4BMBA

Crystal structure of the n terminal domain of human galectin 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Natural Single Amino Acid Polymorphism (F19Y) in Human Galectin-8: Detection of Structural Alterations and Increased Growth-Regulatory Activity on Tumor Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords GALECTIN-8
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bmbA00
1V6OA 5IT6A 1AX0A 2DVFA 3RRDA 1GZ9A 3OJBA 3IPVB 4UW5A 4YLZA 1LTEA 3N7JA 2A75A 2DURA 3WVJA 1ZA4A 1JYCA 1AX1A 1KRIA 5T5LA 1GICA 4Q1PA 1MS1A 2SBAA 4FP3A 1WCSA 2JE7A 3B69A 1Q56A 5CB7A 3I4IA 4LBKA 2UURA 4PBPA 3WCSA 4YW3A 2ZGUA 4WV8A 2OW4A 1S0IA 5CA6A 3PVNA 1X50A 2ZMKA 3C2UA 1GV9A 1FV3A 1UKGA 4FPEA 5IK7A 1MVEA 2ZHKA 1WLWA 2EXJA 3AP4A 3LCPA 1SLAA 4Q8LA 3WG2A 3WHTA 1QKQA 4IQPA 4AWDA 2G4IA 1LOEA 1SBDA 2VUAA 4P9WA 1IKPA 3NV1A 4XBLA 4XOGA 4YW5A 5AVAA 1BXHA 5L73A 5T52A 2WT1A 2R0HA 4XIOA 1LU2A 4YFWA 2R1BA 4AGGA 4SLIA 4LBQD 3QCWA 2DVBA 1MR5A 1LHUA 1IKQA 1MS3A 3VUOA 4YGCA 5DUWA 1YXWA 1LGNA 1SBEA 3PMEA 2ZABA 1JUIA 4R9AA 1NXD1 4GWMA 4YFZA 1WBLA 3AZVA 2DWRA 1FAYA 2OVUA 1LEDA 4K1YA 1QF3A 1UZZA 1Q8OA 1O4ZA 2P34A 4GWNA 5GJ6A 1JBCA 2NZ9A 3ZYRA 2WSUA 2ZZJA 2ENRA 1DQ2A 1YRZA 2BQPA 5HCBA 1YI7A 4DS0A 2ZGRA 2D7FA 4ZXKA 2VY0A 1G86A 1YYNA 4XJAA 2W08A 3OBRA 5KXEA 4AVTA 1WUVA 2FMDA 2CWSA 3BIWE 1RINA 1HQWA 4Y20B 5IK8A 2CWMA 1QGLA 1C1LA 3PVOA 4GALA 4DFSA 1S0CA 1JYIA 1EPWA 4LBOA 5DUXA 2A3YA 3WNXA 3VKNA 1BQPA 1ENQA 2A5ZA 4XE9A 1IOAA 2VW1A 1A8DA 3WDXA 2HYKA 1AJKA 1IS6A 1D0HA 4FPFA 4FPGA 1G9AA 1CPNA 2A7AA 1B09A 1F9KA 1KDKA 4XHBA 2R16A 2ARBA 2GNTA 5DXDA 1FNZA 1I3HA 1DBNA 4Y1ZA 1H9PA 3FFZA 4YZ3A 1GBGA 4FOVA 2A6XA 3AX4A 4LBLA 3ZXEA 2I2SA 2UWAA 1RIRA 1DGLA 1IS4A 5JDBA 3ILNA 3OBTA 3T1MA 3H0OA 1V6MA 1AZDA 1KJLA 2D6PA 2D44A 2GDFA 2P3KA 4HANA 4JRAA 1IS3A 2XG3A 2JECA 4P9XA 3AZYA 3PJQA 1ULDA 1ULGA 3R4SA 2JE9A 4LBMA 5GZCA 1SLTA 1S0GA 3B3QE 3SLIA 1DLLA 1QDOA 2D6KA 4K20A 1QNWA 1MVQA 4H55A 4HL0A 2R1DA 4D69A 3FLTA 1SLIA 4YZ5A 3M3OA 2W39A 1WBFA 2E7QA 4NOTA 4M3CB 3RG0A 1ENSA 2P37A 4BM8A 4Y20A 3W58A 2A70A 1GKBA 4XIKA 4FOWA 1QOSA 2VXRA 3T2TA 2ZKNA 1N47A 3A4UA 4Y22B 2ZACA 3WG1A 3SH3A 4C1WA 2UWCA 4JCKA 4YM1A 2FHRA 4XZPA 2GNMA 2P2KA 2NM1A 3OYWB 2A3XA 4DPNA 3OPZA 2VU9A 3W59A 1QU0A 3IKWA 3VKFC 2V5YA 5JMCA 2JKBA 1UX6A 1GZCA 1W6OB 2D43A 1FV2A 3N7LA 1BJQA 2EXHA 4JC1A 5H9QA 1W0PA 1DYKA 2Z42A 1A3KA 5FRAA 1W6OA 3USUA 3RMXA 4DQAA 4M00A 1ONAA 1VAMA 3ZXFA 4PCRA 2DYCA 1G8WA 1QMJA 1LHOA 1VAVA 2ZHLA 3O0WA 4FPKA 4FOQA 2D3SA 4R9DA 2ZA9A 3N35A 4FPHA 4XTMA 4CTEA 1GLHA 4LBQA 1GZWA 3ZYPA 2PHFA 1V6JA 4ITCA 2DU1A 2D6OX 4FPLA 4OZXA 4XDQA 4Y22A 4Y1UA 4MYEA 4XTPA 3ZXLA 2ZHNA 1YIFA 3AFKA 4WVVA 4YG6A 2DTWA 4ASMB 3PVEA 2OUHA 3RSJA 3GALA 4AVSA 4YW1A 1LOBA 5KXCA 3POYA 3WCRA 4R9CA 3HN1A 4BMBA 2VH9A 2LTNA 3MPPG 1A78A 1LJ7A 4ISQA 5JLVA 2DTYA 1JHNA 1DQ5A 1C57A 3I8TA 4Y24A 3ZXJA 5DUVA 5GLTA 4M01A 5DG2A 2D3RA 3L2YA 5JOYA 1H9WA 2ZAAA 1F31A 3SH4A 2WNEA 4YGDA 3CNAA 3ATGA 3VV1A 4LBNA 4PQ9A 3WDWA 1FX5A 1G7YA 1N3OA 1MZ6A 3V0AB 2AUYA 5HCFA 4U36A 1LENA 1LOGA 4XMAA 2DV9A 1CIWA 4YZ4A 1LODA 3APBA 1PZ9A 5GZEA 3UK9A 1U0AA 2VW2A 1G9FA 1WW7A 1JOJA 2DU0A 2EXKA 2DUQA 3VKMA 1OQ1A 3NWKA 3ILRA 4LBQB 5KXBA 3WDUA 2UU8A 4FPOB 2GMMA 4FPCA 4K21A 1O4YA 1JXNA 1N3PA 4FP2A 1J1TA 1HKDA 5EWSA 5JOZA 3SH5A 1ULEA 2ZGTA 2WLQA 2YMZA 3RQ0A 1CONA 5GZFA 5GALA 3AXEA 1LOFA 3ENRA 5FREA 3N3HA 3ZXKA 3AYCA 4PBOA 5T50A 4BQ1A 1UN1A 1CESA 3WDVA 2ZHMA 4RL7A 3VKLA 2GNDA 3JU9A 2ZGSA 2E7TA 1QOTA 4CRQA 3V0BA 4XHXA 2JD4A 4L8QA 1S1AA 5SV8A 3ZVXA 1MACA 1IS5A 3Q9OA 1BYHA 1LOAA 4YM2A 1AVBA 1CVNA 1V00A 2DVGA 2LALA 1I1EA 3B01A 1HQLA 2GALA 5JOXA 1WLCA 2DUOA 2EXIA 1SCRA 3INAA 3HMYA 3O12A 3VKOA 4BMEA 4FOYA 2JJ6A 4K1ZA 4AGVA 1S0BA 4UW6A 1W6PA 3FUQA 1AXYA 4XJ8A 2VW0A 1SACA 4NO4A 1D2SA 1DYPA 2OUJA 3V64A 5KXDA 3MEPA 3IMNA 4XBQA 1DQ6A 3AYAA 1LHNA 1QOOA 1UMZA 4M3CA 3O0VA 1DHKB 1V6NA 1ZM1A 4GKXA 5IK5A 4BPZA 3AK0A 4AYUA 3USUB 1Q8VA 5CAZA 2PHRA 1TEIA 4P9YA 4XJUA 5H9RA 3AYEA 4PF5A 5E8AA 4ATFA 3V0BB 3KQRA 4DRVA 1YO8A 1MS9A 4GA9A 5F5QA 3JUUA 3N36A 3OY8B 1G9BA 2WKKA 1WLDA 3AZXA 1APNA 1N1VA 5DZGA 1MZ5A 1KDMA 2CTVA 1W6QA 1W6PB 1KITA 1MS0A 3RMYA 3T1LA 2AR6A 2B7YA 5DZFA 4F83A 3DGTA 1LEMA 1UL9A 4YZ2A 1NLSA 3WOGA 3AP7A 1N1TA 3SITA 2PHTA 1V6LA 2H0BA 1BZWA 1DQ1A 2CY6A 4ISRA 5E88A 2AREA 3NV3A 3NV2A 5GLVA 2AYHA 1LULA 1S0JA 3WDTA 3WDYA 1CN1A 1LOFC 4I30A 5GLZA 2A6ZA 3FBYA 2GMPA 5GM0A 1VALA 1CR7A 1QDCA 3A0NA 1LU1A 2W68A 1Z78A 2WJSA 4XBNA 2D6MA 4YGBA 5JOWA 3WG4A 1N3QA 5T5JA 1JW6A 2YV8A 3GNEA 3AJYA 1WW5A 4FVVA 3LSDA 3AJZA 3WUCA 4YM0A 1JN2P 1GNZA 3HR9A 2Q5TA 5IUQA 4WZFA 1LCLA 1MS5A 3TAYA 1W6QB 2ZMLA 4RA0A 5F9TA 3UL2A 1VIWB 3M3CA 4YG3A 1V6KA 1UZYA 2PHUA 2ZGQA 4XJZA 3POSA 4KBBA 5CNAA 2C5DA 5GLWA 5H9PA 5IK4A 1Q8PA 2AH2A 1LGBA 1FATA 2NMOA 3M2MA 4Q2FA 1DFQA 1Q8QA 3M3EA 1VLNA 4Y1YA 4UW4A 3WUDA 3ZPYA 5CBLA 3AP6A 4M3CF 1LECA 1AX2A 2R0FA 3UJOA 5EYXA 2A3WA 2E53A 3IN9A 2D6NA 3MW4A 5GZDA 1SBFA 1GYKA 2A6YA 5T54A 3WZ1A 3OYWA 1H30A 4Y26A 1DQ0A 2WSVA 2XB6C 3FUOA 4XXAA 4XJWA 1RITA 2CNAA 2EALA 5T5PA 1W6NB 1GSLA 4Z8BA 2KM2A 