2D5HA

Crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
488
structure length
373
Chain Sequence
FNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISNICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and divergence on plant seed 11S globulins based on crystal structures.
pubmed doi rcsb
source organism Glycine max
molecule tags Plant protein
molecule keywords glycinin A3B4 subunit
total genus 72
structure length 373
sequence length 488
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d5hA01
2CAUA 5HI0A 4IEZA 4LTAA 4J1XA 5FLJA 3WW2A 2BNOA 2Z69A 1GQHA 4XF9A 1EP0A 2UYBA 3NKTA 5KHHA 4QGLA 3UKTA 5FLHA 4B29A 2D5FA 4NVPA 5C8WA 3D0SA 3DKWA 4QM9A 2IXLA 1ZRDA 3BCWA 4KL1A 1LRHA 3EHKA 1WGPA 3NSTA 5FDBA 4E2GA 2Q1ZB 4AVBA 3MPBA 2HJIA 1O7FA 3LA2A 4I0AA 1Q5OA 1J59A 2WFPA 4IETA 3KMHA 1G6NA 2K0GA 2FQPA 3UKVA 1U12A 5LEKA 3E97A 2QVSB 1YHFA 2Y0OA 2QJVA 3S7EA 1EYBA 4IEOA 4P9GA 1CAUB 2GH2A 2ZKLA 2CV6A 4MZUA 4YYOA 2QNKA 3UKNA 3DV8A 3ES1A 3QOPA 3H8UA 3MDPA 3ELNA 2PAEA 3H1WA 5LEJA 3U10A 1HW5A 1X82A 4IESA 4I02A 4ORFA 4META 4MUVA 5FQ0B 3CO2A 4OLLA 4XFAA 1ZRRA 2QDRA 2MHFA 2PHDA 4QGNA 3HT2A 3MZHA 2KXLA 3KCCA 1CAVB 5FPXA 2H6CA 4LEJA 2D5HA 4BYYA 3U0ZA 1OI6A 2B8MA 5I8SA 2BGCA 3E5XA 4ONUA 5C6CA 2XGXA 2PA7A 5JSRA 2IC1A 4HLTA 3LZZA 3I59A 3RDIA 2B9UA 4O9EA 4XF0A 1ZX5A 3NVCA 4A2UA 3GYDA 3M70A 4PJYA 4HVOA 3ST7A 2OZJA 4BH9A 5F1RA 1LKNA 4BIFA 2B5HA 5I8YA 5JSOA 2D40A 4FBFA 1RC6A 3O14A 1UIKA 1I6XA 4X6QB 1ZRCA 3C3VA 3CLPA 3ZDSA 3H7YA 5FCCA 4JVAA 1LB2A 4R8HA 2XLAA 5I0TA 5FQ0A 1EY2A 1RUOA 4YNIA 4E2QA 1V70A 3FWEA 4N9HA 1O3SA 5J7MA 3OCPA 1DZTA 2UY9A 4FT8A 1ZZ9A 2ET1A 3PVBB 1UW8A 1CAVA 4Q0PA 2GZWA 5I0SA 1JUHA 2IXCA 3IDBB 2QCSB 3IWZA 1PMIA 1FT9A 4QMAA 1O3QA 2Q0AA 1NE6A 4EV0A 1CAXB 4I01A 1O5LA 5BY5A 3E6BA 4Z82A 1IPJA 1XE7A 4KWLA 2WC2A 3S0MA 2XHKA 2PQQA 2DCTA 1RTVA 4PIXA 3E6CC 3LA7A 4O9GA 3RYKA 1UPIA 5FLIA 3S7IA 3FZ3A 4XFCA 5CU1A 4MGKE 1SQ4A 3USSA 1Y3TA 3QACA 4HN1A 4EWEA 4KU7A 1O5UA 3GBFA 5BUVA 4KWJA 4YARA 4IEPA 2ET7A 4LA2A 2P17A 3I59B 2OZ6A 4IEXA 4EWDA 2VECA 4D7TA 1QXRA 4N9IA 3CEWA 5BPXA 2IXIA 4EROA 4MGYE 3R6SA 5EFUA 4IEWA 1VR3A 3JZVA 4AXOA 4IEVA 5I93A 4XFGA 3MYXA 1Q43A 4R52A 1J58A 2GU9A 4GULA 2F4PA 4QM8A 1SFNA 2OYZA 2O8QA 2Z2SB 2N7GA 2O1QA 4Q0UA 3LA3A 4IEYA 4F8AA 4UBHA 4XFBA 3LAGA 4AVAA 3OD0A 1Y9QA 1OD5A 1UCXA 2PHLA 1UD1A 4BHPA 3PNAA 4XFFA 4LLOA 5CADA 1XE8A 1ZVFA 3LWCA 1X7NA 1TQ5A 3LOIA 2D93A 5BV6A 5EZWA 2GC3A 2EVXA 1ZZ7A 4LUKA 4I3PA 1YWKA 5AVPA 4HSLA 3H3ZA 4UBGA 1O3TA 4IERA 2C0ZA 2EAAA 3TNQA 3WW1A 1ZZ6A 2Q30A 1YFXA 3SCHA 2CAVA 3HIFA 4WVZA 1CAWB 3VHRA 3SXWA 4JTNA 1NE4A 2OA2A 1DGRA 3SHRA 1X8EA 4QX5A 3BPZA 1IPKA 2OPKA 3FJSA 1VJ2A 1ZNPA 4PIZA 3WW4A 2Q4SA 1UIJA 3RNSA 4JTOA 2PAKA 3B02A 1NZCA 3G7DA 1H1MA 1LR5A 4EWAA 1RUNA 3KGZA 3WW3A 3ETQA 4AVCA 1CAWA 1EPZA 3ACLA 3NW4A 1J3QA 5K8SA 1DZRA 3D0JA 5KHGA 1PM7A 3DN7A 1RGSA 1J1LA 2ATFA 2BEOA 5KHJA 1FI2A 1Q3EA 1QY4A 3RPQA 4Q0VA 3FE5A 4YRDA 4L2NA 1CGPA 2GC2A 5LRRA 3U11A 1CAUA 1NXMA 4J1WA 4DINB 3RYRA 5J3UA 3SMHA 4D7SA 4JV4A 1J3RA 4QGMA 4Q0SA 3CJXA 3CL1A 1ZZBA 2VPVA 3OGJA 2EA7A 4XETA 4I09A 3TNPB 4MGZE 3ROUA 1O3RA 4HVQA 1I5ZA 4TLFA 5I0RA 2ZCWA 1L3JA 4HZFA 1QWRA 3KGLA 2CGPA 1J3PA 1QXJA 2HKXA 4KWKA 5CVRA 1XRUA 3RYPA 4YSFA 5I8TA 3RZZA 3KSCA 2I45A 4LUMA 2XL7A 5E1RA 3BALA 4MGIE 4XF1A 3PLQA 5JR7B 5I0UA 3H3UA 4LULA 4ZU7A 2BYVE 3FHIB 2XKPA 5J48A 2XL9A 3OTFA 2MPFA 1X8MA 4PIYA 5JCTA 3I7DA 3H9AA 4RD7A 3NJZA 5LRSA 5FPZA 4HN0A 1ZZ8A 2BNMA 2H0VA 4QXKA 5KHIA 3SCFA 2PFWA 1OFNA 4Q29A 2GC1A 3EBRA 3FX3A 3HQXA 4LA3A 4Q0QA 4Z07A 4ZU4A 3OF1A 5D1IA 4ZU5A 5KBFA 5JSPA 4FAHA 4X6RB 4IEUA 4WZCA 4XF4A 1VP6A 4IEQA 4XFIA 2FMYA 3IDCB 3M3IA 1O4TA 2XKOA 3IBMA 2IXHA 4K8FA 3CF6E 3E5QA 2IXJA 4MV2A 2XLFA 4AQ2A 2PAMA 4AQ6A 1CAXA 4MX3A 1H1IA 3DL3A 2UY8A 4MH0E 1YUDA 3H1MA 3EJKA 2VQAA 3H50A 4UXAA 1NYWA 2K9ZA 5JAXA 4XFHA 1YFUA 2H6BA 1WA4A 4XEZA 1YLLA 5KHKA 4OFGA 3EQEA 3N4MA 2UYAA 1SEFA 2GC0A 4KU8A 3IIAA 1YFWA 3BU7A 4HSJA 3D82A 4HMZA 4FAGA 1OMIA 1YFYA 4HVRA 3H1YA 2IXKA 1CX4A 4I0BA 2ETEA 3NL1A 2MNGA 1ZREA 3H7JA 2BNNA 3FFQA 5T3NA 4E2SA 4I2OA 2XLGA 4L11A 2V09A 4WBBA 1GQGA 3BB6A 1ZZCA 1RL3A 4CYDA 4H7LA 3E6DA 2PTMA 2GAUA 1FXZA 5E16A 3ES4A 3I54A 3EO6A 1ZRFA 4XF3A 5BXXA 3HT1A 3L2HA 4F7ZA 2PYTA 3E5UA 3SCGA 1DGWA 5I91A 1WLTA 4HBNA 2E9QA
chains in the Genus database with same CATH superfamily
