2JIJA

Crystal structure of the apo form of chlamydomonas reinhardtii prolyl- 4 hydroxylase type i
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
206
Chain Sequence
MVGFGELKEEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKRTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROLYL-4 HYDROXYLASE
publication title The Active Site of an Algal Prolyl 4-Hydroxylase Has a Large Structural Plasticity.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 58
structure length 206
sequence length 224
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2jijA00
2V4AA 2G1MA 4BQWA 4Y5SA 4ZPIA 3BVCA 4J25A 4XABA 5DAVA 3NNFA 3GJBA 2Y34A 2RG4A 4IW3A 5LBFA 4NHKA 2JIJA 3W20A 5C5TA 2FCUA 3OUJA 4NAOA 3NNMA 4XACA 5DAPA 3HQRA 5C5UA 2RDSA 5LBBA 5L9BA 3OUIA 4NHYA 4KBZA 5DAXA 4XCAA 3KT7A 3GZEA 4XAAA 3MGUA 3PL0A 3KT1A 5LATA 3OUHA 2RDRA 5EPAA 5HV4A 5IAXA 3W21A 5LBEA 3OBZA 4NHMA 5LASA 4MHRA 5LA9A 5A3UA 2FCTA 3HQUA 4JZRA 3NNLA 4MHUA 5HV0A 3GJAA 5ERLA 5LBCA 4BQYA 4NHLA 4BQXA 5L9RA 2G19A 2HBUA 5EP9A 5DAQA 5L9VA 4NHXA 2OPWA 4XC9A 5EQUA 2FCVA 3NNJA 2A1XA 4Y5TA 3KT4A 3DKQA 5M0TA 2HBTA 4UWDA 4NMIA 2JIGA 5DAWA 4ZONA 4XCBA 5IATA 5LB6A 3EMRA 2RDNA 4Q5OA 5IAVA 2RDQA 3ITQA 2Y33A
chains in the Genus database with same CATH superfamily
2BFUS 1GUIA 2G1MA 4XZPA 3K3OA 4Y1VA 4Y33A 1RXGA 4XFGA 1J3QA 2BWAA 5APAA 3BVCA 4FPJA 2WWSA 4QHBA 4QMAA 1VRH1 1Y43B 1J83A 1RHI3 1RUF2 1MS0A 1NX9A 4BIOA 1REEA 5DZGA 5LK7B 3FUQA 3POFA 4OHZA 5GALA 4RD7A 4AQ2A 1UY4A 4EE2A 2GMEA 2VC9A 2IUWA 2QBXA 1QXJA 1HLCA 1VBA2 1WLCA 3WDVA 3WVJA 4HVRA 1LRHA 1GOGA 2DFCA 3H7YA 5KR7A 5F5AA 4CDXA 1LESA 3A4UA 1UD1A 1NCQA 3UKNA 4XACA 1W6OB 4A6SA 2GP5A 3AMQA 5IWFA 5CVRA 4D7SA 3RQ0A 3BIWE 1JI6A 1GKBA 4FTSA 1O3QA 1NY72 2W9XA 1DCSA 1JN2P 3MYXA 4CZSA 5KBFA 5I8TA 3WNXA 1PO11 1LENA 2DVBA 1COV2 2QQIA 2QQJA 3KF5A 3ZFGC 4CCNA 4QPGB 3RWKX 2J1VA 1LULA 1N1SA 1OLME 3WW3A 2EF6A 4KG0A 3KVAA 3PIJA 1V6KA 3AX4A 3HBKA 1ND3A 2Z2SB 4EJRA 1W0NA 3NSTA 2VCCA 3SEPA 4CP9A 1N3OA 4XUOA 4RQPA 4DXTA 1REDA 3E5UA 4LIVA 3TN93 2LTNA 3H42B 1RUG1 2PHWA 3UL2A 1GQPA 2QZ2A 5BXXA 1FX5A 4AWDA 2ZEXA 2W92A 3W21A 1UZ0A 2XUMA 3AYCA 1ENXA 3WNLA 1R092 4KGGA 2E7TA 3FLRA 2P3YA 3CMGA 1DZTA 2WS93 3H3UA 4R9AA 5DDJ1 1PK6A 1QJY3 2QKDA 1QEXA 4AHYA 3MZHA 5SV8A 4YVWB 2PTMA 2UYBA 4AYUA 1AVBA 2JDNA 5T5JA 3HNBM 3IDBB 4UYBA 5C3OA 1QOSA 4HKOA 3AZZA 2G9FA 4Y1ZA 3CIHA 5IFTA 2Q8CA 1OFSA 1U12A 4D8MA 4XJAA 5AVAA 4D7YA 5FZFA 4PIXA 4QHZA 4Z82A 2HBUA 5DZFA 2Y0OA 4CDUA 5BNNC 3CHXA 1O5LA 2PA7A 2VXJA 4LBOA 2W2IA 4XMIA 4XC9A 2GNBA 1ULPA 1ZBE2 3LKJA 3UJQA 1FYUA 3VBUC 4EN6B 1YQ8A 3BALA 4IEYA 3AP5A 4D6SA 5J36A 2VCMA 5FFOC 1W8ZA 1JYWA 2B46X 2ERFA 3W9AA 1FXZA 5BY5A 2R063 3WP5A 5JDBA 4IEQA 2W1SA 1X50A 4XQWA 4W65A 3LDRA 5ABJC 3ZFFC 3WG4A 3TBDA 4AEDA 1GYKA 2XPJA 3LA2A 1LR5A 4OLLA 5LA0A 1I5ZA 2KR2A 2OUHA 3NAPA 3ZYIB 4CE8A 1YYNA 4QQ2A 5HCAA 4AFAA 5FY7A 4KH9A 2RMU3 4LBLA 4A3XA 4BLIA 5A6XA 4GMP0 1D0HA 1LOFC 4HN1A 1CAUB 3KWVA 5CA6A 2DUQA 3I2DA 5LWBA 3UKTA 2VO5A 3ZIXA 2B45X 5FYYA 2N7GA 4LBKA 4IDZA 2YY1A 4N53C 5DAVA 2R16A 5GZEA 2D6NA 4X8PA 2XL9A 5CIRA 5FPAA 3SHRA 2RS13 2ZKLA 4FOWA 3WNNA 3C7HA 1UOBA 3KM5A 2WNVC 4LO6B 3DGTA 3ATGA 4Q8KA 4N90A 5IJRA 1EPZA 4NHKA 5FR3A 2CV6A 4LKEA 2EALA 1NCRB 4JDNA 3NW4A 4M3CE 5L36A 4JDOA 1J84A 2PLV3 2YC4A 1BYHA 1YFWA 5FZ3A 1ZRRA 4KMQA 1UZZA 1UKGA 1XNAA 2XJTA 4YW7A 3LEGA 1AYN2 1UY0A 1TEIA 4AVVA 1G86A 4K3UA 3RNSA 2HWD3 4HSJA 4QQPA 1ONAA 5L9BA 4A45A 1U0AA 3ZFGB 4ASKA 4D6QA 1JZ3A 1H2MA 1W6MB 2A73B 1DU3D 1L3JA 1WBLA 4M00A 5F3EA 2HJIA 3AYAA 3WXPA 3S5AA 2VOTA 3DYOA 1K5MB 1WWYA 5GLZA 3THDA 5T5PA 4XAAA 1CONA 5FZ0A 2D3SA 2UY8A 2GSYA 1RMU3 3FN9A 4XURA 1O59A 1GU3A 4QX3A 4BQ2A 4AQTA 3OYWB 1UZYA 1VBE2 3NO8A 4KQ7A 2ID4A 1ZBA2 3JBG3 5F3CA 1LOCA 1QQP3 3MIEA 2CDPA 5TSWA 5BNPC 4GAZA 2XKOA 5FXVA 3V0AB 4ZXKA 3FE5A 1PGSA 3AZYA 1PO13 5L7OA 5LBEA 1VBD2 2UY9A 3LFMA 4LQRA 4XJZA 1ULFA 2JDKA 1OUSA 4XDQA 1AJOA 1RUJ3 4LLFA 1VJ2A 3FUOA 3MF9A 4AI0A 2XBO1 1UMIA 4QB1A 5A7WA 4NWWA 5I0RA 1HX6A 2D5FA 4OZXA 2Z79A 5LY2A 4XFBA 3T30A 1TMF1 1MVEA 1PMHX 1U5ZA 3S6PA 3DEMA 5BNNB 2FMDA 4CUBA 4R9DA 1W2AX 4Q1RA 1WA6X 1UPSA 4GWIA 4Z2AA 2XONA 1RUNA 5EP9A 4XPVA 3WDYA 3OGSA 4NIDA 4QKDA 3BYWA 3H8RA 2J1UA 3VKLA 4JGZA 5EFUA 4RA0A 4XBLA 4Y20B 3O1SA 5IVBA 1G9FA 4IV3A 1W3VA 2PAMA 3MHZA 4CCKA 4DXRA 1AF9A 4QX7A 2HLEA 4DB5A 1RUI2 4Q0VA 2UU8A 3N7MA 4HPKB 3VV1A 4HSLA 1POQA 5A3OA 1MEC1 3J7HA 4NMIA 5KC5A 2HH9A 4XFAA 2XDVA 2JB8A 1NE4A 1CQ9A 1G9CA 1F5FA 1PO23 3BB6A 2ORXA 3CDZB 3K4DA 4XETA 1DF0A 1JU4A 1V6IA 5IATA 5FO9B 3O0XA 5JOZA 4RR3A 2ZGTA 1LOEA 2QUOA 3GCWA 4HLTA 4N53B 1H2KA 1UYPA 3AP9A 2TEPA 5KHGA 4E4SA 3M7AA 2PHUA 1H30A 2WNVB 4QHOA 4J25A 5T5OA 1BK0A 3CO2A 1HV0A 4RS5A 1MS3A 3IIAA 1XOYA 2RR12 3IDAA 4LHNA 3R4UA 4FPOB 5FJKA 2O14A 3URFA 2G4IA 2K2SA 4PDWC 1HRV1 1RUC3 4PBOA 4NAOA 5KXCA 1BCXA 3LSDA 1DGWX 1OSGA 1PZ8A 2Y0IA 5F32A 1R1A3 4PIYA 5DAPA 3NJYA 5FPLA 3S0MA 5FYBA 1RHI2 5G04L 3WDXA 3TEYA 3U11A 5FV3A 3GHNA 5C71A 1IS6A 5DABA 3VBSC 3N9QA 1PNFA 5LBBA 2CDOA 4NE9A 1IG0A 3OUIA 2WN3A 3USUA 4BQ3A 4CEWA 1OPOA 1OQ1A 4C8DA 1Q8QA 2BNOA 2F6BA 1ZZ6A 4R8HA 4HVQA 3KSCA 5A3PA 5JIUA 3AYEA 3AMHA 4JX0A 4LPLA 2WUHA 1BVVA 5DUWA 3GZEA 1NY71 2DURA 1BLZA 3LFIA 5JUVA 2BTVC 5CFCC 5I8YA 1S0JA 3DYMA 3P3NA 4IE6A 3GZUC 4ES8A 2ZEWA 1Q56A 2O8QA 2XH6A 4OFGA 3IBMA 2ZX3A 5JIAA 3JUUA 4RN5A 4IEWA 4BMEA 4MADA 3RYPA 1PIV1 4QGMA 4UFIA 5F6KA 2VCAA 2XG3A 4UFHA 1F35A 3NRUA 4IETA 4M0NA 5FYCA 3THTA 1NQJA 2D97A 4BXFA 3I3DA 1IKQA 5A3UA 3HQUA 1GP5A 1W99A 4X6RB 1S0BA 2DUPA 2ZGNA 3T1MA 2QTWB 3IKWA 3NNLA 1VIWB 1YJKA 2JENA 2ZEZA 3FBMA 2JWPA 4AEKA 4MX3A 1J3RA 2P3IA 4AQSA 1HQWA 2X09A 4B8EA 3DUIA 5FYIA 2G19A 5GLUA 3SNMA 1UN1A 2CGOA 5CISA 3K48A 4XEZA 1CN1A 2LW8A 3MW3A 4BA6A 1UYZA 3AP7A 4I02A 4ITCA 4Y24A 5FMOS 5A7PA 2VTFA 3POSA 3ST7A 3CU7A 3ZYPA 1ZM1A 4CP1A 3TEWA 1SHWB 3JXSA 5H9QA 1S2BA 1XE8A 2XBO3 4Q27A 2ZMKA 4XE9A 1CX4A 3HWJA 4WVMA 4CDUC 2JE8A 4DOUA 1DYPA 1KQRA 1PVC1 1NA1C 1VPHA 2VG9A 4GH4A 5LK5A 5A1AA 3JB8A 2BQPA 1TMF3 3WCRA 1JOJA 2VUDA 3I54A 4Y3OA 1ZZCA 4IE7A 1L7RA 2JDPA 2JIGA 4YW2A 4QQOA 4PLOA 3ZXKA 4IGQA 2E31A 5C4WA 4RHV3 1QDCA 4MV2A 2BEOA 1CJPA 4TTGA 1RUE3 2Z5WA 3LAGA 1DBNA 4L92A 4UFKA 1VBC1 3PVEA 4DUXA 2WZR1 2VAUA 2QCSB 3EYPA 3MW2A 4QT6A 5AVPA 3J8F1 5B4XA 