2D5HA

Crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
488
structure length
373
Chain Sequence
FNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISNICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycinin A3B4 subunit
publication title Conservation and divergence on plant seed 11S globulins based on crystal structures.
pubmed doi rcsb
source organism Glycine max
molecule tags Plant protein
total genus 72
structure length 373
sequence length 488
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA01
2Q4SA 2PHDA 5JSRA 4BIFA 3E6DA 4MX3A 2Q1ZB 3S7IA 4HZFA 4IEUA 3E6CC 5FPZA 3E97A 2O8QA 1XRUA 2BNMA 5I93A 5D1IA 3H1WA 4O9EA 1J3PA 2P17A 5FQ0A 4HVQA 4IEWA 4XETA 3BCWA 5KHGA 5BPXA 1ZZ8A 1ZZ7A 1CAXB 5EZWA 4QGLA 3WW4A 4K8FA 2ET7A 4IEZA 3FFQA 2GC2A 4XFCA 2B5HA 3FHIB 4O9GA 4Q0VA 4D7TA 3DKWA 5FLIA 1YUDA 2HKXA 1PM7A 3LZZA 4MGZE 3S7EA 2PHLA 4E2GA 2GZWA 3D82A 1JUHA 4IEQA 4AVAA 2CV6A 4AQ6A 3E5QA 1YHFA 4BH9A 1O3TA 4I2OA 1UIJA 3H7JA 5T3NA 3SCFA 3OGJA 1GQGA 4XFHA 1ZRCA 4LA2A 2XLAA 5KHIA 1ZZ9A 2D40A 1DGRA 4ONUA 3RPQA 5KHKA 1WGPA 4DINB 4HN1A 5I91A 4FAHA 1H1MA 2OZJA 2MHFA 4JTNA 3MDPA 3PVBB 3UKVA 3ROUA 4J1WA 1X82A 2GAUA 2D5HA 3WW3A 5AVPA 2C0ZA 4OLLA 3JZVA 2GC0A 5I0RA 1OI6A 2EAAA 1O5LA 4F7ZA 2OPKA 5LRSA 3MYXA 4N9IA 4BHPA 5CU1A 5J48A 1NXMA 3PNAA 1VJ2A 3KGLA 3KMHA 2IXHA 4Q0PA 2H6BA 1J1LA 3HQXA 5F1RA 4QXKA 3EBRA 2MNGA 4BYYA 4HVRA 2O1QA 1G6NA 3CJXA 3VHRA 1UPIA 2QVSB 2KXLA 2H6CA 2H0VA 4I0AA 3DN7A 1PMIA 4JV4A 4PIZA 4QGMA 5I0UA 3BU7A 2WFPA 3RNSA 4PIYA 1XE7A 1OFNA 4R8HA 4XFBA 3WW2A 1U12A 3ES4A 4L2NA 4HMZA 3SMHA 4PJYA 5HI0A 3O14A 1J59A 1J3RA 2GH2A 4XF4A 5FDBA 2IXCA 4EWEA 4JTOA 4AVBA 2K0GA 3M70A 5JSOA 4IERA 2VECA 3IDCB 1ZZCA 4I09A 1L3JA 4LLOA 1X8MA 1IPKA 3ETQA 4MUVA 3OCPA 3PLQA 4AXOA 1O7FA 1O4TA 1O5UA 2QDRA 2XGXA 4HBNA 1ZVFA 4UBHA 2XKPA 4L11A 1TQ5A 3USSA 4EV0A 3H1YA 3LOIA 3MZHA 3L2HA 1EYBA 1V70A 4UXAA 4B29A 1CGPA 1OD5A 4MH0E 3CF6E 1J58A 1EY2A 4KWJA 4MGKE 1LR5A 1QWRA 1QXRA 3ST7A 3SXWA 3ELNA 4NVPA 2XL9A 3EJKA 3EHKA 3MPBA 4RD7A 5CADA 3ES1A 2GC3A 3I7DA 3NJZA 4XEZA 4LEJA 3DV8A 3HIFA 3BPZA 4LUKA 2E9QA 1QY4A 2UY8A 3GYDA 3D0JA 3H50A 3NW4A 1RGSA 3LWCA 3N4MA 1VP6A 1UCXA 4I02A 1CAUA 4E2SA 2D5FA 1Y3TA 1SFNA 1RL3A 2N7GA 3ACLA 3BALA 2IC1A 2UYAA 1ZRRA 2GU9A 5LEJA 1UIKA 4IEOA 2PQQA 4KU8A 3G7DA 4H7LA 4LTAA 5EFUA 3RZZA 1ZRFA 3I54A 3B02A 4XF1A 3H3UA 5KHJA 1FT9A 2XHKA 4AVCA 3S0MA 1YFYA 1FI2A 4I01A 3H3ZA 5C8WA 4XF0A 2QCSB 5C6CA 4QMAA 1UD1A 2IXKA 2BEOA 2BNOA 4KL1A 2OYZA 4OFGA 1NYWA 3C3VA 3CLPA 1DGWA 2K9ZA 3ZDSA 5LEKA 4WZCA 4YYOA 4ZU4A 1ZRDA 1ZREA 3UKTA 3UKNA 3E6BA 1NZCA 4KU7A 2ETEA 3OTFA 5FQ0B 4YRDA 4XF9A 1EPZA 1NE6A 3H7YA 3LA7A 3RYPA 1WA4A 3U0ZA 3KSCA 1CAWA 4FT8A 3HT2A 2CAUA 1CAXA 1RC6A 3E5XA 3RYKA 2BNNA 2VQAA 2FQPA 4YNIA 1LRHA 4HSJA 5J3UA 2ZKLA 1ZZBA 1HW5A 4XFGA 3HT1A 1Y9QA 3FX3A 4KWLA 5K8SA 3H9AA 1O3QA 1IPJA 3EO6A 3R6SA 1YWKA 2XL7A 4ZU5A 1DZTA 3RDIA 1GQHA 1H1IA 4XFIA 1YFXA 5BY5A 3U10A 1CAVA 5LRRA 4LUMA 4ORFA 4HLTA 5I8YA 3OF1A 5I8TA 4EROA 4FBFA 4Z82A 2PAMA 4HVOA 5BV6A 4N9HA 2MPFA 3IDBB 3SCHA 5JAXA 1I5ZA 5FLJA 2PFWA 3LA2A 2XKOA 3TNQA 2Z69A 2B8MA 1LKNA 2I45A 4X6QB 1SEFA 2XLGA 2B9UA 2BYVE 4WBBA 4D7SA 3GBFA 4TLFA 1UW8A 2ATFA 5JSPA 2WC2A 3IIAA 4LA3A 3IWZA 1DZRA 4MGYE 4FAGA 1ZX5A 4XF3A 2OA2A 1X7NA 4IEXA 1X8EA 5CVRA 2QJVA 4ZU7A 3D0SA 4QM8A 2OZ6A 1CAWB 4IESA 3E5UA 3I59A 3LA3A 5I0TA 4YARA 4GULA 3QACA 4IEYA 2XLFA 2ZCWA 1RUNA 2BGCA 2HJIA 5E16A 2PYTA 1YLLA 4IETA 5FLHA 3SHRA 2PAEA 2F4PA 4LULA 3CL1A 3IBMA 1YFWA 5JCTA 2IXIA 4IEPA 3TNPB 1ZZ6A 2FMYA 4QX5A 2Z2SB 4Q0QA 2CGPA 1O3SA 5FPXA 4AQ2A 4HSLA 5BXXA 4EWAA 1NE4A 4YSFA 3EQEA 4QGNA 3RYRA 1QXJA 4META 2IXLA 2Y0OA 4J1XA 3QOPA 2UY9A 1CAVB 2CAVA 4IEVA 2PAKA 3CEWA 3KCCA 1EP0A 3BB6A 5KHHA 1WLTA 2EVXA 1Q5OA 2UYBA 3FZ3A 5I8SA 1RUOA 1OMIA 3WW1A 1J3QA 4QM9A 2QNKA 3SCGA 4HN0A 2ET1A 3U11A 2VPVA 2IXJA 2V09A 4I3PA 1O3RA 4PIXA 3NSTA 5FCCA 3NKTA 2EA7A 4A2UA 5JR7B 3FJSA 4P9GA 4XFFA 3H1MA 4EWDA 3NL1A 1FXZA 4CYDA 4WVZA 3DL3A 3NVCA 4F8AA 3FWEA 4KWKA 1YFUA 4MGIE 2PA7A 3I59B 1I6XA 1LB2A 3FE5A 1ZNPA 4MV2A 4X6RB 3KGZA 1CAUB 2DCTA 4Q29A 2Q0AA 1CX4A 2PTMA 4I0BA 1RTVA 1SQ4A 4JVAA 4UBGA 4Q0SA 3CO2A 1Q3EA 5J7MA 3H8UA 4Q0UA 2D93A 3LAGA 1Q43A 4XFAA 5E1RA 3M3IA 2Q30A 4R52A 4E2QA 5I0SA 1VR3A 4MZUA 5KBFA 4Z07A 1XE8A 2GC1A 5BUVA 3OD0A
chains in the Genus database with same CATH superfamily