4HONA 3PUIA 1QU0A 1X9PA 4JRAA 2ZEWA 5HI0A 1N1YA 2WA3A 5FLJA 1QOSA 1UKRA 3WG1A 3K3OA 4KI5M 2Z69A 3PVNA 1QJY3 3LSDA 2WZR3 5JXHA 5CAZA 4LITA 3MLJA 3ORJA 4IE0A 4QX3A 4GJZA 1D0HA 4XQDA 2HWE3 4NROA 3ZMOA 1W90A 5FLHA 5FUIA 1Q8PA 1PGL2 2W92A 5FK8A 5C8WA 3DKWA 2HEVF 1AR62 2VZUA 2P3KA 4Y1VA 1NCQA 1UY0A 1OLMA 4N43A 5HXMA 3ZFGA 2BERA 3CDZB 4QHBA 3TEZA 3HN3A 3SC7X 4ZKTB 4GKYA 1BEV2 1PM4A 2ZEZA 4AVBA 2X5IC 4LO5B 4HXCA 1OKOA 2WNOA 2LALA 1HIXA 2GMMA 3LA2A 4I0AA 3JD71 1H2LA 1J59A 3B69A 1JZ6A 3KT1A 1IGOA 2VY0A 4IETA 3HNBM 4PI2A 1UNBA 2WAAA 3N9OA 3UKVA 5LEKA 5JMOA 3TBDA 5FOJB 2WQ8A 5JPNB 1VRH3 1WW5A 3S7EA 4GZ9A 3C8XA 1KEXA 4BK4A 1UX7A 2AYHA 3J9SA 5DG1A 4UW4A 3KLSA 1VLNA 4YW2A 4Q4X2 1LEDA 1US2A 1ZBA2 2CV6A 2DU1A 4YYOA 4TTGA 3AL5A 2QNKA 1QJU2 2LROA 2YDEA 1PO11 3R0RA 5F2SA 1JYIA 3N9NA 4RHV2 4EN0A 3H8UA 2WUHA 3LEGA 1JZ2A 4GJYA 2JIGA 3BOPA 1HB3A 1V6IA 5FYYA 1YQCA 1CESA 2DYCA 1LOFC 2XMLA 4XUOA 2F6BA 5IW0A 1H8VA 4FI9A 2ZS6B 2BUKA 3U10A 4CUGA 5T54A 2OX0A 5DQ0A 1QDCA 4Q4W1 5CFDB 4PHZA 2VMFA 4Q4V1 1BXHA 1VIWB 4IQPA 4PQQA 1FOD2 2MHFA 4GH4B 1L7LA 4L8QA 2YFZA 3HT2A 1I5PA 2KXLA 2TBVA 4N90A 3WUCA 1CAVB 2ZX3A 4CXXA 3ZYBA 5F6LB 2RS11 2ZEXA 1ULOA 4LEJA 2D5HA 4BYYA 3AVSA 1COV3 3VDBA 4Q2FA 4CCEA 1RUF2 1OI6A 3ECQA 4Y33A 1OOPA 4CZSA 1OQDA 4UWDA 2ARCA 4PDWB 1W03A 4QQ2A 4DRVA 1GP6A 2PA7A 4E4ZA 1W8TA 1MQTA 4H2AA 2TNFA 2W08A 3I59A 3M4FA 5FUNA 4IV3A 4K6BA 3M2MA 1REEA 3C7HA 5ANQA 2WNEA 1JHNA 1X9TA 2HWD1 3OBTA 3ZN6A 1XYPA 1LODA 2R042 1F15A 3RMYA 3FLRA 4MVTA 4A2UA 1O8PA 3M70A 4IUGA 4PJYA 2ZZQA 4HVOA 3ST7A 2OZJA 3SQOA 4KNCA 4XJ8A 2ES3A 5F1RA 3E1F1 4LORA 3J7NA 2NQYA 5FZBA 3IPVA 4E27A 4A42A 4CCCA 5L73A 1QOTA 4M3CE 4D3WA 3LFMA 1BZWA 1FAYA 1UIKA 3RSJA 3PHMA 3C3VA 3WUDA 4CDXA 4ZPIA 1ZRCA 5FZ6A 3UJOA 1NCQC 2DURA 2WL1A 3GM8A 4SBVA 1KFUL 2ZTNA 2CU5A 1RUOA 4CEYC 3NNMA 1QMJA 4C1XA 2B42B 2WZR1 4M01A 1V70A 4LXLA 3FWEA 4E2QA 3ZXGA 5C9AC 3MIBA 1C8M1 3I3EA 4XILA 3T08A 4CEYA 2ZPXA 3P3NA 4FT8A 1ZZ9A 2ET1A 5FZ8A 1EAH3 3URFA 4KBZA 5I0SA 3WXPA 2R061 4ASLA 4B1LA 3L9JT 1QJX1 2C4XA 1QQP2 1W8ZA 4DUVA 4UFIA 3BTXA 4XHBA 3IWZA 1FT9A 5C8CA 3L2YA 2HWD2 3FN9A 1NE6A 1XBFA 5FRAA 3N9QA 5IK7A 1CAXB 4FCAA 2RM23 1B35A 1K5MA 1ZA4A 1O5LA 1X36A 4OMDA 3RG0A 1EV11 1SFPA 3E6BA 1I9RA 1U5IA 3HNYM 2GMPA 1XE7A 2WC2A 4BXSV 3LOBA 2DCTA 4PF5A 3MI8A 2W1UA 1IKPA 2YC2A 2JDYA 5AFEA 1UPIA 5FLIA 1Q8QA 3OPTA 5E88A 5FMDA 3AZXA 3RWKX 1JZ5A 3T2PA 1ND3B 1R081 2WQZC 1SQ4A 3GBWA 3QACA 3USSA 3B7MA 3CJIA 1QNYA 4BJ0A 3GBFA 4BIOA 5JOXA 1QGLA 4YARA 1UYZA 1ULEA 2P17A 2PLV2 4ASKA 4EWDA 4AFMA 4P9IA 2VECA 5F6KA 4N9IA 2OT7A 2ZA9A 3CEWA 2B7YA 3THCA 2Y6FA 3WNLA 1W6NA 4EROA 2RR11 4OHWA 2Q8OA 5LWBA 4OUMA 3ZFEA 4G9SB 4OQ9A 1R082 5FP8A 2XWBB 4DQAA 2VZOA 4JHZA 3JZVA 4AXOA 3F2ZA 4JX0A 5FP4A 2ZEYA 2R071 1DGWX 2QQLA 1ND2A 1J1TA 2ZGNA 4XBQA 4UW5A 4QM8A 1SFNA 5DG2A 3GGLA 2WBKA 5A7NA 1DP0A 1AX2A 2O8QA 2D3SA 2Z2SB 2O1QA 3MV11 4AFDA 2E7TA 2Y38A 4Q0UA 1F8VA 1UZVA 5EJ3A 2VG9A 3ZN4A 2D3PA 4XFBA 4PDWA 1DGRN 4D0QA 1H6YA 2HWB1 2RJLA 4GA9A 5BNQA 1A6CA 5D8AA 1W0NA 2EIDA 4EZ4A 4TLGA 1RHI2 1UCXA 4JCKA 2PHLA 1UD1A 4BHPA 1AL21 2J42A 1UZWA 3ZXJA 1RUD3 4CEWA 4GD4A 1LJ7A 2UWCA 2W95A 2YROA 3LWCA 3VZMA 5FYZA 2D93A 1SPPA 2PXJA 2YZ4A 5JXJA 4XURA 2EXHA 5BV6A 1U5ZA 4IGPA 1KQRA 2EVXA 2V5YA 5A3LA 5CFCC 4B4RA 1HRI1 4BQYA 4JC1A 4UBGA 4NWVA 4CDWB 2BW8A 4RQPB 1CJDA 3ZYIB 1LHNA 1NY71 1C5HA 3WW1A 4UAPA 1JYWA 3V56A 3J8F2 1AR91 4IE5A 4FPEA 4NHKA 3TEWA 1H2KA 1IPSA 1CAWB 1CJPA 1POV1 2WO2A 1JZ3A 2RS53 4JTNA 2L9LA 5DPNA 4E9KA 4X8PA 1GU3A 5DAVA 4ZS3A 2P4EA 3SHRA 1X8EA 5LY1A 1LENA 3BPZA 4FTEA 3B9IA 2ZHLA 3V65A 1X50A 1BVP1 4IE6A 2R1BA 3S57A 1QH6A 3RNSA 1HRI2 4Q27A 4QT6A 2Y8KA 4XXPA 4BLJA 1I1EA 4DXTA 2CDOA 3G7DA 1MS4A 3OY8A 3PUSA 4LO8A 3WDWA 1JZ8A 2QQMA 1VRH2 3ZIXA 2XJUA 1LGNA 2W68A 1JODA 1NX9A 2PHRA 3K46A 1RYYA 1HDKA 3D0JA 1C8NA 2JD4A 3ZFFA 5ISLA 3P3PA 1E5RA 4FOWA 3B5LB 2Y34A 1Z7S3 4IL7A 4NAMA 4QB6A 2DUPA 3HEIA 5KHJA 1Q3EA 1XSRA 4O65A 4Q0VA 3RPQA 1YQ2A 4DEVA 4CDXB 4YRDA 5LATA 3WEZA 4B3NA 4YWAA 5C8CC 4JGZC 4K8RB 1CGPA 4NHMA 5GZGA 1OLME 3T30A 4XCBA 2C9AA 4C0BA 2O14A 4QXHA 3UESA 4H3WA 3R4UA 3RYRA 3IM0A 4W6YA 1VBB3 1LOFA 1O4YA 3AYDA 4MGSA 3H8XA 1J3RA 1PO23 4MHRA 4W6XA 4COYA 3MGUA 2WNVC 1PGSA 1PMJX 2EA7A 4GWNA 1FMD1 3OG2A 1UOGA 4FXKB 4ES9A 2YUEA 5FR3A 5HCAA 3FC0A 2E51A 1IG0A 3M7AA 3ROUA 1Q8OA 4LHLA 5IFTA 1O3RA 2P1BA 1FMD3 3D4KA 1COV2 1EAH1 2WZEA 3KV6A 5FZ0A 4FP2A 3H8OA 4L92A 3P5BA 2IVIB 4QQLA 1QWRA 5FFOC 3T4VA 1RUI3 1PX3A 4OUSA 3GJAA 1RXFA 4A7YA 2FDIA 3N7JA 5I8TA 2MEV1 1Z78A 3RZZA 2A75A 2B4KA 4NPRA 2VOVA 4LIUA 5CYYA 1AR81 3ZFEB 4AFCA 2R0FA 3KVAA 3SH5A 2XL7A 5E1RA 2RVAA 3BALA 3VDDA 2ZGLA 3ZXEA 1WMDA 1VBA3 4Y22B 2VNOA 2VO5A 2HWB2 3ZSKA 2D6KA 4AZZA 4BU2A 3SKVA 2FCTA 1C3HA 2D3RA 1OH4A 4ISRA 5AC92 4BOWA 3A22A 4XJAA 3FHIB 2VH9A 2GN3A 1O91A 5FZMA 2XL9A 3OTFA 5F32A 1HLCA 1RVF2 3WF3A 5A6YA 1W8NA 4IV3C 3ZN5A 1COV1 4FSJA 2D98A 1W2AX 2R072 2W1QA 4G3YC 5FMOL 3I7DA 3T09A 1UMHA 3WVJA 1C8M3 4BB3A 3O1OA 2W2IA 3ZOIA 5A7QA 5K0UC 5FO7B 5FYVA 2O8OA 2RR12 4Q5OA 2H0VA 1W6MB 4NHXA 4E8CA 3RQ0A 4BA6A 3ZSMA 5EXOA 4K20A 3T2TA 4CU6A 3WF0A 5F3EA 1ASJ3 5JI9A 1K5MC 2GN7A 2AEYA 1OFNA 2D7FA 1D4M1 1QH7A 3GCXA 3SLIA 4NO4A 4AW7A 4LA3A 3TOJA 1U0AA 4Z07A 2ZGRA 4DZGA 4ZU4A 1ND3A 5D1IA 4ZU5A 3VGIA 5DDJ1 3WT3A 2QBXA 4XDQA 3P1IA 4Y24A 5FYSA 4M0NA 3WNMA 4WZCA 4XF4A 3HR9A 1PNGA 4NUBA 2XG3A 3WF1A 5IVFA 4AOCA 1RUG1 3NV3A 4FVVA 4XDPA 4BCUA 3B9CA 5EQUA 4CEWC 4JGYC 5HXVA 3KHBA 1E5HA 1G9CA 4K8FA 4C8DA 1AVBA 3WNOA 4XCAA 1F4AA 3E5QA 4MV2A 5GLWA 3VZJA 2WIIB 4AQ2A 1OH3A 5FO9B 1R64A 1CAXA 4NRPA 3I2OA 4D6SA 1QNWA 1JN2P 2KD7A 4MH0E 1C57A 4H55A 2VGDA 5FYIA 2Q8CA 3H50A 2XJPA 1NYWA 2JDAA 5IT6A 1UAIA 2EALA 2JDZA 2P37A 1BBT3 1ZRIA 2DTWA 3ON7A 3N9MA 2HWF2 3I97A 4DIQA 1IQAA 4NWWA 5L36A 1Y4WA 2VUCA 5EPAA 2UWAA 3ETPA 5FY8A 5F9TA 5A6QA 3S30A 4AVTA 3O12A 