3GBWA 5HBAA 1AX1A 3AZXA 2MPFA 2WKKA 4D3WA 3WNKA 4FP3A 1MEC3 4ASLA 3PHMA 1JU3A 3IM0A 4NRMA 1PM4A 3RYRA 1UQXA 4F7ZA 2X10A 2RMU2 3THCA 1ALYA 2ZAHA 4IW3A 2H6BA 3N9LA 4YLZA 4FAGA 3HJRA 4JKKA 2BERA 3QH7A 4BJ0A 3OGGA 1GV9A 4GJZA 4JRLA 3APBA 1MS5A 3VDDC 1ZYBA 2QFEA 4XBNA 3TYJA 2VZSA 4I30A 4IEZA 1W3XA 4Q4Y3 5C5UA 3RJRA 5IFPA 1HJFA 4GXLA 2XL7A 3E6CC 2Y6GA 5IVVA 3CBNA 4HK9A 1H9WA 5FIXA 4K1ZA 2GNTA 2XJVA 2JE9A 3HNYM 2LM3A 5EJZB 5DUVA 4WVZA 3B02A 1AYN1 1HRV3 2I45A 1ENSA 3UKVA 3VHPA 4LO8A 4LOSA 1SMVA 4GB32 4MGTA 4FPGA 4Y1YA 4Y5Z0 2Y6HA 4YWAA 5ACA3 2D6OX 2A6YA 3FZ3A 2OYZA 1KGYA 2D93A 2GNMA 1YCIA 2HWD2 1DQ6A 2PHRA 2EIDA 1BMV2 3KV9A 4WVVA 4C0BA 1ND3B 2BDRA 4Q4X1 2BUKA 1V6MA 5ANNA 1HXS3 4W4ZA 5HV4A 4FPFA 1LCLA 4OZOA 4LO4B 1LEMA 1W39A 3H8UA 5LASA 5FZKA 1SBFA 4EZHA 3HN3A 1QY4A 2ETEA 3I3MA 4XTMA 1RMU2 1NT0A 2A6ZA 4YYOA 3RZLA 4JGYA 4ATFA 3LOBA 2VZ1A 3WNPA 3O1UA 1PMIA 2PHFA 4QPIC 2RM21 5F5QA 4KNCA 3F2ZA 5C6CA 5HV0A 5L7OC 3GJAA 3HMYA 1YQCA 4CCEA 2D98A 4IXLA 5A32B 1OI6A 4Y4RA 4JVAA 1SLTA 1HN1A 4TLFA 1FPN2 2J42A 4O9EA 5JI9A 5L9RA 4KL1A 4BISA 4WZFA 5I0TA 5KHIA 4NJ4A 4IQPA 3T2QA 2BZDA 4LR4A 2WYSA 2GC1A 4HK8A 4NHXA 3ASIA 3VKMA 2VZQA 2JG9A 4U36A 1W9WA 3DPRA 4CDUB 3PUHA 2FD8A 4A2UA 2QVSB 1OKQA 1PX4A 2V5DA 4W6YA 5FKCA 1UW8A 4HFSA 1AJKA 2WN2A 1GWMA 2EXKA 4EYUA 2VMDA 2QDNA 1Z0HA 4ZHNA 2IZWA 1Y4WA 2VMEA 2WFF3 2BBVA 4YW3A 4KWLA 4FXKB 4XQDA 3RGBA 4CXYA 4ET7A 1K45A 1NE6A 2R073 4AEDB 1NLSA 2ZMLA 3FLTA 3NAPB 1SFYA 1D4M1 2VVDA 2VOKA 5DPNA 3B9CA 5G05L 4UBGA 3VL9A 1VALA 4YVSC 3ITQA 4UBHA 3MIGA 2A71A 1Z7S1 1HB1A 1LOBA 3E1F1 2WT0A 4MGKE 1V6NA 1WD4A 3LQCA 4WM7A 1B35A 1RVF2 4ZU5A 4BQWA 3WF4A 1OA2A 3WV6A 2E33A 1H6YA 3CJXA 3SC7X 3ZKUA 1AYM1 2VQTA 4BB3A 4E4HA 2EA7A 3NNFA 3SXWA 1PO22 1QJU1 3M70A 1ZZ9A 3ZPOA 2A3XA 1KDMA 2ZS6B 3JD73 4HKLA 1VBC3 5CFDA 3RI8A 1VR3A 4RL7A 3K51A 1T6GC 3N36A 1PX3A 2WZR3 2YXSA 2SBAA 4UWDA 1AX0A 3J8F3 4K40A 4N43C 1X36A 5K0UC 3D6EA 3HQRA 3R0RA 1GWLA 1QXPA 1RJ7A 2SLIA 4UF0A 2PXJA 3RJ2X 5F37A 1H2LA 4FQZA 2JG8A 1QJZA 2FMYA 3KCXA 5DUUA 1JH5A 4XF0A 1Y9GA 5AC93 2BPA2 3ECQA 5BNOA 1GSLA 1WCUA 1YQ6A 2IFRA 3OY8A 1RUC2 2TUNA 4GWMA 4B1MA 2HWB2 3OGRA 1US3A 2YG0A 3HIFA 4H7MA 4IEUA 4QGLA 4EN7B 5JMOA 5FUIA 1FV2A 2CSGA 3AJZA 1DP0A 3PL0A 2EIEA 3VDAA 5J1XA 4LXLA 1TME1 2HWF2 5A7NA 1H4HA 2R7EB 2IXLA 5FY4A 4QU2A 5EHDA 4CP0A 3I49A 2RDRA 5IUQA 5C8WA 5LA1A 3I2KA 2MEV1 4MVTA 3MIHA 1R083 4QPIB 1LOGA 2A5ZA 1HQLA 1C8M1 1H4GA 3SH4A 4PQ9A 2R6QA 5JXJA 5L7OB 1NOVA 1W8HA 4FQ4A 3LEKA 4AI8A 2OW4A 3C2UA 4OVEA 1NAEA 3VN4A 5ERLA 5LBCA 3NL1A 4BQYA 5A7WB 1K12A 5LRRA 5C8CA 3AP4A 4LEJA 1C28A 1FNZA 4Q4X3 2ZXQA 1MACA 4IL7A 5C7GA 4QPGC 4FFGA 3SLIA 2LS6A 1XNCA 1OLQA 1XNTA 3QD6A 3ZVXA 4JTNA 1Q8OA 1VAMA 2XJRA 3O0WA 3AKQA 3UESA 1DQ5A 2RS51 3WR0A 4CUGA 4XDPA 3VBRC 4YSFA 2WO7A 2RM23 1CAXB 4BXSV 1SBEA 2QQMA 2AENA 2F17A 4IV3B 2WA3A 2J22A 3B01A 4Z1VA 2HWE1 3HOBA 3WG2A 4B4QA 3MBWA 4IGOA 3GGLA 2AYHA 1JS9A 4CEYC 2IXCA 4OMCA 5FZAA 2EAAA 1HDKA 2X8KA 3D0SA 5T5LA 4CU9A 2JD9A 3OB8A 3K75B 1ZZ7A 4ZS3A 5FZMA 2FDHA 4Q5OA 2JDYA 1NLRA 3AK0A 4J1XA 5A3WA 4W6WA 1X9PA 2AC1A 2GN3A 2ILMA 4RR3B 4OHYA 2WZ8A 3LE0A 2ZKNA 3POYA 2YBKA 2CWMA 4L99A 4XHBA 3ACGA 3E6DA 1UU6A 2J1EA 1I6XA 4WVWA 4YGDA 4RHV2 5FKBA 4CA9A 5LA2A 4FFIA 4GQ7A 1ZA7A 3ZO0B 1RUE2 3O0VA 1X8MA 2LUWA 3FMGA 1XBFA 3VD5A 2RJLA 2Y34A 4QX8A 2VL4A 4M4PA 4RS5B 2HWC1 3MIDA 4FAHA 4MG2A 1UY3A 4NUBA 4N43B 4DNYA 5JI7A 2GALA 2VBBA 3GYDA 1IKPA 5BNQA 1SPPA 2FCUA 3ZPYA 4ZY9A 2YPJA 2WNUA 2ES3A 2G9ZA 3F95A 1Z7S3 1MS8A 5FPBA 4Q4W1 3USSA 3SKJE 4UOJA 1UY2A 1N47A 3ZFEC 1AYM3 4COWA 1S4CA 3GNEA 3L9JT 5F5CA 3THPA 3UYJA 3VB9A 3ZXJA 2IVJA 1SLCA 2DWRA 5FP8A 5JZGA 3D0JA 1IPSA 2W46A 3KVBA 1JOBA 3CLPA 2AZ5A 2WDBA 4FOQA 4K6BA 4META 4PI0A 1WCSA 4MUVA 1EUTA 3S57A 4DMIA 5H9RA 2E26A 2ARBA 2DBNA 2Y6JA 2R49A 2ZHLA 5EWSA 5KXDA 2OZJA 1AXZA 2VNRA 3H3LA 3MGUA 4Q4Y2 4CCLA 2A7AA 1UU5A 1FOD3 5H9SA 2VM9A 1X7NA 5GLTA 1GZWB 4UI9L 3KCYA 4C91A 1A34A 3M3CA 2W1UA 3FJSA 3N3HA 5FZ9A 1NCRC 3H7JA 1I5PA 2JECA 1XE7A 4ONUA 1AL23 3W5MA 4LE3A 1YEWA 3VZLA 4GULA 1K42A 4LIUA 2F4PA 3LWCA 4AHWA 4CU8A 4QPYA 4NHMA 3AXDA 4H2AA 4DUWA 3DL3A 3ZXDA 1BMV1 1RUH3 2GAUA 4B29A 4F83A 5F9TA 1DDLA 2RS33 1XQNA 4M3CF 5ACA2 3ZMNA 3I3BA 1YI7A 1ULEA 1OUXA 4S2HA 2WC2A 4XXPA 2CGNA 1WCKA 5FLIA 1X9TA 4NHLA 1CPNA 4WZCA 1HXS2 3V64A 1LTEA 1MZ5A 1K5MC 1QF3A 3WG1A 2DCKA 4Y4YA 1W6QA 3C7FA 3ETQA 4AVSA 1I3HA 1XYPA 5D8AA 4N9HA 4QXCA 1RUD3 5J48A 2CWSA 3VBRB 1C5HA 3MEPA 3SCFA 3G7DA 3D4KA 5IW0A 3M8LA 4PBPA 1S0DA 1SLBA 3SMHA 1AR72 2D6PA 1DZQA 4BPZA 5C70A 4D6RA 3ZFGA 5HPOA 1JZ7A 1JYXA 1FPN1 1JUIA 1UKRA 3IPVA 2WWJA 2YPDA 5FY8A 1OQEA 1H6XA 5I0UA 3KV5A 3PUAA 4FPCA 4BMBA 3PTYA 4MGIE 4HKWA 2VH9A 2FZ2A 2JDAA 3ZYGA 5EIYB 3I59A 5JPMB 4M3CA 1H1AA 4LUMA 5FJHA 1GNZA 4Z8BA 1ND2A 1F9KA 4LBJA 2RJKA 3AKRA 1KS4A 4AGVA 4XCBA 3UETA 4PLMA 3ZDVA 4KWKA 4NPMA 3IIIA 2EXHA 1ULOA 3K46A 1DYKA 3D8CA 4BYYA 1IPKA 5IYYA 2IXJA 1Q8PA 4OHVA 2WFF2 3LA3A 1O3SA 4GMP3 5F2SA 4DQAA 1QNWA 1N3QA 4OULA 4XOGA 2QQUA 4AG4A 4URTA 1JHNA 3WW4A 2ZCWA 2XGXA 3WDTA 3NV1A 4UFLA 2OPKA 4AAPA 1BEV3 4KG8A 3POIA 4BQ1A 3V0BA 5HCHA 3OGJA 1OPMA 1X82A 1F4HA 4QX0A 1OOPA 1RVF1 4Y1XA 4OHWA 4CU7A 3MLKA 2GN7A 5FP9A 1LB2A 4ARYA 3RMYA 2DF7A 1EAH2 2JX9A 3KLSA 3MLJA 1MQTA 5FRAA 1V9U1 3J7LA 5E89A 3VBFC 3ZFEB 2I74A 2CU5A 1W6PA 5FZCA 1ENRA 1JMUB 4AVBA 4XJ9A 1HRI2 1VB2A 2DCJA 2VZTA 4HONA 4HT1T 5FYTA 3RZGA 1X8EA 1AR61 1ZX5A 1RTVA 1VBB3 3H9AA 3QH6A 4GIQA 4K8RB 4YGBA 3WSOA 4E8CA 5L19A 1W8WA 3CJIC 4P9YA 2JDHA 3INAA 4FBFA 5LW9A 3JD72 4FFFA 2HWC3 3WOGA 3HEIA 5IT6A 1QJEA 2BOJA 2ZZJA 3NV4A 1W6NA 4RFT0 5EV7A 3ZDSA 4XIKA 2XKPA 3SISA 2KXLA 1HV1A 5FREA 1WUVA 5EJ3A 4Q4W3 4BE3A 2YBPA 5J37A 1CR7A 1ASJ1 2DVAA 4XF3A 5CB7A 4FPLA 2HEYF 4MGQA 4HN0A 1DZRA 5FZOA 3T09A 2BBAA 1ZZ8A 5AC92 3WQ0A 4BH9A 3RZKA 4GZ9A 4ATEA 1VP6A 4OMDA 3B5LB 1VRH3 1ZRFA 3BOWA 5C9AA 1LU2A 2VTXJ 5FPUA 3IB3A 4LBQD 3K3NA 2WL1A 3MFCA 2WO3A 2ZHMA 5JXHA 1QOTA 3OF1A 3OBRA 2J1TA 2W3JA 2NMOA 1WMXA 5E8AA 3LB9A 3OSDA 4JGYB 1D4VB 3U78A 3OBAA 4ZZ8A 3ZYBA 1QH6A 5DG2A 3ZR6A 4QAWA 3U4SA 5I8SA 3NJXA 4C0HA 4QXKA 3LPGA 5EYXA 5J98B 1GOFA 4XUTA 3ZSKA 1WW4A 4LULA 3ZXEA 3O1VA 3MW4A 2J1RA 5EZWA 1J59A 1YC61 2IXHA 2NN8A 2Q4SA 3ALQA 5T54A 1IPJA 1HB4A 5FY9A 5C8CC 1UAIA 2JDUA 5FZHA 2VQUA 2C1FA 3AB0A 3Q8EA 