3MW2A 2ES3A 4DRRA 1OKQA 4YG0A 4YM3A 5E89A 4YGEA 1UAIA 1S0FA 2NYYA 3B9CA 4XYXA 4ZKTB 4GKYA 1BKZA 2YROA 4XMIA 2AENA 1AJOA 1GNHA 1LHVA 2GN3A 2PHWA 4Q1RA 4WVWA 4BOWA 2ZGLA 3FLRA 4BLIA 1N1YA 4Q27A 3N7MA 1DIWA 1DQ4A 1S0DA 1V6IA 3B00A 4U2AA 3AZWA 1AXKA 2E6VA 2WT0A 3AXDA 3WV6A 1AF9A 2ZGPA 2C9AA 1PZ7A 3ZSMA 1LHWA 5HCAA 3RS6A 2ERFA 1HLCA 5T5OA 3FLPA 4Q8KA 4FPYA 2CL2A 2YXSA 3TB0A 1WW4A 4R9BA 4M3CE 5LK5A 5DG1A 4AGRA 2RHPA 1SFYA 2ZGKA 1SLCA 2AGSA 3ZSJA 1N1SA 1R1ZA 1AXZA 1W6MB 1S0EA 2ZGOA 3A0KA 1WW6A 2WT2A 1ULFA 2YZ4A 3WG3A 5EYYA 4YZ1A 1Q8SA 2DVDA 1F5FA 2NMNA 2ZGMA 3BOPA 1HDKA 2E51A 3UJQA 5GZGA 2YY1A 2NP0A 2NN8A 1GZWB 1WD3A 1W6MA 2PHXA 4XJ9A 4FQ4A 5JVVA 3WLUA 3AP9A 1C1FA 5H9SA 3OY8A 3POWA 4FQZA 2UWBA 2P3JA 5DUUA 3D4KA 1ULCA 2R49A 1OFSA 3AP5A 1MS4A 3O5SA 4UW3A 4Y1XA 3ZSLA 3BODA 1WD4A 3ZSKA 3V0AA 4Q26A 5GLUA 2GMEA 3QLQA 1XQNA 1Z0HA 2A6WA 1DZQA 4LBJA 3BTAA 3IPVA 2SLIA 1CPMA 1KQRA 4GXLA 1CJPA 4TZDA 2V73A 5BYNA 1ENRA 4BLJA 3N7KA 2A71A 2DVAA 4XXPA 2EF6A 2EIGA 2TEPA 4ATEA 4TYSA 3O0XA 4C1XA 2ZGNA 1G9DA 3V65A 1SLLA 2A6VA 3NV4A 2ZMNA 5EXOA 3MW3A 3D5OA 1C4RA 1W6NA 2DUPA 2P3IA 1FNYA 4YW4A 1G9CA 3AYDA 3U4XA 4AVVA 3R4UA 1SLBA 2GNBA 1Y7BA 3ASIA 4YW2A 1MS8A 3M3QA 1KJRA 2EAKA 4XILA 2ARXA 5T55A 3SNMA 3DUIA 1QNYA 2CYFA 3WHUA 1FYUA 1LESA 1W0OA 3ILFA 3M1HA 3KM5A 1GANA 3AZZA 2ZBJA 2D6LX 4FPJA 1URXA 1UPSA 2GN7A 3SISA 1CQ9A 1PZ8A 3D6EA 3OGGA 2D3PA 4Y1VA 5DZEA 4CZSA 4P14A 3R05A 2WQZC 2PELA 1SCSA 2W52A 3IM0A 1LOCA 2JDZA 1LGCA 3LSEA 4W65A
chains in the Genus database with same CATH superfamily
4QQPA 3N9PA 1Y9QA 5L9RA 3GCXA 2RMU3 2VNGA 3VHNA 5DDJ3 4A2UA 3T30A 2J1RA 1AYM2 3OJBA 3IPVB 4Q0PA 3N7JA 1XE7A 2A75A 4UBGA 1ZA4A 3U78A 1AX1A 3WVJA 1W2TA 2YYOA 4YVWA 3IDEA 3VN4A 4LPLA 2DFBA 4TWTA 4YW3A 2ZGUA 4LO5B 3TN91 5CA6A 3W20A 5JXHA 1AR82 1O5UA 3LEGA 1HN1A 4MG2A 2YC2A 4FPEA 5FZOB 5TSWA 2ORXA 3E5QA 3KVBA 2Y38A 5FYYA 3WHTA 5B4XA 3SKVA 1GP5A 2G4IA 4AWDA 3FHQA 4HPKA 2XWJB 5FP4A 5AVAA 4WVMB 4ZPIA 5FV3A 4IV1A 1HRV2 1A6CA 3WF2A 1DG6A 1ZBE2 4YFWA 1TME2 4ASKA 1ASJ2 3VD3A 4URAA 4Y5Z0 4LE3A 4SLIA 3C8XA 3PL0A 2Y6LA 4Q4V1 2JDUA 2WRAA 4OQ8A 1CGPA 1ZBE3 1TME3 4QXCA 3AKRA 1LHUA 4NN0A 4NVPA 5LA1A 3VD9A 3WF3A 1TVGA 1JZ6A 1LGNA 1SBEA 3OOXA 4G9SB 4E2GA 1ASJ1 4YFZA 4GWMA 2VD7A 2F17A 1FAYA 4CA9A 5EIYB 3I3MA 1QF3A 2K46A 2WWJA 4XF1A 4GB31 2Q0AA 2QNKA 2WZR1 4QX7A 3NNLA 3ST7A 3GYDA 4AEMA 2NZ9A 3ZYRA 2ZZJA 1CJDA 2ENRA 2HEYF 2JDPA 4RR3A 1ZRDA 1OBNA 4I0BA 1UOJA 5FUIA 4ZXEA 3E6DA 4GH4C 2ZGRA 4ZXKA 1UU4A 2QQIA 3RZMA 2W08A 2MHFA 2YC4A 2YPJA 3M4FA 3NO8A 1JTZX 1H8TC 4JGZC 5D2AA 2AZ5A 3PLQA 4OI2A 4E4ZA 3ZXDA 1C1LA 5CVRA 4R52A 3VBRC 5LWBA 5C5TA 3VBOB 5C6CA 5KHGA 3IAQA 3MUY1 5JCTA 4AFDA 3VKNA 1L7RA 1CX1A 2A5ZA 4QXBA 3ZFEA 1OOPA 4XE9A 5A32B 1OD3A 5IVCA 3GBWA 2VE1A 2XGXA 5KXCA 1A8DA 1IPSA 4J25A 2BFUS 3NQHA 1G9AA 3VZJA 2FDJA 2R16A 5C3RA 2GNTA 1AL22 4IW3A 1I3HA 4NMIA 2JB4A 1XSQA 3FFZA 4ES9A 1Y43B 2IZWA 3T2QA 5JPNB 4GQ7A 1DU3D 4PJYA 5JDBA 3H0OA 1RHI2 1JZ8A 1XJAA 2CGNA 1KJLA 2HBTA 3DYOA 3WP3A 2JG9C 1QJX1 2XG3A 4PLOA 1TMF1 5KR7A 1W9SA 3H42B 3JD72 3PJQA 1ULGA 1YJKA 4OYUA 1J3PA 4IGOA 1BK0A 1S0GA 4RFRB 5ABJA 5FO9B 4NHXA 2WNUC 1RUC3 4K20A 1GR3A 1PO23 3LAGA 1MVQA 3IZOA 4H55A 4HL0A 2R1DA 5L9VA 3EJKA 2FD8A 1AR91 2WNVB 2I45A 1T2XA 3FL7A 1WBFA 4M3CB 3RG0A 2P37A 4XCBA 2ZXQA 3CZUA 3GBGA 2Z69A 4LMFA 4XIKA 4A6OA 3CJIB 3GHNA 4J1XA 1XNBA 4KNCA 5IVEA 2QDRA 4DNYA 1QOSA 3Q8EA 1N47A 4UFMA 3WG1A 2W87A 1K5MA 2UWCA 2GAUA 3LPFA 4JCKA 1DGRN 1VMFA 1ZBA3 4YM1A 4YRDA 3H8OA 2XBO2 4IEXA 2Z4FA 4M4PA 1MZFA 1W03A 4DPNA 5A3TA 4AAXA 3I97A 3HNMA 4MZUA 3O1UA 3KF5A 1UX6A 1E57A 4W6YA 2BYVE 5IW0A 2D43A 1GQHA 3ZDVA 5ABJC 2D5FA 3ZX7A 2X09A 2EXHA 3LGRA 1COV3 1O6UA 2VQUA 2RG4A 2RR12 2WS91 1ND2B 2JB8A 2YDEA 5FRAA 3CEWA 3ZXFA 1PM7A 3BIEA 2BVBA 3FC0A 3NJXA 4PCRA 2OXBA 4CEWC 3H7YA 3V56A 2W9XA 3S7EA 4GMP1 2ZA9A 4BQYA 1BEV2 1L7QA 3LSEA 4PDWC 3MV01 3GJAA 4IV1B 1GLHA 4LBQA 4H2AA 4ZZ5A 3ABZA 2XLGA 4ITCA 4XDQA 4Y22A 4HK9A 3MV11 3U75A 3ZXLA 4D94A 1NY71 1QXJA 4KGGA 1E5IA 4KWUA 5FYIA 4OVEA 3BTXA 2NQYA 1H4GA 2DTWA 4AFAA 1XNDA 4ASMB 3OUHA 3GALA 3I2KA 2F6BA 1LOBA 3EBRA 4YW1A 2AEYA 3VHRA 3VDCA 4DY5A 2YPDA 2QZ3A 1PVC2 2GZWA 5FXZA 2BV4A 4OUMA 3M8LA 1LJ7A 1W2UA 4KQ7A 3UGGA 2DTYA 2Y6FA 4N43A 3DF0A 3VL8A 1PNGA 2B45X 2QQOA 3LF7A 1H4HA 2D3RA 3L2YA 1KFUL 2TNFA 1EV13 1ZA7A 2RM21 1YQ8A 2WNEA 1MEC3 4AL9A 5J1XA 3VV1A 4OHYA 3LPGA 3V0AB 4JKLA 1RB8G 1MZ6A 1RUC1 1H2NA 4ORFA 1PO21 4EROA 1LOGA 1XSRA 3NKTA 3ZN4A 1LODA 3APBA 1PZ9A 3D0JA 1JOJA 1XNTA 5C4WB 4HVOA 1OQ1A 1NE4A 5FZ7A 5IYYA 4LBQB 2IXIA 3UKVA 3KWVA 5EWSA 5LCWL 1O4YA 1N3PA 5J3UA 1O8SA 2PXJA 5JOZA 2Y8KA 2X05A 2JXAA 2WLQA 1ENXA 2XL9A 4CDXA 3AXEA 3L2HA 1W28A 3N3HA 3ZXKA 1DGWX 2WFF1 5T50A 4N53A 5FK7A 1QH6A 4D6SA 1R092 1SG3A 2UYBA 2WQ4A 2WA4A 2FBEA 4QU2A 4XHXA 5FY1A 3PUQA 3ZDSA 3ZLIA 1IS5A 1MACA 2AC1A 1JHJA 1DCSA 5FZHA 1LOAA 3JBG1 5CZKA 2DVGA 2LALA 3MICA 4RGKA 1QQP3 1I1EA 5JOXA 2EXIA 5FYMA 2P17A 3O12A 3ZN6B 4AI3A 1NUKA 5JMOA 3KB5A 4QPIC 4UFHA 3OG2A 2BU9A 4XVHA 2VO5A 1S0BA 4AGVA 4AI2A 3HN3A 4FBFA 4UW6A 3WNLA 1AXYA 3NAPA 3O14A 2RS53 3ZO0B 