4BMBA

Crystal structure of the n terminal domain of human galectin 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-8
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Natural Single Amino Acid Polymorphism (F19Y) in Human Galectin-8: Detection of Structural Alterations and Increased Growth-Regulatory Activity on Tumor Cells.
pubmed doi rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bmbA00
3MEPA 4XBLA 2JKBA 1N1VA 2ZGOA 1FNZA 1H9PA 1AJOA 2FMDA 1WUVA 1F5FA 4GA9A 5HCFA 2ZBJA 4YZ5A 4Y1UA 3WOGA 1UAIA 3WG3A 1RIRA 3RSJA 1LOFA 4M01A 1Y7BA 1SCSA 4ISQA 1N3QA 2P34A 1LOBA 3WDVA 4KBBA 1DFQA 2ZKNA 2VW1A 4WVWA 2ZHMA 4CRQA 3A0KA 3OYWA 4FOVA 2ZHNA 4AVTA 4YGCA 3M1HA 2D6MA 1DQ6A 1DHKB 1FX5A 3BIWE 3IN9A 3USUB 3RMYA 2GNMA 2P3KA 1IS3A 1WLDA 3FLTA 4Y20A 1N1SA 1S0FA 3OBRA 4FPOB 3AK0A 2A71A 4M3CB 2E7QA 2Q5TA 5T5LA 4FQZA 2V5YA 1IS6A 4LBKA 1SFYA 2ZGSA 4AVSA 2ZGUA 4U2AA 3M3QA 1UX6A 5DUUA 2ZMNA 3O5SA 3AZVA 1CN1A 3VKOA 4PBOA 2A3XA 2EXIA 3MW3A 1MZ5A 3MW2A 5E88A 5GM0A 2CWSA 3TB0A 1AX0A 2DU0A 1HKDA 4FPHA 4AWDA 1JXNA 1JHNA 3AXDA 3AP5A 5GALA 1CIWA 5CBLA 1V6IA 3R4SA 1SACA 4LBNA 2WT0A 3D6EA 1LOEA 1LULA 1F9KA 1CONA 1W6NA 3N3HA 3POYA 1QKQA 3AZWA 1KDKA 1WW7A 2PHTA 4K21A 5LK5A 1LEDA 5T55A 2P2KA 2YZ4A 2ZA9A 1LEMA 2DUQA 4UW5A 1NLSA 1SBEA 5E8AA 1W6PB 1S0IA 2JD4A 5EYYA 4YG0A 4XMIA 2TEPA 4YW5A 4BLIA 2OUJA 3OY8B 1Q8PA 4YM0A 2HYKA 1IS5A 1ONAA 1N1YA 2ENRA 3ILRA 1Q8OA 4K20A 2E7TA 3OGGA 5F9TA 1H9WA 2EIGA 3WNXA 1GSLA 5FREA 2R1DA 1G9AA 3AFKA 2ZGNA 4GWNA 2R16A 3OYWB 1LHOA 3POWA 3WG2A 1CPMA 4FOWA 3I8TA 2WJSA 2EXKA 2VW2A 2VU9A 2W52A 1QF3A 4JCKA 4OZXA 3KM5A 4Q27A 3RRDA 1G8WA 4XBQA 1SBDA 2ZMLA 1RITA 1W0OA 4Y26A 3WHUA 1OFSA 4ATFA 1GNHA 2BQPA 1IOAA 3A4UA 4Y22B 3WG1A 4ATEA 1W6QA 1YYNA 4R9BA 3I4IA 1NXD1 3LSEA 3AJYA 1MVQA 1W6OB 1X50A 4M00A 3SLIA 1YRZA 2OUHA 3SNMA 1QMJA 3FUOA 5H9PA 4F83A 3V0AB 1N3PA 2YROA 2P37A 3PVEA 3SH5A 1C57A 1MACA 2SLIA 4YM3A 5IT6A 2ZGMA 1UPSA 2A70A 4XTMA 1I1EA 1V6KA 1W6MB 1Z0HA 2V73A 3V0BA 5T50A 4XIOA 1DLLA 2ZGLA 3AYAA 3M3CA 1MS3A 1WBFA 3JUUA 1BJQA 4WV8A 3VKFC 2WNEA 3HR9A 1LHWA 4Q2FA 1DQ0A 4AYUA 4HL0A 2LALA 4YZ1A 1LOFC 1QDOA 3WLUA 4BMEA 5GLUA 2B7YA 2A6VA 1FV2A 1CJPA 2D6LX 2DUPA 2GNTA 2OVUA 3HMYA 4LBMA 4YFZA 1IKQA 2NMOA 1WCSA 1KQRA 3AYEA 1G9FA 4FPLA 1QOTA 1AX1A 1YI7A 1JYIA 1V6OA 3AYCA 1WW6A 1HQWA 1UMZA 4XJ9A 2A6WA 3USUA 4FP3A 3RS6A 2GMPA 2ZZJA 1W6OA 3V65A 2AUYA 1HDKA 2PHXA 2A6YA 2W68A 1MS1A 3GALA 4ZXKA 2PELA 1LTEA 4MYEA 4Q1RA 4Y22A 4C1WA 5GZCA 4LBOA 1JYCA 4Q8LA 1SLCA 3AJZA 2PHFA 5H9SA 1V6JA 5JOXA 2EALA 5CNAA 3O0VA 4YW4A 4U36A 1LODA 3T1MA 1VAMA 2ARXA 1MS5A 3PMEA 1FYUA 5JOWA 1QDCA 3C2UA 1ENSA 2GMMA 3WDXA 3ZVXA 1G9BA 1DIWA 1W0PA 1XQNA 1OQ1A 1MS9A 4BM8A 1CPNA 1AVBA 2DVBA 1DQ5A 5DXDA 3N7JA 3VKNA 3AYDA 4FPGA 4CTEA 5DUWA 5JOZA 1Q8SA 2PHUA 4FPCA 2A5ZA 4XXAA 1MVEA 4HANA 1Q8QA 1UKGA 3UL2A 3AXEA 2D43A 5AVAA 5JDBA 3VKLA 2GDFA 1AXZA 2I2SA 3B9CA 5GZDA 1Q56A 3VKMA 2CTVA 1BKZA 2GN3A 1SLTA 3L2YA 1KRIA 1LU2A 4Y1YA 2EXHA 2RHPA 2WSUA 2YV8A 3B01A 5IK8A 2E6VA 3O12A 2AREA 2DVGA 2UU8A 3SITA 1VLNA 3R05A 4DRVA 3OPZA 1HQLA 2ES3A 1N3OA 1AZDA 1SLLA 1DBNA 1DGLA 3IKWA 2VW0A 3TAYA 3FFZA 2ARBA 4XYXA 1ZM1A 1ULDA 1QU0A 3BTAA 1PZ7A 4XJWA 5IUQA 2R1BA 2NM1A 5BYNA 5KXBA 2ZABA 3NV2A 3AP9A 1ULGA 4ISRA 5L73A 4FP2A 5E89A 3RMXA 1C1FA 3OBTA 3VV1A 2DTYA 2ZGQA 4YW2A 1SLIA 1S0DA 1J1TA 2JECA 1LGCA 5GLVA 3V0AA 1BXHA 3BODA 1LCLA 1S0BA 5EYXA 5DUXA 1JUIA 2ZGTA 2ZGKA 1FATA 1JW6A 2A3YA 3H0OA 1GV9A 4M3CA 4YW3A 5JVVA 4TYSA 3NV4A 3M2MA 1BYHA 1WW5A 4IQPA 3SH4A 1MR5A 1Z78A 2NZ9A 4XJ8A 1QOOA 5GLZA 2VY0A 1W6MA 4FPKA 2AENA 2CNAA 1GICA 4LBQB 2H0BA 5IK7A 2D6KA 1G7YA 1DYKA 4YZ2A 4YZ3A 1D2SA 2DUOA 4YM2A 2YMZA 5KXDA 4AGGA 2DVAA 4GXLA 2LTNA 1ENRA 1R1ZA 5DG2A 5GZGA 4UW6A 4LBLA 1B09A 2A7AA 1QGLA 2UURA 4P9XA 1CR7A 3O0WA 1A78A 3ZSMA 1WLCA 1HLCA 2A6XA 1DQ1A 3ILNA 5T52A 5T54A 1VALA 2DV9A 2NP0A 4BPZA 4ZKTB 1S1AA 1TEIA 2R0FA 2ZGRA 3ZSJA 3WDYA 1DYPA 2DTWA 4PQ9A 5KXCA 4NO4A 3AX4A 4YGDA 1LHUA 3INAA 1SLBA 5HCBA 3QCWA 1S0EA 3QLQA 1OKQA 3ILFA 4XXPA 2AGSA 3ZXEA 4XJZA 4YGBA 4YG3A 2AH2A 2CL2A 2C9AA 1KJLA 1S0JA 4K1ZA 2UWCA 3M3EA 4P9WA 2NN8A 4W65A 4XBNA 2G4IA 4LBQD 4XIKA 1AX2A 1CESA 2DVFA 1S0CA 2VXRA 4GKYA 3NV1A 4RA0A 4XJUA 1JN2P 3N35A 3FLRA 3WCSA 3WG4A 3WDUA 2WSVA 2YY1A 1AF9A 3ASIA 3ZYRA 1LECA 3ZYPA 1YIFA 2GN7A 2ZAAA 4NOTA 4FOYA 1GZCA 1YXWA 1ULEA 1GZWA 3B3QE 5JLVA 1LGNA 1SLAA 5DG1A 1QNWA 2JJ6A 3ZXJA 1G9CA 1LOCA 5F5QA 2E51A 3PVNA 2A3WA 2Z42A 4FQ4A 3AP6A 1MS8A 5GZFA 4C1XA 3N7MA 3R4UA 1C4RA 4XZPA 2GNBA 3KQRA 1AJKA 2GNDA 2UWBA 1O4ZA 3LSDA 4FPJA 4GALA 5CA6A 4ITCA 2D3RA 2ZMKA 4LBJA 1W6PA 4FPEA 1MZ6A 4M3CF 1DZQA 4SLIA 4JC1A 2YXSA 1LOAA 1VAVA 2D6NA 1V6MA 5JOYA 2JDZA 4H55A 4R9DA 2JE7A 1GKBA 5T5PA 1W6QB 4K1YA 3FLPA 3UK9A 1MS4A 3OJBA 3ZXFA 1IKPA 3BOPA 1ZA4A 1MS0A 1V6NA 4UW4A 1JBCA 2ZHKA 1G9DA 4WZFA 3T2TA 1ULFA 4YGEA 2ZACA 1Q8VA 4YW1A 2P3IA 2EF6A 3LCPA 3N7KA 2WLQA 3AP4A 4PCRA 1VIWB 2ERFA 4DS0A 2WQZC 5DZGA 2XB6C 1S0GA 4XHXA 3NWKA 2D7FA 4YG6A 1CQ9A 1O4YA 2OW4A 3ZPYA 1C1LA 1BQPA 4UW3A 4FVVA 4L8QA 3V0BB 4P9YA 1APNA 4GKXA 1FNYA 3N36A 1GLHA 4Q1PA 