4NAMA 3DPRB 4IV1C 1ZVFA 2WT2A 2ZGSA 4B7EA 4EWDA 3W58A 5M0TA 1OBNA 2XLAA 1QJX1 2TBVA 3I3EA 2D44A 4MGZE 3BI3A 4A7ZA 1EV11 3NQHA 5LY1A 1F8VA 4EZ4A 2P4EA 3L2YA 1YLLA 5FOJB 2XWJB 4P9JA 5FOBB 2B4KA 5FCCA 4ZS2A 1LOAA 1YFUA 2VNOA 4LA3A 1F15A 2X5IC 3AL5A 2CNAA 2ZBJA 1RUG3 4QX2A 1O3TA 1SLLA 1PM7A 4EQVA 3VZJA 2V4AA 3U75A 1ZRDA 3QBQA 4KI5M 2B8MA 1Q8VA 3J26N 3HAGA 1XE0A 5IVCA 3FFQA 5DDJ3 4C1WA 3GXUA 3VGIA 3I8TA 5FYZA 1IS3A 3H3ZA 2QQNA 2BP6A 3GJBA 3WX5A 5A3LA 2VMHA 3MDPA 1KFUL 4GWNA 2PAKA 3T0AA 2IVIB 4XZUG 4Q4V1 4JRAA 3WQ1A 5LBFA 2IXIA 5GKAC 1QU0A 5C33A 3VBFB 1POV1 2JIJA 1H8TA 5DZEA 2WLQA 1YIFA 2W0XA 5FBZA 5C5TA 4WM8A 5CFDB 2ZACA 4DUVA 1N1YA 3IWZA 2ZMNA 1FMD1 1S0GA 3CJIB 3IMNA 4XFIA 2R042 1Y9QA 1BBT2 1UMHA 1YJLA 2FDKA 3KGZA 2E6VA 5F5IA 3S5QA 3KS7A 2A6XA 4NVPA 1KEXA 1OH3A 1W05A 1W2NA 5E6HA 1SG3A 1ODNA 1V6LA 4QWNA 1AR91 2VOXA 4OI2A 3VBHC 1AR81 2VZOA 3VBOA 2P6HA 4B4PA 4ORFA 4GKXA 4K8FA 1LHWA 3S7EA 4BCUA 1EPWA 3FX3A 1JYTA 1FI2A 3OJBA 2ZX0A 1S2KA 5BNOB 4CUCA 4O7XA 3OY8B 4YW6A 4F3JA 2G9GA 1V9U3 2XUEA 3RPQA 4NN0A 4MXWA 4MYEA 5IK7A 1HB3A 2F4LA 4DINB 5GZCA 5A6QA 4GWJA 5BV6A 1QJFA 1AR63 2DYCA 2QQLA 3RDIA 1RUF1 4FTBA 4ZU7A 3NKGA 1CIYA 1Y7BA 4QKFA 1FT9A 1IHMA 1UF2C 4AI9A 4YGCA 3SH5A 4URAA 3VDBA 1UPIA 1VBA1 2VJXA 4LBQA 1W8TA 4CDXC 1PGL2 2GH2A 1NCQC 2VVEA 4Q0UA 2ZHKA 4OUEA 3ZR5A 1C1FA 2E7QA 2ZGOA 1GP6A 1ASJ3 4P5YA 1CAWB 5JOWA 3MUY1 4LOTA 3WUCA 4YRDA 4NIIA 1A6CA 3GBFA 1AL22 1APNA 2BU9A 3KF3A 5D21A 3NJZA 4BQ4A 5C8CB 2YGLA 2ZPXA 4QXHA 4CDWA 1LHVA 1COV1 2WRAA 2V73A 1DQ2A 1RUH2 2CY6A 1U5YA 5FMDA 3O1OA 3PLQA 2RS32 3ME2A 4IV1B 4NOTA 2C26A 3WD5A 3ZYFA 4AI2A 4D94A 2XQRA 1MZEA 2E63A 4LKDA 3DXTA 3PUIA 1ND3C 2QQWA 3I7DA 4MO3M 3WW2A 1LEDA 4RQPC 4ZZ5A 2PMWB 3QOPA 1O8SA 2DTYA 3UGGA 4GKYA 2WLPA 1YHFA 4Y1UA 3WINE 5J09A 4N7IA 1AR71 1RUD2 2P3KA 3AFKA 2X5IB 4K20A 4CCDA 5LCWL 4ASMB 1GQGA 2B5HA 2CTVA 3TN92 1EP0A 2E51A 1CD3G 3LZZA 1R091 4NRQA 1PK6C 4OI1A 4MZUA 5LB6A 3EMRA 1LODA 2A6WA 2JEMA 4PLNA 4FPYA 3ZOIA 3D5OA 1IQDC 2Y33A 3P5BA 3AYDA 2WS92 1QJY2 4BIFA 3BTZA 1EV13 1JYCA 2P1BA 5FZ8A 1JZ6A 4ZPIA 3ZYRA 1WW6A 1CZVA 4XABA 2WIIB 5FP7A 1JZ8A 1XU2A 4LORA 1RJ8A 3T1LA 4XTPA 5FYMA 3DKWA 3GZTB 1O8PA 2YHJA 4UAPA 1ZBE1 3CZUA 3E5QA 4XDOA 1WGPA 1QDOA 2VNGA 3AVSA 1RC6A 5CZKA 3PDQA 2VCBA 2GNDA 5FY1A 3SQOA 2OQ7A 2Q30A 3PVNA 1LHUA 1SPPB 1Z78A 2H6CA 3WT3A 2LALA 2WNUB 5T52A 4XILA 1RIRA 4YG3A 3VD7A 4AEDC 2PFWA 3VBHB 5KWRA 5JAXA 3NAPC 1NYWA 1BEV2 2R062 2VGDA 4UW5A 1UOJA 1XYNA 1PZ9A 2DV9A 5FYSA 2ZEYA 3CKHA 4YVWA 1BQPA 4LK7A 4NHYA 3LOIA 1OKOA 1WLDA 4K7JA 2A6VA 4LITA 3ELNA 3ILFA 1HN0A 1HRI1 3VD9A 1DGRA 1Q5OA 2VNVA 3KT7A 1LHOA 4C1XA 3N35A 4UW3A 1H1MA 2YC2A 4A3ZA 4NRPA 1RINA 4KU7A 3O14A 3T3YA 5B4NA 5ISLA 2RV9A 1VB4A 3HT2A 5FZEA 1JZ4A 3SITA 3KT1A 3H0OA 1IS5A 2VU9A 4LO7A 4OQ8A 3B3QE 2YU2A 4MGYE 5FPVA 3WY6A 4CDXB 3I2FA 1AR93 1H9PA 2VD7A 1NCQB 1HB2A 1AXYA 4AHZA 1XNDA 3RZMA 2C4XA 4FVVA 2RS12 3TB0A 1FV3A 1POV0 1V70A 1I1EA 1ACCA 5IVJA 2DFBA 5CEHA 3U1XA 3ZYJB 1GWKA 1Q43A 4HXCA 2DCYA 2FCTA 4QDSA 4AGGA 1KJRA 2PAEA 1OXCA 5F3GA 4COUA 2P2KA 1A78A 3IMMA 2PLV2 2VMFA 4UT5A 5IK4A 2P34A 4YZ3A 1OT5A 3H50A 5JR7B 1LGNA 2XOMA 5FWEA 1TVGA 1VRH2 5FPZA 4JAAA 1IQAA 4A44A 2JD4A 1C57A 4NO4A 3K77A 4QQLA 1O4TA 1W6QB 5CBLA 1SBDA 3PVOA 5D8AB 4EN8B 4ARXA 4JV4A 1GNYA 2VOVA 4CP9B 2A1XA 4RQPB 3WNOA 3AKPA 1ZNPA 1BVP1 1O91A 3ZN6A 3RZJA 3O1TA 1VBE1 3IPVB 3LEMA 1ZZBA 2AEZA 2BVBA 5BPXA 5JXIA 1ZBA1 2ZJCA 3ON7A 4R52A 2GC0A 2XHNA 3N9NA 3I59B 3RRDA 4N9IA 4M3CB 1PK6B 4TLGA 2NM1A 4XYXA 5FBJA 1K3IA 3JBG2 5DMYA 1VBD1 1QQP2 3WW1A 4SBVA 1JUHA 1CJDA 4LHSA 4CEYB 1YFYA 1JYVA 5DQ0A 2W08A 1BXHA 3FHIB 1PO12 1EY2A 2O8OA 3RVHA 1W90A 1PIV3 2BVVA 2D6KA 4YZ2A 1RUJ2 2JKXA 4FCAA 4HOOA 3EBRA 2W91A 4OUSA 1S2EA 1W6MA 4Q0QA 3TNPB 1UL9A 5A3NA 3CNAA 2DCTA 3M3OA 4W50A 2CAUA 2OZ6A 3TEZA 2WO1A 4IEXA 4QQHA 3LF7A 1W9FA 1BJQA 3KHCA 1GQHA 3PMSA 5AFEA 4CDQA 3TAYA 1LU1A 3ORJA 4JGZC 4UW6A 4NIAA 4PF5A 2B9UA 4XJ8A 2Q1MA 1RUG2 4P9XA 5FMCA 5F2WA 1R093 2RVAA 1WKYA 4EV0A 3OYWA 3V0BB 3NMBA 4IV3C 4LBMA 3T0BA 3KCCA 4E8DA 2K9ZA 4G4FA 1OD3A 1YNAA 4PQQA 3OPWA 4N8MA 2O1QA 1RUI1 3NNMA 2XVLA 1IGOA 2VZUA 5DDJ2 1NXMA 3AM2A 4BK5A 3HD8B 1W6PB 4X6QB 5CU1A 2V4VA 5D1IA 2OIIA 2WO2A 1PVC3 1NZCA 4L2NA 4RYDA 4I3PA 2VMCA 1G7YA 3BKZA 3ILNA 4RR3C 2A75A 1ZBE3 4FXGB 3ZLIA 2R041 4COVA 1JHJA 1OH4A 5E16A 3WEZA 1W2TA 3AZWA 2WR9A 4LTAA 1W6NB 5JVVA 1V0AA 2C9KA 1GNHA 1K5JA 1N1VA 3AKTA 3VBUA 4AI3A 4CRQA 4DRRA 5JWPA 1WMEA 1SLAA 1GOHA 4RS5C 1P8JA 4W6XA 4YW5A 1GLHA 4CP2A 3U4XA 1G8WA 4YZ5A 2GC2A 5CKNA 3T0DA 2DU0A 3JQXA 5ABJA 5FZOB 2RR11 3ZFFA 2AR6A 1CZSA 3T2PA 1W0PA 3SCGA 5DN2A 3ZSEA 4HPKA 3QACA 4E2SA 4TWTA 2BW8A 2QQPA 1H8VA 4IE0A 2B42B 1VAKA 4A42A 1W8UA 2ET7A 5C9AB 2YROA 3AKSA 3Q8FA 4AEJA 2FDGA 3KQRA 4JZRA 1RITA 2RHPA 1W04A 1RHI1 4I01A 4G9SB 1LOFA 2YGMA 5KXBA 5LEJA 2XMLA 2X05A 1DHKB 4FI9A 1R1A2 5K4LA 3FFZA 2E32A 4PI2A 3ZKYA 4OUMA 3CF6E 5FZ4A 1WLWA 2UWCA 3RI9A 3L2HA 5FZBA 4CEWC 3EHKA 3UGHA 4FPHA 4N53A 4ZKTB 3PIGA 2EICA 5FO8B 4OI4A 4K9SA 1UIKA 1PMJX 2WNVA 4NWVA 4JKMA 2DDUA 5EQUA 1YXWA 3H1WA 3NNGA 3K4AA 1YO8A 1QKQA 3EJKA 4L9BA 1KXGA 5FXWA 3WF1A 3ACLA 3DN7A 2HBTA 1CWPA 2OKXA 1AYN3 2NPIA 1GANA 3ZXGA 1XJAA 3VD3A 3EXUA 3FLPA 4I0AA 1W8NA 4BDVB 2D6MA 1DQ1A 1ENQA 1A3KA 3HBZA 1IOAA 3S30A 3MLLA 2BWCA 2XJUA 1JZ2A 2WYFA 5FTTC 4A41A 3BTAA 4JHTA 4DS0A 1LNSA 4MOAA 2XLGA 5IK5A 4FT8A 1XYOA 3OD4A 2RDQA 4BK4A 4H55A 1R1ZA 1V00A 3TOJA 2NP0A 3OEAA 3SCHA 1VBE3 4XUPA 1OF4A 4TZDA 3BOPA 1W9TA 5GLVA 1E5IA 1ZBA3 1H2NA 1PGW2 2HEVF 2WZEA 2YZ4A 4JGZB 3U07A 3U37A 3RYKA 1ZA4A 1FNYA 1ODMA 4DXSA 3BCWA 2J1SA 2A3YA 4QM9A 5C3QA 1VBD3 3ENRA 2VMGA 3WF3A 2RG4A 5A6ZA 3R4DB 3O1MA 1IZ3A 1QJY1 4WBBA 5BNPA 1AX2A 3V56A 4JQRA 3M2MA 1GZCA 4GH4C 4RSUA 2ET1A 1H8TB 2WQ8A 2C6SA 2XBO2 4AGRA 3I3QA 1W0OA 5A1LA 5HXMA 3QLQA 1N3PA 3MIFA 5C4WC 1W2UA 3I2JA 4O61A 1TMF2 1W06A 1YI9A 4Q0SA 4AEMA 4CU6A 2HKXA 4GJYA 4Y26A 1OLMA 4KBZA 3PTRB 3JU9A 3PNAA 3DCQA 5CKQA 1QIQA 1VMFA 4Q26A 4YG6A 3VBOB 4COZA 5FQ0A 4EWEA 4TXWA 2R061 5FY5A 2R0HA 2VUJA 5H9PA 2JE7A 1J58A 1D4M3 4LO5B 4S2GA 2VOWA 1E5RA 3B69A 2GZWA 4MXWB 3Q8AA 3PURA 5CAZA 1MVQA 1OF3A 2OXBA 2ADDA 5GLWA 1JBCA 1MEC2 3J4UH 2RMU1 4ISRA 4AXOA 5K7PA 1OA4A 4GALA 4OQ9A 2QJVA 5GZDA 5I0SA 3OGVA 2UYAA 4B3NA 5J3UA 1QJU3 2VZRA 3LPFA 