4BMBA

Crystal structure of the n terminal domain of human galectin 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-8
publication title Natural Single Amino Acid Polymorphism (F19Y) in Human Galectin-8: Detection of Structural Alterations and Increased Growth-Regulatory Activity on Tumor Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bmbA00
3TB0A 1LECA 4GWNA 2LTNA 1JYCA 4IQPA 3VKOA 1JHNA 5GLWA 1DYPA 1GNZA 2UWBA 1UPSA 2R0FA 3B3QE 3FLTA 1LOEA 3LSDA 5JOZA 3SISA 4U2AA 5JVVA 3PVNA 2RHPA 4ZXKA 1CN1A 3B00A 1GICA 4LBJA 1QU0A 3AZVA 3MW4A 1QOSA 4P9YA 3U4XA 1HQLA 2PHFA 2VW1A 3V65A 4AVTA 2DVFA 2DU0A 1DFQA 1WLDA 1DBNA 1AF9A 1CQ9A 2CL2A 2UWAA 3OJBA 5T5OA 4UW5A 3VKNA 1G9CA 3B9CA 4FQZA 4AWDA 2P3IA 2JKBA 4K21A 4Q2FA 1MZ6A 2C9AA 1QNWA 2WT0A 4YGEA 1VAVA 3N36A 2GALA 1MZ5A 4YM2A 1V6IA 1S0EA 3IPVB 1WW4A 4GKYA 1MS0A 4R9BA 2CYFA 3AZZA 3QLQA 1F9KA 3PVEA 1LGNA 3POYA 1GZWA 4XHBA 4XJWA 5E89A 3SNMA 4Y1VA 3APBA 1MVEA 4Q8KA 1KJRA 1V6KA 1FV2A 3USUA 2A6XA 5IK7A 3HMYA 1QF3A 3HR9A 3IN9A 2A3WA 3RS6A 3GNEA 1GZWB 1SBFA 4FOQA 4RL7A 2ZHNA 3BIWE 1JUIA 3OBRA 1CJPA 5H9RA 2ZKNA 2H0BA 1LOCA 1SBEA 3FFZA 1S0GA 1DQ1A 3USUB 1ENRA 2CTVA 5T54A 3ZSJA 4UW6A 1BKZA 2D6MA 1LEDA 1CESA 4HL0A 3N7KA 1JBCA 2E7TA 2VUAA 2W52A 3ENRA 3W59A 1IKQA 3WOGA 5JMCA 4PBPA 3WG4A 3ZSKA 1DIWA 1IS4A 1F5FA 2UU8A 2ZHMA 1G9AA 2DTWA 4Y20B 4LBNA 2ZZJA 2E53A 3Q9OA 1LOFC 3OBTA 2JE7A 1IS6A 3L2YA 3ZSLA 4P9XA 1C57A 2D43A 3M2MA 2JECA 3JUUA 3WG3A 5IK4A 3SH3A 2PHXA 4BLJA 2A75A 3WUCA 1RINA 1B09A 2PHWA 3AP6A 1ZA4A 1LULA 3PVOA 2DUPA 5JLVA 3WDUA 4M00A 4GKXA 3WVJA 3SLIA 2D6KA 3AP7A 4FP2A 1SFYA 1DZQA 1ULGA 2ZGLA 1Z0HA 4PF5A 1ZM1A 3N7JA 2WKKA 1AJKA 5T5JA 3OYWA 5H9PA 1RITA 3O0WA 3VKMA 4XIKA 1XQNA 3O0XA 4MYEA 3NV1A 1MVQA 5GZEA 2Q5TA 3FLPA 1JN2P 3ATGA 4GXLA 4YFWA 3INAA 2W39A 5E8AA 5IUQA 1W6NA 3OYWB 4TYSA 3AP4A 4M01A 1LGCA 4AYUA 3WV6A 3HN1A 2D3RA 4YW3A 4DS0A 3MEPA 1KJLA 4F83A 1DQ4A 3RMXA 3M3CA 2PHTA 2YZ4A 4XYXA 3WG1A 4W65A 1N3OA 1A8DA 2VH9A 1W6NB 4DRVA 3RMYA 4FPJA 5CA6A 1FYUA 4FPCA 3JU9A 1BZWA 1Q8SA 1TEIA 4H55A 4WZFA 3AYDA 1BQPA 1OFSA 5T55A 1H9PA 1Q8VA 1UN1A 1A78A 2GNBA 3D5OA 3ZYPA 4CRQA 3UK9A 4GALA 4P9WA 4Y1YA 1JOJA 4XIOA 1QOOA 4UW3A 3ZPYA 1YXWA 2UWCA 3AXDA 4YG6A 4Q1RA 2B7YA 1FATA 1MS3A 1W6OA 2ZACA 3A0NA 3I8TA 2GNDA 4XE9A 2VW0A 2D6LX 4R9AA 5GLVA 4HANA 2A6WA 2EXHA 3NV4A 4LBLA 5DXDA 5GLTA 1G9FA 4ITCA 1H30A 4FPYA 4Q1PA 4Y26A 1W6OB 2EXJA 1SACA 4YZ1A 1QOTA 1R1ZA 3WDTA 1FNZA 4R9CA 1U0AA 2OW4A 2SLIA 4ISQA 1CR7A 4D69A 1AX0A 5DUXA 1ULCA 4YLZA 4FPGA 5GZCA 1AVBA 5DZFA 3WCSA 3VUOA 2CWMA 5DUWA 3ZXKA 2DUQA 5EWSA 2CNAA 4XMIA 3NV2A 3R4UA 1FAYA 2GDFA 2WSVA 1S0DA 2D3SA 3IMNA 5CBLA 3A4UA 1LOAA 2D6OX 1GSLA 3N35A 5JOXA 2E6VA 2XG3A 1IKPA 1LHUA 5H9SA 2ZGPA 1N1VA 1S0FA 1DGLA 4XJZA 4YW5A 5T5LA 2FMDA 5GZFA 5HCFA 1LTEA 1LHOA 5DZEA 1SLTA 4CTEA 4Q26A 4YZ5A 3RRDA 4BQ1A 5GZDA 1GBGA 2I2SA 1ENSA 3AYAA 3A0KA 5CAZA 2EXIA 3LCPA 2DU1A 3T2TA 5JOWA 2OUJA 4YG0A 3SITA 3I4IA 3RG0A 1AJOA 3AK0A 2AGSA 4BMBA 1LHWA 2NN8A 4CZSA 1URXA 1Y7BA 2A5ZA 1Q8PA 4TZDA 3WNXA 3CNAA 3AP5A 2AREA 1KDMA 1SCRA 5DZGA 5FRAA 3WHUA 2DURA 3POWA 4LBMA 5DG1A 4XBNA 1YIFA 1OQ1A 3VKFC 2AENA 1LGBA 3ASIA 4K20A 4LBQD 4YW2A 2DV9A 1GZCA 4AVSA 1QGLA 1Q56A 1UZZA 3RSJA 3AYCA 1LESA 1N1SA 2GMMA 5BYNA 2W08A 4FPKA 1N3QA 2EALA 1YRZA 5F5QA 1S0JA 4JRAA 3N7MA 1MS8A 1IS5A 1QKQA 1S0BA 3V64A 2LALA 1UL9A 5KXCA 2EXKA 4XJUA 1V6OA 2JE9A 4AVVA 1BYHA 1JXNA 2WSUA 2P2KA 5F9TA 2E7QA 3V0AA 2D7FA 1ENQA 3T1MA 1W0PA 2W68A 2NMOA 5T50A 4FPHA 3ILFA 1GLHA 1QMJA 2WLQA 1WD4A 1APNA 4WVWA 5EYYA 3BODA 4K1YA 3WDXA 3V0AB 3B69A 1G7YA 1V6JA 1SCSA 4JC1A 1WBLA 1GYKA 1EPWA 5KXDA 2A6YA 2ZMLA 5LK5A 2DVDA 3O5SA 3R05A 2HYKA 4AGVA 1FX5A 1SLBA 1LENA 1N1YA 1LODA 1VLNA 2D6PA 4K1ZA 2AUYA 1OKQA 1YI7A 5CNAA 3ZSMA 2R0HA 2ZGUA 5H9QA 4PQ9A 4YZ4A 1DQ6A 1LEMA 1C4RA 1RIRA 2YV8A 1Q8OA 1SLAA 4R9DA 4BOWA 1S1AA 2A7AA 4LBQA 4C1XA 1BJQA 3N3HA 3AYEA 2DVGA 5EXOA 5T5PA 2SBAA 1DQ5A 3OY8A 3MW2A 1WW5A 3WZ1A 2A6VA 4LBQB 1LCLA 4XOGA 3ZXFA 2PELA 4BLIA 3SH5A 3UL2A 2Z42A 1YYNA 2GN3A 3OY8B 2A70A 3AFKA 1VIWB 5GLUA 4XJ9A 1AZDA 2VW2A 3AZWA 1VAMA 3PMEA 4YZ2A 3AP9A 1CONA 2FHRA 3GALA 2WT2A 4C1WA 1IS3A 4DRRA 1NXD1 1DQ0A 4BPZA 3AZYA 1G86A 3KQRA 4I30A 4M3CE 2EF6A 4YW1A 1D2SA 1UZYA 2AYHA 2ZGQA 1MS9A 1QDOA 2NM1A 2A71A 4XMAA 2TEPA 4YM0A 4BMEA 5IK8A 4FPFA 4WV8A 3WLUA 1CPNA 4AGGA 1G8WA 1H9WA 1UX6A 4SLIA 3VV1A 1W6MA 2D6NA 1DQ2A 1KQRA 2ZGOA 1LHVA 4Y22A 1PZ8A 1QNYA 2C5DA 4KBBA 4L8QA 3RQ0A 3WUDA 4ATEA 3ILRA 3M3EA 4XTMA 4BM8A 4XXAA 3ZVXA 5HCAA 1W6PA 3D6EA 4XDQA 2YY1A 1W6MB 4FPOB 1ULFA 1MR5A 4UW4A 3WCRA 1W0OA 4Y22B 1WW7A 1D0HA 2NYYA 4DFSA 2G4IA 2NP0A 3R4SA 1V00A 1DLLA 2GNTA 1W6PB 2NMNA 2GN7A 3BTAA 4YFZA 3ZYRA 2GNMA 5EYXA 2OVUA 2CY6A 1CPMA 1YO8A 1JW6A 2ARBA 2EAKA 4XHXA 1WCSA 1HKDA 2DVAA 3O12A 2VY0A 1CVNA 2ZHLA 2VXRA 2ZGSA 1UKGA 3AXEA 1BXHA 4YG3A 1X50A 2ES3A 3QCWA 2ZGKA 2V5YA 2ZHKA 3AJYA 3BOPA 3H0OA 4ISRA 4ZKTB 1WW6A 2WJSA 2ZMKA 1V6MA 2XB6C 1AX2A 3FLRA 1I1EA 1UMZA 4NOTA 1C1LA 5L73A 5FREA 1LHNA 4Q8LA 4XZPA 2P34A 4DQAA 1ONAA 1GZ9A 3M3QA 1F31A 4M3CF 1WD3A 1UAIA 1I3HA 2YXSA 4JCKA 