4BLJA 1IS4A 1LGBA 4R9AA 5EWSA 2KM2A 3MPPG 4BOWA 1SBFA 3CNAA 3W58A 4WVVA 5H9QA 4YZ4A 3VUOA 1EPWA 2JE9A 2R0HA 2DURA 1GZWB 5IK4A 1AXYA 1URXA 5FRAA 2E53A 1WW4A 1YO8A 1UZZA 2WKKA 4Z8BA 2PHWA 3IMNA 2DYCA 1U0AA 4XJAA 2ZHLA 5DUVA 4Y24A 1KJRA 2NMNA 3U4XA 1AXKA 4XHBA 1LJ7A 2FHRA 5CAZA 1QNYA 3B00A 4DFSA 2XG3A 2CY6A 3OY8A 1GYKA 3UJQA 2D6PA 1DQ4A 2CYFA 3POSA 3WVJA 4DQAA 3A0NA 4Y1VA 1KDMA 4FPYA 3FBYA 4AGVA 1LESA 4JRAA 3SISA 3GNEA 2W08A 4TZDA 3PJQA 3PVOA 1GNZA 1FV3A 1WD4A 1LU1A 2VUAA 3Q9OA 1H30A 5IK5A 3AZYA 3B69A 5GJ6A 3WHTA 3SH3A 1GZ9A 3ZSKA 3WUCA 1UZYA 1JOJA 4ASMB 1ENQA 3T1LA 3NV3A 3RG0A 3IPVB 1LHNA 4YFWA 4XE9A 1LHVA 3ATGA 3V64A 3M3OA 2NYYA 1D0HA 1A3KA 4CZSA 1SCRA 3APBA 1ULCA 3AZZA 2DVDA 3D4KA 3O0XA 3UJOA 2WT1A 2ZGPA 3HN1A 4Q8KA 2CWMA 3WUDA 5KXEA 5GLTA 2GALA 3WDWA 3WV6A 4YM1A 1W6NB 2R49A 3IM0A 4DPNA 4FPFA 2C5DA 2D6OX 1WD3A 2GMEA 5DZFA 5HCAA 4PBPA 3WZ1A 3ENRA 1LENA 4P14A 3WCRA 2VH9A 1DQ2A 3D5OA 5GZEA 2D44A 4AVVA 1RINA 4I30A 1PZ9A 1QOSA 1WLWA 1N1TA 4FOQA 2EAKA 3W59A 1LOGA 3IPVA 4XDQA 1PZ8A 3ZSLA 4RL7A 2D3SA 1BZWA 4Y20B 2D3PA 2DWRA 2WT2A 4PF5A 4YLZA 1A8DA 4BMBA 1FAYA 4XOGA 5DZEA 4XILA 1N47A 3FUQA 2EXJA 2P3JA 2PHRA 1F31A 4Q26A 3WDTA 3DUIA 5T5OA 3ZXKA 5EXOA 1UN1A 5GLWA 2SBAA 4LBQA 1WBLA 2AR6A 3JU9A 4Y1XA 4GWMA 3RQ0A 4M3CE 5SV8A 4BQ1A 1G86A 1I3HA 1V00A 2A6ZA 1GBGA 5T5JA 4AGRA 3AP7A 4R9CA 4DRRA 2W39A 1CVNA 4XTPA 4XMAA 2A75A 3N7LA 2AYHA 4D69A 3MW4A 4Y1ZA 3AZXA 1V6LA 2DU1A 1KITA 3ZXLA 5JMCA 5H9RA 2UWAA 1GANA 3DGTA 1UL9A 5CB7A
chains in the Genus database with same CATH superfamily
1OQDA 4XDOA 5A80A 2W9XA 2ZEZA 1Y4WA 2VNRA 3JBG1 5FPXA 1FNZA 4CEWA 1AJOA 1D4VB 1XYNA 2OS2A 4B4QA 1SPPA 1W03A 1Y9QA 1OMIA 4QXKA 1XOYA 3J8F2 4AL9A 5C8CC 1NCQA 1QHDA 1UAIA 4XFAA 5ABJC 1CGPA 1J3PA 2PHDA 5FZKA 5FR3A 3RSJA 4MGTA 1LOFA 5FLJA 1Y7BA 1VBC3 4WVMB 5FWEA 4ET7A 2QQNA 3WDVA 3OUHA 5DDJ2 5JXGA 2XVKA 1RL3A 4GZ9A 1RVF3 1HN1A 1O3TA 3FL7A 1XNKA 1RHI1 1XU1A 2ZHMA 2GC0A 4FOVA 2ZHNA 3LD8A 4AVTA 1R092 2D6MA 2XJVA 5A3WA 1FX5A 1NXMA 3LIHA 5DPNA 4AHXA 4RGAA 2PN5A 4IL7A 1X33A 5KWRA 2A71A 5L9BA 4CXXA 4Q4W2 2F17A 2Q5TA 1O91A 5CZKA 3SKVA 2HWF2 4O61A 2JIJA 4CDXA 5CFDB 1W39A 4JHZA 1W9WA 3MUZ1 1MEC3 1UX6A 1W8FA 2ZTNA 4AI1A 3O5SA 1AR83 2YC4A 3VKOA 1RUI1 4ZONA 2A3XA 3LAGA 3I59B 2VG9A 4BCUA 4N43A 3JD71 3VD3A 4H14A 1AX0A 1L7RA 1XSRA 2WAOA 2XUEA 3EQEA 5C6CA 2OYZA 5A6YA 2B4KA 4QAWA 3AP5A 1YJLA 4DXZA 1F4HA 2IC1A 5LA0A 1V6IA 1SACA 2JG8B 2WS93 2WT0A 3D6EA 1AYM2 4AXOA 3GJBA 3N3HA 4BQ2A 1QKQA 3AZWA 2GU9A 1WW7A 2PHTA 4JDNA 5LK5A 2XQXA 1LEDA 3GJAA 3LOBA 2E9QA 5T55A 2P2KA 3HAGA 1ZBE2 1YFWA 1PMHX 2B9UA 3POBA 4EN7B 4NWVA 4JQTA 4SBVA 1LEMA 3SXWA 1Y9MA 4BISA 3VDBA 1BK1A 3UKNA 1SBEA 1W9TA 5E8AA 4QHOA 3C7FA 1V9U2 3K51A 1DF0A 4YG0A 3EB7A 3MZHA 3LWCA 3TEZA 1NQDA 5K7PA 2Z2SB 3TBDA 1RUI2 2PAEA 3PUIA 1Q8OA 3FHQA 3KT4A 4FFHA 4QQPA 5F9TA 1H9WA 4AI0A 1G9AA 3ZMNA 3AFKA 2Q30A 5FYTA 5I8SA 1YQ5A 2OPWA 4P9JA 2R16A 4RQPB 3K2OA 1LHOA 1QJX2 1OI6A 5FZMA 3I8TA 2WJSA 1VBC1 2EXKA 3DEMA 1SDDB 1CX4A 1ULOA 1VAKA 4LK7A 4COUA 4JCKA 4OLLA 4OZXA 3KM5A 4CEYA 2VNVA 4AHWA 3RRDA 3MBWA 2JWPA 1WGPA 5LB6A 4AVCA 4ATFA 1GNHA 1QEXA 3KF3A 4WM7B 4AOCA 5CEHA 3O1PA 3A4UA 3B93A 2WNOA 3GHNA 2IXCA 4LO8A 1W9SA 1EV12 4R9BA 2CAUA 4CVUA 1IPSA 4UFJA 3GHMA 2PLV2 1NXD1 5L19A 5A7QA 2W1WA 1ODNA 2LROA 2WFF1 3WP5A 3ZLIA 3SNMA 4CDWC 2RJLA 3FUOA 5BNNB 5BNOB 2RM21 2RS11 3V0AB 2P37A 2YDEA 1CJDA 3N9LA 1PO11 3N9OA 1RUC3 3DN7A 1V9U3 5FPLA 2VMEA 3WNPA 2SLIA 1VB2A 2I07B 1U5YA 3A21A 2VD7A 5CU1A 4CPBA 1I1EA 4N53A 4WM8C 4XACA 1Q5OA 2WABA 2X10A 4GB31 1VBB2 3KV9A 4QX1A 4CDQA 3H3ZA 2V73A 1PO23 4M4PA 4LNVA 3V0BA 1UOGA 5T50A 1FOD2 4OYUA 4CCKA 4ZXEA 3AYAA 1JI6A 4Z92B 4CEWB 3O1VA 4W8JA 1PGL1 3SQOA 1DQ0A 5ABJA 2YG0A 4HL0A 2LALA 4YZ1A 1AL22 1LOFC 3HNBM 2A6VA 1FV2A 3WF4A 3PURA 4LIVA 4RHV1 3TEXA 1JH5A 1W90A 1TQ5A 4FCAA 4LBMA 3VZJA 2OX0A 1WCSA 3SKJE 2VZ1A 4FPLA 1AX1A 1M4WA 1YI7A 2UY9A 1JYIA 2X8KA 3IMMA 4N7UA 1FPN1 1HQWA 1UMZA 1WCUA 2VTFA 4HG6B 5FYCA 2QQPA 2HBUA 3USUA 3ZR6A 4CU8A 3RFRA 4J1XA 5FQ0A 4CEYC 1HDKA 1UXXX 1XYOA 5FMOS 3J8F3 5FZGA 3GALA 4Q1RA 2BV4A 4KWJA 1UU5A 5AFEA 2BPA2 3AJZA 5H9SA 2EALA 5CNAA 4MXVA 2RDQA 4EZHA 2ZX2A 5A6ZA 1ND3B 1O7FA 5ANNA 1HXS2 3J4UH 1VAMA 1MS5A 2XBO1 2HEYF 1K5MC 1VBD2 3CL1A 1ENSA 1PM7A 1VBB1 2V4VA 3DECA 3MF9A 2VTXJ 5A7OA 4CDWA 5F3GA 1RUNA 1FT9A 1OPOA 1UCXA 3WNMA 1OQ1A 1EPZA 4C8DA 2VMHA 1CPNA 3MPBA 1NG0A 4UF0B 5HI0A 2DVBA 2RM22 2RS12 3WEZA 3ROUA 1BBT3 5DAQA 3MFCA 1CAVB 2WNUC 2JE8A 4QPIB 2WZEA 1Q8SA 4QKFA 3TWIA 3WR0A 4NJ4A 1ULPA 2D43A 2WL1A 5JDBA 3KT7A 2RV9A 5GZDA 1UY2A 3L9JT 1CAWA 2R6QA 2CTVA 3DKWA 1BKZA 2GN3A 3E97A 3WF3A 4JGZB 5IVVA 4QPGC 1U5ZA 1LU2A 2ARAA 2ZEYA 2XH6A 1QQP3 5L7OB 2WSUA 2XDVA 4ZU5A 2MHFA 3FHIB 4LQRA 3BVCA 1QWRA 4E4ZA 4NIHA 1UPIA 2E6VA 2AREA 3JB4C 1ZBA2 2YU1A 1ALYA 4IGPA 2RDSA 5C5UA 1RUD1 2VW0A 5FZ4A 1JOBA 1NLRA 3H3UA 1PZ7A 5IUQA 3FN9A 2IZWA 2W91A 2VM9A 2NM1A 4LHLA 1PMJX 2XHKA 1PIV3 2WZR3 2XLAA 2Y6JA 2ZABA 3AP9A 2O0OA 3NV2A 4RS5C 3O1TA 4AQTA 1VMFA 3W5MA 4CPBD 2HWC2 3VV1A 1OLQA 1SLIA 1S0DA 1BK0A 1J1TA 1BHGA 1LGCA 2OT7A 5GLVA 3WNKA 5B2GB 1S0BA 