3IIAA 1YQ6A 4PLMA 4KH9A 3WV6A 2J1UA 1YFWA 2YB7A 4IXLA 3BU7A 4YGBA 3VBSA 1OURA 3RGBA 1FATA 3DECA 2Y26A 4UW3A 4Y1ZA 3VBHA 4FAGA 1OXCA 4R9BA 4COVA 5BNNC 1AXZA 1TNRA 3GCWA 4A7KA 2DUQA 2IXKA 2Y6LA 5LW9A 1GFF2 3UT0A 4U2AA 1H30A 1UO9A 4GH4C 3VD9A 1NY72 1HKDA 3NL1A 2MNGA 1HX6A 4HK8A 3H7JA 2JE7A 3K4ZA 5A33B 4QB1A 3HPNA 5T3NA 3U37A 5A7WB 2VXJA 3U07A 5FXXA 4N7IA 2V09A 2JG9C 3MUY1 4LBJA 4LNVA 4XABA 2LS6A 3ILRA 3BB6A 4Y4RA 1KXGA 3GNEA 2BDRA 5FZGA 3S5QA 3FBMA 5BNNA 1LHOA 4CYDA 1QF3A 4Y1XA 4EN9B 1PVC1 4P9JA 2P3YA 1PX4A 5FY9A 5JI7A 4RFT0 1N3QA 5E16A 1GBGA 4N53A 2JECA 3ES4A 4Q4W2 3EO6A 3BIEA 1YXWA 2DVGA 2ZABA 1EV13 3ITQA 3ACIA 1VE0A 1CONA 1SLBA 2VZVA 4YW5A 3MW3A 4CA9A 5FZEA 3ILFA 1DGWA 2GNBA 2WS92 3SNMA 2WT0A 2A1XA 3EYPA 1HXS2 4P9YA 4DY5A 4PLOA 1FPN3 4XDOA 4MGQA 2Q1MA 5CG9A 3T2OA 4AGVA 2WZ8A 3POEA 1LNSA 2RMU2 3BTAA 1CVNA 1D2QA 1XC6A 1RHI1 3POJA 4QQHA 5FYUA 3MFCA 1T6BX 3NKTA 4IGOA 2VOWA 5GLZA 2ZHNA 1ULFA 2SLIA 4YVSA 1STMA 4YVWB 1ZBE1 1UKGA 2GNMA 5KHHA 3VHNA 3LFIA 5EP9A 5M0TA 1JU4A 2C26A 1DQ2A 4V2VA 5GZEA 1RUE2 4GWIA 1UYYA 1KS5A 2PLV1 2E7QA 5FO8B 3CQOA 2A6WA 2ARXA 4RYDA 3KV9A 4OVEA 4LHSA 5LK7B 1R1A2 3GZEA 4KL1A 3NSTA 5DUVA 2VQUA 1CZVA 1OUXA 5DDJ3 3CZJA 3CIHA 2WN2A 1JOJA 4CUAA 1TMF3 3C7FA 3J7HA 3HAGA 2DCJA 3HJRA 5JOZA 2FDFA 3AZZA 1UMZA 1GP5A 1H2MA 1TMF1 2VBDA 2X5IA 2BP6A 2ZGTA 1GZ9A 1S0BA 2RDQA 1JW6A 1VAVA 3IKWA 2WFPA 1NQJA 3TN92 4BPZA 5IUQA 4UF0A 1VPHA 3WDUA 1G6NA 4HT1T 3NNFA 5C3OA 1U12A 4WVMA 4OULA 2D6PA 3E97A 2QVSB 3GF6A 3NV2A 2OKXA 5BNPB 3MEPA 5A70A 3KD4A 4IEOA 1QJY2 4ZY9A 3UJQA 5JZGC 2HWE2 3Q8EA 1A8MA 1UXXX 3N36A 2J1TA 1S0CA 1R091 3UKNA 1E5SA 3ES1A 4CP1A 1HB4A 1OC1A 2R062 4N8MA 1YQ5A 2ID4A 2E32A 4CDQB 1WCDJ 1WD4A 1YQ8A 4AF9A 2PAEA 1LCLA 4FOQA 4RR3C 4BQXA 5DZGA 4XVHA 3ZPOA 4Y1YA 1HW5A 4IESA 4ORFA 4I02A 3VBOB 1UY1A 1HQWA 1F5FA 1EAH2 4META 1HV1A 1SFYA 2YY1A 2OQ7A 4MUVA 4N7UA 3IZOA 4F3JA 5F5QA 3B3QE 3GZTB 3CO2A 4QPGC 1AYM3 4EN8B 2JG8A 3I3MA 2ZMLA 1VBC2 2PHDA 3AC0A 2WO1A 3MZHA 5DUXA 3KCCA 4DUWA 3M8LA 1XNBA 2W46A 1W9SA 2PHWA 3MIGA 4PCRA 5FPBA 5C4WA 1HQNA 2QQNA 4QXBA 2KM2A 3U0ZA 2XQXA 3KV5A 2HYXA 1DG6A 4CXWA 5D2AA 4FFFA 3UGHA 4XJUA 4XYXA 2BGCA 2HEYF 3RJRA 3E5XA 3AMMA 5A3NA 1BMV1 2LTNA 4GALA 4ET7A 5C6CA 2E53A 3WDXA 4Q4X3 2VUDA 5JSRA 2IC1A 3HMYA 4HLTA 1JZ7A 1RB8G 1GR3A 1EPWA 4XQWA 2B9UA 4GAZA 1HRV3 1FX5A 2AC1A 2QZ3A 4AL9A 3NJVA 3ZIWA 1RUJ3 5ACA2 4HPKB 1FOD1 2VTXA 3WDVA 3HNMA 4BH9A 3GZAA 4AI0A 1VMFA 1QJEA 5J98B 4D6RA 3WNNA 3B01A 3MHZA 1NKGA 3I3QA 3N35A 1GNYA 4FBFA 3DPRA 3WQBA 2VZSA 4R9CA 3ZPYA 1I6XA 2ZGOA 5G04L 4QPWA 5T5OA 3H7YA 3ZDSA 2Q1FA 4AG4A 4EZHA 5A32B 2XLAA 4D6QA 4DOUA 4W50A 2WLQA 4QHOA 4YG3A 3POYA 2QQVA 3KT4A 1MS3A 3N7KA 1VRBA 4RGAA 3WQ0A 4TSVA 1OUSA 3VBFC 4LOTA 1H4GA 5IK5A 2ARAA 1O3SA 5C5UA 1UU5A 4Y5SA 3PTYA 5EYXA 3OCPA 4UFMA 4P14A 3TWIA 5HBAA 4GKXA 2V4VA 5CIRA 4FTBA 5AFBA 3PUQA 3ASIA 4SLIA 2X09A 4C90A 2G4IA 4M0HA 2QCSB 3U1XA 3VZKA 5A6XA 2GP3A 5FZ7A 4M3CA 5LBCA 3RJ2X 3TN91 2VW0A 2Q0AA 4LO7A 3VBSC 1DYKA 1OPMA 5J1XA 5FY7A 1WUVA 2Y6JA 1AR82 2HWF3 1WCQA 1D2SA 3A7QA 3PDQA 1IPJA 2WSVA 3AMHA 3AP5A 4YZ4A 2R32A 4KWLA 2J1VA 2VCBA 3Q8CA 1WBFA 2FDKA 3USUA 5FZ1A 3S0MA 5E8AA 2PQQA 1HXS1 4PIXA 3GALA 1AX1A 1MACA 3LA7A 4YW6A 3RYKA 2J7MA 3W58A 4OCTA 3FZ3A 4UW6A 2NP0A 1XNCA 3K77A 3DCQA 3I2JA 5CU1A 2LW8A 1ZBA1 2JDMA 4MGKE 2FCUA 2G19A 2GALA 1Y3TA 4HN1A 5C3RA 1F31A 4EWEA 3J8F3 2WWJA 2XR4A 4KU7A 5K4LA 2LM3A 3W5MA 2YGMA 3ZFGC 5JDBA 4LKEA 3AVRA 5T5JA 4KWJA 2YMZA 3B94A 4IEPA 2OXBA 2ET7A 4KG8A 4B7EA 3RZJA 5FBZA 3VHPA 2VMGA 1JZ4A 4D7TA 3SEEA 2QUOA 3OJBA 3I2FA 4NJ4A 2Y6GA 4MHUA 4QQOA 2IXIA 3PIJA 4MGYE 1V0AA 4RA0A 4BQ5A 2RDRA 2P2KA 1MS8A 2D6OX 3ACGA 4IEWA 4UFKA 1DIWA 2E6VA 3VDAA 4BISA 3DUIA 2RG4A 4P00B 5F39A 4JKLA 4IEVA 1Y9MA 3AP7A 2DFCA 4FPJA 2BGOA 3ZSJA 5GLUA 1GZWA 1AYN2 2X10A 5A3TA 2GU9A 4LIVA 4COZA 4PI0A 2B39A 3NJXA 1DLLA 3I49A 1G9BA 1YO8A 2C1FA 2N7GA 2VXRA 1S0IA 4FPKA 4LKSA 4P9XA 3OGSA 4YLZA 3WCSA 5DMYA 5CKQA 4PF1A 4TWTA 3BI3A 2P34A 3HVDA 4JQRA 2OUHA 3AP9A 4YPJA 3H42B 4HKLA 1LU1A 4KGGA 5IYYA 2ZGQA 5T55A 2XJSA 5E89A 2Z79A 1W05A 5J96B 4LR4A 3TYJA 1MZ5A 5CADA 3KQ4B 2QQOA 3RRDA 5FPUA 2C24A 3Q9OA 1S2KA 1LOAA 4LPLA 5K9YA 2P3IA 1FV3A 5LA1A 1PVC3 1V6LA 1X33A 2HWE1 3A0NA 1KS4A 1QJU3 1IS5A 4I3PA 4AR2A 2W94A 1VBE3 1YYNA 3D8CA 4QX2A 1W28A 1O3TA 3AMQA 5BNNB 2C0ZA 2EAAA 2VE1A 4GXLA 1ST8A 4A7ZA 2Q30A 1ENSA 1YFXA 4YGCA 3VBSB 3SCHA 3HIFA 4ZXEA 2RJKA 5H9QA 3VHRA 4D69A 5BNPC 5A3WA 3AXEA 3VBRB 1I3HA 3MF9A 2VZRA 2OA2A 4Q26A 4QX5A 3I4IA 2IFWA 1IPKA 2OPKA 4A6SA 1ENQA 1K5JA 1JXNA 1LEMA 2BFUL 3FJSA 1JTZX 4PIZA 2C5DA 3VZNA 1VBC1 2BOJA 3TN93 5F3GA 2DTYA 3OSDA 1ODNA 2WO7A 1QJY1 2Q8EA 1VBD3 1XNAA 2WNUC 4L9BA 3N3HA 4LKFA 4OYUA 4CDQC 1XNTA 5CFDA 3KGZA 3LEIA 4DXRA 2XBO1 4AVCA 1MS9A 1EPZA 3ACLA 5K8SA 4A6OA 1DZRA 4R4XA 1UZ0A 2D6LX 4XJWA 4FXGB 1W99A 4GMP3 2BZDA 3WP5A 2RM21 2BU9A 2WSUA 1AR73 1W2OA 5JVVA 2ATFA 1FI2A 1QY4A 1YI9A 4XUQA 3JBG3 1CPMA 3ILNA 4MXWB 4Q4V2 3HN1A 2GC2A 3DPRB 4JDNA 1NG0A 1P8JA 2YBSA 4KWUA 4QX8A 5FBJA 4I3GA 5DZEA 1GNZA 1ASJ2 4AEMA 3A0KA 4DINB 3SMHA 4NIDA 1IS3A 3PJQA 3O1PA 1VB2A 3O5SA 