4BMBA

Crystal structure of the n terminal domain of human galectin 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-8
publication title Natural Single Amino Acid Polymorphism (F19Y) in Human Galectin-8: Detection of Structural Alterations and Increased Growth-Regulatory Activity on Tumor Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bmbA00
1F5FA 4TZDA 4P14A 2I2SA 3PJQA 4XJ9A 3WZ1A 2D6NA 3PVEA 5HCFA 4LBQB 4YZ1A 1BJQA 2DU1A 4YFWA 1LGBA 2E53A 4XJUA 2AUYA 4DQAA 3V0AB 1CJPA 3LSDA 1UN1A 2DVDA 3OY8A 1LOAA 1GANA 5H9RA 5GZFA 2A70A 4Y24A 1VAMA 2A71A 3AP5A 4LBQD 2ZGSA 5CNAA 3RRDA 2AREA 2DUQA 4JRAA 3M2MA 1KRIA 2P2KA 1GICA 3ATGA 1LENA 2D43A 1WLDA 1LOGA 2H0BA 5IK7A 3N7LA 3ZXLA 3M1HA 1R1ZA 1ZM1A 4Y22A 3ZYPA 1I1EA 2ARBA 3FBYA 3RQ0A 1WW6A 1N3OA 4Y20A 4M3CF 1TEIA 5GZCA 1WLWA 2R1DA 1WD3A 3AYCA 2DURA 3ZSKA 2WLQA 3NV2A 5JVVA 1N47A 1QU0A 1WW4A 1JW6A 3FFZA 4K1ZA 5DZFA 3T1LA 3WG4A 1CIWA 3AZVA 3B01A 1IOAA 2P3KA 2ZA9A 4Q8KA 3ZSLA 5GJ6A 3ZPYA 5CBLA 5BYNA 3RMYA 2ZMKA 2SBAA 5KXCA 3N36A 5GLWA 1FX5A 1DQ5A 3OBRA 4LBMA 5DG1A 1GBGA 4LBKA 4BMEA 4YGBA 4AVVA 5DZEA 4U36A 5EYXA 3N3HA 1DYPA 1LULA 1VLNA 5IK5A 4K20A 2D6OX 1DFQA 3ASIA 4ASMB 4BLIA 5IK8A 3B69A 2ZGLA 4BLJA 1W6PA 4Q2FA 1S0GA 4P9YA 1KDMA 4CTEA 4YM0A 2BQPA 2GNTA 4YZ3A 1MZ5A 2DVFA 3WCSA 3WUCA 3KQRA 3APBA 1G86A 2ENRA 4BPZA 5GZEA 5CA6A 2AGSA 2A5ZA 4Y26A 4YW4A 4P9WA 3WDWA 4XJWA 2ZGPA 4H55A 1DBNA 3WLUA 5DUXA 1PZ7A 1KJRA 3I8TA 4FP3A 1WLCA 3L2YA 1VALA 2LTNA 1QF3A 1S0IA 4PQ9A 1C4RA 2ZMLA 2DTYA 1LOFA 4L8QA 4LBLA 1QGLA 2D3SA 3VV1A 4YW3A 2W39A 4Y1YA 3DUIA 1JUIA 2WKKA 4LBQA 4TYSA 4Y20B 4YGCA 4YW5A 1WW5A 3D5OA 3WCRA 1DLLA 3ZSMA 5JDBA 1G7YA 3V0AA 2ZGUA 4OZXA 4AGGA 1WD4A 3FLRA 3PVOA 2GN7A 1RITA 2AYHA 5EWSA 1ENRA 2A6XA 5GLZA 5JOZA 4RL7A 4M00A 1F9KA 1HLCA 1G9BA 1AX1A 3AXDA 3AYEA 2ZGNA 1CONA 3LCPA 1Q8PA 1JYCA 1DQ6A 4BOWA 1C1FA 5AVAA 4CRQA 1W6MB 5T5LA 1J1TA 1SACA 4Q1RA 2PHXA 3N7KA 4XXAA 3GNEA 1GNHA 3WDXA 2D6PA 4XOGA 4YM3A 3AZXA 5IUQA 3OYWA 1W6PB 1BQPA 2GMMA 4YG3A 1UX6A 1AJOA 4C1WA 1N3PA 4YZ2A 1JBCA 2WT1A 5JLVA 3AZWA 3POWA 3AX4A 1SLTA 1WBFA 3JUUA 1QDOA 1LCLA 1JOJA 1LU1A 3ZXKA 4ZKTB 5GZGA 3M3OA 1FAYA 1FYUA 1SLIA 3FLTA 4HL0A 4XHXA 4XMAA 1I3HA 5H9QA 1D2SA 1B09A 1GZ9A 4YG0A 3HMYA 4Z8BA 3V0BB 2NMNA 4XHBA 2ZHLA 2A6YA 2W68A 1MVEA 2A75A 2VW0A 3WVJA 2JKBA 2JJ6A 3WDYA 3QCWA 2GALA 3AK0A 2FHRA 4GXLA 4Q8LA 1H9PA 1YIFA 1DQ4A 2GNDA 2R0FA 3HN1A 4GKXA 4M3CE 4M3CB 4UW6A 3W58A 1Q56A 1UZZA 2VW1A 1AXYA 3OJBA 1G9AA 1JXNA 2ZHNA 3AZYA 4UW4A 1SBDA 3O0WA 1S0CA 2VXRA 1S0JA 1GYKA 1GZCA 2A7AA 2Z42A 5E8AA 4XJAA 1V6IA 3WG2A 1DQ2A 1BXHA 2DUPA 3BOPA 3SH3A 1Z0HA 1HQLA 1RIRA 1D0HA 4NOTA 3WUDA 1QOSA 4ITCA 1GSLA 4FOYA 4UW3A 4LBJA 3VKLA 2R1BA 3SITA 1S0EA 4YLZA 3MPPG 5GM0A 2R16A 1VIWB 1MS3A 4ATEA 4R9CA 3OYWB 5DZGA 3BODA 5JMCA 1XQNA 2ZGRA 5JOYA 4R9AA 1QDCA 1HDKA 1KQRA 1WBLA 4XXPA 4YFZA 4GALA 1A8DA 3SLIA 5KXBA 5T55A 2CWSA 3OGGA 2C5DA 3POSA 2VUAA 2EXIA 3ZYRA 4BM8A 2V73A 5H9PA 1DQ1A 1YO8A 2WQZC 1QKQA 3OPZA 5FRAA 2D6LX 3IN9A 1W6MA 1G8WA 4R9BA 4YGDA 5T54A 3ZXJA 2EALA 1A78A 2NZ9A 4P9XA 4C1XA 5CAZA 1LHNA 1OQ1A 2PELA 4M01A 4PBPA 5L73A 2A3YA 1IS5A 2P3IA 1QMJA 4Y1UA 4DPNA 2Q5TA 3TB0A 3T2TA 4FOWA 3JU9A 4ATFA 2KM2A 3WNXA 1ULFA 5JOWA 4FQ4A 2A6VA 2DVGA 4FOVA 1CPMA 3NV1A 4I30A 3SH4A 2PHWA 1FV3A 4FPKA 4KBBA 1MS5A 3FUOA 4JC1A 1HQWA 1W0PA 2ZMNA 1Z78A 3V0BA 1G9DA 3KM5A 3WG1A 1H9WA 1YXWA 2B7YA 3NV4A 4FQZA 3UK9A 4D69A 3N35A 3VUOA 3PMEA 1WCSA 2UURA 3U4XA 2RHPA 1FATA 1APNA 1AXZA 1QOOA 2E7QA 2EXKA 2PHFA 2WSVA 1Q8SA 2D6KA 4PCRA 5EXOA 4M3CA 1BZWA 2GDFA 2P3JA 3DGTA 1W6NB 2JE9A 2XG3A 4XBNA 2VU9A 4XYXA 1GNZA 1LHUA 4WZFA 1LJ7A 4FVVA 2E51A 4Q27A 1LOFC 2EF6A 1NLSA 5H9SA 1BYHA 1IS3A 2W52A 5T5OA 2GN3A 2D44A 1X50A 4GA9A 4Y1VA 3RS6A 3O0VA 4BMBA 5CB7A 2NYYA 5DXDA 2NP0A 4FPCA 2DU0A 1MACA 1MS8A 1V00A 2NM1A 3AYDA 4PF5A 5GLVA 4YM1A 1AX0A 2OUHA 4FPFA 4U2AA 2UWCA 3ZSJA 2C9AA 2ERFA 1KDKA 4WVVA 2EAKA 1W6OB 2NN8A 2ZGOA 1W6QB 1LESA 2P37A 3SH5A 2ZKNA 1CVNA 1N1SA 5FREA 1DHKB 1URXA 1QNWA 3AXEA 3SISA 3WDUA 3USUB 2WT2A 1LEDA 2UWBA 1N1YA 3WHUA 1IS6A 4LBNA 1BKZA 5E89A 2NMOA 3CNAA 2CTVA 1LEMA 1S0FA 3QLQA 3M3QA 1N1VA 2ES3A 2GNMA 3OBTA 5KXDA 1ULCA 2D7FA 1MR5A 4XIKA 1ENSA 4AVTA 3I4IA 1EPWA 3O12A 1PZ9A 1SFYA 2DTWA 4XJ8A 4DS0A 3MEPA 1V6LA 3IKWA 1AX2A 2VH9A 4UW5A 4YG6A 3VKOA 2A6ZA 3GALA 2CWMA 4K1YA 1JYIA 1AZDA 3Q9OA 2WJSA 1DZQA 3FUQA 3N7MA 1SBEA 1ULDA 1LOEA 1S1AA 4GWMA 4YW1A 1H30A 4MYEA 5GLUA 4FPLA 2ZGKA 3AJYA 1N1TA 1SLCA 1DIWA 4XTMA 4YZ5A 3AP9A 4AWDA 4XBQA 3SNMA 1CN1A 1GLHA 1SCRA 2PHRA 4PBOA 1C57A 2DYCA 3V65A 1GKBA 3AP6A 1VAVA 3O5SA 3H0OA 4AVSA 3M3EA 4NO4A 1IKPA 3NWKA 5E88A 1V6KA 1AXKA 3WDTA 1F31A 3C2UA 4YM2A 3ILNA 1G9FA 3AFKA 5GALA 3VKMA 3ZXFA 2GNBA 1ONAA 3N7JA 1W6NA 5DUUA 5HCBA 3UL2A 1Y7BA 3FLPA 1DGLA 3AYAA 2AR6A 3ILRA 5F9TA 2DUOA 1WUVA 2DVAA 3D6EA 2ZABA 5DG2A 3ILFA 5DUVA 4AGRA 3ENRA 2DWRA 1LHVA 2PHTA 3IMNA 1AF9A 2E6VA 5GLTA 1DYKA 2ZGTA 4GWNA 3M3CA 3B9CA 1KJLA 1GV9A 2YROA 3RMXA 1LGCA 4FPEA 2D6MA 3INAA 1WW7A 3IPVB 3IM0A 2AH2A 4XMIA 2FMDA 1ULGA 1Q8OA 2ZHKA 3UJQA 5LK5A 3WHTA 2VY0A 5T5JA 2EXJA 3D4KA 