5C33A 5DUXA 3BU0A 2QCSB 2ZGTA 4D6SA 4KU7A 4Z1VA 4O9EA 1YUDA 4YW3A 4P9IA 4ZS3A 3M2MA 1NZCA 4IQPA 1MR5A 1W2AX 1Z78A 1QOOA 3B02A 3N9MA 2VY0A 4D6RA 3POGA 4AEDC 3MIEA 4OFGA 2BOIA 2J1UA 1GOHA 4NIAA 1QQP2 2WNUA 5IK7A 1DYKA 2JEMA 4YZ3A 1GP5A 3MICA 5JXIA 3F95A 4XAAA 1RUD3 2LTNA 3C7EA 1R1ZA 1YQCA 4K7JA 4E27A 3ACHA 5IVEA 5IVFA 1ODMA 1OKOA 2A7AA 4JKMA 4LBLA 4P9XA 1OPMA 1WLCA 4G9SB 1HLCA 4MVTA 2YC2A 2CGOA 3IWZA 1D7PM 2JXAA 4ZZ5A 4FTEA 3URFA 5BXXA 3HBKA 3JD72 2LM3A 2V09A 3WDYA 1TMF3 1NZIA 2DTWA 4C0HA 4X6QB 2D5HA 4W6WA 4BHPA 4DO0A 5IW0A 3INAA 4QU1A 1UU4A 1KXGA 4JRLA 2J1TA 3C8XA 4L9BA 2UY8A 4PDWC 4UI9L 4WBBA 4XXPA 3ZXEA 4YGBA 4NRMA 3Q8FA 4BXFA 4LMFA 5FZAA 1YC61 2N7GA 2NN8A 3NJZA 4ZU7A 3QD6A 3GBGA 3K75B 4XIKA 1AX2A 5KHJA 2DVFA 1S0CA 4E2GA 4XJUA 2RS33 1JN2P 5FP3A 3WCSA 5IATA 1H2LA 2FDJA 2GN7A 4KWKA 4NOTA 4CP9A 3PU8A 3VBUC 1SFPA 5BNPA 4A2UA 3NO8A 2F4PA 2RS52 3B3QE 3C7OA 3B94A 4DOUA 1A8MA 5A7WB 3NAPC 2VZTA 2AC1A 1G9CA 1LOCA 3PVNA 2G19A 2JDYA 4P02B 1MS8A 4OHVA 3J8F1 4A3ZA 3NNGA 3RPQA 3ETPA 1AJKA 3AKPA 3H1MA 2UWBA 4GALA 2YPJA 3IDCB 4RR3B 1ZZ9A 2D3RA 1VRH3 5FLIA 1OLME 4BB3A 2Q8EA 4LBJA 1OLRA 5FYZA 1NCQC 1OBNA 1MZ6A 4SLIA 5FP8A 1R1A2 1FXZA 5FK8A 4BIOA 3D0SA 4YARA 4MGIE 4A7KA 2CDPA 4KNCA 2Q0AA 5FUIA 4CCOA 1C8NA 1H0BA 1YIPA 5JOYA 2RS31 2ZX3A 4AFMA 5FXVA 4R9DA 1VRH1 1RJ7A 1W6QB 4NHMA 4PHZA 5CYYA 3DXUA 4IEZA 3GBFA 4PJYA 3VHOA 5FZLA 3WP4A 1MS0A 2MPFA 5FY5A 5FYMA 2DCKA 1Z7S2 3I2KA 4K8FA 4OQ9A 4BIFA 2W3JA 2VOTA 2BZDA 2VJXA 2EF6A 4GB33 2JENA 4JTNA 3N7KA 2PAMA 4PCRA 4YWAA 4DS0A 5IFTA 3D82A 2R32A 2XB6C 5FXWA 3UNPA 1WMDA 2D7FA 3E5QA 4UBGA 2OW4A 1NY72 1O4YA 2TBVA 4PT6A 3ZPYA 1BQPA 1UZ0A 1XC6A 3ITQA 2OXBA 2YU2A 1QY4A 3HOBA 3V0BB 1PVC2 4GKXA 1PGL2 3NNJA 4A7YA 1U5XA 3CDZB 4FI9A 3LB9A 5AC93 2AACA 2W47A 2XUMA 2VCMA 4B8EA 3CNAA 2BEOA 2CSGA 5BNOA 3WY6A 5H9QA 2P3YA 1JZ2A 3VUOA 4X6RB 3AVRA 2DCZA 2VOWA 1PO12 2K2SA 2VMIA 5IK4A 1AXYA 2HWE3 1URXA 1TVGA 2WINB 2E53A 1F4AA 5CFDA 1ZA7A 3IMNA 3HQUA 1NX9A 2ZHLA 4OULA 1KJRA 4Y24A 5C70A 3BIEA 3NMBA 1EAH3 3VN4A 4GAZA 2B45X 4LKDA 5A7NA 3VBRB 5F1RA 4QB6A 3UJQA 1PX3A 2HWD3 2HWE1 3WW1A 1HB1A 4IERA 3LA3A 2CYFA 1OH3A 2VCAA 1XE8A 4QMAA 1KDMA 4NPRA 2RM23 2RS13 5FMCA 1UNBA 4JRAA 2X5IC 4HBNA 1GNZA 1WD4A 1LU1A 5F32A 1H30A 2VCBA 3AZYA 5GJ6A 5EQUA 4FSJA 1GMMA 4YW6A 1T6GC 1XXNA 2P5BA 1UX7A 1JOJA 3T0DA 2H0VA 1ENQA 1PHMA 2IVIB 2OIIA 1W05A 3RG0A 3K46A 4QB1A 3B7MA 1LHVA 1OT5A 2JB4A 3GDBA 2FCTA 3M3OA 5FOBB 1HRV3 1D0HA 2VMFA 1A3KA 3NKTA 4QX7A 4OMDA 4CZSA 1NLQA 5M0TA 4QHBA 4RQPA 4DINB 3AZZA 4O7XA 3UJOA 1W0NA 2W87A 2WO2A 3MYXA 5GLTA 3WV6A 3J9SA 3VBRC 2R49A 1FMD2 1R1A3 2C5DA 2GMEA 3WZ1A 2J42A 3WCRA 4BZ4A 2VH9A 3VHRA 5BNPC 2ET7A 1CD3G 3GZEA 1IPKA 3PUSA 4XDQA 4RL7A 2D3PA 2WT2A 4GMP0 5F37A 2DBIA 1ZZ7A 1RUH1 2HWC1 2XXZA 4QT6A 2EXJA 4BQYA 4IEUA 4YNIA 2PHRA 2VAUA 3WDTA 5J96B 1RXFA 5T5OA 3MLKA 2XR4A 3VL8A 4QM8A 2SBAA 5CFCA 2AR6A 4BQ1A 5SV8A 1J3QA 5KC6A 4MXWB 1I3HA 1V00A 1JZ3A 4LKFA 2QZ3A 4IE4A 4YVWB 4XTPA 3N7LA 4BH9A 2GC1A 2DF7A 3MW4A 4YW7A 1KITA 1UZWA 2DCTA 5JMCA 2VOVA 2VVFA 4A45A 4HXCA 3QH6A 4CDXB 2RDNA 2K9ZA 5CADA 2ATFA 2CGNA 1WUVA 3K3OA 1VBB3 2L9LA 1C28A 1F5FA 2QJVA 2XJTA 4GA9A 1QJFA 4V1PA 5FYHA 4AAPA 3MV01 1KS5A 2Z4FA 4LUMA 4URAA 4Y1UA 3WOGA 4MXWA 3RZGA 1ZX5A 4PIZA 3ZFFB 1RIRA 3T08A 4M01A 2I74A 4ISQA 1K42A 3Q8AA 4Q0VA 1LOBA 4QQLA 1ZZ6A 4H2AA 2QE3A 3ON7A 4MOAA 3LDRA 4KU8A 4LLOA 3ME2A 2IXJA 3P3PA 1JYXA 4D3WA 1X8MA 5C3OA 4K8RB 3S5AA 2GC2A 3SEPA 4K3UA 3WF1A 1CX1A 1NY71 1XRUA 2BJSA 3M1HA 1T2XA 5LRRA 1R64A 2FDHA 2EICA 2GNMA 4Q4Y1 3OBRA 3AK0A 2XMLA 3WSOA 3N9QA 1YQ2A 3E5UA 3M70A 4M3CB 1SPPB 3WF2A 1W8ZA 2E7QA 3WW2A 1HRI3 2H6BA 2VVDA 4HVRA 4CU7A 5FXZA 4FQZA 1LKNA 4XFIA 1IS6A 4LBKA 3CLPA 5A32A 4NRQA 2EAAA 5LWBA 1AR92 4G3YC 4EZ4A 5JMOA 5LASA 5C9AB 1CN1A 2YGLA 3RJ2X 1WKYA 1Q43A 2HWD2 4TWTA 5GM0A 2EXIA 5FZHA 3MW2A 4BK4A 5E88A 2CWSA 1UYXA 1QJY1 2A1XA 3TB0A 4MADA 3H7JA 1HKDA 2MNGA 4AWDA 5A3PA 4JZRA 2ZX1A 3THCA 4LXLA 1MQTA 5CBLA 4XUNA 1PO13 1XYPA 4LBNA 2RVAA 4BE3A 1R083 1CONA 4HSLA 3PUAA 5I0RA 5K0UC 1RC6A 3MIGA 1MEC2 3EXUA 4Q4Y2 3ZM8A 1SZBA 1XNCA 1BBT2 5I0DA 4CCMA 1BMV1 2J1VA 2ZA9A 3OPWA 3A7QA 2FCUA 4UW5A 4YVSB 2J1EA 4FFIA 3VL9A 3J7NA 3LF7A 1H6YA 5EYYA 2OQ6A 2E7AA 4HSJA 1OA2A 3AKTA 3J7MA 3PJYA 2YUEA 4B29A 4JV4A 4FAHA 1N1YA 2ENRA 4IV1B 3ILRA 4HETA 1GP6A 4K20A 4CP2A 4AF9A 1FI2A 3WNXA 1YFXA 2FMYA 2R1DA 5FREA 4AEDB 2MEV1 2XVGA 4JQRA 1EV11 4DY5A 3O1RA 3NJXA 3OYWB 5CG9A 3ABZA 3WG2A 1QJU3 1CPMA 4YPJA 4UXAA 2VU9A 1PGW2 1Y9GA 3HT1A 1YJKA 1WCQA 3I49A 3I3QA 4XBQA 2OA2A 2ZMLA 4CP0A 2PA7A 3WHUA 1W0OA 2QQMA 1GNYA 1GFF2 2BERA 3VD9A 1BBT1 3VZMA 4Y3OA 1IOAA 5KC5A 4Y22B 1W6QA 4HK9A 1QJEA 1RUE3 1K45A 3PLQA 3D0JA 3P5BA 1H2NA 5FY0A 3AJYA 1X50A 1H1IA 1W6OB 2VZUA 4H3WA 4AW7A 3BTYA 2Q1MA 5FZCA 2YFUA 2GP5A 5H9PA 2WS91 2VO5A 4F83A 3QH7A 1ZRCA 4A4AA 4ZY9A 2VZSA 3OOXA 3ACGA 1FOD3 1UPSA 2ZGMA 5DN2A 4D7TA 5FZBA 1QQP1 1V6KA 2BDRA 2X5IB 4FAGA 2YB7A 3BALA 2KD7A 3I2HA 1QJU1 4JAAA 2Q8OA 4CDUC 2VUDA 4BA6A 1TG7A 4N8MA 2ID4A 1WBFA 3AL6A 1EAH1 2WO7A 3JUUA 1LHWA 4AYUA 4QX8A 4BMEA 1XNTA 5GLUA 4LE3A 2D98A 