2WFF3 1UYPA 5IVCA 2ZGSA 3LDBA 1OA2A 1PO12 2A70A 1AYM1 2VPVA 1DQ4A 4NIGA 1TE1B 3CZUA 3AYCA 4TN7A 1UY2A 4XETA 5CG8A 1YC61 4MGZE 1WLWA 5EWSA 5FREA 1NCRA 4WM7C 5FIXA 5I0RA 4TLFA 3MLLA 1R1A1 3VD5A 4CP2A 1W8WA 5JAXA 1NXD1 2J1SA 4HZFA 5KC5A 3CJIC 1RMU1 3K48A 4QX0A 1J3PA 4QKFA 4NN0A 3RYPA 4CU7A 2GH8A 1BBT1 3ZO0B 2ZACA 2VCMA 2WQ4A 5GLVA 3MICA 3VHOA 2I2SA 5DUWA 2HWC3 1ZBE2 3GHNA 3O1MA 4W6WA 1FNYA 4B4QA 4XF1A 1RUJ2 1BEV1 5A3UA 1YIPA 3H3UA 1SBFA 4FPGA 4LULA 1CN1A 1AJOA 4ZU7A 2BYVE 4FQZA 5ERLA 5EYYA 2VC9A 5FPAA 3WP6A 5ABJA 3ABZA 2PHXA 2MPFA 4GIQA 3X29B 2R30A 4JHTA 1PGL1 1C1FA 2BV4A 1W6OB 4ATEA 4Z1VA 5JCTA 1TEIA 2QTWB 3NNJA 4JAAA 3NJZA 5LRSA 1DQ0A 1PIV2 4HN0A 1ZZ8A 2BNMA 5D8AC 3PMSA 1LAJA 5EJZB 1OA4A 3AX4A 2Q5TA 4MADA 3RZKA 2V72A 3J8F1 1NCRB 1XQNA 5F5AA 4COWA 4CSWA 4HFSA 4MO3M 4Q29A 3UYJA 5KXDA 2GC1A 3AFGA 1PVXA 2VU9A 4Q0QA 1NLSA 1AHSA 1AF9A 1JUIA 4CVUA 3OF1A 4CCDA 1V00A 5JSPA 1VMJA 4X6RB 1URXA 1PNFA 4P08A 1US3A 5A1LA 4UT5A 5AC93 1UQXA 1VP6A 5IHRA 4OQ8A 4IEQA 4GQ7A 3N9PA 1HN1A 4QKDA 4Z92B 1F35A 2E31A 2V73A 4YVSC 5JZGB 1NA1B 5FZOA 1N3OA 2P6CA 5L9VA 3BOWA 3OPZA 4C91A 4YVWC 3CF6E 2PQSA 3AJZA 5BNPA 2IXJA 3AMNA 5T52A 4J6GA 2XLFA 5C70A 1IZ3A 2PAMA 2XB6C 3CNAA 4YVWA 3DL3A 4AHWA 1D4M2 2RR13 2RS12 3EJKA 1A78A 2VQAA 1Q56A 4QDRA 5HPOA 1FPN2 1WBLA 1AL0G 3NAPA 2K9ZA 4XTMA 4DXZA 4FPFA 3I2KA 1HRV1 4QKBA 3VBUB 2JKXA 2XQRA 5C7GA 2WABA 3D6EA 2ZXQA 4GB33 1XOYA 1YJLA 4O61A 3RI9A 1JH5A 3N4MA 1O4ZA 2GC0A 4AVVA 2VL4A 5SV8A 4CPBA 3VZLA 2YFUA 3OYWA 1LOBA 1XNDA 4HSJA 5FTTC 3D82A 3ZYJB 1CWPA 2JDKA 4XAAA 5A3OA 4RQPC 4XOGA 2JICA 2Y0IA 3WNXA 4KMQA 1OD3A 2BRTA 3H1YA 1UL9A 4A3XA 3O1RA 2H0BA 2ZX2A 2JG9B 1CX4A 3LDRA 1Y7BA 2XBO3 2ADEA 2VNVA 4LBKA 1Y43B 5FXVA 3KCYA 1SPPB 2Z4FA 3ZM8A 2BNNA 3NQHA 1H4HA 1SBEA 2A6ZA 2JIJA 5FZAA 4UFHA 4TXWA 1POV0 4NHLA 1S1AA 1GSLA 1RUC3 3RI8A 5L7OA 3MUZ1 1GQGA 5B4NA 1WLCA 2IWGB 4XJZA 1RUD2 4Y3OA 1QJX3 1ZZCA 1XU2A 5FY4A 4H7LA 4JDOA 4XIOA 4YM2A 3E6DA 3JQXA 3M3CA 1FXZA 1H6XA 5JIAA 3VBRC 3AZVA 4XF3A 4Y22A 3IDAA 4RR3A 2W3JA 3VKOA 3M1HA 4EQVA 1J83A 1JYCA 2R043 1RIRA 5C4WB 4K1ZA 2VOTA 2D43A 3SCGA 4YZ2A 4A45A 3O0VA 1DYPA 1W6NB 1LU2A 1WLTA 2ZAAA 5ABJB 5EHDA 3PL0A 1SZBA 2CAUA 2I74A 5DAWA 2RJ2A 3GJBA 4Y20A 3J7MA 1HV0A 2Y33A 3T3YA 3ZR6A 5FMBA 1EP0A 1IOAA 2FBEA 4OMCA 1DZQA 3VB9A 1ULPA 1ALYA 2D6NA 2D5FA 2JB4A 4OI0A 1PK6A 4NVPA 3KF5A 4N43C 1YIFA 3VKFC 1AX0A 1XE0A 2A3WA 4HKWA 2XUMA 4K3UA 4XUNA 1PMHX 1ZRDA 2IXLA 2AGSA 3JQWA 1MS5A 2R49A 3BCWA 4CXYA 5IVYA 1LRHA 1VB4A 3EHKA 5FDBA 4E2GA 4E8DA 3OEBA 3VBUC 1GNHA 3J7LA 3MPBA 4AQSA 4CU9A 3OBRA 3WDYA 3PIGA 1U5XA 1Q5OA 2I07B 1YJKA 2E7AA 2QQWA 4XBLA 2YG0A 5E6HA 2J1RA 4E4SA 2UWBA 5FZDA 4AFBA 2NYYA 3KMHA 1IHMA 1SDDB 1DCSA 1VRH1 1W9TA 1LOEA 1K3IA 1VBB2 2DVBA 2X29A 2FQPA 4S2GA 4UI9L 5FZOB 5IJRA 4Y4YA 5TSWA 3WCRA 4DPNA 1KRIA 1GWMA 1YHFA 5LZ6A 1F5JA 2Y0OA 2X53S 2QJVA 3JB8A 3SITA 4L97A 2DVDA 4R9AA 2EIBA 4B1MA 2XVGA 3VL8A 2GH2A 1BMV2 2ZAHA 4P5YA 4MZUA 3T1MA 5GALA 5GJ6A 2IFRA 3WNKA 4CDWC 1RITA 2BBAA 3UL2A 2VZ1A 2DDUA 3WDTA 4W8JA 3MDPA 1W8OA 4H7MA 3WINE 5F3CA 3ELNA 1CIYA 3H1WA 3U4XA 2O0OA 2VOKA 4RSUA 1DF0A 2EICA 1R1A3 5LEJA 1O59A 1X82A 2P6HA 5DDJ2 5JOYA 2GNDA 2YC4A 4B8EA 3B93A 3JBG1 1QEXA 5GZDA 5IVEA 1GKBA 5F3IA 5CA6A 4OLLA 3DEMA 3UGFA 1ZRRA 2QDRA 5DAQA 2BWCA 4FOVA 5F2WA 2KR2A 4FTSA 1W8HA 3N7MA 4QPGA 5DXDA 4DY3A 3LEKA 1NZIA 1GZWB 1VBB1 2NM1A 2WFF1 4XACA 2H6CA 1RUF3 2W9XA 1MZFA 1TZOA 1OFSA 2YC0A 5A33A 3WZ1A 3BTZA 4ZS2A 3SH3A 1DDLA 3OEAA 4GH4A 2XJRA 3AKTA 1PK6C 3APBA 3EMRA 2QFEA 2XXZA 1XSQA 4NE9A 1OQEA 1ZM1A 3DYPA 4EYUA 1SMVA 3LEMA 3RDIA 3RZHA 1XU1A 3UNPA 1BHGA 2CHHA 1H8TA 2VMDA 3K2OA 4O9EA 3JD72 3ZKUA 1CX1A 1RUH2 1ZX5A 1Z7S2 4EE2A 4OZXA 3ZYHA 2ZBJA 4AK3A 2VW2A 4CCNA 3KHCA 2R1DA 3DPRC 1SCRA 1MS1A 4AI8A 4BIFA 1TME3 4CDXC 5I8YA 4IV1C 5C3PA 1VBE1 5J09A 1CR7A 2D40A 5FXWA 1AYM2 3O14A 1APNA 4XW3A 4LMFA 2FDGA 2RHPA 3THTA 4X6QB 3VDDC 2WAOA 2VQ0A 1A34A 1W9FA 4NIHA 1IKQA 5FCCA 4JVAA 2JG8B 3ZXDA 5B2GB 1POV3 5GZCA 2GP5A 3ZDVA 2W91A 3U75A 5FQ0A 1W04A 5A7PA 5CB7A 2JXAA 1BKZA 1RMU2 5DAPA 5C3SA 1W0OA 2VD7A 2VMEA 4LHNA 2SBAA 2ZJCA 4CP9A 4YNIA 5L7OB 1DYOA 4N9HA 1HB2A 3C7GA 4Z8BA 5J7MA 5LBFA 1FMD2 3HD8B 3WSOA 4LT5A 3KF3A 4BMEA 2UY9A 1MS0A 4FPHA 1CAVA 4Q0PA 1S2BA 2GZWA 4FPOB 5F8PA 3IDBB 2VMHA 1OQ1A 2ZGMA 3AFKA 4ZZ5A 4XPVA 1AXYA 4Z2WA 1G8WA 3OPWA 1QQP3 1PMIA 3VBFB 4Q8KA 2XPJA 2JD9A 4BQWA 1O3QA 1D4VB 1Q8VA 1LECA 4EV0A 1YRZA 4OI1A 3LIHA 2GNTA 2LRPA 3BVCA 2ZGKA 5FY5A 4FOYA 4Z82A 3POGA 3VBFA 4IGQA 3S5AA 2X5IB 1SLAA 3D5OA 1DQ1A 2DFBA 2WNVA 3WP3A 3I2IA 4DEQA 4LBLA 1PZ7A 4AQTA 5FJKA 4GWMA 4FFIA 3HOBA 1RINA 4XFCA 1W9YA 2YU2A 5JWPA 3LF7A 2E63A 2AEZA 3AKPA 1C8M2 4CUCA 4JZRA 4IDZA 2VR4A 3MF6A 1O5UA 2WZR2 3FFZA 1H9PA 3FHAA 5A80A 3W5NA 3A23A 1KITA 3NV4A 1V9U3 3MO4A 5JIUA 2RMU3 4LA2A 3C2UA 1S0GA 3RWNA 2QZ2A 1LHVA 3H8RA 1LGCA 2OZ6A 1BYHA 4HG6B 1ENXA 1NA1A 3PUHA 5FZ4A 4CDWA 2YPDA 3OB8A 4G4FA 4QD2A 3VDDB 4Q4Y2 1UX6A 3R6SA 2P5BA 4BQ1A 2ZMKA 3OBAA 5EFUA 4KGQA 4XMIA 5LCWL 2W52A 4XUTA 3FBYA 4DMIA 2XOMA 3PTRB 4XFGA 4AI9A 3UETA 1Q43A 4R52A 2F4PA 2OYZA 2J1EA 2VM9A 3FLTA 3WP4A 2E33A 