1UYYA 4RL7A 2YC0A 1UOJA 3AYDA 1U5ZA 5CVRA 2WZEA 1RB8G 1M06G 2D97A 4YFZA 1NXD1 2D3SA 2R0FA 2PHRA 3JZVA 4AG4A 2XR4A 4LMFA 4GALA 3B00A 4LHKA 1W28A 2EVXA 1NAEA 3OYWA 1DFQA 3AXDA 3N3HA 2J1SA 4IEWA 4DY5A 1DF0A 3HT1A 1OPOA 2XB6C 4NIGA 3H50A 1U0AA 2J1VA 2FDHA 4I09A 1KFXL 4FQ4A 4LR4A 2WNUC 2Y6FA 3FFZA 1VBD3 1QJU2 2Z5WA 3ME2A 3AL6A 3UGHA 3VBOC 5AC93 3DXTA 1FV3A 4FPGA 1WLCA 2ZGLA 3HT2A 5IK7A 1BZWA 2V5YA 1XU2A 1KEXA 5C5UA 1UXZA 2W1QA 4P9JA 2CGPA 2ZAHA 1WMEA 3VKNA 4CCMA 5DN2A 2HEVF 1H30A 1XE8A 4ES9A 5FXWA 4IDZA 4P9WA 2A7AA 1Z78A 3BU7A 4H7MA 3E6DA 3VKMA 3MFCA 2BVBA 4ET7A 2OW4A 3J8F1 1H1IA 4UOJA 1HJFA 2NMOA 4YZ4A 4NVPA 5CB7A 1AYM1 1E5HA 3CEWA 3SC7X 1V6NA 4FT8A 4Q0PA 5IWFA 3AJZA 2VUJA 2C4XA 5FYTA 4XJ9A 3I3DA 5JVVA 4XQDA 2QQMA 1OVPA 1QDCA 3PIGA 2IXKA 3I3EA 3J26N 1NY72 3LQCA 2E31A 4Q1PA 4XF4A 2GC1A 4AGRA 5FOBB 1W99A 2WA3A 4RSUA 1W9WA 2EAAA 4HZFA 2BTVC 3MYXA 1H4HA 2D5FA 5E89A 1DLCA 5KHGA 5IVFA 3AFGA 1KDMA 3VKFC 2UWAA 3VDBA 4A6OA 4BK5A 2VNGA 1RMU1 1SFNA 5AFEA 5FK7A 4RR3B 1HV1A 3WW4A 3TEYA 1SLAA 2VUDA 2PA7A 4CDXB 2Q1MA 1PO13 1ULFA 4TLFA 5FZOB 1G6NA 3PTYA 5JMOA 5KHIA 1JHJA 3C7HA 2QDRA 3DECA 1Y9GA 5IW0A 4P9IA 2QTWB 2VOKA 4QU2A 3MICA 4MADA 1W6MA 2WLPA 5DQ0A 1LOFC 3AC0A 3HBZA 2Z69A 2OZJA 3KF5A 2ZMNA 3UGGA 3PU8A 4CXXA 1S55A 2JEMA 3WP4A 1IS4A 1RUF1 1AXYA 1NLRA 2VMCA 4FSJA 2C9KA 2W87A 1GQHA 2Z4FA 2R061 1DLLA 3MIGA 4IV3A 2VG9A 3TRSB 1VJ2A 3E5XA 4ORFA 2JKBA 2ATFA 1WGPA 1MS3A 2FD8A 4QWNA 1PNGA 1ND2A 1WD3A 4BXSV 2H6BA 2YPDA 4Q0UA 3USUA 4GJZA 4MXVA 3THTA 4RYDA 1YFWA 3PVEA 3M4FA 1DYOA 3WDYA 4DMIA 5F7UA 2FDIA 5JI9A 1AL21 2QQIA 1U12A 3S5QA 4LKFA 4L9BA 4OHWA 1CN1A 1I5ZA 1GNYA 2YGLA 3MLLA 4IL7A 4QX0A 2KA3A 4LO4B 2D6KA 4NIIA 4AEDA 5JPMB 5KC6A 2ERFA 2A3WA 1K5MC 4PJYA 2RS33 1FNYA 2ZGPA 4DNYA 2WL1A 4KNCA 1YLLA 2WIIB 4Z82A 5F8PA 5ACA3 4X8NA 5EJ3A 1XYPA 3R05A 4XEZA 2JDPA 2C1FA 3V65A 4IGPA 4OZOA 2CDOA 2XVKA 4Q4V2 3H3ZA 1QXPA 2PYTA 4J1WA 4COVA 4QPGA 3KCXA 4FAHA 3U14A 1XNTA 2Q1ZB 2ZTNA 3GZAA 4Q4Y2 4BXFA 4YW6A 4S2DA 1BXHA 1JOBA 3RMXA 2ZGNA 4ISQA 4LITA 3FLRA 3OBRA 4XFGA 4R52A 3JD72 5FZIA 5GZFA 5L9BA 4AI9A 2JE7A 2VULA 5J09A 3QOPA 2R1DA 2VW2A 1QJFA 1UU6A 4I0BA 3NNJA 1UMHA 2VJXA 3DPRC 1W3XA 4M3CF 4MHRA 3S7IA 3ZO0B 4TSVA 1V9U2 4V2WA 2IC1A 3M3IA 2VNOA 3VBUC 4CCLA 1QOTA 1IOAA 1J59A 1VMJA 2JE8A 3RZHA 2I2SA 4LKSA 1ULEA 2A6YA 1UYXA 3ON7A 2WWJA 5H9PA 1QNYA 2JDAA 1MS4A 2DUPA 5FMDA 5FXXA 1JW6A 4FQZA 3IBMA 4W65A 4ZZ5A 3WF2A 1C8NA 3W9AA 3OUIA 3ZYGA 1GYKA 1DDLA 3KV5A 1IGOA 1W6MB 3LPFA 4FFIA 3DL3A 4MGTA 1RUJ1 1V6JA 3WDTA 4FCAA 3D0JA 3ZKUA 2W0XA 4Q0QA 4U36A 1APNA 4IXLA 4EWEA 4WBBA 5J48A 2W46A 3BTZA 1SG3A 4E27A 2ZEWA 1ND3A 1OOPA 1WBLA 2QZ3A 4IV3B 4NHXA 4NWWA 4YNIA 4FFFA 3J8F2 4WV8A 4YG3A 2HLEA 3WINE 2GU9A 4BCUA 2K46A 4BQXA 5J37A 1NKGA 1LOEA 4HKLA 1ND2B 3ZSLA 3WVJA 3ZN5A 1MQTC 1UMZA 3USUB 3N9OA 4BE3A 1PMHX 3VHPA 2VM9A 1S2EA 4GQ7A 1D4M3 4LBQD 4O65A 1SBEA 1K3IA 1SLCA 2V5DA 1DU3D 3ZYJB 2WLQA 3UKTA 1PVXA 1UZWA 1VIWB 4BM8A 2WJSA 4OQ8A 5FDBA 4FTSA 2PHWA 4YGCA 1J58A 5HCHA 1EPZA 1GU3A 2B9VA 3FE5A 4AEDB 3RG0A 4CPBA 3BTAA 5GLUA 1MEC2 3I3QA 1TME3 3N7MA 4AHYA 3INAA 5JR7B 1S0JA 2GNMA 4FFHA 2B5HA 3IWZA 1JZ7A 2RS53 4EZ4A 2JG8C 3R0RA 3TNQA 1W6PA 5FO9B 2XH6A 4Y5TA 1K12A 1LESA 3JUUA 4QKBA 1RUI1 5EJ1B 3AKRA 4QB6A 2XGXA 3FMGA 1GWLA 1O3TA 3FHAA 1DGWA 1F2NA 2IVIB 2Z42A 1XRUA 1S0GA 2AENA 3I2KA 1UY4A 1XNDA 3HNBM 1H8VA 1GLHA 5FY4A 2WS91 5HXMA 1W8OA 2JJ6A 2AEYA 1G8WA 4OVEA 4BHPA 3BKZA 1MACA 4N90A 2O8OA 5T5JA 4S2HA 4CCEA 3AP9A 1MS1A 1XSRA 1UY2A 1U5XA 1Z7S3 1VAKA 2XBO3 1HXS2 2PAKA 4XZPA 4NAMA 4OULA 1OC1A 2DTWA 4Q0VA 5FUPA 2WT1A 2XKOA 4UXAA 1W90A 2Y38A 4L2NA 4A2UA 3WP5A 1ST8A 1PGSA 4OI1A 3VBOA 5CBLA 3IDEA 1PVC3 1LEDA 2D6LX 2XJTA 2GN3A 2QQJA 2HWF3 1UPIA 4Q4W3 4GKYA 4XW3A 3F95A 5LBFA 3MBWA 2BFUL 4XHBA 1OA4A 5C3SA 4BQYA 4BMBA 3O7OA 4UFLA 2D44A 5FJKA 3MHZA 3UGFA 4BMEA 4XYXA 4Z8BA 5LEKA 2X5IC 1FI2A 3WDVA 3ZR6A 1PZ8A 1WKYA 2HWC3 1WMXA 3NV3A 4LBKA 3WCSA 3HMYA 5A3TA 4XDPA 2WA4A 1TMF1 4LBNA 2B7YA 2RR11 4AI0A 4AI8A 4P5HA 3AKTA 5A6XA 3VBFA 1ND3B 1OOPB 2F4PA 3GJAA 5I93A 3KCYA 5CKNA 3F2ZA 4NHLA 1O4TA 1S0IA 5LA0A 1YYNA 1AX1A 3TN92 1V0AA 