1FNZA 3W59A 2YZ4A 1U0AA 2WT0A 1LECA 3NV3A 1CPNA 1W6OA 1SLLA 2D3PA 5T52A 2EIGA 1W6QA 1UPSA 4XDQA 2EXHA 3O0XA 1AVBA 1JN2P 4ISQA 3ZVXA 2D3RA 4GKYA 3USUA 3R4UA 1GZWA 2W08A 1SCSA 2AENA 1PZ8A 2TEPA 3HR9A 3R4SA 1Q8QA 5GZDA 3TAYA 2SLIA 3LSEA 4ZXKA 5KXEA 1N3QA 4XJZA 2ZZJA 4FPJA 4FP2A 3WDVA 2OVUA 4XZPA 3WV6A 4IQPA 4AYUA 1AJKA 2VW2A 4WVWA 2XB6C 1ULEA 3B00A 4Q26A 3RG0A 2DVBA 1V6OA 3AZZA 1DQ0A 2JDZA 1S0BA 3A0NA 1LHOA 5DUWA 1O4YA 3MW3A 2PHUA 3OY8B 1IS4A 3PVNA 2UU8A 3AP7A 4SLIA 1Q8VA 2YY1A 2A6WA 2CY6A 2R49A 1MS0A 4ISRA 2JECA 4LBOA 4XTPA 4W65A 4F83A 1UKGA 1FNYA 2WNEA 1YRZA 4R9DA 4DFSA 4WV8A 2ARXA 5HCAA 2ZGQA 5EYYA 5T50A 5IK4A 4FPOB 1LHWA 2CL2A 3B3QE 4FPHA 4Y1XA 2YV8A 4Y22B 2A3WA 1O4ZA 1HKDA 1MVQA 3BIWE 2ZHMA 1LOCA 1CR7A 4JCKA 1SLAA 1KITA 1RINA 4XBLA 3V64A 4DRVA 1V6NA 2A3XA 2P34A 3A0KA 4XIOA 1C1LA 1SLBA 5JOXA 1JHNA 1ZA4A 4RA0A 1UZYA 2YMZA 4FOQA 2ZACA 4BQ1A 1LODA 1QOTA 1V6MA 4Y1ZA 1G9CA 1GZWB 3A4UA 2GMPA 1CESA 5SV8A 2OW4A 3POYA 1YI7A 1MS1A 3WG3A 2ZBJA 4YGEA 3WOGA 4YW2A 2UWAA 2G4IA 1S0DA 1YYNA 2JE7A 3UJOA 2HYKA 1MZ6A 2CYFA 3IPVA 1MS4A 1LOBA 1IKQA 3VKFC 3MW4A 1FV2A 1NXD1 2YXSA 1SBFA 2JD4A 4FPYA 2CNAA 2V5YA 4Q1PA 5F5QA 3RSJA 1A3KA 4HANA 1V6JA 3ZXEA 2R0HA 3R05A 1QNYA 3T1MA 4YZ4A 3BTAA 4CZSA 5T5PA 1OFSA 4XILA 2DV9A 2LALA 1CQ9A 1MS9A 4FPGA 1LU2A 2E7TA 2OUJA 3MW2A 1UAIA 2WSUA 3AJZA 1W0OA 3AP4A 4XE9A 4AGVA 4DRRA 1UMZA 2ZGMA 1LGNA 1OKQA 2ZAAA 2GMEA 4K21A 5IT6A 1ENQA 1UL9A 1LTEA 3VKNA
chains in the Genus database with same CATH superfamily
1F5FA 3T0BA 4AK3A 5CU1A 1PGW2 4JAAA 1R64A 2P4EA 2VMHA 4XUOA 5FK8A 1QY4A 1K5MA 2RJKA 5FZFA 4LIUA 4LBQB 3JQWA 1RHI3 5BNNB 2HWF1 4X6RB 2KA3A 1XYOA 4XJUA 3VD9A 4BQ2A 5DAWA 2P6CA 3HQUA 2K9ZA 2CDPA 2ZX4A 2VOXA 4UAPA 4CP2A 3HNYM 5C8CA 2ZS6B 3H8XA 4Y24A 5FIXA 2A71A 2O1QA 1FXZA 2R072 4YW6A 2AREA 3PMSA 4N90A 4RGAA 4IE5A 2QDNA 2ZX2A 3O14A 4Y5TA 5LBBA 5LY2A 4DUXA 1GICA 1BEV2 5FZ3A 1H1MA 1B35B 2H0BA 3OPWA 5IK7A 3N7LA 2GSYA 1XNTA 4ZZ8A 1R1ZA 4Q4W1 2QE3A 1RUD1 2BERA 2J1UA 2WWUA 3K51A 4UWDA 3HBKA 5C8CC 3KWVA 4QPGA 1U12A 4M3CF 4E8CA 1YFYA 3VZLA 1PNFA 5ABJA 3WW2A 4CCLA 1O6UA 1PMJX 3AYCA 4BQYA 4EZHA 1YFUA 2DURA 1HN1A 4QHOA 1N47A 4HSJA 5DZFA 3FFZA 5HI0A 3KV9A 1PO13 1CIWA 4XCAA 3KV6A 3B01A 3CMGA 2JB8A 3UGFA 2DCZA 3ZYHA 5LY1A 4RHV3 4Q0UA 3VBOC 1X36A 2B4KA 5BYNA 1UXZA 2SBAA 1RUG1 2G9GA 5C6CA 3N36A 3GZUC 1HB2A 1IG3A 1FX5A 5FPAA 4AVBA 5DG1A 3O1UA 1ZBA2 1HV1A 1PGW1 2VOWA 1IPJA 3DPRA 5EYXA 5I93A 3N3HA 4CYDA 5FKBA 1XXNA 2BOJA 1OSGA 3ZO0B 2ZGLA 1W6PA 3Q8EA 1PM7A 1WCKA 3MHZA 3MYXA 4HOOA 4YM0A 4CTEA 5LWBA 2BQPA 2GNTA 4YZ3A 1MZ5A 2R071 3OD4A 2XBO2 2AGSA 4Y26A 4N53A 1ZX5A 3F95A 4P9WA 1ZZ7A 1RVF3 2VUCA 2ZGPA 3ABZA 1X82A 2BGPA 3P1IA 1BEV1 4XJWA 3W5NA 2Q0AA 1Y9QA 3MO4A 4LO4B 5FPVA 5DUXA 3TRSB 1ND2C 1QJU3 4AF9A 4JKKA 1TME3 2BWAA 3PUHA 3ES4A 3KT4A 3MICA 1XNKA 1S55A 1VALA 2LTNA 3CIHA 4Q5OA 4PQ9A 4GD4A 5J36A 2DTYA 1LOFA 3DF0A 4NIIA 2JDMA 2JX9A 3RWNA 3VV1A 4E27A 2W39A 2FD8A 1H2MA 2HYXA 3G7DA 1JUIA 4L11A 4QPGB 2BFUL 5E16A 4YW5A 1WW5A 2FCVA 2BPA2 5F2SA 1DLLA 3ZSMA 5FZEA 3V0AA 2ZGUA 4W6XA 1ULPA 4AGGA 1WKYA 2GN7A 5FOBB 3J26N 4EN9B 5I0SA 2ZEYA 4QX2A 1S4CA 3IZOA 2QJVA 3S0MA 4R8HA 4XFFA 1VBD2 2V4VA 1ZBA1 4MGQA 4PLNA 3DEMA 2WZR2 2KR2A 3ZSEA 1PO23 4J25A 1JYTA 1C1FA 4ZU4A 2CAUA 1DP0A 4OI1A 4CRQA 2WQ8A 4MG2A 1VBE2 3GNEA 1O3SA 3WSOA 4CEYB 4YM3A 4LJHA 4TLFA 1W6PB 3BI3A 2PTMA 2LM3A 2XBO1 4C1WA 3K75B 5FY4A 4AQTA 3JUUA 5JXGA 5FY7A 4JHZA 5A33B 1JOJA 1LU1A 1GOGA 4ZKTB 5GZGA 1CJDA 1FAYA 1D4M2 2QZ3A 3N9NA 1GZ9A 5LCWL 1UX7A 2IFWA 3MIFA 5DDJ2 4Z8BA 3W20A 3H8OA 5HXMA 4XHBA 4ZZ5A 3DN7A 2WYSA 1EUTA 1MVEA 1VBC2 5DPNA 1AR82 3WDYA 4L99A 1VJ2A 2GALA 4IV3A 4CUGA 2Y6LA 3TN93 4NIHA 3CZUA 4GXLA 2R0FA 2GNDA 4GKXA 4M3CB 5DAQA 3WF0A 4BQXA 5A1LA 5A6XA 2VW1A 3W5MA 1SEFA 3EO6A 1W05A 5HPOA 1VBD1 2ZHNA 3SMHA 1TNRA 1SBDA 5FZ1A 2JDPA 2FZ1A 4K7JA 4BWOA 2WZR1 3OUHA 2W87A 2EIEA 3PHMA 2V4AA 3WG2A 2DCTA 4CUAA 1BXHA 1DQ2A 3HBZA 1VBE1 5BNOB 3CDZB 2WABA 2BBAA 3HNMA 3GHMA 3MIDA 1VPHA 2JDYA 4LBJA 1S0EA 2R30A 3LZZA 3MLJA 2FMYA 1RUI3 4RQPA 3WQ7A 4K8FA 4OUEA 5FP7A 2AC1A 4CEWA 1HXS1 5CFCC 4MVTA 1JYWA 2QQWA 3Q8FA 5FAXA 4Z07A 2UYAA 1HDKA 3OF1A 1CAXA 1D4M1 1A8DA 4QPIA 5FLIA 3KS7A 3T3YA 3VBRC 2VULA 4QGLA 4XFHA 5T55A 3PIGA 1PMIA 4IGPA 4KL1A 5DDJ1 3POSA 5IATA 2HEYF 4AAPA 5I0UA 1OOPC 1XU1A 4QXKA 1DQ1A 1VBC1 4XFGA 1NAEA 2D6LX 3E5QA 3IN9A 4JTOA 1AR81 1W6MA 3SEPA 2JG8A 4R9BA 4YGDA 3THTA 3ZXJA 2ET1A 4IW3A 4XF4A 4QDSA 3WNKA 1UZVA 2C6SA 1XPWA 2BEOA 3ZR6A 4IV3B 2K2SA 2XJUA 1J59A 4OZOA 4UFHA 3J9SA 4C0BA 4MH0E 1GMMA 1IS5A 1RYYA 1QMJA 1Z7S3 2P3IA 2Q5TA 4JKLA 4Y1UA 2AZ5A 1GP4A 2PLV3 5FYTA 3WF2A 4FOWA 2R043 4WM7A 5FXZA 1NLQA 4ATFA 3WNXA 1OC1A 1ULFA 3BALA 4HPKA 2FCTA 4FQ4A 4RGKA 5FUPA 5L9RA 4OHVA 1QJX3 1CPMA 3DL3A 4AHXA 4LHLA 4BQ3A 1QJZA 5ACA2 1XNBA 2JDUA 2MEV3 4XF3A 3JD73 4COUA 1R083 5LASA 4V2VA 4V1PA 2ORXA 3KM5A 1ZZ6A 4WM8A 1YXWA 1YFXA 4FQZA 3UK9A 3PMEA 1PK6C 3LKJA 1UYYA 1W39A 3UKVA 5FZOB 4HVQA 2RHPA 1AUYA 1FATA 2ARAA 2EXKA 2KXLA 2PHFA 3CL1A 2D6KA 2VZQA 4PCRA 2JD9A 4QKFA 4MGSA 1BZWA 4W6WA 4BDVB 2CU5A 2QQNA 4MV2A 5F3CA 