1SLTA 5CFCA 2WYSA 4NPLA 4OHVA 4XZPA 1DQ5A 2WS93 3JU9A 5FWJA 2R7EB 4IEYA 5D21A 5L7OC 1HXS3 4NIAA 2WO3A 2HBTA 3VD3A 4F8AA 4UBHA 3M3QA 1RUJ1 4Y26A 4C1WA 3LAGA 1Z0HA 3WY6A 1RHI3 2IVJA 1B09A 4AGGA 3OD0A 4TYSA 1IQDC 4QPYA 5IVVA 1QJFA 3WR0A 2EF6A 3I2HA 1SLLA 2NMOA 4GB31 3ZYGA 1Q8SA 1GOFA 4LLOA 1DHKB 4QU2A 4A44A 4RHV1 5C33A 1AUYA 1X7NA 3NMBA 1TQ5A 3LOIA 2UU8A 2XVKA 4COUA 4K7JA 4D8MA 2HBUA 2ARBA 1DGLA 4RHV3 2BTVC 3VBUA 5D8AB 3O0WA 2GC3A 4AE2A 1ZZ7A 2CYFA 3OUIA 1YWKA 4BK5A 2ZHKA 4FPYA 5AVPA 4F83A 1E5IA 5J36A 1M06G 3CBNA 5JXIA 2JDUA 5HV0A 4IERA 1H2NA 3TNQA 2BWAA 4AFAA 1A3KA 1XNKA 1UU4A 1ZZ6A 3OYWB 4LO6B 3R4SA 2FDHA 2CAVA 4ES8A 4LJHA 4WVZA 3MIEA 2WS91 3VBHB 1B35B 4EJRA 3SXWA 4EN6B 3ZKYA 2FZ1A 4JDMA 4NPMA 4OZOA 3AKSA 5JOWA 1NE4A 1DLCA 2QKDA 3WHUA 5JZGA 1H8TC 1ZNPA 2VNGA 1QOOA 3WW4A 2BVBA 2Q4SA 5IK4A 1UIJA 4WM8C 2BBVA 2QQIA 4IW3A 4CTEA 4Y5TA 2PAKA 3NNLA 1UOFA 2DV9A 1NZCA 1V9U1 2DBIA 1XJAA 4EWAA 1RUNA 4CEYB 4DB5A 5T5PA 3WW3A 3ETQA 1W2NA 4URTA 4W65A 4E4HA 1CAWA 3QCWA 2XUEA 1OF4A 1MEC2 1RJ7A 4RS5C 1ULGA 3RFRA 3NW4A 1J3QA 3WG4A 1DQ6A 4YW7A 2DBNA 2A71A 2EXIA 3AZWA 1RUD1 3CJIB 5KHGA 2QQPA 3DN7A 1F4HA 1BEV3 1JYXA 1RGSA 1QDOA 1AR63 2BEOA 4NR1A 1JI6A 3KT7A 3FE5A 1O8SA 1RUG3 2D97A 2JDHA 2W87A 2HWC1 3QH6A 1T2XA 2CNAA 4O7XA 3U11A 1CAUA 3V0BB 4GWJA 4J1WA 4UOJA 1NUKA 5FMOS 3S6PA 3OUHA 1PK6B 4N43B 1NCQB 1TG7A 5GLTA 5IAXA 1JHJA 4JV4A 3W59A 5CEHA 4QGMA 4Q0SA 1C5IA 3HWJA 4HKOA 3B00A 3CJXA 4CP9B 4OHZA 4LOSA 4K9SA 4I09A 5AVAA 3KCXA 2NZ9A 4HVQA 3U14A 2WN3A 2ZCWA 1RUE3 1L3JA 5ABJC 1ULDA 4PQ9A 2HYKA 5SV5A 2HKXA 2WA4A 3GBGA 5CVRA 2HEWF 1XRUA 3I2DA 4P02B 3JXSA 3PUAA 3KWVA 2VJXA 2FZ2A 3AJYA 5KC6A 3DKQA 3VZOA 4XE9A 2XH6A 1W9WA 1NA1C 2ZKNA 4LUMA 2Y60A 3TB0A 1C1LA 5L9BA 4DRRA 1V6NA 4MGIE 1OA3A 4WZFA 3PLQA 1RUH3 1EUTA 1RUC1 2AREA 3PVEA 1AR71 1GWLA 1W6QB 4YGEA 5EV7A 5FZCA 4TZDA 1AR61 3IIIA 1H8TB 3DYOA 1ODMA 3GDBA 3IAPA 2R041 2A6VA 2XKPA 5IAVA 3CHXA 2Y64A 3BODA 4CP0A 1W06A 2IZWA 4Q4W3 1UOJA 2FHRA 4AHXA 3AKQA 3IPVB 1RVF3 1LGBA 3RVHA 4YGDA 1OVSA 1CZSA 1LHWA 2B9VA 2C6SA 4DO0A 5K0UA 4YFZA 2VVFA 1OHFA 3KS7A 5CFDC 2G9FA 4QQPA 4NHYA 4QX7A 3BN6A 2GSYA 4RL7A 5G05L 3ZYRA 2J22A 3SKJE 1W6PB 1D0GA 1K42A 1UWWA 2RE9A 4CPBD 2A5ZA 3RZMA 4AEKA 1H9WA 4C0HA 2BOIA 2XVLA 1JMUB 4AHZA 1W8FA 4K1YA 1OVPA 2OW4A 1CZTA 2RS32 3NO8A 2QE3A 2VOXA 5LA9A 3LDKA 3FX3A 1JBCA 2XJQA 2WZPP 1VBA1 1HJFA 4Q1RA 5LBEA 4QKNA 3KV4A 4XIKA 5FP9A 1VBC3 1LESA 1WCUA 1AR83 5A7OA 3MIDA 2J1AA 5BY5A 5HCHA 4XFIA 3ZXLA 4BQ3A 2HLEA 1QXPA 2W5FA 3ME2A 4YW3A 4BMBA 1OPOA 1GV9A 4QHZA 2UURA 3IB3A 1TMF2 1R092 2K2SA 2CGNA 3DXTA 4Q8LA 2Q8DA 1TVGA 4RS5B 4DNYA 4GMP0 2R6QA 4MOAA 4MX3A 2UY8A 3TEYA 3H1MA 1G9DA 3IT8A 1V6MA 4UXAA 5FPVA 3FMGA 5LASA 3SH4A 3TRSB 5JMCA 4CCKA 1RUF1 2VBPA 4XFHA 3VD7A 1YFUA 2HWD3 1VBD1 2H6BA 3KVBA 5ANNA 2XWJB 2ZX0A 4CCJA 1YLLA 2EIEA 2ILMA 4R9DA 5KXCA 4IE7A 1UMIA 1QJU1 2JWPA 1V9U2 1SCSA 3SEPA 3ZSEA 3ZFGB 5FP7A 2B46X 3PJYA 5KR7A 2AENA 2VCAA 2R063 4BM8A 4BQ4A 2X05A 2R0HA 1Z7S1 4D7YA 2JB8A 2W0XA 1W3XA 1OMIA 1FYUA 1YFYA 1GUIA 1HB1A 1WWYA 2NPIA 1W2UA 5BYNA 5FJHA 2VZPA 4M3CB 4AEDA 4CCMA 4I0BA 3ZFEC 2RS52 4BXFA 2ETEA 2DUOA 4PBPA 3MIHA 3VKMA 4CUBA 3FFQA 2GDFA 5B4XA 1C28A 2F4LA 1W8UA 4BE3A 4E2SA 2XDVA 1AL23 4M4PA 3QBQA 4L11A 4WBBA 2JKBA 3T2QA 1W6OA 3AP4A 3I8TA 2PMWB 4AAPA 1ONAA 4FP3A 4IV3B 3AP6A 3RS6A 2HWB3 3UGGA 2PHUA 1G7YA 3VKNA 2DVFA 3V0AB 2JG9A 3J26N 4LBOA 5FYMA 3A21A 3WHTA 3BPSA 1W6MA 4IE4A 1ZRFA 4NAOA 1UZYA 3L2HA 1OSGA 1POQA 5LY2A 3K51A 1EV12 2R073 4Y1UA 2PHTA 3O1UA 1GYKA 3POFA 2PYTA 2OS2A 1N1VA 2OPWA 4RGGA 5DAXA 2JG8C 4HBNA 3WD5A 3OOXA 4LBMA 2DCKA 2WT1A 4XJ9A 3LB9A 4IEZA 4LTAA 4J1XA 1G9AA 1BK1A 3WW2A 2MEV3 1IS4A 2BNOA 4LKDA 1GQHA 5F5CA 4XF9A 3USUB 2VMIA 4LK6A 2UYBA 2NN8A 1PO13 3JB4C 4DFSA 3O1VA 3POWA 5FV3A 4NMIA 1OLQA 4QGLA 3UKTA 3VBOA 1BLZA 2IUWA 2VNRA 4L99A 5GKAC 4X8NA 5FZ9A 5CKMA 3ZR5A 4B29A 1UU6A 3R4DB 4R4ZA 2HWF1 1AR92 1MQTC 1MPXA 1R083 3VDCA 1M4WA 3D0SA 3BTYA 4GMP1 3NV1A 5IFPA 2DF7A 2RDNA 3MFAA 4JGZA 4QM9A 2ORZA 2VULA 2LUWA 3O1TA 4K21A 1WGPA 4YG0A 3CKHA 1AR72 2Q1ZB 3BUCA 4JRLA 2BPA2 2AACA 2OQ6A 4LE4A 2HJIA 5LB6A 4UFLA 1O7FA 1PGW2 2VAUA 4HL0A 4INDA 3ZFFC 1ND3C 5HV4A 1UYXA 1YI7A 5A3PA 2ZX1A 4PBOA 5A1FA 2ZGPA 3AK0A 1PZ8A 4ITCA 5JLVA 1GICA 4YZ3A 4YFWA 3VN4A 3MIFA 5C3QA 1HJGA 2K0GA 4NRMA 1MVEA 3ZYFA 1EYBA 5LA0A 4P9GA 4OI4A 1CAUB 4H14A 3RMXA 3ZX7A 3V0BA 1S55A 1W0PA 2ZKLA 3FLPA 4WM8A 1RVF1 4CDUB 4KG0A 3NAPB 4KQ7A 3QD6A 5IWFA 3DV8A 2X8KA 3QOPA 3IAQA 1CQ9A 3VBRA 2ZZJA 3N9LA 3AL6A 3AYAA 3PVOA 2EIGA 3TAYA 5FOBB 1WD3A 1VBE2 5BNOA 1AJKA 2YHJA 3SISA 5CBLA 4B7KA 5FQ0B 1ENRA 2HWC2 5LK5A 2WRAA 2Y6KA 4XFAA 1B35C 1F9KA 5C9AB 2D6MA 3MLKA 2B45X 4FPCA 4QGNA 5CFCB 3NKGA 4IV1B 1JYNA 2XJTA 3TEXA 3O1SA 2BJSA 3C7OA 2JE8A 5K0UB 4FFGA 5FPXA 1OOPC 1WW6A 1HRI3 3FUQA 3FHQA 4JQTA 4OI2A 1UOBA 3WQ1A 4HPKA 1RUE1 2K46A 4WVWA 4XZUG 2KA3A 2VUJA 1D7PM 3H0OA 3P6BA 4XTPA 2B8MA 4AVSA 2A73B 1J84A 1U5YA 2PELA 5I8SA 1AYN3 4M00A 4ONUA 1XYNA 3ENRA 4QU1A 2XGXA 1WMFA 5FY0A 3AKRA 3KZ4C 1QQP1 1VAMA 2CSGA 2D44A 3LZZA 4FO9A 4QPIB 1HRV2 1CD3G 4QAWA 1MVQA 5JR7B 4S2DA 1DBNA 