2G9GA 1POV1 1XNAA 2D6LX 2DUPA 2GNTA 3HMYA 1TME2 3M8LA 1NT0A 4JGYC 4YFZA 5JXJA 3AYEA 2NMOA 2VBBA 1H8VA 1KQRA 1WLTA 4QKBA 1JZ5A 1QOTA 3I3MA 3ZIXA 3EMRA 3ST7A 2VUCA 4Q4V1 3RVHA 3UV9A 4XUPA 1WW6A 4XJ9A 5IVCA 4FFGA 5FUNA 3CO2A 1CIYA 2ZZJA 4F8AA 1H1MA 3X29B 2CDOA 1W6OA 1UY3A 1ND3C 5LW9A 4MGQA 5LA1A 1MS1A 2PELA 4CP9B 4MGZE 1LTEA 3WQ7A 2BRTA 4Y22A 1HRV2 4XEZA 1W99A 4QGNA 2Y38A 3POIA 5IVYA 1RB8G 1V6JA 3I2DA 3O0VA 2G1MA 3JQXA 3PTYA 3T1MA 3KSCA 3VHNA 5JWPA 3S7IA 1ZBA1 3N9NA 3PMEA 5ACA2 3ZVXA 3KGLA 3BPZA 4PQQA 2Q4SA 3OGVA 4BM8A 4EQVA 3O1OA 5I8TA 2XQRA 5A7PA 4NN0A 3T30A 4CCJA 1ZBE3 1KFXL 1E5SA 4CTEA 4OCTA 1GQPA 1RTVA 4QDSA 4EV0A 3ZYIB 2R071 3U14A 4CDUA 3RZJA 1Q8QA 1UKGA 2PAKA 1JHJA 3KVAA 5AVPA 3UL2A 3U11A 3VKLA 2GDFA 2I2SA 2QQVA 3B9CA 4CEWC 5FJKA 2WZR2 3ZFEB 2ZX0A 4UFIA 4UWDA 4CCCA 4OHYA 1KRIA 2CU5A 5FP9A 1TME1 3S30A 4P5YA 1YQ6A 2VULA 2GH2A 5F5IA 3ZFEC 5IK5A 2YBSA 2IXKA 2Y0IA 4WM8B 5IK8A 4INDA 1G6NA 3BB6A 2DVGA 2UU8A 3SITA 3OPZA 1ST8A 3ALQA 4GWJA 2ES3A 4QWNA 1N3OA 1AYM3 3NNMA 2WFF3 1SLLA 1DBNA 3IKWA 2VMGA 4CDWB 1XNBA 3FFZA 1VBE2 3CJIA 4QQ2A 1ND3A 4XJWA 1ULDA 1QU0A 3BTAA 3MLLA 4BWOA 3W9AA 1Z7S1 1CAUA 2R1BA 1FPN2 4FBFA 4JHTA 1XE7A 2VOXA 4DUWA 3JXSA 1SMVA 2VE1A 5E89A 1C1FA 3VBSA 3C7HA 3OBTA 4JX0A 1D4M1 3ZX7A 2JECA 3RGBA 1BXHA 4I3PA 4Y33A 1DGRA 1CAXB 3FHAA 3ZN6A 2OPKA 2ZGKA 3H0OA 1JW6A 2JDMA 4M3CA 4TYSA 3EYPA 3NV4A 3LA2A 4QU2A 3TEYA 4RQPC 4XJ8A 2NZ9A 1W2TA 5GLZA 4NMIA 2FDKA 1RUG2 1XSQA 4COVA 2IXLA 3VDCA 2AENA 4MGSA 3TN93 4Y4RA 1GICA 5FP4A 4Y5SA 1NUKA 3FWEA 5FY9A 1G7YA 1PGW1 1R093 3HBZA 4AFAA 1LB2A 1D2SA 4YM2A 2G9ZA 5FTTC 3AKSA 5APAA 4AFCA 1JOPA 4AGGA 4GXLA 1UYPA 2VGDA 1PK6C 3I2FA 2ZCWA 4MGKE 4UW6A 5GZGA 2GC3A 3KMHA 2QQOA 3ZFFA 3ZSMA 4DB5A 2HKXA 3UGGA 3E6CC 2IWGB 4BQ3A 2A6XA 1DQ1A 4OI0A 4Q0PA 5T54A 2NP0A 3VDDB 1U5IA 2RR11 4COZA 3Q8BA 3ZYHA 1S1AA 5FUPA 4A6SA 3MFAA 3ZSJA 3OD4A 1J59A 2BW8A 2P6CA 1H2MA 4A41A 4KI5M 2D97A 5KXCA 2B42B 4IV3C 4JGYA 4YGDA 5FZ0A 1SLBA 1BVP1 1S0EA 2PLV1 3QLQA 2R073 1OKQA 1S2EA 4NROA 2WO1A 5FWJA 1HRV1 4YG3A 2AH2A 4EWAA 2C9AA 1KJLA 4BYYA 2UWCA 3M3EA 5HXVA 4XBNA 2CHHA 1W8UA 3K48A 4TLFA 2NPIA 5EZWA 3LOIA 1CESA 1OA3A 2VXRA 2WUHA 1PO22 3NV1A 4GKYA 3WG4A 3K4AA 5K8SA 1HV1A 1I6XA 3WDUA 1F15A 1AF9A 1REEA 1LECA 2VZPA 1YIFA 3ES4A 4IGQA 4I2OA 3KCXA 2QQUA 4FOYA 2JDAA 4LTAA 1ULEA 4RYDA 4M0HA 1R082 1YCIA 3WXPA 5G04L 3ZXJA 1COV3 2RR13 4OHWA 2H6CA 2XJQA 4XQDA 5F5QA 4YYOA 4XUTA 1RHI3 4HKWA 2XONA 1GWKA 3N7MA 4GMP1 4LO6B 3KQRA 4HFSA 2FCVA 1ZVFA 1O4ZA 1WMEA 5E6HA 4XVHA 2ZMKA 3RYPA 1W9YA 1ZRDA 4JGZC 4EN6B 1DZQA 3OEBA 4HN0A 1UU6A 5F7UA 1GQHA 3TN91 1SFNA 4OMCA 2D6NA 1V6MA 3OUIA 4LOTA 2Q1ZB 3ZKUA 2JE7A 4AVBA 4BQWA 1UIKA 2WN2A 4K1YA 3GCWA 3WINE 5K9YA 3I2IA 3UK9A 1MS4A 3ZXFA 1IKPA 1BEV2 5FY4A 4D7SA 1O5UA 3O1MA 1QJX3 2BGCA 1ZA4A 1V6NA 2J7MA 1KEXA 5FBZA 4LHSA 3T2TA 4YW1A 1Q8VA 3VBHC 2P3IA 5J1XA 3LCPA 1X36A 3OEAA 1OC1A 3NWKA 1XJAA 3AB0A 4XURA 4YG6A 2BWAA 2HWF1 2EVXA 3RYRA 1COV2 4UW3A 1JMUB 1OD3A 3LEMA 4CCLA 4P9YA 2BVVA 1W06A 1RHI2 2RS53 1XPWA 1J3RA 3N36A 2NQYA 2Y33A 4QKDA 1RMU1 4BLJA 4NIDA 1IS4A 1L3JA 1LGBA 3OD0A 5EWSA 3MPPG 4AEKA 2WNVC 1NCQB 5LA9A 1VB4A 4JTOA 1EP0A 3PU3A 2ADDA 1W2UA 4YZ4A 1DCSA 5KR7A 2HJIA 1X8EA 2VL4A 3UKTA 4BQ4A 5LK7B 1EPWA 5F6KA 2R0HA 1GZWB 4IETA 1PNFA 1J1LA 4OHZA 2B46X 1EUTA 3U37A 4NR1A 1UZZA 2WKKA 3GYDA 3MDPA 2ZZQA 2WA3A 4GULA 2NMNA 3NAPB 1AXKA 4XHBA 4QXCA 4QQHA 1W8OA 5CAZA 1QNYA 4DFSA 3NKGA 3LZZA 4UFMA 4EYUA 1GYKA 3OGJA 5K4LA 2UYAA 3BTXA 3WVJA 5IFPA 5DMYA 1K3IA 3FBYA 5F6LB 3B9IA 5FZ8A 4AGVA 4HN1A 1DU3D 2Y8KA 1A34A 3EJKA 3EBRA 1FV3A 3U4SA 2V5DA 4AHYA 2B8MA 5A33B 1HJFA 3KF5A 1O8PA 3MIBA 3WHTA 3WW3A 1RMU3 4M4RA 2JG8A 1GZ9A 3ZSKA 4E2SA 3W21A 4HK8A 5C5TA 1VBD3 2GAUA 4MZUA 1KD7A 5JXHA 4IUGA 2OZJA 2V4AA 5BNNC 5LZ6A 1ZZBA 4Y5TA 4A3XA 4I3GA 3NV3A 5JPMB 4N9IA 4YFWA 3V64A 3GM8A 2G9FA 4LUKA 4R4ZA 3UYJA 4CE8A 1I5PA 3PL0A 1SCRA 4KMQA 1JYVA 2DVDA 4HLTA 5FYBA 2HWB3 4JKLA 2XOMA 4WM7C 3WUDA 4YVWC 4DEVA 5KXEA 4PIXA 4YM1A 5FZIA 1I9RA 1US3A 4FPFA 4JGYB 4CYDA 5HCAA 1WD3A 5JZGB 1W28A 1EYBA 5D8AA 4QX0A 2ZJCA 3IIIA 5I0UA 3SHRA 4NPLA 2WQ4A 3LKJA 3ORJA 1XE0A 3D5OA 5AFBA 1V0AA 1RINA 2HWC3 5DAPA 1PZ9A 1SEFA 2ZEXA 5BY5A 3W59A 2BNOA 5LBFA 4N90A 4CDUB 3FBMA 2W2IA 1HIXA 1A8DA 2VC9A 4BMBA 4XOGA 5DZEA 5FP7A 1W2OA 2DBNA 1N47A 2XJSA 3O1SA 3NQHA 2YBKA 3ZYBA 3AC0A 4WM8A 1RUJ1 4FO9A 5DAXA 1POQA 1NOVA 1WWYA 5EXOA 2Y0OA 2FZ1A 4KQ7A 5GLWA 1WBLA 3THTA 1RUF3 3M7AA 4GWMA 2WFF2 4KH9A 4Y1XA 3RQ0A 3ZFEA 2VVEA 1G86A 1UZVA 4K40A 3OSDA 1GBGA 2RJKA 4LKEA 3AP7A 4AVAA 2W39A 1CVNA 1ZYBA 2ZAHA 3AMPA 2X05A 5BUVA 2AYHA 1V6LA 2WAAA 1DLCA 2DU1A 2QQWA 3PDQA 1F5JA 3VBOB 4XPVA 2ET1A 5J7MA 5H9RA 3KV4A 1BVVA 1FPN3 2UWAA 4IEXA 4ARXA 1UL9A 2XBO2 1D0GA 3MEPA 4XBLA 2JKBA 5CB7A 4Q5OA 1N1VA 1H9PA 4QPGA 3T2OA 5E1RA 2BUKA 3ZPOA 1E57A 2WO3A 5HCFA 1YFYA 2YFZA 5L9VA 2ZBJA 2E26A 4YZ5A 1QH6A 1WMFA 5F5AA 4W50A 5JOWA 1PGSA 1POV3 2PQQA 5D8AC 4OI1A 3WG3A 4UAPA 4Z2AA 2VQ0A 4NIIA 1CAXA 4HZFA 4IV1C 4KBBA 4XETA 1S2KA 2VW1A 2JICA 3C3VA 4WVWA 4DXTA 4X8NA 3CQOA 5LA2A 1JTZX 4CRQA 2WNVA 3IDEA 2XWJB 3NSTA 5JSOA 1DHKB 