3K2OA 2IXLA 3POBA 4BQ2A 2ZX0A 1RUH2 4EN7B 1XNAA 3C2UA 3BI3A 2VZOA 2TNFA 4YYOA 2PLV3 4LEJA 1LGNA 4N43C 2Q5TA 4YM1A 1NE6A 5J7MA 2X10A 2NZ9A 2VQTA 1HW5A 2VL4A 3QACA 1O5UA 2GNDA 1AZDA 4IEVA 4IEUA 4PF5A 4UBHA 2ARXA 3SNMA 4YVSC 1RUG2 3LSEA 2RMU1 1W6PB 5A3MA 2BQPA 4PI2A 2WZR2 2YBPA 1C4RA 1LOFA 2G4IA 4LIUA 1ENSA 3WDUA 3QCWA 4PCRA 3S5AA 2QBXA 4FPFA 1RUD2 2WR9A 1IKPA 2ZAAA 1PK6C 5FTTC 4NROA 4WM8A 4HFSA 2GC0A 2J1TA 5F6KA 1CD3G 1NLQA 5LWBA 2J1AA 2C5DA 3FLPA 5A7QA 2WNVC 1JYTA 4AHXA 3ZMOA 3BIEA 3LA2A 4FOQA 1VBA1 4CEYC 4WM7C 1T6BX 3H1WA 2VBDA 2XDVA 4I30A 4XJZA 5E8AA 5A7WA 2J7MA 1FXZA 2I45A 3AP6A 1RTVA 2WC2A 4MYEA 2FCTA 4JGYC 4KG8A 1LU1A 1K5MA 3U75A 3AMMA 1CVNA 1W6OA 2B39A 2GH8A 3PVOA 3OGJA 4MUVA 4RA0A 3VD9A 1UOFA 4XQ4A 1DGWX 2JDKA 1E57A 4L0PA 2TEPA 5KXDA 5CG8A 2VCBA 3CKHA 3NWKA 4MG2A 4AI2A 1SCRA 1JTZX 3AVSA 4QX7A 1EAH2 4RHV1 3ZFGC 3ASIA 3WNMA 5I8TA 2FBEA 1UY0A 4YVWC 1S1AA 3VBFB 2GP5A 3NV1A 2YV8A 3SEEA 3ATGA 3LF7A 2WO1A 3AX4A 3J7NA 1VBB1 1AYM3 3KSCA 1KGYA 3OEBA 4GD4A 1DIWA 5F6LB 1KS4A 4HXCA 3ABZA 2DVFA 5IJRA 5FUIA 3NNLA 1C8M2 3NSTA 4GWMA 1W39A 3M3EA 1SMVA 1LHVA 2EA7A 5FP8A 2KD7A 4A44A 1ZBA2 4XJWA 4CP2A 1REDA 2NYYA 3BGAA 2BNMA 3HNYM 1XBFA 3V0AA 2PQSA 4Y5Z0 3K4ZA 4JAAA 3KV9A 2P17A 1SLLA 1JOPA 1V6MA 4JHTA 1XNKA 2OKXA 5BNNC 2JDHA 5J98B 5F5IA 1RMU3 2R32A 5FK8A 4OHZA 1W8WA 3ZYIB 2WN2A 3D6EA 1REFA 3I4IA 4GB32 2NLRA 4JVAA 4UFIA 4XVHA 1GZ9A 3OTFA 1PMJX 3SMHA 2DBNA 2TUNA 1U5IA 3OF1A 3R4SA 5FPUA 2RJKA 3C7OA 3IKWA 2XJPA 1MZ6A 2CAUA 3GDBA 1O5LA 2BYVE 4WM8B 1Y3TA 2P3YA 4B1LA 3B69A 1LR5A 3WD5A 4LQRA 3NJVA 1OA3A 3HJRA 3PURA 1NZCA 1KD7A 3FHQA 4CZSA 4FBFA 2BWCA 3Q8BA 1NA1B 1RUF3 1TMF2 2HWD2 5JXGA 1PZ9A 2YMZA 3IPVA 2D6MA 3B9CA 1N1VA 5FWJA 2H6CA 2R063 5HV0A 2YZ4A 5JSPA 5LW9A 5A7WB 3RJRA 4CXWA 3P6BA 3FX3A 1ULOA 3LOIA 4LIVA 1X50A 3B02A 3CQOA 1Q5OA 1PO21 1GZCA 3CF6E 1JUIA 1S0CA 2X8KA 4TN7A 4YW3A 4CU7A 5IT6A 3UYJA 1W6OB 3LE0A 1EV12 1W04A 3O0XA 1AL23 1WA4A 2GSYA 3K51A 3C7GA 3M1HA 2MEV1 1BQPA 3IZOA 4RS5C 4CA9A 3VB9A 3ZXDA 1XNBA 3KD4A 2GP3A 1LOBA 4QX1A 1ACCA 3IDAA 1BJQA 4IUGA 4EN6B 4IEXA 1W3VA 4NAOA 1ZZBA 4KI5M 3VZKA 3V64A 1OFSA 5IK8A 4XC9A 3SCGA 5JI7A 1IG3A 1S0EA 3POGA 1NLSA 2RG4A 5M0TA 3BYWA 5EQUA 5EXOA 3W58A 4TYSA 1BBT1 5EHDA 2Y6HA 3LA7A 4PIYA 2OPWA 2P3IA 2WAOA 3ZSJA 4KGQA 5L9VA 1SBFA 3ZIXA 2XJUA 3BB6A 3MUY1 1YFUA 2CDPA 3LOBA 4QGMA 1Y43B 3V0AB 1JYXA 1A78A 2HWB1 5DZEA 1YFYA 4Q8LA 5FPXA 5FXVA 2ZX3A 4ISRA 5GZEA 3EO6A 4PDWC 4CU8A 1GV9A 1KJLA 2D6NA 4DUXA 2D5HA 1BKZA 1KFUL 2XUMA 3NAPC 3WY6A 2WT0A 4IE4A 3TBDA 1YXWA 1URXA 2QQKA 3NQHA 4MVTA 1AJOA 4QM8A 1R64A 4E2SA 1COV2 2YDEA 1W9TA 4D7TA 4QXBA 1AF9A 1ENXA 2VY0A 3GM8A 3NV2A 2UU8A 5T54A 3H7YA 3UK9A 1QMJA 1ZRDA 3ZFEC 1AXZA 1R1ZA 3KT4A 2JE9A 3N36A 4B3NA 4C91A 1O3QA 1RUJ3 4YG6A 4BK4A 5HCBA 3VHOA 1VRH1 2YFUA 4QXKA 4XBLA 5DDJ2 3WLUA 1QOSA 3I2HA 2WZ8A 2GH2A 2F4LA 1AJKA 3IPVB 5JZGA 5KBFA 2NM1A 3NJZA 3PUHA 4Z07A 4L99A 2HH9A 1ALYA 1DGRN 1O59A 1DCSA 5IFPA 3A22A 4XF3A 1NUKA 3LSDA 1VBB2 1O8PA 4N43A 4ES8A 5T5PA 3WNLA 3U37A 1H2LA 5FY8A 4GAZA 2VOWA 5A3UA 2VUAA 1FPN2 1IPJA 1WCUA 3ZXKA 4Y33A 1OXCA 1XQNA 5CU1A 4C0BA 4MOAA 4YGBA 3S7EA 1AR91 5AFBA 2VQUA 1NY71 3AZYA 1LOAA 4Z2AA 3M7AA 3BIWE 3HQXA 4BLIA 1RIRA 2DF7A 5A70A 2VCMA 3A4UA 4DIQA 1G7YA 3D0SA 1QY4A 2RS13 2YY1A 3OGRA 4XFFA 2UYAA 5FLIA 1PMIA 4ZXEA 3VBSB 3BU0A 3KGLA 2A73B 1PK6A 2ZZJA 2EXJA 1AR82 2WO3A 1LOGA 3WNKA 1D7PM 2QNKA 4XFHA 4R9AA 1RUI3 3AMHA 4HBNA 4O61A 3ZXEA 3VZMA 3VDCA 2JENA 2IXHA 1UZYA 2EAKA 1CONA 5DAQA 4FPJA 4QX8A 2W3JA 2WS93 1O3RA 3FWEA 1Y7BA 1FV2A 1NCRC 4DB5A 3MIFA 4CEYA 3B5LB 1DQ5A 3ZMNA 1GMMA 4K40A 2ZGOA 4KBBA 2VE1A 4FTBA 3VZLA 2HEWF 2QQUA 2J22A 4CDQC 2XJRA 2XONA 3AP7A 5LRRA 1FATA 2R072 1RUE2 1W9YA 2VZTA 3APBA 4NWVA 5B4NA 3KV4A 5EYXA 4JDNA 3S0MA 5FQ0A 2FZ2A 3NJXA 4JRAA 2X09A 4KQ7A 1HRI2 1GANA 4OZXA 4M0NA 1HRV2 3O1UA 2DCTA 2WN3A 1BCXA 1AX2A 2HJIA 5C9AC 4HLTA 2HEYF 5EPAA 1PGW2 3GGLA 3JU9A 4NJ4A 2ORXA 4YVWA 4QDSA 3USSA 3TEXA 1J3PA 1PIV2 2ZS6B 5EIYB 5FO8B 4YM2A 5FYIA 5BV6A 2WFPA 2VTFA 5CIRA 1WA6X 5F3GA 5IVVA 2RR13 1X7NA 4KL1A 2CHHA 5BNOC 1TE1B 2NN8A 2QVSB 3NMBA 4UAPA 1F4HA 4P5YA 5JZGB 