1KJRA 3AXDA 1N3PA 1RUH1 1SBDA 2Z42A 4XF0A 1ND2C 3V0AA 4D94A 3NVCA 3GYDA 3AZYA 5HCFA 1Y9GA 2V4AA 2Y6HA 1KDKA 1OOPB 4XAEA 4CDQA 3PURA 3WNPA 2AH2A 3JBG2 1LKNA 1VBA2 4YW1A 5F7UA 3RZLA 1WZXA 2B5HA 2VMCA 3NWKA 3W20A 4YZ5A 5JSOA 3Q8BA 3WF2A 1GOHA 1RC6A 1EUUA 1PO22 2RMU1 1XB9A 4MXWA 4AI1A 4ASMB 3IN9A 3CLPA 1PVC2 2QQUA 2WFF2 5BNOB 1V6OA 1LB2A 4LBNA 4R8HA 1ZBA3 1K12A 1NOVA 5I0TA 4Y5Z0 2A3XA 1EY2A 1JYTA 2EXJA 1UY4A 5CISA 3IMNA 2DVAA 1YEWA 1BJQA 1KFXL 1OF3A 5FZ3A 1R1ZA 2AZ5A 1JOPA 3IDEA 3NAPC 3DYMA 1DZTA 4CDUA 1UN1A 4ISQA 3F95A 2YXSA 4ZZ8A 1R093 4DS0A 5F37A 3PVBB 1UW8A 5IATA 4AAXA 5CZKA 1JUHA 2IXCA 4FFHA 2PLV3 5FUPA 1KDMA 4JGZB 3OGRA 3WX5A 5ACA1 3BIWE 3WQ7A 2ADDA 2V5DA 1LOCA 5FWEA 3RZGA 2FD8A 4QMAA 1ZBE3 4V2WA 1SDWA 4LHKA 2QDNA 4I01A 4K40A 5IK8A 3VD4A 4GB32 2C9KA 3KB5A 3POBA 4ZXKA 4MG2A 1WW4A 2CTVA 5J37A 3K3NA 2BVVA 3BGAA 5FKCA 2XHKA 4Q4Y1 1NLRA 2VZQA 1RTVA 4AHYA 3E6CC 2BFUS 1GQPA 5FZHA 4O9GA 4RN5A 1VMHA 5IVBA 1FNZA 1MR5A 3S7IA 1NQDA 1NLQA 3PU3A 3ACHA 2WLPA 3DGTA 3ZSLA 3LSEA 2WINB 5HCBA 2G1MA 1TNFA 4JKMA 1DU3D 4DXSA 4WVMB 2QQKA 2DU0A 5F5IA 3D3AA 4LBQA 4UFJA 5BUVA 5EIYB 3VL9A 2PHFA 1UPSA 5A32A 4AYUA 3MBWA 1GLHA 3OGGA 3UK9A 3BU0A 3I59B 4PDWC 4IEXA 5JUVA 3EXUA 1MQTB 1QXRA 1W2TA 2AR6A 3QLQA 4RFRB 5FYTA 2CY6A 5BPXA 4CCLA 4B4PA 2ZGUA 5DZFA 2OVUA 1WCSA 2EXKA 2E26A 1UXZA 3K4DA 1SLIA 1NAEA 3NNGA 1VR3A 4WM7B 1MEC3 5BNOC 5I93A 5DABA 3MYXA 2RDSA 3ACFA 1GMMA 1J58A 1WA6X 4GULA 4QPGB 1E57A 4EN7B 1GZTA 4ZHNA 1GWKA 2Z5WA 4U36A 3M3OA 4YVSB 5FXZA 4A4AA 4ARXA 1GZCA 2ENRA 2A3YA 3LA3A 3LKJA 4OUEA 3LPGA 4QB2A 1PZ9A 3VV1A 2XJVA 3AMPA 3MPPG 2GMEA 3JUUA 2DCZA 4QDSA 4AVAA 1JYVA 2NLRA 1ND2B 1Y9QA 3HQRA 1OD5A 2VVEA 4A41A 2ZX4A 3FUOA 2JDPA 4MLOA 4CE8A 2YPJA 3PNAA 4MXVA 4XFFA 1A8DA 5FMCA 1XE8A 2ZMNA 4YW4A 1NCRC 1ZVFA 1REFA 3LIGA 4E4DX 5H9SA 1G86A 5EZWA 3EB7A 1BK0A 2VCCA 2XHNA 4RGKA 5A7SA 5IVJA 1LTEA 5AC91 2VW1A 4LUKA 4ATFA 1W3VA 1UZZA 3M3EA 4HSLA 3H3ZA 1KGYA 5FZFA 5A1AA 1LHUA 1WMEA 1ZA7A 2YBPA 3AM2A 3THDA 4NOTA 3AYEA 4YM1A 5C5TA 1UF2C 3VUOA 3QH7A 3O7OA 2P3JA 4XBNA 1F2NA 3WOGA 2VZ3A 2F17A 2AUYA 3Q8AA 4WM7A 3T4HB 1DGRA 3H3LA 4UYBA 3VKLA 4I0WB 3POSA 1OT5A 1VJ2A 1XYOA 4LO4B 4FPLA 2JE9A 2YYOA 1S0FA 4YZ1A 1OBNA 2QQJA 3LGRA 3LPFA 1O6UA 3Q8FA 4HANA 4JTOA 4MSVA 3B02A 5GM0A 1H1MA 5T50A 1LR5A 4UF0B 3DF0A 1C4RA 2JJ6A 2WNUA 4CDUC 5LBBA 2YBKA 4LBQB 1MZ6A 1NT0A 3KQRA 2NMNA 4BDVB 3VBOC 2WYFA 1N1TA 3N7LA 1PM7A 5I0DA 3FL7A 1D4M3 2CWMA 1J1LA 5T5LA 1ZYBA 4LK7A 1TME1 4Q4V3 1UY3A 4AI2A 4HOOA 4CRQA 2VTXJ 4L2NA 1N1SA 2CL2A 5LRRA 4XC9A 5K7PA 1NXMA 1QKQA 4MYEA 1LULA 1BVVA 1SLCA 2CDPA 1HQLA 5J3UA 3ZMNA 3GHMA 2RS31 3ZVXA 4D7SA 1ULCA 3U78A 1SACA 4QXCA 3CMGA 3T0AA 4QPIC 2FMDA 2DCYA 5C71A 2JDNA 2W47A 3GXUA 3CL1A 1ZZBA 3OGJA 4RS5A 2ZOEB 5FZKA 5A6ZA 3JCIA 3VLBB 4QPIA 3AB0A 3TNPB 1S4CA 1GP4A 5A3MA 4LQRA 1YNAA 5DUUA 4AGRA 1H1AA 1FV2A 1W6QA 1HN0A 1I5ZA 5FYBA 3W9AA 1QJZA 1AXKA 3KGLA 5FAXA 1SHWB 3WG2A 2CGPA 1QHDA 1QXJA 2A6XA 2XONA 4KWKA 1S0DA 4YSFA 3WF4A 1AYN1 2BGPA 3LCPA 4YM0A 3NJYA 4WVVA 2JENA 1JU3A 1FOD3 2I45A 3KSCA 3JD73 1RXGA 4LLFA 1W39A 1RJ8A 4QX1A 5KWRA 4URAA 3K75B 4CEWB 3A4UA 5CNAA 4N53B 1WLDA 1RUC2 1PIV1 2G9GA 5CKNA 2R16A 4XMAA 3UV9A 5I0UA 5FP3A 2WR9A 2ERFA 1TME2 1XPWA 1WCKA 4Z2AA 4L0PA 4CCOA 4AEJA 3NRUA 3CU7A 3ZXKA 5J48A 4W4ZA 3BYWA 1LOGA 1YCIA 5L9RA 1X8MA 3HQUA 4PIYA 4FQ4A 4WV8A 1VALA 4P9WA 1PO21 1L7RA 4BQ2A 3H9AA 2RV9A 2W39A 4RD7A 1S2EA 2WDBA 5A7WA 5FPZA 1RUI1 1WW7A 4NIIA 1V6JA 4HETA 4V1PA 2ORXA 1OKQA 2CWSA 1AZDA 1PHMA 3OGVA 4P9LA 3DXUA 4QXKA 4YM3A 5KHIA 3LQCA 1MEC1 5ACA3 5JXGA 4HK9A 4KBBA 1BBT2 3SCFA 1DFQA 1N47A 3IMMA 4JKKA 2YGLA 2PFWA 5FZLA 4S2HA 3ZFFB 4ZONA 3U4SA 3EBRA 4XQ4A 3HQXA 4Q4X1 4JGYB 2VTFA 5FYCA 1AL22 4QWNA 5KBFA 4FAHA 4MGTA 4A3ZA 5FK7A 4IEUA 3OD4A 4Q4Y3 5JPMB 3ZXFA 3K4AA 4IV1A 2FMYA 1VBD2 2TEPA 1G9FA 3G6JB 2RS51 1KJLA 3IDCB 3INAA 4ARYA 3M3IA 1O4TA 2XKOA 3I2GA 3J4UH 4NRQA 2OIIA 3IBMA 2IXHA 1RUI2 4PLNA 1K45A 1CIWA 3MW4A 5KXBA 4OHYA 4YG6A 3ZXAC 4JGYA 4BWOA 4AQ6A 2ZHMA 1BQPA 1H1IA 3WLUA 3GZUC 1MZEA 1YUDA 3OY8B 1QIQA 4I30A 2WWSA 4AI3A 3OBZA 1L7QA 2WT2A 3C7EA 4J25A 5C4WC 2WNUB 2RS13 4DUXA 2RM22 2EAKA 2YV8A 2YU1A 4XXAA 1S0JA 4WM8B 5FKBA 3T1LA 4XEZA 1WA4A 3MV01 2WJSA 2MEV2 2RS33 1S0EA 3OUJA 5KHKA 1BCXA 4S2FA 4OFGA 3I3DA 2WNVB 3EQEA 4AWDA 3PU8A 1OLRA 1ASJ1 2UYAA 1SEFA 3WG3A 2OUJA 4KU8A 4M4RA 5H9PA 3POIA 2JX9A 3VBHC 4LE3A 5FPLA 4OHXA 4HMZA 3T0DA 1V6KA 3MW2A 3ZYPA 1AR93 1ACCA 4QDQA 1K5MB 5FYHA 1JS9A 2A7AA 4HVRA 4Y20B 1KD7A 5C8CB 1RMU3 3W21A 2G9ZA 3LD8A 5KXEA 2XBO2 1REDA 2TUNA 2PN5A 4M3CF 1FPN1 1T6GC 2VQTA 1ZREA 1IS6A 3ZLIA 3O0XA 5GZFA 1W6PA 1SG3A 3THPA 2FCVA 2VZTA 4I2OA 2W1WA 2WWUA 1JOBA 2XLGA 4XHXA 3ALQA 4RR3B 1H0BA 1CPNA 1XXNA 2FDJA 2JEMA 2VVDA 4BLIA 4LBQD 3BKZA 5C9AA 5DN2A 1QJX2 4RQPA 2VBBA 5FZIA 1RL3A 4P5HA 3ZN6B 4XUPA 5FY1A 4AEDB 4BZ4A 1GOGA 2GAUA 2PTMA 1IG3A 1WMXA 2CGOA 5EJ1B 4AEDC 3I54A 3HBZA 1PGW1 2W1SA 5LA2A 5BXXA 3T0BA 3HT1A 2A6YA 4N53C 1VAKA 4F7ZA 2VUAA 1WKYA 3ATGA 3I3BA 3R05A 2WKKA 3E5UA 5APAA 3LE0A 2BQPA 2DWRA 5H9RA 1RUG2 2HH9A 1PIV3 5JR2A 5I91A 4CU8A 3HBKA 4Q1PA 2E9QA 4PT6A 5L19A 3V64A 3KM5A 1GANA 3PMEA