3BIWE 3IN9A 4MG2A 1IS3A 4Y20A 1N1SA 4W4ZA 1PK6B 1W2NA 5DABA 5CKMA 4CU6A 3THPA 3ZN5A 5K0UB 1JZ8A 1PNGA 3CIHA 2VNGA 5T5LA 1ZRIA 4N7IA 2W1UA 3HNYM 1U12A 4AK3A 2ZGUA 4U2AA 5HPOA 4I0BA 3M3QA 4B7KA 3RZMA 5IJRA 1NA1B 5KHHA 4PBOA 3LA7A 3MW3A 1MZ5A 2PHLA 5C7GA 4P5HA 3HPNA 4GIQA 3KLSA 1OF4A 4UFKA 4LR4A 4MGYE 4FPHA 2PTMA 2QQJA 3GZTB 1JXNA 4LJHA 4ARYA 3POFA 3MUY1 4IE0A 4J6GA 4L97A 1WZXA 4CSWA 5GALA 1CIWA 5ACA1 3VZNA 4IE5A 2ILMA 3AVSA 4HT1T 5JR2A 2BTVC 3H8UA 3NNLA 1DGRN 3FJSA 3BYWA 3FC0A 1F9KA 1W6NA 4K21A 3UETA 3JQWA 3POYA 5GKAC 4FXKB 1HJGA 5L7OA 2YZ4A 1RUC2 4DEQA 3TNQA 4I09A 4YSFA 5A3TA 2TUNA 2E63A 5DQ0A 1W6PB 4A6OA 3BTZA 3OG2A 4YW5A 4NAMA 4BLIA 1X9TA 2TEPA 2XKPA 4GJYA 2OUJA 4XMIA 4XABA 5FXXA 4X8PA 1HB4A 4AZZA 1ZRRA 4YM0A 1K5JA 4LA2A 5K0UA 1HXS3 1ONAA 4LOSA 4GD4A 5FLHA 4OI4A 4LORA 4XQ4A 2EIGA 4CUBA 2VMDA 2ZGNA 4CUCA 3PVBB 2KR2A 4HVOA 4NAOA 4Q4V2 5A3OA 4E8DA 3TN92 3GZAA 1WMXA 5D2AA 1OUXA 4Q4W3 2W52A 1QF3A 1C3HA 2OZ6A 1SQ4A 3BUCA 4CXYA 4XUQA 2EIBA 3TYJA 1QJU2 4Y26A 2O1QA 2VQUA 3VB9A 1LNSA 1ZBE1 3VBUB 3AKQA 4ATEA 1UQXA 1VJ2A 1YYNA 3I4IA 1EAH2 2JIGA 3T3YA 3GGLA 5AC91 5A70A 3SLIA 3H1YA 2WFPA 2OUHA 3HEIA 1GOGA 1J84A 1R081 5ANQA 1GUIA 2YROA 3PVEA 3NL1A 3SH5A 1MACA 2Y64A 4FXGB 1W9FA 4YM3A 3FMGA 4XTMA 2A70A 5IAVA 1RUOA 1X82A 2JG9A 1JYWA 1UO9A 3K4DA 1YHFA 4IEQA 5LRSA 4DXSA 2A73B 2XVLA 4OZOA 4XIOA 1RJ8A 3H50A 2ZGLA 2VECA 3M3CA 1ZRFA 4WV8A 1OXCA 3VKFC 4C0BA 3HR9A 2OQ7A 1H2KA 5A1FA 1EY2A 2HWE2 1E5RA 2WYFA 2P17A 3KV6A 3R0RA 3LFMA 3WLUA 2BFUS 2B7YA 5FIXA 4ZHNA 1CJPA 5FPUA 1O3QA 4GB32 4GWIA 5F3EA 1IKQA 4XF4A 1VP6A 1G9FA 4JGZA 3ZDVA 3HD8B 4B1LA 4Q4Y3 1C5HA 2A6WA 2W94A 4AI9A 3KVBA 1H1AA 4OHXA 2MEV2 3HVDA 3RS6A 4H7LA 1BCXA 5KHGA 3AMQA 4P08A 1F2NA 2AUYA 2PHXA 4UFLA 2A6YA 5D8AB 3I3DA 4UBHA 4HOOA 5FBJA 2IXIA 1IQDC 4RN5A 4MYEA 1ND2B 3BKZA 3PNAA 4XCAA 4C1WA 5GZCA 1F35A 5ACA3 2HH9A 2ZKLA 1HW5A 2PHFA 5LBEA 1PVC1 5JOXA 5LY1A 3DPRC 3ACIA 1OVPA 1ZNPA 4YW4A 1LODA 1AR62 2CGPA 1FYUA 1QDCA 1VBC2 2GMMA 2Y6FA 2ZXQA 3C2UA 3WDXA 1GU3A 2R7EB 1W0PA 4AQ2A 4ZS2A 5JCTA 1ASJ2 1XQNA 4IEYA 4IESA 4ASKA 1MS9A 4ORFA 5JZGA 1AVBA 1RXGA 5C9AA 1DQ5A 5DXDA 4R8HA 2HWD1 5J37A 1UIJA 3AYDA 5DUWA 3T0BA 3OF1A 2VQTA 3DCQA 4LULA 5JOZA 1LAJA 2PHUA 5J36A 2A5ZA 1MQTB 4XXAA 4I0WB 2RS32 3AXEA 3BN6A 3SC7X 1AXZA 2PQSA 2BBAA 3N4MA 1AUYA 1R1A1 4B4RA 3HNMA 4QPGB 4Y1YA 4TTGA 2EXHA 3NAPA 5FZOA 1AR91 2YV8A 3HQRA 4ONUA 5J48A 4HKOA 1PIV2 1QIQA 3NJYA 4LEJA 2WA4A 2O8QA 4CCNA 3O12A 3PTRB 3NRUA 4NRPA 1VLNA 2RMU2 3VBOA 4DRVA 4META 3T2QA 5EJ3A 1HQLA 5JSRA 3ZO0B 5FMOL 4QPIC 2OKXA 4YVSC 3P1IA 1RUF2 1S4CA 4MO3M 3KHCA 3K3NA 4IV3A 2ARBA 3PUQA 4QPWA 4BQXA 3ACFA 1UYZA 1ZM1A 4KWLA 3U78A 3ZR5A 5HXMA 4Q0UA 2RS51 3MI8A 4JDOA 3WNOA 5KXBA 5FZ7A 5EHDA 5DAVA 3WQ0A 5BNQA 1NCRC 1ULGA 4W6YA 1AR71 3CBNA 2JDHA 3RMXA 1UY0A 2DTYA 2ZGQA 4YW2A 4QPYA 3P6BA 5FPZA 3V0AA 5CG8A 1B35A 1LCLA 2QBXA 1VPHA 2VBPA 2BU9A 1RMU2 3CJXA 5HCHA 1BLZA 4LLFA 2J1AA 1BYHA 1A6CA 1WW5A 3A23A 4NE9A 5KHIA 3RYKA 1AR81 4COWA 4OUSA 2DFCA 1W6MA 3KGZA 3VBSC 4WVZA 4YRDA 2WQ8A 2CNAA 3U10A 5CFCB 3OGSA 1KS4A 2H0BA 4R52A 2D6KA 1VMJA 2JG9C 3ZIWA 5HV0A 4IEPA 1DG6A 1ENRA 2WIIB 5FYIA 4NHLA 1K5MA 4FTSA 5BV6A 1QGLA 2UURA 1A78A 3MIDA 1CZVA 2R062 2VZQA 3ILNA 4LE4A 5FY8A 5T52A 2DV9A 4ZU4A 1FMD3 4B3NA 3K4ZA 5F5CA 1XB9A 2R0FA 3IBMA 4QKNA 2BWCA 3JBG2 4MLOA 1B35B 4PQ9A 1W8HA 4NO4A 3AX4A 5FK7A 2GH8A 1YWKA 5HCBA 4BXSV 2GP3A 3ILFA 3THDA 3KV5A 2AGSA 3ZYGA 4XJZA 3S5QA 5SV5A 4BDVB 2BBVA 4K1ZA 1S0JA 3EO6A 3IDBB 5A1AA 2P6HA 4P9WA 1D4M3 1PIV1 4W65A 3D3AA 1W8TA 3CZUA 5A1LA 1JZ4A 1JYNA 1O8SA 2WR9A 4RA0A 1W04A 3G6JB 3N35A 3FLRA 3BOWA 1OURA 4HPKA 1GWLA 2WSVA 2YY1A 3IAQA 5L9RA 3ZYRA 3WNNA 3ZYPA 1O4TA 1YXWA 4NUBA 1OOPB 1DZTA 1GZWA 1TMF1 1PVC3 2HEVF 2WS92 4IEWA 1LGNA 4IE6A 5JLVA 2VTXA 3DYMA 5DG1A 4K9SA 4V2WA 3OTFA 1AL0G 2A3WA 3GF6A 4XFHA 4C1XA 3R4UA 1C4RA 4XZPA 3UGFA 3S0MA 2GNDA 4HMZA 2R063 2VXJA 4FPJA 5EFUA 2GZWA 1UOJA 2B5HA 1HX6A 2YXSA 2HYXA 1LOAA 1VAVA 3TNPB 3VGIA 2D5FA 3MLJA 4QXBA 4RSUA 2YGMA 4JKKA 4Q0SA 5FZ3A 5BNPB 3HJRA 5A3MA 4O65A 1GKBA 4L0PA 2XHNA 3M3IA 3FLPA 4CCDA 1JYTA 4QX5A 5EIYB 3ZDSA 2B9VA 3VBRA 1O59A 1IQAA 2HWB1 5BPXA 2Y26A 4F3JA 4QX2A 4A44A 2ZHKA 1UXZA 1RUJ2 5HBAA 2ORXA 2JG8C 1ULFA 2ZACA 4XFFA 4E4DX 4ES9A 4B1MA 2WLQA 3AP4A 2WQZC 3V56A 5DZGA 1S0GA 4AHZA 5DDJ3 4D94A 3N9PA 5FYSA 2QDRA 4FVVA 4L8QA 4QGLA 4BU2A 1QJX1 3BCWA 2R041 1DP0A 1HB2A 2VOKA 1ZREA 4Q1PA 2PYTA 4LK6A 4O9GA 4R9AA 2KM2A 3E6BA 4CU9A 4I0AA 3HQXA 1PVXA 4GQ7A 3W58A 4I01A 4RHV3 4EJRA 5LCWL 3VDAA 2BOJA 2F6BA 3GCXA 3LEIA 3ZN6B 1VRH2 1OQEA 4XF0A 4UFHA 2JB8A 3VDDC 5FRAA 5F2WA 1TE1B 3CMGA 4Z8BA 2PHWA 1U0AA 5DUVA 1Q3EA 2WNUB 5J09A 3U4XA 4L2NA 4DY3A 3ZFGC 4RR3A 1MPXA 4FTBA 4IEVA 4QGMA 3B00A 4RD7A 2BNMA 2CY6A 2KA3A 2XG3A 3OY8A 3DYOA 5FY7A 4CA9A 5FDBA 1L7LA 2D6PA 1DQ4A 4MHRA 3W5NA 4GH4A 2O14A 2ADEA 2WRAA 3POSA 2BP6A 5FKCA 4RFT0 5FY1A 4DQAA 4Y1VA 1YFUA 1JU4A 5A7WA 1FOD1 2C0ZA 1J58A 2XJUA 3SISA 2W08A 3JZVA 5F3CA 3PJQA 5EPAA 2VUAA 2W1SA 2WZR1 2PXJA 2JD9A 5JAXA 3B69A 5A3UA 3SH3A 2VMCA 3LEKA 3RWNA 3WUCA 2FDIA 1UZYA 4ASMB 1UMHA 2IFWA 3USSA 