4DPNA 2R49A 3FBYA 3IPVA 1FNYA 1MS5A 3WDYA 5DUUA 4XBLA 1AXZA 2WT1A 1GNHA 1SLIA 2R1BA 3T1LA 4YGCA 4ASMB 5KXBA 4Y1XA 1KRIA 5GM0A 4RA0A 4YGBA 3LSEA 3W58A 1DYKA 4Z8BA 1LOBA 5T52A 2DYCA 3FUOA 2YMZA 3MW3A 1AX1A 2ZAAA 2ENRA 4NO4A 4XXPA 1J1TA 3D4KA 1S0CA 1GV9A 5HCBA 1FV3A 2BQPA 2YROA 4ATFA 4Y1UA 4FOVA 3VKLA 1ULEA 1G9DA 1O4YA 2A6ZA 1JYIA 2V73A 1HDKA 2ARXA 2WQZC 4FQ4A 3N7LA 5GJ6A 4XJAA 1PZ9A 3M1HA 4FP3A 1HLCA 5AVAA 1SLLA 5IK5A 3AZXA 3V0BA 4U36A 1WBFA 2ZGNA 1V6LA 2EIGA 2VU9A 3UJQA 1KITA 1WLWA 3IM0A 3PJQA 4PBOA 1LU2A 3ZXJA 4Q27A 3WHTA 4YW4A 3V0BB 2D3PA 2P3JA 4GWMA 2GMPA 3OGGA 4Y20A 3WG2A 5KXEA 1WLCA 3DGTA 5JDBA 2AH2A 1DHKB 1MS4A 4P14A 2ERFA 1N1TA 1Z78A 3OPZA 4YM1A 1W6QA 4FPEA 4AGRA 1WUVA 3M3OA 2ZABA 1IOAA 1C1FA 2CWSA 3WDVA 4YM3A 1QDCA 1ULDA 1W6QB 2UURA 3AX4A 3MPPG 2ZBJA 4GA9A 3DUIA 2E51A 3TAYA 1LJ7A 2PHUA 3IKWA 2GMEA 1CIWA 5IT6A 1G9BA 4LBKA 1N47A 2ZGTA 1Q8QA 2DUOA 5DUVA 4FOWA 2A3YA 2D44A 4WVVA 1KDKA 1LOGA 2P37A 1S0IA 3POSA 5DG2A 2DVBA 1MACA 2WNEA 2DWRA 1NLSA 2JDZA 4XTPA 4YZ3A 5E88A 3SH4A 5CB7A 3ZXLA 4XJ8A 5GALA 2NZ9A 4PCRA 4XILA 2AR6A 2A3XA 1LOFA 2KM2A 2R1DA 4OZXA 2DTYA 3NWKA 1GKBA 1PZ7A 2ZA9A 3NV3A 3KM5A 2JD4A 2ZGMA 3O0VA 4XBQA 1HQWA 3ILNA 4Y24A 4YGDA 1N3PA 3FUQA 1AXKA 4Y1ZA 1VALA 5JOYA 1SBDA 2OUHA 3B01A 4LBOA 1AXYA 1A3KA 5GLZA 3UJOA 1SLCA 4M3CA 4FPLA 3AJZA 2ZGRA 4FOYA 5SV8A 4FVVA 1V6NA 3WDWA 2ZMNA 1GANA 2P3KA 1LU1A 1O4ZA 3C2UA 5GZGA 1MS1A 2PHRA 4M3CB 2JJ6A 3ZXEA 2R16A
chains in the Genus database with same CATH superfamily
3DXUA 5DAPA 5B4XA 4Q4V3 1JYCA 1V9U3 3VKOA 2BW8A 5BUVA 3G6JB 5JZGA 2ZKLA 4AK3A 3FLTA 4COZA 1QJZA 2UY8A 3SISA 2PYTA 2XLGA 4ORFA 2FQPA 5FPUA 4QPIC 3ZSEA 1CN1A 3B00A 1D4M1 3KF3A 1UZWA 5DQ0A 3VBOA 3OPTA 4AVCA 3AZVA 2C24A 4JGYB 1UY2A 4I0BA 1J3PA 4IEOA 4BQ3A 5JSPA 1RMU2 4Y5SA 2VW1A 4K8RB 5IVVA 1RJ8A 3V65A 3HN3A 3VBRC 4MXVA 2DU0A 2HWE3 2WN3A 1CQ9A 1DGRA 2CL2A 3KLSA 5T5OA 4ARXA 1G9CA 5FP4A 2IVIB 3B9CA 4CPBA 3H7YA 2P3IA 2JKBA 3MLLA 4CUGA 4UOJA 4QGNA 2QKDA 1BK1A 5I0UA 1ZZ8A 3TNPB 3QH6A 4A4AA 1B35B 5FZBA 3DECA 4ZZ5A 4IW3A 1CAXB 3I7DA 3QLQA 3VZJA 4EN9B 3POYA 2VZVA 1AYN3 5F32A 3TEYA 2W5FA 1KJRA 1YJKA 5BNOA 1FV2A 3NNLA 3USUA 5BNPB 3HR9A 2A3WA 2IC1A 2RS33 3GNEA 1RGSA 1GZWB 2AC1A 3N9PA 3AMQA 2VUCA 3BIWE 4IV3A 4COYA 4DNYA 3BALA 4EN0A 5H9RA 5AFEA 3GJBA 1SBEA 5K0UC 1S0GA 4A44A 1BKZA 1BVVA 1LEDA 3P3NA 2RS13 4CUBA 4OMDA 5CKMA 3ENRA 4I3GA 2WRAA 2HWB2 3MF6A 5FOBB 3WOGA 2YC0A 1RUJ1 3PU8A 2QJVA 3UNPA 1LAJA 1DIWA 1W8WA 2UU8A 1AR81 5C6CA 5C5UA 1AR72 4Y20B 2ZZJA 1O6UA 4P9XA 1C57A 3E5QA 3M2MA 5EZWA 3JUUA 5JR7B 4AHXA 1HXS2 3J8F3 3JXSA 3ZOIA 2PHXA 3PU3A 5LY2A 4AQ6A 3JB4C 1RINA 2PHWA 2W1QA 1C8NA 4AVBA 1LULA 1W8OA 4AE2A 5J09A 3I2IA 5C8CB 1OQDA 4N53B 4RQPC 3SLIA 4IE7A 3WINE 3WVJA 1SFYA 1DZQA 1ULGA 2BWCA 2ZGLA 1ZRDA 4PLNA 2X05A 5T5JA 3K75B 4PDWA 1O8SA 3O0WA 4XIKA 2QQUA 1T6BX 4MYEA 4Q5OA 3GBFA 5GZEA 4DIQA 4YFWA 2E31A 1JYWA 4YVSC 2W39A 2JXAA 1W6NA 3OYWB 3N9LA 4TYSA 2BU9A 4NMIA 4V1PA 1US3A 1BCXA 3H8RA 4WZCA 4QPGB 5F3EA 1KJLA 4N8MA 2Q0AA 5FPZA 1DQ4A 1SG3A 1BBT1 1ND2A 4H3WA 5FO7B 3RMXA 4D6SA 3HJRA 3O14A 4DRVA 3KVBA 5ANNA 2VVFA 4A42A 1O3TA 1VB4A 4XF4A 5LWBA 1BZWA 1RUG3 3PIGA 2BERA 4XUNA 3E6CC 1BQPA 4B7KA 1Q8VA 2J1UA 1DP0A 2BNOA 3D5OA 5JR2A 2JENA 4CDUA 1HRV2 1NCRB 2IXLA 3ZFFB 4D7TA 4J1XA 4NN0A 3UK9A 1OA4A 2VBDA 3VBOC 3I2OA 1VRH3 4XFAA 3RWNA 3HWJA 1CAUA 1GOHA 2UWCA 1NE4A 3AXDA 4CXYA 3OD0A 1AYM2 4TXWA 3KT7A 4P00B 2ZACA 3ME2A 3K77A 5GLVA 2KXLA 3RZLA 4NIGA 4CE8A 2EXHA 5GLTA 1ZBA2 1G9FA 3AVSA 3ETPA 4UF0B 3T09A 2GSYA 2VAUA 3OUHA 4FPYA 4ITCA 1OC1A 4PJYA 4S2FA 3VDCA 5D21A 5JXHA 1ODMA 1YHFA 1SACA 1MEC1 1QOTA 2XUMA 3WDTA 2NPIA 1FNZA 1RB8G 3FJSA 1NA1A 2ORXA 3OCPA 4ISQA 1NY72 1O91A 1UYYA 1W2AX 3H1MA 3H8UA 1PGW1 4CCLA 5JCTA 4JKLA 4OHZA 3C7OA 5DUXA 4IV1A 3AM2A 3SHRA 2ADDA 2F6BA 4AQSA 4C0HA 1QJX3 2CWMA 5I0RA 3NRUA 4AFCA 2D5FA 4N43A 2XONA 4NWVA 1OKOA 1FAYA 2GDFA 1GQPA 4BK5A 2HEWF 2D3SA 1PVXA 3IMNA 4AHWA 4FTSA 1EV12 2VXJA 3A4UA 3KMHA 3HT2A 2BDRA 4DINB 4QXCA 4HKWA 2VMGA 5FXXA 2XG3A 4K6BA 4XQDA 2HBTA 3C7GA 1S0FA 1V70A 4IV3C 4JTOA 4XJZA 4YW5A 3HQXA 4OI1A 5GZFA 4C8DA 1H0BA 1AL0G 3SCFA 1LHOA 5DZEA 1SLTA 4O61A 1H6YA 4GJZA 4Q26A 3RRDA 3KV9A 1GBGA 3AYAA 1PIV3 5DAVA 4AXOA 1RUNA 3VBHA 1X33A 2KD7A 4PT6A 4ZONA 1XYPA 1LNSA 4I0AA 1C8M1 3T2TA 5CVRA 4YG0A 5CFDC 1RMU3 1AJOA 2W94A 2LROA 1RUD2 1FPN1 2ZX1A 4FO9A 5F5IA 4BMBA 3M70A 2RMU2 3MDPA 1W3XA 2VECA 4COWA 1SCRA 3T30A 4H7MA 2R063 3POWA 5DG1A 4D7YA 1OVPA 4FFGA 3JD72 1YIFA 2WYFA 1D2QA 2Z2SB 4HSLA 4GULA 3ALQA 2VQUA 1LGBA 2FBEA 3WP3A 3HT1A 1OUXA 4ZS2A 3K3NA 4QQPA 4GH4B 4PDWC 3ZYIB 2QUOA 1Y4WA 4XUQA 3RSJA 4B8EA 1J3QA 2BEOA 1UZVA 3K3OA 4FPKA 1NKGA 2QQOA 4LHKA 4CCEA 1JZ8A 1YRZA 1QQP1 1RHI1 4BQ4A 1QKQA 3T4HB 3V64A 1PHMA 3ACHA 3E1F1 2RR12 5KXCA 5I8SA 4QPWA 3PIJA 5FZKA 2IFRA 2E7QA 2WNUB 1OF3A 5FZIA 1UOFA 3B94A 2B9VA 2CAVA 3T1MA 3V0AA 1W0PA 5JXGA 4BQWA 4QHOA 2NMOA 2ID4A 5IJRA 1GLHA 4NIAA 1VBC2 1WD4A 1M4WA 5FBZA 5DN2A 1TNRA 4QPIB 4AAXA 5C8WA 3O1MA 4K1YA 1AR62 3CBNA 4QHZA 1UOBA 4X6RB 1UMIA 1V6JA 1SCSA 2GP3A 3J9SA 1R1A1 4FTEA 1AR73 2QQWA 4QKFA 