4K6BA 4AI0A 4CEWB 3H8UA 4CDUA 2JE9A 2WWSA 2Y33A 3THPA 4XBNA 1OXCA 2ZCWA 2XL7A 1CAXB 3U10A 4B4PA 4QPIB 3VD4A 4PQQA 4FVVA 1W8OA 3TOJA 1LB2A 1I6XA 2EF6A 5CYYA 1H4HA 4FXKB 5H9SA 5SV5A 2JB4A 2V09A 3C7HA 1NA1B 3EYPA 5DXDA 1DF0A 3ZFGA 4FPCA 2J1RA 1R1A2 2Y34A 2JG8B 5FMBA 4AG4A 2B9UA 3TBDA 3IDAA 1O8PA 1RHI2 4Q0QA 2ERFA 4WVVA 1RUOA 4BXSV 1OUSA 2P37A 2R32A 2YFUA 1F2NA 5F32A 5FREA 3SHRA 3HQXA 3SISA 5ACA1 1QNWA 4WM7B 4Q4V2 4CUBA 4FT8A 4HPKB 3VBSC 3ME2A 3MBWA 2OX0A 3IWZA 4NAOA 3MUZ1 4META 1LEDA 2UWBA 1N1YA 3HAGA 4AVCA 3BPSA 3U78A 2WIIB 2DF7A 4OHXA 1HRI3 2BUKA 4XQDA 1NLRA 4QU1A 1S0FA 2QQIA 3M3QA 5IW0A 4O7XA 3H3LA 2GNMA 3KCCA 4WM8B 3T09A 5FMDA 3ROUA 4BK4A 3NVCA 1ZZ8A 4UI9L 2DBNA 1EPWA 1UIJA 1PZ9A 1SFYA 3O12A 4CDWA 1F35A 2X53S 1V6LA 4XW3A 4NUBA 3EB7A 3OCPA 1QEXA 1KEXA 4AL9A 1AZDA 2WR9A 2HWC3 4EE2A 1YQ8A 2JG9A 1H4GA 1L7QA 3ZPOA 1QJY3 1PO12 1S1AA 1F15A 3FC0A 4GWMA 3D0SA 1H30A 4MADA 4Q29A 4XUPA 1GWLA 1WA4A 4QGMA 4JQTA 1EP0A 3UKNA 1C8NA 2J22A 4IUGA 4I0BA 1HX6A 4BQ4A 1R1A1 1GWKA 2DYCA 3FHIB 2ZEWA 1L7LA 3V65A 4LKSA 4IE0A 5EJZB 5BNQA 3ZFGB 2JG9C 3H0OA 2XQRA 3M3EA 4NO4A 1IKPA 4CCKA 1RHI1 4CU7A 1V6KA 1AXKA 3BYWA 4WZCA 5IHRA 2WAOA 3ILNA 3IT8A 1G9FA 4MGYE 4COYA 1KD7A 1RTVA 4QKDA 5K0UB 2WAAA 5BNPB 4XEZA 1JTZX 4Q4V1 2A73B 2TUNA 1DGLA 5FLHA 2VCCA 2DVAA 3D6EA 4IE7A 4ZU5A 5F37A 3QD6A 5IFTA 3B5LB 4OQ9A 1RVF2 2Y38A 2VZSA 2ZZQA 4H3WA 5FBJA 1VMHA 3M3CA 4B7KA 4BCUA 4L97A 3OUJA 1QJU2 2YUEA 1E57A 2VMFA 2IXHA 4FPEA 3GJAA 3IPVB 2W0XA 3IM0A 3S5QA 3VB9A 3BVCA 5I0TA 4IV1C 2ZHKA 3WHTA 1UOBA 5LK5A 4DEQA 5T5JA 4AFCA 1RB8G 1MEC3 2XLFA 4HXCA 3WINE 4CDWB 1LECA 4GH4B 1EAH2 1STMA 5A32A 2WQ4A 2QTWB 3RWKX 2CHHA 3ZXAC 1CIYA 1PO11 1W6QA 4GWIA 4XDQA 4AHYA 2EXHA 3O0XA 1AVBA 1JN2P 2WZPP 2OQ6A 5G05L 4UFMA 3ZVXA 4R52A 3USUA 3UKTA 4GMP3 2ZJCA 3GCWA 3R4SA 5CISA 1SCSA 2Y8KA 3TAYA 4NRPA 4ZXKA 1ZRCA 1N3QA 4XJZA 3V64A 4CCJA 4Y5Z0 3WDVA 4K40A 4AYUA 1VRH3 5FO9B 1TE1B 1QHDA 1X9PA 3NAPA 1PO22 4XETA 4S2DA 4LQRA 4LMFA 1ULEA 4Q26A 5DN2A 3MFCA 2XJQA 1U5YA 2Y6HA 5FZMA 3WXPA 3MPBA 1JYXA 3AMPA 2IWGB 3IIAA 2RDSA 4L0PA 4ZS3A 3A0NA 2HEWF 1O4YA 1OA2A 3PU3A 4FTBA 1PVXA 4NPLA 3OGVA 3PVNA 3AP7A 3AL5A 3DXTA 1QXPA 3Q8AA 1RVF1 3U14A 4ISRA 1S2BA 3L9JT 4F83A 4W65A 1QJU1 3BGAA 1ZRDA 2VZTA 4HK8A 1C5IA 2UY9A 2I74A 3ACGA 1VBB3 5I8YA 5IK4A 2RVAA 3WF1A 1DZRA 1LHWA 4FPHA 4Y1XA 2A3WA 4FTSA 1O4ZA 4C91A 1EAH1 3BIWE 1GFF2 4XFAA 3AVRA 1DGWX 1SDDB 3KZ4C 4LUKA 5FXWA 4C8DA 3TN92 4TWTA 4E4SA 5IAVA 3QACA 1SLBA 2WLPA 5JOWA 5FP3A 5JOXA 1JHNA 1UZYA 2VOVA 3EJKA 3AKPA 3H9AA 4HSLA 5IYYA 1QOTA 4BZ4A 3ACIA 2Q8EA 3ZXGA 4HKWA 4I3GA 1MS1A 1PO21 3POFA 4GULA 4S2FA 4GWJA 3KVAA 4KWUA 4QHZA 1GNYA 2UWAA 2G4IA 4YW2A 1PHMA 2Q30A 3DV8A 2D93A 4AHZA 2WZEA 1YC61 4DXSA 1US2A 1IKQA 3I2KA 3WNNA 4E2QA 1UMIA 1SBFA 4Q1PA 1AR73 1A3KA 1YI9A 1E5RA 3VDDA 3WP4A 1NCRA 4PDWA 5FYHA 3PURA 1OFSA 2QQKA 3THDA 5D1IA 2ADEA 3GGLA 4ARXA 4DEVA 1DGWA 1TQ5A 2E7TA 4W4ZA 2OUJA 5JR7B 1ZREA 1UAIA 3CF6E 1W9WA 4I01A 4OUMA 2ZGMA 4PHZA 4N43A 1OKQA 4QHBA 4K21A 3NSTA 4RR3B 4FAGA 5FO8B 1UL9A 1LTEA 4IEQA 3CLPA 2D6NA 2Q1MA 3OD0A 1XE0A 3POEA 3PVEA 5HCFA 2C24A 2JIJA 2PAMA 2C0ZA 1W8HA 3NJVA 3DKQA 1BJQA 3TN91 4COVA 5LW9A 4YFWA 1LGBA 4N7UA 2E53A 4QPYA 5EV7A 1BVP1 4XZUG 3QH7A 5LBCA 4AQ2A 4LO8A 1UN1A 3RJ2X 1LOAA 1GANA 2VQUA 2VC9A 3NKGA 3AP5A 4LBQD 2PLV2 3S30A 4M0HA 2R042 3I59B 3RRDA 4MLOA 5B2GB 4ZS2A 1QJX2 1O3TA 4X8NA 3T2OA 1W99A 1LENA 1OQDA 4QKNA 2MEV2 1W9FA 4IERA 2WO2A 1R082 3K4DA 3ZXLA 5A3UA 1ZM1A 1S2EA 5D8AC 3ZYPA 5C3OA 5FPBA 3RQ0A 1WW6A 4UFLA 4Y4RA 2ILMA 4FCAA 3VDAA 1SG3A 1WD3A 5ANNA 4D3WA 3KLSA 5FP4A 2VGDA 3NL1A 3FL7A 1NCRB 4LLOA 1JW6A 4XUQA 2DFCA 4DIQA 4O9GA 4HK9A 2P3KA 2RS33 2OQ7A 3ZSLA 3T0DA 5A3MA 5GJ6A 2VNGA 3C3VA 1J58A 5FYZA 3UGHA 5GLWA 4N43B 5KC6A 3EHKA 4BMEA 4YVWA 1JOBA 4YGBA 4AVVA 2AEZA 4CDXC 3UNPA 3JB4C 3RI9A 1JI6A 3T2PA 5IK5A 4E2GA 5F3GA 1MQTC 3ASIA 4BLIA 4O65A 1ND3B 2IFRA 1HJGA 5IK8A 3NW4A 3I3MA 1VMJA 3I2FA 3BTZA 4WVZA 3GDBA 4LK7A 4P5YA 4BIOA 1O8SA 3U4SA 3WCSA 3I3BA 2PLV1 3T08A 1G86A 2ENRA 2R041 2VQAA 4BISA 4BPZA 1CAVA 4B4QA 1QJX1 1QXRA 5FJHA 5HXVA 1DBNA 4BQ5A 2WNUC 1KGYA 5HV4A 5FUIA 1R081 1KJRA 4QDQA 1WLCA 5F3IA 1ZZBA 3K2OA 1HRI2 2W47A 4L92A 1S0IA 3GZEA 5JPNB 1C4RA 3HT1A 2ZMLA 4TZDA 5FPZA 2WN2A 3THCA 4QX5A 4ASLA 4OHYA 1XB9A 4LBQA 3OUIA 4TYSA 3M8LA 5BNNA 4YPJA 1SFPA 3ACLA 1HJFA 3D5OA 5KHKA 5JDBA 1UOGA 4EWEA 1AR93 1W06A 4TSVA 3FLRA 3PVOA 1RITA 5EWSA 4DO0A 4QX1A 2QUOA 3K77A 2XVKA 3TNPB 1HN0A 1OLMA 4LHKA 4QPWA 2HWC2 4NVPA 1QJY2 3CKHA 1DU3D 1PM4A 1POV3 3IDEA 3KCYA 4KGQA 1O7FA 1G9BA 2D40A 1AX1A 1J1LA 1YIPA 3ETQA 5BNNC 5CFDB 2ZGNA 1YLLA 1B35A 2YPJA 3Q8CA 1Q8PA 2DBIA 5C3RA 5C4WB 2XWBB 5FWJA 5AVAA 4P9IA 2VECA 5KHJA 2CGPA 4Q1RA 1H1AA 3AKSA 3N7KA 3HNBM 5KR7A 1GNHA 4RSUA 5JUVA 4QAWA 3LA2A 5FZIA 3GF6A 4NPRA 4GB33 4XOGA 3AZXA 1I5ZA 4UOJA 5IUQA 1BQPA 1Q43A 4YG3A 3BPZA 4AEDB 3UESA 2BV4A 3OOXA 3BB6A 1REDA 3POWA 3AX4A 1SLTA 3PU8A 5CIRA 1B35C 2VAUA 4KMQA 1LCLA 3ZFEB 4BB3A 2PN5A 1YUDA 5F8PA 1CAVB 1NQJA 4KQ7A 1SLIA 3KF3A 4HL0A 3BN6A 4E2SA 4XMAA 1ASJ2 1T6BX 1XNDA 3C7GA 1HRI1 4IGQA 1BVVA 3OBAA 