2VW0A 4EZHA 4MXWB 5I8YA 1DYPA 2OUJA 3THPA 1OF3A 3MEPA 1CX4A 3IMNA 5FBJA 5KXDA 4FTSA 1QOOA 4CDQB 4XURA 4M3CA 4IE7A 1DHKB 1ZM1A 3I3BA 4GKXA 4YW6A 2BPA2 1O5LA 3I3DA 5ACA2 1ODNA 3USUB 4K9SA 1CD3G 4CUBA 4FTBA 3J26N 4BZ4A 1UF2C 3UYJA 4E4HA 2C24A 1TMF3 2ZEYA 5C9AA 5H9RA 3AYEA 3CU7A 1RMU1 2YFUA 1UX7A 4OFGA 4CCKA 2VTFA 1UU6A 3R0RA 5F5QA 3JUUA 1SDDB 3P3PA 1QJFA 5BPXA 1RUE2 3N36A 2WL1A 3OY8B 4QGNA 1G9BA 2BOJA 5IVBA 1CAVA 2CTVA 3D82A 4QPIA 1W6QA 1OLQA 4BIFA 3CBNA 4Q0QA 3J7MA 1RUE3 1OVPA 1YI9A 2VOXA 3B7MA 3T1LA 2FDGA 5FR3A 4DY3A 1I5PA 4KU7A 3VBFB 4PI2A 4N8MA 2O0OA 3DGTA 5F32A 4QX8A 1UL9A 4YZ2A 1N1TA 4G4FA 3SITA 1PHMA 2PHTA 4BH9A 4DZGA 5LRSA 3IDCB 1BZWA 1VBA3 2WO2A 5E88A 1FXZA 3H3ZA 5GLVA 2HWE2 1OUSA 4B1MA 4OHZA 5E1RA 1SFNA 1W8ZA 2GMPA 4AR2A 1CR7A 4AQ6A 1LU1A 2JG8C 1S2KA 2J22A 3KV4A 4LLOA 4XFBA 4NAOA 4JDMA 4WZCA 3BALA 2W92A 3VBFC 1COV1 2QVSB 2ZEXA 3DXTA 3BKZA 3JBG3 4XQDA 3LA3A 1QQP1 2ZMLA 3UL2A 3AMHA 1VIWB 1US3A 3M3CA 3KF3A 1RUF2 3W5MA 1UZYA 1B35B 2JDKA 2PHUA 3POSA 4FXGB 4KBBA 3PIGA 4RS5B 4AOCA 2AH2A 4M0NA 3KV6A 1DLCA 2AEZA 4FFGA 1CAUA 1O4TA 1RUF3 4A3XA 2RS51 4Q2FA 1JZ2A 3AKTA 2ARCA 2Y64A 2YHJA 1IHMA 1VBE3 1ZREA 2JDAA 3ZPYA 2B42B 5CBLA 5IAXA 2Q8OA 1LECA 3ON7A 1PM4A 4QQ2A 3E5UA 4FO9A 1HXS3 1VBE2 3CDZB 2FDKA 3A21A 5CFCC 4A7KA 1GYKA 4AVBA 5DQ0A 2RDNA 3EQEA 3OYWA 3GBFA 2DCKA 4BK4A 4Q4W1 4Y26A 4FT8A 4CUAA 5A3MA 1JS9A 5IATA 2VPVA 2KXLA 1KD7A 2RM23 2CNAA 2EALA 3FHIB 1W6NB 4LHNA 4R8HA 4UI9L 1UNBA 4Z8BA 3MW2A 3VZLA 2B5HA 2XONA 4QDQA 3RZGA 5I0DA 5BNPC 4ZKTB 5FLJA 1S0FA 4I02A 1RUG3 4XMIA 5ERLA 4AEDB 5C3QA 3KD4A 4IEVA 4IEQA 1KEXA 4MV2A 4WVWA 1FMD1 1LHVA 4LO6B 3ALQA 4COZA 4N43C 3ZN5A 2ZGLA 2RS33 3T4VA 3B94A 3RZZA 1DIWA 1GP6A 4IEOA 3B00A 3AZWA 2RR11 2WS92 2E6VA 2XJRA 3AXDA 3K4AA 4NRPA 1AF9A 4CE8A 2VGDA 4RHV2 5J09A 3W21A 1LHWA 2XUMA 3RS6A 2ERFA 1HLCA 1TE1B 4AQ2A 4QPWA 2CL2A 1NX9A 4RFT0 1V70A 2Q1FA 2YXSA 3TB0A 5DG1A 3POBA 4UF0B 4JGYA 3WNNA 1SLCA 1Y3TA 4AEDC 4WM8B 1N1SA 4F7ZA 1S0EA 2PLV2 2XJSA 3I3EA 1TNFA 2Q8EA 1ULFA 5FZOA 2J1TA 1Q8SA 2DVDA 1F5FA 4B4PA 5C3PA 1RUD1 4E4DX 3H7JA 1BEV1 2YY1A 3BYWA 5G04L 1GZWB 4BE3A 1SDWA 4IEYA 2VXJA 3AP9A 2P3JA 1RUI2 3AVRA 4N9HA 1JYVA 3O5SA 5IVJA 3DPRC 3AL6A 4LXLA 4NHLA 1WD4A 4P9GA 4KG0A 1R091 3SCFA 4Q26A 4JV4A 2ZX3A 1HJFA 3QLQA 2YGLA 3AM2A 3HT1A 1Z0HA 1GNYA 4LBJA 3DYMA 5A80A 2WFF2 2SLIA 2W0XA 4C0HA 1KQRA 4CCJA 4DINB 5BYNA 2XL7A 4UFJA 3WSOA 3N7KA 1DGWA 4AEDA 3I2IA 5FCCA 2TEPA 2ID4A 3NAPC 3WNKA 4Z2WA 2CV6A 3WW1A 4P5YA 2ZGNA 3THDA 3V65A 1CZTA 4IEUA 4CEWB 3EO6A 5C3OA 1JOBA 2VZPA 1W6NA 2DUPA 1AL21 3J7NA 4JGYB 3LIHA 4OCTA 4CP2A 2BZDA 2HWF1 4AVVA 4CCDA 4YW2A 3U4SA 4IERA 1KJRA 4H3WA 4XILA 2R041 3POIA 4PDWB 1OA4A 3DUIA 3L9JT 2ZTNA 3DEMA 5A3NA 1LESA 2OPKA 1UWWA 1W0OA 1GANA 4RQPC 3AZZA 5J48A 1RUI1 2E9QA 1PK6A 3RI8A 3TYJA 4LIUA 2HJIA 1YUDA 2LUWA 1UPSA 5FXVA 3SC7X 2DCZA 1X82A 5FZ8A 3ZYJB 3H3LA 2XJQA 4P5HA 2PELA 4XF4A 1SCSA 2HWE3 1F4HA 2W52A 2BW8A 4MGYE 1LGCA 4ZONA 2GSYA 2IXJA 4MVTA 4N53C 4XFFA 3ZYHA 4K40A 2JIJA 2WZPP 4BXFA 4DMIA 3VDDC 4YSFA 1AX0A 5BXXA 1I5ZA 3J8F1 3RRDA 4CYDA 1GZ9A 5IFTA 3LA2A 1AR92 4UW5A 2PHLA 3IDBB 3ECQA 3CMGA 5FP7A 3MIFA 1MS1A 4DUVA 1B35C 1NCRB 2VZOA 2JE7A 4X8PA 4LBKA 5CB7A 1U12A 4BQWA 1ZX5A 3ZFFB 4PBPA 3VZNA 1HB2A 1K5JA 3M70A 1S0IA 1O3SA 1QJY2 3BB6A 3NKGA 2VQ0A 4QQOA 1GV9A 1FV3A 1OFNA 2XBO1 3RI9A 2WZR3 3WT3A 5IK7A 1WLWA 4MGKE 4N9IA 2EXJA 3IWZA 1UY2A 4RD7A 1NKGA 5LRRA 1SLAA 3WG2A 1QKQA 2IVIB 2WZR2 1QEXA 1SBDA 4P9WA 3NV1A 4XOGA 5LY2A 4QPIB 2WT1A 2CSGA 2R0HA 5A6ZA 1U5YA 3POJA 4XEZA 3VDAA 2C1FA 3PU8A 2JIGA 4AI1A 3TN92 2R1BA 4GMP0 1UPIA 3DL3A 4XFHA 3SXWA 3EHKA 4BQ2A 2GC2A 1MR5A 2ZAHA 3HJRA 4OQ9A 3RZHA 1MS3A 5FPUA 2OYZA 1DF0A 1OLMA 3PUAA 1HN0A 4Q4V2 4YGCA 5DUWA 1YXWA 2OQ7A 5JWPA 3IIIA 2D40A 3PMEA 4D7SA 2BEOA 3S7IA 3K3OA 1Y9MA 5FXXA 5FZ4A 2OVUA 3I49A 3H3UA 4B8EA 1R1A3 4CEWA 2LS6A 4C0BA 1O4ZA 2P34A 4UWDA 1WCQA 2NPIA 5HI0A 5HXMA 2DDUA 2XQRA 1SMVA 1M4WA 1YRZA 2BQPA 5HCBA 4DS0A 2XHKA 1G86A 2VQTA 3BCWA 4XJAA 5FUNA 5KXEA 1GWKA 4NWWA 5EZWA 2P5BA 4IV3B 3DPRB 2GH2A 1WLTA 2YC0A 2JDNA 2WZEA 2VMCA 2F4LA 5IK8A 3T0BA 2VUDA 2H0VA 1NLRA 1JYIA 3H1WA 1S0CA 1OH4A 4PLMA 3ZYIB 4XUQA 3ZPOA 2HEWF 4DXSA 4E4SA 3WF4A 1IOAA 1CAXA 3AMNA 3WDXA 2Y6GA 3A23A 3K77A 2EVXA 1PGL1 1VMHA 4FPGA 1B09A 1KDKA 4XHBA 2DBNA 2ARBA 1WWYA 3JCIA 4N7UA 3K4DA 1XBFA 3OB8A 4LE4A 4LO4B 3TOJA 4YZ3A 1ZRRA 4DXZA 1ODMA 4AI9A 2VMIA 3NL1A 3NAPB 3GCWA 3VL9A 1RIRA 1DGLA 4LO8A 4ZU4A 5G05L 3ILNA 2VOKA 3ZIWA 2VVFA 3T1MA 4DEQA 1UXZA 2D44A 2DCTA 1NQDA 4EJRA 2B9UA 1C3HA 3AZYA 4AAPA 1X8EA 3BVCA 2JE9A 2LROA 1GQGA 4D6QA 2YBKA 5I0RA 4LOSA 3B3QE 3VLBB 5I93A 2D6KA 1PNFA 4LKDA 3N9OA 2VCCA 2ET7A 2QQPA 4TN7A 1EAH3 2IVJA 1SLIA 1AYM1 3HOBA 1UKRA 3M3OA 4NOTA 4BM8A 2G19A 1ENSA 4EN9B 1VBD2 2JE8A 4Y20A 1HRV1 5FZFA 5FKBA 3RPQA 3W58A 3RVHA 4COWA 1OI6A 3WNOA 4XUNA 2RS12 2VXRA 1EYBA 3AC0A 3BPSA 1H0BA 3T2TA 4AK3A 3KT4A 2ZACA 4Y22B 3PURA 4MADA 5A7PA 2HWC1 4XQ4A 1UZ0A 3BGAA 4E8DA 1OT5A 2GNMA 4QXKA 2RDSA 4NWVA 3OYWB 3TNQA 5JAXA 2VU9A 1QU0A 2V5YA 3B5LB 4UFKA 3PTRB 1W6OB 3CJXA 3LZZA 2VM9A 2ZCWA 1DP0A 4V2VA 3P6BA 