4KI5M 1DF0A 2WIIB 2HYKA 2CSGA 4B3NA 5IVFA 3PURA 1K5MC 2Y6KA 3ZSMA 2XH6A 3N4MA 2R0HA 5H9QA 1DQ6A 1LEMA 4R9DA 2G19A 1LR5A 1NA1C 1S1AA 4X8PA 2IUWA 3NQHA 3TWIA 3AYEA 2DVGA 5T5PA 2SBAA 5I0DA 3OY8A 2PA7A 1V9U1 1ZA7A 3WZ1A 4N9HA 1GQHA 4LBQB 1O8PA 4XOGA 3M8LA 4N43C 3UL2A 1OA2A 5APAA 1GUIA 1QIQA 3MZHA 4CEYB 1A34A 3GF6A 1UY0A 5GLUA 5FYBA 3U11A 4A41A 2DCZA 2VW2A 1VAMA 3PMEA 2BGOA 3RVHA 1R082 3FBMA 5JPMB 3MUY1 1R092 4XFBA 5FR3A 3TEZA 3T0DA 2DCKA 3VBFC 1GMMA 3CMGA 3EMRA 2HWE1 3O1OA 1O3SA 1RUI2 3AZYA 1HRV3 4EWDA 4P08A 4M3CE 1FOD3 1UPIA 4J25A 1UZYA 2ZGQA 4WM8A 4XETA 3LEMA 4FXKB 4XMAA 3IDAA 3VBHC 2CHHA 5IK8A 4FPFA 1HB3A 3WLUA 4UYBA 1CPNA 3DEMA 2HH9A 4A3XA 1MPXA 2O14A 1YI9A 2YBKA 2XVLA 3AMNA 5K4LA 2VCBA 4E4ZA 3UKTA 4EN7B 4JDMA 4CCOA 4N90A 1W6MA 2PAKA 2ZGOA 4NHLA 1UXXX 1BMV1 2C5DA 4EROA 4L8QA 1AYN1 3M3EA 4WM7C 3U0ZA 5HCAA 3D6EA 3ZN6A 3GCXA 3BTYA 5HBAA 3H7JA 2CGOA 3WCRA 4O7XA 3IIIA 4BIOA 3MI8A 1OD3A 1E5HA 3KCYA 4NPLA 3VDDC 3R4SA 2YPJA 1V00A 4MXWA 3N9MA 2GN7A 2C26A 4YFZA 1U5YA 1K12A 2VD7A 4OI4A 4OCTA 2CY6A 3VD4A 4BCUA 5J48A 4XHXA 1XE7A 2O0OA 2DVAA 4YVSB 1RXGA 1EV13 3NAPA 3GZEA 3WT3A 2J7MA 1Q43A 2ZHLA 3OPWA 3OUJA 1UKGA 3VZOA 4Z92B 4QU1A 1S4CA 3LZZA 3I59B 2EIEA 2P17A 3AJYA 3H0OA 1ZZCA 2W1WA 3U4SA 1WW6A 4ZKTB 2WLPA 3LE0A 4E27A 2PFWA 2XB6C 3FLRA 4Q0PA 5LB6A 2EIDA 3WF3A 1UMZA 4NOTA 1C1LA 1W8HA 3J8F1 4QDQA 1NXMA 1WMFA 4XZPA 2K9ZA 1T6GC 2FCUA 3M3QA 4S2HA 4XVHA 4QB1A 5A3MA 3I3EA 5LRRA 2OZ6A 4CDQA 2YXSA 5JPNB 2OX0A 1RUD3 4JCKA 4L2NA 2JDKA 4WVMB 3UT0A 4AG4A 1ND3B 4DPNA 4LHNA 3FBYA 1FNYA 2RMU3 5DUUA 2HYXA 1UQXA 4XBLA 3P3PA 1ULPA 1JU4A 3WP6A 3WQ1A 4HFSA 1SLIA 3T1LA 5L19A 3P5BA 4YGCA 4ASMB 1NOVA 2V72A 3MIDA 4MGQA 5GM0A 2Y6GA 4Z8BA 2W46A 4NPRA 3LDRA 1UY3A 2DYCA 2VPVA 5BNPA 4A7KA 4Q0SA 3KGLA 5D1IA 2OZJA 3J7LA 4XAEA 3RGBA 2E33A 2QQNA 2WS93 1RUE2 3PNAA 4BK4A 1RUG1 2C6SA 4IXLA 4AVAA 4OQ8A 1JYIA 1XSRA 2ARXA 3HOBA 3LPGA 5GJ6A 3E5XA 2DF7A 1NYWA 4FP3A 2VG9A 5F37A 1JZ6A 3AZXA 4LO6B 1WBFA 2RR13 5FWEA 1X36A 1VRH1 2EIGA 4IE6A 4QQOA 1KITA 5BNQA 1RTVA 1LRHA 1RUF2 4DUVA 3B9IA 2VNOA 1UCXA 4KGQA 4RFT0 3ZXJA 1Y3TA 5KHGA 4YW4A 4Y20A 4YYOA 4KMQA 2VNVA 3SEEA 1Y43B 3VHRA 3WG2A 3DGTA 3HNMA 5FZOA 2ET1A 1XNCA 1XRUA 3ZLIA 4B7EA 3KV5A 4P14A 2YU1A 1N1TA 3VB9A 3RDIA 2FDHA 4YARA 4N53A 3S6PA 2RVAA 2WL1A 4E4SA 4LXLA 5FPLA 4EN6B 1GP6A 2ZTNA 4EWEA 2GH2A 2GC1A 3KSCA 1L7QA 4RGGA 1W6QB 5FYSA 2HWC2 4B4QA 5LA9A 3FHQA 5BY5A 4GA9A 4NE9A 3POIA 2E51A 2XQRA 4IDZA 3TAYA 1LJ7A 2YYOA 3BGAA 5HI0A 3IKWA 1W04A 2GMEA 4JKMA 3T2QA 5IT6A 1ST8A 5F1RA 1GNYA 2RDSA 4QPGA 1VMHA 5DDJ2 5FZ9A 3ZIXA 3PMSA 2VR4A 3E97A 3GBWA 5JXJA 2QNKA 2VCCA 4JKKA 5LA0A 2JDZA 3DYOA 4B4PA 3NAPC 1PIV1 5CB7A 3RZZA 3ZXLA 4PCRA 3ZYBA 1JMUB 1O7FA 4XILA 4CEWC 2AR6A 2GU9A 3UGFA 2A3XA 2KM2A 1KFUL 3BCWA 1XNBA 1R083 2WUHA 1RMU1 1R093 2R072 4AZZA 2ZA9A 3RYRA 2W3JA 3O1TA 2JD4A 2B9UA 5FIXA 2F17A 4D3WA 3H8OA 4LOTA 4Y24A 3ILNA 3POBA 4Q4Y2 4YGDA 4F8AA 2WQ8A 3FUQA 1DU3D 1EP0A 2A73B 1VALA 5LBFA 2QQVA 2R061 4CP9A 2OUHA 2R042 3K4ZA 4BISA 1TVGA 2YFUA 1SLCA 4IEPA 3LGRA 3AJZA 4LNVA 4CDQC 4H2AA 4IERA 1GANA 1LKNA 2RS52 2WINB 2P3KA 4AHYA 2ARCA 1MS1A 1UD1A 3I54A 4M3CB 3BYWA 2HJIA 5FKCA 3ZXEA 2GZWA 2Y33A 2VMHA 3MV01 1IPKA 2W87A 1DCSA 5IATA 4GWNA 3ZYHA 3KCCA 5F6KA 2FZ2A 4CDWB 5GLWA 1DYPA 1GNZA 4DXSA 2R0FA 1LOEA 3LSDA 4YVWA 5JOZA 1UXZA 2TBVA 4U2AA 3LDBA 5JVVA 1OOPC 4CSWA 3PVNA 5I91A 4ZXKA 1VBE2 2RDQA 4LBJA 5GKAC 4GAZA 1QU0A 3WQ0A 4PIYA 3ZR5A 4XC9A 3EHKA 1OH4A 4FI9A 4AVTA 2DVFA 1DFQA 2UWAA 3OJBA 3PUIA 3VKNA 4N7IA 1AR71 4AAPA 4BJ0A 1FMD2 4TN7A 2JG9B 2ZPXA 1VMFA 4LE4A 5FY9A 1X82A 1VAVA 5J7MA 3BVCA 1NZCA 1MZ5A 2GALA 2RG4A 2VL4A 3N36A 4KWJA 1PVC2 1Q3EA 5L9RA 1C3HA 1RUOA 2JD9A 5D8AA 1WGPA 5KHKA 3BB6A 3BOWA 5F8PA 3WF0A 2V4AA 2VZRA 2CYFA 3GHNA 4OUSA 3IDBB 2OA2A 3PVEA 1LGNA 4XHBA 5JLVA 3SNMA 2WZR2 4CDXB 1TZOA 4O9GA 3APBA 1PMIA 4EWAA 1V6KA 2DBNA 2XPJA 2B8MA 2ZX3A 4Q4X3 1JI6A 2VOKA 1AHSA 3JQXA 3KT4A 4FOQA 4CCDA 4PLMA 4Y3OA 4FBFA 4IEWA 5LZ6A 3SCGA 1DQ1A 1PK6B 1W2TA 4B1LA 1ENRA 1OI6A 1XYNA 2AEZA 2CTVA 2H0VA 3FHIB 1H1AA 5T54A 3RS6A 3ZSJA 1XJAA 1RUE3 1JBCA 1E5SA 2E7TA 1YWKA 2Q1FA 3VDDB 1F35A 3G7DA 2MNGA 5JMCA 2DCTA 3JB8A 2VZ1A 3WG4A 1HRV1 3H9AA 1IS4A 3MFCA 1FOD1 1H8TB 2Y38A 4LULA 1L7LA 4JZRA 4UFLA 4JDNA 1G9AA 1S2BA 2E53A 2C4XA 4Q0QA 1RUF3 5IVBA 2JE7A 5FY0A 3L2YA 3GDBA 3ZSLA 3HPNA 2D43A 2JECA 5IK4A 3LF7A 5A7QA 2LS6A 4BLJA 5HXMA 3FE5A 1B09A 4RR3A 1Y9QA 3AKSA 2FMYA 3AP6A 4LPLA 2DUPA 4XPVA 4DOUA 3WDUA 4M00A 1VP6A 4GKXA 4PF5A 4IEVA 4RSUA 1Z0HA 3OEBA 2FDIA 1RVF1 3ZO0B 1MQTA 2QDRA 5FDBA 1RITA 4LO5B 2BYVE 1MVQA 2Q5TA 3FLPA 3UKNA 4GXLA 3GXUA 4BU2A 1PX4A 2F4PA 4RHV2 5E8AA 4LUKA 3MO4A 3RJRA 4KG8A 3AP4A 4M01A 1LGCA 4AYUA 3HAGA 3VHPA 3WV6A 2WFF2 2D3RA 4YW3A 3VD9A 1KD7A 1QJU2 4DMIA 4GMP1 4XYXA 1EV11 1PO23 1ZRFA 3OGSA 1W9SA 1FYUA 4YVWC 3S0MA 1YLLA 3AYDA 2JEMA 1OFSA 2MHFA 5DDJ3 5FY8A 1S55A 2GNBA 5HXVA 3VBUB 4QKDA 3TBDA 5FZEA 4D0QA 2XLAA 4XACA 4NAOA 1RUH1 2V4VA 2IFWA 4IETA 1TE1B 1TQ5A 4XIOA 5ACA2 4UW3A 3ZPYA 2JB8A 4YG6A 3BKZA 2PAEA 2QQIA 4QD2A 4OI0A 1MS3A 3MPBA 4XE9A 3I8TA 4R9AA 4ONUA 2PMWB 