1RGSA 2HWE3 4QT6A 1TZOA 1UO9A 2OPWA 2A6YA 2W68A 4HONA 2RMU3 4EZ4A 1Y43B 3JZVA 4QGNA 2X05A 2JKBA 2JJ6A 3E97A 3WNOA 4JHTA 3ACFA 4LXLA 3VBFB 3VN4A 4QD2A 5AC93 4JTNA 2XKPA 4LT5A 3HN1A 1MEC2 4UW6A 1QH6A 5DABA 5HBAA 1QWRA 3O1VA 5CKNA 2HWC1 4DXTA 1UCXA 1QJY1 3A7QA 2XJSA 4ONUA 1JXNA 2EICA 1WMFA 4EWAA 2VXRA 1BBT3 4W8JA 2VVDA 5E8AA 1VAKA 1K5MC 4XJAA 1VBA3 2P3YA 2PA7A 1DGRA 3BOPA 3SH3A 2QVSB 1HQLA 3WUDA 3W21A 1HIXA 3U37A 5FY8A 3U1XA 2FZ2A 4UW3A 3GBFA 2ATFA 2DDUA 2XPJA 3BOWA 5GM0A 2R16A 3WW4A 1MS3A 3AB0A 5JPMB 5J1XA 3S5AA 3OB8A 2O8OA 4NE9A 3ZLIA 4EWDA 5DZGA 3BODA 4XFCA 4D94A 1WCDJ 1XQNA 1GOHA 3LDKA 5JOYA 3NJYA 2JDKA 5LA9A 5FLJA 4B29A 4GALA 1ASJ1 2Z4FA 4QDRA 2WS93 4RYDA 3OGGA 2C5DA 1PGSA 2RM23 3ZMOA 4CXWA 2EXIA 1JMUB 4QPGC 1SZBA 2EAAA 4QB6A 3MZHA 3K46A 2F17A 2WQZC 1YO8A 3OPZA 5ABJC 4H7MA 4OHWA 4ASKA 2EALA 4QKBA 4CVUA 2NZ9A 4LKEA 5FMOS 1MEC1 4CEYA 4CP9B 4EYUA 4DUVA 5CAZA 3JQXA 1UOFA 4EN8B 4D6SA 3ELNA 2ZX0A 4IL7A 2A3YA 2YFZA 2Q8DA 3T2TA 3TB0A 5E1RA 4QX7A 4F3JA 2IXKA 5A33A 4A3ZA 4GMP1 3DPRC 2DVGA 3ZYGA 4D8MA 1JZ4A 4FPKA 1FV3A 4IEUA 4KBBA 1UU4A 2JE8A 2MHFA 2QCSB 2RG4A 1HV0A 1RL3A 2WUHA 5FZAA 4CEYC 3BTYA 5BPXA 1Z78A 2YC0A 3BCWA 1G9DA 1RUF3 2Y64A 3NV4A 3DKWA 3N35A 4D69A 2RS53 3ORJA 1AR62 3VBHB 3IDBB 5EZWA 4AI9A 3CJXA 4AZZA 4YRDA 3UT0A 1AXZA 4NWWA 4N53C 3MIGA 5KBFA 5EXOA 1YQ6A 3DYMA 1WMXA 3AM2A 4M3CA 4WVMB 1AR72 3WP3A 5I8TA 3DGTA 1W6NB 4LTAA 5I0RA 1LHUA 3MLLA 1TMF3 5D21A 1CAUB 5JIAA 4KGGA 2E51A 4K9SA 1LOFC 5AFEA 1NLSA 4GZ9A 4KU8A 4LNVA 1IS3A 4FI9A 4B1MA 5DAVA 2P6HA 5BNOA 3ZKUA 5LBEA 3R4DB 4KNCA 4XDPA 3OGSA 3VBOB 3GXUA 5FZDA 1MS8A 3I2IA 4LK6A 4QX8A 4NJ4A 4HLTA 4YM1A 2WWJA 2OUHA 4FPFA 5LA1A 4U2AA 4P02B 5DAPA 2JENA 2VUJA 3J7NA 4YNIA 2EAKA 5A1FA 1UYXA 1LESA 2VE1A 3SH5A 1J83A 5A1AA 4CDQA 3PLQA 1MZFA 2JWPA 4AI1A 3DXUA 5FPLA 1BK0A 3HQRA 3UETA 5LEKA 1GP6A 2EVXA 2PXJA 1BKZA 5E89A 2NMOA 2CTVA 4LUMA 2XL9A 5FJKA 1AR61 2C26A 1QXJA 4DMIA 1DG6A 1HB4A 2GC0A 3OBTA 3VD7A 5KXDA 1RJ8A 2G9FA 2Q1FA 1ND2B 5G04L 4XJ8A 4I02A 3RZLA 1AR71 4DS0A 3HOBA 3IKWA 1YEWA 3KT7A 4BU2A 4UW5A 1O59A 1UKRA 3VKOA 5KHIA 2A6ZA 1DGRN 3Q9OA 3FUQA 1FPN2 3N7MA 1XE7A 1ULDA 3HJRA 4MYEA 1W3XA 2QQOA 4FPLA 2WC2A 2ZGKA 3UGGA 5I91A 2X09A 4BXFA 2RS32 1SLCA 3D8CA 1DIWA 3RFRA 4BIFA 4XTMA 4IV3C 1CN1A 1GLHA 2J1EA 1PX4A 1H6YA 1C57A 2VL4A 2XWJB 1GKBA 2MNGA 3AP6A 1EV12 3LEMA 5E88A 5FZOA 5A3WA 3WZ1A 1O3RA 4ZPIA 3VZJA 4Y3OA 3ES1A 3KMHA 4JQRA 3RYKA 3AFKA 2ADDA 2Q8CA 3VKMA 3ZXFA 5DUUA 5FYCA 3AYAA 3ILRA 1PMHX 2VG9A 1UNBA 5F9TA 1OLQA 1WUVA 5DG2A 1C8M3 4AGRA 4CDQB 3O1TA 3IMNA 5IVJA 2YGLA 4P9GA 2DCKA 3OEAA 5GLTA 2VCAA 4GWNA 2QQJA 3PJYA 4XACA 3UYJA 1YFWA 3VD3A 3AVSA 4JDMA 4A7ZA 4LLFA 1GUIA 2YROA 4DY3A 1J3PA 1LGCA 1W8ZA 1XU2A 2RE9A 4RQPC 2I45A 4ZONA 3ZOIA 4CEWC 1NA1A 5KWRA 4MO3M 4DNYA 4GQ7A 3N9OA 4UF0A 1ULGA 2VVFA 3PUQA 5FKCA 2RS12 3UJQA 4QPIC 4P5HA 4QU2A 3W59A 1U0AA 2XHNA 2VNOA 3IAQA 5FFOC 4DXZA 1FPN1 1CPNA 1SLLA 2D3PA 2WNVA 2EIGA 4UBGA 2W46A 5T52A 2W2IA 1UPSA 3JXSA 1AR92 5F6LB 2HWB3 2WZ8A 2W92A 3KSCA 2RS31 4Y5SA 2OA2A 2RDQA 2YG0A 2ZXQA 2JG8C 3LGRA 3TWIA 2BNMA 2SLIA 3LSEA 4K3UA 4HT1T 4JV4A 1I9RA 1ULOA 5LRRA 2OVUA 3WV6A 2X29A 1EV11 3TYJA 3O7OA 2YBKA 3HPNA 1JODA 1X7NA 4E4DX 4WM7C 1V6OA 3RI8A 3AZZA 2TNFA 3J8F3 1LHOA 3LA7A 3PTRB 1ZZCA 3I2GA 5DUWA 2PHUA 3OSDA 4C0HA 3OY8B 2D5FA 4NN0A 2L9LA 4LO6B 1CX4A 1RJ7A 5BY5A 2CY6A 4WM8C 5FBZA 1UY3A 1ZVFA 5CFCB 2JECA 5J37A 2W94A 4MUVA 4MGKE 1ZRIA 4K8RB 4RGGA 1YRZA 1Y3TA 3H7YA 1UXXX 3P3NA 2QDRA 2XLAA 3VBRB 5HCHA 2HWE2 2RS11 4FPOB 4QM9A 5FZCA 2VMCA 4Y22B 4ET7A 2YV8A 5LZ6A 1MZEA 4CDUC 5T3NA 2RMU2 4UF0B 1OOPB 2ZHMA 5L7OB 4JCKA 1QJEA 1OKOA 3VBUA 3LFIA 1RINA 4XBLA 1NT0A 1AR91 1V6NA 2P34A 3A0KA 4HKLA 4MSVA 4OLLA 3POBA 5K0UA 4DRVA 1AYN3 1JS9A 2J7MA 4RN5A 5BNPA 1X33A 2WNVB 4R4XA 2FDFA 1ZA4A 5A6QA 3VLBB 2YMZA 5EHDA 2JIGA 3FHQA 3ZFGC 1WMDA 4CCMA 1G9CA 3E5UA 4PIZA 1CESA 3PUSA 1ZNPA 2OW4A 1WWYA 4OCTA 3H1YA 1BBT2 5FWEA 4A42A 1ZBE3 3FFQA 3WOGA 3CU7A 2UYBA 1S0DA 3M3IA 1ZYBA 5JI9A 2HYKA 4CP0A 2CYFA 3IPVA 4CCEA 1LOBA 1UPIA 2HJIA 4IE6A 3MW4A 1JYVA 1NXD1 3RSJA 3RYPA 4FPYA 1FT9A 1VMFA 2JD4A 1BLZA 1NCQA 4GH4A 1V6JA 4HANA 5FY9A 2OKXA 5FY1A 3BKZA 2XQXA 3R05A 2VNVA 2E7AA 1AYM3 4XURA 4CZSA 2Y60A 1ZRFA 2DV9A 1TNFA 2LALA 2XUMA 2OYZA 4YARA 1IPKA 3AJZA 4AGVA 2WS92 5FP8A 5FZKA 3VHPA 3D0JA 5C3PA 4IEXA 4Q0VA 5IFPA 1CX1A 5BUVA 4RHV2 5IT6A 5FZLA 2HWE1 4CDWC 4GH4C 2ZEZA 3H1MA 3I2DA 3KHBA 2I2SA 2VZOA 3LIGA 2RMU1 3PJQA 4P14A 4XJ9A 2HBTA 5FYBA 2GC3A 5FXVA 5FPUA 4XABA 3HD8B 4HG6B 4D0QA 5C7GA 1KS5A 3ST7A 5AC91 4YZ1A 1D2QA 3MDPA 1W04A 2AUYA 5F5CA 1FMD3 3VBUB 1CJPA 3E6CC 2NLRA 2DVDA 2XLGA 3WD5A 3PUAA 1K5JA 1GOFA 3HIFA 3J7HA 2ZGSA 5L9VA 2FCUA 2DUQA 5FY0A 4HETA 1BBT1 1KRIA 2P2KA 3Q8BA 5C5TA 3CEWA 4LEJA 1X8EA 5FYIA 3AC0A 1OMIA 1WLDA 1LOGA 3QBQA 5C9AB 2W1UA 3M1HA 1GZTA 3RYRA 3VBSB 1TME2 4Q4W3 5FQ0B 2PAEA 2W9XA 1EY2A 1RUF2 2E63A 1XYNA 3RGBA 4KG0A 1I1EA 3AMNA 5JSPA 3PL0A 4QXBA 1N3OA 3J7LA 5M0TA 3TEZA 1OD5A 1TEIA 4IGOA 5LB6A 4MHUA 4BA6A 4CU9A 5GZCA 1WLWA 2R1DA 4PF1A 4CCDA 1NCQB 3E5XA 1ALYA 2CGOA 3I3DA 1QU0A 2VMDA 4IETA 