3ZXAC 4CCJA 5LA9A 2AGSA 2H0VA 5I0DA 3FHAA 3IZOA 4B1LA 2W68A 3KV6A 3POJA 2DU1A 2GMMA 2PQSA 3USUB 4MHUA 4M4RA 3VHRA 4J1WA 4Y22A 4CEWB 3FHQA 2P5BA 4RGGA 3T2TA 1KS5A 2D7FA 4BQXA 4UW4A 3PU3A 3VLBB 1BKZA 2PHLA 3X29B 3O7OA 4XXAA 2J1AA 3N4MA 5DAQA 1VAVA 1QH7A 5L9VA 1XC6A 2OPWA 2PLV1 1UMZA 3A22A 4CDWB 3WZ1A 1SDDB 3ZMOA 2YU1A 1UYYA 4GB31 2D40A 2IWGB 4MLOA 4BWOA 3H8OA 5FK7A 4JKLA 2FBEA 4F8AA 1HRV2 4XFCA 4A7KA 2BNMA 2WQ4A 2VBDA 2YV8A 1UO9A 4P02B 2HWD1 2VULA 3K4ZA 4PDWA 5IHRA 3BUCA 3AZVA 2ZABA 2C5DA 3A7QA 1OMIA 4FO9A 5A70A 2NMNA 2Z69A 4HETA 3T4VA 1BZWA 1KRIA 2I07B 5A6YA 3O12A 3OG2A 5DAWA 2CGPA 1HQNA 5FLHA 1TME3 3S7IA 3VBSA 1V6OA 2KD7A 4FTEA 2H0BA 1L7LA 4KU8A 1D2QA 1QGLA 4JGYC 2WWUA 1RMU1 5FZ6A 1S0EA 4AR2A 3VZKA 2MEV3 4AVCA 1E5SA 1ZREA 1S0IA 5KHHA 1C8M3 3JBG1 5F39A 1QQP1 3C7OA 4YFWA 4XUNA 5FO7B 1KJLA 5CFCA 1F5JA 1J1TA 3NVCA 4U2AA 1YUDA 1OFNA 2AH2A 2IXKA 3M3QA 4AVTA 1ZRIA 3DYPA 1RUJ1 2JG9C 4WVMB 2VW1A 5FLJA 3DPRC 5A1FA 2ZOEB 4GH4B 3BPSA 1VMHA 1LHNA 2XVGA 3ACHA 4PJYA 1PIV2 5FZLA 5JR2A 1QXRA 3N7JA 4XF9A 3ACIA 2D6LX 1RUOA 2VUAA 1YQ2A 4BQ5A 2TNFA 5L73A 5C4WB 4CDQC 1CGPA 1GICA 1S0CA 4QX1A 2RS53 2YFUA 3J9SA 1JYIA 1GZTA 4XMAA 4AZZA 3LEIA 1DLCA 4MXVA 5FZIA 3RSJA 4TN7A 4AHXA 5KHJA 4NIGA 3U14A 3C8XA 2HYKA 1XRUA 3R05A 3MO4A 2HWE3 4XF1A 3H1MA 4X8NA 2R072 1AHSA 1D2SA 1STMA 5A32A 2BYVE 3B00A 4DFSA 2ZTNA 3E97A 1WW7A 4DO0A 4WM7C 4CPBD 3BU0A 2V5YA 1B35C 4YG0A 5CKMA 4AOCA 4AVAA 1VRBA 3DV8A 4LUKA 1PHMA 1WCQA 3WLUA 1PVXA 3KZ4C 1PVC2 1PO21 5SV5A 3A23A 1NA1A 2PN5A 3TRSB 4CUAA 4W8JA 5FZ1A 1WLTA 4I0BA 1XNKA 5CFDC 2ZX4A 4COYA 1W8FA 1E57A 4HG6B 2VZVA 4DEVA 2R1DA 1OC1A 1TZOA 3IT8A 3MV11 4MHRA 2VQ0A 4YZ4A 2BRTA 4R4XA 2WINB 5KXEA 1VBC2 1QWRA 5K9YA 3VDCA 4M01A 2WZR2 3MFAA 2YMZA 5EXOA 1CAVA 3J7MA 3J8F2 1MS1A 2JG8C 4HANA 2WSUA 2Q8DA 1M4WA 1W8OA 2FDJA 3ZM8A 2P37A 2C9AA 5BNOC 5J96B 2Q8EA 4EROA 1JW6A 3UGFA 3KMHA 3BN6A 2DBIA 4IUGA 3MICA 1RUC1 4LE4A 4PCRA 4IESA 2HWB1 3LD8A 4QGNA 3PVBB 4Z07A 5DUXA 5FWJA 1QOOA 1R1A1 5AFBA 4UFMA 3U0ZA 5LRSA 4AF9A 1XU1A 3ZIWA 4SLIA 1OVSA 5FYVA 1U5IA 1VMJA 2D3PA 2ZZQA 1GBGA 2HWF1 2QQVA 3VDDA 1TE1B 3N9OA 1I9RA 2FHRA 3ZN6B 2OVUA 3PU8A 4HBNA 4YM1A 4BU2A 4QPWA 4LKFA 3WCSA 1Q3EA 5JPNB 1L7QA 5A33A 3KHBA 2CL2A 3HNMA 3ZSJA 3BTXA 3IDCB 1C5IA 1J3PA 4HL0A 4QKNA 4TYSA 4H7LA 4EWAA 1HJGA 2A3WA 3UV9A 5GZGA 4GB33 1R082 3IDEA 4YFZA 3VZMA 2UURA 5JOXA 2Y6LA 4XFHA 2ZA9A 3GALA 1WA4A 2YBSA 3P3PA 1ST8A 2A70A 4LNVA 1F31A 1KFXL 2Q0AA 2Y64A 4E2QA 3RZZA 2JG9B 3HVDA 4NPRA 4Z2WA 2NQYA 2JJ6A 1NQDA 3IAPA 3I4IA 2D43A 4Q4X2 4AI1A 5JXGA 1G9AA 5C3RA 5HI0A 1GP4A 4FSJA 1UX6A 3NJVA 2RJ2A 4E4ZA 4CDQB 3GZAA 4JDMA 1UOGA 2X53S 1PGW1 5FY0A 1KITA 2BFUL 3VHNA 3B9IA 3E5XA 4I0WB 4XJWA 2PHDA 2JB4A 5JSOA 2I2SA 2LROA 2RM22 3AL6A 3NKTA 3ZN5A 1JYNA 1FPN3 4QPIA 2J7MA 4JC1A 3WF0A 5DG1A 4Q1PA 1HKDA 3I2HA 4IE5A 3T08A 5IK8A 1SCRA 3LGRA 3J7NA 2VUCA 2IFWA 4WM7B 1TQ5A 3M3IA 1B35B 2Y6FA 1QMJA 1TG7A 5FXZA 1J1LA 2ORZA 5DAXA 4XCAA 3ETPA 1S1AA 1UOFA 2E53A 2PYTA 3WHTA 4CPBA 1AXKA 3HN1A 1WMFA 4NPLA 3UT0A 1OHFA 4L0PA 5I91A 3QCWA 4XFFA 2ZHNA 4YW1A 2Q5TA 4RGAA 1F4AA 4RHV1 4PT6A 1AZDA 1QHDA 4S2FA 3R6SA 3VBUB 1RUE1 4AL9A 4D69A 5C3PA 1M06G 2AEYA 2VY0A 1PZ7A 3OEBA 3W5NA 2DUOA 3LIHA 1CAXA 2ADEA 2ARCA 2DCZA 2ARXA 3AMMA 2Z4FA 5FZGA 3ZXFA 2E9QA 2ENRA 4LHKA 4UF0B 4PF1A 2WNUC 5ABJB 3ZFFB 3OCPA 2XB6C 1D4M2 2JG8B 5A7QA 1WW5A 2Q1FA 1RVF3 2AUYA 4IGPA 4KGQA 3U10A 3PUQA 5C3SA 1US2A 2EIBA 3GM8A 4YVSA 1OVPA 1Z7S2 2YFZA 1G9DA 3KD4A 3W59A 1UXXX 5JZGC 3EO6A 4Q2FA 4E4DX 3GDBA 4CVUA 1AYM2 1QJU2 4LHLA 4IERA 3LCPA 2VMIA 1W2OA 4XJUA 4XQ4A 3ACFA 2NLRA 2R32A 3WG3A 4AFDA 2FCVA 1D0GA 3NNJA 2Y38A 4P08A 1LECA 3OBTA 4V2VA 1FAYA 4BLJA 3IN9A 1RXFA 4O65A 2R30A 3KT4A 4Q4Y1 3HT1A 1C1LA 3O5SA 2W1WA 2Q8OA 3TWIA 4A7YA 5JMCA 2GC3A 1YRZA 4N43A 4D7TA 5K0UA 3O1RA 1FOD2 2WZPP 1DYOA 1HW5A 1LGCA 3RWNA 1UNBA 2BGOA 4ZU4A 3MUZ1 4ZONA 1W03A 4JCKA 2BJSA 2HWB3 2VZPA 2W87A 4M0HA 4NROA 5FP3A 1O4YA 5ACA1 4AK3A 1GR3A 5FDBA 3UNPA 1DGWA 4QDRA 5IVYA 1O7FA 2VW0A 5D2AA 4CXWA 4DY3A 2HWF3 1HXS1 4YM0A 4P9IA 4Y5SA 4B7KA 5FXXA 5E1RA 5D8AC 5EJ1B 3NV3A 1UU4A 5DXDA 2EIGA 4P9LA 1TME2 2WAAA 5GJ6A 3B7MA 4LT5A 1OQDA 2WJSA 3VKOA 2ATFA 3I97A 2EXIA 3VZNA 1Q8SA 2MEV2 4QX5A 1GZWA 3W20A 2FZ1A 1OLRA 5T3NA 4XVHA 3P6BA 1C8M2 1O6UA 1W6OA 1HIXA 2P17A 2EAKA 2WNOA 4LBNA 3TNQA 5BNPB 1W28A 5HXVA 3ZYHA 4MH0E 1ND2C 2Y8KA 3AMNA 2V09A 2JICA 2BNNA 3AP6A 1RGSA 4XBQA 1QJX3 1UIJA 3P1IA 5CG9A 2W39A 2XJSA 1LGBA 4CCMA 2BOIA 1UZVA 4QPGA 4G3YC 4V1PA 4YGEA 2XHKA 4GD4A 5LZ6A 2KA3A 2Q1ZB 4YARA 3EQEA 3NWKA 1O4ZA 5HCBA 2B39A 5CG8A 2W52A 3VKFC 5FQ0B 2RS52 2WFF1 4FFHA 1CVNA 4V2WA 4IEOA 3VBRA 3BU7A 5KC6A 1SZBA 4R4ZA 4JHZA 4YM3A 3MPBA 2R071 1EYBA 1G6NA 3OUHA 3ZN4A 4KBBA 1ZRCA 1V6JA 3RG0A 2CAVA 2HWE2 2P3JA 1OOPC 3MV01 3AJYA 4R9CA 2GP3A 4WV8A 5EPAA 2C24A 4N7UA 1DLLA 5FUPA 2WA4A 2VBPA 4CEYA 1ULGA 3T4HB 1IS4A 2BGCA 1MQTC 1UCXA 1URXA 1EAH1 3A0NA 2AACA 2BGPA 1RL3A 2WABA 3FC0A 4Q4V3 3OOXA 3MF6A 2VZ3A 1POV3 4P00B 5JZGB 2ZGKA 1CX1A 3JZVA 1BHGA 1OA3A 4JQTA 3NV2A 5I93A 3N7LA 4ISQA 1CZTA 4FPEA 4Y22B 1FMD3 4OCTA 3LA7A 1VBB2 1D7PM 1XSRA 3D82A 3JD71 3KB5A 5BUVA 5FPXA 2WT1A 1QNYA 4IE4A 3VD4A 2VTXA 4BOWA 5BYNA 3BPZA 4QB6A 4B4RA 1MZ6A 1XNBA 1JTZX 4Q0PA 2ZAAA 3Q9OA 1CESA 2HWC2 4A4AA 2DVDA 2XVKA 1AR83 3BGAA 3HR9A 4AFCA 1O5UA 1A8MA 4PHZA 5FYUA 2LRPA 1W9YA 2K46A 3PMEA 2YYOA 2XQXA 1IG3A 3UK9A 3AMPA 2QZ3A 4Q4W2 4PDWB 3ROUA 2W5FA 1F2NA 2QDRA 5AC91 1S55A 3G6JB 1DFQA 3SKVA 2WSVA 3ILRA 2ZGMA 4LKSA 1H1IA 3VHOA 4A6OA 3GF6A 1WMDA 3ZFEA 5C9AC 1RUF3 2VVFA 2R0FA 3H1YA 2PHXA 2QQOA 3VKNA 2OX0A 3R4SA 4NIHA 4H14A 1CAUA 2FQPA 4HVOA 4PIZA 5FMBA 3VBSB 1SEFA 2AREA 5FYHA 3OPZA 2FDFA 3RS6A 2YB7A 1VBA3 1Y3TA 4TSVA 4DZGA 4I09A 4XF4A 5K8SA 3KV4A 1TNRA 3WNMA 2HYXA 1T2XA 4CXXA 2KM2A 4QM8A 1DGRN 4L97A 2ARAA 3B94A 2P6CA 1R081 2VE1A 4QXBA 1Y9MA 5CFCB 3H8XA 4Q29A 1T6BX 1B09A 1NCRA 2JKBA 3T2OA 3A0KA 4DEQA 2K0GA 3RMXA 5A3TA 1COV3 1ND2B 3OUJA 1UZWA 2W95A 2X29A 2DVGA 4LK6A 4ZXEA 1A8DA 4AE2A 1NKGA 4FP2A 4CYDA 5A7OA 3JCIA 3OD0A 4QB2A 1OD5A 2JDMA 2RDSA 5F3IA 3VZOA 3K2OA 5JSPA 3CQOA 4Z92B 2Y60A 1JZ5A 3LIGA 3KQ4B 2L9LA 1DQ4A 1VLNA 1K5MA 4QDQA 3GCXA 1AR73 3V65A 3Q8BA 3PJQA 3C7EA 3E6BA 1G9BA 1R64A 3LSEA 1JOPA 3POWA 4AAXA 2R1BA 2B7YA 2CYFA 2JXAA 2MNGA 2QQKA 4L11A 1W9SA 4FOYA 