2R073 5DXDA 1EUTA 5C3PA 3GBGA 5L7OA 4I0WB 4QKBA 4Q1PA 4E9KA 1YQ6A 4N7UA 4Q4Y3 3OUIA 1W6OB 4Y4YA 4P02B 5A7WB 2XJRA 2SLIA 2VO5A 3IBMA 3HVDA 1CR7A 2WO2A 1W90A 4D69A 2XXZA 5D8AC 1X9TA 4AI2A 3OBZA 1U5IA 1AVBA 3F2ZA 5BPXA 5DZFA 3WCSA 3VUOA 2XHKA 1HJFA 2BFUL 2RS53 2WN2A 4KG0A 3T2PA 1KS4A 2DUQA 3TN91 2CNAA 2VBPA 3EYPA 2DFBA 1XBFA 2WS91 1S0DA 2XGXA 5FMOL 5A1LA 3V56A 4X8NA 5A3LA 2D6OX 3M7AA 4YPJA 3W20A 3N35A 4W4ZA 1LHUA 2ZGPA 2R30A 2RR11 3FWEA 1HX6A 1LTEA 1NLQA 3AKPA 3OD4A 2XLFA 4CTEA 5BNNB 3E6DA 3SKVA 5FTTC 3ELNA 5DPNA 4EN8B 1EAH2 1VBE3 4K8FA 4QQLA 5A3NA 4WBBA 1M06G 1CX4A 3KHCA 1I6XA 3HNBM 2OUJA 2XUEA 4MX3A 3SITA 2UYAA 3ZN5A 3POGA 4KL1A 2Q8EA 5CEHA 2AGSA 4OI2A 4P9IA 4BH9A 4CZSA 2A5ZA 4CEWB 2P6CA 3CNAA 2AREA 4WVMA 3VL8A 2XKPA 4Y4RA 5L36A 3FX3A 5I8TA 2BVBA 2WZEA 4QQHA 4RR3C 4W6YA 3U14A 2VOXA 2H6BA 2AENA 1QJEA 3ASIA 3CU7A 4K20A 4NRPA 4LBQD 5ABJA 3O1VA 1W99A 4CA9A 1GZCA 3UGGA 1EY2A 1QGLA 2BNMA 2VTXA 5KWRA 1PGSA 3ZFGB 3NKTA 1JOBA 1LESA 1N1SA 5LBEA 1YQ5A 4QDRA 1TMF2 4PHZA 2WNVA 2WZR3 3C7HA 2PQSA 4RS5A 1SMVA 1DGWX 3CEWA 4MVTA 4NHXA 2CAUA 3VBSA 4ES9A 4AEDA 4CUAA 3VD5A 3NJVA 5AC92 1OF4A 5C4WB 1V6OA 2JE9A 2XJQA 3AMMA 2X5IB 2WSUA 2IXKA 2P2KA 2TUNA 5A7NA 4AVVA 5C9AA 4QPYA 2QBXA 2JDYA 2WO7A 2WWUA 4HXCA 2B39A 4IGQA 4NIDA 3J7NA 1R091 4ZHNA 3ILFA 3LD8A 2AEYA 1APNA 3TNQA 2WAAA 4MV2A 1XE0A 3BODA 4UFKA 4A6SA 1G7YA 2Z4FA 1XXNA 5FO9B 4IL7A 4GWJA 5C71A 5KXDA 1W03A 2Z69A 5LK5A 1PGL1 3O5SA 2OXBA 3H42B 1FX5A 4IUGA 1SLBA 3LIHA 2XVGA 5CFCB 5L7OC 1SPPA 1OKQA 1PO12 4YZ4A 1OFNA 3ZN4A 1C4RA 2YV8A 5FXZA 2PHLA 2A7AA 2HWF2 2JE8A 1A6CA 2WQ4A 4GWIA 5EXOA 4AI9A 1NCQB 1H8VA 1QJY1 4QX0A 2JDHA 3JBG3 5JZGC 2A6VA 4K3UA 3PUQA 2RDNA 4RHV3 2VNGA 5IFPA 2ZX2A 3OSDA 5EHDA 1H4GA 1VBB1 1HJGA 2A70A 3AFKA 1VIWB 3MIHA 2WFF3 3D82A 4XJ9A 1AR93 3AZWA 4C0BA 4CCJA 2J1SA 4XFHA 1COV2 2FD8A 5EIYB 1Z7S2 1W2OA 3I2KA 1CX1A 1IS3A 1OLME 2EVXA 1DQ0A 2VBBA 3ZXDA 1G86A 2ZOEB 2YGMA 3T0AA 1J3RA 1OMIA 4YW1A 4IGOA 2AYHA 3RFRA 1QDOA 5ACA3 3P1IA 2BOIA 4YM0A 1X7NA 1BEV2 5FUNA 4AI8A 1HN1A 4AGGA 1G6NA 4URAA 1QWRA 2E9QA 4AFBA 2VVEA 2D6NA 1DQ2A 1KQRA 4IGPA 3I2JA 4Y22A 1I5PA 3WUDA 3RQ0A 2Y6JA 5LK7B 3ILRA 4XTMA 1W9TA 4XXAA 1W6PA 4JHZA 5BNOC 5LY1A 4LJHA 2YY1A 4FPOB 4XDQA 1ULFA 4GZ9A 2BRTA 1TME2 3LPFA 5FZ8A 3E5UA 1H1MA 1WW7A 4Q4X1 4HN0A 2G4IA 3D8CA 1NE6A 2RJKA 1GP5A 3J26N 5F5CA 1VJ2A 4E8DA 5FQ0B 3OGVA 2OPKA 2WNVC 1CPMA 1YO8A 3NKGA 2ARBA 4RS5C 3WW4A 4DUXA 1WCSA 2I74A 2BGCA 1RUE1 1S2EA 3O12A 4L0PA 2VY0A 4LA3A 4JGZA 4JQTA 1CVNA 1E5IA 4XF9A 2ZGSA 3WNLA 4AEDC 4AI1A 4NRQA 5A7SA 1VAKA 1UZ0A 1OXCA 4ZU5A 1X50A 1K5JA 2VM9A 3QCWA 3S7IA 3I49A 4QGMA 2ZHKA 3BTXA 5C9AC 4E4DX 2ZMKA 1RUF1 2Z79A 3ZFEA 4ZU4A 4PF1A 2W47A 4AEKA 4BXFA 1I1EA 1EAH3 3W5MA 5L73A 5F3GA 4AFAA 2PLV1 2P34A 1GZ9A 4JX0A 1HQNA 2UYBA 2JG8A 4BQYA 4EZHA 1UWWA 2JDNA 4LKSA 3I2FA 3BU7A 3WDYA 4I2OA 4I01A 1GWMA 1CZTA 3CIHA 2QZ3A 4R4XA 3PUHA 1QXPA 3KT1A 4L11A 2ORZA 3WSOA 5KXBA 3Q8AA 4Y1XA 4RA0A 4YGBA 3IMMA 5CG9A 3LSEA 3NNJA 1W0NA 3IAQA 4KU7A 1JS9A 2BWAA 2YMZA 5F6LB 1AX1A 2ZAAA 2BNNA 2ENRA 5F3CA 4LO7A 1L7RA 2ZEZA 1ND2C 2ZX0A 4HN1A 1PO21 1GV9A 3LFIA 4Q0VA 4A2UA 2BQPA 4NIHA 3HD8B 1ULEA 4QX2A 2A6ZA 4LQRA 5DDJ1 4FQ4A 1WLTA 4XJAA 4E2GA 5IK5A 4CDUC 1SLLA 3O7OA 3I2DA 3H8XA 2HWB3 3U75A 3K46A 3H1WA 4W6WA 2BOJA 4XQ4A 4OHVA 1NUKA 2WNOA 1RXFA 1WLWA 2ZEXA 3J7MA 4XFCA 3V0BB 4GWMA 5KXEA 2GMPA 3OGGA 1WLCA 4A7ZA 2O1QA 1D4VB 1H2MA 4LA2A 3VBRB 1DHKB 1WMEA 1HV0A 4Q4W2 3PHMA 3CJIA 1HXS3 5A70A 3DPRA 3RWKX 3OPZA 4Q4Y1 1OHFA 1XNKA 4AGRA 1U5ZA 1WUVA 4EQVA 5J1XA 4HPKB 4KH9A 1CAVA 4CCCA 2CWSA 3WDVA 4YM3A 4BQ5A 4IV1C 1ULDA 4Q4V1 1SHWB 3TEWA 3B02A 1NAEA 3AX4A 2XBO2 2RS51 4IE5A 3K48A 1PO13 5HCHA 2QQKA 3KQ4B 1CIWA 4DXRA 4ZS3A 1G9BA 5FZAA 3K4DA 4BWOA 1UY1A 4I09A 1N47A 2W1UA 1CD3G 3O1SA 4R8HA 5JSOA 3A22A 1O5LA 1W06A 1LOGA 4J6GA 2VZTA 3W21A 5DMYA 4IEYA 5K0UB 2DVBA 1MACA 5JIAA 2GC2A 3ACGA 5FBJA 5GALA 4JGZC 2NZ9A 1F4AA 1VBE1 1Q5OA 1OLQA 1OLRA 3PTRB 1IG3A 1LOFA 2VNRA 3MHZA 1BVP1 2CDOA 3VN4A 5F3IA 1AYM3 1GKBA 1PZ7A 1RUJ2 1Z7S3 3BPZA 4OFGA 2Q8OA 4F7ZA 1YUDA 2ILMA 3ZFEC 1N3PA 1ZBA3 4NROA 1AXKA 4HVRA 4KWKA 4NHMA 4CYDA 4FAHA 2IXIA 1W28A 1OH3A 3KHBA 1QEXA 5BXXA 3RJ2X 1AXYA 1UY4A 2E7AA 3WR0A 5EP9A 1W8TA 3ZMNA 1KXGA 1ZZ6A 3WDWA 1V6NA 3IAPA 2ZMNA 1QXRA 1SDDB 4RQPB 5G04L 5FYTA 4MLOA 2RS31 4FXGB 5GZGA 2TNFA 5EJ1B 2JJ6A 4RFRB 1STMA 2BUKA 2YBPA 3TB0A 1LECA 2WZR1 2A1XA 1YJLA 1OBNA 3AKRA 1VPHA 2LTNA 2RS11 3MIFA 4LHSA 3WW2A 4CCKA 2VQ0A 1TME3 2UWBA 1UPSA 3B3QE 4JGYA 1FI2A 3HQUA 2Q4SA 2G9GA 1BBT2 5LATA 5L9BA 1GICA 4DEQA 3MW4A 1QOSA 4P9YA 3ROUA 1GWKA 1HQLA 5E1RA 2QFEA 1GOGA 3DV8A 1DGRN 2EIBA 5FY1A 2C1FA 4B1MA 4IEQA 4EYUA 2J42A 3VBOB 1WLDA 1UYZA 1AF9A 5FZ0A 5T3NA 4QT6A 3B93A 1SDWA 1B35A 4FQZA 4AWDA 4PIXA 4Q2FA 1CAXA 3GZTB 2C9AA 4O9EA 1CZSA 1QNWA 4HK8A 4IE0A 5K8SA 1JTZX 2RJ2A 1ASJ2 4KBZA 2FDGA 3DPRC 5FPAA 4UAPA 2EAAA 3JD73 1XOYA 1V6IA 3U10A 3VDBA 1W8NA 3IPVB 1WW4A 4GKYA 2J1VA 5FV3A 1EYBA 4RN5A 2BV4A 5LCWL 4R9BA 3AZZA 4KGGA 1F9KA 2XJUA 1PMJX 2D5HA 4DUWA 2VMIA 4J1WA 1GZWA 1POV3 3JBG1 5E89A 4NR1A 1PGW2 3ZFGA 4Y1VA 1FXZA 