1FOD1 2SLIA 2Y6FA 4XQDA 5FTTC 5FY1A 5HXVA 4H3WA 5JSRA 1JBCA 1HRI3 1GNYA 1QMJA 1B35A 2QQVA 1MS9A 4FPOB 3OGSA 3B5LB 1VPHA 4W8JA 5L9RA 3A21A 5FUNA 4UFJA 5GLZA 5KC6A 3ZXLA 1K5JA 1QJX2 4YG3A 2O0OA 5DUWA 4N43A 1MS0A 1CWPA 3E6CC 4FFGA 1JUIA 2Y8KA 4JAAA 4QKBA 3TBDA 1RVF3 1NCRA 4LIUA 4P9JA 2DDUA 1AYM1 1D0HA 3NWKA 4QKNA 4QQHA 2NPIA 1J3PA 5EHDA 5FQ0A 4X8NA 3BTYA 3U37A 3TN91 2F6BA 4NRPA 4PBOA 3B01A 1C28A 1LOAA 4CDWC 4DPNA 4EWDA 2AC1A 3J7NA 5BPXA 1ZZ8A 3ZKUA 4LLFA 1BK0A 4CDQA 2ET7A 3FFQA 4FFIA 4GJZA 4XPVA 5FXVA 3AFKA 1OF4A 4C90A 4XFCA 3VZKA 5FZOB 3OUIA 4YFWA 2HWE1 4OQ9A 5CFCB 2Y38A 1FNZA 4B1MA 2H0BA 1HN1A 4H7MA 2ZS6B 2W91A 2R071 1PM7A 3OYWB 1S0FA 3OG2A 5DUXA 2CV6A 1W8FA 2ORXA 4FI9A 1CONA 3H7JA 2ARXA 5T3NA 3SCFA 4AGVA 1MR5A 1ZRCA 2YROA 3NV4A 2XLAA 4Q4Y1 4WVMB 4XE9A 4OUMA 3P3PA 5FXWA 5FRAA 1DGRA 1VBD3 3ZFEA 1DF0A 1C5HA 1K5MA 3S6PA 1PX4A 4XUOA 3VL8A 2W95A 4AI3A 4RFT0 3RZHA 4K1ZA 4XCBA 1KFUL 3KCXA 2YY1A 3VDAA 4HN1A 1OFSA 3WD5A 4JQRA 2E31A 2OZJA 3H8XA 4FP2A 4Z1VA 2MHFA 2RJ2A 1YIFA 1GSLA 4HXCA 4M00A 1CIWA 1W2NA 3GBWA 3HQUA 4MGTA 1IS5A 4E9KA 1POQA 2TEPA 5GLWA 3ZO0B 1A8DA 2V5DA 2DWRA 3P5BA 1FX5A 1MVQA 3PHMA 1QQP3 3GZAA 3Q8AA 5KC5A 1OKQA 2E53A 1GKBA 1BBT3 3JZVA 5H9QA 3VKOA 5I0RA 3RJRA 4FTBA 1MQTB 1ALYA 1ULFA 5E88A 4N9IA 5L9BA 5C3SA 5FZHA 1UOFA 4QHBA 2JG8B 5BNNB 1RITA 1NXMA 1N47A 1ENQA 1ENRA 2RS13 3ALQA 2D3RA 3GCXA 3KMHA 1SG3A 1AX0A 1OD3A 1REEA 3F95A 2JDMA 3U4SA 4TLGA 1PVXA 3EBRA 3NRUA 3O1MA 5JDBA 2NQYA 4HVRA 3VBFB 1WW7A 1RUE2 4TYSA 1DYOA 2GSYA 2ADDA 1AR71 4LBLA 2HWF2 4URTA 2QQUA 1W9SA 2W9XA 2XUMA 5FMOS 1COV3 2XHNA 3WDYA 3LEGA 1B35C 1KJRA 2OX0A 1HQLA 3MIDA 1EAH3 4URAA 1AR82 4JV4A 4PIZA 1CJDA 2E7TA 4BLJA 2I07B 1VRBA 4N43C 4DRRA 3GNEA 4G3YC 5C9AA 3OPTA 4PI0A 3ZMNA 3NAPA 1NCRC 1JH5A 4RS5A 3N9OA 4RR3B 3UGFA 4LXLA 4XFBA 1ULDA 2ZX1A 2ZEWA 1U12A 4MHRA 4UFMA 4C91A 2VO5A 1BEV2 1XB9A 2LUWA 3A0NA 4LE4A 3SMHA 1JW6A 4WM8B 3O14A 4Q1PA 2PHWA 1J3RA 3I2HA 3AJZA 2WWJA 2P34A 4YVWB 5A6YA 2CY6A 3GHMA 4MLOA 5KXCA 4CDQC 2DVBA 1KXGA 4XVHA 4BJ0A 2EF6A 2D6NA 2K0GA 3VN4A 5JSOA 2VZSA 2VECA 3DF0A 4OHXA 2XBO2 4J6GA 1ZZCA 5GLVA 3MIHA 3FN9A 1X8MA 4P9LA 2WNUA 5APAA 4HANA 4HPKA 3MF6A 3PLQA 5IW0A 2HWD2 3WOGA 4A6OA 2C4XA 3K48A 1DLCA 4P9XA 2XGXA 5C71A 4F83A 1QJY3 4JDMA 3AJYA 1NQDA 3VD7A 1MZEA 5DDJ3 1AYN3 1W9TA 1DU3D 3KT7A 4L92A 3RWNA 4BQ3A 1CN1A 2MEV1 3ZFEC 4CUAA 1K5MC 4BQYA 1TNFA 2VCBA 1UAIA 1HRI1 3DKQA 3ETPA 2XJPA 1YQ2A 3HEIA 3APBA 1EYBA 1GFF2 2W1WA 4IGPA 1VB2A 2XVGA 4ARXA 4A42A 1ULCA 4MH0E 4RSUA 5A7QA 3W59A 5L36A 4N53A 3ASIA 3ZSKA 2JE7A 2PHXA 1YCIA 1OLME 1T6GC 4KWJA 1PO11 2ZAHA 2RDRA 2Q8DA 5IVEA 1GNHA 1PO21 4YWAA 2P3JA 1BKZA 2ARAA 1WCQA 2A3XA 3NJZA 2KD7A 4Y1UA 3C8XA 1F5JA 5C3QA 1HV0A 2LM3A 1IQDC 2EXJA 3PU8A 4JRLA 4W6WA 2E9QA 3SH5A 1PIV2 2UY8A 4DNYA 1PGL1 3VD4A 2VNOA 4XJ9A 3NW4A 4K9SA 3AZZA 1QJU2 5LATA 3LWCA 5FY5A 3TEZA 3QBQA 4RGKA 3LQCA 4LHKA 4ZPIA 3IPVA 3ZXJA 4Y1ZA 3WNKA 1C5IA 2D5FA 1CX1A 1V6OA 3ABZA 1RL3A 2KR2A 1IPSA 2IC1A 4YG0A 1ZRRA 4BZ4A 2PHRA 4COZA 3O1OA 3AYEA 4LK6A 1UQXA 4IEOA 4KU8A 4JHZA 4LTAA 4A7YA 2W1SA 4M4RA 4E4DX 4XURA 4ZXKA 4XW3A 5GZEA 5ISLA 3B02A 1GP5A 1JZ8A 3AP6A 1FT9A 4CEWB 5FO8B 5C9AC 2A5ZA 1VBC1 3NAPC 2QKDA 4RS5C 3OGGA 1UKRA 5FPLA 1AR62 3OUJA 4AQTA 4LORA 1OOPC 2QCSB 4QMAA 4XF0A 1NLQA 3I3BA 2BNOA 2JIJA 5GLTA 4QX2A 4AYUA 3DEMA 4OMCA 4Y1VA 3R4UA 4ISRA 4OFGA 4EN7B 4OHVA 2IZWA 2K9ZA 2VW2A 3ILRA 3PJYA 2E26A 3VD5A 1DQ2A 2IVIB 2R1DA 2VBDA 5FYVA 3URFA 4Y1XA 2K2SA 4Q2FA 1BBT1 1LHUA 1NY72 1DQ0A 2VZVA 1OUSA 1V6JA 1EUUA 2WNUC 2WO2A 4LR4A 1OQ1A 1ND3B 3MIGA 4MADA 5KXBA 2P4EA 4FCAA 1BK1A 2NZ9A 2BGOA 2XMLA 2F17A 1T2XA 3KT1A 3ORJA 1NE6A 3CZUA 4A4AA 4GMP3 2RS11 2XJTA 5D8AA 1LEMA 4UW5A 3KSCA 3WR0A 2VZUA 3SH3A 2R042 3NNGA 4FPEA 4LBNA 4XOGA 1I3HA 4AHWA 2A75A 1AL22 4KG8A 1YEWA 4LBKA 3DYOA 1CAXA 2FCVA 1W8HA 4UAPA 2WNVA 4UWDA 4GH4A 3RYKA 5FMCA 1F31A 5FP4A 1COV1 3VD9A 1OXCA 1J1TA 1NQJA 1LRHA 2I74A 1ZBE2 1QIQA 3UJOA 1EAH1 5CG8A 3ZXDA 1WWYA 1QOOA 5J3UA 2Q8EA 2WINB 5AC92 4Y22A 2VQ0A 3LDRA 4OMDA 2B7YA 4N53C 4D69A 1URXA 2YV8A 2DUPA 4XHXA 5K8SA 5A3OA 1BVVA 2XONA 4LPLA 2JDAA 5LY1A 4AI9A 5JWPA 1HXS3 3R6SA 4CP9B 4Y20B 2YGMA 3ZN5A 3T0AA 3BVCA 1XXNA 2O14A 1D4M1 4RQPB 1DIWA 3WVJA 5FYYA 4LK7A 1LOEA 1XYPA 4ZZ5A 5J1XA 2WT0A 2VUDA 2ZMKA 3ZSLA 1AR83 2D3PA 3K46A 2QDNA 2ES3A 3U10A 1VIWB 4ET7A 1D0GA 1IOAA 4BQ2A 1KDKA 5LRRA 2D7FA 2NYYA 3H3LA 4OI0A 3QD6A 1G9DA 4GKYA 1XYOA 2VG9A 5FWJA 3ILFA 4FPGA 4GWNA 2WN2A 5LZ6A 1G9AA 1NUKA 4EROA 2J1TA 2BWCA 3CJIB 3M3OA 4Z82A 4Y5SA 2I2SA 3HBKA 5FBJA 2R30A 3MHZA 4QKDA 2MPFA 3ZXEA 4CCDA 3IDBB 3J7LA 3VZJA 2G19A 4DEVA 3POEA 5EJ1B 1QJY1 3TNQA 3KF3A 1ZBA3 3N36A 2HBUA 1KS4A 2EXIA 1TMF3 5DDJ1 1AYN1 2B9UA 2WIIB 4MO3M 3WP6A 1UX7A 1SDWA 5F6KA 2PQSA 2FZ2A 4D7SA 3J7HA 1H2NA 1WZXA 3LDKA 3ZPOA 5L9VA 1W0PA 4AGGA 2WYSA 2HEYF 4OULA 3NO8A 4MGYE 4BOWA 2HWD3 3O1RA 2X5IA 2OA2A 3HVDA 5F3EA 1X7NA 4IEXA 3MW2A 1S0DA 4ZU7A 2BVBA 3THCA 2AEZA 5CISA 3POGA 1OQDA 3HD8B 2VQUA 4B4PA 3I59A 5I0TA 4CU9A 4XXPA 5G04L 2A3YA 1JZ6A 1WW5A 2XLFA 1GICA 4QT6A 4Q4X2 1S2EA 1XNTA 4XCAA 4BMEA 2WN3A 1YRZA 2PYTA 4IETA 4WVWA 3SISA 1WKYA 1OPOA 4JGZA 4LULA 1MS1A 4L9BA 5EV7A 3IBMA 2PLV2 4I3GA 3O1VA 2LW8A 4IL7A 3AZVA 2RS52 4YGBA 5D8AC 5C8CA 5A7WB 1XNBA 4XDPA 1QH6A 3TNPB 1PM4A 2YBSA 3OGRA 1OURA 4UI9L 2BOIA 1GP6A 1SLBA 2ZX0A 5FZKA 4PT6A 3RZLA 3DPRA 5FPXA 1Z0HA 3LOBA 4H14A 2WZR1 4LO4B 2WNVC 2ADEA 4GH4C 3AXDA 3VDDA 4AF9A 5FZ1A 3Q8FA 4META 2Y0OA 3J8F1 1POV1 3WNXA 4C1WA 3N9PA 1PIV3 4PDWA 2XQRA 3L2YA 2YU1A 5C3OA 2PAKA 3NV2A 4QU1A 3KHBA 1DBNA 2Y6JA 2YPDA 4HG6B 2R0HA 3UL2A 3ZM8A 3BB6A 3EMRA 4IUGA 4HKOA 4WM7A 1LJ7A 4G9SB 2XVKA 3JBG3 2OUHA 3WW1A 4IXLA 2BBVA 4QXHA 4B8EA 3U07A 4AL9A 1I1EA 1H8TB 2VPVA 4Q8KA 5JOWA 1R1A1 2R7EB 3IAQA 1DZQA 2FMDA 1PZ9A 4OQ8A 5EJZB 5LY2A 5HBAA 3BI3A 4BQ5A 1S0BA 2BGPA 1GV9A 3FJSA 1SLIA 3H1MA 2GALA 