2BU9A 1BEV2 1QXJA 1CPNA 1BK0A 1N3QA 1NZIA 4Q4V1 5F37A 1HQWA 4JQTA 1MS9A 2YU1A 2LM3A 4V2VA 3UESA 3M3CA 3EMRA 4QPYA 3RSJA 1JYIA 3RDIA 1A6CA 4OFGA 1ZX5A 1V6IA 4Q2FA 4Q4Y1 4CEWA 5T52A 1E5RA 1ZZ9A 1OBNA 3I3MA 1GQPA 4H2AA 1UKGA 4LK7A 4OHXA 3PTRB 5KXEA 1CWPA 4KWKA 3JD71 1K5JA 1H2KA 1LECA 4LK6A 2K2SA 4ZU5A 5D1IA 4FPCA 4LT5A 4O9GA 1S2KA 2GZWA 2HWB2 1YUDA 2GDFA 4LBQA 4CE8A 3GNEA 5FXZA 4QX2A 1V9U1 4NIDA 1PK6B 5JWPA 1NCQC 3P5BA 4P9LA 2RMU3 5EWSA 3H8RA 5CG9A 3M3QA 4FXKB 5FZCA 3LEIA 4FOWA 2O1QA 2XUEA 3ZN6A 1R082 2G9GA 2YFZA 3I2JA 1X9PA 1Q8SA 1R1A2 4IW3A 1YRZA 1NX9A 3SISA 1V6KA 2WT2A 3NNMA 4GZ9A 2Y6KA 4LE3A 2DU0A 5K9YA 2JG9C 5D8AC 3AK0A 3IDBB 1OLME 4OCTA 1OSGA 1H1MA 2WSVA 1VRH2 3RWKX 3K75B 2IFWA 2QKDA 4D8MA 2ZPXA 4CCOA 4P02B 1HV0A 1B35C 3OBAA 1QDOA 1VBA3 4M3CA 5C70A 3GBFA 5JDBA 3VDDB 5C8WA 3N7LA 2ZHMA 1HN1A 1UCXA 3B9IA 3U1XA 1RXFA 1XC6A 2VMEA 3POFA 4INDA 1IS3A 5CAZA 2P34A 3GBWA 4QKDA 3POJA 4EN8B 1OHFA 4N53A 4QQPA 3HQUA 3MW3A 4NPRA 4BQ4A 3ALQA 1TNFA 4YVWB 4YSFA 1YC61 4KU8A 3M70A 1MR5A 5ERLA 5K7PA 1AR92 5ABJA 4I02A 1OF3A 3KGZA 3T3YA 4HVRA 2Q8CA 3J7MA 3N35A 1MEC1 4ATEA 5F2WA 4RHV3 2ES3A 2ZGQA 1SDWA 3LGRA 4C0HA 2VVDA 1GNZA 2VU9A 1ZA4A 4MXWA 1YI7A 1X36A 2QQNA 3ZSEA 3AKSA 2MNGA 2J1RA 3M3OA 3ES4A 4ZONA 3J7LA 1Q3EA 2LRPA 4YGEA 3E5UA 3WX5A 1SHWB 2W92A 1VR3A 2FDJA 4CEWB 5C3QA 5F5QA 1G9CA 2VVEA 4OYUA 2LUWA 2P5BA 2UWBA 3HN3A 4A6SA 5FR3A 4OUMA 2YROA 3C7EA 3O5SA 3VL9A 1ZRFA 1H8TA 1HXS1 3U11A 4PIXA 4D6QA 1JZ2A 3GBGA 1CX1A 3ZPYA 2VZQA 1QJY2 4PQ9A 4COUA 5C4WA 1IQAA 3H1MA 3OYWB 4XXAA 1OKOA 4Q4X2 2UY8A 1CAVA 4Y1XA 2DBIA 1UO9A 4XUNA 2XLGA 2ZEYA 3POEA 2PMWB 1UZ0A 2P37A 4A41A 4I0AA 3MIDA 4HSLA 5EYYA 3PHMA 3T1MA 2DCZA 3ZN6B 5FMBA 2D6OX 2RDNA 2RVAA 3GALA 3FFQA 1VBC2 2YG0A 3VBRC 3WG1A 1GP6A 2ZACA 3D82A 5CA6A 4ZHNA 5IATA 1STMA 4AFBA 1W2AX 4GH4A 2JWPA 3WR0A 1FOD2 4NRQA 3POIA 2A6ZA 3VBHC 5LBEA 2QFEA 1C1FA 2D93A 2V09A 4B4PA 3UNPA 1LCLA 4A4AA 1YO8A 5FV3A 4K21A 5L36A 1US2A 2ORZA 3ACGA 3PJQA 1LULA 3I2OA 3WV6A 1PO23 2VCCA 5C3OA 3TN91 4PQQA 2IWGB 3L2YA 2VMFA 4CDUA 5LA1A 3SHRA 1XXNA 3HD8B 4N53B 1DQ6A 5ANQA 1RUH1 2WABA 1SEFA 2A71A 2YC2A 4HKWA 4FAGA 1DZTA 1AYN2 4B29A 1W2NA 2DFBA 3NJYA 2MEV3 3IMNA 4MLOA 4LKEA 5A7NA 5ABJB 2Y6GA 4AGVA 5DAXA 4ZZ8A 2ENRA 3ZKYA 5K0UC 3AZWA 1Q8QA 2R042 1M4WA 3FUOA 2EF6A 5LY2A 4JDMA 5C33A 1XYOA 3DEMA 5FY0A 3E1F1 1SPPA 3ETPA 1X8EA 3TYJA 3RZGA 3T2PA 3H9AA 5FYUA 1RUG1 4XHXA 2GN7A 4MXWB 2JD9A 1I5PA 2WZR1 4RQPA 4META 3BALA 4IEOA 2ZKLA 4K6BA 2YYOA 4B7KA 5IHRA 1RUD1 4CDQA 4BQ5A 3O14A 1UKRA 5D21A 5IVBA 2SBAA 1TG7A 1BBT3 1L3JA 3WDWA 5JOZA 5BNPA 3VUOA 4JGZA 4XURA 1W06A 4UFHA 3WW3A 3SKVA 5FP9A 3ZIWA 4I2OA 3ACIA 4XTPA 2VECA 5FYSA 4TWTA 1H8TB 2AREA 1OMIA 3OOXA 1YFXA 3D8CA 3VD7A 1JBCA 2XXZA 1CX4A 3AM2A 4FVVA 3W21A 4Z2WA 2DVDA 4RN5A 5C4WB 5HCFA 2RJ2A 3WG2A 2VBBA 4BQ3A 2VR4A 4PLNA 2H0VA 1AUYA 1WW4A 2JECA 3P1IA 4JKLA 4XAEA 5FZLA 1D4VB 1EY2A 4LO5B 4COWA 1QH6A 2P3KA 4LA3A 5FPAA 2J42A 3LZZA 1OUXA 1YQ5A 1QJEA 2VW0A 1Y9QA 2CWSA 2W1WA 3AP5A 3T08A 3WEZA 4HK9A 3WNXA 4ASKA 3GZEA 1GUIA 3KMHA 1W8ZA 1QJU3 2RM23 3OGSA 3N4MA 3OPTA 5A3PA 2XHNA 4AEMA 4FPOB 2P6HA 1CZTA 1H4GA 1QJX2 5K8SA 1AR62 2WYSA 2GAUA 5CFDA 3O0VA 1UU4A 1JU4A 4GH4B 4NIAA 5H9QA 1UMIA 3T4VA 5FP3A 5IK5A 3ZXGA 4KBZA 2XOMA 4JKKA 1EAH1 1GOHA 3WF4A 3KF3A 3K3OA 1NYWA 5FZ1A 2DFCA 1OQDA 5FZ4A 4XJUA 5FKBA 1ZRCA 2WWUA 5F1RA 4EYUA 1AR72 2OT7A 2YB7A 2EICA 1R093 3AL5A 3CJXA 3N7KA 4QPGB 4NOTA 2XPJA 1JI6A 5A1AA 5GLVA 4LORA 2XQXA 1ZBE2 4CDUB 2P1BA 3IM0A 1UU5A 4UWDA 1VP6A 3EJKA 1C8M1 2HYKA 4JHZA 3O1OA 1NCQA 4IEYA 3E97A 3WCRA 3AYEA 1RVF2 3T0BA 1ZBA1 4IE7A 4JRLA 2CSGA 4Y20A 5L73A 5T5LA 2GC3A 4Q27A 2BERA 4XJAA 1DGLA 5DG1A 4BIFA 4F8AA 2WNUA 3VN4A 5JLVA 3NL1A 1BMV2 4OMDA 3LIGA 3SH4A 4L11A 1A8MA 3MV11 2IUWA 5H9SA 3WQ1A 3LEKA 1W8UA 5CNAA 2PN5A 2UY9A 2E7TA 1LNSA 5T50A 2JG9A 2HWE2 4RQPB 5T3NA 3ZN4A 4EJRA 3CZJA 4PF1A 5CFCC 4XUQA 4PI0A 5A7PA 1UYZA 4GB31 3KZ4C 2QUOA 3AZVA 3KB5A 3ZFFC 2PHDA 4HT1T 4FTEA 3PUQA 2ZHKA 3MF9A 4IEZA 4Y3OA 4YFWA 3SITA 1F5JA 1OA2A 1UXXX 5BNPB 4JGZB 4FPKA 1PHMA 4QPIC 2WFF2 4LHSA 1QQP2 3WG3A 3T2OA 3LB9A 3MI8A 5F3EA 1RC6A 