3N7LA 3WQ7A 4JC1A 1HB3A 2VBPA 2Z42A 1QXPA 4BQ3A 4NIGA 4QHOA 4HLTA 4DQAA 5A7WB 4CCEA 1ONAA 2GU9A 2DYCA 3OCPA 1QMJA 3O0WA 2Q8CA 1R082 2ZHLA 2VNOA 1XE0A 3POEA 4RS5A 2W3JA 4R9DA 1B35A 3N35A 4PIZA 4QB6A 1CZSA 3R4DB 4XTMA 3OPWA 2G9ZA 3LD8A 1GFF2 5KHHA 2Q8DA 2WYSA 4CDWC 3ZYPA 2DFCA 1BVVA 1K5MB 2QUOA 2DU1A 4FPLA 4XFIA 2CDPA 4A44A 1YIFA 4GWIA 4QKFA 3ZFGB 1UIKA 3NJZA 3RDIA 5LB6A 2B9VA 1YFYA 4QX2A 3POYA 1JZ7A 3WCRA 3HN1A 3RWNA 4QWNA 2VCBA 4CDQC 2VH9A 2LTNA 4OZOA 4ISQA 3F2ZA 2W94A 5JLVA 2WNVA 3K3NA 1EUUA 1JZ5A 5FZMA 4M01A 5DG2A 2PN5A 1QJU1 1VAKA 1IGOA 2V09A 4XC9A 2WS93 3SH4A 3BU0A 3ATGA 3LOIA 5FWJA 1FX5A 1GP4A 4QHBA 5AC93 1RGSA 3K51A 4U36A 1BBT1 3HIFA 3VBFA 5GZEA 3UK9A 4CXXA 5FKCA 1G9FA 4EN7B 5JR2A 1S2BA 4YVSB 1PK6C 2VCMA 3VKMA 5C9AC 1ZVFA 3BTYA 1X7NA 1YQ6A 3B02A 3GGLA 4MSVA 3DECA 3NJYA 5KXBA 1YFUA 2HWB2 2RDRA 3GZTB 4FP2A 1GOFA 1XU1A 3RQ0A 3M7AA 4Y5SA 1QH7A 4AE2A 4K7JA 5GZFA 1LOFA 2J42A 2O14A 3LDBA 4EYUA 1SQ4A 1SFPA 3AYCA 1S2EA 3RJRA 3LQCA 3Q8CA 1DZRA 2XHNA 3VBHB 1GOHA 4LKEA 5FZBA 4RL7A 4WVZA 3VKLA 5F7UA 1XYNA 2ZGSA 2E7TA 4CRQA 5SV8A 4L8QA 1EV11 4YVSC 3Q9OA 4P00B 1BYHA 2HKXA 3KT7A 4YM2A 1CVNA 3TEXA 3B01A 3VB9A 5DAQA 3AMPA 1WLCA 1SCRA 2NLRA 1JU3A 3ACLA 1Z7S2 3HMYA 3INAA 5FYBA 4EQVA 3I59A 2JJ6A 1AR62 3DKQA 1EAH2 4K1ZA 4RN5A 4D0QA 4F8AA 2HYXA 3HQUA 5D8AC 4CPBA 5LZ6A 2RJKA 1SACA 2Q1MA 1D2SA 2ZEWA 4MX3A 3GF6A 4OHWA 4HVRA 2XOMA 3AYAA 5CFDA 1O3TA 1OA3A 5FQ0B 3O0VA 4C8DA 1ZRCA 3GM8A 2PMWB 4DUXA 5IK5A 2PYTA 3AK0A 4GB33 2VZ3A 4C90A 3ZFEB 2ARAA 2ET1A 3LWCA 5A3PA 2PQQA 4JDNA 2GP3A 5FYUA 1L7LA 1TEIA 3C7OA 3QD6A 4P9YA 2R072 4XJUA 3MDPA 1W3VA 2J7MA 4PF5A 1OKOA 1YIPA 3Q8BA 4LQRA 2QE3A 4GA9A 4LA3A 5DAPA 4XF3A 4CDXB 5F3EA 3T2OA 1JMUB 1K45A 4LHKA 4BWOA 1WLDA 1QJU3 3CO2A 4MXWA 4NHYA 3MLKA 1UCXA 4WVMA 2HWB1 1JI6A 2VZUA 3RMYA 3GZUC 3NNMA 4RR3B 2AR6A 1BBT3 1CZVA 1R083 3KT1A 3RWKX 1NE6A 3BI3A 4F83A 4COUA 4K8FA 2Y0OA 4QDSA 4ZU7A 1BBT2 1O59A 2WO1A 5LEKA 3CHXA 3N4MA 4IL7A 1H1AA 2H0BA 4AVAA 3OD4A 4LA2A 1DQ1A 1LNSA 4ISRA 1OPOA 3NV3A 3VBUC 3WP4A 1CN1A 5FO8B 1AR73 2A6ZA 2W47A 3QOPA 1NCQB 4QX5A 5GM0A 2HWD3 1VALA 2WN2A 3A0NA 4PF1A 2W68A 3ZXGA 4CEYC 2IC1A 1J3QA 1RJ7A 3WG4A 3TRSB 2YG0A 4KL1A 1N3QA 1SHWB 4QGLA 4QM8A 1ZNPA 1JW6A 2IXLA 2YV8A 4QKDA 1HJGA 3FX3A 1GNZA 4IGQA 4YM0A 5FAXA 5IUQA 2X5IB 3TAYA 3PU3A 4RA0A 2RMU1 1O7FA 1U5ZA 4HKWA 2ZGQA 5H9PA 1HX6A 5GLWA 2VMGA 2W5FA 4HFSA 5CG9A 3FHAA 3MHZA 4YW7A 1LGBA 1FATA 2HLEA 2E31A 2NMOA 1Q8QA 1PX4A 1VLNA 2PAKA 4LEJA 3O1TA 4Y1YA 4LORA 3MIBA 4EWEA 3WW4A 3TN93 4CCNA 1K5MC 3AP6A 2XQXA 4NHKA 3WNPA 4GWJA 4K6BA 5IAVA 5A6QA 2FCTA 1ND2A 3O1SA 3KMHA 2JG9B 1SBFA 3A22A 4UFLA 2A6YA 5C8CB 3IT8A 3VD7A 1MQTC 4LK6A 4IV3A 3H8XA 1X36A 1DQ0A 4HZFA 2WSVA 4AFMA 3I7DA 5T5PA 2KM2A 3S5QA 5GKAC 1HV0A 4W4ZA 2WC2A 3CIHA 4V1PA 5FZDA 5J36A 3CJIA 3DXUA 3UKNA 3KCCA 4YGEA 4Y4RA 1AR63 1BKZA 4GKYA 2DF7A 2AENA 1QJZA 2G9FA 1GNHA 2QBXA 4ONUA 2OX0A 4QX0A 5FLIA 2QZ2A 4M4RA 4R4ZA 4ARXA 4BOWA 2RE9A 4JVAA 3BPZA 2JKXA 5FPZA 2VBDA 4U2AA 1VBE1 1V6IA 4HT1T 3IIAA 3T4HB 4LUKA 1O91A 2WDBA 2WAAA 1PZ7A 1RVF1 2W1QA 3ZSMA 5L19A 5HCAA 5T5OA 3FLPA 2OS2A 4IE4A 5JSPA 2PHDA 1H2KA 4O65A 3T3YA 5LK7B 3A7QA 5E6HA 4M3CE 5LK5A 4BA6A 2XJPA 1OSGA 2AGSA 1UXXX 3WY6A 1AYN1 4CDUA 4YVSA 3A0KA 2WT2A 2B39A 1FOD3 2J1SA 2RMU2 1L3JA 4AQTA 4PT6A 1U5IA 4YZ1A 5DDJ1 2NMNA 1NQJA 3BOPA 3UJQA 4CDUB 5GZGA 5D8AB 5C33A 2NN8A 4DXRA 4OHVA 1W6MA 2FMYA 3WLUA 1AR83 2VBBA 1YEWA 4Y5TA 3OY8A 2JDMA 3MPBA 3UGFA 1OOPB 3JBG2 3D4KA 4P02B 5FMCA 3AP5A 1OFSA 1C8M2 2RS31 2JG9A 3ZKUA 4BISA 3RYRA 1NZCA 5FLHA 4HSJA 5D1IA 1RTVA 3U10A 3RJ2X 3VDBA 1OC1A 1XQNA 2N7GA 2Q4SA 4QKNA 3KGZA 2YFZA 1CJPA 4TZDA 2FZ1A 3VBOA 1MPXA 3TEYA 2ZX1A 1AR72 5FJHA 1C8NA 2A71A 1NLQA 4W6XA 4S2GA 2QJVA 5FZ3A 4TYSA 1VBD3 3ES4A 1HXS2 3ZFGA 2XDVA 2A1XA 2VL4A 3H50A 1WKYA 1QY4A 1OVSA 3JZVA 4S2FA 4AVCA 5F5AA 3HAGA 3P1IA 1R64A 1BEV3 3D5OA 1C4RA 3VZKA 2P3IA 1FNYA 4B7KA 1EY2A 5FZGA 1D4M1 3OPTA 2C0ZA 3VBUB 4META 2A73B 3J8F3 2Y6JA 4HOOA 1VB4A 5FYSA 3HNBM 3H1MA 2GNBA 1Y7BA 4UT5A 1REEA 4BU2A 2P6CA 4PIYA 5ANNA 3VBSC 1VJ2A 3N9QA 1JH5A 4DIQA 1QNYA 4AXOA 1FPN2 1W90A 4N53B 2WABA 5FZAA 2B8MA 4CUCA 1E5SA 5FZ1A 3ZOIA 1LR5A 3Q8FA 4CEYA 4IE5A 1YFXA 2HWD1 3FWEA 4QAWA 2VULA 5A33A 2D6LX 2VC9A 5AFBA 3SISA 1C5HA 1CQ9A 2BDRA 3OGGA 1YFWA 5DZEA 4CZSA 1RUD2 2VZVA 1OQDA 5BNNC 3R05A 5F3CA 1GQPA 2WQZC 4FAGA 1HB1A 1LOCA 2JDZA 4I2OA 4XABA 1PIV2 1YHFA 2GC3A 1V6OA 3AMQA 2HWD2 3C7FA 5IT6A 3PNAA 5DAXA 1GMMA 1Y4WA 4Z2AA 1IZ3A 4I0AA 4CCCA 5DN2A 5ISLA 2RVAA 4HSLA 4YLZA 1ULPA 1NA1A 1LTEA 1DZTA 4WBBA 5T3NA 1W2NA 4JHTA 1GICA 4O61A 4W50A 4GMP3 3B69A 1F2NA 1Q56A 1W3XA 3I4IA 4NROA 5JI9A 5I8TA 5FYVA 2XKPA 3WCSA 4WV8A 1JZ3A 2OW4A 3THCA 4QX1A 4LTAA 5B2GB 1JZ4A 5FY8A 2BWAA 1QJX2 3PVNA 1X50A 2ZMKA 3C2UA 4QKBA 2WUHA 4LUMA 3NMBA 1VP6A 3MI8A 3OBZA 4O9GA 4WM7B 1OUXA 2JD9A 2E63A 2ZHKA 4EWAA 1OXCA 4D7TA 4ES8A 1QJX3 4LLFA 4IQPA 2BBVA 1POV1 1LOEA 3ACGA 3I2OA 3F95A 5L73A 3WQ1A 1RJ8A 2CGOA 2VECA 1PO22 1LU2A 4QPGC 4AGGA 4B3NA 2ZPXA 1WCUA 4LBQD 5A7OA 2E7AA 1FPN1 5A7SA 3M3IA 4LNVA 2DVBA 1ACCA 1IKQA 5LA2A 3VUOA 4LT5A 3O1RA 