4BM8A 4HMZA 1OOPB 5LATA 3C3VA 1MPXA 5CNAA 3V0AA 1RYYA 3FL7A 4YM2A 3CL1A 5F6LB 1MQTB 2OA2A 3M4FA 2Z42A 4HZFA 5EYYA 1NA1B 3ZSLA 1H8TC 1DGLA 2VR4A 4QU1A 4AFMA 2E7AA 3C7GA 4WM8C 2ZX2A 3M3EA 4XUQA 1U5XA 1SACA 2EVXA 4YPJA 1REFA 1JXNA 4C90A 1DG6A 1BBT1 1ULDA 2EXJA 3IAQA 5BNNA 1SCSA 3PUSA 3WDWA 2ZGUA 3RFRA 5A3MA 3I2OA 1CAVB 4NR1A 5A80A 1BK1A 4JTOA 4R9BA 1E5HA 4UXAA 3VBOC 3SEEA 5F7UA 1UWWA 1MS9A 3VL8A 2WFPA 2D3RA 1EUUA 5F1RA 1YFXA 4Y20A 4AQ6A 1EAH3 3FWEA 4P9GA 1FATA 1ULCA 3LDKA 2D5HA 4H3WA 3WQ7A 2FDIA 5JOYA 4Y5TA 2XR4A 4CCCA 3HPNA 1HRI3 4P14A 3DKQA 5T55A 1XXNA 1LKNA 2VECA 3WF2A 1V9U2 2YDEA 3VBFA 2Y6KA 1AR62 4E9KA 2QNKA 3MI8A 3N7KA 2GU9A 2OT7A 3VDDB 3B93A 2B9VA 3POBA 2C0ZA 5FMOL 1UYXA 1YWKA 3CJIA 3POGA 4QKBA 4DPNA 5A33B 2PQQA 2PELA 4YZ1A 5LEKA 1PGL1 4E27A 1C3HA 3BIEA 1UX7A 2YUEA 1S0FA 2RDNA 1FOD1 3CZJA 3M1HA 3ZX7A 1WZXA 3DECA 5IVEA 3WP4A 2Y26A 3WUDA 1SFNA 4IEVA 4I3GA 5ANQA 2RE9A 4INDA 1YQ5A 5FZDA 1KDKA 5J7MA 2WQZC 2VXRA 1NLQA 1AL21 1ASJ2 4RGKA 3MPPG 3ZSMA 1SQ4A 4CDWC 3WDUA 2NZ9A 2VPVA 1RUH1 3OPTA 2GH8A 3WQBA 4CCOA 1XB9A 1GMMA 1LJ7A 2RS31 2VW2A 2ZGLA 4ES9A 3BTYA 4DRVA 4FPKA 4OYUA 3POEA 4BHPA 1NXD1 4OHXA 4CSWA 1UXZA 3OTFA 2BV4A 1X33A 3AVRA 2WAOA 1DQ0A 4IEPA 1H0BA 2ZGQA 5B2GB 4QD2A 2O0OA 5FUNA 3ABZA 3MIBA 3I2GA 5A7SA 3RZHA 3CEWA 1XPWA 1RUD1 1RB8G 1MR5A 3ES1A 3KGLA 5KHKA 3TN91 3A21A 3ZXLA 3TEXA 1AL0G 2NYYA 2W1QA 1CAWA 1YIPA 1WCDJ 3WP3A 5FK8A 1WD3A 3I2IA 1C8NA 4O9GA 2WS91 3FBYA 4P9WA 4EN0A 3VUOA 4AFBA 1XSQA 1SDWA 1NZIA 4XHXA 3N9PA 3AXEA 4LMFA 3JQWA 4YNIA 4IV1A 2W47A 1QJX2 2DTWA 3D3AA 1C4RA 3PJYA 4S2DA 4XAEA 3UJOA 1EV12 1UY1A 2XWBB 1LAJA 2XJPA 4WM8B 3O1PA 2V72A 4L8QA 4FOVA 5GZFA 5IAXA 1AUYA 4J6GA 3DF0A 4DIQA 3OBZA 3LDBA 4UFJA 5CADA 5JSRA 4EN9B 4GMP1 4LJHA 3SH3A 1OURA 1CIWA 1VE0A 2QE3A 2X5IA 4BZ4A 4RFRB 2IC1A 1SFPA 2YC0A 5E88A 4YW4A 5FP4A 4DXZA 4I2OA 2JDZA 5FAXA 1BEV1 4AW7A 2CHHA 1RUI3 2ZX1A 4YVSB 2OQ6A 2XLFA 4KWJA 4XIOA 4YVWC 2W94A 1MZFA 5IVFA 4CTEA 1WBFA 5JCTA 4P5HA 3Q8CA 4Q4V2 4K21A 2OUJA 4K1YA 4D0QA 5FZ7A 1PNGA 2DVFA 2ZGPA 2HEWF 1N1TA 1NUKA 1VBB1 2R043 1JODA 5GM0A 1BBT3 4GA9A 3WP6A 5CYYA 4LLOA 3EB7A 1TNFA 5HCFA 1NG0A 4KWUA 2PHTA 2WNEA 1FMD2 3HQXA 2WBKA 4MSVA 1GFF2 3GHMA 3N9MA 4LBQB 1CPMA 1GZ9A 2OS2A 1MS4A 3DXUA 4LA2A 3WHUA 3BODA 5F8PA 1O3RA 3AFGA 5K0UB 2GDFA 2UWBA 2RS11 1SLIA 2XXZA 3JB4C 5T50A 4E2GA 2XJQA 4Q8LA 1AR92 2GMPA 2UWAA 1AR82 4XW3A 2ZGRA 3AC0A 3GBGA 1KD7A 3VBHA 4OI0A 1DIWA 5JLVA 2RR13 5IAVA 4DY5A 3ES4A 2MHFA 2VQAA 4MGSA
chains in the Genus database with same CATH topology
2V4AA 2G1MA 4BQWA 4Y5SA 4ZPIA 3BVCA 4J25A 4XABA 5DAVA 3NNFA 3GJBA 2Y34A 2RG4A 4IW3A 5LBFA 4NHKA 2JIJA 3W20A 5C5TA 2FCUA 3OUJA 4NAOA 3NNMA 4XACA 5DAPA 3HQRA 5C5UA 2RDSA 5LBBA 5L9BA 3OUIA 4NHYA 4KBZA 5DAXA 4XCAA 3KT7A 3GZEA 4XAAA 3MGUA 3PL0A 3KT1A 5LATA 3OUHA 2RDRA 5EPAA 5HV4A 5IAXA 3W21A 5LBEA 3OBZA 4NHMA 5LASA 4MHRA 5LA9A 5A3UA 2FCTA 3HQUA 4JZRA 3NNLA 4MHUA 5HV0A 3GJAA 5ERLA 5LBCA 4BQYA 4NHLA 4BQXA 5L9RA 2G19A 2HBUA 5EP9A 5DAQA 5L9VA 4NHXA 2OPWA 4XC9A 5EQUA 2FCVA 3NNJA 2A1XA 4Y5TA 3KT4A 3DKQA 5M0TA 2HBTA 4UWDA 4NMIA 2JIGA 5DAWA 4ZONA 4XCBA 5IATA 5LB6A 3EMRA 2RDNA 4Q5OA 5IAVA 2RDQA 3ITQA 2Y33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4A A;  2G1M A;  4BQW A;  4Y5S A;  4ZPI A;  3BVC A;  4J25 A;  4XAB A;  5DAV A;  3NNF A;  3GJB A;  2Y34 A;  2RG4 A;  4IW3 A;  5LBF A;  4NHK A;  2JIJ A;  3W20 A;  5C5T A;  2FCU A;  3OUJ A;  4NAO A;  3NNM A;  4XAC A;  5DAP A;  3HQR A;  5C5U A;  2RDS A;  5LBB A;  5L9B A;  3OUI A;  4NHY A;  4KBZ A;  5DAX A;  4XCA A;  3KT7 A;  3GZE A;  4XAA A;  3MGU A;  3PL0 A;  3KT1 A;  5LAT A;  3OUH A;  2RDR A;  5EPA A;  5HV4 A;  5IAX A;  3W21 A;  5LBE A;  3OBZ A;  4NHM A;  5LAS A;  4MHR A;  5LA9 A;  5A3U A;  2FCT A;  3HQU A;  4JZR A;  3NNL A;  4MHU A;  5HV0 A;  3GJA A;  5ERL A;  5LBC A;  4BQY A;  4NHL A;  4BQX A;  5L9R A;  2G19 A;  2HBU A;  5EP9 A;  5DAQ A;  5L9V A;  4NHX A;  2OPW A;  4XC9 A;  5EQU A;  2FCV A;  3NNJ A;  2A1X A;  4Y5T A;  3KT4 A;  3DKQ A;  5M0T A;  2HBT A;  4UWD A;  4NMI A;  2JIG A;  5DAW A;  4ZON A;  4XCB A;  5IAT A;  5LB6 A;  3EMR A;  2RDN A;  4Q5O A;  5IAV A;  2RDQ A;  3ITQ A;  2Y33 A; 
#chains in the Genus database with same CATH topology
 2BFU S;  1GUI A;  2G1M A;  4XZP A;  3K3O A;  4Y1V A;  4Y33 A;  1RXG A;  4XFG A;  1J3Q A;  2BWA A;  5APA A;  3BVC A;  4FPJ A;  2WWS A;  4QHB A;  4QMA A;  1VRH 1;  1Y43 B;  1J83 A;  1RHI 3;  1RUF 2;  1MS0 A;  1NX9 A;  4BIO A;  1REE A;  5DZG A;  5LK7 B;  3FUQ A;  3POF A;  4OHZ A;  5GAL A;  4RD7 A;  4AQ2 A;  1UY4 A;  4EE2 A;  2GME A;  2VC9 A;  2IUW A;  2QBX A;  1QXJ A;  1HLC A;  1VBA 2;  1WLC A;  3WDV A;  3WVJ A;  4HVR A;  1LRH A;  1GOG A;  2DFC A;  3H7Y A;  5KR7 A;  5F5A A;  4CDX A;  1LES A;  3A4U A;  1UD1 A;  1NCQ A;  3UKN A;  4XAC A;  1W6O B;  4A6S A;  2GP5 A;  3AMQ A;  5IWF A;  5CVR A;  4D7S A;  3RQ0 A;  3BIW E;  1JI6 A;  1GKB A;  4FTS A;  1O3Q A;  1NY7 2;  2W9X A;  1DCS A;  1JN2 P;  3MYX A;  4CZS A;  5KBF A;  5I8T A;  3WNX A;  1PO1 1;  1LEN A;  2DVB A;  1COV 2;  2QQI A;  2QQJ A;  3KF5 A;  3ZFG C;  4CCN A;  4QPG B;  3RWK X;  2J1V A;  1LUL A;  1N1S A;  1OLM E;  3WW3 A;  2EF6 A;  4KG0 A;  3KVA A;  3PIJ A;  1V6K A;  3AX4 A;  3HBK A;  1ND3 A;  2Z2S B;  4EJR A;  1W0N A;  3NST A;  2VCC A;  3SEP A;  4CP9 A;  1N3O A;  4XUO A;  4RQP A;  4DXT A;  1RED A;  3E5U A;  4LIV A;  3TN9 3;  2LTN A;  3H42 B;  1RUG 1;  2PHW A;  3UL2 A;  1GQP A;  2QZ2 A;  5BXX A;  1FX5 A;  4AWD A;  2ZEX A;  2W92 A;  3W21 A;  1UZ0 A;  2XUM A;  3AYC A;  1ENX A;  3WNL A;  1R09 2;  4KGG A;  2E7T A;  3FLR A;  2P3Y A;  3CMG A;  1DZT A;  2WS9 3;  3H3U A;  4R9A A;  5DDJ 1;  1PK6 A;  1QJY 3;  2QKD A;  1QEX A;  4AHY A;  3MZH A;  5SV8 A;  4YVW B;  2PTM A;  2UYB A;  4AYU A;  1AVB A;  2JDN A;  5T5J A;  3HNB M;  3IDB B;  4UYB A;  5C3O A;  1QOS A;  4HKO A;  3AZZ A;  2G9F A;  4Y1Z A;  3CIH A;  5IFT A;  2Q8C A;  1OFS A;  1U12 A;  4D8M A;  4XJA A;  5AVA A;  4D7Y A;  5FZF A;  4PIX A;  4QHZ A;  4Z82 A;  2HBU A;  5DZF A;  2Y0O A;  4CDU A;  5BNN C;  3CHX A;  1O5L A;  2PA7 A;  2VXJ A;  4LBO A;  2W2I A;  4XMI A;  4XC9 A;  2GNB A;  1ULP A;  1ZBE 2;  3LKJ A;  3UJQ A;  1FYU A;  3VBU C;  4EN6 B;  1YQ8 A;  3BAL A;  4IEY A;  3AP5 A;  4D6S