4IV1C 5HCAA 3MEPA 3POYA 4DEQA 2HWD1 2BW8A 2FCVA 3H1YA 1G86A 2L9LA 5FZBA 4IGOA 2DVAA 4LO8A 4BDVB 3VD4A 4AE2A 2XQRA 4C1WA 1NXMA 4UW4A 3PDQA 4M4RA 4P08A 5FZAA 4A7ZA 1H0BA 1W8TA 1HLCA 4FP2A 2WBKA 3EYPA 2ZCWA 4FPHA 3CJIC 5FZ8A 4YLZA 4XDQA 2BPA2 1WCQA 3FBMA 1EV11 4I0WB 3AZZA 4Y1UA 3MIHA 3ZDSA 3MV01 3FLTA 4MGSA 3DYMA 5FZHA 2A1XA 1XNCA 3VV1A 5JOXA 2ADEA 3AFKA 5GJ6A 2OA2A 5IVEA 4YRDA 4UYBA 3JBG2 5CFDB 1IS5A 1CIYA 4YG0A 1O3SA 4Y4RA 5FBZA 1MZ5A 4HETA 5F2SA 4Y1YA 1CPMA 5FZKA 5A1LA 3OUJA 4AQ2A 4CDWC 2FDKA 5FWEA 4X8PA 1RYYA 1KRIA 5LK7B 4XBQA 4Q4V3 3UV9A 4BPZA 3GF6A 1F8VA 1A8DA 3R4UA 4ATFA 3WHTA 4Q4Y3 4A42A 1W2UA 4GJYA 3CLPA 2XWBB 1NCQB 4B4QA 3KHCA 3JD73 5C8CC 4Y20B 1HIXA 2RDRA 1JYNA 1QGLA 2C26A 2FHRA 3K77A 2WNUB 4FPYA 4AQ6A 1AHSA 2ZX4A 4CU9A 1UIKA 1W0PA 1JYWA 3PVNA 5HXVA 1V9U3 1W6NA 1XE7A 2VMGA 3K46A 4M01A 3VBOB 4AGGA 5JSOA 5DXDA 3ES1A 4Q26A 3O1RA 1LJ7A 1YHFA 2JG9B 3AYAA 5FPBA 3I97A 5KHKA 1POV0 1VMHA 1WMFA 4EWDA 1COV1 2NMNA 5FZ3A 1KQRA 3L2HA 4YW2A 5FZ0A 4QAWA 5C71A 1Q8VA 1HQLA 2QZ2A 1YJKA 3KV6A 3IT8A 4UFKA 2B46X 4AFAA 1Z0HA 2WQ8A 4QGLA 3ILNA 2UYBA 2WKKA 4YW1A 2AGSA 5C3PA 2AUYA 2W5FA 3KWVA 4E2QA 3VLBB 5DDJ1 4ZU4A 4DO0A 2E32A 3QBQA 3VGIA 1OURA 4D94A 3AKPA 1PGL2 2YBSA 4PT6A 3SH5A 2XJQA 4DOUA 2ETEA 2HYXA 1FMD2 2ZGMA 2VZSA 1UL9A 2MHFA 3J8F3 3OPWA 4CCCA 5A32A 5F9TA 1N3OA 1DQ1A 1RINA 2BZDA 5FYZA 5K0UA 1J3RA 4OI2A 3WP3A 3DPRA 3ENRA 1JS9A 1FPN1 5G05L 4QT6A 1SLIA 4QB2A 4XUPA 3VBUA 3BTXA 5A7SA 4DXRA 2YU2A 3PUIA 2SLIA 2A6WA 4LPLA 4HPKA 4LOTA 2E26A 3MFAA 4OLLA 4OHYA 4RGKA 2PHLA 4NMIA 4HVQA 1MEC3 1RUC2 5GALA 1C5HA 1OH3A 4G3YC 1JZ5A 1LOCA 1QH7A 1ULCA 3WDXA 2XMLA 1AR81 4HL0A 3AJYA 1CR7A 3OGVA 3B01A 5KR7A 4IESA 3DF0A 5LA9A 5SV8A 5IYYA 1HB2A 4CUGA 3ZVXA 4IGQA 4NUBA 2FMYA 5IK4A 3PMSA 4MZUA 4AVAA 1WCSA 3U10A 4JZRA 3RZMA 1S0FA 1HB1A 1HQNA 1ASJ2 1OLRA 4CDXC 3TNPB 3NVCA 3B94A 3HWJA 1RHI2 1VLNA 1HXS3 3VDAA 5I8SA 1MQTA 1O4YA 2W1SA 4JX0A 2R071 1E5IA 1RUE1 3RYKA 1ZRIA 4N9IA 4AFCA 1W6NB 4R4XA 4YZ1A 3RPQA 4XFAA 5EZWA 5FFOC 3SH3A 3WT3A 3ZYRA 4BH9A 4YZ2A 5BNQA 3RZLA 3WHUA 4WZCA 1HRI1 3WP6A 3HOBA 1JZ3A 1BHGA 2PHUA 1SZBA 1HRV1 2D98A 2DVGA 3EB7A 4N8MA 2DVBA 3BOPA 3LPGA 4G4FA 1K5MB 2VCAA 3T4HB 1JZ6A 2P2KA 1PGW1 1Y4WA 3U4XA 3MPPG 3POWA 3WOGA 2JG8A 5DUXA 4HN0A 1PIV1 2RHPA 5FYHA 2K0GA 4E2GA 5ACA1 2CY6A 3UJQA 3SXWA 1DHKB 4R9DA 4NHMA 4YWAA 5DG2A 4XUTA 2W68A 3O1SA 5KC5A 3H8UA 4TLGA 4CU6A 2JDYA 1WLTA 1F31A 2OX0A 3ZLIA 1BEV1 1U5YA 1VBE2 2C24A 1W9FA 1XYNA 5A32B 3RFRA 2ET7A 1YWKA 3HPNA 3T1LA 4AI3A 3WF3A 2VD7A 5K0UB 4FOVA 4P00B 1JH5A 2D3RA 2RE9A 3TN93 5A3LA 1IQDC 3DPRB 1HN0A 4GULA 2Q8DA 1H6YA 1RUH3 1WMDA 1ZVFA 5IAXA 3PJYA 3NKGA 3VBUB 4S2FA 1DQ0A 3SEPA 5CFCA 5FY9A 4L8QA 3IIAA 4K20A 5L7OC 3KCCA 1UWWA 3EXUA 3LDKA 3AXEA 1BVP1 3I2FA 5DUUA 1SFYA 1LODA 1XPWA 2IZWA 3JB8A 3QH6A 1RUG3 2X5IA 5JIUA 4LBOA 5FYYA 1VBD2 2WZR3 3MUZ1 4H55A 3SCHA 4B1MA 1UW8A 4LUKA 1VAVA 4IV1A 1OD3A 1R081 1HKDA 5K4LA 1OH4A 2VZVA 3MW4A 4QDRA 5AC92 1RUD3 1R1A1 2W9XA 5CZKA 3I54A 3H8XA 2BGCA 3PMEA 1UAIA 1PZ7A 4CUAA 2V4AA 5KHJA 4ZU7A 2DWRA 1J1TA 1WW5A 2LALA 3MIEA 1OPMA 2OXBA 3PNAA 1MQTB 4Y5SA 2QCSB 3CZUA 4A3XA 3TEWA 4CVUA 1UNBA 3EQEA 2QQPA 2LTNA 4I01A 5DUWA 4XTMA 2Y0OA 4HN1A 4CCNA 4XPVA 4BB3A 1ENRA 3OCPA 3D4KA 2BGOA 1H2MA 2OUJA 5FZ7A 1MS0A 5T5OA 5FMOS 2LW8A 3VZJA 4AFMA 3RZKA 4IV3C 4LKDA 4MSVA 5GZCA 2D43A 4BZ4A 3ZYHA 1PM7A 1F9KA 4F7ZA 4AQSA 4C1XA 2X29A 4QHOA 5T55A 4YVSA 4UI9L 2JG8B 3E6BA 4K1YA 5GZDA 4BISA 4CXYA 4JCKA 4HG6B 1D0GA 3D3AA 3Q8AA 3VHRA 5LZ6A 1ZYBA 5I0UA 1EAH3 3LKJA 2GMPA 4LBLA 3ZDVA 1EUUA 4AEDC 3OG2A 3H7JA 3KM5A 3E5QA 3N7JA 4Z1VA 1PO12 5CADA 1VB4A 3O0WA 3UJOA 1LHUA 2QQOA 4DPNA 3C8XA 4P9YA 5TSWA 1HJGA 3GCWA 1AX0A 1NE4A 1F15A 3AMPA 1K45A 3GZTB 5G04L 1L7LA 1PNFA 2AH2A 2WNVA 2XLFA 1WW7A 4BWOA 2WYFA 3T30A 1Q8PA 4A7KA 1IZ3A 1C8M3 4WM7A 4BJ0A 4XIOA 3OD0A 1GFF2 4NE9A 5FZMA 1CAXA 1QXRA 2R16A 1ZBA3 5CFCB 4CYDA 4OQ9A 1VMFA 3GCXA 1LB2A 1H6XA 4JGYA 2CV6A 1QJY1 3WSOA 5A6ZA 2I74A 5JOWA 4Q4X1 2VGDA 1Y9MA 1BLZA 2X5IB 5GM0A 2E9QA 2JDMA 4DRRA 4R9CA 3OBTA 2CGOA 2IXJA 1XOYA 4GB33 1YIFA 4IQPA 4O7XA 4QX3A 5JXJA 3DN7A 4GWJA 4E4ZA 1E5SA 1VBC1 