5CZKA 1WZXA 2B42B 2BTVC 2HKXA 2PYTA 3T1LA 2F4PA 3AZVA 3FX3A 4IEZA 1IOAA 2WS91 4R4ZA 5A7QA 4Q8KA 4RHV1 2IVJA 1TMF2 3RMYA 1RUG3 3R0RA 3KF5A 3IMMA 1F8VA 2E9QA 4FFHA 3TEXA 1DQ5A 4LBMA 1GBGA 4LBKA 4NRMA 5DZEA 1DYPA 2NQYA 4P08A 1XOYA 4K20A 2D6OX 1DFQA 4KBZA 4NHKA 1DLCA 5A7NA 3WW3A 4BJ0A 3B69A 3VZMA 4BLJA 4OI0A 1S0GA 3MIHA 4N9HA 4I09A 2G1MA 3CQOA 3HVDA 5F5AA 3WUCA 3KQRA 5GZEA 4AHWA 2CDOA 2A5ZA 3S6PA 5CA6A 3AFGA 3NAPC 1YWKA 1G6NA 3H50A 4MGIE 4A2UA 1DDLA 1PZ7A 1F4AA 4FP3A 1TME1 4RR3A 3L2YA 5CG8A 2K0GA 2IZWA 1RUF1 2P17A 1U5XA 3O1MA 3S7EA 4AFMA 4L8QA 1QGLA 2D3SA 5AVPA 4YW3A 4Y1YA 2XGXA 2WKKA 3MI8A 4B1LA 1SPPA 4QXHA 1OLRA 2VCBA 1HQNA 1TVGA 4PI2A 3WCRA 3B94A 3USSA 4OZXA 1WD4A 2AYHA 4D7SA 2A6XA 4JVAA 5GLZA 5JOZA 1TMF1 3O1PA 3I59A 4NRQA 1F9KA 2ZOEB 1L3JA 1HLCA 1ZBA3 3DYOA 1JYNA 4RS5A 1OA4A 5LATA 1W8FA 1RXFA 3AYEA 3LCPA 1UY0A 2WA3A 3QH6A 5FZ4A 5HV0A 1DQ6A 4BOWA 5FYMA 2UY8A 1QQP3 1J1TA 5F1RA 1I5PA 3WQ0A 3WDXA 2D6PA 3AMQA 3ZR5A 4XFBA 5IVFA 5F2WA 3KGZA 4FFGA 3GCXA 5FZ8A 2GMMA 2XBO3 1UX6A 4YZ2A 3AL6A 5JLVA 2WYFA 4MXWB 3ZN4A 1RUI2 2VZRA 3AZWA 2YB7A 2QKDA 3M7AA 2GP3A 2ORZA 2TBVA 4GAZA 4AAXA 3VD5A 5FYSA 5CG9A 5F39A 2VMEA 1RXGA 1W2OA 2FDHA 4XHXA 1C8M2 4LIVA 2WFF3 1I3HA 1OT5A 3BU7A 1B09A 2VVEA 1H2NA 1M06G 1W2NA 3IB3A 3HMYA 4KWKA 3X29B 1J3RA 3V0BB 4JGYA 2LROA 2ZHLA 3NO8A 3VDDC 2A75A 1NCRC 2VW0A 3N9PA 4PDWC 3O1SA 4LE4A 3VL8A 3WVJA 4B3NA 1BHGA 1ND3A 2X5IB 3QCWA 5EPAA 4XAAA 3AK0A 2W5FA 1W9YA 2WFPA 3KQ4B 4Q8LA 1H9PA 1DQ4A 1SPPB 2B46X 3W58A 3M70A 4ZU7A 4XUNA 2BZDA 1UZZA 2YBPA 2V72A 4N43C 1AXYA 2V5DA 3OJBA 3ZYFA 2VQTA 1JZ5A 1G9AA 1Z7S2 2R063 3AZYA 1JUHA 2RR13 2XMLA 3H8RA 2HWB2 3MFAA 1FOD3 4GJZA 1C5HA 4AEJA 2FDIA 2A7AA 2XJVA 4RS5B 2VZ1A 3NRUA 3N4MA 3R6SA 1VBE3 2DUPA 5FCCA 1Z0HA 3JD72 4Q0SA 4KU7A 3F2ZA 1D0HA 1QOSA 1OVSA 3VKLA 5C33A 2R1BA 3SITA 3MPPG 3NQHA 2RJ2A 1VIWB 4ATEA 5A6YA 5L19A 1RUI1 4R9CA 4MHRA 2YU2A 2Z2SB 1HXS3 3WEZA 4AQSA 2HEVF 2B8MA 3AMMA 1XJAA 1VB4A 3I97A 4LULA 3J8F2 3T0AA 1OI6A 2BGCA 2JEMA 1QDCA 1KQRA 4R9AA 4XXPA 1D4M3 4YFZA 4A6SA 2VBDA 2LUWA 3SLIA 4PLMA 5B4XA 4HN1A 2CWSA 1YJKA 4PLOA 2JICA 2VUAA 2MPFA 2ET7A 3T2QA 3ZN5A 1K45A 2V73A 4YVSB 5CFDA 3MLKA 2ETEA 2Y6JA 5C4WA 4JGZB 5A80A 5FYYA 1WLTA 1HRV3 3KHCA 1IQDC 2VM9A 4JGYB 3C8XA 1NYWA 1A78A 4P9LA 4P9XA 2QZ2A 1H1IA 4C1XA 3WY6A 1LHNA 5J96B 3I49A 2PELA 3LOIA 1L7RA 5F5IA 4AEDA 2VBPA 1Z7S1 3I7DA 5JZGA 3ZFEA 1F4HA 2HWB1 1AYN2 2DCYA 5GKAC 2KM2A 4YVWC 3SKVA 1PNGA 1WCUA 4JDNA 4I30A 3SH4A 2PHWA 2VMIA 5FTTC 1MS5A 3FUOA 4QMAA 4IEVA 2MEV1 3JD71 1W0PA 3ZDSA 2ZMNA 1RUNA 1VE0A 1K3IA 2B7YA 3FHAA 3WG1A 1VP6A 1ZBE2 3NJZA 3VUOA 5JXIA 1WCSA 1AHSA 2UURA 3WNPA 3U4XA 2E31A 1O5LA 4EROA 1QOOA 2E7QA 1JHJA 3ALQA 4XCBA 3VBFA 1Q8SA 3J8F1 1US3A 2BGOA 2XJRA 4INDA 2HWD3 1CZVA 2O0OA 2GDFA 2Y6FA 2QQPA 3VHOA 1NE6A 3ZFFB 5JAXA 3LD8A 1O3QA 1M4WA 3FE5A 3LEIA 4A6OA 4XYXA 3N9MA 3N9QA 2IXLA 4ES8A 5T5OA 3DECA 3HT2A 4QM8A 3VDCA 1X50A 2VD7A 4Y1VA 3ZYIB 1E5SA 4QXCA 3D82A 3RS6A 2QQVA 1NX9A 4BMBA 5CB7A 2NYYA 2XHKA 2NP0A 2YC2A 1MACA 2QQMA 4PIXA 3AYDA 5K8SA 3SXWA 5FR3A 3OEBA 3ZMNA 1U5IA 4ORFA 4CDXB 2UWCA 5EJ3A 2RDRA 3ZSJA 1KDKA 3CJIB 1AYN1 1W6OB 3MUY1 5FV3A 4E4HA 5JXHA 1FMD2 4LORA 5JZGB 3AKQA 1N1SA 3AXEA 2GAUA 1W9TA 2DCJA 2Z79A 2WT2A 1W8NA 1GQGA 3KD4A 5IVEA 5FZHA 1QIQA 2F6BA 2VZUA 1IS6A 1UYPA 2H0VA 4LBNA 4PJYA 1ZBE1 2Y6KA 1UW8A 2W3JA 2WO3A 4YSFA 2FDKA 1QJFA 1W2TA 1ULCA 2D7FA 1MR5A 1UYZA 2WN3A 5JCTA 4Q4W2 4XIKA 3BIEA 2W95A 5IVBA 4LA2A 4B8EA 4CP9A 3TEWA 4G9SB 3SCFA 4XF1A 4DUWA 4CU8A 2VH9A 2BVBA 2VXJA 4YG6A 1XNCA 4COWA 3GALA 4K1YA 1P8JA 5IWFA 2Y6GA 2EIBA 4KWJA 1OUXA 1SBEA 1LOEA 2JKXA 3PUIA 4IEPA 2X8KA 1W2UA 1N1TA 3FWEA 4A45A 3OBZA 2HLEA 5JI7A 1H8TB 4HZFA 3AP9A 2PQSA 4AWDA 3SNMA 1R1A3 3I3QA 1OA3A 5LRSA 3LEGA 3VBHA 3WNMA 3WP6A 1VRH2 3O5SA 4AVSA 3WT3A 4OYUA 3MF6A 5C3QA 5JR2A 1PIV3 1H0BA 2QBXA 4QB2A 1XYPA 3WDTA 1FMD1 1F31A 4QQHA 3C2UA 4O9EA 4WVMA 4ZY9A 5JMOA 2GC1A 1ONAA 2GNBA 1W6NA 3FBMA 1GQHA 4Q4V3 2VUDA 2DFBA 2DUOA 2W91A 3D3AA 2ZABA 3V56A 4NMIA 3ILFA 5DUVA 3POIA 4Z82A 1CAUA 1PX3A 1UF2C 3ENRA 3VBHC 1RUC3 3SCHA 1DYKA 4OULA 4Q4X3 3TEYA 5K9YA 2BU9A 4UFKA 5ANQA 4CCCA 2KD7A 4P00B 1OPOA 2PMWB 2ZTNA 5J7MA 2D6MA 1OF3A 3INAA 4G4FA 2R6QA 3VBOA 4CP1A 1WW7A 3ZYBA 3ZN6A 1VBB2 2FMDA 1Q8OA 2VY0A 3GBWA 4GMP0 1FNZA 2BFUS 4BE3A 2YZ4A 2WT0A 1SMVA 3NV3A 1OURA 4MOAA 1H6XA 1OF4A 3LOBA 3KT1A 2Q8OA 3AMHA 3SCGA 2CV6A 2YYOA 2E26A 4AFBA 3KB5A 4QB1A 1WMEA 1NXMA 1GZWA 2Y0OA 2AENA 4MXVA 2BDRA 1CD3G 5EJ1B 3TNQA 2ZZJA 3EMRA 2O8QA 4FP2A 3WF4A 4XZPA 4CSWA 1VRH1 4WVWA 5J98B 1DZTA 1FI2A 1PVC3 1QQP2 2W1WA 1ND2A 3H1WA 3RG0A 2DVBA 5A7WA 3RZGA 1K5MB 2H6BA 4UFIA 2JDZA 5CKMA 2BBVA 4H7LA 1SHWB 2C9KA 3MW3A 3A22A 1UY1A 1UY2A 1IS4A 5C8CB 2UU8A 2VTXJ 5FO7B 1Q8VA 1QH7A 2YY1A 1MS0A 3GHNA 4LBOA 1UKGA 1FNYA 4CPBD 2WNEA 2WFF2 3BTXA 4C90A 4A41A 4TN7A 4Y4YA 4R9DA 4DFSA 5I0DA 2Z69A 2ARXA 5A3NA 5HCAA 1VBB1 2ZGQA 1UMHA 5KHGA 3EBRA 5K4LA 2NPIA 4LO5B 1EAH3 1HKDA 5FMOL 1MVQA 2EIDA 3ZN6B 4FO9A 1LOCA 1CR7A 4A3XA 3H42B 1SLAA 3JBG3 5ABJB 3O1RA 1KITA 4LHSA 2WO7A 4M4RA 4XIOA 1O5UA 2G9ZA 1C1LA 1C28A 3NNMA 4NR1A 