A;  5J36 A;  2VCM A;  5FFO C;  1W8Z A;  1JYW A;  2B46 X;  2ERF A;  3W9A A;  1FXZ A;  5BY5 A;  2R06 3;  3WP5 A;  5JDB A;  4IEQ A;  2W1S A;  1X50 A;  4XQW A;  4W65 A;  3LDR A;  5ABJ C;  3ZFF C;  3WG4 A;  3TBD A;  4AED A;  1GYK A;  2XPJ A;  3LA2 A;  1LR5 A;  4OLL A;  5LA0 A;  1I5Z A;  2KR2 A;  2OUH A;  3NAP A;  3ZYI B;  4CE8 A;  1YYN A;  4QQ2 A;  5HCA A;  4AFA A;  5FY7 A;  4KH9 A;  2RMU 3;  4LBL A;  4A3X A;  4BLI A;  5A6X A;  4GMP 0;  1D0H A;  1LOF C;  4HN1 A;  1CAU B;  3KWV A;  5CA6 A;  2DUQ A;  3I2D A;  5LWB A;  3UKT A;  2VO5 A;  3ZIX A;  2B45 X;  5FYY A;  2N7G A;  4LBK A;  4IDZ A;  2YY1 A;  4N53 C;  5DAV A;  2R16 A;  5GZE A;  2D6N A;  4X8P A;  2XL9 A;  5CIR A;  5FPA A;  3SHR A;  2RS1 3;  2ZKL A;  4FOW A;  3WNN A;  3C7H A;  1UOB A;  3KM5 A;  2WNV C;  4LO6 B;  3DGT A;  3ATG A;  4Q8K A;  4N90 A;  5IJR A;  1EPZ A;  4NHK A;  5FR3 A;  2CV6 A;  4LKE A;  2EAL A;  1NCR B;  4JDN A;  3NW4 A;  4M3C E;  5L36 A;  4JDO A;  1J84 A;  2PLV 3;  2YC4 A;  1BYH A;  1YFW A;  5FZ3 A;  1ZRR A;  4KMQ A;  1UZZ A;  1UKG A;  1XNA A;  2XJT A;  4YW7 A;  3LEG A;  1AYN 2;  1UY0 A;  1TEI A;  4AVV A;  1G86 A;  4K3U A;  3RNS A;  2HWD 3;  4HSJ A;  4QQP A;  1ONA A;  5L9B A;  4A45 A;  1U0A A;  3ZFG B;  4ASK A;  4D6Q A;  1JZ3 A;  1H2M A;  1W6M B;  2A73 B;  1DU3 D;  1L3J A;  1WBL A;  4M00 A;  5F3E A;  2HJI A;  3AYA A;  3WXP A;  3S5A A;  2VOT A;  3DYO A;  1K5M B;  1WWY A;  5GLZ A;  3THD A;  5T5P A;  4XAA A;  1CON A;  5FZ0 A;  2D3S A;  2UY8 A;  2GSY A;  1RMU 3;  3FN9 A;  4XUR A;  1O59 A;  1GU3 A;  4QX3 A;  4BQ2 A;  4AQT A;  3OYW B;  1UZY A;  1VBE 2;  3NO8 A;  4KQ7 A;  2ID4 A;  1ZBA 2;  3JBG 3;  5F3C A;  1LOC A;  1QQP 3;  3MIE A;  2CDP A;  5TSW A;  5BNP C;  4GAZ A;  2XKO A;  5FXV A;  3V0A B;  4ZXK A;  3FE5 A;  1PGS A;  3AZY A;  1PO1 3;  5L7O A;  5LBE A;  1VBD 2;  2UY9 A;  3LFM A;  4LQR A;  4XJZ A;  1ULF A;  2JDK A;  1OUS A;  4XDQ A;  1AJO A;  1RUJ 3;  4LLF A;  1VJ2 A;  3FUO A;  3MF9 A;  4AI0 A;  2XBO 1;  1UMI A;  4QB1 A;  5A7W A;  4NWW A;  5I0R A;  1HX6 A;  2D5F A;  4OZX A;  2Z79 A;  5LY2 A;  4XFB A;  3T30 A;  1TMF 1;  1MVE A;  1PMH X;  1U5Z A;  3S6P A;  3DEM A;  5BNN B;  2FMD A;  4CUB A;  4R9D A;  1W2A X;  4Q1R A;  1WA6 X;  1UPS A;  4GWI A;  4Z2A A;  2XON A;  1RUN A;  5EP9 A;  4XPV A;  3WDY A;  3OGS A;  4NID A;  4QKD A;  3BYW A;  3H8R A;  2J1U A;  3VKL A;  4JGZ A;  5EFU A;  4RA0 A;  4XBL A;  4Y20 B;  3O1S A;  5IVB A;  1G9F A;  4IV3 A;  1W3V A;  2PAM A;  3MHZ A;  4CCK A;  4DXR A;  1AF9 A;  4QX7 A;  2HLE A;  4DB5 A;  1RUI 2;  4Q0V A;  2UU8 A;  3N7M A;  4HPK B;  3VV1 A;  4HSL A;  1POQ A;  5A3O A;  1MEC 1;  3J7H A;  4NMI A;  5KC5 A;  2HH9 A;  4XFA A;  2XDV A;  2JB8 A;  1NE4 A;  1CQ9 A;  1G9C A;  1F5F A;  1PO2 3;  3BB6 A;  2ORX A;  3CDZ B;  3K4D A;  4XET A;  1DF0 A;  1JU4 A;  1V6I A;  5IAT A;  5FO9 B;  3O0X A;  5JOZ A;  4RR3 A;  2ZGT A;  1LOE A;  2QUO A;  3GCW A;  4HLT A;  4N53 B;  1H2K A;  1UYP A;  3AP9 A;  2TEP A;  5KHG A;  4E4S A;  3M7A A;  2PHU A;  1H30 A;  2WNV B;  4QHO A;  4J25 A;  5T5O A;  1BK0 A;  3CO2 A;  1HV0 A;  4RS5 A;  1MS3 A;  3IIA A;  1XOY A;  2RR1 2;  3IDA A;  4LHN A;  3R4U A;  4FPO B;  5FJK A;  2O14 A;  3URF A;  2G4I A;  2K2S A;  4PDW C;  1HRV 1;  1RUC 3;  4PBO A;  4NAO A;  5KXC A;  1BCX A;  3LSD A;  1DGW X;  1OSG A;  1PZ8 A;  2Y0I A;  5F32 A;  1R1A 3;  4PIY A;  5DAP A;  3NJY A;  5FPL A;  3S0M A;  5FYB A;  1RHI 2;  5G04 L;  3WDX A;  3TEY A;  3U11 A;  5FV3 A;  3GHN A;  5C71 A;  1IS6 A;  5DAB A;  3VBS C;  3N9Q A;  1PNF A;  5LBB A;  2CDO A;  4NE9 A;  1IG0 A;  3OUI A;  2WN3 A;  3USU A;  4BQ3 A;  4CEW A;  1OPO A;  1OQ1 A;  4C8D A;  1Q8Q A;  2BNO A;  2F6B A;  1ZZ6 A;  4R8H A;  4HVQ A;  3KSC A;  5A3P A;  5JIU A;  3AYE A;  3AMH A;  4JX0 A;  4LPL A;  2WUH A;  1BVV A;  5DUW A;  3GZE A;  1NY7 1;  2DUR A;  1BLZ A;  3LFI A;  5JUV A;  2BTV C;  5CFC C;  5I8Y A;  1S0J A;  3DYM A;  3P3N A;  4IE6 A;  3GZU C;  4ES8 A;  2ZEW A;  1Q56 A;  2O8Q A;  2XH6 A;  4OFG A;  3IBM A;  2ZX3 A;  5JIA A;  3JUU A;  4RN5 A;  4IEW A;  4BME A;  4MAD A;  3RYP A;  1PIV 1;  4QGM A;  4UFI A;  5F6K A;  2VCA A;  2XG3 A;  4UFH A;  1F35 A;  3NRU A;  4IET A;  4M0N A;  5FYC A;  3THT A;  1NQJ A;  2D97 A;  4BXF A;  3I3D A;  1IKQ A;  5A3U A;  3HQU A;  1GP5 A;  1W99 A;  4X6R B;  1S0B A;  2DUP A;  2ZGN A;  3T1M A;  2QTW B;  3IKW A;  3NNL A;  1VIW B;  1YJK A;  2JEN A;  2ZEZ A;  3FBM A;  2JWP A;  4AEK A;  4MX3 A;  1J3R A;  2P3I A;  4AQS A;  1HQW A;  2X09 A;  4B8E A;  3DUI A;  5FYI A;  2G19 A;  5GLU A;  3SNM A;  1UN1 A;  2CGO A;  5CIS A;  3K48 A;  4XEZ A;  1CN1 A;  2LW8 A;  3MW3 A;  4BA6 A;  1UYZ A;  3AP7 A;  4I02 A;  4ITC A;  4Y24 A;  5FMO S;  5A7P A;  2VTF A;  3POS A;  3ST7 A;  3CU7 A;  3ZYP A;  1ZM1 A;  4CP1 A;  3TEW A;  1SHW B;  3JXS A;  5H9Q A;  1S2B A;  1XE8 A;  2XBO 3;  4Q27 A;  2ZMK A;  4XE9 A;  1CX4 A;  3HWJ A;  4WVM A;  4CDU C;  2JE8 A;  4DOU A;  1DYP A;  1KQR A;  1PVC 1;  1NA1 C;  1VPH A;  2VG9 A;  4GH4 A;  5LK5 A;  5A1A A;  3JB8 A;  2BQP A;  1TMF 3;  3WCR A;  1JOJ A;  2VUD A;  3I54 A;  4Y3O A;  1ZZC A;  4IE7 A;  1L7R A;  2JDP A;  2JIG A;  4YW2 A;  4QQO A;  4PLO A;  3ZXK A;  4IGQ A;  2E31 A;  5C4W A;  4RHV 3;  1QDC A;  4MV2 A;  2BEO A;  1CJP A;  4TTG A;  1RUE 3;  2Z5W A;  3LAG A;  1DBN A;  4L92 A;  4UFK A;  1VBC 1;  3PVE A;  4DUX A;  2WZR 1;  2VAU A;  2QCS B;  3EYP A;  3MW2 A;  4QT6 A;  5AVP A;  3J8F 1;  5B4X A;  3GBW A;  5HBA A;  1AX1 A;  3AZX A;  2MPF A;  2WKK A;  4D3W A;  3WNK A;  4FP3 A;  1MEC 3;  4ASL A;  3PHM A;  1JU3 A;  3IM0 A;  4NRM A;  1PM4 A;  3RYR A;  1UQX A;  4F7Z A;  2X10 A;  2RMU 2;  3THC A;  1ALY A;  2ZAH A;  4IW3 A;  2H6B A;  3N9L A;  4YLZ A;  4FAG A;  3HJR A;  4JKK A;  2BER A;  3QH7 A;  4BJ0 A;  3OGG A;  1GV9 A;  4GJZ A;  4JRL A;  3APB A;  1MS5 A;  3VDD C;  1ZYB A;  2QFE A;  4XBN A;  3TYJ A;  2VZS A;  4I30 A;  4IEZ A;  1W3X A;  4Q4Y 3;  5C5U A;  3RJR A;  5IFP A;  1HJF A;  4GXL A;  2XL7 A;  3E6C C;  2Y6G A;  5IVV A;  3CBN A;  4HK9 A;  1H9W A;  5FIX A;  4K1Z A;  2GNT A;  2XJV A;  2JE9 A;  3HNY M;  2LM3 A;  5EJZ B;  5DUV A;  4WVZ A;  3B02 A;  1AYN 1;  1HRV 3;  2I45 A;  1ENS A;  3UKV A;  3VHP A;  4LO8 A;  4LOS A;  1SMV A;  4GB3 2;  4MGT A;  4FPG A;  4Y1Y A;  4Y5Z 0;  2Y6H