1MVEA 4Q8KA 4GMP0 5CKQA 5IK7A 1XU2A 3HMYA 1QF3A 2QDNA 4RHV1 3IN9A 1QH7A 4BXSV 1T2XA 1BK0A 2YC2A 3WNMA 1LB2A 2ZHNA 1W8FA 1JUIA 2VOTA 1CJPA 2V09A 2WFF1 3OBRA 1AR91 4JQRA 5BNOB 2H0BA 1CZVA 1LOCA 1R64A 1VRBA 2VE1A 3R4DB 4LORA 3USUB 2B4KA 2X5IA 4UW6A 4HL0A 3N7KA 4Z82A 2W52A 2VUAA 4IV3B 3W59A 3AMPA 5CG8A 2BFUS 1JZ2A 2X29A 3K51A 1VBC3 3ZSKA 4CU7A 1F5FA 1AUYA 4P9LA 1AR63 4WM8C 2DTWA 2W95A 4LBNA 5FMOS 5ACA1 3Q9OA 1LOFC 3MV11 4D6RA 5IHRA 4ZPIA 1IS6A 5C8CA 5IVJA 5CFDB 3VZNA 1C8M2 3WG3A 3SH3A 2VULA 1FPN2 2A75A 2W92A 4Q4W3 3PVOA 1GU3A 1QJX1 2G1MA 3AP7A 5JAXA 3WP4A 3L9JT 4XUTA 5FMDA 2VZOA 4CP0A 1IHMA 5A33B 1ZM1A 1AJKA 3VD7A 3OYWA 2IXJA 3ZYGA 3AVRA 5SV5A 4AQTA 3VKMA 3WNPA 2QVSB 1XQNA 4QDSA 5IVYA 1ULOA 3O0XA 4CCMA 4Z2WA 1JN2P 3ATGA 3INAA 2X10A 1HB1A 3N9QA 2XBO3 4PDWB 2VOWA 4ASLA 2IZWA 5JIUA 2RM22 3HN1A 4AFMA 3MEPA 5FZ7A 3S7EA 3WG1A 1NCRA 3ZFFA 1XNAA 4LITA 1A8DA 2VH9A 1W6NB 3P6BA 5FLJA 1RHI2 2WFPA 3CF6E 4TLGA 4EZ4A 2GC0A 3JU9A 5IAXA 4Y5Z0 4JGYC 1TEIA 4H55A 1U5XA 1H9PA 1UN1A 4P9JA 5FZ1A 1VBD2 2YGLA 1UIKA 3BPSA 4CRQA 5A6YA 3WW3A 1PM4A 4Y1YA 1F2NA 1RUI3 2XWBB 2ZCWA 1W39A 1EAH1 2HWD2 3C7FA 4UF0A 5BV6A 4MO3M 4CDUB 4Q1RA 5CKNA 1QXJA 1FATA 4QXBA 2GNDA 2D6LX 5KHJA 2A6WA 2Y60A 3EO6A 1RUJ3 1YQ2A 1B35C 1CAUB 4OUEA 4XUPA 3ZPOA 4HMZA 1H30A 2E63A 4JHTA 4Y26A 5IW0A 5FJHA 1IQDC 1W8UA 3MBWA 2EXJA 3VHNA 4YZ1A 5FUIA 3S30A 4OHWA 1CWPA 2OW4A 1UKRA 3OOXA 3KCXA 1K5MB 3LIGA 4DXTA 4HKOA 2VMDA 2E32A 4C90A 4YLZA 4FPGA 5CISA 2XJSA 3UYJA 4BDVB 5A3PA 3ZXKA 1ZRIA 1X9PA 5DUWA 5BNPC 1NA1B 3AB0A 3CJXA 3PLQA 4QU2A 4XMIA 3R4UA 4CP2A 4AEJA 5LEKA 1JZ4A 4GQ7A 2JDUA 1IPSA 1YQ8A 2EICA 4IV1B 4LIUA 1XE8A 4Q29A 3POFA 5FZ4A 5CBLA 3RZGA 4XURA 1LOAA 5FWJA 4HKLA 5A32A 4UXAA 4L92A 3KF5A 1IKPA 4N43B 1N1VA 1DGLA 1K42A 4HZFA 1HB4A 2HWB1 5HCFA 3MF9A 3WY6A 3KV4A 3SMHA 4BQ1A 1BBT3 5GZDA 1JYTA 2GAUA 3PTYA 3GCWA 4V2WA 3A0KA 4RGAA 3ZM8A 3VBFB 2EXIA 1J59A 2BZDA 5FYMA 4HSJA 2JB4A 4QKNA 3C8XA 4A3ZA 2HWE2 3I4IA 1HXS1 4Q0UA 3K4AA 4UBHA 3AK0A 2J22A 2VUDA 1LHWA 4TLFA 3VBHB 1URXA 5HV0A 5C8CC 4TZDA 4MGZE 4N53C 3WQ7A 2VVDA 3AP5A 1XYOA 2DDUA 3QACA 5DZGA 5FRAA 3BUCA 4LBMA 3OB8A 4GH4A 3QBQA 1DLCA 4XBNA 4DY3A 1H6XA 4JV4A 1VE0A 1ASJ3 3S5QA 1NX9A 1PO11 4YW2A 2DV9A 3UV9A 4AVSA 4HVOA 2HBUA 3ZDSA 2WA3A 1PNFA 4CXWA 4WM7B 1YFWA 3AYCA 4HOOA 2GMMA 1WCUA 5BYNA 2VOVA 4QPGC 5FP3A 2OS2A 1N3QA 3KD4A 2HEYF 1X8MA 1OUSA 5F5QA 4JRAA 3WEZA 3N7MA 5LBCA 1GP4A 3PL0A 2WNUA 1ZRCA 5LBBA 1IS5A 1S0BA 4NHYA 3ZKUA 4QX5A 1C5HA 3AC0A 4AI0A 1UL9A 2IWGB 3BIEA 5JI9A 5C70A 1NCRC 5F9TA 4LLFA 2QQPA 1JXNA 2XHNA 4I02A 4QPIA 2W9XA 2D7FA 1ENQA 5C3QA 4BYYA 3H3ZA 2P5BA 3JCIA 1AYM1 1Z7S1 4QAWA 2WLQA 4URTA 5EYYA 5FP7A 1NLRA 3KB5A 2BTVC 5FK7A 3WDXA 3V0AB 1ZBA1 2D97A 1WCKA 4P5HA 5C3RA 4JC1A 1J1LA 1WBLA 1EPWA 5IVEA 5FPBA 2A6YA 2ZMLA 1W2UA 1F5JA 4QXKA 2DVDA 4NHKA 1O3QA 4AHZA 3J8F2 5IYYA 1JU3A 1N1YA 1C8M3 1LODA 1NY71 1VLNA 2D6PA 1YCIA 2AUYA 2WO3A 4K1ZA 3THTA 4DZGA 4Z1VA 1YI7A 5CNAA 1WMDA 3VD3A 3R0RA 1IQAA 1ZZ9A 4MZUA 2HWC3 2VQTA 3CKHA 4PQ9A 5FZFA 2B5HA 3RYKA 4BOWA 1Q8OA 1YIPA 4LBQA 3N3HA 3T0BA 1HN0A 1AL22 2XJVA 5A1FA 1DQ5A 4KWLA 4CEYA 4PQQA 5A6ZA 2KR2A 5CU1A 3MW2A 3W5NA 3MUZ1 4QB6A 1TME1 2YB7A 3DYPA 3ES4A 2PELA 1UU6A 4BLIA 1GFF2 3SH5A 1XU1A 2O8OA 2Z42A 5FZCA 1RUC2 4ASKA 2GN3A 3OY8B 4UWDA 2PQQA 2RM23 4ZXEA 1AZDA 1HB2A 5HV4A 5FYUA 4YZ2A 3KV6A 2FCVA 3M3IA 5A1AA 1CONA 2FHRA 2ARAA 3GALA 5FK8A 4CUCA 1W9FA 1NXD1 4BPZA 5EJ3A 5KHIA 3W9AA 4H14A 3RNSA 1VBD3 1RUD1 3KQRA 2EF6A 4BQXA 2UY9A 4LE3A 5FO8B 2RMU1 5DABA 4XFIA 2TEPA 1ZYBA 4MG2A 2HWD3 3E6BA 4WV8A 3QD6A 1G8WA 3JD71 3U78A 1SFPA 1YFYA 2R043 2XR4A 5A32B 4WM8B 1JUHA 3NSTA 3HQRA 1HRI2 3VV1A 2Y34A 2JIJA 2Y26A 3LAGA 4K40A 3SC7X 3ZYFA 4GH4C 1POV1 4ATEA 3KZ4C 1ZBE2 5CYYA 1H2NA 3L2HA 2W1SA 2PN5A 4ZU7A 1W6MB 4G4FA 4UW4A 3S5AA 1VMJA 4LT5A 2NYYA 4YVSA 3DN7A 3A21A 1DLLA 2D40A 3IDCB 2NMNA 3OBAA 4MSVA 4RD7A 2GNMA 3J7HA 3K2OA 4LEJA 1UF2C 5EYXA 3ZN6B 1UYPA 2VC9A 1SFNA 3I59A 1JW6A 2R32A 2WNUC 2XJTA 2MEV2 3NW4A 5F2SA 2VCAA 1UX7A 2VXRA 4MXWB 2J1TA 1PMHX 1DZRA 2OIIA 3ECQA 4NUBA 4YG3A 5ISLA 1VBC1 2ES3A 4BZ4A 1XPWA 2ZGKA 2V5YA 4HVQA 4P5YA 1YQCA 3ZDVA 1AR61 4ISRA 3NAPB 1YFXA 1PIV2 2VZQA 4XDPA 4ZY9A 4OQ9A 3LWCA 3LQCA 5FLIA 3IT8A 3IIAA 5CIRA 2X09A 3GHMA 1ND3A 3IDEA 4JVAA 1LHNA 1FMD3 3NL1A 4Q4W1 3LOIA 4JDOA 2BBVA 1PVC3 4QX8A 1I3HA 4L9BA 2R49A 2R062 3IPVA 4QB2A 1MS5A 4UFMA 1MQTC 3GM8A 1YNAA 1AXZA 2WT1A 2Y0OA 2XJPA 1GNHA 2RJLA 4FT8A 4UFIA 2HEVF 4CDQB 1KRIA 3RZHA 1J58A 2WABA 4NVPA 2XBO1 1H4HA 5A80A 1DYKA 3W58A 1LOBA 1VBA2 4W6XA 1ZRRA 3MIEA 4NO4A 4TSVA 1UMHA 4CEYC 1V0AA 1S0CA 3WNKA 3DKQA 5HCBA 1FV3A 2YROA 2IXHA 2VQAA 4Y1UA 4FOVA 3RYPA 1O3RA 3O1PA 1O4YA 2V73A 3FHAA 1IZ3A 1HDKA 5A3OA 4K9SA 3AL6A 3U37A 5A7OA 1R081 1CAWB 5AVAA 2B42B 2YPDA 1HLCA 2FDJA 3NMBA 1OOPB 4U36A 2ZGNA 1NQJA 2WWSA 1V6LA 1YFUA 1RUI1 1QHDA 4XF3A 5FZGA 3IM0A 4PLOA 3ES1A 3PJQA 4PBOA 1LU2A 3WHTA 2D3PA 2FZ1A 5LEJA 3HBKA 5JDBA 1MZEA 3QH7A 5CFDA 2N7GA 3UKVA 3VLBB 3WD5A 2K2SA 4XFFA 5FY7A 4YM1A 1DG6A 4AOCA 1W6QA 4FPEA 2WO1A 4M4PA 2VMEA 3M3OA 4TWTA 5FZOB 2WYSA 3JZVA 2ZABA 1IOAA 5A3WA 