5A1FA 3HWJA 1QXRA 3VBHA 2QQJA 4JKKA 1MQTA 1JUIA 3VHOA 4CU6A 5DAWA 1UOFA 2JICA 5HPOA 3PUIA 1H2LA 3R6SA 2DWRA 2VTXJ 5FY9A 4K1YA 5FYTA 1BCXA 4P08A 5KC6A 2WNVC 4YARA 2XBO3 1VRBA 5JZGB 4MGSA 1DGRA 1PO11 5GJ6A 3SEPA 4BK5A 1XYPA 3ZIXA 2WSUA 2BNOA 3AKPA 5SV5A 2WNUB 1DQ2A 1HXS1 2IFRA 5C5UA 1YI7A 4TLFA 1O3QA 3FFQA 2PQSA 2VY0A 1YYNA 3I59B 3UV9A 3OBRA 1XU2A 1ULOA 4XFCA 5FZLA 2H6CA 2VUCA 2XVLA 2FMDA 2CWSA 1AUYA 1COV2 1HRI3 4MGIE 5BNNA 4Z1VA 1RINA 1HQWA 1H2MA 1QGLA 2G1MA 2LW8A 1RUH3 3PVOA 5FPLA 4DFSA 3OTFA 4LBOA 5DUXA 2A3YA 2W2IA 3WNXA 2VNRA 2ZEZA 1BQPA 3PUSA 5DAVA 3T2PA 3WF1A 4G3YC 1RUG1 1AYM3 4IE0A 3OUJA 4QQLA 2VW1A 4XCAA 3NVCA 5A3LA 5ABJB 1W04A 4XUOA 1IS6A 4FPFA 3PTYA 2CDOA 3WNMA 2A7AA 3MF9A 1F9KA 3THTA 3O1PA 1FNZA 1V9U2 4JRLA 1VBC3 4Y1ZA 5DDJ2 2QQVA 1WA4A 1GBGA 1VMJA 1UYYA 1K3IA 2A6XA 3AX4A 4IE6A 4LBLA 3ZXEA 4OUEA 4B4RA 4CVUA 1VBC2 1V6MA 2D6PA 1VBD1 2J1AA 3NW4A 3ZFFA 1IS3A 4JDOA 2JECA 4P9XA 5CKQA 3ZFGC 4S2HA 1POV3 3R4SA 1ULDA 5FMBA 4IEZA 4AG4A 2J1EA 3GJBA 1Q3EA 1VE0A 2JG8B 5FZKA 5GZCA 1SLTA 4JHZA 3SLIA 1LB2A 1QDOA 3HEIA 4AQSA 4IV1C 4C91A 1QNWA 1D4M3 1C28A 3FLTA 1YWKA 3FMGA 2Z79A 5FTTC 4YZ5A 2JG8A 4E2QA 1TME1 1D4M2 2W39A 2E7QA 4Q4Y1 2QFEA 3DN7A 2VAUA 3O1MA 2R7EB 5F6LB 4Q4X3 3VDDA 2BBAA 3NSTA 4FOWA 1KS4A 1ASJ3 1R093 2ZKNA 3PVBB 4V2WA 1CAWA 2QQNA 4H7MA 5JIUA 2FHRA 3J7HA 1PK6B 5AVPA 1QQP2 3RFRA 1CAVB 4XDPA 4YVWC 5EV7A 5C4WC 3WD5A 1AYN2 2X10A 2NM1A 3GHMA 2A3XA 1OLME 2GC1A 4Q4W2 3W59A 3VKFC 3IKWA 1GOGA 2JKBA 1GZCA 2XJVA 5CYYA 3FN9A 5IFPA 5FWEA 4AF9A 2XLAA 4ZU5A 5A6XA 1MQTB 4OLLA 5K0UB 4LK7A 4IEPA 5D21A 5H9QA 4D7YA 3BUCA 1C5IA 1DYKA 4R4XA 3PUHA 1W6OA 3USUA 3RMXA 1C8M1 2RS32 4A41A 4HG6B 1VAMA 2BGOA 3BU7A 2XLFA 2GC0A 1VAVA 2RS52 4FPKA 1UYXA 4FOQA 1DYOA 4B29A 1ND3C 4Q0VA 1M06G 1PIV3 4FPHA 3EMRA 4CTEA 1RUF1 1GZWA 2C4XA 4XQWA 1V6JA 2WNUA 2D6OX 4OZXA 3WW3A 1HIXA 4MYEA 1RXGA 5APAA 3LDKA 5ACA3 4EV0A 1XB9A 2PAMA 2F4PA 1ZZBA 3I54A 5FZ9A 4YG6A 3PVEA 2OUHA 5ANQA 2ZS6B 4I09A 4DUWA 3ZN6A 2EIDA 3C3VA 1HQNA 4R9CA 4WM8A 2BFUL 2VZRA 1RHI3 2WIIB 3MPPG 3LDRA 3I8TA 4CDUC 1C57A 4MXVA 4QPGB 4IV3C 1RVF2 3HNYM 4GJZA 3LKJA 2IXKA 3LEIA 4H14A 4ZY9A 2VNVA 3J4UH 3JD73 1F15A 1H9WA 2Y34A 2ZAAA 1F31A 4IUGA 5A1AA 3OEBA 3WDWA 3VGIA 4ARYA 4PQ9A 3ZYGA 1N3OA 3I2GA 2AUYA 1ZBE1 1PVC1 2Y6KA 4W6WA 4NRQA 3UESA 1UZWA 5B4NA 2DV9A 1CIWA 4J6GA 3DPRA 4L92A 3HPNA 2FDHA 2VW2A 3WX5A 3U37A 2Y60A 3RYPA 4HKOA 5JUVA 2DUQA 2BRTA 2R061 3ORJA 1POQA 2O8QA 2XVKA 3ILRA 3NWKA 3ZMNA 3O1VA 3UKTA 2WZ8A 2GH8A 2L9LA 2LRPA 4FPOB 4FPCA 2WINB 1J1TA 1HKDA 2VQAA 4DOUA 3SH5A 2H6BA 3UETA 2ZGTA 2YMZA 5LBFA 1ZYBA 1CONA 4B7EA 2WQ8A 5GALA 5J98B 1OF4A 1W8NA 3MIHA 1I9RA 3FJSA 1JYXA 4PBOA 3RGBA 4GH4A 5FPVA 1VR3A 3JB4C 4HK8A 1CESA 2KR2A 2ZHMA 5HBAA 3TEWA 2GNDA 4Q29A 5FZCA 1J83A 1W05A 3V0BA 5K0UA 1S1AA 2HH9A 5J96B 1AVBA 1V00A 5F1RA 1ZBA2 2QQKA 1G6NA 2PTMA 2VG9A 1IG0A 3VKOA 4BMEA 3VBUA 1WGPA 3VHPA 3X29B 4XUPA 1CAWB 3MFAA 3MIEA 1UU5A 1F8VA 4A7YA 1SZBA 1REDA 3PIJA 1RUH2 3V64A 3ELNA 1VBB1 4XBQA 1DQ6A 4CDWA 1LHNA 1PMHX 4OMDA 4DO0A 1UMZA 1HW5A 3KZ4C 2XJTA 3HD8B 2UY8A 1V6NA 2XJUA 4I0WB 4J1WA 4HVQA 1J59A 4OI1A 5EPAA 1ST8A 3BOWA 1U5XA 3HBZA 1QWRA 1Q8VA 2W91A 1UOGA 5LA0A 2BGPA 4L0PA 5FOBB 4I3PA 1K42A 2Y0IA 4D3WA 4Q4W3 1V9U3 1YC61 3VBSA 5IVVA 1WCKA 5FJKA 3VD4A 1YO8A 2O8OA 3EXUA 3WINE 1YQ5A 4AW7A 5IVYA 1E5RA 4CXYA 2QTWB 3NJVA 3P3NA 3JD71 3AZXA 2VMFA 1APNA 1N1VA 5DZGA 1KDMA 5KWRA 4ZHNA 1W6PB 1PVC3 3OBAA 4NIHA 4Q4Y3 2OA2A 1QIQA 1OQEA 5KBFA 4LJHA 2V5DA 2V4VA 1NLSA 3WOGA 3AP7A 2VZTA 4LKSA 1V6LA 1ZZ8A 4IETA 1ZBA1 2CY6A 3WW2A 3NV2A 4L2NA 2AYHA 1LULA 1S0JA 2VOVA 4Y3OA 1SEFA 2VJXA 3WF0A 3LE0A 5I0SA 2OZJA 4NR1A 4B4QA 4YGBA 2HEVF 2PLV3 1UY1A 4XF0A 2YBSA 4OULA 5T5JA 1T6BX 2QQLA 4OI0A 3OGRA 1RUJ2 4L11A 1KS5A 3KV9A 2ATFA 2KD7A 4HONA 2BJSA 3HR9A 4WZFA 5C7GA 1LCLA 2BNNA 1MS5A 2GP5A 3N9MA 3SCGA 1W6QB 3MIDA 5F9TA 2VR4A 2QCSB 4UXAA 2R30A 5K9YA 3JQXA 1EAH1 5CNAA 5JZGA 5IK4A 1AR61 4XAEA 1Q8PA 3ETPA 1US2A 3QH6A 3SKJE 1A34A 1RUJ1 2XH6A 2OQ6A 2DBIA 3M2MA 5EHDA 4KI5M 4F3JA 2CAUA 1D4VB 1OD5A 2MPFA 2C6SA 1Y9GA 4M3CF 2J1VA 1ZZCA 1AX2A 2R0FA 2HWC3 5JIAA 3UJOA 2A3WA 3IN9A 3KCXA 3MW4A 2J1UA 4QT6A 2BERA 5GZDA 5A3WA 2VZ1A 4FFHA 3WZ1A 4PHZA 2K0GA 3E6CC 1TMF2 3K46A 3AL5A 4LO7A 2XB6C 2ZX4A 3FUOA 1OURA 4XJWA 1RITA 4XXAA 2IWGB 5BNQA 4BQ4A 1VPHA 1RUH1 2OKXA 2ES3A 4DRRA 5DMYA 1OKQA 4RGGA 2R062 4YG0A 3ZFEC 2RS11 4DEVA 5E89A 3IB3A 2CAVA 1UAIA 3JB8A 3B9CA 3MIGA 5C70A 5HV4A 2PA7A 1XOYA 5LW9A 4QM9A 1AJOA 1PMIA 2R063 3G6JB 4FXKB 1W8HA 2GN3A 4Q1RA 4QB2A 2MEV3 4YPJA 3AMMA 4AFBA 1HB4A 1F4AA 1W2AX 3FLRA 1RXFA 4L99A 3CL1A 1VRH3 2WO7A 4Q27A 1DQ4A 4BLIA 5BY5A 2I07B 4CU8A 2JDHA 1F5JA 2C9AA 2TUNA 2D93A 3UNPA 4ASLA 4SBVA 1VBA2 1X9PA 4Q8KA 5A7QA 3AFGA 3WEZA 3H8UA 3UGHA 1H1MA 1WW4A 1YQ2A 3AKQA 1RYYA 4HKLA 2RHPA 4OHXA 4AGRA 4AZZA 5J7MA 2ZGKA 1UOBA 2LM3A 1AXZA 4MHUA 4A42A 2FDIA 5IHRA 4AHXA 5C4WA 2YZ4A 4BJ0A 3LFMA 5HXVA 5BUVA 5EJ1B 5EYYA 4ZS3A 4KBZA 5E16A 5BNOA 2WWUA 1HDKA 1ZZ9A 5JPMB 2NP0A 1AR93 2W1SA 1TNRA 2EAAA 2X5IA 5JVVA 2VUJA 4CEYB 5DUUA 3POWA 4FQZA 2UWBA 4Q4Y2 1X33A 1PGL2 1ULCA 1MEC2 