A;  4YWA A;  5ACA 3;  2D6O X;  2A6Y A;  3FZ3 A;  2OYZ A;  1KGY A;  2D93 A;  2GNM A;  1YCI A;  2HWD 2;  1DQ6 A;  2PHR A;  2EID A;  1BMV 2;  3KV9 A;  4WVV A;  4C0B A;  1ND3 B;  2BDR A;  4Q4X 1;  2BUK A;  1V6M A;  5ANN A;  1HXS 3;  4W4Z A;  5HV4 A;  4FPF A;  1LCL A;  4OZO A;  4LO4 B;  1LEM A;  1W39 A;  3H8U A;  5LAS A;  5FZK A;  1SBF A;  4EZH A;  3HN3 A;  1QY4 A;  2ETE A;  3I3M A;  4XTM A;  1RMU 2;  1NT0 A;  2A6Z A;  4YYO A;  3RZL A;  4JGY A;  4ATF A;  3LOB A;  2VZ1 A;  3WNP A;  3O1U A;  1PMI A;  2PHF A;  4QPI C;  2RM2 1;  5F5Q A;  4KNC A;  3F2Z A;  5C6C A;  5HV0 A;  5L7O C;  3GJA A;  3HMY A;  1YQC A;  4CCE A;  2D98 A;  4IXL A;  5A32 B;  1OI6 A;  4Y4R A;  4JVA A;  1SLT A;  1HN1 A;  4TLF A;  1FPN 2;  2J42 A;  4O9E A;  5JI9 A;  5L9R A;  4KL1 A;  4BIS A;  4WZF A;  5I0T A;  5KHI A;  4NJ4 A;  4IQP A;  3T2Q A;  2BZD A;  4LR4 A;  2WYS A;  2GC1 A;  4HK8 A;  4NHX A;  3ASI A;  3VKM A;  2VZQ A;  2JG9 A;  4U36 A;  1W9W A;  3DPR A;  4CDU B;  3PUH A;  2FD8 A;  4A2U A;  2QVS B;  1OKQ A;  1PX4 A;  2V5D A;  4W6Y A;  5FKC A;  1UW8 A;  4HFS A;  1AJK A;  2WN2 A;  1GWM A;  2EXK A;  4EYU A;  2VMD A;  2QDN A;  1Z0H A;  4ZHN A;  2IZW A;  1Y4W A;  2VME A;  2WFF 3;  2BBV A;  4YW3 A;  4KWL A;  4FXK B;  4XQD A;  3RGB A;  4CXY A;  4ET7 A;  1K45 A;  1NE6 A;  2R07 3;  4AED B;  1NLS A;  2ZML A;  3FLT A;  3NAP B;  1SFY A;  1D4M 1;  2VVD A;  2VOK A;  5DPN A;  3B9C A;  5G05 L;  4UBG A;  3VL9 A;  1VAL A;  4YVS C;  3ITQ A;  4UBH A;  3MIG A;  2A71 A;  1Z7S 1;  1HB1 A;  1LOB A;  3E1F 1;  2WT0 A;  4MGK E;  1V6N A;  1WD4 A;  3LQC A;  4WM7 A;  1B35 A;  1RVF 2;  4ZU5 A;  4BQW A;  3WF4 A;  1OA2 A;  3WV6 A;  2E33 A;  1H6Y A;  3CJX A;  3SC7 X;  3ZKU A;  1AYM 1;  2VQT A;  4BB3 A;  4E4H A;  2EA7 A;  3NNF A;  3SXW A;  1PO2 2;  1QJU 1;  3M70 A;  1ZZ9 A;  3ZPO A;  2A3X A;  1KDM A;  2ZS6 B;  3JD7 3;  4HKL A;  1VBC 3;  5CFD A;  3RI8 A;  1VR3 A;  4RL7 A;  3K51 A;  1T6G C;  3N36 A;  1PX3 A;  2WZR 3;  2YXS A;  2SBA A;  4UWD A;  1AX0 A;  3J8F 3;  4K40 A;  4N43 C;  1X36 A;  5K0U C;  3D6E A;  3HQR A;  3R0R A;  1GWL A;  1QXP A;  1RJ7 A;  2SLI A;  4UF0 A;  2PXJ A;  3RJ2 X;  5F37 A;  1H2L A;  4FQZ A;  2JG8 A;  1QJZ A;  2FMY A;  3KCX A;  5DUU A;  1JH5 A;  4XF0 A;  1Y9G A;  5AC9 3;  2BPA 2;  3ECQ A;  5BNO A;  1GSL A;  1WCU A;  1YQ6 A;  2IFR A;  3OY8 A;  1RUC 2;  2TUN A;  4GWM A;  4B1M A;  2HWB 2;  3OGR A;  1US3 A;  2YG0 A;  3HIF A;  4H7M A;  4IEU A;  4QGL A;  4EN7 B;  5JMO A;  5FUI A;  1FV2 A;  2CSG A;  3AJZ A;  1DP0 A;  3PL0 A;  2EIE A;  3VDA A;  5J1X A;  4LXL A;  1TME 1;  2HWF 2;  5A7N A;  1H4H A;  2R7E B;  2IXL A;  5FY4 A;  4QU2 A;  5EHD A;  4CP0 A;  3I49 A;  2RDR A;  5IUQ A;  5C8W A;  5LA1 A;  3I2K A;  2MEV 1;  4MVT A;  3MIH A;  1R08 3;  4QPI B;  1LOG A;  2A5Z A;  1HQL A;  1C8M 1;  1H4G A;  3SH4 A;  4PQ9 A;  2R6Q A;  5JXJ A;  5L7O B;  1NOV A;  1W8H A;  4FQ4 A;  3LEK A;  4AI8 A;  2OW4 A;  3C2U A;  4OVE A;  1NAE A;  3VN4 A;  5ERL A;  5LBC A;  3NL1 A;  4BQY A;  5A7W B;  1K12 A;  5LRR A;  5C8C A;  3AP4 A;  4LEJ A;  1C28 A;  1FNZ A;  4Q4X 3;  2ZXQ A;  1MAC A;  4IL7 A;  5C7G A;  4QPG C;  4FFG A;  3SLI A;  2LS6 A;  1XNC A;  1OLQ A;  1XNT A;  3QD6 A;  3ZVX A;  4JTN A;  1Q8O A;  1VAM A;  2XJR A;  3O0W A;  3AKQ A;  3UES A;  1DQ5 A;  2RS5 1;  3WR0 A;  4CUG A;  4XDP A;  3VBR C;  4YSF A;  2WO7 A;  2RM2 3;  1CAX B;  4BXS V;  1SBE A;  2QQM A;  2AEN A;  2F17 A;  4IV3 B;  2WA3 A;  2J22 A;  3B01 A;  4Z1V A;  2HWE 1;  3HOB A;  3WG2 A;  4B4Q A;  3MBW A;  4IGO A;  3GGL A;  2AYH A;  1JS9 A;  4CEY C;  2IXC A;  4OMC A;  5FZA A;  2EAA A;  1HDK A;  2X8K A;  3D0S A;  5T5L A;  4CU9 A;  2JD9 A;  3OB8 A;  3K75 B;  1ZZ7 A;  4ZS3 A;  5FZM A;  2FDH A;  4Q5O A;  2JDY A;  1NLR A;  3AK0 A;  4J1X A;  5A3W A;  4W6W A;  1X9P A;  2AC1 A;  2GN3 A;  2ILM A;  4RR3 B;  4OHY A;  2WZ8 A;  3LE0 A;  2ZKN A;  3POY A;  2YBK A;  2CWM A;  4L99 A;  4XHB A;  3ACG A;  3E6D A;  1UU6 A;  2J1E A;  1I6X A;  4WVW A;  4YGD A;  4RHV 2;  5FKB A;  4CA9 A;  5LA2 A;  4FFI A;  4GQ7 A;  1ZA7 A;  3ZO0 B;  1RUE 2;  3O0V A;  1X8M A;  2LUW A;  3FMG A;  1XBF A;  3VD5 A;  2RJL A;  2Y34 A;  4QX8 A;  2VL4 A;  4M4P A;  4RS5 B;  2HWC 1;  3MID A;  4FAH A;  4MG2 A;  1UY3 A;  4NUB A;  4N43 B;  4DNY A;  5JI7 A;  2GAL A;  2VBB A;  3GYD A;  1IKP A;  5BNQ A;  1SPP A;  2FCU A;  3ZPY A;  4ZY9 A;  2YPJ A;  2WNU A;  2ES3 A;  2G9Z A;  3F95 A;  1Z7S 3;  1MS8 A;  5FPB A;  4Q4W 1;  3USS A;  3SKJ E;  4UOJ A;  1UY2 A;  1N47 A;  3ZFE C;  1AYM 3;  4COW A;  1S4C A;  3GNE A;  3L9J T;  5F5C A;  3THP A;  3UYJ A;  3VB9 A;  3ZXJ A;  2IVJ A;  1SLC A;  2DWR A;  5FP8 A;  5JZG A;  3D0J A;  1IPS A;  2W46 A;  3KVB A;  1JOB A;  3CLP A;  2AZ5 A;  2WDB A;  4FOQ A;  4K6B A;  4MET A;  4PI0 A;  1WCS A;  4MUV A;  1EUT A;  3S57 A;  4DMI A;  5H9R A;  2E26 A;  2ARB A;  2DBN A;  2Y6J A;  2R49 A;  2ZHL A;  5EWS A;  5KXD A;  2OZJ A;  1AXZ A;  2VNR A;  3H3L A;  3MGU A;  4Q4Y 2;  4CCL A;  2A7A A;  1UU5 A;  1FOD 3;  5H9S A;  2VM9 A;  1X7N A;  5GLT A;  1GZW B;  4UI9 L;  3KCY A;  4C91 A;  1A34 A;  3M3C A;  2W1U A;  3FJS A;  3N3H A;  5FZ9 A;  1NCR C;  3H7J A;  1I5P A;  2JEC A;  1XE7 A;  4ONU A;  1AL2 3;  3W5M A;  4LE3 A;  1YEW A;  3VZL A;  4GUL A;  1K42 A;  4LIU A;  2F4P A;  3LWC A;  4AHW A;  4CU8 A;  4QPY A;  4NHM A;  3AXD A;  4H2A A;  4DUW A;  3DL3 A;  3ZXD A;  1BMV 1;  1RUH 3;  2GAU A;  4B29 A;  4F83 A;  5F9T A;  1DDL A;  2RS3 3;  1XQN A;  4M3C F;  5ACA 2;  3ZMN A;  3I3B A;  1YI7 A;  1ULE A;  1OUX A;  4S2H A;  2WC2 A;  4XXP A;  2CGN A;  1WCK A;  5FLI A;  1X9T A;  4NHL A;  1CPN A;  4WZC A;  1HXS 2;  3V64 A;  1LTE A;  1MZ5 A;  1K5M C;  1QF3 A;  3WG1 A;  2DCK A;  4Y4Y A;  1W6Q A;  3C7F A;  3ETQ A;  4AVS A;  1I3H A;  1XYP A;  5D8A A;  4N9H A;  4QXC A;  1RUD 3;  5J48 A;  2CWS A;  3VBR B;  1C5H A;  3MEP A;  3SCF A;  3G7D A;  3D4K A;  5IW0 A;  3M8L A;  4PBP A;  1S0D A;  1SLB A;  3SMH A;  1AR7 2;  2D6P A;  1DZQ A;  4BPZ A;  5C70 A;  4D6R A;  3ZFG A;  5HPO A;  1JZ7 A;  1JYX A;  1FPN 1;  1JUI A;  1UKR A;  3IPV A;  2WWJ A;  2YPD A;  5FY8 A;  1OQE A;  1H6X A;  5I0U A;  3KV5 A;  3PUA A;  4FPC A;  4BMB A;  3PTY A;  4MGI E;  4HKW A;  2VH9 A;  2FZ2 A;  2JDA A;  3ZYG A;  5EIY B;  3I59 A;  5JPM B;  4M3C A;  