3P5BA 2XOMA 2Y0IA 5D2AA 2VO5A 1LKNA 4FOQA 5BNOC 2ZACA 5C8WA 1A34A 4BQ1A 2R062 3KV4A 2RR12 2K46A 4Y1ZA 1GZWB 1FOD2 3A4UA 2VJXA 3B02A 5SV8A 5JXJA 4QWNA 5ISLA 3OPTA 5LK7B 1CWPA 4OVEA 4YGEA 3CHXA 4UXAA 1QQP1 4AVAA 2VMGA 3DPRB 5FY5A 1ODMA 2JE7A 2WINB 3UJOA 1MZ6A 3MIEA 5BV6A 2BVVA 2C1FA 2I07B 4AEMA 3VKFC 4AFDA 3POGA 4CDQC 1X9TA 4L9BA 5A7WB 2CNAA 1IQAA 1K12A 2V5YA 3U0ZA 2R0HA 5LA0A 2JDNA 1BMV2 1SFNA 3FN9A 3T1MA 1HXS2 3BTAA 4CCNA 2CSGA 2YGMA 3A21A 5T5PA 1CQ9A 3K4AA 2ZAHA 4OMCA 1LAJA 4N53B 1LU2A 5FZ9A 3S57A 2WFF1 3MW2A 1X8MA 2WSUA 4CU6A 1W0OA 3VHRA 4DRRA 1UMZA 1AL23 1LGNA 3RNSA 4E4ZA 2ZAAA 5CADA 2ID4A 1W8UA 1ENQA 2YXSA 3J7MA 3W9AA 1JOPA 4KI5M 5A6ZA 2XVLA 2XVGA 4NIDA 3VDBA 3GZAA 5FXXA 1EYBA 5A7PA 3OTFA 3P6BA 1HRV2 4F7ZA 4NPMA 3NNJA 5FUNA 4J6GA 1COV3 1OQEA 2DU1A 2BJSA 1ST8A 4DQAA 3EXUA 3V0AB 3LSDA 4CPBA 1ZA7A 4EN7B 3OY8A 5FZGA 4QQPA 2BOIA 4PT6A 5H9RA 5GZFA 2A70A 3K3OA 1RC6A 1VAMA 2R061 4UBHA 2RR11 1OLME 5CNAA 4D6RA 1FOD1 5CFCA 4Z92B 4FTEA 1F5JA 4JRAA 4AR2A 3M2MA 4D7YA 2IC1A 3KCXA 4ZHNA 3SC7X 3LIHA 4AXOA 1KXGA 3ATGA 1XSRA 4B7EA 1T2XA 1OD3A 1RUJ3 2D43A 1S2KA 3VBRA 5AC92 4D7TA 4LR4A 1GR3A 4GJYA 3WX5A 4EQVA 5J3UA 2WL1A 2OXBA 2XKOA 4OUSA 4Y22A 2ARBA 1SDWA 2VOTA 3FBYA 3MGUA 2XJPA 3HEIA 4Y20A 4Q4Y3 2GP5A 1OOPA 1CAWA 1V9U3 4LKFA 4HMZA 5FMCA 5L7OA 1BMV1 4XPVA 4CUCA 1TG7A 2HH9A 1MPXA 4NHXA 3ZSKA 4DZGA 2WLQA 3IBMA 2HWD2 3NV2A 2PQQA 4XF0A 5JVVA 1H2LA 1WW4A 2WNOA 4G3YC 4K1ZA 4N7IA 3WG4A 4BQWA 4J1WA 1UOJA 2D98A 4A44A 4I3PA 2ZA9A 2YDEA 1NA1C 3WQ1A 4YWAA 3NNLA 3ZPYA 5CBLA 3FZ3A 2ZMKA 3ZIWA 5KXCA 5L7OC 3IDCB 3OBRA 1HRV1 1OH4A 4U36A 1NE4A 3E6BA 3NNFA 2WDBA 1LULA 1VLNA 1NQDA 2WNVC 4FFIA 3MIBA 4ASMB 1OPMA 3T4HB 4I2OA 4Q2FA 4O61A 5C71A 3RVHA 4IEWA 4P9YA 1KDMA 1NKGA 3NJXA 4GB32 3RZHA 1PK6A 2DVFA 1D4VB 1XSQA 3APBA 3ETPA 3VHNA 5FZBA 3H7JA 2PAKA 3RPQA 5E6HA 4YW4A 3WDWA 4FSJA 3B93A 4H55A 1RMU3 3RDIA 5BXXA 2AACA 1RUE3 5L36A 3WLUA 4AI3A 5C70A 1ZZ9A 3I8TA 1UWWA 3JB8A 1RUH3 2WO1A 5JWPA 2ZEXA 3O1OA 1QF3A 2QQLA 1Y9GA 2BWCA 2VZPA 4LBLA 1OFNA 4XUTA 4BHPA 1IPSA 3DUIA 1A8MA 5KHHA 4Y20B 4YGCA 3E6DA 1POV0 4YYOA 1CAWB 1YJLA 4RQPB 2HWD1 4HFSA 3AKRA 3BUCA 3VZKA 4TTGA 1G7YA 1UZ0A 4XDOA 5A7SA 3OG2A 1CZSA 1W9SA 2IUWA 3RZJA 1ENRA 1J3QA 4RL7A 1KS4A 3DYPA 2E32A 2J1SA 4M00A 1R093 2OZ6A 1POV1 2ARCA 5C5UA 1JZ8A 3U11A 1O91A 2GU9A 1Q5OA 2PFWA 2YU1A 5AFBA 4AI8A 1CONA 5C9AA 3NNGA 4QQOA 1JYCA 3VBUC 3VBSA 4BH9A 5FQ0A 1W6MB 1VBA2 5T5LA 1SACA 5K0UC 4NIGA 2PHXA 4XXAA 3CO2A 5BNPC 3C7OA 4EN6B 1HB1A 1JU3A 2BNNA 3A23A 5FZ7A 4XFIA 4GB31 1XE8A 3OYWA 1PIV2 1AJOA 3C7EA 1N3PA 2IXCA 1JBCA 1CZTA 2WT1A 3JCIA 3H3UA 3M4FA 5A3PA 3WNLA 2F4LA 1PK6B 5IVVA 1WBFA 5C9AC 1QDOA 1IG0A 1W0NA 1NZCA 4IEOA 3ZXKA 1T6GC 3M3OA 1FYUA 1GQPA 3FLTA 3H3ZA 4KWLA 5H9QA 3BU0A 1D2SA 4CE8A 1RUC2 2YHJA 3OGRA 3G6JB 1IHMA 4J1XA 3QOPA 4YG0A 2RM22 4Q4X2 4QQ2A 2B5HA 1ODNA 4OQ8A 2NMNA 1NCQC 3MV01 2IXJA 2RJLA 4LOSA 4S2GA 5J09A 4AEKA 3ZXDA 5A3TA 4XC9A 2FHRA 2HWF3 3I54A 1YIFA 3LDRA 4OMDA 4M3CE 5EP9A 2GZWA 3J4UH 2ZKLA 1Q56A 4CDUB 4FAHA 4OI2A 4UW4A 3O0WA 1S0CA 2VQ0A 1S0JA 3IIIA 1PGL2 1GYKA 1GZCA 4LA3A 2Z42A 4LITA 5CVRA 2VR4A 4Y33A 2FDJA 4KG8A 1V6IA 4NWVA 1VBA1 2VPVA 1RIRA 1UD1A 4NOTA 5A70A 4ITCA 1DYOA 1RUD3 3ZIXA 1GSLA 4FOYA 4HN0A 3RZZA 3U07A 3S7IA 2QFEA 1PIV1 4L2NA 4YLZA 4QX3A 1PVC2 2RS52 5ERLA 3CZJA 5A3LA 3KV5A 4Q0PA 2VZ3A 3OYWB 1OH3A 5DMYA 1E5IA 2ZGRA 3GZTB 5JMCA 5C3SA 1UY4A 5DAXA 4IV1A 5FDBA 1WBLA 2XR4A 4TXWA 1ASJ3 3URFA 1W2AX 5LA2A 2D5HA 2W1QA 5KXBA 1RUC1 1Q3EA 2G19A 1NOVA 1WGPA 1GWMA 2RM21 4Q4X1 2OT7A 2YC4A 5FP9A 3ZYRA 1REFA 1ACCA 1YQCA 4BM8A 5EIYB 1SQ4A 5H9PA 1WCQA 5JIUA 1QKQA 3EQEA 5FRAA 4B4RA 3ZDVA 1G8WA 3I3EA 4PI0A 3WP5A 2AEYA 5B4NA 4X6QB 3I2OA 5T54A 1XC6A 2VNRA 2X10A 1LNSA 3FJSA 3WW1A 5TSWA 3ZX7A 1OQ1A 1W8TA 4M01A 4PBPA 2YPDA 3JBG2 5FYUA 5L73A 4MXWA 2CGNA 3WF3A 4DPNA 3NKTA 2R073 1YCIA 5FZ6A 2JG9B 3JU9A 4JX0A 1V70A 1PGL1 4JKMA 2A6VA 2W1SA 4FOVA 3HWJA 1GU3A 3NV1A 1W28A 1BEV3 1O4TA 4JC1A 2R7EB 1HQWA 3GBGA 4RD7A 3V0BA 2Z5WA 2BP6A 1H9WA 4UT5A 1AL0G 4HKOA 4CXYA 1REEA 1PVC1 2RS51 4XVHA 1YQ2A 1C3HA 2VBBA 2ZPXA 2BW8A 2P1BA 3FMGA 2X5IA 3PTYA 4EN0A 4URTA 5J48A 1APNA 4M0NA 2WSVA 3P3PA 3SKJE 4IE4A 2VCMA 3MV11 4BK5A 4Z1VA 2P3JA 4ARYA 4LPLA 2WA4A 1BK1A 1UU5A 4RR3C 2XG3A 4IV1B 1OBNA 4A7KA 2VU9A 4W6YA 4ES9A 1GNZA 2OIIA 4AOCA 4WZFA 5EQUA 1LJ7A 5FZ0A 3SQOA 4F8AA 1JZ2A 4IESA 4Q27A 4MGTA 1NY72 2X5IC 1BYHA 2W52A 1HB3A 4DXRA 2GN3A 1AL22 2D44A 4GA9A 3DCQA 2Q4SA 2E33A 3O0VA 2O14A 2Y26A 3B9IA 5FK7A 2DU0A 2NM1A 2PHLA 1V00A 4PF5A 3LFMA 1H8VA 2B45X 3LF7A 4JDOA 5GLVA 3AKTA 2XDVA 3LWCA 3VL9A 1XRUA 2BYVE 1AX0A 3JBG1 5A32B 1IGOA 4H2AA 1COV2 2C9AA 3OGJA 2NN8A 2ZGOA 5FOJB 1LR5A 1W6QB 4RS5C 4W50A 2ZKNA 4AI2A 1CVNA 4DY5A 3ITQA 1DHKB 1URXA 1ENXA 3WDUA 3WR0A 3USUB 4D6QA 1ZRRA 3WHUA 4AFAA 2FDGA 4E8DA 2XH6A 5LBFA 2GC2A 4DINB 4XF9A 4YVSA 5APAA 4LOTA 3CNAA 1LEMA 1AR63 2CAVA 1XNAA 3QLQA 4JGZA 4NHLA 3PVBB 4RFRB 5KC5A 2LS6A 1RUJ2 1N1VA 2ES3A 3ECQA 3NAPB 3ZM8A 2EA7A 3POJA 2BRTA 2J1VA 1WA6X 4UFJA 1ENSA 4MX3A 4AVTA 3I4IA 2DTWA 4RFT0 4E9KA 5CEHA 3MEPA 4Q4Y2 1AX2A 1V9U2 