3NL1A 3GALA 1TE1B 2QQOA 3ZFFA 1JU4A 1IS6A 1N3QA 3C7FA 1OLQA 4M3CA 3Q8BA 3OJBA 3ZYRA 4GMP1 1QOSA 3O7OA 1RMU3 4LBQD 1NA1A 3I2FA 4KWKA 5F37A 1M4WA 3TYJA 2W39A 4R9BA 1HB3A 3A4UA 3NNMA 4K20A 2BVVA 1R64A 2RDQA 3NNFA 2Y6KA 1RINA 3FE5A 1DP0A 4MV2A 3T3YA 3NV1A 4QPIB 1DCSA 1GOGA 2VZQA 2WFF2 2R062 1HJGA 4J25A 1FPN3 5FAXA 2Q0AA 4AVSA 2A70A 3AYAA 4JRAA 4UW4A 4MHUA 4LO7A 4MXWA 2VZ1A 2W87A 2X5IC 3VZLA 3RQ0A 1RTVA 3OBTA 4UFKA 4XJZA 1NCQA 4QU2A 4ASKA 5F3GA 1X33A 1JZ4A 5FY0A 1G7YA 2QFEA 1HXS1 4JVAA 4NIGA 3T2OA 4UBGA 3CO2A 4A41A 4ARYA 2RM22 5A3WA 4BMBA 4Q0UA 1GU3A 3I3QA 4Q5OA 1HDKA 3OY8A 5E1RA 1ZBE3 4QHZA 4JGZC 3FMGA 2BU9A 1ZA4A 1Q56A 1JN2P 2XXZA 4OI2A 4YGDA 5KBFA 4Z07A 1KRIA 1HJFA 4Q4V2 4PLNA 5BUVA 5C8CC 2D6PA 4AWDA 2Q4SA 2PHDA 4SBVA 4XXAA 2Q8CA 5EQUA 2LTNA 2GDFA 4ZXEA 2J22A 3PUAA 4Z2AA 4TSVA 3DPRC 4CDWB 1BVP1 4HK9A 4KBZA 4MX3A 5GZDA 2DCKA 2W5FA 1AJOA 3VDDC 1GNZA 2VMFA 3FBYA 1AXKA 2ZEZA 4P5YA 2DFCA 1ZBA1 2E32A 3VDCA 2O8QA 1OVSA 4XMAA 5FZCA 4EZHA 1TMF1 3MEPA 5BNPA 4IDZA 2G4IA 4PDWC 1KGYA 3H1WA 2ZABA 1P8JA 5D1IA 2FDKA 3KS7A 4QXBA 3W9AA 4V1PA 1UMZA 4LOTA 2ZZQA 1RUJ2 4IEWA 3GXUA 4QPGA 1VBE3 4BA6A 3BCWA 4AOCA 5K0UC 5T5OA 1ND2A 4WM7C 1I9RA 2RS31 5EZWA 1IGOA 1MVEA 3AL5A 4QGLA 2DVDA 5DG1A 3WW4A 2WABA 3HNBM 2G9ZA 3WDTA 2VW1A 2AR6A 2B5HA 5F2SA 2WAAA 5B4XA 5FYSA 3FHIB 5FPVA 5GKAC 3ZYHA 2AH2A 1H9WA 4LNVA 5A80A 3MLJA 3DKWA 1YUDA 4DY3A 3V56A 4P14A 4CE8A 4DXRA 2PHLA 1LHVA 1UMHA 3D82A 1PVC3 3ACGA 3AMPA 5A32A 3E5QA 1YHFA 3OD4A 3ZFFC 4AQSA 4BH9A 4I2OA 4XFHA 2YZ4A 3MF9A 1R1ZA 4CUBA 3T09A 3GF6A 3KWVA 4XZUG 4BK4A 3VBSA 3USUA 2D40A 5FZ3A 4AK3A 4ONUA 3Q9OA 3KQRA 1RUH3 2P6HA 1WGPA 4UF0B 4DINB 4M3CF 5ACA2 2R49A 3ZXGA 3WNPA 5I91A 1W6PA 3OEBA 3HQRA 3WG4A 2ZMLA 3PU3A 1TZOA 1EV12 1H1MA 2PXJA 2VMCA 3VGIA 3WY6A 3WF0A 4JTNA 2R6QA 1GBGA 3SEPA 1LOFA 2VZOA 3K2OA 5FYTA 3K77A 2B45X 4YVSA 2WNEA 4BU2A 4HT1T 4J1WA 1D7PM 2RS53 4XJUA 1NCQC 1OT5A 2GAUA 1JODA 1QXPA 5C5TA 1NLRA 3RJ2X 2HWB3 1R081 5FZIA 5LBBA 4XJWA 3RI9A 1O5LA 4A6SA 3T4HB 4NAOA 2OPKA 3JBG1 1B35B 1UNBA 2UWCA 3GDBA 3WDXA 4BHPA 2Y6LA 3HAGA 2WZPP 5HV4A 4HL0A 3KGLA 2UWAA 5FMBA 2WQZC 5FYMA 5J09A 2H6BA 1NCRB 1J1LA 1W9YA 5F1RA 1ASJ2 3LDBA 4DIQA 4EE2A 1KDMA 4QXKA 4XQWA 2MNGA 5FJKA 1GANA 1SZBA 4AI8A 2L9LA 1XPWA 2LALA 3VHRA 1UPIA 2KXLA 2CU5A 2H0VA 4LO5B 2JE8A 1DFQA 1PMIA 4NHKA 5LBEA 1YI7A 4IE0A 4C0BA 1W6MB 2Q5TA 4CDQB 4CDXB 4QGMA 5FK8A 1RMU1 4GB31 4QQLA 2WFPA 5FXXA 1VB4A 1GZWB 1DG6A 1IKQA 1NAEA 1RUF2 1KEXA 1OFNA 1XE7A 2C6SA 1RHI2 2D97A 2J42A 4RL7A 2CDPA 3MIEA 4XTMA 5FYZA 5A7NA 3WF1A 5BNPC 2UU8A 1OH4A 3WW2A 1GOFA 1V00A 2G1MA 2ZGLA 1TME2 2RJKA 3ZMOA 5FYIA 1W2AX 5HI0A 1R092 1KITA 1SLLA 1FPN1 1V9U2 5JPNB 3AKSA 4CEYA 1LAJA 4ASLA 1MEC1 1GMMA 1QJFA 2JX9A 1HX6A 4TWTA 2ARBA 4JTOA 2YGLA 4AVBA 3FLPA 4NHLA 4IERA 4AR2A 3M1HA 1H2LA 2XDVA 3NKGA 3ZFEB 2GNDA 2OW4A 2VR4A 1K5MB 3VV1A 3ZYGA 1IPKA 1ACCA 1DQ1A 2SBAA 1QJEA 3LSDA 2V4AA 5IJRA 4COUA 3I2KA 4YLZA 1O7FA 2EIBA 1Y7BA 2WFF3 1O5UA 1FMD1 1A3KA 2R063 3AYDA 3PVEA 2ENRA 1O4YA 3ZYPA 5JOXA 4NIDA 2HWC2 3ZYBA 2P3YA 4QX3A 1RB8G 4FPLA 2YHJA 4V2WA 4BE3A 5A70A 3IMNA 1OKOA 5A7SA 3VBSC 4XABA 3O0VA 3VBHC 3USSA 4K21A 4EV0A 3WHTA 2RJLA 3OPZA 3MZHA 2VY0A 3K75B 2XWBB 3L2HA 4NRMA 1S0CA 3O1SA 1W6NA 3LCPA 4Y5Z0 4UXAA 2VGDA 5FPUA 1JZ5A 1FNYA 4DZGA 3OGVA 4B29A 1G8WA 4K1YA 3A22A 5F5QA 4YZ4A 4M0HA 1LOFC 3VUOA 1TNRA 3JU9A 4NO4A 4DQAA 4YVSC 2A6WA 1D2SA 1LR5A 1UO9A 1IG3A 1OPMA 1LHOA 3NNJA 3ST7A 5L7OB 3ELNA 2ZHLA 4Q4V3 3J9SA 3EJKA 3MPBA 2X53S 2GC3A 3I7DA 1VBE1 1XSRA 3LF7A 4XEZA 3UT0A 5FP3A 1JYXA 3DV8A 4GXLA 5LWBA 3HIFA 3P6BA 3BPZA 1NX9A 4QB6A 4EN9B 2XG3A 4QX1A 3VBOA 4BM8A 1A8MA 3D0JA 3CKHA 3I3EA 4QDRA 2RMU2 4CUGA 2A1XA 1W99A 1YI9A 5DAPA 1PNGA 5JI7A 5C9AB 2P3KA 3NAPB 2JKBA 3HMYA 4KG0A 5T54A 4RS5B 4E2SA 5IK7A 1SFNA 5FFOC 2LRPA 3LPGA 2D6OX 3ACLA 3OOXA 5FKBA 2FDGA 1HN0A 2UYAA 4YW4A 4YW2A 1RJ8A 1RUJ3 1PVC1 1OOPB 1ENSA 1UYXA 3JQWA 1UIKA 3S5QA 3BU0A 2JDPA 2PQQA 3AC0A 2JG9A 3EB7A 1D4VB 3BYWA 1YYNA 2DFBA 4MSVA 5EJ3A 2VJXA 2EIEA 3KLSA 3H3UA 4Y1YA 5JMOA 3VZMA 1OUXA 3HWJA 3AP9A 1W6OA 3Q8CA 3SKJE 5JZGA 4RHV3 4GWMA 2DCYA 2DBNA 1RUH1 4E27A 2WNUB 2ZAAA 1OSGA 4MYEA 4I01A 4HPKB 5C6CA 4YM0A 2VOWA 1RUD3 2BEOA 1DQ6A 4CEYC 3WX5A 5C3RA 1NYWA 2CNAA 4JKMA 2DVAA 3WQ7A 3V64A 4Y24A 1Z78A 1QNWA 1VRH2 4O65A 1V6KA 3FL7A 3UKNA 2VE1A 1PGW2 2HWB1 5FZ9A 1UYYA 4XJ8A 1V6MA 2GMMA 2RR13 2XJQA 1JYIA 4XMIA 2J1VA 5ACA3 4UW3A 2VMDA 2WSVA 3KV5A 5L19A 1EV13 3VKMA 5FZDA 2R32A 3FC0A 2B4KA 5IAXA 2AACA 1PX3A 1AR92 4N53B 5HCBA 2D3SA 1CAWA 1V6IA 3RZMA 1WCDJ 1YO8A 2FBEA 2CAUA 5CG9A 3HN3A 1S4CA 2GH8A 3L9JT 5JOYA 4UYBA 5CFDA 5CNAA 1U5IA 2PHTA 2WWUA 5DMYA 3THDA 2NMNA 2BNNA 1UXXX 4DO0A 1LTEA 1WMXA 4YNIA 3HPNA 3KZ4C 2VUAA 4E8CA 1G9FA 1QNYA 4HSJA 4AFMA 5A7OA 3ZR5A 3AVSA 4LKEA 4QAWA 3TOJA 1VBB2 5CKNA 2A73B 5LBFA 3OYWA 3GZEA 3FX3A 4PLMA 4CP2A 2ZX2A 1HRV3 3IPVB 4FO9A 5FZAA 4CVUA 1HB2A 1YWKA 3I2GA 2GN3A 4QXCA 2HEWF 4QDSA 5IYYA 1NKGA 4R9AA 2A6XA 1W05A 4ZONA 2V72A 1WMFA 4WVMA 5IUQA 4A7KA 2WA4A 4KNCA 5JIUA 3T2TA 5BY5A 1F4HA 3ZYFA 3VBOC 3PIJA 2DBIA 4L0PA 3AXEA 3I97A 5C5UA 3KVBA 1RUF3 5AVAA 2A6ZA 