4IE6A 1NG0A 4PLOA 2P4EA 4C90A 3ZFGA 4RGGA 2A75A 1Q56A 1TEIA 2BWAA 1VRBA 4M0HA 1LHNA 1OD5A 4XF9A 2AACA 4JKMA 2RS32 1PX4A 2DTYA 2Y8KA 1SLTA 2A3YA 5ACA2 1S0BA 2GMEA 1G9FA 3NW4A 1FOD1 2JB8A 2ZGUA 4DXTA 2I07B 1TMF3 4EN0A 2HWD3 3G7DA 2PTMA 3IB3A 1OF4A 1T2XA 1OKQA 5A7OA 3HR9A 4NO4A 3ST7A 1ZNPA 3V56A 1POV1 5C3RA 4XMAA 2G9ZA 2Y34A 1SQ4A 2R30A 5L19A 2ILMA 2E63A 4KWUA 3O1PA 5FREA 4N43B 5EP9A 1I1EA 1ND3C 4H3WA 2CWMA 2E6VA 4URTA 1PGL1 2KXLA 5HPOA 3ECQA 1DQ2A 1EV13 2WSUA 2CYFA 1AYN1 3KT7A 3Q9OA 4YVSB 4AK3A 1WLDA 4D7YA 2P6CA 5BNNA 2VOVA 4QM9A 5KXCA 4TXWA 2Z79A 1WZXA 3MLJA 3GXUA 4GMP0 5BPXA 1XSQA 4CP0A 2ET1A 4EWAA 2R041 4QKNA 1W9SA 1UY1A 4EROA 2Y26A 4AW7A 2Y0IA 4Y24A 3HVDA 3O1VA 4UFMA 2QQLA 4AVCA 4JTOA 1DYPA 5FZOA 2NP0A 4FPEA 5C5TA 4YGDA 2UWCA 3ACHA 4QQOA 4W6XA 1GP4A 4AF9A 4QMAA 1O7FA 4WVZA 4I3PA 4Y26A 2ZHLA 4DEVA 5J96B 2WNVB 1VB2A 3MPBA 2EXIA 3ZPOA 3V0BA 1GBGA 1UZZA 1T6GC 2WNEA 3NRUA 4CEYB 4WM7B 1YQCA 4HANA 2W52A 1D2QA 2D6PA 4PLMA 3UKVA 4LHLA 1CAXB 3KVBA 1FAYA 2OS2A 5BY5A 1L7RA 2ZX2A 4JGYB 2LS6A 3T2TA 2R1BA 3G6JB 3ORJA 4UBGA 5F32A 5FPLA 4RD7A 4XXPA 4AWDA 5FQ0B 2Q8OA 4WVMA 2QQWA 1A34A 3ELNA 1KDKA 2CGNA 1D4M2 3N9QA 2RM22 4RS5A 2ZGTA 1CGPA 2FDFA 3RNSA 2X53S 1COV3 3CNAA 3WF1A 3VD3A 3ZFGB 2RDSA 1N1YA 4LULA 4XE9A 4UW3A 1QJX1 2KM2A 1QHDA 4CCJA 2W2IA 1AR61 4NRMA 1SBDA 1TME2 3CMGA 1LENA 2WUHA 4HOOA 4YM3A 1DYKA 1ULPA 2RS52 5E6HA 1UPSA 4UW5A 5DDJ3 5BUVA 5IUQA 1YJLA 1BYHA 1UIJA 2F17A 4JQRA 2WWSA 2VZ3A 1RL3A 1RGSA 1R092 1FX5A 2BDRA 2BOIA 2FCUA 3OB8A 4PBOA 4PHZA 5FMCA 5FYCA 4AHZA 5FZ6A 1RXGA 1QJZA 1W0OA 2BP6A 2Y6JA 1AR71 1VBB3 1ZZ6A 3POSA 4GKXA 3VBFC 2CTVA 4X6QB 4LLOA 2VZPA 3LFMA 5L7OA 1ZBE1 1DG6A 4XETA 5GLTA 5DZFA 4AVTA 1FPN3 5FY5A 1W2TA 1Z7S2 2XBO2 1ONAA 2VOTA 5B2GB 3P3PA 1ULDA 4PDWA 5GLZA 5BNNB 1RVF1 3NAPA 3KQ4B 2AEZA 1WUVA 4QGNA 3ZYPA 1JYCA 1PVC2 2ZGKA 4Y4YA 2GNTA 4K9SA 3T09A 3LFIA 4FPLA 4LBQB 2GC2A 4MGIE 4AEJA 2HWF2 3I8TA 4XOGA 2Q4SA 4Q4W2 1OFNA 1JUHA 1UQXA 1ZM1A 2XL7A 4Y22A 5FPVA 1AR83 3E6CC 5KXBA 1BVVA 4QQHA 3ZFEA 5FP4A 4QQ2A 2HWE1 3CDZB 5LA2A 2VBPA 2WRAA 1ENQA 4MO3M 3AMQA 1DGRA 2PQQA 4N7UA 3WW1A 4ARYA 4CP1A 4DRVA 5JXIA 1WD4A 2ZZQA 4LHNA 4L97A 5E1RA 4EQVA 2HWC2 2UURA 3V0BB 5LEJA 4G9SB 4OUEA 1FT9A 2VOXA 3PUAA 4K8FA 2WFF1 1QQP1 3J9SA 2G19A 3URFA 3H0OA 4NHYA 1W0NA 4LE4A 2OIIA 2VH9A 4OHVA 2VPVA 2W47A 1X33A 2BOJA 2ZOEB 1CZSA 4H14A 3ZYFA 5JAXA 1RUNA 4WM8C 5CISA 4EV0A 2R073 4WVVA 3WUDA 3FZ3A 1RUE3 4M3CB 3HBKA 2A70A 2ZX1A 3IIIA 1NA1C 2X05A 3N9LA 2JDNA 4WVMB 4OMCA 3R4DB 4D7SA 1HRI3 4RS5B 4YPJA 4JTNA 1GR3A 1HRV3 5FZ9A 3RZJA 3RI9A 5I91A 4O9EA 1POQA 3WW2A 1D2SA 1VPHA 2PLV2 3T0AA 1JYVA 1CAWA 3AMNA 2YPJA 2ZGSA 4YW7A 5FZDA 1K42A 4YZ5A 1X82A 2G9FA 3IN9A 1ZZ8A 2J1EA 4DS0A 5ANNA 1PIV3 2PHXA 3JBG1 3PUSA 4HVOA 4WZFA 3PVBB 5KHHA 4K7JA 3J4UH 1J3QA 5LBCA 2OVUA 3ITQA 4NRPA 4DUVA 1NCRA 2FMDA 4YZ3A 1BEV3 1HDKA 2ZEXA 3LWCA 1LEMA 2VNRA 4L92A 1KJRA 2FDGA 5H9RA 4CP9A 1N47A 3H42B 1W03A 3MLKA 5CKMA 2RJLA 4SLIA 5L7OB 2YBKA 3RYPA 3EBRA 2CL2A 3MDPA 3TAYA 2WNOA 5FPZA 4JDOA 4NPLA 4PDWB 1JMUB 1LGBA 2YXSA 3TB0A 3DGTA 3N9PA 3NAPB 2VAUA 1O8SA 5JIAA 1KXGA 4XQWA 1GSLA 2CAVA 4B8EA 3NNGA 4ITCA 2BVVA 4UFJA 4DINB 1JXNA 3RZZA 4A3ZA 3O12A 5C9AA 2HWB3 1WCDJ 4NN0A 3PL0A 2YGMA 4LO7A 4R4ZA 4RFRB 4TZDA 2MPFA 4Y22B 3WXPA 1IS6A 5FZEA 1CAVB 1D0HA 1EYBA 2VMIA 4DXZA 3WQ0A 3ZFEB 1ODMA 3I49A 3TOJA 2QJVA 1V6OA 1R083 1JHNA 2YHJA 2Q8EA 3JQWA 1R1A3 1X9TA 3FHIB 3VD5A 1I3HA 5BNOA 3BCWA 5FY1A 1LKNA 2GALA 2W95A 4LA2A 1H1AA 4WVWA 2JX9A 3FN9A 4YW4A 5JSRA 3LDRA 3KHBA 2CNAA 2ID4A 1YNAA 4UW6A 1NT0A 4URAA 5JCTA 1VRH3 3B3QE 4AHWA 5LATA 3L9JT 2DCJA 3J7HA 2XWJB 4AVBA 4XFCA 1O6UA 4Q5OA 1IHMA 4NR1A 2BGPA 1TVGA 2EXHA 1AYM2 2IFRA 4A7YA 2O8QA 2XG3A 1FMD1 1SACA 3A21A 1S4CA 5DAVA 5DZGA 1UF2C 2E33A 3OY8A 1UYPA 3I3BA 4AAXA 5F39A 4XF1A 5A33A 3HN1A 1OLQA 1GZWA 3LAGA 4ZPIA 5E16A 4XDOA 4DY3A 4E8DA 1CAWB 5FKCA 1W05A 4FOYA 4KH9A 4UF0A 3ILFA 5I0RA 1AR93 4ASLA 3NV4A 2RS11 4W4ZA 1LAJA 2C9AA 1X8MA 4E8CA 4YM0A 2B9UA 2ZXQA 3ACLA 1RUC1 4YW5A 2BEOA 4E4HA 1RMU2 1SPPB 5EV7A 5I0DA 1AL0G 5FCCA 1NCRB 2ARCA 2R6QA 1DBNA 2EALA 2IXIA 1C57A 2QQVA 5D8AA 1GICA 