2R49A 2W1UA 1MS4A 4UW3A 3LEKA 2W46A 2WAOA 3ZSLA 3BODA 4DXTA 4EN0A 5A6YA 3ZSKA 2VOWA 3V0AA 2XPJA 2XUEA 5L9BA 2GMEA 5AFEA 1NCQA 1DZQA 4LHLA 3IPVA 4QD2A 1D0GA 3ACFA 2DCJA 1ZRFA 5C71A 1ZZ6A 2O1QA 1W9TA 4JKMA 1ENRA 4KGQA 2ILMA 4BLJA 2HBUA 2PFWA 3W5NA 3VD5A 4LHSA 2EF6A 2ORZA 4K8RB 3NNJA 2BTVC 2EIGA 4HN0A 3OGJA 3ZFFC 4ATEA 3ZYBA 5CFDB 4O7XA 4CP9B 3TEZA 4KG8A 4YNIA 1OHFA 2QKDA 5FUPA 1MZEA 3WXPA 2A6VA 3Q8AA 2X8KA 3LFIA 4QX3A 1CIYA 1Q43A 4JX0A 5EXOA 3MW3A 2QQMA 1W9YA 3ZYFA 2AACA 1RUE1 1AR81 5LBBA 5FYCA 1G9CA 3AYDA 4PLNA 5JXGA 2EA7A 4LR4A 1PGW1 3QH7A 2VMHA 3U4XA 1RUG2 3ASIA 4RQPA 3M3QA 1WMDA 2WFPA 2WBKA 4PIXA 4URTA 2EAKA 1XPWA 4RYDA 3QBQA 2BVVA 2ARXA 2XKOA 3SNMA 2WA3A 1J58A 1R1A1 3MFCA 3WHUA 3NNFA 5ACA1 5HCHA 1FYUA 1UW8A 3NNGA 3PJYA 4JZRA 3ROUA 5JSRA 1WMEA 4X6QB 4I01A 3GZAA 3N9NA 3POGA 4Y4YA 5CG8A 1CAUB 2RJLA 4NUBA 4O9EA 3WP6A 4BHPA 2FQPA 4BQ5A 4GULA 4XZUG 5JXIA 4TTGA 1URXA 2GN7A 2E33A 4D8MA 1W9WA 3D6EA 2K9ZA 3CZJA 3B93A 1LRHA 4Y1VA 3D0SA 5DABA 5FY4A 5A70A 4P14A 2E26A 4XUTA 3DV8A 3SHRA 5FFOC 2XVGA 4DB5A 3IM0A 1GUIA 1POV0 2V4AA 4IGPA 1UZVA 2BOIA 3ETQA 5HV0A 1P8JA 1W8FA 5FYZA 4BYYA 5L7OB 4EWDA 1D7PM 3PMSA 4GD4A 2DVFA 5EFUA 3MLLA 2HWB3 4EN6B 2XXZA 1YLLA 2DURA 5A7NA 1KRIA 1JYCA 1RUJ3 1UD1A 5T5LA 4KWJA 2R042 2SBAA 4Q1PA 4FP3A 4RGAA 1WCSA 3QACA 1VB2A 3SMHA 2P3YA 2UURA 3KQ4B 5F8PA 3OGVA 1W39A 4TLGA 3T08A 3HQXA 2D5HA 4YWAA 2CGPA 2CU5A 2WFF3 1BK1A 1PO13 1UKGA 3U0ZA 5L7OC 1MVEA 2VVDA 3K2OA 3TNPB 3AP4A 3LCPA 4XDOA 1W8TA 4Q8LA 3ZXAC 5K4LA 1PO12 2VUAA 1IKPA 1X8MA 4XBLA 4YW5A 1T6GC 3P5BA 1BXHA 5T52A 1WCDJ 5F37A 4XIOA 4Z07A 5M0TA 4FI9A 3OUIA 2Q1ZB 3OF1A 4UAPA 2RS13 4COVA 5BNPA 4QGMA 1UYPA 3QCWA 1FMD3 2MEV1 1OOPC 3HBKA 5FPXA 1REFA 1S55A 1XNKA 3E5XA 3K4ZA 1F35A 5JZGC 4AI0A 2ZABA 3FZ3A 4R9AA 1NXD1 2RV9A 3J8F2 4Q5OA 2Z2SB 1WBLA 5I0UA 3AZVA 4CDQA 2D98A 1LEDA 4NHMA 1RC6A 1UZZA 4NIDA 4Y33A 1Q8OA 5EQUA 1VBC1 1H8TA 2B46X 2IXHA 4GWNA 4JGZA 1JBCA 4CP9A 3OGSA 4FCAA 4BQXA 4EZ4A 1BMV2 4TXWA 4HXCA 4XFGA 2IFWA 1VRH2 1XNCA 2BP6A 1V9U1 5EP9A 2D7FA 3K48A 3C7GA 4AVTA 1QJY1 1WUVA 4BB3A 5C8CA 5LBCA 5I8SA 3U1XA 1RL3A 2JEMA 3BIWE 4Y20B 2VOTA 2CWMA 2X5IC 1KXGA 1RUD3 1ALYA 1LKNA 4E8CA 4XETA 3HVDA 5A7WA 2WO3A 4GALA 1EPWA 4LOTA 4CP1A 1XRUA 4RSUA 4FSJA 1W8WA 4N43B 4PI0A 1ENQA 3MO4A 1CWPA 3KHBA 4LKFA 4GH4B 1UY0A 2BWCA 3CQOA 4MGQA 4NRMA 2YU2A 4D6RA 2HYKA 1AJKA 1D0HA 2ZKLA 5F6KA 3KHCA 2VCAA 1CPNA 4FFFA 1DDLA 1UO9A 3TBDA 4Q4X1 5DXDA 5BNOB 5FYHA 1DBNA 3JXSA 2YU1A 1H9PA 1PGSA 1EP0A 3H1YA 1XXNA 4FOVA 1BMV1 3CKHA 5CFDC 2I2SA 3VBOC 4S2DA 1FI2A 2ADDA 2UWAA 1IS4A 3OBTA 5AC92 2PLV1 3LA7A 4K3UA 5F3GA 1AZDA 5FZ0A 2GDFA 5C8CC 4HANA 3H9AA 4JRAA 3E97A 4RHV3 2JWPA 2KA3A 3BN6A 4XACA 3DCQA 3B9IA 2C9KA 4LBMA 5FK8A 1DLLA 4NIAA 3ZM8A 4HN1A 4A7ZA 5FOJB 5BNOC 4WM7C 1NT0A 4YVWB 2X29A 4D69A 2YB7A 2HWF2 2FCVA 3KV5A 4NE9A 2PAEA 2I74A 1YQCA 4M0HA 2QQUA 4COYA 4P9LA 4YYOA 1D2QA 2R043 2A70A 3CLPA 1IG3A 2WN3A 4QPYA 1GKBA 1H1IA 1PIV1 5BV6A 5FZEA 4QDRA 3A4UA 5F5CA 5F3IA 4C1WA 1RUI3 5FBZA 3SH3A 1EUTA 4P9JA 2BNMA 1BHGA 3FE5A 1H8TB 4JGZB 4XZPA 2P2KA 4LIVA 3IMMA 1PMJX 5K7PA 1AR71 1KGYA 3OPZA 4AHWA 2QDNA 1J3RA 5JXJA 5JMCA 2CHHA 1GU3A 5CKNA 3W9AA 4JTNA 1H6YA 3WP5A 4XF9A 1CAXB 4WM8C 3IDAA 1FV2A 1R1A2 2IXCA 4CU9A 1WZXA 1BJQA 3U14A 1W0PA 5KHJA 3S0MA 1SPPB 4N90A 2ZX0A 5EJZB 1A3KA 5I0TA 1UY3A 1QJEA 4M00A 4XFAA 3E1F1 5DPNA 5FQ0A 5LEJA 3LOBA 1G8WA 1LHOA 1FMD2 5FPBA 2D3SA 5IWFA 5JSOA 3ES1A 4QXHA 4MO3M 1VRH1 2Z5WA 2PHFA 5L36A 4KMQA 4Y1UA 2ADEA 3S30A 2BUKA 2X53S 4XTPA 4BDVB 2JX9A 1WA6X 4GB32 3MUZ1 1STMA 2ZHNA 3AFKA 3OEAA 4WVVA 2D97A 4KWKA 1OLRA 4KH9A 4AVSA 3RSJA 5F2WA 3DKWA 4CCLA 1FOD2 3I2JA 2R073 2WYFA 2YBPA 3LIGA 4HBNA 3AKSA 3OSDA 4JTOA 4BMBA 1A78A 3PDQA 1JHNA 1DQ5A 2MEV2 1OH3A 4Y24A 3ZXJA 4NIIA 4RHV1 5DUVA 5GLTA 4H7LA 4PQQA 5F2SA 1NCRA 5CU1A 5JOYA 3O1OA 3AVSA 4YGDA 3CNAA 1C8M3 4LBNA 4QMAA 5J37A 1G7YA 1LAJA 3O7OA 5HCFA 3CJIC 1LENA 1IQAA 4XMAA 3S5AA 1OMIA 4YZ4A 3VZMA 3H8RA 1U0AA 3N9LA 4GIQA 1WW7A 2DU0A 4CDXC 2EXKA 5A3UA 3VBRA 1K12A 4MHRA 2QQWA 1HRV3 3WDUA 2C26A 2UU8A 4KU8A 2GMMA 4K21A 1JXNA 2R6QA 1ULEA 3EB7A 3I2FA 4TSVA 5KHKA 1UMHA 3J7LA 2UY9A 4L9BA 3URFA 1UMIA 5JI7A 4AHZA 3ENRA 5FREA 5CADA 3RZJA 1H8VA 5A32A 5CIRA 4IXLA 3U07A 1UN1A 4BQ1A 3GZEA 3SQOA 1YJLA 3WDVA 2YGMA 1BVP1 4GAZA 1QJY3 3JU9A 1QOTA 4PDWA 1JODA 2JD4A 3ZVXA 1AYN3 1RUNA 4EN8B 4RQPB 5JR7B 1MEC1 3J9SA 5CFCA 1J1LA 1HQLA 1O3RA 2GALA 2UYAA 5FXWA 2DUOA 3HT2A 3MYXA 4IEWA 1FT9A 4FOYA 4JAAA 4MH0E 2VZSA 1FPN3 2HWF3 4HPKB 1W6PA 3FUQA 3MGUA 2BGCA 5FY0A 2XWBB 4XJ8A 4OUSA 1TG7A 2P1BA 4NO4A 5C8WA 1PVXA 1W2OA 1NCRC 1W8OA 4P9IA 5FP9A 3ZR5A 3C7EA 2Y6HA 4OI4A 4UOJA 1A8MA 4MGTA 1XE8A 4UFIA 3T0DA 1OPMA 3VBSB 4UYBA 1JUHA 4GZ9A 4BPZA 4AYUA 4CUGA 5FDBA 2P6HA 4XAAA 4Z82A 2ZZQA 5CAZA 2RM22 2PHRA 1SPPA 5FMOL 2R071 2ETEA 3ZSEA 4FAHA 3MBWA 4AEJA 5F39A 5E8AA 2HWE1 4ATFA 3V0BB 3KQRA 4DRVA 1PGW2 1MS9A 4INDA 5KC5A 5BNNB 2K2SA 2WKKA 1TZOA 1IPJA 3I2HA 4NPRA 1UIJA 1MZ5A 1Q5OA 2WNOA 4NAMA 1AHSA 3KVAA 2YUEA 5AC91 1KITA 1MS0A 1NY72 4Q0SA 1E5HA 2B7YA 2OPWA 5DZFA 3TWIA 2VTXA 4AI8A 1LEMA 1W9FA 2E32A 