1GWMA 1NA1C 2BFUL 2YHJA 4S2FA 3IPVB 3ATGA 1JU3A 3RZKA 3KT1A 1X7NA 3ELNA 4Q4W1 3WQBA 1Y3TA 5I0SA 2DDUA 3O0XA 4TSVA 2KXLA 1VBE3 3H3LA 3HN1A 2CWMA 4KBZA 2GALA 3WDWA 5A6QA 3BI3A 3O1UA 1W6NB 1ASJ3 4DPNA 2YYOA 1NAEA 3KCCA 2ZS6B 4E4SA 4PBPA 3WP3A 1DGWX 4LA3A 4E2QA 2DFBA 3LDKA 2D44A 1RUI3 1HV0A 1QOSA 1WLWA 2W1QA 3I2GA 3BU7A 4FOQA 1PMIA 2EAKA 4PDWA 3IPVA 4PI0A 1PZ8A 1REDA 3ZSLA 2D3SA 1BZWA 4YLZA 2DWRA 4IW3A 3ZFGA 5CKQA 1TZOA 4XILA 5F8PA 4D8MA 5KHKA 1CAVA 3FUQA 4E4HA 1S55A 5JI9A 1HN0A 3VD4A 2E31A 1OUSA 1US2A 3AMNA 2VUJA 1F31A 1KFUL 1RUG3 4AEJA 1JZ7A 1PM4A 3RZHA 4Q0QA 1TNFA 2V72A 4OUEA 3ZYFA 5BNOC 4AAXA 1BEV1 1CAWB 4EN0A 1CAUB 1YNAA 2W92A 2HWF3 4GH4B 1H8TA 2A6ZA 4CCEA 2RDRA 4AGRA 1QXRA 4R4XA 3VBOC 4XMAA 4CUAA 4D69A 2J1RA 1J83A 1UY1A 4Y1ZA 4J1WA 3AZXA 5DAWA 5FYVA 2WWJA 4PIYA 4QQOA 5I93A 5EV7A 1DZRA 3I3BA 3AL5A 4MHUA 5FZ1A 3PMSA 3O7OA 4XDPA 2P4EA 5FQ0B 1Z7S3 2ZGOA 2QTWB 4EN9B 2FMDA 3GXUA 3CF6E 3H9AA 5JIAA 2BGOA 4A42A 2XL9A 4DIQA 1H8TB 4MUVA 1NYWA 4PDWB 4PLMA 2BNNA 3UESA 5TSWA 1VE0A 2VCCA 5JUVA 2EIDA 5LY2A 1YQ8A 3GZUC 1SCSA 1N3QA 1L7QA 2ORZA 2P34A 5FZDA 4AI2A 3MV11 5ISLA 1H6XA 1O6UA 5CISA 1DFQA 2ZKNA 1IPJA 3K77A 2Y6GA 3RJRA 3CJIC 5J98B 1VRBA 4XAEA 3A0KA 3OYWA 4GMP3 5E16A 1PO21 4AEMA 1RVF1 5FO9B 4YGCA 1E5IA 3SEEA 1DQ6A 3RNSA 3USUB 4DXRA 3RWKX 3HN3A 2ETEA 3RMYA 2VR4A 2P3KA 3A22A 1WLDA 3FLTA 3PIJA 1S0FA 3I3EA 2DCYA 3O14A 4FPOB 4G4FA 4LITA 4LHNA 3CHXA 5C3QA 2R042 4KWUA 5L36A 4NPMA 3LDBA 5ERLA 2RR12 2HWB2 2V5YA 1SFYA 2ZGSA 4AVSA 2Y34A 1QXPA 3AFGA 5DUUA 2ZMNA 2QQLA 4YVSA 3AZVA 1JODA 2ZPXA 2FDGA 4BK5A 1IHMA 5G05L 4LO5B 3ZN4A 1DDLA 5CVRA 3SCHA 5FAXA 3KWVA 2DU0A 4XC9A 1IGOA 3VBHB 3IT8A 1JHNA 3Q8CA 3AXDA 5FZ9A 4N53B 2QDNA 4Z2WA 4IGOA 1AL23 2PLV3 2PMWB 4XW3A 3R4SA 5CFDC 4QPIA 1B35C 4XFCA 4Q4X1 5JSPA 1LOEA 1LULA 5BNNA 4IDZA 1KDKA 3H7YA 4PF1A 1BEV3 1ZZ8A 3TRSB 1OD5A 3DKQA 2EA7A 1UD1A 2DUQA 1HXS1 2D93A 2K0GA 3LEGA 1NLSA 1TMF2 1C8M1 4WZCA 4L92A 2IXHA 4ASLA 1S0IA 3EHKA 4XZUG 5JIUA 2JD4A 3VBHA 3I2OA 5FMBA 3OY8B 1Q8PA 2X5IA 3MIHA 2JDNA 3KD4A 2HYKA 1QJZA 5A6XA 4RFRB 1IS5A 3ETQA 5L7OC 3QACA 3DV8A 2E7TA 5A33A 2Z69A 3OGGA 4RHV2 3AMMA 2YPDA 1VBA3 1GSLA 3MO4A 3R6SA 1YLLA 5ABJB 5IVJA 1AL21 4GWNA 5EJ1B 4ZZ8A 3JB8A 3POWA 1IZ3A 4FOWA 1UOFA 2VW2A 4E9KA 2I45A 3LFIA 3CKHA 1T6BX 4Q27A 1G8WA 2FQPA 4P00B 1SBDA 2K46A 2D40A 1RITA 1XU2A 1OFSA 3J26N 4N43C 2BQPA 3MF6A 2VZVA 3MHZA 1NCRB 4XFBA 3WG1A 3U0ZA 4EWDA 4TN7A 4N43B 3LSEA 4B4PA 4CDQC 5C8WA 1K5MB 1MVQA 4EN8B 4M00A 4TLGA 1RUE1 2O8OA 4FT8A 1YRZA 1CZSA 3QOPA 2JDUA 4LIUA 1QMJA 3SCGA 1OF3A 3WNLA 4AEDA 4QDRA 4Y4YA 3VLBB 1N3PA 1OA4A 1QH7A 3OBZA 1C57A 3ZKYA 4XUOA 5IT6A 2R072 4N9HA 4DMIA 1W6MB 3VKMA 1Z0HA 4CEYB 2WLPA 4OVEA 1AHSA 4Q29A 2QFEA 3LE0A 2QUOA 3E5XA 4D6QA 4QM9A 3WP6A 2AEZA 1DLLA 2PFWA 1S2BA 4QD2A 3U1XA 5A3LA 4RGKA 1MS3A 3LIGA 1BJQA 2WNEA 4Q2FA 1X9PA 5A3NA 3Q8EA 1OOPA 2W5FA 3POEA 1IG0A 3TOJA 1QDOA 1RUH3 3QBQA 4D0QA 3L2HA 3RZZA 3KB5A 4WVMA 2OVUA 4WM7A 5IVBA 2VQAA 3OUJA 1P8JA 2LRPA 2Q8CA 2Y6HA 1UY4A 5FPBA 2AEYA 3CU7A 4YVWA 1GP4A 3UGHA 3VDDA 1V6OA 5D1IA 1STMA 1UMIA 3AYCA 1TNRA 3JBG3 1POV0 3KQ4B 2LUWA 2LW8A 4C90A 4FP3A 5B4NA 2GMPA 3V65A 4MSVA 4F7ZA 1MZEA 3ZFFC 2W68A 1AR72 1HRI2 3U75A 4ZXKA 2WZPP 3G7DA 3OBAA 4AQSA 3I54A 4LBOA 1JYCA 4HPKB 3KS7A 4Q8LA 4AI8A 1SLCA 1H4GA 2C4XA 3R4DB 4P9GA 5LBBA 3T4HB 5C71A 3IAPA 1OH4A 4RGGA 1VMHA 4U36A 5FV3A 4BJ0A 2ARXA 1G9BA 1QJY3 4IV3B 4LO4B 1GR3A 2X53S 5C3RA 5I8YA 5I0TA 5JI7A 3T09A 1DIWA 1MZFA 4URTA 3DXTA 3H8RA 4I02A 2AZ5A 1AYM1 2C6SA 3J7HA 4Q4V3 4KL1A 3DL3A 3N7JA 1UWWA 3VKNA 1D2QA 1HRI1 4FPGA 4AR2A 4DNYA 3PIGA 4DUXA 4Y5Z0 1Y43B 4FPCA 2FZ2A 1MVEA 4HANA 4CP1A 3C7GA 4LT5A 2VZ3A 3CJIB 4PLOA 5HV4A 5AVAA 1ASJ1 2DCJA 3IDAA 4HKLA 2LS6A 1Q56A 3KHBA 4LO7A 1I5ZA 5FPAA 1SLTA 3L2YA 4CUGA 2IFRA 3I59A 2RHPA 2NLRA 3B01A 1K12A 2WWUA 4XF9A 3VZLA 1GZTA 4QDQA 3CZJA 4JVAA 4L99A 2FD8A 5IWFA 4H7MA 4Z82A 3R05A 3DYPA 3BGAA 1AZDA 4FFFA 4QX3A 1DGLA 2HBTA 1LRHA 4W6XA 1GOFA 3TAYA 3UT0A 5FO8B 3UKVA 3I2JA 2Q1FA 4S2HA 2RMU3 1R091 1UKRA 4XYXA 5B4XA 4EROA 1OHFA 5CKNA 2R043 4NWWA 5BYNA 1REFA 2Y60A 4ISRA 2CAVA 5L73A 4FP2A 4QXHA 3VZOA 4B7EA 1O3RA 5FCCA 2IUWA 3RI9A 4AG4A 1W3XA 4KG0A 4GH4C 3BODA 4GJZA 1BMV2 2ZX4A 1RUE2 3FX3A 3VD5A 5EYXA 4Z07A 3ZSEA 1JUIA 1AR93 1FATA 2A3YA 1GV9A 3RI8A 5JVVA 1IG3A 4PI2A 1HQNA 3SH4A 1NCRA 3JD73 5C4WA 3VD7A 4NHXA 4FPKA 1VBD1 2MEV3 1NE6A 2QQIA 4XF1A 3ZMOA 5C3PA 4LBQB 1RUG1 2RE9A 1WA6X 4BQ5A 4YZ2A 1NE4A 2F4LA 3AM2A 2DUOA 5KXDA 2YMZA 2GSYA 5CIRA 5FMDA 1UYYA 2DVAA 1QJY2 4MH0E 5EJZB 2Y6LA 1AR63 2CV6A 2XL7A 5DG2A 1QXJA 2IVJA 5FZOB 2XJRA 3KCYA 1B09A 2FDFA 2C24A 4MX3A 1CR7A 1W8NA 3O0WA 4LPLA 1VALA 4E8CA 4NHKA 1O3SA 4BPZA 2FBEA 2JG9B 3M4FA 4OI2A 4C91A 4AI3A 2RG4A 1TEIA 2ZGRA 4ZKTB 5J3UA 1DYPA 4XF3A 5LEJA 2YC0A 1XNDA 1OVSA 4HVQA 3CEWA 4XQWA 1LHUA 3RZLA 3VHPA 5AC92 3VBSB 1VBA2 3QCWA 3ES1A 4MV2A 5FZ6A 3ZXAC 4UT5A 3VBFB 2E33A 3RDIA 1JUHA 4L11A 5C8CB 4A7ZA 2CL2A 4RS5A 1DYOA 4IEOA 1YI9A 4KGGA 1WCDJ 3BPSA 3VBFC 2G4IA 4LBQD 2VZOA 1H4HA 1WA4A 3ZXDA 3H1WA 2BGPA 5LATA 1PX4A 4HONA 5FOJB 1JZ6A 3GBWA 5F2SA 3FZ3A 3POJA 3ASIA 