2RDQA 3VBSC 4KG0A 3WQBA 4CP9B 2KR2A 1CJDA 5APAA 3ROUA 1XJAA 4D6RA 1F4AA 4CDQB 3W5NA 4W50A 4BLJA 3ZSKA 2B8MA 3WF0A 4CUBA 4LO6B 3AYCA 1B35A 1ASJ1 1EPWA 4GMP1 4J6GA 4M3CE 5FZGA 3RMYA 4Q8KA 4LJHA 4Y1ZA 2WZPP 2VXJA 5FO7B 4NIHA 2DYCA 1RUF2 4AR2A 1RHI1 1SFPA 2GMMA 4DQAA 2C6SA 1YQ6A 3WZ1A 2R062 2WDBA 3RJ2X 2DURA 1QJY3 1GOGA 4FXGB 4LBJA 5C9AB 3MW2A 3UETA 2VC9A 2Z2SB 4MGZE 4Q4X3 2ARBA 3ZX7A 1MS8A 4W6YA 1UOBA 4IEQA 4AEKA 2D3PA 2JIJA 1MVEA 2O14A 1GZTA 3I2IA 1AL22 4W8JA 4GWNA 4K3UA 3QLQA 1OQEA 3LD8A 1VBC3 2WQ4A 4N9HA 2AZ5A 3I2DA 4AVVA 3MZHA 2B45X 2D7FA 1J1LA 5FIXA 5BNOB 3GZUC 2JICA 1ULGA 3H8OA 4QXHA 4KU7A 3U78A 1H9PA 5F3IA 5JR2A 5FYBA 1QWRA 5JOYA 2D40A 3UKNA 1FOD3 2LROA 4GA9A 3ZXJA 4QDQA 5FUNA 4H7LA 5CEHA 1W6QA 3B93A 4XFBA 3CIHA 1JZ8A 4KWJA 2WINB 1YQ8A 1POV3 1PX3A 1YI9A 3MF6A 1VBE1 5A3OA 3SCFA 3OY8B 3M8LA 3N9NA 2VUCA 2A5ZA 1C3HA 4QPWA 4E4DX 5JZGC 3TWIA 2EIBA 1KS5A 2XJSA 3QH7A 2OQ7A 4ONUA 2Q30A 4GWIA 5FY7A 4C8DA 5KWRA 1SCSA 2E7QA 2ZKNA 4QX5A 4XIKA 1GZWB 3W59A 4MH0E 2VMDA 5A33B 3U4SA 5J36A 3OGGA 4CRQA 1EUTA 4BU2A 4AFDA 2BFUS 3JCIA 1AYN3 3KT1A 4UF0B 2XVGA 4OI4A 3ZSMA 2DV9A 2JKXA 3TEZA 3K4DA 4OI0A 3A0NA 2R0HA 4V1PA 2F6BA 2R043 3I59A 4XF0A 1MZFA 2VTXJ 4AL9A 5F3CA 4JC1A 1HX6A 3VKOA 3VBRA 4FO9A 3RYRA 4J1XA 3CL1A 4QKFA 3ZOIA 4MGQA 5GLWA 5LASA 3FC0A 3OD4A 1VBD1 2ZMKA 3KVAA 3LIHA 1DZQA 3K4AA 1S0DA 5J1XA 1RITA 2TBVA 5D8AB 4QHZA 5AC91 2B4KA 3HEIA 3VBHA 2XVLA 5A1FA 1GWKA 1RUJ2 4RFT0 1B35B 1OUSA 4P9GA 1GOFA 3A0KA 3QD6A 3JQXA 1GNHA 3ZR5A 4CSWA 3VZNA 3W5MA 4QHBA 1NA1A 4EN9B 3H3UA 1WLWA 4D6SA 3C7FA 4QD2A 3KLSA 1GQGA 4BA6A 1DQ4A 1UOGA 2VQAA 2O0OA 1ZZCA 3WUCA 2V4VA 2JXAA 2PHTA 3U0ZA 4M4PA 2XHKA 3IDCB 4X6RB 1CQ9A 2BBVA 2PFWA 4MGKE 1UX7A 2K9ZA 4XCAA 2G1MA 5GKAC 3WNNA 3HQRA 1FNZA 1QF3A 1QOOA 1C5IA 2Y33A 2ZJCA 3RWNA 3IAPA 3LDBA 2XJVA 1IPSA 4XJ8A 1CESA 2JDZA 3M2MA 3MO4A 3OPZA 5IVJA 2WO2A 3VDDC 2OUHA 3A7QA 1OQ1A 1LU2A 1OT5A 3GHNA 2DCYA 4J25A 5BXXA 4ZY9A 3NNFA 1DZRA 1SLBA 1MS5A 4BYYA 1QJX3 5JUVA 3OEAA 1AR63 4OUSA 2VVFA 5FYVA 2RS12 1ZZ7A 4BIOA 2AR6A 2VNVA 5A3WA 2HBTA 2A3XA 2EXKA 2ZABA 2BBAA 1TZOA 4R9BA 3OSDA 4UT5A 1RUI2 2VZUA 1W6QB 2V72A 2DUQA 3PIJA 4CUCA 2YC4A 1JZ4A 1PO11 2Y6LA 2PELA 1UN1A 4DZGA
chains in the Genus database with same CATH topology
1MZEA 2WS92 4F3JA 1AR73 3BODA 4KGGA 1F5FA 1TQ5A 4IERA 1O91A 3LA3A 4D69A 2WQZC 1ZBE3 4RR3C 2JD4A 4YARA 1IKQA 1C1LA 4SBVA 4QQLA 2XL9A 4U2AA 3AB0A 4LUMA 1RVF3 4COZA 4CEWC 1I6XA 2P3JA 1RJ7A 3X29B 2B42B 3I59B 5FLJA 1LHOA 3MIBA 2A6XA 3VBRB 5HBAA 2PAEA 1QKQA 3CU7A 3ZXAC 1VAMA 2HWE3 3S6PA 4D3WA 1CAUA 3VBHB 3OJBA 1WW6A 4HK8A 3RQ0A 2RS31 2WFF3 1QQP3 4W6WA 4AI1A 2RR12 5LK5A 3DV8A 1BK1A 3MGUA 3NO8A 4MGYE 1OI6A 1C28A 4P14A 3SLIA 1AXKA 4HMZA 4XMIA 1G9AA 3RI8A 2EIGA 1TNRA 4IETA 4E9KA 4PBPA 2PHFA 1ZRRA 4PIZA 3FBYA 1V70A 3I7DA 4COYA 3WQ7A 5J3UA 1JOJA 2DCKA 2H0BA 5LRSA 4B4RA 1Q43A 5FOJB 4BQ1A 1EP0A 1N1TA 3FJSA 2QE3A 2IXCA 4XBNA 3ZXFA 3JBG3 2VMHA 4N53C 3VBSA 4HPKB 3GYDA 5FMOL 3ZFFA 2RMU2 1N3PA 4Q1RA 5ABJC 4R8HA 4QPIA 1ZREA 5AVAA 5GZGA 1IPKA 3VL8A 1B09A 1KITA 4P9XA 3VZOA 1I9RA 2FQPA 5BYNA 1LHWA 1YIPA 2ZMLA 3KQRA 4N7IA 1S2BA 3VKLA 4LNVA 4ZXKA 4KWLA 4I3GA 2FZ1A 3KS7A 1VBA2 3WG4A 1V6LA 5FRAA 3P3NA 3CJIA 3VHNA 3R6SA 1YCIA 2ZGRA 4GXLA 4ASMB 4E4SA 1H8TC 5JMCA 2PAMA 2XLAA 4XFIA 1XU1A 2DU1A 3BOWA 5C4WC 4HSJA 1D4M1 1QJU1 2BNOA 2RM21 3UL2A 2E51A 2VW1A 4Z92B 4LTAA 4S2GA 5I0SA 2XKPA 1CAUB 1VALA 1A3KA 4Q0SA 4CDWA 4CTEA 3ZXLA 2C0ZA 1ND2C 3ILRA 1NOVA 3ETQA 1TME1 4JV4A 4RHV2 1GKBA 5C6CA 5JPNB 1NQDA 2W08A 3U07A 1UX6A 4M00A 2RS51 3AZXA 2W39A 5FLHA 1QNWA 1NQJA 3DUIA 1G9BA 4GIQA 4GH4C 2OZ6A 1R091 1QU0A 2NQYA 3CO2A 1FMD3 3JB4C 5C8CA 3LCPA 4RGAA 3D5OA 1N1SA 4LLFA 3AP4A 4BOWA 3NKTA 1JN2P 1Z7S1 2XBO1 2ZA9A 4XILA 4QPGC 3GHMA 2HKXA 4MX3A 4CDUC 2BUKA 4LBMA 2OPKA 1CJPA 2V73A 1FYUA 1PVC1 1RUC3 2Q0AA 3ZFFB 4K1ZA 2HWF1 4Q4W1 1AVBA 5HI0A 2YUEA 2E53A 2GNBA 4QPIB 5EFUA 1G9DA 2VQ0A 5E88A 4IV1B 3B7MA 1REEA 5AVPA 2HWC1 4RQPC 3S30A 4GMP3 1ASJ3 1LGCA 2BNNA 2DUOA 2N7GA 4NHKA 1CIWA 4Q29A 3PLQA 1RHI3 4AYUA 3RS6A 5BNPC 1H2NA 3K48A 4JGZC 5SV5A 3C3VA 3CJIB 3HAGA 4FP3A 3DKWA 3VDDA 4AVSA 