1Z7S1 4LULA 4ET7A 1RUC2 2VVEA 3KLSA 1RUOA 2AREA 3D3AA 1RMU2 2VMDA 4XW3A 3WDTA 1ZZ7A 2DCYA 1O8PA 1GWMA 1LOFC 4I30A 3WDYA 5FZIA 5GLZA 3FBYA 4QHZA 3FBMA 1QDCA 4XBNA 3POFA 2FZ2A 1Z78A 2WJSA 2Y26A 2D6MA 4CU7A 5JOWA 4ZZ8A 1NA1B 1YCIA 2VZQA 1TQ5A 4CPBD 3RZLA 3D8CA 5FMOS 5A3OA 1H6XA 4CCOA 1FOD1 3GNEA 4AFCA 3AJYA 1WW5A 4X6RB 5LATA 4FVVA 3LSDA 3AJZA 3SEEA 3WUCA 5A1LA 1JN2P 1EPZA 1OA2A 2Q5TA 1HV1A 2P4EA 4A4AA 1GWLA 4CXWA 5LY1A 2ZOEB 4YG3A 1V6KA 5FPAA 4XJZA 2TBVA 4WM7A 2C5DA 2XMLA 1XC6A 3JQWA 4MGZE 1QHDA 3ACIA 4I3GA 5A33B 5LBEA 1BLZA 1DFQA 3M3EA 4UF0A 2G9GA 3ZMOA 3RYKA 1VBA1 3GXUA 5FZ6A 2ZX2A 4UW4A 3WUDA 4QPGA 4RR3C 1IQDC 2RR13 4NPLA 4X8NA 1X9TA 4QB1A 4W8JA 1JYWA 3WQBA 5EYXA 5FIXA 4BCUA 4MOAA 2E53A 2V72A 3S57A 2D6NA 2OIIA 3EYPA 1XNAA 2JENA 4FFIA 5T54A 3T09A 1H30A 4UBHA 1ND3A 5FMDA 2EIBA 2OT7A 4CCMA 5EJ3A 1UYZA 1W8UA 2EICA 5CISA 5FP8A 1GSLA 1ZRIA 3ZKYA 1NCQC 3SCHA 1NAEA 1W06A 3CF6E 3VDDB 4YM3A 4L97A 2NYYA 4XYXA 4KWLA 4JQTA 2YROA 4E27A 5CFCB 3NRUA 5CEHA 2PHWA 1R081 4QU1A 4AHYA 1N1YA 4JQRA 3N7MA 3OD0A 1S0DA 1QJU2 1EV12 1AXKA 2WT0A 4HETA 3AB0A 3WV6A 5C3SA 2ZGPA 1WMFA 3KCYA 4NJ4A 4MLOA 4BXSV 5BNPB 2RDQA 4FPYA 4CP0A 1I6XA 4ZS2A 4R9BA 1JYTA 2W1WA 3I3QA 3PHMA 1SFYA 1NYWA 4XPVA 5LA9A 1S4CA 3ZSJA 1R1ZA 1W6MB 1RHI1 2ZJCA 3KS7A 4N7IA 2ZGOA 3USSA 1UY4A 3VBRB 4IESA 4BIOA 1WW6A 1JYNA 4NPMA 1J84A 4RS5C 3WG3A 4OMCA 3T0AA 2ZGMA 3E6BA 3WR0A 2E51A 3MZHA 1W0NA 4Q4X2 3IAPA 1AL23 1WD3A 4XJ9A 2PHXA 4FQ4A 2MNGA 4LITA 1C1FA 5H9SA 1ND3B 1W99A 3ITQA 4QQHA 4Y1XA 5F5IA 5FY5A 1NOVA 3C7HA 3KSCA 2WWSA 3U11A 5GLUA 3ME2A 1XYOA 3LB9A 2A6WA 3BTAA 1IPKA 1KFXL 1CPMA 5LASA 4GXLA 4A45A 5FO7B 2XR4A 5L7OA 2V73A 1UQXA 5KHIA 4CSWA 3MLJA 3I2DA 2DVAA 4XXPA 3GDBA 2EIEA 5D8AA 3DYPA 3VZOA 4CDWB 5K8SA 4E2SA 2HWC2 3O0XA 3G7DA 4C1XA 2B4KA 1G9DA 3BTZA 4B1LA 1SLLA 3NV4A 2ZMNA 4Q0UA 3KGLA 4MUVA 2FCUA 5IJRA 4E9KA 2Y33A 5K0UC 4A3ZA 2VMEA 4Q4V3 4YW4A 5FP3A 2FDFA 3LEMA 4Z92B 3IBMA 3ACHA 4FTEA 3MF6A 5FY7A 1PX3A 3R4UA 1SLBA 1AL0G 3HQRA 1JU4A 1MS8A 4JGYC 5IVFA 2OZ6A 3WQ0A 1NZIA 1Z7S3 3ZR6A 5C9AB 3RZKA 1JOPA 2WLPA 4HMZA 5T55A 5I91A 2CYFA 3K75B 2WR9A 1WMXA 1NG0A 1VBB3 1NXMA 4AEKA 3ILFA 3M1HA 3KM5A 4A6SA 1RVF3 2RJ2A 1GZTA 2Q30A 2W95A 2ZBJA 1VBB2 4GJYA 3UT0A 4FPJA 1V0AA 1PZ8A 2D3PA 3RNSA 2JDYA 3VBHC 5CKMA 1HRI2 3S6PA 4IDZA 1HRI1 1YNAA 1RMU3 1NA1C 4EE2A 2P3KA 2IUWA 1ND2C 2R32A 4W65A
chains in the Genus database with same CATH topology
4QQPA 1Y9QA 2RMU3 2VNGA 3VHNA 5DDJ3 4A2UA 1AYM2 3OJBA 3IPVB 4Q0PA 3N7JA 1XE7A 2A75A 4UBGA 1ZA4A 3WVJA 1AX1A 2YYOA 4YVWA 3IDEA 3VN4A 2DFBA 4TWTA 4YW3A 2ZGUA 4LO5B 3TN91 5CA6A 1AR82 1O5UA 4FPEA 5TSWA 3E5QA 3WHTA 2Y38A 4AWDA 2G4IA 4HPKA 2XWJB 5AVAA 4WVMB 4IV1A 1HRV2 1A6CA 1DG6A 1ZBE2 4YFWA 1TME2 1ASJ2 4Y5Z0 4LE3A 4SLIA 4Q4V1 1CGPA 1ZBE3 1TME3 3AKRA 1LHUA 4NN0A 4NVPA 1LGNA 1SBEA 4G9SB 4E2GA 1ASJ1 4YFZA 4GWMA 1FAYA 1QF3A 4XF1A 4GB31 2Q0AA 2QNKA 2WZR1 3ST7A 4AEMA 3GYDA 2NZ9A 3ZYRA 2ZZJA 1CJDA 2ENRA 2HEYF 4RR3A 1ZRDA 4I0BA 3E6DA 4GH4C 2ZGRA 4ZXKA 1UU4A 2W08A 2MHFA 2YPJA 3NO8A 3M4FA 1JTZX 1H8TC 4JGZC 2AZ5A 3PLQA 4OI2A 4E4ZA 3ZXDA 1C1LA 5CVRA 4R52A 3VBRC 3VBOB 5C6CA 5KHGA 5JCTA 4AFDA 3VKNA 2A5ZA 3ZFEA 1OOPA 4XE9A 5A32B 3GBWA 2XGXA 1A8DA 2BFUS 1G9AA 3VZJA 2R16A 2GNTA 1AL22 1I3HA 4ES9A 3FFZA 1Y43B 2IZWA 5JPNB 4GQ7A 1DU3D 4PJYA 5JDBA 3H0OA 1RHI2 2CGNA 1KJLA 3WP3A 2JG9C 1QJX1 2XG3A 4PLOA 1TMF1 3JD72 3PJQA 1ULGA 1YJKA 1J3PA 5ABJA 1S0GA 5FO9B 2WNUC 1RUC3 4K20A 1GR3A 1PO23 3LAGA 1MVQA 4H55A 4HL0A 2R1DA 3EJKA 1AR91 2WNVB 2I45A 1WBFA 4M3CB 3RG0A 2P37A 3GBGA 2Z69A 4XIKA 3CJIB 3GHNA 4J1XA 1XNBA 4KNCA 2QDRA 4DNYA 1QOSA 1N47A 3WG1A 1K5MA 2UWCA 2GAUA 4JCKA 4YM1A 1DGRN 1ZBA3 4YRDA 2XBO2 4IEXA 1MZFA 4DPNA 4MZUA 1UX6A 1E57A 4W6YA 2BYVE 2D43A 1GQHA 5ABJC 2D5FA 3ZX7A 2EXHA 3LGRA 1COV3 2RR12 2WS91 1ND2B 2YDEA 5FRAA 3CEWA 3ZXFA 1PM7A 2BVBA 3FC0A 4PCRA 4CEWC 3H7YA 3V56A 3S7EA 4GMP1 2ZA9A 1BEV2 4PDWC 4IV1B 1GLHA 4LBQA 2XLGA 4ITCA 4XDQA 4Y22A 4HK9A 3ZXLA 4D94A 1NY71 1QXJA 4KGGA 4OVEA 2NQYA 1H4GA 2DTWA 4AFAA 1XNDA 4ASMB 5KXCA 3GALA 2F6BA 1LOBA 3EBRA 4YW1A 3VHRA 4DY5A 2QZ3A 1PVC2 2GZWA 4OUMA 3M8LA 1LJ7A 1W2UA 4KQ7A 2DTYA 4N43A 3DF0A 3VL8A 1PNGA 2B45X 1H4HA 2D3RA 3L2YA 1KFUL 2TNFA 1EV13 2RM21 4OHYA 2WNEA 1MEC3 3VV1A 3V0AB 1RB8G 1MZ6A 1RUC1 1H2NA 4ORFA 1PO21 4EROA 1LOGA 3NKTA 3ZN4A 1LODA 3APBA 1PZ9A 3D0JA 1JOJA 5C4WB 4HVOA 1OQ1A 1NE4A 4LBQB 2IXIA 3UKVA 5EWSA 1O4YA 1N3PA 5J3UA 5JOZA 2JXAA 2WLQA 1ENXA 2XL9A 4CDXA 3AXEA 3L2HA 3N3HA 3ZXKA 1DGWX 2WFF1 5T50A 4N53A 1QH6A 1R092 2UYBA 2WQ4A 4QU2A 2WA4A 2FBEA 4XHXA 3ZDSA 1MACA 1IS5A 1LOAA 3JBG1 2DVGA 2LALA 3MICA 1I1EA 1QQP3 5JOXA 2EXIA 3ZN6B 2P17A 3O12A 4AI3A 3KB5A 4QPIC 4AI2A 4AGVA 1S0BA 4FBFA 4UW6A 1AXYA 3NAPA 3O14A 2RS53 3ZO0B 2VW0A 4MXWB 5I8YA 1DYPA 2OUJA 3THPA 5KXDA 3MEPA 1CX4A 3IMNA 4FTSA 1QOOA 4CDQB 4M3CA 1DHKB 1ZM1A 4GKXA 2BPA2 1O5LA 5ACA2 3USUB 4K9SA 1CD3G 4FTBA 3J26N 4BZ4A 1UF2C 1TMF3 5C9AA 5H9RA 3AYEA 3CU7A 1RMU1 4OFGA 1UU6A 3R0RA 5F5QA 3JUUA 3P3PA 5BPXA 1RUE2 3N36A 2WL1A 3OY8B 4QGNA 1G9BA 1CAVA 2CTVA 3D82A 4QPIA 1W6QA 1OLQA 4BIFA 4Q0QA 1RUE3 3B7MA 