1C1FA 5A33A 1J84A 2LW8A 3LA3A 1QDCA 2FDKA 3UGHA 1NT0A 4FFHA 4HONA 4Z07A 4XCBA 4BE3A 3DUIA 4OULA 2P6HA 2PHUA 3WF1A 2K0GA 2OQ6A 2GH8A 4LKFA 2J1RA 1REDA 2ZGTA 1AL23 2R7EB 1QJU3 2Y0IA 2Y64A 4S2GA 5DUVA 5F2WA 4FOWA 5FKBA 4LOSA 5C3OA 2OT7A 2A3YA 3DXTA 4DY5A 4FSJA 1UYXA 2P37A 1OPMA 3POSA 5FYZA 5I0SA 2WNEA 1O4TA 1RUC3 2DWRA 1NLSA 1GQGA 4YZ3A 5E88A 2Q8DA 3SH4A 1PX3A 2EA7A 2ZEYA 4UFJA 1DZTA 4D8MA 4P9GA 1W2NA 5FYIA 3DF0A 3OGJA 3PUAA 1ACCA 1KFXL 4OZXA 4XW3A 1F8VA 3JQWA 2ADEA 3ZIWA 4PI0A 4CPBD 3ITQA 3KM5A 3B7MA 3ACLA 3TOJA 2QTWB 1FOD2 2ZGMA 4XBQA 5M0TA 1HQWA 3EB7A 5A3TA 2BJSA 4Y1ZA 1DDLA 1ND3C 4MGTA 5FY4A 4QX7A 4FTBA 1SBDA 4UFHA 2DCYA 3B01A 4UBGA 4QQ2A 1RJ7A 4M3CA 1ASJ1 3GGLA 2ZGRA 3PDQA 4FOYA 5J98B 2ZS6B 4FVVA 1K5MA 4B4RA 1K45A 5ABJC 3MYXA 5D2AA 2LRPA 4CP9B 1LU1A 3URFA 1O4ZA 3C2UA 1UU5A 4XEZA 2RE9A 1HRI3 3D3AA 3C3VA 3FN9A 4MADA 1RVF2 4CDWA 2W2IA 4WVZA 1OA3A 2R16A 5FPVA 5B2GB 1BHGA 1UU4A 1E57A 4E8CA 4FAGA 1WCDJ 1ZBE3 3Q8BA 3T08A 4IQPA 3RPQA 5K9YA 3EBRA 1JHNA 3VBSC 4XCAA 2D93A 2P1BA 5F5AA 4HBNA 3BI3A 1REEA 4LKEA 2YC4A 4GB32 5C33A 3ZXAC 2QQMA 2JDPA 2RHPA 2WZ8A 3N9NA 1U12A 5FZHA 2KA3A 4NJ4A 1A8MA 4YVWB 2MEV3 3U4XA 3M4FA 4M4RA 4YWAA 4HETA 1WKYA 2J1EA 2I45A 2PHFA 3VBFA 5JMOA 1ZNPA 4OLLA 1RUH2 2JG9A 3ORJA 3Q8FA 3B5LB 4I3PA 4MOAA 2C9KA 4OHXA 1DBNA 5FMCA 1DGWA 1Y9GA 2VCMA 4O65A 1XC6A 4UW5A 3OF1A 5FYVA 3VZMA 4YSFA 2FDFA 4K21A 1MZ6A 2YUEA 5KHHA 4G3YC 2XL9A 2WT0A 4YGEA 3WF2A 4YM2A 5CADA 2HWC1 2RV9A 2VZSA 4CDXA 1S0EA 1O5UA 4B29A 1UW8A 3VZLA 2CDPA 1MS0A 1NG0A 3NO8A 4QX3A 2ZX4A 3CQOA 4WM7A 4XJWA 3ZR6A 3ON7A 5D8AB 2OYZA 1TMF3 3ACIA 5I8YA 5KC5A 2A6XA 5F7UA 1PK6A 2XVKA 1QJFA 3TN92 2GP5A 3NVCA 4N9IA 1WMXA 1C28A 1SBFA 1CIYA 1VBA3 2F4LA 4RL7A 3VDDA 1TG7A 4BQ2A 2RM21 2X8KA 4CU9A 2WS92 2PTMA 1ZVFA 1C5IA 2ZKNA 5AC93 3FFZA 5FMBA 1D4M2 4ET7A 2D6MA 2WC2A 4CXXA 1CESA 1H8TA 1WA6X 4R52A 1W05A 5J37A 4OUMA 1IKQA 1GWLA 3MGUA 2G9ZA 4PBPA 2R071 2Y6FA 3WW1A 1VBD1 4IEUA 4LKDA 2ZHMA 3FMGA 4XF1A 3OBTA 5LW9A 1UIJA 2HWD1 4NWWA 1GOFA 3DL3A 1D7PM 3ZYJB 2R041 1ZZ7A 4XUOA 4UI9L 4TTGA 3WUCA 3HIFA 4Y5TA 1ZA4A 5KC6A 4BA6A 5DAQA 2D6KA 2DFCA 4FP2A 5FXWA 3VZKA 4D6QA 2C0ZA 4W50A 3N7JA 2WKKA 5FAXA 4A7YA 3I97A 5H9PA 4MUVA 4RR3B 5FZDA 2HWF3 4D7SA 1RL3A 1OSGA 1RC6A 1SZBA 1GZTA 2ZAHA 3NV1A 4W8JA 2XOMA 5LASA 4A45A 3S57A 1H1IA 3LA2A 1Y9MA 2YBSA 5IUQA 4LTAA 4CDWC 4DB5A 4EJRA 1MQTB 5HPOA 1SEFA 4DXZA 4QM8A 1JZ3A 2VUJA 4LR4A 4DS0A 5C5TA 3VBUA 3ACFA 4F83A 3LKJA 4LMFA 2JDMA 3M3CA 2PHTA 2YZ4A 4M0HA 5IVCA 4W65A 1N3OA 3BN6A 4KWUA 3RMYA 1EPZA 4FPJA 4FPCA 3D0SA 3PJYA 4HK9A 1IPJA 1Q8SA 1COV3 5FY5A 4WZFA 3ZMOA 4A6OA 3MLKA 3GZUC 5T55A 3ZYPA 5CA6A 1A78A 5CZKA 3IWZA 3IZOA 5FUPA 3NJZA 4H7LA 3OG2A 1AR82 4GALA 4P9WA 1REFA 1JOJA 1PM7A 1QOOA 1XNDA 2NQYA 3VDAA 2JIGA 4CU8A 1JH5A 1YXWA 5LA1A 1W8ZA 2DBIA 1XSQA 2PHDA 2VTXJ 1I9RA 2XWJB 1FMD1 2B7YA 1W6OA 2JG9C 3A0NA 2VW0A 5A7WA 4HANA 1BEV3 2JG8C 1PVC1 3NV4A 4LBLA 3CLPA 4LK6A 2PAMA 2L9LA 3POJA 5FFOC 1PGL2 4S2DA 4EV0A 1R1ZA 4R9CA 1U0AA 3H50A 3BU0A 5L7OB 3I2HA 2CGNA 4CDXC 4YNIA 1AX0A 2QZ2A 1J83A 3AFGA 1ULCA 2CU5A 2RDRA 5GZCA 4QHBA 3A23A 3Q8EA 4NRMA 5J96B 2QCSB 5EWSA 5AVPA 3NV2A 2YU2A 1RVF3 1NQDA 1QJY2 1X8EA 2QQLA 2WSVA 3KVAA 1W3VA 4HT1T 3WX5A 1GR3A 2BBAA 2GC3A 2OQ7A 3C7EA 4V2VA 1EUUA 5FOJB 1ZZBA 1PK6C 3KWVA 5BNNA 5JZGB 1GSLA 5E16A 3GYDA 2E6VA 5H9SA 3MIGA 1W9WA 4OYUA 5JOXA 1XNTA 4BHPA 5T5LA 2FMDA 1ZX5A 4MGSA 1VBB2 5A7PA 2WAOA 4GD4A 4PI2A 4YZ5A 3MICA 4G9SB 5J3UA 1H8TC 4GMP3 4GB33 2I2SA 1ENSA 2JWPA 2VMCA 1ODNA 3MLJA 4NAMA 5CAZA 5A3UA 3GZAA 4LHLA 4CEWA 2D98A 3LCPA 2DU1A 5JOWA 3WQBA 2NLRA 2OKXA 3RG0A 3CJIC 1HV1A 2WWJA 3CZUA 5IWFA 4DO0A 5FLHA 1QY4A 3Q8CA 1I5ZA 1RUH3 1YEWA 2NN8A 4BB3A 4RYDA 1Y7BA 3WP5A 1Q8PA 3WNXA 4BIFA 3ZXGA 1MEC2 3GJAA 4YW7A 4X6QB 3UESA 1KDMA 5FZMA 3WHUA 2DURA 2Q1MA 3AMHA 3RI8A 4Y33A 4E2QA 5DAXA 2Z5WA 1OQ1A 3VKFC 2ZXQA 4DEVA 2P4EA 2Y6LA 3RZKA 1S2KA 1Q56A 1UZZA 3I3BA 3WNOA 5AFBA 1CGPA 3O1RA 3WXPA 2CGPA 5EPAA 2J1AA 3I3DA 1AL21 2W08A 1QJU1 2EALA 5C4WA 5ABJB 1S0JA 3U07A 4COVA 4Q4X2 1MS8A 2Q30A 4LLOA 4QX1A 5FZLA 3TRSB 2LALA 4LO8A 4RGKA 4CVUA 3NNFA 5EQUA 2WZPP 2G9FA 3TN93 1CAWA 2H6CA 1RUC1 3VBUC 2EXKA 3OTFA 4XJUA 2WNVB 3NJYA 4RS5B 4Z2AA 5B4NA 1BYHA 1OOPA 1OPOA 4FFIA 3H3LA 4QGLA 3VBSB 4AEDB 1D4M3 2W68A 3DCQA 5T50A 3LDKA 4FPHA 3ST7A 4EE2A 1QMJA 4WVWA 3F95A 3THDA 5FPXA 5C9AB 5JWPA 1UNBA 4MHRA 3B69A 1KS5A 1IG0A 2X53S 2VGDA 3WF4A 5CFCA 1JYNA 2YFZA 1JHJA 4QXHA 1GYKA 5FZ6A 3POEA 3R05A 1NZIA 4CU6A 4AGVA 2Y6HA 2PLV2 1LENA 4MGIE 1POV0 4HG6B 2AZ5A 3ABZA 1NCQA 3RZJA 2ZGUA 1HRI1 3LB9A 1RIRA 3RI9A 5KBFA 1OT5A 5F39A 1SLAA 4IE4A 4C1XA 5I93A 5C3SA 1BJQA 2I07B 3HNYM 1SPPB 3WNNA 1ZBE1 5G05L 3MFAA 2ETEA 1QQP2 1KGYA 1WW5A 2O8QA 3SEPA 5KR7A 4JRLA 1WWYA 1LCLA 2BVVA 3ZXFA 2DCJA 2JDAA 3MIBA 5EJZB 1K3IA 2VMFA 1YYNA 4LK7A 1FT9A 1ND2B 3EQEA 2W0XA 4XQWA 1PO22 3CZJA 1HW5A 1WZXA 2WA4A 3I2GA 5BNNC 1P8JA 1HIXA 1O59A 2MEV1 3OEAA 5FXVA 4E2SA 3AP9A 4E4HA 2WT2A 3TEXA 4C1WA 5I0TA 5J36A 3UETA 4DRRA 5JXIA 4XABA 3CDZB 5FYHA 4OMCA 4AEMA 1WA4A 2ZJCA 4I30A 3VL9A 1AR83 1D2SA 5K7PA 1R1A2 1MS9A 2NM1A 