1MVQA 4MV2A 1PO22 3RRDA 4IEPA 3FUQA 4HKOA 1RUOA 1LRHA 2A6VA 4B7EA 2NPIA 5I0TA 2QDNA 1OOPC 4F83A 2R49A 1WBFA 1WCKA 2MEV2 2PLV1 4AQTA 4Y1VA 4CDWB 1V00A 3EHKA 3HIFA 3BPZA 4AXOA 2OYZA 1O4ZA 1UD1A 5DUVA 1LTEA 2AYHA 1RJ8A 5FAXA 3AKQA 5I8YA 4RR3A 2ZHNA 4DFSA 5CFDC 4CDXA 4ZKTB 2E7AA 2ZBJA 1VBE3 5C8CB 3THPA 1BBT2 1Q8OA 1H9WA 2VXRA 4RL7A 2YC0A 3AYDA 5CVRA 1U5ZA 1RB8G 1M06G 2D97A 4YFZA 1NXD1 2D3SA 2R0FA 2PHRA 3JZVA 4AG4A 4GALA 3B00A 4LHKA 2EVXA 3OYWA 1DFQA 3AXDA 3N3HA 4IEWA 4DY5A 1DF0A 3HT1A 2XB6C 1OPOA 3H50A 1U0AA 4I09A 1KFXL 4FQ4A 4LR4A 2WNUC 3FFZA 1VBD3 1QJU2 2Z5WA 3ME2A 3VBOC 5AC93 1FV3A 4FPGA 1WLCA 2ZGLA 3HT2A 5IK7A 1BZWA 2V5YA 1XU2A 4P9JA 2CGPA 2ZAHA 1WMEA 3VKNA 2HEVF 1H30A 1XE8A 4ES9A 4P9WA 2A7AA 1Z78A 3BU7A 4H7MA 3E6DA 3VKMA 3MFCA 2BVBA 2OW4A 3J8F1 1H1IA 2NMOA 4YZ4A 4NVPA 5CB7A 1AYM1 3CEWA 1V6NA 4FT8A 4Q0PA 3AJZA 2VUJA 4XJ9A 5JVVA 4XQDA 1QDCA 2IXKA 4Q1PA 3J26N 1NY72 4AGRA 4XF4A 5FOBB 2GC1A 2WA3A 4RSUA 2EAAA 4HZFA 2BTVC 3MYXA 1H4HA 2D5FA 5E89A 5KHGA 3AFGA 1KDMA 3VKFC 2UWAA 2VNGA 1RMU1 1SFNA 5AFEA 3WW4A 4RR3B 1HV1A 1SLAA 4CDXB 2PA7A 2Q1MA 1PO13 1ULFA 4TLFA 1G6NA 3PTYA 5KHIA 2QDRA 4P9IA 2VOKA 4QU2A 3MICA 1W6MA 2WLPA 1LOFC 3HBZA 2Z69A 2OZJA 2ZMNA 1S55A 2JEMA 3WP4A 1IS4A 1RUF1 1AXYA 1NLRA 4FSJA 1GQHA 2R061 1DLLA 3MIGA 4IV3A 2VG9A 3TRSB 1VJ2A 3E5XA 4ORFA 2JKBA 2ATFA 1WGPA 1MS3A 1PNGA 1ND2A 1WD3A 2H6BA 4Q0UA 3USUA 4MXVA 3THTA 1YFWA 3PVEA 3M4FA 3WDYA 4DMIA 5JI9A 1AL21 1U12A 4L9BA 4OHWA 1CN1A 1I5ZA 2YGLA 4IL7A 3MLLA 4AEDA 5JPMB 2KA3A 4LO4B 2D6KA 5KC6A 2ERFA 2A3WA 1K5MC 4PJYA 2RS33 1FNYA 2ZGPA 4DNYA 2WL1A 4KNCA 1YLLA 2WIIB 4Z82A 5ACA3 4X8NA 5EJ3A 1XYPA 3R05A 4XEZA 3V65A 2C1FA 4Q4V2 2XVKA 3H3ZA 1QXPA 2PYTA 4J1WA 4COVA 4QPGA 3KCXA 4FAHA 2Q1ZB 2ZTNA 3GZAA 4Q4Y2 4S2DA 1BXHA 3RMXA 2ZGNA 4ISQA 3FLRA 3OBRA 4XFGA 4R52A 3JD72 5GZFA 2JE7A 2VULA 5J09A 3QOPA 2R1DA 2VW2A 1UU6A 4I0BA 3DPRC 3ZO0B 4M3CF 3S7IA 4TSVA 1V9U2 2IC1A 3M3IA 2VNOA 3VBUC 1QOTA 1IOAA 1J59A 2I2SA 1ULEA 2A6YA 5H9PA 1QNYA 1MS4A 2DUPA 1JW6A 4FQZA 3IBMA 4W65A 1C8NA 3W9AA 3ZYGA 1GYKA 1DDLA 1IGOA 1W6MB 3DL3A 1RUJ1 1V6JA 3WDTA 4FCAA 3D0JA 2W0XA 4Q0QA 4U36A 1APNA 4IXLA 4WBBA 5J48A 4E27A 4YNIA 1ND3A 1OOPA 1WBLA 2QZ3A 4IV3B 4NWWA 4YG3A 5E16A 4WV8A 3J8F2 3WINE 2GU9A 4BCUA 5J37A 1LOEA 4HKLA 1ND2B 3ZSLA 3WVJA 3ZN5A 1MQTC 1UMZA 3USUB 4BE3A 3VHPA 4GQ7A 1D4M3 4LBQD 1SBEA 1SLCA 1DU3D 3ZYJB 2WLQA 3UKTA 1PVXA 1VIWB 4BM8A 2WJSA 5FDBA 4FTSA 2PHWA 4YGCA 1J58A 1EPZA 4AEDB 3FE5A 3RG0A 3BTAA 5GLUA 1MEC2 4AHYA 1TME3 3N7MA 3INAA 5JR7B 1S0JA 2GNMA 2B5HA 3IWZA 2RS53 2JG8C 3R0RA 3TNQA 1W6PA 5FO9B 2XH6A 1LESA 3JUUA 1RUI1 3AKRA 2XGXA 3FMGA 1O3TA 1DGWA 1F2NA 2Z42A 1XRUA 1S0GA 2AENA 3WP5A 1XNDA 1H8VA 1GLHA 2WS91 2JJ6A 1G8WA 4OVEA 4BHPA 1MACA 4N90A 2O8OA 5T5JA 4S2HA 3AP9A 1MS1A 1U5XA 1Z7S3 1VAKA 2XBO3 1HXS2 2PAKA 4XZPA 4OULA 2DTWA 4Q0VA 2WT1A 2XKOA 4UXAA 2Y38A 4L2NA 4A2UA 4OI1A 1PGSA 3VBOA 5CBLA 3IDEA 1PVC3 1LEDA 2D6LX 2XJTA 2GN3A 2HWF3 1UPIA 4Q4W3 4GKYA 4XW3A 2BFUL 4XHBA 1OA4A 4BMBA 3O7OA 2D44A 5LEKA 4BMEA 4XYXA 4Z8BA 2X5IC 1FI2A 3WDVA 1PZ8A 2HWC3 3NV3A 4LBKA 3WCSA 3HMYA 2WA4A 1TMF1 4LBNA 2B7YA 2RR11 4AI0A 4AI8A 4P5HA 3AKTA 3VBFA 1ND3B 1OOPB 2F4PA 5I93A 3KCYA 4NHLA 1O4TA 1S0IA 1YYNA 1AX1A 3TN92 4EN7B 2IXLA 2ZX0A 1RUH2 3C2UA 2TNFA 4YYOA 2PLV3 4LEJA 1LGNA 4N43C 2Q5TA 4YM1A 1NE6A 5J7MA 2NZ9A 3QACA 1HW5A 4IEVA 4PF5A 1O5UA 2GNDA 1AZDA 4IEUA 4UBHA 2ARXA 3SNMA 4YVSC 1RUG2 3LSEA 2RMU1 1W6PB 5A3MA 2BQPA 2WZR2 1C4RA 1LOFA 2G4IA 3WDUA 1ENSA 3QCWA 4PCRA 4FPFA 1RUD2 1IKPA 2ZAAA 1PK6C 5FTTC 4WM8A 4HFSA 2GC0A 5F6KA 1CD3G 2C5DA 3FLPA 2WNVC 4AHXA 3ZMOA 3LA2A 4FOQA 1VBA1 4CEYC 4WM7C 3H1WA 4I30A 4XJZA 5E8AA 1FXZA 2I45A 3AP6A 1RTVA 2WC2A 4MYEA 4KG8A 4JGYC 1LU1A 1K5MA 3AMMA 1CVNA 1W6OA 2B39A 2GH8A 3PVOA 3OGJA 4MUVA 4RA0A 4XQ4A 1DGWX 1E57A 2TEPA 5KXDA 5CG8A 3NWKA 4AI2A 1SCRA 1JTZX 1EAH2 4RHV1 3ZFGC 3ASIA 5I8TA 2FBEA 4YVWC 1S1AA 3VBFB 3NV1A 2YV8A 3ATGA 3AX4A 1VBB1 1AYM3 3KSCA 1DIWA 5F6LB 1KS4A 2DVFA 1C8M2 3NSTA 4GWMA 1W39A 3M3EA 1SMVA 1LHVA 2EA7A 1ZBA2 4XJWA 4CP2A 1REDA 2NYYA 2BNMA 3V0AA 4Y5Z0 4JAAA 2P17A 1SLLA 1V6MA 5BNNC 1XNKA 4OHZA 5J98B 