2YU2A 2VMHA 3I3MA 5I8TA 2LROA 1UOGA 2E63A 1C8M1 1VBA1 3GGLA 1TME3 4OHZA 1D2QA 4HVOA 5ERLA 1PK6A 1R093 2IUWA 3AKPA 3ZLIA 3MV11 2JG9C 1VMJA 2VOTA 1RUC2 3SCHA 3WNNA 1OC1A 5JAXA 5JR2A 1I5ZA 4D7YA 4DRVA 2XJRA 4IW3A 3H0OA 2A6VA 3LB9A 4EZ4A 3I2OA 1HB1A 2XLGA 1RVF1 1ZA7A 5KR7A 5JZGC 4Z8BA 2A7AA 2ZGOA 1F35A 1UW8A 2ATFA 2WC2A 4DEQA 2WBKA 3SKVA 2ZPXA 3MW4A 2J1RA 4LHLA 3RGBA 2DYCA 4NWVA 3PURA 1BMV1 3OPWA 1LNSA 4XF3A 3RZJA 4NUBA 5A33A 1X8EA 5CVRA 1MPXA 1DQ5A 3BOWA 5D8AB 3ZIXA 1QJX3 3BPSA 2GN7A 2V73A 4FPJA 3TEXA 2VXJA 1JZ2A 4AAXA 4V2VA 4FOYA 4GULA 1SLTA 3KV9A 1RUNA 3POJA 2W3JA 3JD72 3VBUB 2HJIA 2WNVB 4GH4B 2WS92 5E16A 4E4SA 2J1UA 4MGQA 1XSQA 3DYPA 4FFHA 3N7MA 5LW9A 2PAEA 1FV3A 2F4PA 4ASMB 4NPRA 4RR3A 1MACA 2FHRA 3HNMA 4XDOA 1O59A 1REDA 1SACA 4Y22B 1L7QA 3S30A 5KXEA 3RZKA 2HEVF 3ILNA 3AP5A 3UJQA 2CGNA 4WM8A 1BHGA 4IV1A 1RIRA 4YM3A 3CMGA 5FJHA 3IT8A 5JXIA 2QQKA 1SCRA 1RXFA 3Q8EA 1VBD1 2JJ6A 2TUNA 5C4WA 2AUYA 4AQ2A 4EWAA 5CFDC 3EQEA 4QGNA 4DOUA 4LITA 1GR3A 2XPJA 4OHYA 2IXLA 5M0TA 1JYCA 4WZFA 4BCUA 5FZBA 4I30A 4INDA 4AZZA 2GMPA 4KQ7A 3ZKYA 2RMU3 1Z7S2 4DXTA 2KA3A 2RE9A 2D6LX 4IEVA 1L7LA 4FOQA 3ZPYA 1XNAA 5FPBA 4RHV1 3SEEA 3CEWA 4OCTA 5FY8A 1CIYA 4RGGA 3KCCA 3B94A 1QQP1 5JLVA 1F4AA 1WA6X 1LOCA 1RUOA 3MUY1 3KF5A 4UOJA 1RUD1 4QM9A 4DUXA 1JZ3A 5EPAA 1PMJX 3V65A 3SCGA 1UF2C 4BQWA 3OUHA 5GLUA 3HR9A 3FLTA 4H55A 2IXJA 2VL4A 1UU5A 3ME2A 2B46X 5IHRA 1RUI2 3ZSJA 2AZ5A 3LFIA 3NSTA 1H4HA 1W3XA 4A2UA 2DCZA 1RYYA 4COVA 5JR7B 2RR11 3MUZ1 3WZ1A 2CTVA 5C70A 1GZCA 4CYDA 4G4FA 4MGSA 5IT6A 2OQ6A 4WVZA 1HB4A 1QGLA 3N9MA 1PK6C 3HN1A 3NMBA 1IS4A 4SLIA 4HKWA 2X5IB 3BN6A 2GP3A 3G6JB 4Q4W2 4YZ1A 5IVCA 1W0OA 2PA7A 2W46A 4ZHNA 4A3ZA 5FP7A 3LKJA 3I59B 1I6XA 1ZYBA 1LB2A 1N1SA 4ZS3A 4BPZA 3TEYA 4CXYA 1W03A 2JENA 2QQJA 1CAUB 4IE6A 3NV3A 4Q29A 3VKNA 2JD4A 4XBNA 2VZPA 1RUE3 1RUG2 5BNQA 5FZFA 1CX4A 1S2BA 4JGZB 3O1UA 2HWF3 2QQWA 4BK5A 1LEDA 2PTMA 3WNLA 1ENXA 1FOD2 1W8OA 3MICA 4I0BA 3ZXFA 1AR93 5J96B 5C8CB 1JOBA 1HIXA 1VMFA 1HRV1 2J1AA 4PF1A 4XILA 3OB8A 2VQTA 4WV8A 2O8OA 3DPRB 1CR7A 5CAZA 5F3IA 1CZTA 3VDDB 1AYM2 1BEV3 4FOWA 3BODA 1JHNA 4BB3A 2D98A 2VCCA 2ZGQA 4W65A 2C24A 3MIBA 2Q30A 1JMUB 2VMGA 5I0SA 3TN92 4PDWB 1VBB3 3FHQA 5KWRA 4M0NA 4XAEA 5A1AA 3J4UH 3WF2A 3ZFGA 4AFBA 4B3NA 4M3CE 1LOGA 4IV1C 3GM8A 4YW5A 1WW4A 4BIFA 1K45A 5K0UB 5FY4A 2Z5WA 2XBO3 3KV6A 4WM7B 1UYZA 4FXGB 3LPFA 5FZ0A 5C4WC 3B9CA 2HWE2 3AKRA 4HZFA 2W68A 2ZXQA 4IEUA 4FFFA 3T0BA 1J84A 2E7AA 3RVHA 3E97A 1X9TA 2R072 3POFA 1NG0A 2VD7A 3O12A 5T55A 4D8MA 4O9EA 4Y33A 1AX1A 4PCRA 4XUTA 1E5RA 1WLWA 2P17A 2QQNA 4NROA 1XBFA 2WLQA 5F9TA 5I0DA 4OYUA 3I49A 5DAVA 1W6QB 3WUCA 4NWWA 2BWAA 4Q4Y2 3D6EA 3N9LA 3ZFFB 4NIHA 3U78A 5F3CA 4GD4A 4M3CB 2WJSA 3AMMA 4FPFA 5L73A 3ZYIB 1AX2A 1FYUA 4FPKA 2ZEYA 3HOBA 4GALA 1A6CA 2XOMA 3N9QA 4PHZA 2QQLA 2ID4A 1QJX1 5FWEA 2X8KA 3M4FA 3A7QA 1OA3A 4D7TA 4Q0VA 3LEMA 4BXFA 2A71A 4R9CA 2HKXA 3LZZA 4MGZE 3S7EA 2A3WA 4CTEA 1W8WA 4E2GA 2GZWA 4PQQA 1JUHA 2C1FA 4QWNA 4AVAA 4IE4A 2BZDA 1Y43B 1UIJA 4CZSA 5DUUA 1Q8QA 1GQGA 1WCUA 3OGJA 2W52A 3POYA 4ES9A 5IFTA 3MIFA 1OHFA 1SLAA 4Y20A 1ZZ9A 1US2A 2F4LA 2BFUL 3SITA 1NCQB 1WBFA 3WQBA 4QQ2A 1H30A 4TZDA 3AKQA 1QJU3 3R05A 4NAMA 3ZIWA 1CESA 3WG1A 1IS3A 2P37A 3UYJA 1UZVA 3SC7X 2RDSA 1JTZX 5DZEA 3MDPA 4FPHA 1W8UA 3OSDA 1JYTA 3OY8B 4IE5A 5A6ZA 2VNVA 1S2KA 3VKLA 3PVBB 4LBQB 2YFUA 3UKVA 3X29B 3ROUA 2WSUA 3VZNA 1AR72 3T1LA 5BNOA 2RV9A 5B2GB 5FPAA 1F5FA 1VMHA 4OLLA 2E6VA 5A6XA 1YIPA 2GC0A 3AMNA 2J7MA 2EAAA 4FSJA 4L99A 3I2IA 1QOTA 4F7ZA 4XACA 3FUOA 1TG7A 2CGOA 3GCWA 3I2JA 1AR63 2OVUA 1XOYA 2Y33A 5CU1A 2WT1A 3B9IA 3PNAA 1SPPB 3AZXA 2IXHA 3AMQA 5K9YA 3HQXA 4LO8A 1LGCA 5BNPB 1OA4A 1Z7S3 5BYNA 3ITQA 5F2WA 4BYYA 1NXD1 3ZFGC 2ZA9A 1XYNA 3CJXA 1DGRN 3GJAA 2QVSB 3H42B 4LOSA 4U36A 4ZS2A 4CXXA 2X05A 4E8DA 3RSJA 3DN7A 1LENA 1PHMA 3AL6A 4QKFA 5FYCA 5I0UA 2ZHKA 1WBLA 3RNSA 1REFA 5FYHA 2QE3A 4LBOA 2C9KA 3U1XA 3ECQA 3M3CA 4NHXA 4NHYA 3D5OA 1CQ9A 4FQ4A 2W0XA 4Y4RA 1GP4A 3POBA 4LBJA 3PUHA 4HMZA 2WO3A 2Y64A 3IDAA 3W21A 2R043 1SBEA 3ZR6A 2VMIA 1J59A 5F8PA 2VTFA 2GH2A 1AL23 5A32B 4CCCA 5HCHA 3RMXA 4P02B 5FDBA 1RUE1 1S0IA 2IXCA 4HOOA 3WSOA 5JOZA 2HWF1 1UY0A 3OBAA 4NIAA 4DXZA 2YUEA 2NM1A 3T2PA 3BTZA 2MEV2 2BOJA 3M70A 3AB0A 4PBPA 2D6KA 3VBSB 1HRI2 3P1IA 1AR81 4FVVA 3USUB 3VBHB 4I09A 3ZSEA 1L3JA 5AC93 4AEDA 5A3PA 5DN2A 3N3HA 5FYBA 1APNA 3DGTA 2G9GA 2QTWB 3ZN6A 1U5XA 3ETQA 4CPBA 3OCPA 3T08A 2HYXA 1AXZA 5DAXA 3MW3A 4HETA 3K4AA 1BEV1 1PO12 3MFAA 4HBNA 1PO22 1RUG3 1TVGA 2W1QA 3IDEA 2DV9A 2WZEA 2XR4A 3VZOA 4YVSB 4L11A 3UGHA 5A6QA 2YB7A 4XTPA 1CZSA 3JCIA 2ZGTA 5EWSA 5FBZA 3NJXA 3H1YA 1W0NA 3LOIA 5EIYB 2WT2A 1PGL2 2XBO1 3BTXA 2FDJA 1H8TA 5LB6A 1CGPA 1FATA 1OD5A 4L8QA 2JECA 3VHOA 4ZKTB 1SDDB 2HWD1 2ZOEB 3CF6E 1ST8A 4XIOA 1W9WA 1EY2A 4LKFA 4MGKE 4W6YA 3JQXA 3J26N 5BNOC 1SBDA 1QWRA 1NZIA 3TRSB 3C2UA 3OEAA 5HXMA 2OPWA 2WQ8A 3KV4A 3POWA 5FZGA 4LEJA 2HLEA 4LUKA 2E33A 2GNBA 1QY4A 3GYDA 1VBC2 2HWE3 3B00A 3RG0A 2JB8A 2QZ3A 4XIKA 5T52A 1VP6A 1C1LA 5CA6A 1UCXA 3HNYM 5E6HA 3SLIA 5D2AA 2JXAA 4CU7A 5C33A 4CUCA 1UZYA 1YC61 1NA1C 