2A71A 5A6XA 2YDEA 3FZ3A 5FYCA 4BMEA 2BPA2 2LM3A 1JYXA 4IEXA 1D0GA 1XB9A 2HLEA 1H9WA 4META 1YC61 5LRSA 2JKXA 4IEZA 1UX6A 4SLIA 2WBKA 2XMLA 4MHUA 5ANQA 3T3YA 1LHVA 4KQ7A 1PZ8A 1QNYA 4KBBA 4GJYA 4BM8A 3U1XA 3ZFGC 3H1YA 3ZVXA 3EJKA 2VZ3A 3RZMA 1TMF1 4Q4V2 1V9U2 5FQ0A 3CHXA 1MR5A 4F3JA 1W0OA 4Y22B 3VGIA 1IGOA 5IFTA 1D0HA 1US2A 4ARYA 1KEXA 4DFSA 1VBA1 2NP0A 2GNTA 1W6PB 1JODA 3BTAA 3ZYRA 5AC91 5C4WC 1SQ4A 2OVUA 4AF9A 1QJY3 2W91A 4CCNA 2X5IC 2EAKA 4AQ2A 1UO9A 1HKDA 4OHYA 4FCAA 3SKJE 2QE3A 1OD5A 3AXEA 3I3QA 1BXHA 2CV6A 4PIZA 1VBB3 2K46A 2PXJA 3BOPA 3HEIA 1BLZA 2WJSA 3EXUA 4JGZB 1ALYA 4OVEA 4QMAA 1V6MA 3LEKA 5E6HA 3NNMA 3T4VA 3J4UH 1DYOA 1AX2A 3CO2A 1W9YA 2VTFA 5FREA 4Q8LA 3AKTA 4DQAA 1ONAA 4KNCA 4UT5A 3PUSA 2OPWA 3ZFEB 1F31A 1ENXA 1WD3A 4KU8A 4M3CF 5TSWA 5CFCC 1UAIA 1RYYA 1H2LA 2YHJA 4XDOA 1BMV2 2ZEWA 1AYN2 1MEC3 5LA2A 2WDBA 2HWF1 2R1BA 4XFGA 3TYJA 4XF0A 1CJDA 2XKOA 2JG8B 3THCA 1NCQC 4L97A 2RS32 2WR9A 1VB2A 4IESA 1UOJA 3AKQA 2YG0A 3CL1A 3LEIA 5T52A 3FUOA 3SCHA 3MW3A 4QM9A 4XXPA 1J1TA 4SBVA 3D4KA 3KS7A 5A6QA 3ZFFC 2V5DA 4LUMA 4ATFA 5FYYA 3VKLA 1PNGA 2RS12 4FFFA 1G9DA 3BTZA 3LEGA 3ETQA 2XL7A 2E26A 1COV1 3ZKYA 2WQZC 2AACA 3N7LA 1PZ9A 3M1HA 1F15A 3V0BA 4AI3A 1VR3A 3X29B 3ZX7A 4K7JA 2VU9A 5FP9A 3UJQA 1F4HA 3VBRA 4AFDA 2QQJA 5DAWA 4ES8A 3SQOA 4MGYE 4Q27A 1TNFA 2JICA 4AR2A 2P3JA 1H2KA 4C91A 2VZUA 4YW6A 3HBZA 4CP1A 1BEV1 2AH2A 2P3YA 3D0JA 4HPKA 2Q1ZB 1MS4A 1JZ7A 5JSRA 1E5RA 1Z78A 2ERFA 1FPN3 3T2OA 3AL5A 4HLTA 3NJXA 4M0NA 5FCCA 3DYMA 4NPMA 4YRDA 1QH6A 1WCQA 4JTNA 4L99A 5EV7A 3R6SA 2LUWA 3CJIB 3DPRB 4QWNA 3KGZA 4XZUG 2PLV3 2XDVA 1OQEA 2UURA 3A7QA 2VJXA 5EFUA 5FP8A 1UOGA 4INDA 4LIVA 4D94A 3MPPG 2ZBJA 4NIIA 3I3MA 1CAVB 4AW7A 1JZ5A 4MH0E 2Y8KA 3FC0A 3JBG2 4LBKA 2ATFA 1JOPA 5K0UA 1OVSA 1Q8QA 2DUOA 1RUG2 1L3JA 3USSA 1QQP3 3LOBA 2Q8CA 2D44A 4OZOA 1RHI3 5FZ3A 5C7GA 4WVVA 1KDKA 4AL9A 3O1UA 1S0IA 1AR92 5DG2A 2ZZQA 1VRH2 5FJKA 3THPA 3NNGA 4XTPA 5JUVA 4GB31 4XJ8A 3LFMA 2JX9A 2IXCA 2BP6A 3OGRA 1POQA 1MZFA 5L9VA 2HKXA 2R1DA 4GIQA 2DTYA 3NWKA 4R4ZA 2FCTA 2VZPA 3LA7A 3NV3A 3O0VA 2MPFA 4ZZ8A 4LO4B 4JAAA 3SXWA 3VHOA 5JOYA 2B45X 4RQPA 1ZREA 1OLMA 1R1A3 1OURA 4LBOA 3DKWA 4MGKE 5GLZA 1A3KA 3PVBB 3UJOA 5SV8A 4FPLA 3IB3A 4XAAA 5JI7A 1JYVA 5IAVA 1QJX2 4COUA 3H3UA 2B46X 2ET7A 5ERLA 2IVJA 2XQXA 3FFQA 3FL7A 3QOPA 2PHRA 2BGPA 3N9OA 2R6QA
chains in the Genus database with same CATH topology
4Q4V3 1JYCA 1V9U3 3VKOA 2BW8A 5BUVA 3G6JB 5JZGA 2ZKLA 4AK3A 3FLTA 4COZA 1QJZA 2UY8A 3SISA 2PYTA 2XLGA 4ORFA 2FQPA 4QPIC 3ZSEA 1CN1A 3B00A 1D4M1 3VBOA 4AVCA 3AZVA 4JGYB 4I0BA 1J3PA 4IEOA 5JSPA 1RMU2 2VW1A 1RJ8A 3V65A 3VBRC 4MXVA 2DU0A 2HWE3 1CQ9A 1DGRA 2CL2A 3KLSA 5T5OA 1G9CA 3B9CA 3H7YA 2P3IA 2JKBA 3MLLA 4QGNA 2QKDA 1BK1A 5I0UA 1ZZ8A 3TNPB 3QH6A 1B35B 1CAXB 3I7DA 3QLQA 3VZJA 4EN9B 3POYA 1AYN3 1KJRA 1YJKA 5BNOA 1FV2A 3USUA 5BNPB 3HR9A 2A3WA 2IC1A 2RS33 3GNEA 1RGSA 1GZWB 3AMQA 4IV3A 3BIWE 4COYA 4DNYA 4EN0A 3BALA 5AFEA 5H9RA 5K0UC 1SBEA 1S0GA 1BKZA 1BVVA 1LEDA 3P3NA 2RS13 3ENRA 4I3GA 3MF6A 2HWB2 5FOBB 3WOGA 2YC0A 1RUJ1 2QJVA 1DIWA 2UU8A 1AR81 5C6CA 1AR72 4Y20B 2ZZJA 4P9XA 1C57A 3E5QA 3M2MA 5EZWA 3JUUA 5JR7B 4AHXA 1HXS2 3J8F3 2PHXA 4AQ6A 3JB4C 1RINA 2PHWA 5J09A 1C8NA 4AVBA 1LULA 4AE2A 5JLVA 5C8CB 1OQDA 4N53B 4RQPC 3SLIA 3WVJA 3WINE 1SFYA 1DZQA 1ULGA 2BWCA 2ZGLA 1ZRDA 4PLNA 5T5JA 4PDWA 3O0WA 4XIKA 4MYEA 3GBFA 5GZEA 4YFWA 4YVSC 2W39A 2JXAA 1W6NA 3OYWB 4TYSA 4V1PA 1BCXA 4WZCA 4QPGB 1KJLA 2Q0AA 5FPZA 1DQ4A 4H3WA 1BBT1 1ND2A 5FO7B 3RMXA 3O14A 4DRVA 2VVFA 1O3TA 1VB4A 4XF4A 1BZWA 1RUG3 3E6CC 1BQPA 4B7KA 1Q8VA 3D5OA 2BNOA 2JENA 4CDUA 1HRV2 1NCRB 2IXLA 3ZFFB 4D7TA 4J1XA 4NN0A 3UK9A 1OA4A 3VBOC 1VRH3 4XFAA 3RWNA 3HWJA 1CAUA 2UWCA 1NE4A 3AXDA 3OD0A 1AYM2 3KT7A 2ZACA 3ME2A 5GLVA 2KXLA 2EXHA 5GLTA 1ZBA2 1G9FA 3VL9A 4COUA 2GSYA 4ITCA 4FPYA 4PJYA 4S2FA 1YHFA 1SACA 1MEC1 1QOTA 2XUMA 3WDTA 2NPIA 1FNZA 1RB8G 3FJSA 1NA1A 3OCPA 4ISQA 1NY72 1O91A 3H1MA 5JCTA 3H8UA 1PGW1 4OHZA 5DUXA 3SHRA 4IV1A 3AM2A 2F6BA 4AQSA 4C0HA 1QJX3 2CWMA 4AFCA 2D5FA 4N43A 4NWVA 1FAYA 2GDFA 2HEWF 2D3SA 1PVXA 3IMNA 4AHWA 4FTSA 1EV12 3A4UA 3KMHA 4DINB 3HT2A 4HKWA 2VMGA 2XG3A 4K6BA 4XQDA 1S0FA 1V70A 4IV3C 4JTOA 4XJZA 4YW5A 3HQXA 4OI1A 5GZFA 1H0BA 1AL0G 3SCFA 1LHOA 5DZEA 1SLTA 4Q26A 3RRDA 1GBGA 3AYAA 1PIV3 4AXOA 1RUNA 3VBHA 1X33A 1XYPA 3T2TA 4I0AA 1C8M1 5CFDC 5CVRA 4YG0A 1RMU3 1AJOA 1RUD2 1FPN1 2ZX1A 4FO9A 4BMBA 3M70A 2RMU2 3MDPA 2VECA 4COWA 1SCRA 4H7MA 2R063 3POWA 5DG1A 4D7YA 3JD72 1YIFA 1D2QA 2Z2SB 4HSLA 4GULA 3ALQA 1LGBA 2FBEA 3WP3A 3HT1A 4QQPA 4GH4B 4PDWC 3ZYIB 2QUOA 3RSJA 4B8EA 1J3QA 2BEOA 4FPKA 4LHKA 1YRZA 1QQP1 1RHI1 1QKQA 3V64A 1PHMA 2RR12 5KXCA 5I8SA 2IFRA 2E7QA 2WNUB 3B94A 3V0AA 2CAVA 3T1MA 1W0PA 2NMOA 1GLHA 1VBC2 1WD4A 1M4WA 5FBZA 1TNRA 4QPIB 5C8WA 4K1YA 1AR62 4X6RB 1V6JA 1SCSA 3J9SA 1R1A1 4FTEA 1AR73 1DF0A 2WIIB 2HYKA 4B3NA 1K5MC 3ZSMA 2XH6A 3N4MA 2R0HA 5H9QA 1DQ6A 1LEMA 4R9DA 1LR5A 1NA1C 1S1AA 4X8PA 3TWIA 3AYEA 2DVGA 5T5PA 2SBAA 3OY8A 2PA7A 1V9U1 3WZ1A 4N9HA 1GQHA 4LBQB 4XOGA 3M8LA 4N43C 3UL2A 1OA2A 3MZHA 4CEYB 