1RMU3 2R32A 3ZYIB 3D6EA 1REFA 3I4IA 4GB32 2NLRA 4JVAA 1GZ9A 3OTFA 3SMHA 2TUNA 1U5IA 3OF1A 3R4SA 2RJKA 3IKWA 2XJPA 1MZ6A 2CAUA 1O5LA 2BYVE 4WM8B 1Y3TA 3B69A 1LR5A 3WD5A 1OA3A 1NZCA 1KD7A 4CZSA 4FBFA 2BWCA 1NA1B 1RUF3 1TMF2 2HWD2 1PZ9A 2YMZA 3IPVA 2D6MA 3B9CA 1N1VA 2H6CA 2R063 2YZ4A 5JSPA 3RJRA 3FX3A 3LOIA 1X50A 3B02A 1Q5OA 1PO21 1GZCA 3CF6E 1JUIA 1S0CA 2X8KA 4YW3A 5IT6A 1W6OB 1EV12 3O0XA 1AL23 1WA4A 2GSYA 3K51A 3M1HA 2MEV1 1BQPA 4RS5C 3ZXDA 1XNBA 3KD4A 1LOBA 1BJQA 4EN6B 4IEXA 1ZZBA 3VZKA 3V64A 1OFSA 5IK8A 3SCGA 5JI7A 1S0EA 1NLSA 5EXOA 3W58A 4TYSA 1BBT1 4PIYA 3LA7A 2P3IA 3ZSJA 4KGQA 1SBFA 3ZIXA 2XJUA 3BB6A 1YFUA 3LOBA 4QGMA 1Y43B 3V0AB 1A78A 2HWB1 5DZEA 1YFYA 4Q8LA 5FPXA 2ZX3A 4ISRA 5GZEA 3EO6A 4PDWC 1GV9A 1KJLA 2D6NA 2D5HA 1BKZA 1KFUL 2XUMA 3NAPC 3WY6A 2WT0A 3TBDA 1YXWA 1URXA 4MVTA 4E2SA 4QM8A 1AJOA 1COV2 2YDEA 4D7TA 1AF9A 1ENXA 2VY0A 3NV2A 2UU8A 5T54A 3H7YA 3UK9A 1QMJA 1ZRDA 3ZFEC 1AXZA 1R1ZA 3KT4A 2JE9A 3N36A 4B3NA 4C91A 1O3QA 1RUJ3 4YG6A 5HCBA 3VHOA 1VRH1 4QXKA 4XBLA 5DDJ2 3WLUA 1QOSA 2GH2A 1AJKA 3IPVB 5JZGA 5KBFA 2NM1A 3NJZA 4Z07A 4L99A 1ALYA 1DGRN 4XF3A 3LSDA 1VBB2 4N43A 4ES8A 5T5PA 1H2LA 2VOWA 2VUAA 1FPN2 1IPJA 3ZXKA 1XQNA 5CU1A 4C0BA 4YGBA 3S7EA 1AR91 5AFBA 1NY71 3AZYA 1LOAA 3M7AA 3BIWE 3HQXA 4BLIA 1RIRA 2DF7A 3A4UA 1G7YA 3D0SA 1QY4A 2RS13 2YY1A 4XFFA 5FLIA 2UYAA 3VBSB 1PMIA 3KGLA 2A73B 1PK6A 2ZZJA 2EXJA 1AR82 1LOGA 4XFHA 2QNKA 4R9AA 1RUI3 3AMHA 4HBNA 3ZXEA 3VZMA 2JENA 2IXHA 1UZYA 2EAKA 1CONA 4FPJA 2WS93 1O3RA 3FWEA 1Y7BA 1FV2A 1NCRC 4DB5A 3MIFA 4CEYA 3B5LB 1DQ5A 3ZMNA 4K40A 2ZGOA 4KBBA 4FTBA 3VZLA 2HEWF 4CDQC 2XJRA 3AP7A 5LRRA 1FATA 2R072 1RUE2 3APBA 4NWVA 5EYXA 4JDNA 3S0MA 5FQ0A 2FZ2A 4JRAA 4KQ7A 1HRI2 1GANA 4OZXA 4M0NA 1HRV2 2DCTA 1BCXA 1AX2A 2HJIA 5C9AC 4HLTA 2HEYF 1PGW2 3JU9A 4YVWA 3USSA 1J3PA 1PIV2 2ZS6B 5FO8B 4YM2A 5BV6A 2WFPA 5CIRA 2RR13 1X7NA 4KL1A 5BNOC 1TE1B 2NN8A 2QVSB 5JZGB 1BEV2 1QXJA 1CPNA 1N3QA 4Q4V1 1HQWA 1MS9A 2LM3A 3M3CA 4QPYA 3RSJA 1JYIA 3RDIA 1A6CA 4OFGA 1ZX5A 1V6IA 4Q2FA 4Q4Y1 4CEWA 5T52A 1ZZ9A 1UKGA 4OHXA 5KXEA 4KWKA 3JD71 1H2KA 1LECA 2K2SA 4ZU5A 5D1IA 4FPCA 4LT5A 4O9GA 1S2KA 2GZWA 2HWB2 1YUDA 2GDFA 4LBQA 3GNEA 1V9U1 1PK6B 5JWPA 1NCQC 4P9LA 5EWSA 2RMU3 3M3QA 4FXKB 4FOWA 2O1QA 3ZN6A 1R082 2G9GA 1Q8SA 1R1A2 1YRZA 3SISA 1V6KA 2WT2A 4LE3A 2DU0A 5K9YA 2JG9C 5D8AC 3AK0A 3IDBB 1OSGA 1H1MA 2WSVA 1VRH2 2IFWA 2QKDA 2ZPXA 1HV0A 1B35C 1QDOA 1VBA3 4M3CA 3GBFA 5JDBA 3VDDB 5C8WA 3N7LA 2ZHMA 3B9IA 1UCXA 4INDA 1IS3A 5CAZA 2P34A 3GBWA 4EN8B 1OHFA 4N53A 4QQPA 3MW3A 4NPRA 3ALQA 1TNFA 4YVWB 4YSFA 4KU8A 3M70A 1MR5A 5K7PA 1AR92 5ABJA 4I02A 3KGZA 4HVRA 3N35A 1MEC1 4ATEA 4RHV3 2ES3A 2ZGQA 1SDWA 3LGRA 4C0HA 2VVDA 1GNZA 2VU9A 1ZA4A 4MXWA 1YI7A 1X36A 3ZSEA 3AKSA 2MNGA 3M3OA 3ES4A 1Q3EA 4YGEA 3E5UA 3WX5A 1VR3A 4CEWB 5F5QA 1G9CA 2VVEA 2LUWA 2UWBA 4OUMA 2YROA 3VL9A 3O5SA 1ZRFA 1H8TA 1HXS1 3U11A 4PIXA 3GBGA 3ZPYA 4PQ9A 1QJY2 4COUA 5C4WA 1IQAA 3H1MA 3OYWB 4XXAA 4Q4X2 2UY8A 1CAVA 4Y1XA 2XLGA 2P37A 4I0AA 3MIDA 4HSLA 5EYYA 3PHMA 3T1MA 2DCZA 3ZN6B 2D6OX 3GALA 3FFQA 1VBC2 3VBRC 3WG1A 2ZACA 3D82A 5CA6A 4AFBA 4GH4A 3WR0A 1FOD2 2A6ZA 3VBHC 2QFEA 1C1FA 2D93A 2V09A 4B4PA 1LCLA 1YO8A 4K21A 5L36A 3PJQA 1LULA 3WV6A 1PO23 3TN91 4CDUA 2IWGB 3L2YA 1PGL2 3SHRA 1XXNA 3HD8B 4N53B 1DQ6A 1RUH1 4HKWA 1SEFA 2A71A 4FAGA 1DZTA 1AYN2 4B29A 2DFBA 2MEV3 3IMNA 4MLOA 5ABJB 4AGVA 5K0UC 2ENRA 3AZWA 1Q8QA 2R042 1M4WA 3FUOA 2EF6A 4JDMA 5C33A 1XYOA 1X8EA 3TYJA 3H9AA 1RUG1 4XHXA 2GN7A 4MXWB 2WZR1 4RQPA 4META 3BALA 4IEOA 2ZKLA 4K6BA 2YYOA 4B7KA 1RUD1 4CDQA 3O14A 1UKRA 2SBAA 1L3JA 1BBT3 3WDWA 5JOZA 5BNPA 3VUOA 4JGZA 3WW3A 3ZIWA 4I2OA 4XTPA 2VECA 4TWTA 1H8TB 2AREA 1OMIA 1YFXA 3D8CA 1JBCA 3AM2A 1CX4A 4FVVA 4Z2WA 2DVDA 5C4WB 5HCFA 3WG2A 4PLNA 2H0VA 1AUYA 1WW4A 2JECA 1D4VB 1EY2A 4LO5B 4COWA 1QH6A 2P3KA 4LA3A 3LZZA 3AP5A 2VW0A 1Y9QA 2CWSA 4HK9A 3WNXA 3KMHA 1QJU3 2RM23 3N4MA 4AEMA 4FPOB 1H4GA 1QJX2 5K8SA 1AR62 2GAUA 5CFDA 3O0VA 1UU4A 4GH4B 5IK5A 5H9QA 3ZXGA 1EAH1 1NYWA 2DFCA 1OQDA 4XJUA 1ZRCA 5F1RA 1AR72 4QPGB 3N7KA 1R093 3CJXA 2XPJA 4NOTA 5GLVA 1ZBE2 4CDUB 3IM0A 1UU5A 1VP6A