2DCJA 1JXNA 2GU9A 5LEJA 1W3VA 4BQ1A 3VBRA 1NLSA 4BISA 2RHPA 2WWSA 3G7DA 4IE7A 2JEMA 2ARCA 4D0QA 3V0BA 2FD8A 1E57A 3LSEA 4Q4X3 1N3OA 3LIGA 4XF1A 1BBT2 4YW6A 5KHJA 2RDNA 5FOBB 5CZKA 1PIV1 2GNMA 3MO4A 3PVOA 4NPMA 3S57A 4AVCA 2BPA2 1WLDA 1QJU1 2PLV3 3EXUA 1POV0 1VLNA 4O7XA 5D21A 5GALA 5FO9B 2XJVA 3THTA 3AKTA 1J83A 2CSGA 1JYWA 2WA3A 1E5IA 2RS12 3H3ZA 5C8WA 5A3MA 3WINE 2EIDA 2ZBJA 1G9BA 1LU2A 4KL1A 1PNFA 1YQ6A 4NRQA 2OYZA 3WF3A 4CDUA 5FZMA 4OHWA 4BLIA 1DGWA 3ZDSA 2J1SA 2TNFA 4WZCA 2PMWB 4ZU4A 4N43B 2R0FA 1COV2 3UKTA 3E6BA 4AEDC 5A1LA 1EAH2 4XJAA 1QU0A 2ETEA 3OTFA 1HKDA 4LKDA 3PMEA 4B7KA 3V0AA 3S5AA 3O0WA 1W6NB 4JHTA 2AENA 4YRDA 5FQ0B 4TTGA 4Y5TA 4XUPA 4RFRB 1AR61 4XF9A 1EPZA 3H7YA 4CU6A 3RYPA 1BYHA 4C8DA 1Q8PA 1U5ZA 5CIRA 1AUYA 1YJKA 4CCMA 5ABJA 4JX0A 4NMIA 1IQAA 4FT8A 4YFZA 2C9AA 1D4M2 3BOPA 4K40A 4EN8B 4P5HA 1W2OA 2JKXA 3RS6A 5IK5A 5IK8A 2GP5A 3GBGA 3AYCA 4EN6B 2NP0A 3ZSMA 2NN8A 4NR1A 1ULGA 4TXWA 2DTYA 2FQPA 2WAOA 4D6RA 1Y4WA 4MVTA 4QPYA 1NY71 1H6YA 3LE0A 3U4XA 1LHWA 4LO6B 1GZ9A 2ZKLA 1ZZBA 4QPGC 3VBOB 1HW5A 1QH7A 4XFGA 1ND2C 3HT1A 2DUQA 1C8NA 1SFPA 1G86A 1UX6A 1VAVA 4HK8A 4KWLA 3WDWA 2ZHMA 3UGGA 1UMIA 3POIA 1O3QA 3EO6A 5CYYA 5F7UA 4AEMA 3GZUC 2XH6A 4ZU5A 1RXGA 5FO7B 4AVTA 1DZTA 1GQHA 2R041 1VAKA 3I3DA 1QJY2 1WUVA 4P00B 3HJRA 1AL21 1VALA 1XNCA 4N7UA 4RGAA 3B93A 4XFIA 4LIVA 1AYN2 1YFXA 5DDJ2 5E89A 3M7AA 1CAVA 4FTSA 1X9PA 1ZBE1 4UF0A 4ORFA 1MS3A 4HLTA 4LJHA 1N1TA 2Z79A 5CKQA 5AC91 3OF1A 5JZGB 4ES8A 3WDVA 1IKPA 2DU0A 4FBFA 3WQ1A 3M3QA 2EAKA 5H9SA 3KM5A 1H2KA 2JIGA 2PAMA 2PELA 4UW6A 4NOTA 2GNTA 3VBRC 4N9HA 2JICA 2RM23 2VZ3A 3AZWA 5JXJA 2XKOA 4UT5A 1E5SA 5GZGA 2B8MA 4LE3A 1JYNA 2MEV3 4JGYA 2BYVE 2BERA 2W94A 4JZRA 3W5NA 1UU6A 5LA2A 3PIGA 3GBFA 1RJ7A 2W08A 3KT4A 3IIAA 4LA3A 3IWZA 3O1TA 1DZRA 2ZKNA 4YZ2A 1OQEA 1X50A 2IVJA 2AEYA 1PO13 2PN5A 4CDUC 1HQWA 1PO23 4R4ZA 2QJVA 3PTRB 4BWOA 4DB5A 3C7EA 1LULA 3NJYA 3A0KA 3CIHA 3POSA 1CAWB 3FLRA 4IV3A 2WZR2 3E5UA 3LA3A 3W5MA 4YARA 1UY3A 3MPPG 3TAYA 4IEYA 2ZCWA 2VBPA 3HBZA 5JXGA 3J8F2 4CDXA 1W6MA 5CFDB 4CCOA 4UFLA 5FLHA 3ZXAC 4QQPA 1GZWA 4UFHA 5IATA 3CL1A 4A7ZA 1JHJA 4OI4A 1HV1A 3FBMA 2P3IA 3WHUA 4B7EA 3MV01 1YFWA 3ZN4A 1S0GA 5JCTA 2Y26A 5ABJC 4XBLA 2ZACA 2DURA 1UKGA 5DABA 1W2UA 1ZZ6A 4QX5A 2Z2SB 5AFBA 4CU8A 5IVYA 2BV4A 4OI1A 4FPYA 4HSLA 2ZEXA 5BXXA 1NE4A 2JDZA 2QZ2A 3QH7A 1ODMA 3IB3A 5FZ8A 1QXJA 1UN1A 1R1A2 1W8TA 2TBVA 1CJPA 2VMEA 4Q4X1 5J37A 3ZXKA 1IG0A 4P9IA 1VBC3 2R1BA 5FR3A 2UY9A 2AGSA 4JCKA 5A3NA 1H0BA 2QQIA 4YG6A 1UL9A 1C3HA 2BTVC 4EYUA 2VVEA 2BQPA 2X09A 1MZ5A 2PLV1 5KXDA 1C4RA 4XBQA 2RS51 4LMFA 2VOXA 1KFXL 2EVXA 5FK7A 4KGQA 1OMIA 1VAMA 1PK6B 2QNKA 1UZ0A 4YZ3A 5F5IA 4D6SA 4GJYA 2VCAA 4GWJA 4CP0A 4L97A 4YW1A 1O3RA 1UY1A 1Y9MA 4BQ4A 4PIXA 5LK7B 1OH3A 1S1AA 2B39A 2VM9A 3NKTA 4I0WB 1CVNA 4Y3OA 4YGCA 3LD8A 3QCWA 4P9GA 1C1FA 4KH9A 5FOJB 3RZGA 1H2MA 1SBFA 2OT7A 1OA2A 2WYFA 5AFEA 4Y4YA 3DL3A 4F8AA 3WP4A 1HXS2 5L7OA 4NPLA 5FMOL 3BIEA 4AW7A 5FZOA 3FWEA 5A33B 1YFUA 4MGIE 1O91A 4XUQA 5CFCA 5FUIA 4AHYA 2QQPA 2ZMNA 2ERFA 4JGYC 3VHNA 4HKLA 3WT3A 1W9FA 1XC6A 2ZGSA 3B69A 1OLRA 4AHZA 4P9WA 1ASJ3 1E5HA 1Q8SA 1YJLA 3U14A 1O6UA 1H6XA 2DCTA 3RI8A 1Q8OA 3FUQA 3WLUA 4XHBA 2D43A 4PI2A 3AVRA 2VVFA 4Z2WA 2VUJA 2DTWA 3PUQA 2P1BA 2Q1FA 4XUNA 1OOPA 2WQ4A 4FPCA 4IGOA 5F32A 1AHSA 3TWIA 4IV3C 1D4M3 1OVPA 3QH6A 4IV1B 5SV8A 5TSWA 4Q0SA 4K7JA 4AAPA 1I5PA 3MBWA 3WXPA 5K4LA 3VHPA 1RHI3 3H8UA 1LESA 3A23A 4CDXC 5C4WB 1ZBA2 2ILMA 1Q43A 1BCXA 1TMF2 4DFSA 1CPNA 4XFAA 5LA9A 4A3XA 2FCUA 3M3IA 2WFF1 4YZ5A 3JB4C 2GMEA 2R061 1V9U3 2CL2A 4E2QA 5LASA 2JE9A 5A3LA 4IGQA 3UK9A 5DAQA 1XE8A 4H2AA 3OD0A 3VL9A 2P6CA 3JUUA 2RS32 3ACIA 3T2QA 3AX4A 2Z42A 3THPA 4LQRA 1MQTA 2Q1MA 3E6DA 2V4VA 3F2ZA 4S2HA 1Q8VA 2Q1ZB 2JG8A 3DCQA 3S7IA 5BNNA 2RM21 3K4ZA 5LA0A 1F2NA 5FPZA 4CXWA 1BLZA 1NOVA 5A3UA 1XRUA 4JDOA 5E8AA 2BNMA 1STMA 2ZX3A 5I93A 1ULOA 1GQPA 2DUOA 2HWC3 5T5LA 3RRDA 3VBFA 2BJSA 4HVQA 4FP3A 5A1FA 4XETA 2QQMA 4K8RB 4Q4V1 5KHGA 3WV6A 4LHNA 1ZZ7A 1CAXB 2WDBA 2VOVA 3PVNA 5FZ4A 2V5YA 3IAPA 1QEXA 4K8FA 4IEZA 2VXRA 2GC2A 5JXHA 4GKXA 5DZGA 2W1UA 3DXUA 5CBLA 4OUEA 5JI9A 3WP3A 4RA0A 4AEJA 3R4SA 2E51A 2WKKA 4O9GA 3ZYJB 5FLIA 1M06G 4A44A 1GWMA 5JIAA 4X8PA 3KQ4B 4IEQA 1YQ5A 2RVAA 3KCYA 4YVWA 3K3OA 4AG4A 3I2DA 4AQ6A 4XYXA 1O3TA 1LGBA 1RUJ1 2YYOA 1UOJA 2VZRA 3MLKA 2ZTNA 4B4RA 4AEKA 4LA2A 3NQHA 5KHIA 5L7OC 1WCKA 1KS5A 1R082 1YNAA 2VAUA 2A6YA 5FIXA 2Z4FA 2DU1A 5GZCA 3AZYA 3JBG2 4XC9A 5CFCC 4MOAA 3RPQA 2DF7A 2WZR3 5KHKA 2XUEA 2ORZA 1PGSA 4D3WA 3J8F3 1POV3 4FAHA 1XE0A 1ONAA 1HQNA 3IIIA 1W39A 4FOVA 1K42A 1UY2A 1F8VA 1QDCA 5A7PA 1MZFA 5GM0A 1SHWB 5IK4A 5C3PA 1X82A 4GAZA 3TB0A 1AXYA 2ZGRA 2D5HA 3WW3A 5AVPA 1LHNA 2C0ZA 3ZFGB 1LU1A 4K3UA 1OI6A 5CEHA 2DVFA 5A3TA 1RMU2 4GB32 4DUVA 5LRSA 3MYXA 4EQVA 1PZ7A 3RWKX 4CA9A 2XWJB 5ACA1 4DXSA 1DGWX 1R1A3 1SMVA 4PLOA 5J48A 5DQ0A 1VJ2A 1EV11 4Q0PA 3WCRA 2FZ1A 4R4XA 1XJAA 5H9RA 4LHSA 1EPWA 1IZ3A 4BXSV 3ACHA 3J7MA 1FPN2 4IQPA 4JC1A 1OBNA 5FREA 1K12A 2O1QA 3IKWA 1MEC2 1VRH3 4QDQA 1WMEA 2Y6GA 1G6NA 1U5YA 3AM2A 3AP7A 5G05L 5IAVA 2H6CA 1MQTC 2E7QA 