1YI9A 2VOXA 3T1LA 4DY3A 4KU7A 3VBFB 2O0OA 3DGTA 1UL9A 4YZ2A 1N1TA 4G4FA 3SITA 1PHMA 2PHTA 4BH9A 4DZGA 5LRSA 3IDCB 1BZWA 1VBA3 5E88A 1FXZA 3H3ZA 5GLVA 2HWE2 4OHZA 5E1RA 1SFNA 2GMPA 1CR7A 4AQ6A 1LU1A 1S2KA 2JG8C 4LLOA 4XFBA 4JDMA 4WZCA 3BALA 3VBFC 1COV1 2QVSB 3JBG3 4XQDA 3LA3A 1QQP1 2ZMLA 3UL2A 3AMHA 1VIWB 3M3CA 1RUF2 1UZYA 1B35B 2PHUA 3POSA 4FXGB 4KBBA 4RS5B 2AH2A 4M0NA 1CAUA 1O4TA 1RUF3 4A3XA 2RS51 4Q2FA 3AKTA 2YHJA 1IHMA 1VBE3 1ZREA 3ZPYA 2B42B 5CBLA 2Q8OA 1LECA 4QQ2A 3E5UA 4FO9A 1HXS3 1VBE2 5CFCC 4A7KA 1GYKA 4AVBA 3EQEA 3OYWA 3GBFA 2DCKA 4Q4W1 4Y26A 4FT8A 5A3MA 2VPVA 2KXLA 1KD7A 2RM23 2CNAA 2EALA 3FHIB 1W6NB 4LHNA 4R8HA 4Z8BA 3MW2A 3VZLA 2B5HA 5BNPC 4ZKTB 5FLJA 1S0FA 4I02A 1RUG3 4XMIA 4AEDB 3KD4A 4IEVA 4IEQA 4MV2A 4WVWA 1FMD1 1LHVA 4LO6B 3ALQA 4COZA 4N43C 3ZN5A 2ZGLA 2RS33 3B94A 3RZZA 1DIWA 4IEOA 3B00A 3AZWA 2RR11 2WS92 2E6VA 2XJRA 3AXDA 1AF9A 2VGDA 4RHV2 5J09A 1LHWA 2XUMA 3RS6A 2ERFA 1HLCA 1TE1B 4AQ2A 2CL2A 4RFT0 1V70A 2YXSA 3TB0A 5DG1A 4JGYA 1SLCA 1Y3TA 4AEDC 4WM8B 1N1SA 4F7ZA 1S0EA 2PLV2 2XJSA 1TNFA 1ULFA 1Q8SA 2DVDA 1F5FA 4B4PA 1RUD1 4E4DX 3H7JA 1BEV1 2YY1A 1GZWB 4BE3A 1SDWA 4IEYA 3AP9A 2P3JA 1RUI2 4N9HA 3O5SA 3DPRC 4NHLA 1WD4A 4P9GA 4KG0A 1R091 3SCFA 4Q26A 4JV4A 2ZX3A 3QLQA 2YGLA 3AM2A 3HT1A 1Z0HA 4LBJA 2WFF2 2SLIA 2W0XA 4C0HA 1KQRA 4DINB 5BYNA 2XL7A 3N7KA 1DGWA 4AEDA 5FCCA 2TEPA 3NAPC 4Z2WA 2CV6A 3WW1A 2ZGNA 3V65A 4IEUA 4CEWB 3EO6A 1W6NA 2DUPA 1AL21 4JGYB 4CP2A 2HWF1 4AVVA 4YW2A 4IERA 1KJRA 4H3WA 4XILA 2R041 4PDWB 1OA4A 3DUIA 3L9JT 2ZTNA 1LESA 2OPKA 1W0OA 1GANA 4RQPC 3AZZA 5J48A 1RUI1 2E9QA 1PK6A 3RI8A 3TYJA 2HJIA 1YUDA 2LUWA 1UPSA 2DCZA 1X82A 3ZYJB 2XJQA 4P5HA 2PELA 4XF4A 1SCSA 2HWE3 2W52A 2BW8A 4MGYE 1LGCA 2GSYA 2IXJA 4MVTA 4N53C 4XFFA 4K40A 2WZPP 4DMIA 3VDDC 4YSFA 1AX0A 5BXXA 1I5ZA 3J8F1 3RRDA 4CYDA 1GZ9A 3LA2A 1AR92 4UW5A 2PHLA 3IDBB 3ECQA 3MIFA 1MS1A 1B35C 1NCRB 2JE7A 4X8PA 4LBKA 5CB7A 1U12A 1ZX5A 3ZFFB 4PBPA 3VZNA 3M70A 1S0IA 1O3SA 1QJY2 3BB6A 3NKGA 2VQ0A 4QQOA 1GV9A 1FV3A 1OFNA 2XBO1 3RI9A 2WZR3 3WT3A 5IK7A 1WLWA 4MGKE 4N9IA 2EXJA 3IWZA 4RD7A 5LRRA 1SLAA 3WG2A 1QKQA 2WZR2 1SBDA 4P9WA 3NV1A 4XOGA 4QPIB 2WT1A 2R0HA 1U5YA 4XEZA 2C1FA 4AI1A 3TN92 2R1BA 4GMP0 1UPIA 3DL3A 4XFHA 3SXWA 3EHKA 2GC2A 1MR5A 2ZAHA 1MS3A 2OYZA 1DF0A 5JWPA 4YGCA 4Q4V2 5DUWA 1YXWA 2D40A 3PMEA 4D7SA 2BEOA 3S7IA 2OVUA 3H3UA 4B8EA 1R1A3 4CEWA 4C0BA 1O4ZA 2P34A 2NPIA 5HI0A 1SMVA 1M4WA 1YRZA 2BQPA 5HCBA 4DS0A 2XHKA 1G86A 3BCWA 4XJAA 5KXEA 4NWWA 5EZWA 4IV3B 3DPRB 2GH2A 1WLTA 2YC0A 5IK8A 2H0VA 1NLRA 1JYIA 3H1WA 1S0CA 4PLMA 3ZYIB 2HEWF 4E4SA 1IOAA 1CAXA 3AMNA 3WDXA 2EVXA 1PGL1 4FPGA 1B09A 1KDKA 4XHBA 2ARBA 3JCIA 4N7UA 4LE4A 4LO4B 3TOJA 4YZ3A 1ZRRA 4DXZA 2VMIA 3NL1A 3NAPB 3VL9A 1RIRA 1DGLA 4LO8A 4ZU4A 3ZIWA 3ILNA 2VOKA 2VVFA 3T1MA 2D44A 2DCTA 1NQDA 4EJRA 2B9UA 1C3HA 3AZYA 1X8EA 2JE9A 1GQGA 5I0RA 3B3QE 3VLBB 5I93A 2D6KA 1PNFA 2QQPA 2ET7A 1EAH3 1SLIA 1AYM1 1UKRA 3M3OA 4NOTA 4BM8A 4EN9B 1ENSA 1VBD2 4Y20A 3W58A 1HRV1 3RPQA 4COWA 1OI6A 2RS12 2VXRA 1EYBA 3T2TA 1H0BA 4AK3A 3KT4A 2ZACA 4Y22B 2HWC1 4XQ4A 2GNMA 4QXKA 4NWVA 3OYWB 3TNQA 5JAXA 2VU9A 1QU0A 2V5YA 3B5LB 1W6OB 3CJXA 3LZZA 2ZCWA 3N7LA 3WQ7A 4JC1A 2Z42A 1QXPA 4HLTA 4DQAA 1ONAA 2GU9A 2DYCA 3OCPA 1QMJA 3O0WA 1R082 2ZHLA 2VNOA 4RS5A 4R9DA 1B35A 3N35A 4PIZA 3R4DB 4XTMA 5KHHA 1GFF2 4CDWC 3ZYPA 2DFCA 1BVVA 1K5MB 2QUOA 2DU1A 4FPLA 4XFIA 1YIFA 3ZFGB 1UIKA 3NJZA 3RDIA 1YFYA 3POYA 3WCRA 3HN1A 3RWNA 4CDQC 2VH9A 2LTNA 4ISQA 5JLVA 2WNVA 4M01A 5DG2A 2PN5A 2V09A 1QJU1 1IGOA 1VAKA 3SH4A 2WS93 3ATGA 3LOIA 1FX5A 4QHBA 5AC93 1RGSA 3K51A 4U36A 1BBT1 3HIFA 3VBFA 5GZEA 3UK9A 1G9FA 4EN7B 1S2BA 4YVSB 1PK6C 3VKMA 5C9AC 1ZVFA 1X7NA 3B02A 5KXBA 4MSVA 1YFUA 2HWB2 3GZTB 4FP2A 1XU1A 3RQ0A 3M7AA 1QH7A 4AE2A 4K7JA 5GZFA 1LOFA 1SQ4A 3AYCA 3RJRA 1DZRA 3VBHB 4RL7A 4WVZA 3VKLA 1XYNA 2ZGSA 2E7TA 4CRQA 5SV8A 4L8QA 1EV11 4YVSC 3Q9OA 1BYHA 2HKXA 3KT7A 4YM2A 1CVNA 3B01A 3AMPA 1WLCA 1SCRA 2NLRA 3ACLA 3HMYA 1Z7S2 3INAA 3I59A 2JJ6A 1AR62 1EAH2 4K1ZA 4F8AA 5D8AC 2RJKA 1SACA 2Q1MA 1D2SA 4MX3A 3GF6A 4OHWA 4HVRA 3AYAA 5CFDA 1O3TA 1OA3A 5FQ0B 3O0VA 1ZRCA 5IK5A 2PYTA 3AK0A 4GB33 4C90A 3ZFEB 2ET1A 3LWCA 2PQQA 4JDNA 1TEIA 3QD6A 4P9YA 2R072 4XJUA 3MDPA 4PF5A 1YIPA 2QE3A 4GA9A 4LA3A 4XF3A 4CDXB 4LHKA 4BWOA 1WLDA 1QJU3 3CO2A 4MXWA 3MLKA 1UCXA 4WVMA 2HWB1 3RMYA 3GZUC 4RR3B 2AR6A 1BBT3 1R083 3KT1A 1NE6A 4F83A 4COUA 4K8FA 2Y0OA 4ZU7A 1BBT2 5LEKA 3N4MA 4IL7A 1H1AA 2H0BA 4AVAA 3OD4A 4LA2A 1DQ1A 4ISRA 1OPOA 3NV3A 3VBUC 1CN1A 5FO8B 1AR73 2A6ZA 3QOPA 1NCQB 4QX5A 5GM0A 2HWD3 1VALA 3A0NA 3ZXGA 2W68A 4CEYC 2IC1A 1J3QA 1RJ7A 3WG4A 3TRSB 4KL1A 4QM8A 1N3QA 4QGLA 1ZNPA 1JW6A 2IXLA 2YV8A 3FX3A 1GNZA 4YM0A 5FAXA 5IUQA 2X5IB 3TAYA 4RA0A 2RMU1 1O7FA 1U5ZA 4HKWA 2ZGQA 5H9PA 1HX6A 5GLWA 2VMGA 4HFSA 5CG9A 1LGBA 1FATA 2NMOA 1Q8QA 1VLNA 4LEJA 2PAKA 4Y1YA 3MIBA 4EWEA 3WW4A 3TN93 1K5MC 3AP6A 4NHKA 4K6BA 1ND2A 3KMHA 2JG9B 1SBFA 2A6YA 5C8CB 3IT8A 1MQTC 4IV3A 1X36A 1DQ0A 4HZFA 2WSVA 4AFMA 3I7DA 5T5PA 2KM2A 5GKAC 1HV0A 2WC2A 4V1PA 5J36A 3CJIA 3UKNA 3KCCA 4YGEA 1AR63 1BKZA 4GKYA 2DF7A