2ZX3A 5IJRA 3IAPA 3LB9A 5JSOA 1YNAA 2CWMA 2HBUA 4GIQA 4YVSC 1JYIA 1VRBA 2WJSA 1DZQA 1EPZA 4JGZC 1W8WA 1VBD3 1NY71 4SBVA 3VGIA 4JGYC 4YW1A 5GLUA 1Y9MA 5A3OA 1AL21 3RZMA 2WZR3 3AJYA 1KFXL 1ND3C 4NROA 1JH5A 3T4VA 5LEJA 4URAA 4YZ5A 4HVOA 4XQWA 3PNAA 4MZUA 4XBQA 4JRLA 1SCRA 1OVPA 2PHRA 4PBOA 4Z2AA 5CKQA 1VAVA 4DOUA 3NWKA 1COV1 5A7OA 1VR3A 3LAGA 3LE0A 1CGPA 4EJRA 2VTXA 4YM2A 4NIAA 5D8AA 4EV0A 4X8PA 2JDHA 5GALA 3ZFFA 3N7JA 5HCBA 4LO7A 3UL2A 2OS2A 1Y7BA 3FLPA 4TLGA 2AR6A 4ZXEA 1C8M1 2WBKA 1YHFA 4NHMA 2DWRA 4BYYA 1LHVA 2PHTA 4H14A 1AF9A 2E6VA 2OZJA 4A7YA 1RMU2 2B9VA 1Y4WA 2ZGTA 3B7MA 3PDQA 5DDJ3 1RUE2 3GJBA 1RUJ1 3B9CA 1KJLA 2FQPA 1GV9A 4QX0A 5F3EA 3RMXA 2VOKA 4JZRA 2P5BA 1UQXA 1RUH2 1VBC3 2JDAA 4XQ4A 1U5ZA 3ZFFC 1AR83 1BCXA 4IXLA 2RV9A 2AH2A 4M4PA 4V2WA 4Q4Y1 4XMIA 4FBFA 1NG0A 1V9U1 2EXJA 2JXAA 3D4KA 3KGLA 5IVCA 1NUKA 4CDXA 4YW7A 1FPN3 3VDDB 3ZKYA 1EUUA 3CJIA 1W6OA 1JZ6A 4PDWB 4FFFA 1H2KA 1MQTA 2OPKA 4DB5A 5CFDC 4IEYA 3HN3A 4ISQA 3T30A 5C4WC 2D3RA 4GKYA 3VZNA 3K3NA 2LRPA 2FBEA 3R4UA 1V0AA 2W08A 2TEPA 1PZ8A 3HR9A 5GZDA 1D0GA 1Q8QA 1R092 2Q1ZB 5F6KA 5KXEA 4IDZA 2IVIB 3ACHA 4FPJA 4OFGA 1W3VA 4N9IA 4CXXA 4IQPA 1AJKA 1EV13 3CJIC 1W90A 3CBNA 2A1XA 2VW2A 4AEDC 2WRAA 2BNOA 4P9JA 2WNUA 2XB6C 3RJRA 5JZGC 5JSRA 3B00A 3ZFEC 3NMBA 3UV9A 4AQ6A 5FPXA 1DQ0A 3RZKA 3GYDA 3LPGA 3ON7A 4LHNA 5IVYA 4COZA 1S0BA 4KH9A 4AE2A 3VZOA 3C7FA 1XBFA 5D8AB 3ZYJB 2J42A 3LPFA 4SLIA 2XONA 4A4AA 3N9LA 1AYM2 1RMU1 2A6WA 2R49A 2VZVA 1YQ5A 2XXZA 4MGZE 1RUE1 4S2HA 4WBBA 3U75A 1JZ7A 3MF9A 4XTPA 1OHFA 2GH2A 3I2JA 3L2HA 1K42A 4OI4A 3I2HA 1RUH1 4N8MA 4CA9A 1H8TA 1IZ3A 3VBFC 5F7UA 2YBSA 4WV8A 3E1F1 1DCSA 1GP5A 5EYYA 2QQUA 1UIKA 2RS13 5T50A 2CL2A 2VTFA 3B3QE 1POQA 2N7GA 1NZIA 3LQCA 4HBNA 4NAMA 5K7PA 1KFUL 2J1TA 1HW5A 1D7PM 2H6CA 3K4ZA 2A3XA 5L9BA 3KVBA 2HWF2 5FYVA 4OHZA 2B39A 1H8TC 3SEEA 1MQTB 4RA0A 2RDNA 5ACA3 1R091 3WQBA 2XJTA 4LKDA 1LODA 1V6MA 3LDBA 2GMPA 3POYA 1YI7A 4PIYA 4FXGB 1A6CA 2ZBJA 3GM8A 5DQ0A 3WG3A 4YVWB 2PHDA 4XAEA 2ZX1A 1YYNA 2QNKA 1UZWA 4NHYA 2LW8A 5EFUA 4LE3A 1VB2A 1MS4A 2WNUB 3PIJA 4I0AA 4I0WB 1RUD2 1FV2A 5F5QA 1JZ3A 3ZXEA 1JU4A 1W03A 4HVRA 1QNYA 2XUEA 3LEKA 4YZ4A 4QQLA 1AYM1 5I8SA 4XILA 5IAXA 1E5HA 2J1AA 1J84A 1LRHA 1MS9A 2D97A 1UU6A 4FPGA 2GH8A 3LA3A 4CCOA 3AP4A 2IXIA 2C4XA 3K48A 4XE9A 4AW7A 4Z2WA 2GMEA 4UYBA 3AXDA 1RUG2 3VKNA
chains in the Genus database with same CATH topology
1F5FA 4AK3A 5CU1A 1PGW2 4JAAA 2VMHA 1QY4A 1K5MA 2RJKA 4LBQB 3JQWA 1RHI3 5BNNB 2HWF1 4X6RB 2KA3A 1XYOA 4XJUA 2K9ZA 2ZX4A 2VOXA 4CP2A 5C8CA 2ZS6B 4Y24A 2A71A 2O1QA 1FXZA 2R072 2AREA 3PMSA 4N90A 4RGAA 2QDNA 2ZX2A 3O14A 1GICA 1BEV2 1H1MA 1B35B 2H0BA 5IK7A 3N7LA 2GSYA 1R1ZA 4Q4W1 2QE3A 1RUD1 3K51A 5C8CC 4QPGA 1U12A 4M3CF 1YFYA 3VZLA 1PNFA 5ABJA 3WW2A 3AYCA 1YFUA 2DURA 1N47A 4HSJA 5DZFA 3FFZA 5HI0A 1PO13 1CIWA 3B01A 2DCZA 4RHV3 4Q0UA 3VBOC 1X36A 5BYNA 2SBAA 1RUG1 2G9GA 5C6CA 3N36A 3GZUC 4AVBA 1FX5A 5DG1A 1ZBA2 1HV1A 1PGW1 2VOWA 1IPJA 3DPRA 5EYXA 5I93A 3N3HA 4CYDA 1XXNA 1OSGA 3ZO0B 2ZGLA 1W6PA 1PM7A 1WCKA 3MYXA 4CTEA 4YM0A 2BQPA 2GNTA 4YZ3A 1MZ5A 2R071 3OD4A 2XBO2 2AGSA 4Y26A 4N53A 1ZX5A 4P9WA 1ZZ7A 1RVF3 2ZGPA 4XJWA 1X82A 1BEV1 2Q0AA 1Y9QA 4LO4B 3TRSB 4AF9A 5DUXA 1ND2C 1QJU3 1TME3 2BWAA 3ES4A 3KT4A 3MICA 1XNKA 1S55A 1VALA 2LTNA 4PQ9A 5J36A 2DTYA 1LOFA 3DF0A 2JX9A 3RWNA 3VV1A 4E27A 2W39A 1H2MA 3G7DA 1JUIA 4L11A 4QPGB 2BFUL 5E16A 4YW5A 1WW5A 2BPA2 3V0AA 1DLLA 3ZSMA 2ZGUA 4W6XA 4AGGA 2GN7A 5FOBB 3J26N 4EN9B 5I0SA 2QJVA 3S0MA 4R8HA 4XFFA 1VBD2 1ZBA1 4PLNA 2WZR2 3ZSEA 1PO23 1C1FA 4ZU4A 2CAUA 4OI1A 4CRQA 1VBE2 3GNEA 1O3SA 4CEYB 4YM3A 4TLFA 1W6PB 2PTMA 2LM3A 2XBO1 4C1WA 4AQTA 3JUUA 5A33B 1JOJA 1LU1A 4ZKTB 5GZGA 1CJDA 1FAYA 1D4M2 2QZ3A 1GZ9A 2IFWA 3MIFA 5DDJ2 4Z8BA 4XHBA 3DN7A 1MVEA 1VBC2 1AR82 3WDYA 4L99A 1VJ2A 2GALA 4IV3A 3TN93 4GXLA 2R0FA 2GNDA 4GKXA 4M3CB 2VW1A 1SEFA 3EO6A 1VBD1 2ZHNA 3SMHA 1TNRA 1SBDA 4K7JA 2FZ1A 4BWOA 2WZR1 3PHMA 3WG2A 2DCTA 1BXHA 1DQ2A 3HBZA 1VBE1 5BNOB 3GHMA 3MIDA 4LBJA 1S0EA 2R30A 3LZZA 3MLJA 2FMYA 1RUI3 4RQPA 3WQ7A 4K8FA 5CFCC 4CEWA 1HXS1 4MVTA 5FAXA 4Z07A 2UYAA 1HDKA 3OF1A 1CAXA 1D4M1 1A8DA 4QPIA 5FLIA 3KS7A 3VBRC 2VULA 4QGLA 4XFHA 5T55A 1PMIA 5DDJ1 4KL1A 3POSA 2HEYF 5I0UA 1OOPC 1XU1A 4QXKA 1DQ1A 1VBC1 4XFGA 2D6LX 3E5QA 3IN9A 4JTOA 1AR81 1W6MA 2JG8A 4R9BA 4YGDA 3THTA 3ZXJA 2ET1A 4XF4A 2BEOA 4IV3B 2K2SA 2XJUA 1J59A 3J9SA 4C0BA 4MH0E 2P3IA 1IS5A 1Z7S3 1QMJA 4Y1UA 2Q5TA 2AZ5A 2PLV3 4FOWA 2R043 4WM7A 4ATFA 3WNXA 4HPKA 1ULFA 3BALA 4AHXA 4FQ4A 5JOWA 4OHVA 1QJX3 1CPMA 3DL3A 4LHLA 1QJZA 5ACA2 1XNBA 2MEV3 4XF3A 3JD73 4COUA 1R083 4V1PA 3KM5A 1ZZ6A 4WM8A 1YXWA 1YFXA 4FQZA 3UK9A 3PMEA 1PK6C 3LKJA 1W39A 3UKVA 4HVQA 2RHPA 1AUYA 1FATA 2EXKA 2KXLA 2PHFA 3CL1A 2D6KA 4PCRA 4W6WA 1BZWA 4MV2A 4K6BA 4AI0A 4CEWB 3H8UA 4CDUA 2JE9A 2WWSA 3THPA 4XBNA 2ZCWA 4B4PA 2XL7A 1CAXB 3U10A 4QPIB 4FVVA 3TOJA 1LB2A 1I6XA 2EF6A 1H4HA 4FXKB 5H9SA 5SV5A 2V09A 1NA1B 3ZFGA 5DXDA 1DF0A 4FPCA 1R1A2 2JG8B 2B9UA 3TBDA 1RHI2 4Q0QA 2ERFA 4WVVA 1RUOA 2P37A 2R32A 1F2NA 5FREA 3SHRA 3HQXA 3SISA 5ACA1 1QNWA 