3CZJA 2YBPA 4I0AA 4OZOA 4PF5A 4AI1A 5T50A 2JG8C 5BNNC 4GWIA 3BU7A 3KD4A 5F39A 4PIYA 1DYPA 2UURA 2LS6A 4AFCA 3T4VA 3VBUA 2BDRA 5IFPA 4R8HA 5B4NA 3ES4A 1FMD2 1OLMA 5H9PA 3N35A 4L2NA 2OKXA 3VBFC 1ASJ1 4PJYA 2VNRA 1DHKB 4AFAA 3VDBA 1H9PA 1X36A 3KB5A 3KHCA 4XF4A 5ANQA 4B4QA 4M4PA 4O61A 4HONA 4ATFA 2WLPA 4ISQA 2C5DA 3N9NA 5FZLA 2AYHA 4EWEA 1YQ8A 4ZZ8A 5JMCA 2CYFA 5FY9A 1XQNA 4CEWA 2BBAA 3WNOA 4AGRA 1O8PA 3IDCB 4YPJA 1WW6A 5EYXA 1K3IA 4RR3C 4COWA 1XU2A 4Z92B 2WR9A 1GYKA 4LLOA 2Q8OA 1BZWA 1RUF1 4HFSA 4W6XA 5T5JA 1RHI1 2NMOA 3FHAA 3ATGA 4MUVA 4AXOA 1B09A 4WM8C 2WL1A 1LECA 1H1AA 1O4TA 2ZZJA 5HV0A 2QDRA 1TME1 2WO7A 4YVWC 3RMYA 4W4ZA 3OBZA 4U2AA 2CWMA 3C7GA 4E4HA 1R091 4Q8LA 1ZVFA 1V9U1 2R16A 4D6QA 4UBHA 4E4ZA 2XKPA 3WEZA 1LODA 1VBE2 4Y26A 5BNOB 1TQ5A 3CBNA 4BQXA 5FXZA 1WMDA 1UZZA 1IHMA 4Q26A 1ND3A 3O5SA 1QJZA 2C26A 2X10A 1ZRIA 2WUHA 3K3NA 4YW7A 1V70A 2YC2A 4YM1A 4YGEA 2IFRA 4W50A 1BXHA 1FV2A 3N7LA 4S2DA 4CCLA 4ZY9A 1WD3A 3WQ0A 3BUCA 3GHNA 4N7IA 4NN0A 3UNPA 2CHHA 1J58A 5F6LB 1PVC2 1RUC3 3DECA 3IN9A 1QXRA 2HWC1 3SXWA 4NVPA 1NA1B 2XL9A 5DXDA 3EHKA 1UYPA 2YC0A 4RD7A 4QX7A 3ES1A 5CADA 2RS33 1H4GA 1MS4A 3IMMA 1FAYA 2HYKA 2VCMA 4FXKB 2VNGA 4F3JA 3O1PA 3ZOIA 3IZOA 3JB8A 4QHOA 4KBBA 2Y60A 3D3AA 3PJQA 4S2GA 3NJVA 1JZ7A 4Q27A 4DMIA 3H50A 4AHXA 3FFZA 1RGSA 2YBKA 3N4MA 1RUH2 3O0XA 3DYMA 1W8NA 5CB7A 4I02A 4MXWB 4CP9A 5DUVA 1CAUA 3VB9A 1V0AA 1N1VA 3D8CA 4AE2A 1Y3TA 3P3NA 2N7GA 3LEIA 5EYYA 3BALA 1JI6A 2VTXJ 4RQPA 2JWPA 1HLCA 1AL0G 3E1F1 3W20A 5J98B 1Y9GA 1N1YA 4C0HA 2BFUS 4H7LA 4OZXA 5FV3A 3U75A 3MFCA 1DLLA 5EFUA 2XVLA 3RZZA 3JD73 1ZRFA 3C7HA 1GZTA 3I54A 2WS93 3LFMA 2HWB2 3VLBB 1GOHA 4CSWA 4GQ7A 4FTEA 3M8LA 1UY4A 5C7GA 2XHKA 3S0MA 2EXKA 3VD3A 2RMU1 3VBUC 1YFYA 4AEDB 2VOKA 2YC4A 3GJBA 1F15A 3CJIA 2Y0IA 2WRAA 1FI2A 5FZ7A 3ZN6B 5JVVA 1UD1A 5IVFA 2IXKA 1O8SA 2J1EA 3D4KA 2G9FA 5HCAA 3C3VA 1ODNA 3CLPA 4P08A 4GZ9A 5FMDA 1US3A 2YDEA 1S0EA 2BUKA 5LEKA 2K46A 4YYOA 2JDUA 2OQ7A 1F9KA 1R083 5K0UA 2YFZA 4NE9A 4CEWC 1ZRDA 1ZREA 1LGNA 3CNAA 3LGRA 3BTAA 5SV5A 1NZCA 4KU7A 1LOBA 1W8ZA 3UETA 3PDQA 4EJRA 3PTYA 2JDNA 1JS9A 3EYPA 3ZVXA 5GZFA 2W47A 1BQPA 2RG4A 3TEWA 4S2FA 4QPGB 4UFIA 2YXSA 3LA7A 4KWUA 3WG2A 1V6LA 4M01A 4XZPA 1ND2B 1QHDA 3C7OA 4CPBD 1WA4A 3WDUA 3U0ZA 2QUOA 4QX8A 5LA1A 3PL0A 4CCJA 3HT2A 1W6QA 1AZDA 1PZ8A 2IWGB 4CCEA 1MS8A 5HCFA 2BW8A 2NLRA 4COYA 3RFRA 1RC6A 1MS5A 1VRH1 3AFGA 3E5XA 3LIHA 2VQAA 5FKCA 1ND3C 1UPSA 1UWWA 1RUI3 2ZX4A 4QD2A 1PGW1 4GB33 1H8VA 1MZ6A 4LBMA 3M2MA 4NIIA 1GWKA 4XDQA 5HPOA 2FCTA 2VH9A 3B7MA 5A7WA 4GIQA 1Y9QA 1C8M2 1VBA2 2UWBA 3H9AA 5IVJA 2XQXA 1IPJA 1AR91 2XL7A 3I8TA 3QLQA 4AI0A 4Q4W3 1S0JA 3ZX7A 3ZDVA 3VKFC 3RDIA 4CCKA 2YPJA 3SH4A 1MEC3 1H1IA 1DQ4A 4CP1A 3PMSA 3VBRB 2VC9A 1SFYA 2ZGPA 3H8OA 3DUIA 4OVEA 4NHMA 1RVF2 1W6PB 2VTXA 4MXVA 3T1MA 3V0BB 3N7JA 5FP9A 4AI2A 2JDHA 4LUMA 1KQRA 2HBTA 2W2IA 1C57A 1TEIA 3SQOA 1QDOA 1XU1A 5I8YA 2P2KA 1FOD3 1VBB1 5EP9A 1BMV2 1FMD3 3AP4A 4K6BA 4JQTA 2BP6A 1KJLA 4ITCA 2ZHNA 4LBQA 4RQPC 2WO1A 2EXHA 2HH9A 2EIGA 2W92A 5BV6A 3CDZB 4ATEA 4CDUB 5FLJA 2PFWA 3K4DA 3LA2A 2Z69A 4AFDA 2I45A 1LKNA 4X6QB 4QPWA 1SEFA 1AYM3 4P9YA 1UZWA 2P5BA 4WBBA 5FZ6A 3B3QE 5FY7A 2CDOA 4TLFA 1A78A 1O4ZA 2VBBA 3GZTB 3TN93 5JSPA 3CJIC 3V0AB 4GA9A 1SPPA 4FAGA 4AVVA 1CPMA 1ZX5A 3CQOA 1CZVA 3INAA 3T30A 2PHUA 5FUPA 3D0SA 4QM8A 2JD9A 5ABJB 1VBD2 2OZ6A 2DVGA 3WG3A 1RUC1 1UU4A 2WZ8A 4IESA 2OUJA 4XQ4A 1JOPA 2JB4A 3QACA 3W58A 3MI8A 5F5AA 5IVBA 2R073 1VE0A 2BGCA 2ZGKA 4QPIA 5FP8A 1SLCA 1XNDA 5K7PA 3MLLA 1AJKA 2EALA 1WLCA 1YLLA 3SHRA 3UESA 1JOJA 4QQOA 3BGAA 4LT5A 2XB6C 4RHV2 4WVVA 2VVDA 2X29A 2ZGMA 1NT0A 1UOBA 3CHXA 3SNMA 4DUWA 4Q4Y3 4XAAA 4CEYB 1AF9A 2WNOA 4FQZA 4PQ9A 1QQP2 2FDIA 3MGUA 2IXIA 4IEPA 3WP5A 1EUTA 3PUSA 3BIWE 1N3PA 2FMYA 2IFWA 3WUDA 4QB2A 1RUD2 4Q0QA 2CGPA 3R0RA 1WD4A 1O3SA 2FDFA 1L7RA 2Y34A 4YSFA 4OUSA 5DG2A 1DDLA 1OF3A 4N8MA 5F5CA 3RYRA 3CU7A 4QB1A 5JPMB 1GLHA 1W04A 2Y6HA 2B9VA 3JD71 1W06A 4J1XA 3VBHA 4D94A 2WS91 3QOPA 4DY5A 5J36A 1CAVB 1ULEA 2CAVA 2XJSA 2RR12 3R4DB 4YW3A 4KGGA 3NNLA 2VULA 4NJ4A 1EP0A 1A34A 5KHHA 4CDWA 1WLTA 1Q5OA 2UYBA 3FZ3A 5I8SA 2VW0A 5IWFA 1W28A 1ULPA 1J3QA 3WCSA 5LCWL 4Q1RA 2ZJCA 1GWLA 2PHFA 4LKSA 4TN7A 1YQCA 5CKMA 2ET1A 2OIIA 3U11A 2V09A 4I3PA 3I4IA 5LK5A 4R9DA 1KD7A 2BRTA 3PUIA 4KI5M 4JGYB 4JKKA 5FCCA 2EA7A 1Z7S1 1ZM1A 2KM2A 2XJUA 1AR73 3OBRA 5LBCA 4YM2A 4DS0A 2FDHA 1XNKA 4XFFA 5FYUA 1UXZA 3UV9A 1FXZA 3AMHA 4GMP0 4C1XA 5GJ6A 2AREA 2OXBA 2QBXA 2JDYA 3M3EA 3NVCA 1HRV2 1LCLA 4JKLA 1QKQA 2D44A 3IM0A 3K51A 5DZFA 5DPNA 4BDVB 1H8TC 5DAWA 1AVBA 1W2TA 1WCSA 1DYKA 1YXWA 2VUCA 4IV3B 3LEKA 3H8RA 3T0DA 1ZNPA 4B1LA 4JDNA 2YMZA 5T5PA 2CWSA 5EXOA 4RN5A 1BJQA 3KGZA 4X6RB 3BKZA 1RUI1 3WNMA 1JU3A 1SCSA 4EN0A 1PMHX 2ZGNA 1W90A 3KVAA 2VZTA 4MG2A 3AK0A 2JG9B 2OS2A 3ON7A 5JUVA 1V6NA 4BIOA 1G9CA 3ACFA 1SQ4A 4A45A 5ANNA 4QX0A 2D6MA 1CD3G 4RYDA 1U0AA 4Q4W1 3DXTA 2YG0A 4CRQA 1W6OB 1Q3EA 5J7MA 1T6BX 5FZEA 4QPIC 2D93A 3JXSA 3WF4A 3LAGA 1GUIA 4KMQA 3ENRA 1S55A 2JDKA 4N90A 2B42B 1JYVA 2ZGUA 2VU9A 4CCNA 4R52A 2EICA 1DGLA 1RUG1 1VR3A 4MZUA 5IVVA 4HN0A 2GC1A 1C8M3 3N7KA 1VBA3 1QF3A