chains in the Genus database with same CATH topology
1QU0A 4JRAA 5HI0A 1N1YA 2WA3A 5FLJA 1QOSA 1UKRA 3WG1A 2Z69A 3PVNA 1QJY3 3LSDA 2WZR3 5CAZA 3MLJA 1D0HA 4XQDA 2HWE3 3ZMOA 5FLHA 1Q8PA 1PGL2 5C8WA 3DKWA 2HEVF 2P3KA 4Y1VA 1NCQA 4N43A 3ZFGA 4QHBA 4ZKTB 4GKYA 1BEV2 4AVBA 2X5IC 4LO5B 2LALA 1HIXA 2GMMA 3LA2A 4I0AA 3JD71 1H2LA 1J59A 3B69A 3KT1A 1IGOA 2VY0A 4IETA 3UKVA 5LEKA 3TBDA 5FOJB 5JPNB 1VRH3 1WW5A 3S7EA 2AYHA 3J9SA 5DG1A 4UW4A 3KLSA 1VLNA 4YW2A 4Q4X2 1LEDA 2CV6A 1ZBA2 2DU1A 4YYOA 2QNKA 1QJU2 2YDEA 1PO11 3R0RA 1JYIA 4RHV2 4EN0A 3H8UA 3BOPA 1V6IA 2DYCA 1CESA 1LOFC 2F6BA 1H8VA 2ZS6B 2BUKA 3U10A 5T54A 1QDCA 4Q4W1 5CFDB 4Q4V1 1BXHA 1VIWB 4IQPA 1FOD2 2MHFA 4GH4B 4L8QA 3HT2A 2KXLA 2TBVA 4N90A 3WUCA 1CAVB 2ZX3A 5F6LB 2RS11 4LEJA 2D5HA 4BYYA 1COV3 4Q2FA 1RUF2 1OI6A 3ECQA 1OOPA 4CZSA 1OQDA 4PDWB 4QQ2A 4DRVA 2PA7A 4E4ZA 1MQTA 2TNFA 2W08A 3I59A 3M4FA 4IV3A 4K6BA 3M2MA 1REEA 2WNEA 1JHNA 2HWD1 3OBTA 3ZN6A 1XYPA 1LODA 2R042 3RMYA 3FLRA 4MVTA 4A2UA 3M70A 4PJYA 2ZZQA 4HVOA 3ST7A 2OZJA 4KNCA 4XJ8A 2ES3A 5F1RA 2NQYA 3IPVA 4E27A 5L73A 1QOTA 4M3CE 4D3WA 1BZWA 1FAYA 1UIKA 3RSJA 3PHMA 3C3VA 3WUDA 4CDXA 1ZRCA 3UJOA 1NCQC 2DURA 2WL1A 4SBVA 1KFUL 2ZTNA 1RUOA 4CEYC 1QMJA 4C1XA 2B42B 2WZR1 4M01A 1V70A 4E2QA 3FWEA 5C9AC 3ZXGA 3MIBA 1C8M1 4XILA 4CEYA 2ZPXA 3P3NA 4FT8A 1ZZ9A 2ET1A 1EAH3 3URFA 5I0SA 3WXPA 2R061 4ASLA 3L9JT 1QJX1 1QQP2 4XHBA 3IWZA 1FT9A 5C8CA 3L2YA 2HWD2 1NE6A 5FRAA 5IK7A 1CAXB 4FCAA 2RM23 1B35A 1K5MA 1ZA4A 1O5LA 1X36A 3RG0A 5BY5A 1EV11 3E6BA 1I9RA 1U5IA 2GMPA 1XE7A 2WC2A 3LOBA 2DCTA 4PF5A 3MI8A 1IKPA 5AFEA 1UPIA 5FLIA 1Q8QA 5E88A 3AZXA 1ND3B 1R081 2WQZC 1SQ4A 3GBWA 3QACA 3USSA 3B7MA 3CJIA 1QNYA 3GBFA 4BIOA 5JOXA 1QGLA 4YARA 1ULEA 2P17A 2PLV2 4EWDA 4AFMA 4P9IA 2VECA 5F6KA 4N9IA 3CEWA 2ZA9A 2B7YA 1W6NA 4EROA 2RR11 4OHWA 2Q8OA 4OUMA 3ZFEA 4G9SB 1R082 2XWBB 3JZVA 4AXOA 2R071 1DGWX 1ND2A 1J1TA 2ZGNA 4XBQA 4UW5A 4QM8A 1SFNA 5DG2A 2D3SA 1AX2A 2O8QA 2Z2SB 4AFDA 2O1QA 1F8VA 2E7TA 2Y38A 4Q0UA 5EJ3A 2VG9A 3ZN4A 2D3PA 4XFBA 4PDWA 1DGRN 2RJLA 2HWB1 4GA9A 5BNQA 1A6CA 5D8AA 1RHI2 1UCXA 4JCKA 2PHLA 1UD1A 4BHPA 1AL21 3ZXJA 4CEWA 1RUD3 1LJ7A 2UWCA 2YROA 3LWCA 3VZMA 2D93A 2YZ4A 2EXHA 5BV6A 1U5ZA 1KQRA 2EVXA 2V5YA 5A3LA 5CFCC 4B4RA 1HRI1 4JC1A 4UBGA 4NWVA 4CDWB 2BW8A 4RQPB 1CJDA 3ZYIB 1LHNA 1NY71 1C5HA 3WW1A 3V56A 3J8F2 1AR91 4NHKA 4FPEA 1H2KA 1CAWB 1POV1 1CJPA 2RS53 4JTNA 4E9KA 4X8PA 3SHRA 1X8EA 1LENA 3BPZA 4FTEA 3B9IA 2ZHLA 3V65A 1X50A 1BVP1 2R1BA 1QH6A 3RNSA 1HRI2 4Q27A 4QT6A 4BLJA 4XXPA 1I1EA 3G7DA 1MS4A 3OY8A 4LO8A 3WDWA 1VRH2 3ZIXA 2XJUA 1LGNA 2W68A 2PHRA 1HDKA 3D0JA 1C8NA 2JD4A 3ZFFA 3P3PA 4FOWA 3B5LB 1Z7S3 4IL7A 2DUPA 5KHJA 1Q3EA 3RPQA 4Q0VA 1AR62 5C8CC 4CDXB 4YRDA 4B3NA 4JGZC 1CGPA 4NHMA 5GZGA 4C0BA 2C9AA 4H3WA 3R4UA 3RYRA 3IM0A 4W6YA 1VBB3 1LOFA 1O4YA 3AYDA 1J3RA 1PO23 4W6XA 4COYA 3MGUA 2WNVC 1PGSA 2EA7A 4GWNA 1FMD1 4FXKB 4ES9A 2YUEA 5HCAA 3FC0A 2E51A 3M7AA 3ROUA 1O3RA 1Q8OA 4LHLA 3D4KA 1FMD3 1COV2 1EAH1 4FP2A 4L92A 4QQLA 5FFOC 1QWRA 1RUI3 4OUSA 4A7YA 3N7JA 5I8TA 2MEV1 1Z78A 3RZZA 2A75A 4NPRA 2VOVA 4AFCA 1AR81 3ZFEB 2R0FA 3SH5A 2XL7A 5E1RA 3BALA 3VDDA 2ZGLA 3ZXEA 1WMDA 1VBA3 4Y22B 2VNOA 3ZSKA 2HWB2 2D6KA 1C3HA 2D3RA 4ISRA 5AC92 4BOWA 4XJAA 3FHIB 2VH9A 2GN3A 1O91A 2XL9A 3OTFA 1HLCA 1RVF2 4IV3C 3ZN5A 1COV1 4FSJA 2D98A 2R072 4G3YC 5FMOL 3I7DA 3WVJA 1C8M3 5K0UC 5FO7B 2O8OA 2RR12 2H0VA 1W6MB 3RQ0A 4BA6A 3ZSMA 5EXOA 4K20A 3T2TA 5JI9A 1ASJ3 1K5MC 2GN7A 1OFNA 2D7FA 1D4M1 1QH7A 3SLIA 4NO4A 4AW7A 4LA3A 3TOJA 1U0AA 4Z07A 2ZGRA 4DZGA 4ZU4A 1ND3A 5D1IA 4ZU5A 3VGIA 5DDJ1 3WT3A 4XDQA 4Y24A 4M0NA 4WZCA 4XF4A 3HR9A 1PNGA 2XG3A 1RUG1 3NV3A 4FVVA 4BCUA 3B9CA 4CEWC 4JGYC 5HXVA 1G9CA 4K8FA 1AVBA 3E5QA 4MV2A 5GLWA 3VZJA 2WIIB 4AQ2A 5FO9B 1CAXA 1QNWA 1JN2P 4MH0E 1C57A 4H55A 2VGDA 3H50A 2XJPA 1NYWA 5JAXA 5IT6A 1UAIA 2EALA 2JDZA 1BBT3 2DTWA 2P37A 2HWF2 1IQAA 4NWWA 5L36A 2UWAA 5F9TA 3S30A 4AVTA 3O12A 3IIAA 4PLMA 4KH9A 3WV6A 1YFWA 4IXLA 3VBSA 3BU7A 4YGBA 1FATA 2Y26A 4UW3A 4Y1ZA 3VBHA 4FAGA 4R9BA 4COVA 5BNNC 1AXZA 1TNRA 4A7KA 2DUQA 2IXKA 1GFF2 4U2AA 1H30A 4GH4C 1NY72 1HKDA 3NL1A 2MNGA 1HX6A 4HK8A 3H7JA 2JE7A 5A33B 5T3NA 3U07A 4N7IA 2V09A 2JG9C 4LBJA 4LNVA 3ILRA 3BB6A 1KXGA 3GNEA 3FBMA 5BNNA 1LHOA 4CYDA 1QF3A 4Y1XA 4EN9B 1PVC1 4P9JA 5JI7A 4RFT0 1N3QA 5E16A 1GBGA 4N53A 2JECA 3ES4A 4Q4W2 3EO6A 1YXWA 2DVGA 2ZABA 1EV13 1CONA 1SLBA 4YW5A 3MW3A 3ILFA 1DGWA 2GNBA 2WS92 3SNMA 2WT0A 1HXS2 4P9YA 4DY5A 4PLOA 1FPN3 5CG9A 2Q1MA 4AGVA 2RMU2 3BTAA 1CVNA 1D2QA 4QQHA 1RHI1 5GLZA 3MFCA 3NKTA 2VOWA 2ZHNA 1ULFA 2SLIA 4YVSA 4YVWB 1ZBE1 1UKGA 2GNMA 5KHHA 3VHNA 5GZEA 1DQ2A 1RUE2 1KS5A 2PLV1 2E7QA 5FO8B 2A6WA 2ARXA 4OVEA 5LK7B 1R1A2 4KL1A 5DUVA 3NSTA 5DDJ3 1JOJA 1TMF3 3HAGA 2DCJA 5JOZA 3AZZA 1UMZA 1H2MA 1TMF1 2X5IA 2ZGTA 3IKWA 1GZ9A 1S0BA 3TN92 1JW6A 1VAVA 4BPZA 2WFPA 1NQJA 5IUQA 3WDUA 1G6NA 4HT1T 1U12A 4WVMA 4OULA 2D6PA 3E97A 2QVSB 3GF6A 3NV2A 5BNPB 3MEPA 3KD4A 4IEOA 1QJY2 3UJQA 5JZGC 2HWE2 1A8MA 3N36A 1S0CA 1R091 3UKNA 4CP1A 3ES1A 4CDQB 2R062 1WCDJ 1WD4A 4AF9A 2PAEA 1LCLA 4FOQA 