3GF6A 5GLUA 3U11A 2DCZA 2VW2A 1VAMA 3PMEA 1R082 3FBMA 5JPMB 4XFBA 1R092 2DCKA 3VBFC 2HWE1 1O3SA 1RUI2 3AZYA 1HRV3 4EWDA 4M3CE 1FOD3 1UPIA 4XETA 1UZYA 2ZGQA 4WM8A 3VBHC 4FXKB 4XMAA 5A32A 5IK8A 4FPFA 3WLUA 1CPNA 4A3XA 2XVLA 1YI9A 3AMNA 4E4ZA 3UKTA 4EN7B 4JDMA 4N90A 1W6MA 2PAKA 2ZGOA 4NHLA 1BMV1 2C5DA 4EROA 4L8QA 1AYN1 3M3EA 4WM7C 3U0ZA 5HCAA 3D6EA 3ZN6A 5HBAA 3H7JA 2CGOA 3WCRA 4BIOA 3MI8A 3KCYA 3VDDC 3R4SA 2YPJA 1V00A 4MXWA 2GN7A 4YFZA 1U5YA 4OI4A 2CY6A 4BCUA 5J48A 4XHXA 1XE7A 2O0OA 2DVAA 4YVSB 1EV13 3NAPA 3WT3A 2ZHLA 1Q43A 4Z92B 3VZOA 1UKGA 3LZZA 3I59B 2P17A 3AJYA 3H0OA 1ZZCA 4ZKTB 1WW6A 2WLPA 4E27A 2PFWA 2XB6C 3FLRA 4Q0PA 1UMZA 4NOTA 1C1LA 3J8F1 1NXMA 1WMFA 4XZPA 2K9ZA 1T6GC 5A3MA 3M3QA 4S2HA 5LRRA 4CDQA 2OZ6A 2YXSA 5JPNB 4L2NA 1RUD3 4JCKA 4AG4A 4WVMB 1ND3B 4DPNA 4LHNA 3FBYA 1FNYA 2RMU3 5DUUA 4XBLA 3P3PA 3WP6A 3WQ1A 4HFSA 1SLIA 3T1LA 5L19A 4YGCA 4ASMB 1NOVA 3MIDA 5GM0A 4Z8BA 4NPRA 2DYCA 2VPVA 5BNPA 4A7KA 4Q0SA 3KGLA 5D1IA 2OZJA 2WS93 1RUE2 3PNAA 1RUG1 4IXLA 4AVAA 1JYIA 2ARXA 5GJ6A 3E5XA 2DF7A 1NYWA 4FP3A 2VG9A 3AZXA 4LO6B 1WBFA 2RR13 1X36A 1VRH1 2EIGA 4QQOA 1KITA 5BNQA 1RTVA 1LRHA 1RUF2 3B9IA 2VNOA 1UCXA 4KGQA 4RFT0 3ZXJA 1Y3TA 5KHGA 4YW4A 4Y20A 4YYOA 3VHRA 3WG2A 1Y43B 3DGTA 2ET1A 1XNCA 1XRUA 4B7EA 4P14A 1N1TA 3RDIA 4YARA 4N53A 3S6PA 2WL1A 4E4SA 4EN6B 2ZTNA 4EWEA 2GH2A 2GC1A 3KSCA 4RGGA 1W6QB 2HWC2 5BY5A 4GA9A 2E51A 3TAYA 1LJ7A 2YYOA 5HI0A 3IKWA 2GMEA 5IT6A 5F1RA 4QPGA 5DDJ2 3ZIXA 3PMSA 3E97A 3GBWA 2QNKA 2JDZA 4B4PA 3NAPC 1PIV1 5CB7A 3RZZA 3ZXLA 4PCRA 1O7FA 4XILA 4CEWC 2AR6A 2GU9A 2A3XA 2KM2A 1KFUL 3BCWA 1XNBA 1R083 1RMU1 1R093 2R072 2ZA9A 3RYRA 2JD4A 2B9UA 4D3WA 4Y24A 3ILNA 4Q4Y2 4YGDA 4F8AA 3FUQA 1DU3D 1EP0A 2A73B 1VALA 2R061 2OUHA 2R042 1SLCA 4IEPA 3LGRA 3AJZA 4LNVA 4CDQC 4IERA 1GANA 1LKNA 2RS52 2WINB 2P3KA 4AHYA 1MS1A 1UD1A 3I54A 4M3CB 3ZXEA 2HJIA 2GZWA 2VMHA 1IPKA 4GWNA 3KCCA 5F6KA 2FZ2A 4CDWB 5GLWA 1DYPA 1GNZA 2R0FA 1LOEA 3LSDA 4YVWA 5JOZA 2TBVA 4U2AA 5JVVA 1OOPC 3PVNA 5I91A 4ZXKA 1VBE2 4LBJA 5GKAC 1QU0A 3WQ0A 4PIYA 3EHKA 4AVTA 2DVFA 1DFQA 2UWAA 3OJBA 3VKNA 4N7IA 1AR71 1FMD2 2JG9B 2ZPXA 4LE4A 1X82A 1VAVA 5J7MA 3N36A 1NZCA 1MZ5A 2GALA 4KWJA 1PVC2 1Q3EA 1RUOA 1C3HA 5D8AA 1WGPA 5KHKA 3BB6A 3BOWA 3GHNA 4OUSA 2CYFA 3IDBB 2OA2A 3PVEA 1LGNA 4XHBA 3SNMA 2WZR2 4CDXB 4O9GA 3APBA 1PMIA 4EWAA 1V6KA 2XPJA 2B8MA 2ZX3A 4Q4X3 2VOKA 1AHSA 3JQXA 3KT4A 4FOQA 4PLMA 4FBFA 4IEWA 3SCGA 1DQ1A 1PK6B 1ENRA 1OI6A 1XYNA 2CTVA 2H0VA 3FHIB 5T54A 1H1AA 3RS6A 3ZSJA 4B4QA 1RUE3 1JBCA 2E7TA 1YWKA 3VDDB 3G7DA 2MNGA 5JMCA 2DCTA 3JB8A 3WG4A 1HRV1 3H9AA 1IS4A 3MFCA 1FOD1 1H8TB 2Y38A 4LULA 1G9AA 4JDNA 1S2BA 2E53A 4Q0QA 1RUF3 2JE7A 3L2YA 3ZSLA 2D43A 2JECA 5IK4A 4BLJA 3FE5A 1B09A 4RR3A 1Y9QA 3AKSA 2FMYA 3AP6A 4XPVA 2DUPA 4DOUA 3WDUA 4M00A 1VP6A 4GKXA 4PF5A 4IEVA 4RSUA 1Z0HA 1RVF1 3ZO0B 1MQTA 2QDRA 5FDBA 1RITA 4LO5B 2BYVE 1MVQA 2Q5TA 3FLPA 3UKNA 4GXLA 2F4PA 4RHV2 5E8AA 4LUKA 3RJRA 4KG8A 3AP4A 4M01A 1LGCA 4AYUA 3HAGA 3VHPA 3WV6A 2WFF2 2D3RA 4YW3A 1KD7A 1QJU2 4DMIA 4GMP1 4XYXA 1EV11 1PO23 1ZRFA 1FYUA 4YVWC 3S0MA 1YLLA 3AYDA 2JEMA 1OFSA 2MHFA 5DDJ3 5HXVA 1S55A 2GNBA 3VBUB 3TBDA 2XLAA 1RUH1 2IFWA 4IETA 1TE1B 1TQ5A 4XIOA 5ACA2 4UW3A 3ZPYA 4YG6A 2PAEA 4QD2A 4OI0A 1MS3A 3MPBA 4XE9A 3I8TA 4R9AA 4ONUA 2R073 5DXDA 5L7OA 3GBGA 4I0WB 4E9KA 4Q1PA 4N7UA 4Q4Y3 1W6OB 4Y4YA 2XJRA 2SLIA 3IBMA 1CR7A 4D69A 5D8AC 4AI2A 1U5IA 1AVBA 5BPXA 5DZFA 3WCSA 3VUOA 2XHKA 2BFUL 2RS53 4KG0A 1KS4A 2DUQA 3TN91 2CNAA 2DFBA 2WS91 1S0DA 2XGXA 5FMOL 3V56A 4X8NA 5A3LA 2D6OX 3M7AA 3N35A 1LHUA 2ZGPA 2R30A 2RR11 3FWEA 1HX6A 1LTEA 3AKPA 3OD4A 4CTEA 2XLFA 5BNNB 3E6DA 5FTTC 3ELNA 4EN8B 1EAH2 1VBE3 4K8FA 4QQLA 4WBBA 1M06G 1CX4A 1I6XA 2OUJA 4MX3A 3SITA 2UYAA 3ZN5A 4KL1A 2AGSA 4OI2A 4P9IA 4BH9A 4CZSA 2A5ZA 4CEWB 3CNAA 2AREA 4WVMA 3VL8A 2XKPA 5L36A 3FX3A 5I8TA 2BVBA 4QQHA 4RR3C 4W6YA 2VOXA 2H6BA 2AENA 3CU7A 3ASIA 4K20A 4LBQD 5ABJA 1GZCA 1EY2A 1QGLA 2BNMA 5KWRA 1PGSA 3ZFGB 3NKTA 1LESA 1N1SA 1TMF2 2WNVA 2WZR3 4RS5A 1SMVA 1DGWX 3CEWA 4MVTA 3VBSA 2CAUA 4ES9A 4AEDA 5C4WB 5AC92 1V6OA 2JE9A 2XJQA 3AMMA 2X5IB 2WSUA 2IXKA 2P2KA 2TUNA 4AVVA 5C9AA 4QPYA 2B39A 1R091 3ILFA 3TNQA 1APNA 4MV2A 3BODA 1G7YA 1XXNA 5FO9B 4IL7A 5KXDA 2Z69A 5LK5A 1PGL1 3O5SA 1FX5A 1SLBA 2XVGA 5CFCB 5L7OC 1OKQA 1PO12 4YZ4A 1OFNA 3ZN4A 1C4RA 2YV8A 2PHLA 2A7AA 2HWF2 1A6CA 2WQ4A 5EXOA 1NCQB 1H8VA 1QJY1 3JBG3 5JZGC 2A6VA 4K3UA 4RHV3 2VNGA 2ZX2A 1H4GA 1VBB1 2A70A 3AFKA 1VIWB 3MIHA 2WFF3 3D82A 4XJ9A 1AR93 3AZWA 4C0BA 4XFHA 1COV2 1Z7S2 1IS3A 2EVXA 1DQ0A 3ZXDA 1G86A 2ZOEB 2YGMA 1J3RA 1OMIA 4YW1A 2AYHA 1QDOA 5ACA3 4YM0A 1X7NA 1BEV2 4AI8A 4AGGA 1G6NA 1QWRA 2E9QA 4AFBA 2VVEA 2D6NA 1DQ2A 1KQRA 4Y22A 3WUDA 3RQ0A 5LK7B 3ILRA 4XTMA 4XXAA 1W6PA 5BNOC 4XDQA 2YY1A 4FPOB 1ULFA 1TME2 3E5UA 1H1MA 1WW7A 4Q4X1 4HN0A 2G4IA 3D8CA 1NE6A 2RJKA 3J26N 1VJ2A 5FQ0B 2OPKA 2WNVC 1CPMA 1YO8A 3NKGA 2ARBA 4RS5C 3WW4A 1WCSA 2I74A 2BGCA 1RUE1 3O12A 2VY0A 4LA3A 4JGZA 4XF9A 1CVNA 4AI1A 2ZGSA 4AEDC 1VAKA 4ZU5A 1X50A 3QCWA 3S7IA 4QGMA 2ZHKA 5C9AC 4E4DX 2ZMKA 1RUF1 2Z79A 3ZFEA 4ZU4A