chains in the Genus database with same CATH topology
1FOD1 2SLIA 4XQDA 5FTTC 5JSRA 5HXVA 4H3WA 1JBCA 1HRI3 1QMJA 1B35A 1MS9A 4FPOB 3B5LB 5KC6A 5GLZA 3ZXLA 1QJX2 4YG3A 2O0OA 5DUWA 4N43A 1MS0A 3E6CC 1JUIA 4JAAA 3TBDA 1RVF3 1NCRA 4P9JA 4QQHA 1AYM1 1D0HA 3NWKA 2NPIA 1J3PA 5FQ0A 3TN91 2F6BA 4PBOA 3B01A 1C28A 1LOAA 4CDWC 4DPNA 5BPXA 1ZZ8A 4LLFA 4CDQA 2ET7A 3FFQA 4XPVA 3AFKA 4C90A 4XFCA 3VZKA 4YFWA 2HWE1 5CFCB 2Y38A 1FNZA 2H0BA 4H7MA 2ZS6B 2R071 1PM7A 3OYWB 1S0FA 5DUXA 2CV6A 1CONA 3H7JA 2ARXA 5T3NA 3SCFA 4AGVA 1MR5A 1ZRCA 2YROA 3NV4A 2XLAA 4Q4Y1 4WVMB 4XE9A 4OUMA 3P3PA 5FRAA 1DGRA 1VBD3 3ZFEA 1DF0A 1C5HA 1K5MA 3S6PA 3VL8A 4AI3A 4RFT0 4K1ZA 1KFUL 3KCXA 2YY1A 4HN1A 1OFSA 3WD5A 4JQRA 2OZJA 4FP2A 4Z1VA 2MHFA 1YIFA 1GSLA 4M00A 1CIWA 3GBWA 1IS5A 4E9KA 2TEPA 5GLWA 3ZO0B 1A8DA 2DWRA 1FX5A 1MVQA 3PHMA 1QQP3 3GZAA 5KC5A 1OKQA 2E53A 1GKBA 1BBT3 3JZVA 5H9QA 3VKOA 5I0RA 3RJRA 1MQTB 1ALYA 1ULFA 5E88A 4N9IA 4QHBA 2JG8B 5BNNB 1RITA 1NXMA 1N47A 1ENQA 1ENRA 2RS13 3ALQA 2D3RA 3KMHA 1AX0A 1REEA 1PVXA 3EBRA 5JDBA 2NQYA 4HVRA 3VBFB 1WW7A 1RUE2 4TYSA 2GSYA 4LBLA 1AR71 2HWF2 4URTA 5FMOS 2XUMA 1COV3 3WDYA 1B35C 1KJRA 3MIDA 1HQLA 1EAH3 1AR82 4JV4A 4PIZA 1CJDA 2E7TA 4BLJA 2I07B 4N43C 4DRRA 3GNEA 4G3YC 5C9AA 3ZMNA 3NAPA 1NCRC 1JH5A 4RS5A 4RR3B 4XFBA 1ULDA 2ZX1A 1U12A 4C91A 1BEV2 2LUWA 4LE4A 3A0NA 3SMHA 1JW6A 4WM8B 3O14A 4Q1PA 2PHWA 1J3RA 3AJZA 2P34A 4YVWB 2CY6A 3GHMA 4MLOA 5KXCA 4CDQC 2DVBA 1KXGA 2EF6A 2D6NA 2K0GA 3VN4A 5JSOA 2VECA 3DF0A 4OHXA 2XBO2 4J6GA 1ZZCA 5GLVA 3MIHA 1X8MA 4P9LA 2WNUA 4HANA 4HPKA 3MF6A 3PLQA 2HWD2 3WOGA 3K48A 4P9XA 2XGXA 4F83A 1QJY3 4JDMA 3AJYA 1NQDA 1MZEA 5DDJ3 1AYN3 4L92A 1DU3D 3KT7A 3RWNA 1CN1A 2MEV1 3ZFEC 1K5MC 5JOZA 1TNFA 1UAIA 1HRI1 2XJPA 3APBA 1EYBA 1GFF2 1VB2A 2XVGA 1ULCA 4MH0E 4RSUA 3W59A 5L36A 4N53A 3ASIA 3ZSKA 2JE7A 2PHXA 1YCIA 1T6GC 4KWJA 1PO11 2ZAHA 1GNHA 1PO21 2P3JA 1BKZA 2A3XA 3NJZA 4Y1UA 1F5JA 1HV0A 2LM3A 2EXJA 4JRLA 4W6WA 3SH5A 2E9QA 1PIV2 2UY8A 4DNYA 1PGL1 2VNOA 4XJ9A 3NW4A 4K9SA 3AZZA 1QJU2 3LWCA 3QBQA 4LHKA 3ZXJA 3IPVA 4Y1ZA 1C5IA 2D5FA 1V6OA 1RL3A 2IC1A 4YG0A 1ZRRA 4BZ4A 2PHRA 4COZA 3AYEA 4IEOA 4KU8A 4LTAA 4A7YA 4E4DX 4ZXKA 4XW3A 5GZEA 3B02A 3AP6A 1FT9A 4CEWB 5FO8B 5C9AC 2A5ZA 1VBC1 3NAPC 2QKDA 4RS5C 3OGGA 1UKRA 1AR62 4AQTA 4XF0A 1OOPC 2QCSB 4QMAA 2BNOA 5GLTA 4AYUA 4Y1VA 3R4UA 4ISRA 4OFGA 4EN7B 4OHVA 2IZWA 2K9ZA 2VW2A 3ILRA 3PJYA 1DQ2A 2R1DA 3URFA 4Y1XA 2K2SA 4Q2FA 1BBT1 1LHUA 1NY72 1DQ0A 4LR4A 1V6JA 2WNUC 1OQ1A 1ND3B 3MIGA 5KXBA 4FCAA 1BK1A 2NZ9A 3KT1A 1NE6A 4GMP3 2RS11 2XJTA 5D8AA 1LEMA 4UW5A 3KSCA 3WR0A 3SH3A 2R042 4FPEA 4LBNA 4XOGA 1I3HA 4AHWA 2A75A 1AL22 4KG8A 4LBKA 1CAXA 2WNVA 4GH4A 3RYKA 1F31A 1COV1 1J1TA 1NQJA 1LRHA 2I74A 1ZBE2 3UJOA 5CG8A 1EAH1 4FTBA 3ZXDA 1QOOA 5J3UA 2WINB 5AC92 4Y22A 2VQ0A 2B7YA 4N53C 4D69A 2YV8A 1URXA 2DUPA 4XHXA 5K8SA 1BVVA 5JWPA 1HXS3 3R6SA 4Y20B 2YGMA 3ZN5A 1XXNA 1D4M1 4RQPB 1DIWA 3WVJA 1LOEA 1XYPA 2WT0A 2ZMKA 3ZSLA 1AR83 2D3PA 2QDNA 2ES3A 3U10A 1VIWB 1D0GA 1IOAA 1KDKA 5LRRA 2D7FA 2NYYA 4OI0A 3QD6A 1G9DA 4GKYA 1XYOA 2VG9A 3ILFA 4FPGA 4GWNA 1G9AA 4EROA 2BWCA 3CJIB 3M3OA 4Z82A 2I2SA 2R30A 2MPFA 3ZXEA 3IDBB 3VZJA 1QJY1 3TNQA 1ZBA3 3N36A 1KS4A 2EXIA 1TMF3 5DDJ1 1AYN1 2B9UA 2WIIB 3WP6A 1SDWA 5F6KA 2FZ2A 4D7SA 1H2NA 1W0PA 4AGGA 4OULA 2HEYF 3NO8A 4MGYE 4BOWA 2HWD3 2X5IA 2OA2A 1X7NA 4IEXA 3MW2A 1S0DA 4ZU7A 2BVBA 1OQDA 3HD8B 4B4PA 3I59A 5I0TA 4XXPA 2A3YA 1WW5A 2XLFA 1GICA 4QT6A 4Q4X2 4BMEA 1YRZA 2PYTA 4IETA 4WVWA 3SISA 4JGZA 1OPOA 4LULA 1MS1A 4L9BA 5EV7A 3IBMA 2PLV2 4I3GA 4IL7A 3AZVA 2RS52 4YGBA 5D8AC 5C8CA 1XNBA 1QH6A 3TNPB 2ZX0A 1SLBA 3DPRA 5FPXA 1Z0HA 3LOBA 4H14A 2WZR1 4LO4B 2WNVC 4GH4C 3AXDA 3VDDA 4AF9A 4META 2Y0OA 3J8F1 1POV1 3WNXA 4C1WA 1PIV3 4PDWA 3L2YA 2PAKA 3NV2A 1DBNA 3UL2A 2R0HA 3BB6A 4HKOA 4WM7A 1LJ7A 4G9SB 2XVKA 3JBG3 2OUHA 3WW1A 4IXLA 2BBVA 4B8EA 3U07A 1I1EA 1H8TB 2VPVA 4Q8KA 5JOWA 1R1A1 1DZQA 2FMDA 1PZ9A 5HBAA 1S0BA 1GV9A 3FJSA 1SLIA 3H1MA 2GALA 3NL1A 3GALA 1TE1B 3ZFFA 4EWDA 1N3QA 1IS6A 4M3CA 1OLQA 3OJBA 3ZYRA 4GMP1 1QOSA 3O7OA 1RMU3 4LBQD 1NA1A 4KWKA 1M4WA 3TYJA 2W39A 4R9BA 3A4UA 4K20A 2BVVA 1RINA 3FE5A 4MV2A 3NV1A 4QPIB 2WFF2 2R062 1FPN3 5FAXA 2Q0AA 4AVSA 2A70A 3AYAA 4JRAA 4UW4A 4LO7A 4MXWA 2X5IC 3VZLA 3RQ0A 1RTVA 3OBTA 4XJZA 1NCQA 4QU2A 1X33A 1G7YA 2QFEA 1HXS1 4JVAA 4UBGA 3CO2A 2RM22 4BMBA 4Q0UA 1HDKA 3OY8A 5E1RA 1ZBE3 4JGZC 3FMGA 1ZA4A 1Q56A 1JN2P 4OI2A 4YGDA 5KBFA 4Z07A 1KRIA 4Q4V2 4PLNA 5BUVA 5C8CC 2D6PA 4AWDA 2Q4SA 2PHDA 4SBVA 4XXAA 2LTNA 2GDFA 4TSVA 3DPRC 4CDWB 1BVP1 4HK9A 4MX3A 5GZDA 2DCKA 1AJOA 3VDDC 1GNZA 3FBYA 1AXKA 2DFCA 1ZBA1 2O8QA 4XMAA 5BNPA 1TMF1 3MEPA 2G4IA 4PDWC 3H1WA 5D1IA 2ZABA 3KS7A 3W9AA 4V1PA 1UMZA 2ZZQA 1RUJ2 4IEWA 4QPGA 1VBE3 4BA6A 3BCWA 5K0UC 5T5OA 1ND2A 4WM7C 1I9RA 2RS31 5EZWA 1IGOA 1MVEA 4QGLA 2DVDA 5DG1A 3WW4A 3WDTA 2VW1A 2AR6A 2B5HA 3FHIB 5GKAC 2AH2A 1H9WA 4LNVA 3MLJA 3DKWA 1YUDA 4DY3A 3V56A 4P14A 2PHLA 1LHVA 3D82A 5A32A 1PVC3 3AMPA 3E5QA 1YHFA 3OD4A 3ZFFC 4AQSA 4BH9A 4I2OA 4XFHA 2YZ4A 3MF9A 1R1ZA 3GF6A 3VBSA 3USUA 2D40A 