4WM7B 4Q4V2 4FT8A 4HPKB 3VBSC 3ME2A 3IWZA 4META 1LEDA 2UWBA 1N1YA 3HAGA 4AVCA 2WIIB 2DF7A 4OHXA 1HRI3 2BUKA 4XQDA 1NLRA 1S0FA 3M3QA 2GNMA 3KCCA 4WM8B 3ROUA 3NVCA 1ZZ8A 1EPWA 1UIJA 1PZ9A 1SFYA 3O12A 4CDWA 2X53S 1V6LA 4XW3A 3OCPA 1AZDA 2HWC3 2JG9A 1H4GA 1QJY3 1PO12 1S1AA 3FC0A 4Q29A 4GWMA 3D0SA 1H30A 1WA4A 4QGMA 3UKNA 1EP0A 1C8NA 4I0BA 1HX6A 1R1A1 2DYCA 3FHIB 3V65A 5BNQA 3ZFGB 2JG9C 3H0OA 3M3EA 4NO4A 1IKPA 1RHI1 1V6KA 1AXKA 4WZCA 3IT8A 3ILNA 4MGYE 1G9FA 4COYA 1KD7A 1RTVA 5K0UB 5BNPB 4XEZA 1JTZX 4Q4V1 2A73B 2TUNA 1DGLA 5FLHA 2DVAA 3D6EA 4ZU5A 3QD6A 3B5LB 1RVF2 2Y38A 2ZZQA 4H3WA 4B7KA 3M3CA 4BCUA 4L97A 1QJU2 2YUEA 1E57A 2IXHA 4FPEA 3IPVB 2W0XA 3IM0A 5I0TA 4IV1C 2ZHKA 3WHTA 5LK5A 5T5JA 4AFCA 1RB8G 1MEC3 2XLFA 3WINE 4CDWB 1LECA 4GH4B 1EAH2 5A32A 2WQ4A 3ZXAC 1W6QA 1PO11 4XDQA 4AHYA 2EXHA 3O0XA 1AVBA 1JN2P 2WZPP 3ZVXA 4R52A 3USUA 3UKTA 4GMP3 2ZJCA 3R4SA 1SCSA 3TAYA 4ZXKA 1ZRCA 1N3QA 4XJZA 4Y5Z0 3WDVA 4K40A 4AYUA 1VRH3 5FO9B 1TE1B 1QHDA 3NAPA 1PO22 4XETA 4S2DA 1ULEA 4Q26A 3MFCA 2XJQA 1U5YA 3WXPA 3MPBA 3AMPA 2IWGB 3IIAA 3A0NA 2HEWF 1O4YA 1OA2A 4FTBA 1PVXA 3PVNA 3AP7A 1QXPA 1RVF1 4ISRA 1S2BA 3L9JT 4F83A 4W65A 1QJU1 1ZRDA 4HK8A 1C5IA 2UY9A 2I74A 1VBB3 5I8YA 5IK4A 1DZRA 1LHWA 4FPHA 4Y1XA 2A3WA 4FTSA 1O4ZA 4C91A 1EAH1 3BIWE 1GFF2 4XFAA 3KZ4C 1DGWX 4LUKA 3TN92 4TWTA 4E4SA 3QACA 1SLBA 2WLPA 5JOXA 1JHNA 1UZYA 2VOVA 3EJKA 3AKPA 3H9AA 4HSLA 1QOTA 4BZ4A 3ZXGA 4HKWA 4I3GA 1MS1A 1PO21 4GULA 4S2FA 4YW2A 2UWAA 2G4IA 1PHMA 2Q30A 3DV8A 2D93A 4AHZA 1IKQA 4E2QA 1SBFA 4Q1PA 1AR73 1A3KA 1YI9A 3WP4A 3VDDA 1NCRA 4PDWA 1OFSA 5D1IA 1DGWA 1TQ5A 2E7TA 5JR7B 2OUJA 1ZREA 1UAIA 3CF6E 4I01A 4OUMA 2ZGMA 4N43A 1OKQA 4QHBA 4K21A 3NSTA 4RR3B 4FAGA 5FO8B 1UL9A 1LTEA 4IEQA 3CLPA 2D6NA 2Q1MA 3OD0A 3PVEA 5HCFA 2PAMA 2C0ZA 3TN91 1BJQA 4COVA 4YFWA 1LGBA 4N7UA 2E53A 4QPYA 5EV7A 1BVP1 4AQ2A 3QH7A 4LO8A 1UN1A 3RJ2X 1LOAA 1GANA 3NKGA 3AP5A 4LBQD 2PLV2 3S30A 4M0HA 2R042 3I59B 3RRDA 4MLOA 5B2GB 1QJX2 1O3TA 4X8NA 1LENA 1OQDA 2MEV2 4IERA 1R082 3ZXLA 1ZM1A 5D8AC 3ZYPA 3RQ0A 1WW6A 2ILMA 4FCAA 1WD3A 4D3WA 3KLSA 2VGDA 3NL1A 4LLOA 1NCRB 1JW6A 2DFCA 4O9GA 4HK9A 2P3KA 2RS33 3ZSLA 5A3MA 5GJ6A 2VNGA 3C3VA 1J58A 5GLWA 4N43B 5KC6A 3EHKA 4BMEA 4YVWA 4CDXC 4YGBA 4AVVA 3JB4C 3RI9A 5IK5A 4E2GA 1MQTC 3ASIA 4BLIA 1ND3B 2IFRA 5IK8A 3NW4A 4WVZA 4BIOA 3WCSA 2PLV1 1G86A 2ENRA 2R041 2VQAA 4BPZA 1CAVA 4B4QA 1QJX1 1QXRA 5HXVA 1DBNA 2WNUC 1R081 1KJRA 1WLCA 1ZZBA 1HRI2 4L92A 1S0IA 5JPNB 1C4RA 3HT1A 2ZMLA 5FPZA 4QX5A 4ASLA 4OHYA 4LBQA 4TYSA 5BNNA 3M8LA 3ACLA 3D5OA 5KHKA 5JDBA 4EWEA 1AR93 4TSVA 3FLRA 3PVOA 1RITA 5EWSA 2QUOA 3TNPB 2XVKA 4LHKA 2HWC2 4NVPA 1QJY2 1DU3D 1POV3 3IDEA 3KCYA 4KGQA 1O7FA 1G9BA 2D40A 1AX1A 1J1LA 1YIPA 3ETQA 5BNNC 5CFDB 2ZGNA 1YLLA 1B35A 2YPJA 1Q8PA 5C4WB 2XWBB 5AVAA 4P9IA 2VECA 5KHJA 2CGPA 4Q1RA 1H1AA 3AKSA 3N7KA 1GNHA 4RSUA 3LA2A 3GF6A 4NPRA 4GB33 4XOGA 3AZXA 1I5ZA 5IUQA 1BQPA 1Q43A 4YG3A 3BPZA 4AEDB 3BB6A 1REDA 3POWA 3AX4A 1SLTA 5CIRA 3ZFEB 1B35C 1LCLA 2PN5A 1YUDA 1CAVB 1NQJA 4KQ7A 1SLIA 4HL0A 4E2SA 4XMAA 1ASJ2 1XNDA 1HRI1 1BVVA 1RGSA 2HWE3 4QT6A 2A6YA 2W68A 2RMU3 1Y43B 3JZVA 4QGNA 2JKBA 2JJ6A 3E97A 3VN4A 3VBFB 4QD2A 5AC93 4JTNA 2XKPA 4LT5A 3HN1A 1MEC2 4UW6A 1QH6A 5HBAA 1QWRA 2HWC1 1UCXA 1QJY1 2XJSA 4ONUA 1JXNA 1WMFA 4EWAA 2VXRA 1BBT3 2VVDA 5E8AA 1VAKA 1K5MC 4XJAA 1VBA3 2PA7A 1DGRA 3BOPA 3SH3A 2QVSB 1HQLA 3WUDA 1HIXA 2FZ2A 4UW3A 3GBFA 2ATFA 2XPJA 3BOWA 5GM0A 2R16A 3WW4A 1MS3A 3AB0A 5JPMB 2O8OA 4EWDA 5DZGA 3BODA 4XFCA 4D94A 1WCDJ 1XQNA 5JOYA 5FLJA 4B29A 4GALA 1ASJ1 2WS93 3OGGA 2C5DA 1PGSA 2RM23 3ZMOA 2EXIA 4QPGC 2EAAA 3MZHA 2WQZC 1YO8A 3OPZA 5ABJC 4H7MA 4OHWA 2EALA 2NZ9A 5FMOS 1MEC1 4CEYA 5CAZA 3JQXA 4EN8B 3ELNA 2ZX0A 4IL7A 2A3YA 3TB0A 3T2TA 5E1RA 4F3JA 2IXKA 5A33A 4GMP1 3DPRC 2DVGA 3ZYGA 4FPKA 1FV3A 4IEUA 4KBBA 1UU4A 2MHFA 2QCSB 4CEYC 1HV0A 1RL3A 5BPXA 1Z78A 2YC0A 3BCWA 1G9DA 1RUF3 3NV4A 3DKWA 3N35A 4D69A 2RS53 1AR62 3VBHB 3IDBB 5EZWA 3CJXA 4YRDA 1AXZA 4NWWA 4N53C 3MIGA 5KBFA 5EXOA 4M3CA 3AM2A 4WVMB 1AR72 3WP3A 5I8TA 3DGTA 1W6NB 4LTAA 5I0RA 1LHUA 3MLLA 1TMF3 1CAUB 5JIAA 4KGGA 2E51A 4K9SA 1LOFC 5AFEA 1NLSA 4KU8A 4LNVA 1IS3A 5BNOA 3R4DB 4KNCA 3VBOB 1MS8A 4HLTA 4YM1A 2OUHA 4FPFA 4U2AA 2JENA 2VUJA 4YNIA 2EAKA 1LESA 3SH5A 4CDQA 3PLQA 1MZFA 4AI1A 5LEKA 2EVXA 1BKZA 5E89A 2NMOA 2CTVA 4LUMA 2XL9A 1AR61 1QXJA 4DMIA 1DG6A 2GC0A 3OBTA 5KXDA 1RJ8A 2G9FA 1ND2B 4XJ8A 4I02A 1AR71 4DS0A 3IKWA 3KT7A 4UW5A 1UKRA 3VKOA 5KHIA 2A6ZA 1DGRN 3Q9OA 3FUQA 1FPN2 3N7MA 1XE7A 1ULDA 4MYEA 4FPLA 2WC2A 2ZGKA 5I91A 2RS32 1SLCA 3D8CA 1DIWA 4BIFA 4XTMA 4IV3C 1CN1A 1GLHA 2XWJB 1C57A 1GKBA 2MNGA 3AP6A 1EV12 5E88A 1O3RA 3VZJA 3ES1A 3KMHA 4JQRA 3RYKA 3AFKA 3VKMA 3ZXFA 5DUUA 3AYAA 3ILRA 5F9TA 2VG9A 1OLQA 1WUVA 5DG2A 1C8M3 4AGRA 4CDQB 3IMNA 2YGLA 4P9GA 2DCKA 5GLTA 4GWNA 4A7ZA 3PJYA 1YFWA 4JDMA 4DY3A 4LLFA 2YROA 1LGCA 1J3PA 4RQPC 1XU2A 2RE9A 2I45A 4CEWC 1NA1A 5KWRA 4DNYA 4GQ7A 1ULGA 2VVFA 2RS12 3UJQA 4QPIC 4P5HA 4QU2A 3W59A 1U0AA 2VNOA 5FFOC 4DXZA 1FPN1 1CPNA 1SLLA 2D3PA 2WNVA 2EIGA 4UBGA 5T52A 1UPSA 1AR92 5F6LB 2HWB3