1ND2A 1ZBA3 2ZAAA 3AMHA 3DPRA 2JDKA 2WDBA 3WW4A 2UYBA 1GZCA 1V70A 1E5HA 2R061 5FFOC 5KBFA 2VPVA 1SLAA 3NVCA 3ZFGB 1QNWA 2JJ6A 4NVPA 1AYN3 1DGWA 1TME3 1NKGA 2E51A 3IB3A 2Z42A 1UOBA 4FQ4A 4PLNA 2XPJA 3AP6A 1UW8A 5GZFA 1F8VA 2J1SA 3LPGA 1W3VA 2GNBA 3H8XA 5C9AC 4QHZA 3LSDA 1RUJ3 1COV1 4K6BA 4ITCA 5CA6A 1UF2C 1W6PA 4OQ8A 2C9KA 1SHWB 1RUC1 4FPEA 1O5LA 3LQCA 1AR82 4M3CF 2XKOA 4RR3C 4JC1A 1XBFA 1RVF2 4NHYA 2EIEA 4V2VA 3LGRA 5FYUA 4IE7A 2JDZA 4H55A 3T2PA 1MQTC 1ZZCA 3I7DA 1C5IA 5T5PA 2ZOEB 5FZEA 3J7LA 2YBPA 2BYVE 2ZEWA 5C3SA 3OJBA 3NW4A 2Y6KA 3BOPA 4TXWA 3AKRA 2QNKA 5I91A 1ACCA 4UW4A 1PK6A 1JBCA 1G9DA 1AYN1 4AFDA 3WT3A 4WZFA 2TNFA 5FZFA 4EE2A 4YGEA 2W95A 1V9U1 1VIWB 2ERFA 5FKBA 1RUH2 1RUF1 1JS9A 4N53C 1NA1A 2JDPA 4XHXA 1AR73 1CQ9A 1FMD1 3DPRB 1YEWA 2W46A 1C1LA 3HIFA 4J25A 4XCBA 5FYYA 2RMU1 3OGRA 3U07A 5JPNB 3S57A 1CWPA 2QKDA 1APNA 2QZ2A 3DF0A 3T4VA 3SMHA 4OUMA 3VBUA 3H42B 4AE2A 5LEKA 1FNYA 1ND2C 1GLHA 1AYN2 4XFGA 2JKXA 4BOWA 2P1BA 3ZOIA 1SBFA 2ARCA 4M0NA 1W8WA 4WVVA 1VR3A 5F39A 2XJPA 3PHMA 2W0XA 2E32A 2JE9A 1OLMA 2DURA 5C4WC 3WQ1A 3OCPA 1C8M2 4UOJA 2JX9A 3TEWA 1WW4A 1YO8A 1OFNA 2VNOA 4S2DA 5FPVA 4NIGA 5A32B 2DYCA 3E6DA 4XJAA 3KZ4C 2WYSA 5JZGC 4LKSA 1LJ7A 1RUD2 4S2GA 1EV13 2FHRA 2XGXA 2Z79A 3OPTA 1OOPC 1GQGA 3S7EA 4UYBA 5C4WB 4Q4X2 2WBKA 5JR7B 3WF0A 2X09A 2XLGA 3S6PA 3HT2A 5D21A 3A0NA 1AR61 3OB8A 3ZYJB 4FPYA 3H8OA 1LESA 2C1FA 3GNEA 4TZDA 3PVOA 1H8TC 3B5LB 3Q9OA 3VZKA 3ACLA 2VZRA 2BVBA 2VBDA 4COYA 5T3NA 4ZPIA 1OSGA 4IV1A 2Z5WA 1EUUA 2QVSB 3I97A 2WZ8A 2XBO3 1M06G 1WCKA 5DDJ1 2WN3A 3WX5A 3WD5A 3T1LA 3IIAA 3MIFA 1LHNA 1HB3A 4XE9A 2R30A 2WC2A 4P9LA 4QB2A 2NYYA 2XWBB 4AFBA 3APBA 1SG3A 4RS5B 1CZTA 1ULCA 3P3NA 4KG8A 3D4KA 5C8CA 3SCFA 3VBFA 5IYYA 2WT1A 2ZGPA 4Q8KA 1RYYA 3F2ZA 4D7YA 1ENXA 3IM0A 5A7SA 4DUVA 5IHRA 2D6OX 4UF0A 5DZFA 1VBA1 5EP9A 3ENRA 1LENA 3NJVA 4P14A 2HLEA 2WWSA 1MEC1 3W20A 5GZEA 1DQ2A 2RJ2A 3JCIA 4AVVA 4CXWA 4AQ6A 4I30A 3FFQA 3E1F1 3NNFA 1N1TA 1LOGA 4KGQA 5FO7B 3MGUA 4Y20B 4PF5A 4JDMA 5CFCC 1FAYA 3PUHA 2C26A 1C8M3 1SDWA 1D4M2 2WNVB 4LHKA 2P3JA 2B39A 4Q26A 2X29A 3DUIA 3T0AA 1LR5A 3ZXKA 4IXLA 1UN1A 2XLFA 3LPFA 3IZOA 4LBQA 4Q4X3 3ZXGA 1VBE1 3JU9A 5IAXA 4M3CE 5FJHA 4CDXC 2Q8DA 5T5JA 3D8CA 4EWEA 2QQKA 4R9CA 4CDQB 4DRRA 4ES8A 2A75A 3HWJA 5LBCA 3FE5A 5F3IA 1NQJA 1RGSA 3ZXLA 1KGYA 2HEWF 4DZGA 1GANA 2J22A 3DGTA 3ECQA
chains in the Genus database with same CATH topology
1OQDA 2VNRA 3JBG1 5FPXA 1FNZA 4CEWA 1AJOA 1D4VB 1XYNA 4B4QA 1Y9QA 1OMIA 4QXKA 3J8F2 5C8CC 1NCQA 1QHDA 1UAIA 4XFAA 5ABJC 1CGPA 1J3PA 2PHDA 3RSJA 1LOFA 5FLJA 1Y7BA 1VBC3 4WVMB 3WDVA 5DDJ2 2XVKA 1RL3A 1RVF3 1O3TA 1XNKA 1RHI1 1XU1A 2ZHMA 2GC0A 4FOVA 2ZHNA 4AVTA 1R092 2D6MA 2XJVA 1FX5A 1NXMA 4AHXA 4RGAA 2PN5A 4IL7A 1X33A 5KWRA 2A71A 4Q4W2 2Q5TA 1O91A 2HWF2 4CDXA 5CFDB 1W39A 1MEC3 1UX6A 2ZTNA 4AI1A 3O5SA 1AR83 3VKOA 1RUI1 2A3XA 3LAGA 3I59B 2VG9A 4BCUA 4N43A 3JD71 4H14A 1AX0A 5C6CA 3EQEA 2OYZA 3AP5A 1YJLA 4DXZA 2IC1A 1V6IA 1SACA 2JG8B 2WS93 2WT0A 3D6EA 1AYM2 4AXOA 3N3HA 1QKQA 3AZWA 2GU9A 1WW7A 2PHTA 4JDNA 5LK5A 1LEDA 3LOBA 2E9QA 5T55A 2P2KA 3HAGA 1ZBE2 1YFWA 2B9UA 5C33A 4EN7B 4NWVA 4SBVA 1LEMA 3SXWA 1BK1A 3UKNA 1SBEA 5E8AA 1V9U2 3K51A 1DF0A 4YG0A 3MZHA 3LWCA 1NQDA 5K7PA 2Z2SB 3TBDA 1RUI2 2PAEA 1Q8OA 3KT4A 4QQPA 5F9TA 1H9WA 4AI0A 1G9AA 3ZMNA 3AFKA 2Q30A 5I8SA 4P9JA 4RQPB 2R16A 1LHOA 1QJX2 1OI6A 3I8TA 2WJSA 1VBC1 2EXKA 4COUA 1CX4A 1VAKA 4JCKA 4OLLA 4OZXA 3KM5A 4CEYA 4AHWA 3RRDA 1WGPA 4AVCA 4ATFA 1GNHA 4WM7B 3A4UA 3B93A 3GHNA 2IXCA 4LO8A 4R9BA 1EV12 2CAUA 3GHMA 2PLV2 1NXD1 5L19A 2WFF1 3WP5A 3SNMA 4CDWC 2RJLA 3FUOA 5BNNB 5BNOB 2RM21 2RS11 3V0AB 2P37A 2YDEA 1CJDA 1PO11 1RUC3 3DN7A 1V9U3 2SLIA 1VB2A 2I07B 1U5YA 1I1EA 5CU1A 4N53A 4WM8C 1Q5OA 4GB31 1VBB2 4CDQA 3H3ZA 2V73A 1PO23 4LNVA 3V0BA 5T50A 1FOD2 3AYAA 4Z92B 4CEWB 1PGL1 1DQ0A 5ABJA 4HL0A 2LALA 4YZ1A 1AL22 1LOFC 2A6VA 1FV2A 4RHV1 3VZJA 1JH5A 1TQ5A 4FCAA 4LBMA 1WCSA 4FPLA 1AX1A 1M4WA 1YI7A 2UY9A 1JYIA 2X8KA 4N7UA 1FPN1 1HQWA 1UMZA 2QQPA 3USUA 4J1XA 5FQ0A 4CEYC 1HDKA 1XYOA 5FMOS 3J8F3 3GALA 4Q1RA 4KWJA 1UU5A 5AFEA 2BPA2 3AJZA 5H9SA 2EALA 5CNAA 4MXVA 2ZX2A 1ND3B 1O7FA 1HXS2 3J4UH 1VAMA 1MS5A 2XBO1 2HEYF 3CL1A 1K5MC 1VBD2 1ENSA 1PM7A 1VBB1 4CDWA 3MF9A 5JOWA 1RUNA 1FT9A 1OPOA 1UCXA 1OQ1A 1EPZA 2VMHA 1CPNA 3MPBA 1NG0A 5HI0A 2DVBA 2RM22 2RS12 3ROUA 1BBT3 3MFCA 1CAVB 2WNUC 4QPIB 1Q8SA 3TWIA 3WR0A 2D43A 2WL1A 5JDBA 3KT7A 5GZDA 3VKMA 3L9JT 1CAWA 2R6QA 2CTVA 3DKWA 1BKZA 2GN3A 3E97A 4JGZB 4QPGC 1U5ZA 1LU2A 2XH6A 1QQP3 5L7OB 2WSUA 4ZU5A 2MHFA 3FHIB 1QWRA 4E4ZA 1UPIA 2E6VA 2AREA 3JB4C 1ZBA2 1ALYA 1RUD1 2VW0A 1NLRA 3H3UA 1PZ7A 5IUQA 2IZWA 2NM1A 4LHLA 2XHKA 2XLAA 1PIV3 2WZR3 2ZABA 3NV2A 3AP9A 2O0OA 4RS5C 4AQTA 2HWC2 3VV1A 1OLQA 1SLIA 1S0DA 1J1TA 5GLVA 1LGCA 5B2GB 1S0BA 5DUXA 2QCSB 2ZGTA 4Z1VA 4KU7A 4O9EA 1YUDA 4YW3A 4P9IA 3M2MA 1NZCA 4IQPA 1MR5A 1Z78A 1QOOA 3B02A 2VY0A 4AEDC 3MIEA 4OFGA 1QQP2 2WNUA 5IK7A 1DYKA 2JEMA 4YZ3A 3MICA 1RUD3 2LTNA 1R1ZA 4K7JA 4E27A 4LBLA 2A7AA 4P9XA 1OPMA 1WLCA 4G9SB 1HLCA 4MVTA 2CGOA 3IWZA 2JXAA 4FTEA 3URFA 5BXXA 