4AK3A 4ONUA 3Q9OA 3KQRA 1RUH3 1WGPA 4DINB 4M3CF 5ACA2 2R49A 3ZXGA 5I91A 1W6PA 3WG4A 4DZGA 2ZMLA 3WY6A 1EV12 1H1MA 3VGIA 4JTNA 2R6QA 1GBGA 1LOFA 2B45X 4YVSA 2WNEA 4HT1T 4J1WA 2RS53 4XJUA 1NCQC 2GAUA 1QXPA 1NLRA 3RJ2X 2HWB3 1R081 4XJWA 3RI9A 1O5LA 2OPKA 3JBG1 1B35B 2UWCA 3WDXA 4BHPA 3HAGA 2WZPP 4HL0A 3KGLA 2UWAA 5J09A 2WQZC 2H6BA 1NCRB 1J1LA 5F1RA 1ASJ2 1KDMA 4QXKA 4XQWA 2MNGA 1GANA 4AI8A 2LALA 3VHRA 1UPIA 2KXLA 2H0VA 4LO5B 1DFQA 1PMIA 4NHKA 1YI7A 4C0BA 1W6MB 2Q5TA 4CDQB 4CDXB 4QGMA 1RMU1 4GB31 4QQLA 2WFPA 1VB4A 1GZWB 1DG6A 1IKQA 1RUF2 4X8NA 1XE7A 1OFNA 1RHI2 2D97A 4RL7A 5BNPC 3MIEA 4XTMA 2UU8A 3WW2A 1V00A 2ZGLA 1TME2 2RJKA 3ZMOA 5HI0A 1R092 1KITA 1SLLA 1FPN1 1V9U2 5JPNB 3AKSA 4CEYA 4ASLA 1MEC1 2JX9A 1HX6A 4TWTA 2ARBA 4JTOA 2YGLA 4AVBA 3FLPA 4NHLA 4IERA 3M1HA 1H2LA 3NKGA 3ZFEB 2GNDA 2OW4A 3VV1A 1K5MB 3ZYGA 1IPKA 1DQ1A 2SBAA 3LSDA 4COUA 4YLZA 1O7FA 1Y7BA 2WFF3 1O5UA 1FMD1 1A3KA 2R063 3AYDA 3PVEA 2ENRA 1O4YA 3ZYPA 5JOXA 2HWC2 1RB8G 4FPLA 2YHJA 4BE3A 3IMNA 3VBSC 3O0VA 3VBHC 3USSA 4K21A 4EV0A 3WHTA 2RJLA 3OPZA 3MZHA 2XWBB 3L2HA 1S0CA 1W6NA 3LCPA 4Y5Z0 4UXAA 2VGDA 1FNYA 4B29A 1G8WA 4K1YA 5F5QA 4YZ4A 4M0HA 1LOFC 3VUOA 1TNRA 3JU9A 4NO4A 4DQAA 4YVSC 2A6WA 1D2SA 1LR5A 5L7OB 1OPMA 1LHOA 3ST7A 3ELNA 2ZHLA 4Q4V3 3J9SA 3EJKA 3MPBA 2X53S 2GC3A 3I7DA 1VBE1 4XEZA 3DV8A 4GXLA 3HIFA 3BPZA 4EN9B 2XG3A 3VBOA 4BM8A 1A8MA 3D0JA 2RMU2 1YI9A 1PNGA 5JI7A 5C9AB 2P3KA 3NAPB 2JKBA 3HMYA 4KG0A 5T54A 4RS5B 4E2SA 5IK7A 1SFNA 5FFOC 2D6OX 3ACLA 2UYAA 4YW4A 4YW2A 1RJ8A 1RUJ3 1PVC1 1OOPB 1ENSA 3JQWA 1UIKA 2PQQA 2JG9A 1D4VB 1YYNA 2DFBA 4MSVA 5EJ3A 3KLSA 3H3UA 4Y1YA 3VZMA 3HWJA 3AP9A 1W6OA 5JZGA 4RHV3 4GWMA 2DCYA 1RUH1 4E27A 2WNUB 2ZAAA 1OSGA 4MYEA 4I01A 4HPKB 5C6CA 4YM0A 2VOWA 1RUD3 2BEOA 1DQ6A 4CEYC 3WX5A 1NYWA 2CNAA 2DVAA 3WQ7A 3V64A 4Y24A 1Z78A 1QNWA 1VRH2 1V6KA 3UKNA 1PGW2 2HWB1 4XJ8A 1V6MA 2GMMA 2RR13 2XJQA 1JYIA 4XMIA 5ACA3 4UW3A 2WSVA 5L19A 1EV13 3VKMA 2R32A 3FC0A 4N53B 1AR92 5HCBA 2D3SA 1CAWA 1V6IA 1WCDJ 1YO8A 2FBEA 2CAUA 5CG9A 2GH8A 3L9JT 5JOYA 5CFDA 5CNAA 1U5IA 2PHTA 2NMNA 2BNNA 1LTEA 4YNIA 3KZ4C 2VUAA 1G9FA 1QNYA 4HSJA 4AFMA 3TOJA 1VBB2 2A73B 3OYWA 4PLMA 3FX3A 4CP2A 2ZX2A 1HRV3 3IPVB 4FO9A 1YWKA 2GN3A 2HEWF 4R9AA 2A6XA 1WMFA 4WVMA 5IUQA 4A7KA 2WA4A 4KNCA 5JIUA 3T2TA 5BY5A 3VBOC 3AXEA 1RUF3 5AVAA 2A6ZA 2VMHA 5I8TA 2E63A 1C8M1 1VBA1 4OHZA 1TME3 1D2QA 4HVOA 1PK6A 1R093 3AKPA 2JG9C 3SCHA 1RUC2 5JAXA 1I5ZA 4D7YA 4DRVA 2XJRA 3H0OA 2A6VA 3LB9A 2XLGA 1RVF1 5JZGC 4Z8BA 2A7AA 2ZGOA 1UW8A 2ATFA 2WC2A 2ZPXA 3MW4A 4LHLA 2DYCA 4NWVA 1BMV1 4XF3A 5A33A 1X8EA 5CVRA 1DQ5A 3BOWA 5D8AB 3ZIXA 1QJX3 4FPJA 2GN7A 2V73A 4FOYA 4GULA 1SLTA 1RUNA 3JD72 3VBUB 2HJIA 2WNVB 4GH4B 2WS92 5E16A 4E4SA 3N7MA 2PAEA 1FV3A 2F4PA 4ASMB 4NPRA 4RR3A 1MACA 2FHRA 1REDA 4Y22B 1SACA 3S30A 5KXEA 2HEVF 3ILNA 3AP5A 3UJQA 2CGNA 4WM8A 4IV1A 1RIRA 4YM3A 3IT8A 1SCRA 1VBD1 2JJ6A 2TUNA 5C4WA 2AUYA 4AQ2A 4EWAA 5CFDC 3EQEA 4QGNA 4DOUA 1GR3A 2XPJA 4OHYA 2IXLA 1JYCA 4WZFA 4BCUA 4I30A 4INDA 2GMPA 4KQ7A 2RMU3 1Z7S2 2KA3A 2RE9A 2D6LX 4IEVA 4FOQA 3ZPYA 4RHV1 3CEWA 4RGGA 3KCCA 3B94A 1QQP1 5JLVA 1LOCA 1RUOA 1RUD1 4QM9A 3V65A 3SCGA 1UF2C 5GLUA 3HR9A 3FLTA 4H55A 2IXJA 1UU5A 3ME2A 2B46X 1RUI2 3ZSJA 2AZ5A 3NSTA 1H4HA 4A2UA 2DCZA 4COVA 5JR7B 2RR11 3WZ1A 2CTVA 1GZCA 4CYDA 4G4FA 5IT6A 4WVZA 1QGLA 1PK6C 3HN1A 1IS4A 4SLIA 4HKWA 2X5IB 4Q4W2 3G6JB 4YZ1A 1W0OA 2PA7A 3LKJA 3I59B 1I6XA 1ZYBA 1LB2A 1N1SA 4BPZA 2JENA 1CAUB 3NV3A 4Q29A 3VKNA 2JD4A 4XBNA 5BNQA 1RUE3 1RUG2 1CX4A 1S2BA 4JGZB 2HWF3 1LEDA 2PTMA 1ENXA 1FOD2 3MICA 4I0BA 3ZXFA 1AR93 5J96B 5C8CB 1HIXA 1HRV1 4XILA 4WV8A 2O8OA 3DPRB 1CR7A 5CAZA 3VDDB 1AYM2 1BEV3 4FOWA 3BODA 1JHNA 2D98A 2ZGQA 4W65A 3MIBA 2Q30A 2VMGA 5I0SA 3TN92 4PDWB 1VBB3 5KWRA 4M0NA 3J4UH 3ZFGA 4AFBA 4B3NA 4M3CE 1LOGA 4IV1C 4YW5A 1WW4A 4BIFA 5K0UB 2Z5WA 2XBO3 4WM7B 4FXGB 5C4WC 3B9CA 2HWE2 3AKRA 4HZFA 2W68A 4IEUA 2E7AA 3E97A 2R072 1NG0A 3O12A 5T55A 4O9EA 1AX1A 4PCRA 1WLWA 2P17A 5F9TA 2WLQA 1W6QB 3WUCA 4NWWA 2BWAA 4Q4Y2 3D6EA 3ZFFB 4M3CB 2WJSA 3AMMA 4FPFA 5L73A 3ZYIB 1AX2A 1FYUA 4FPKA 4GALA 1A6CA 1QJX1 2X8KA 3M4FA 1OA3A 4D7TA 4Q0VA 2A71A 4R9CA 2HKXA 3LZZA 4MGZE 3S7EA 2A3WA 4CTEA 4E2GA 2GZWA 1JUHA 2C1FA 4AVAA 1Y43B 1UIJA 4CZSA 5DUUA 1Q8QA 1GQGA 3OGJA 2W52A 3POYA 4ES9A 3MIFA 1OHFA 1SLAA 4Y20A 1ZZ9A 2BFUL 3SITA 1NCQB 1WBFA 4QQ2A 1H30A 4TZDA 3AKQA 1QJU3 3R05A 3ZIWA 1CESA 3WG1A 1IS3A 2P37A 1JTZX 5DZEA 3MDPA 4FPHA 3OY8B 3VKLA 1S2KA 3PVBB 4LBQB 3UKVA 3X29B 3ROUA 2WSUA 3VZNA 1AR72 3T1LA 5BNOA 5B2GB 1F5FA 4OLLA 2E6VA 1YIPA 2GC0A 3AMNA 2EAAA 4FSJA 4L99A 1QOTA 4F7ZA 3FUOA 2CGOA 1AR63 2OVUA 5CU1A 2WT1A 3B9IA 3PNAA 3AZXA 2IXHA 3AMQA 5K9YA 3HQXA 4LO8A 1LGCA 5BNPB 1OA4A 1Z7S3 5BYNA 4BYYA 1NXD1 3ZFGC 2ZA9A 1XYNA 3CJXA 1DGRN 4U36A 2QVSB 3RSJA 3DN7A 1LENA 1PHMA 5I0UA 2ZHKA 1WBLA 3RNSA 1REFA 2QE3A 4LBOA 3ECQA 3M3CA 3D5OA 1CQ9A 4FQ4A 2W0XA 4LBJA 4HMZA 2R043 1SBEA 2VMIA 1J59A 5A32B 2GH2A 1AL23 3RMXA 5FDBA 1RUE1 1S0IA 2IXCA 2HWF1 4DXZA 2YUEA 2NM1A 2MEV2 4PBPA 3M70A 3AB0A 2D6KA 3VBSB 1HRI2 1AR81 4FVVA 3USUB 3VBHB 4I09A 3ZSEA 1L3JA 5AC93 <