4RR3C 5DZGA 4Y1YA 1HW5A 4IESA 4ORFA 4I02A 3VBOB 1HQWA 1F5FA 1EAH2 4META 1HV1A 1SFYA 2YY1A 4MUVA 4N7UA 4F3JA 5F5QA 3B3QE 3GZTB 3CO2A 4QPGC 1AYM3 4EN8B 2JG8A 2ZMLA 1VBC2 2PHDA 3MZHA 5DUXA 3KCCA 3M8LA 1XNBA 2PHWA 3MIGA 4PCRA 5C4WA 1HQNA 2KM2A 3U0ZA 1DG6A 4XJUA 4XYXA 2BGCA 2HEYF 3RJRA 3E5XA 3AMMA 1BMV1 2LTNA 4GALA 5C6CA 2E53A 3WDXA 4Q4X3 5JSRA 2IC1A 3HMYA 4HLTA 1RB8G 1GR3A 1EPWA 4XQWA 2B9UA 1HRV3 1FX5A 2QZ3A 3ZIWA 1RUJ3 5ACA2 4HPKB 1FOD1 3WDVA 4BH9A 3GZAA 4AI0A 5J98B 3B01A 3N35A 4FBFA 3DPRA 4R9CA 3ZPYA 1I6XA 2ZGOA 5T5OA 3ZDSA 3H7YA 4AG4A 5A32B 2XLAA 4DOUA 2WLQA 4YG3A 3POYA 4RGAA 3KT4A 1MS3A 3N7KA 3WQ0A 4TSVA 3VBFC 5IK5A 1H4GA 1O3SA 1UU5A 3PTYA 5EYXA 3OCPA 4P14A 3TWIA 5HBAA 4GKXA 4FTBA 5CIRA 5AFBA 3ASIA 4SLIA 4C90A 2G4IA 4M0HA 2QCSB 3VZKA 4M3CA 3RJ2X 3TN91 2VW0A 2Q0AA 4LO7A 3VBSC 1DYKA 1OPMA 1WUVA 1AR82 2HWF3 1D2SA 1IPJA 2WSVA 3AMHA 3AP5A 4YZ4A 2R32A 4KWLA 1WBFA 3USUA 3S0MA 5E8AA 2PQQA 1HXS1 4PIXA 3GALA 1AX1A 1MACA 3LA7A 3RYKA 3W58A 3FZ3A 4UW6A 2NP0A 1XNCA 5CU1A 1ZBA1 4MGKE 2GALA 1Y3TA 4HN1A 1F31A 4EWEA 3J8F3 4KU7A 2LM3A 2YGMA 3ZFGC 5JDBA 5T5JA 4KWJA 2YMZA 3B94A 4IEPA 4KG8A 2ET7A 4B7EA 5FBZA 3VHPA 2VMGA 4D7TA 2QUOA 3OJBA 4QQOA 2IXIA 4MGYE 4RA0A 2P2KA 1MS8A 2D6OX 4IEWA 1DIWA 2E6VA 3DUIA 4IEVA 3AP7A 2DFCA 4FPJA 3ZSJA 5GLUA 1GZWA 1AYN2 2GU9A 4COZA 2B39A 1DLLA 1G9BA 1YO8A 2C1FA 2N7GA 2VXRA 1S0IA 4FPKA 4P9XA 4YLZA 3WCSA 4TWTA 2P34A 4JQRA 2OUHA 3AP9A 4HKLA 1LU1A 4KGGA 2ZGQA 5T55A 2XJSA 5E89A 2Z79A 5J96B 4LR4A 3TYJA 1MZ5A 5CADA 3RRDA 3Q9OA 1S2KA 1LOAA 5K9YA 2P3IA 1FV3A 1PVC3 1V6LA 1X33A 2HWE1 3A0NA 1KS4A 1QJU3 1IS5A 4I3PA 1VBE3 1YYNA 3D8CA 1O3TA 3AMQA 5BNNB 2C0ZA 2EAAA 4GXLA 4A7ZA 2Q30A 1ENSA 1YFXA 4YGCA 3VBSB 3SCHA 3HIFA 2RJKA 5H9QA 3VHRA 4D69A 5BNPC 3AXEA 3VBRB 1I3HA 3MF9A 2OA2A 4Q26A 4QX5A 3I4IA 2IFWA 1IPKA 2OPKA 1ENQA 1LEMA 1JXNA 2BFUL 3FJSA 4PIZA 1JTZX 3VZNA 2C5DA 4DQAA 1VBC1 3TN93 4Z2WA 2DTYA 1QJY1 1VBD3 2WNUC 4L9BA 3N3HA 4CDQC 5CFDA 3KGZA 2XBO1 4AVCA 1MS9A 1EPZA 3ACLA 5K8SA 1DZRA 4R4XA 2D6LX 4XJWA 4FXGB 4GMP3 3WP5A 2RM21 2WSUA 1AR73 5JVVA 2ATFA 1FI2A 1QY4A 1YI9A 3JBG3 1CPMA 3ILNA 4MXWB 4Q4V2 3HN1A 2GC2A 3DPRB 4JDNA 1NG0A 4I3GA 5DZEA 1GNZA 1ASJ2 4AEMA 3A0KA 4DINB 3SMHA 1IS3A 3PJQA 1VB2A 3O5SA 2WFF3 2ZGSA 1OA2A 1PO12 2A70A 1AYM1 2VPVA 1DQ4A 1TE1B 3AYCA 4XETA 5CG8A 5FREA 4MGZE 1WLWA 5EWSA 1NCRA 5I0RA 4TLFA 3MLLA 1R1A1 4CP2A 1NXD1 4HZFA 5KC5A 3CJIC 1RMU1 3K48A 1J3PA 4NN0A 3RYPA 2GH8A 1BBT1 3ZO0B 2ZACA 2WQ4A 5GLVA 3VHOA 3MICA 2I2SA 5DUWA 2HWC3 1ZBE2 3GHNA 4W6WA 1FNYA 4B4QA 4XF1A 1RUJ2 1BEV1 1YIPA 3H3UA 1SBFA 4FPGA 4LULA 1CN1A 1AJOA 4ZU7A 2BYVE 4FQZA 5EYYA 3WP6A 5ABJA 2PHXA 2MPFA 4GIQA 3X29B 2R30A 1PGL1 1C1FA 1W6OB 4ATEA 4Z1VA 5JCTA 1TEIA 4JAAA 3NJZA 5LRSA 1DQ0A 1PIV2 4HN0A 1ZZ8A 2BNMA 5D8AC 3PMSA 1OA4A 3AX4A 2Q5TA 3J8F1 1NCRB 1XQNA 4COWA 5KXDA 4HFSA 4Q29A 2GC1A 3AFGA 1PVXA 2VU9A 4Q0QA 1NLSA 1AHSA 1AF9A 1JUIA 3OF1A 1V00A 5JSPA 4X6RB 1URXA 1PNFA 5AC93 1VP6A 4IEQA 4GQ7A 4Z92B 2V73A 4YVSC 5JZGB 1NA1B 1N3OA 3BOWA 3OPZA 4C91A 4YVWC 3CF6E 3AJZA 5BNPA 2IXJA 3AMNA 5T52A 4J6GA 2XLFA 1IZ3A 2PAMA 2XB6C 3CNAA 4YVWA 3DL3A 4AHWA 1D4M2 2RR13 2RS12 3EJKA 1A78A 2VQAA 1Q56A 1FPN2 1WBLA 1AL0G 3NAPA 2K9ZA 4XTMA 4DXZA 4FPFA 1HRV1 3VBUB 3D6EA 4GB33 1YJLA 3RI9A 3N4MA 1JH5A 1O4ZA 2GC0A 4AVVA 5SV8A 3VZLA 3OYWA 1LOBA 1XNDA 4HSJA 5FTTC 3D82A 3ZYJB 4RQPC 4XOGA 2JICA 2Y0IA 3WNXA 4A3XA 3H1YA 1UL9A 2H0BA 2ZX2A 2JG9B 1CX4A 1Y7BA 2XBO3 4LBKA 1Y43B 3KCYA 2BNNA 1H4HA 1SBEA 2A6ZA 1POV0 4NHLA 1S1AA 1GSLA 1RUC3 3RI8A 5L7OA 1GQGA 1WLCA 2IWGB 4XJZA 1RUD2 1QJX3 1ZZCA 1XU2A 4H7LA 4JDOA 4XIOA 4YM2A 3E6DA 3JQXA 3M3CA 1FXZA 5JIAA 3VBRC 3AZVA 4XF3A 4Y22A 4RR3A 3VKOA 3M1HA 1JYCA 5C4WB 2R043 1RIRA 4K1ZA 2D43A 3SCGA 4YZ2A 3O0VA 1DYPA 1W6NB 1LU2A 1WLTA 2ZAAA 5ABJB 2CAUA 2I74A 4Y20A 1HV0A 1EP0A 1IOAA 2FBEA 1DZQA 1ALYA 2D6NA 2D5FA 4OI0A 1PK6A 4NVPA 4N43C 1YIFA 3VKFC 1AX0A 2A3WA 4HKWA 2XUMA 4K3UA 1ZRDA 2IXLA 2AGSA 3JQWA 1MS5A 2R49A 3BCWA 1LRHA 1VB4A 3EHKA 5FDBA 4E2GA 3VBUC 1GNHA 3MPBA 4AQSA 3OBRA 3WDYA 4XBLA 1U5XA 1Q5OA 2E7AA 1YJKA 2I07B 4E4SA 2UWBA 4AFBA 2NYYA 3KMHA 1IHMA 1VRH1 2DVBA 2X29A 1LOEA 1VBB2 2FQPA 4S2GA 4DPNA 5TSWA 4Y4YA 3WCRA 1KRIA 1YHFA 1F5JA 2Y0OA 2X53S 2QJVA 3JB8A 3SITA 4L97A 2DVDA 4R9AA 2XVGA 3VL8A 2GH2A 1BMV2 2ZAHA 4MZUA 3T1MA 5GALA 5GJ6A 2IFRA 4CDWC 1RITA 3UL2A 3WDTA 3MDPA 4H7MA 3WINE 3ELNA 3H1WA 3U4XA 2O0OA 2VOKA 4RSUA 1DF0A 5LEJA 1R1A3 1X82A 5DDJ2 2GNDA 4B8EA 3B93A 3JBG1 5GZDA 1GKBA 5CA6A 4OLLA 1ZRRA 2QDRA 2BWCA 4FOVA 4FTSA 3N7MA 4QPGA 5DXDA 4DY3A 2NM1A 1GZWB 1VBB1 2WFF1 2H6CA 1RUF3 1MZFA 1OFSA 2YC0A 5A33A 3WZ1A 3SH3A 1DDLA 4GH4A 2XJRA 3AKTA 1PK6C 3APBA 2QFEA 1OQEA 1ZM1A 1SMVA 3RDIA 1XU1A 1H8TA 4O9EA 3JD72 1RUH2 1ZX5A 1Z7S2 4OZXA 2ZBJA 4AK3A 2VW2A 2R1DA 3DPRC 1SCRA 1MS1A 4AI8A 4BIFA 1TME3 4CDXC 5I8YA 4IV1C 1VBE1 5J09A 1CR7A 2D40A 1AYM2 3O14A 1APNA 4XW3A 2RHPA 3THTA 4X6QB 3VDDC 2VQ0A 1IKQA 5FCCA 4JVAA 2JG8B 3ZXDA 5B2GB 1POV3 5GZCA 5FQ0A 5CB7A 2JXAA 1BKZA 1RMU2 1W0OA 4LHNA 5L7OB 2SBAA 2ZJCA 4YNIA 4N9HA 4Z8BA 5J7MA 1FMD2 3HD8B 4LT5A 4BMEA 2UY9A 1MS0A 4FPHA 1CAVA 4Q0PA 1S2BA