3JD72 2LM3A 2V09A 3WDYA 1TMF3 2DTWA 4C0HA 4X6QB 2D5HA 4W6WA 4BHPA 3INAA 1UU4A 1KXGA 4JRLA 4L9BA 4PDWC 4WBBA 2UY8A 4XXPA 3ZXEA 4YGBA 2NN8A 2N7GA 3NJZA 4ZU7A 3QD6A 3GBGA 4XIKA 1AX2A 5KHJA 2DVFA 1S0CA 4E2GA 4XJUA 2RS33 1JN2P 3WCSA 1H2LA 4KWKA 2GN7A 4NOTA 5BNPA 3VBUC 4A2UA 3NO8A 2F4PA 2RS52 3B3QE 3B94A 4DOUA 1A8MA 3NAPC 1G9CA 1LOCA 3PVNA 1MS8A 4OHVA 3J8F1 3RPQA 1AJKA 3AKPA 3H1MA 2UWBA 4GALA 2YPJA 3IDCB 4RR3B 1ZZ9A 2D3RA 1VRH3 5FLIA 4LBJA 1OLRA 1NCQC 1MZ6A 4SLIA 1R1A2 1FXZA 4BIOA 4YARA 3D0SA 4MGIE 4A7KA 4KNCA 2Q0AA 5JOYA 1C8NA 1H0BA 1YIPA 2RS31 2ZX3A 4AFMA 4R9DA 1VRH1 1RJ7A 1W6QB 4NHMA 4IEZA 3VHOA 3GBFA 4PJYA 3WP4A 1MS0A 2MPFA 2DCKA 1Z7S2 4K8FA 4BIFA 2EF6A 4GB33 2JENA 4JTNA 3N7KA 2PAMA 4PCRA 4DS0A 3D82A 2R32A 2XB6C 1WMDA 2D7FA 3E5QA 4UBGA 2OW4A 1NY72 1O4YA 2TBVA 3ZPYA 1BQPA 3V0BB 1QY4A 1PVC2 4GKXA 1PGL2 4A7YA 1U5XA 3LB9A 5AC93 2XUMA 4B8EA 3CNAA 2BEOA 5BNOA 3WY6A 5H9QA 3VUOA 4X6RB 2DCZA 2VOWA 1PO12 2K2SA 2VMIA 5IK4A 1AXYA 2HWE3 1URXA 2WINB 2E53A 5CFDA 3IMNA 2ZHLA 4OULA 4Y24A 1KJRA 1EAH3 3VN4A 2B45X 3VBRB 5F1RA 3UJQA 2HWD3 2HWE1 3WW1A 4IERA 3LA3A 2CYFA 1XE8A 4QMAA 1KDMA 4NPRA 2RM23 2RS13 4JRAA 2X5IC 4HBNA 1GNZA 1WD4A 1LU1A 1H30A 3AZYA 5GJ6A 4FSJA 1T6GC 1XXNA 1JOJA 2H0VA 1ENQA 1PHMA 2OIIA 3RG0A 3B7MA 1LHVA 3M3OA 5FOBB 1HRV3 1D0HA 1A3KA 3NKTA 4CZSA 4QHBA 4RQPA 4DINB 3AZZA 3UJOA 3MYXA 5GLTA 3WV6A 3J9SA 3VBRC 2R49A 1FMD2 1R1A3 2C5DA 2GMEA 3WZ1A 3WCRA 4BZ4A 2VH9A 3VHRA 5BNPC 2ET7A 1CD3G 1IPKA 4XDQA 4RL7A 2D3PA 2WT2A 4GMP0 1ZZ7A 1RUH1 2HWC1 4QT6A 2EXJA 4IEUA 4YNIA 2PHRA 3WDTA 5J96B 5T5OA 3MLKA 3VL8A 4QM8A 2SBAA 5CFCA 2AR6A 4BQ1A 5SV8A 1J3QA 5KC6A 4MXWB 1I3HA 1V00A 2QZ3A 4YVWB 4XTPA 3N7LA 4BH9A 2GC1A 2DF7A 3MW4A 1KITA 2DCTA 5JMCA 2VOVA 2VVFA 3QH6A 4CDXB 2K9ZA 5CADA 2ATFA 2CGNA 1WUVA 1VBB3 2XJTA 1C28A 1F5FA 2QJVA 4GA9A 4V1PA 1KS5A 4LUMA 4Y1UA 3WOGA 4MXWA 1ZX5A 4PIZA 3ZFFB 1RIRA 4M01A 2I74A 4ISQA 4Q0VA 1LOBA 4QQLA 1ZZ6A 2QE3A 4KU8A 4LLOA 3ME2A 2IXJA 3P3PA 4D3WA 1X8MA 2GC2A 4K3UA 1NY71 1XRUA 3M1HA 5LRRA 2GNMA 4Q4Y1 3OBRA 3AK0A 3E5UA 3M70A 4M3CB 2E7QA 3WW2A 1HRI3 2H6BA 2VVDA 4HVRA 4FQZA 1LKNA 4XFIA 1IS6A 4LBKA 3CLPA 5A32A 2EAAA 1AR92 4G3YC 5C9AB 1CN1A 2YGLA 3RJ2X 1Q43A 2HWD2 4TWTA 5GM0A 2EXIA 3MW2A 5E88A 2CWSA 1QJY1 3TB0A 3H7JA 1HKDA 2MNGA 4AWDA 2ZX1A 1MQTA 5CBLA 1PO13 1XYPA 4LBNA 4BE3A 1R083 1CONA 4HSLA 5I0RA 5K0UC 1RC6A 3MIGA 1MEC2 3EXUA 4Q4Y2 1XNCA 1BBT2 1BMV1 2ZA9A 4YVSB 4UW5A 3VL9A 5EYYA 2E7AA 4HSJA 1OA2A 3AKTA 4B29A 3PJYA 2YUEA 4JV4A 4FAHA 1N1YA 2ENRA 4IV1B 3ILRA 4HETA 4K20A 4CP2A 4AF9A 1FI2A 3WNXA 1YFXA 2FMYA 2R1DA 5FREA 4AEDB 2MEV1 2XVGA 4JQRA 1EV11 4DY5A 3OYWB 5CG9A 3WG2A 1QJU3 1CPMA 4UXAA 2VU9A 1PGW2 3HT1A 1YJKA 4XBQA 2OA2A 2ZMLA 4CP0A 2PA7A 3WHUA 1W0OA 1GFF2 1BBT1 3VZMA 5KC5A 1IOAA 4Y22B 1W6QA 4HK9A 1RUE3 3PLQA 3D0JA 1H2NA 3AJYA 1X50A 1H1IA 1W6OB 4H3WA 4AW7A 2Q1MA 5H9PA 2WS91 4F83A 3QH7A 1ZRCA 1FOD3 1UPSA 2ZGMA 4D7TA 1QQP1 1V6KA 4FAGA 2X5IB 3BALA 4JAAA 1QJU1 2Q8OA 4CDUC 4BA6A 1WBFA 3JUUA 1EAH1 1LHWA 4AYUA 4BMEA 5GLUA 4LE3A 2D98A 2G9GA 1POV1 2D6LX 2DUPA 2GNTA 3HMYA 1TME2 3M8LA 4JGYC 4YFZA 3AYEA 2NMOA 1H8VA 1KQRA 1WLTA 1QOTA 3ZIXA 3ST7A 4Q4V1 3UV9A 1WW6A 4XJ9A 3CO2A 2ZZJA 4F8AA 1H1MA 3X29B 1W6OA 1ND3C 1MS1A 2PELA 4MGZE 1LTEA 3WQ7A 4Y22A 1HRV2 4XEZA 4QGNA 1RB8G 2Y38A 1V6JA 3I2DA 3O0VA 3PTYA 3JQXA 3VHNA 3T1MA 3KSCA 5JWPA 3S7IA 1ZBA1 3PMEA 5ACA2 3ZVXA 3KGLA 3BPZA 2Q4SA 4BM8A 5I8TA 4NN0A 1ZBE3 1KFXL 4CTEA 1RTVA 4EV0A 3ZYIB 2R071 4CDUA 1Q8QA 1UKGA 2PAKA 5AVPA 3UL2A 3U11A 3VKLA 2GDFA 2I2SA 3B9CA 4CEWC 2WZR2 3ZFEB 2ZX0A 4OHYA 1KRIA 1TME1 3S30A 2VULA 2GH2A 3ZFEC 2IXKA 2Y0IA 4WM8B 5IK8A 4INDA 1G6NA 3BB6A 2DVGA 2UU8A 3SITA 3OPZA 3ALQA 2ES3A 1N3OA 1AYM3 2WFF3 1SLLA 1DBNA 3IKWA 2VMGA 4CDWB 1XNBA 3FFZA 1VBE2 3CJIA 4QQ2A 1ND3A 4XJWA 1ULDA 1QU0A 3BTAA 3MLLA 4BWOA 3W9AA 1Z7S1 1CAUA 2R1BA 1FPN2 4FBFA 1XE7A 2VOXA 1SMVA 5E89A 1C1FA 3VBSA 3OBTA 1D4M1 3ZX7A 2JECA 1BXHA 4I3PA 1DGRA 1CAXB 3ZN6A 2ZGKA 2OPKA 3H0OA 1JW6A 4M3CA 4TYSA 3NV4A 3LA2A 4QU2A 4RQPC 4XJ8A 2NZ9A 5GLZA 1RUG2 4COVA 2IXLA 2AENA 3TN93 1GICA 3FWEA 1LB2A 1G7YA 1PGW1 1R093 3HBZA 4AFAA 1D2SA 4YM2A 5FTTC 4AFCA 3AKSA 4AGGA 4GXLA 2VGDA 1PK6C 2ZCWA 4MGKE 4UW6A 5GZGA 2GC3A 3KMHA 3ZFFA 3ZSMA 3E6CC 4DB5A 2HKXA 2IWGB 2A6XA 1DQ1A 4OI0A 4Q0PA 5T54A 2NP0A 3VDDB 1U5IA 2RR11 4COZA 1S1AA 1J59A 3MFAA 3ZSJA 3OD4A 2BW8A 1H2MA 2D97A 5KXCA 2B42B 4IV3C 4JGYA 4YGDA 1SLBA 1BVP1 1S0EA 2PLV1 3QLQA 2R073 1OKQA 1HRV1 4YG3A 2AH2A 4EWAA 2C9AA 1KJLA 4BYYA 2UWCA 3M3EA 5HXVA 4XBNA 3K48A 4TLFA 2NPIA 5EZWA 3LOIA 1CESA 1OA3A 2VXRA 5K8SA 1PO22 3NV1A 4GKYA 3WG4A 1HV1A 1I6XA 3WDUA 1REEA 1AF9A 1LECA 1YIFA 3ES4A 4I2OA 3KCXA 4FOYA 4LTAA 1ULEA 4M0HA 1R082 1YCIA 3WXPA 3ZXJA 1COV3 2RR13 4OHWA 2H6CA 2XJQA 4XQDA 5F5QA 4YYOA 1RHI3 4HKWA 3N7MA 4GMP1 4LO6B 3KQRA 4HFSA 1ZVFA 1O4ZA 1WMEA 2ZMKA 3RYPA 1ZRDA 4JGZC 4EN6B 1DZQA 4HN0A 1UU6A 1GQHA 3TN91 1SFNA 2D6NA 1V6MA 2Q1ZB 2JE7A 4AVBA 1UIKA 5K9YA 4K1YA 3WINE 3UK9A 1MS4A 3ZXFA 1IKPA 1BEV2 4D7SA 1O5UA 1QJX3 2BGCA 1ZA4A 1V6NA 5FBZA 3T2TA 4YW1A 1Q8VA 3VBHC 2P3IA 3LCPA 1X36A 3NWKA 3AB0A 4YG6A 2BWAA