1H1A A;  4LUM A;  5FJH A;  1GNZ A;  4Z8B A;  1ND2 A;  1F9K A;  4LBJ A;  2RJK A;  3AKR A;  1KS4 A;  4AGV A;  4XCB A;  3UET A;  4PLM A;  3ZDV A;  4KWK A;  4NPM A;  3III A;  2EXH A;  1ULO A;  3K46 A;  1DYK A;  3D8C A;  4BYY A;  1IPK A;  5IYY A;  2IXJ A;  1Q8P A;  4OHV A;  2WFF 2;  3LA3 A;  1O3S A;  4GMP 3;  5F2S A;  4DQA A;  1QNW A;  1N3Q A;  4OUL A;  4XOG A;  2QQU A;  4AG4 A;  4URT A;  1JHN A;  3WW4 A;  2ZCW A;  2XGX A;  3WDT A;  3NV1 A;  4UFL A;  2OPK A;  4AAP A;  1BEV 3;  4KG8 A;  3POI A;  4BQ1 A;  3V0B A;  5HCH A;  3OGJ A;  1OPM A;  1X82 A;  1F4H A;  4QX0 A;  1OOP A;  1RVF 1;  4Y1X A;  4OHW A;  4CU7 A;  3MLK A;  2GN7 A;  5FP9 A;  1LB2 A;  4ARY A;  3RMY A;  2DF7 A;  1EAH 2;  2JX9 A;  3KLS A;  3MLJ A;  1MQT A;  5FRA A;  1V9U 1;  3J7L A;  5E89 A;  3VBF C;  3ZFE B;  2I74 A;  2CU5 A;  1W6P A;  5FZC A;  1ENR A;  1JMU B;  4AVB A;  4XJ9 A;  1HRI 2;  1VB2 A;  2DCJ A;  2VZT A;  4HON A;  4HT1 T;  5FYT A;  3RZG A;  1X8E A;  1AR6 1;  1ZX5 A;  1RTV A;  1VBB 3;  3H9A A;  3QH6 A;  4GIQ A;  4K8R B;  4YGB A;  3WSO A;  4E8C A;  5L19 A;  1W8W A;  3CJI C;  4P9Y A;  2JDH A;  3INA A;  4FBF A;  5LW9 A;  3JD7 2;  4FFF A;  2HWC 3;  3WOG A;  3HEI A;  5IT6 A;  1QJE A;  2BOJ A;  2ZZJ A;  3NV4 A;  1W6N A;  4RFT 0;  5EV7 A;  3ZDS A;  4XIK A;  2XKP A;  3SIS A;  2KXL A;  1HV1 A;  5FRE A;  1WUV A;  5EJ3 A;  4Q4W 3;  4BE3 A;  2YBP A;  5J37 A;  1CR7 A;  1ASJ 1;  2DVA A;  4XF3 A;  5CB7 A;  4FPL A;  2HEY F;  4MGQ A;  4HN0 A;  1DZR A;  5FZO A;  3T09 A;  2BBA A;  1ZZ8 A;  5AC9 2;  3WQ0 A;  4BH9 A;  3RZK A;  4GZ9 A;  4ATE A;  1VP6 A;  4OMD A;  3B5L B;  1VRH 3;  1ZRF A;  3BOW A;  5C9A A;  1LU2 A;  2VTX J;  5FPU A;  3IB3 A;  4LBQ D;  3K3N A;  2WL1 A;  3MFC A;  2WO3 A;  2ZHM A;  5JXH A;  1QOT A;  3OF1 A;  3OBR A;  2J1T A;  2W3J A;  2NMO A;  1WMX A;  5E8A A;  3LB9 A;  3OSD A;  4JGY B;  1D4V B;  3U78 A;  3OBA A;  4ZZ8 A;  3ZYB A;  1QH6 A;  5DG2 A;  3ZR6 A;  4QAW A;  3U4S A;  5I8S A;  3NJX A;  4C0H A;  4QXK A;  3LPG A;  5EYX A;  5J98 B;  1GOF A;  4XUT A;  3ZSK A;  1WW4 A;  4LUL A;  3ZXE A;  3O1V A;  3MW4 A;  2J1R A;  5EZW A;  1J59 A;  1YC6 1;  2IXH A;  2NN8 A;  2Q4S A;  3ALQ A;  5T54 A;  1IPJ A;  1HB4 A;  5FY9 A;  5C8C C;  1UAI A;  2JDU A;  5FZH A;  2VQU A;  2C1F A;  3AB0 A;  3Q8E A;  4NAM A;  3DPR B;  4IV1 C;  1ZVF A;  2WT2 A;  2ZGS A;  4B7E A;  4EWD A;  3W58 A;  5M0T A;  1OBN A;  2XLA A;  1QJX 1;  2TBV A;  3I3E A;  2D44 A;  4MGZ E;  3BI3 A;  4A7Z A;  1EV1 1;  3NQH A;  5LY1 A;  1F8V A;  4EZ4 A;  2P4E A;  3L2Y A;  1YLL A;  5FOJ B;  2XWJ B;  4P9J A;  5FOB B;  2B4K A;  5FCC A;  4ZS2 A;  1LOA A;  1YFU A;  2VNO A;  4LA3 A;  1F15 A;  2X5I C;  3AL5 A;  2CNA A;  2ZBJ A;  1RUG 3;  4QX2 A;  1O3T A;  1SLL A;  1PM7 A;  4EQV A;  3VZJ A;  2V4A A;  3U75 A;  1ZRD A;  3QBQ A;  4KI5 M;  2B8M A;  1Q8V A;  3J26 N;  3HAG A;  1XE0 A;  5IVC A;  3FFQ A;  5DDJ 3;  4C1W A;  3GXU A;  3VGI A;  3I8T A;  5FYZ A;  1IS3 A;  3H3Z A;  2QQN A;  2BP6 A;  3GJB A;  3WX5 A;  5A3L A;  2VMH A;  3MDP A;  1KFU L;  4GWN A;  2PAK A;  3T0A A;  2IVI B;  4XZU G;  4Q4V 1;  4JRA A;  3WQ1 A;  5LBF A;  2IXI A;  5GKA C;  1QU0 A;  5C33 A;  3VBF B;  1POV 1;  2JIJ A;  1H8T A;  5DZE A;  2WLQ A;  1YIF A;  2W0X A;  5FBZ A;  5C5T A;  4WM8 A;  5CFD B;  2ZAC A;  4DUV A;  1N1Y A;  3IWZ A;  2ZMN A;  1FMD 1;  1S0G A;  3CJI B;  3IMN A;  4XFI A;  2R04 2;  1Y9Q A;  1BBT 2;  1UMH A;  1YJL A;  2FDK A;  3KGZ A;  2E6V A;  5F5I A;  3S5Q A;  3KS7 A;  2A6X A;  4NVP A;  1KEX A;  1OH3 A;  1W05 A;  1W2N A;  5E6H A;  1SG3 A;  1ODN A;  1V6L A;  4QWN A;  1AR9 1;  2VOX A;  4OI2 A;  3VBH C;  1AR8 1;  2VZO A;  3VBO A;  2P6H A;  4B4P A;  4ORF A;  4GKX A;  4K8F A;  1LHW A;  3S7E A;  4BCU A;  1EPW A;  3FX3 A;  1JYT A;  1FI2 A;  3OJB A;  2ZX0 A;  1S2K A;  5BNO B;  4CUC A;  4O7X A;  3OY8 B;  4YW6 A;  4F3J A;  2G9G A;  1V9U 3;  2XUE A;  3RPQ A;  4NN0 A;  4MXW A;  4MYE A;  5IK7 A;  1HB3 A;  2F4L A;  4DIN B;  5GZC A;  5A6Q A;  4GWJ A;  5BV6 A;  1QJF A;  1AR6 3;  2DYC A;  2QQL A;  3RDI A;  1RUF 1;  4FTB A;  4ZU7 A;  3NKG A;  1CIY A;  1Y7B A;  4QKF A;  1FT9 A;  1IHM A;  1UF2 C;  4AI9 A;  4YGC A;  3SH5 A;  4URA A;  3VDB A;  1UPI A;  1VBA 1;  2VJX A;  4LBQ A;  1W8T A;  4CDX C;  1PGL 2;  2GH2 A;  1NCQ C;  2VVE A;  4Q0U A;  2ZHK A;  4OUE A;  3ZR5 A;  1C1F A;  2E7Q A;  2ZGO A;  1GP6 A;  1ASJ 3;  4P5Y A;  1CAW B;  5JOW A;  3MUY 1;  4LOT A;  3WUC A;  4YRD A;  4NII A;  1A6C A;  3GBF A;  1AL2 2;  1APN A;  2BU9 A;  3KF3 A;  5D21 A;  3NJZ A;  4BQ4 A;  5C8C B;  2YGL A;  2ZPX A;  4QXH A;  4CDW A;  1LHV A;  1COV 1;  2WRA A;  2V73 A;  1DQ2 A;  1RUH 2;  2CY6 A;  1U5Y A;  5FMD A;  3O1O A;  3PLQ A;  2RS3 2;  3ME2 A;  4IV1 B;  4NOT A;  2C26 A;  3WD5 A;  3ZYF A;  4AI2 A;  4D94 A;  2XQR A;  1MZE A;  2E63 A;  4LKD A;  3DXT A;  3PUI A;  1ND3 C;  2QQW A;  3I7D A;  4MO3 M;  3WW2 A;  1LED A;  4RQP C;  4ZZ5 A;  2PMW B;  3QOP A;  1O8S A;  2DTY A;  3UGG A;  4GKY A;  2WLP A;  1YHF A;  4Y1U A;  3WIN E;  5J09 A;  4N7I A;  1AR7 1;  1RUD 2;  2P3K A;  3AFK A;  2X5I B;  4K20 A;  4CCD A;  5LCW L;  4ASM B;  1GQG A;  2B5H A;  2CTV A;  3TN9 2;  1EP0 A;  2E51 A;  1CD3 G;  3LZZ A;  1R09 1;  4NRQ A;  1PK6 C;  4OI1 A;  4MZU A;  5LB6 A;  3EMR A;  1LOD A;  2A6W A;  2JEM A;  4PLN A;  4FPY A;  3ZOI A;  3D5O A;  1IQD C;  2Y33 A;  3P5B A;  3AYD A;  2WS9 2;  1QJY 2;  4BIF A;  3BTZ A;  1EV1 3;  1JYC A;  2P1B A;  5FZ8 A;  1JZ6 A;  4ZPI A;  3ZYR A;  1WW6 A;  1CZV A;  4XAB A;  2WII B;  5FP7 A;  1JZ8 A;  1XU2 A;  4LOR A;  1RJ8 A;  3T1L A;  4XTP A;  5FYM A;  3DKW A;  3GZT B;  1O8P A;  2YHJ A;  4UAP A;  1ZBE 1;  3CZU A;  3E5Q A;  4XDO A;  1WGP A;  1QDO A;  2VNG A;  3AVS A;  1RC6 A;  5CZK A;  3PDQ A;  2VCB A;  2GND A;  5FY1 A;  3SQO A;  2OQ7 A;  2Q30 A;  3PVN A;  1LHU A;  1SPP B;  1Z78 A;  2H6C A;  3WT3 A;  2LAL A;  2WNU B;  5T52 A;  4XIL A;  1RIR A;  4YG3 A;  3VD7 A;  4AED C;  2PFW A;  3VBH B;  5KWR A;  5JAX A;  3NAP C;  1NYW A;  1BEV 2;  2R06 2;  2VGD A;  4UW5 A;  1UOJ A;  1XYN A;  1PZ9 A;  2DV9 A;  5FYS A;  2ZEY A;  3CKH A;  4YVW A;  1BQP A;  4LK7 A;  4NHY A;  3LOI A;  1OKO A;  1WLD A;  4K7J A;  2A6V A;  4LIT A;  3ELN A;  3ILF A;  1HN0 A;  1HRI 1;  3VD9 A;  1DGR A;  1Q5O A;  2VNV A;  3KT7 A;  1LHO A;  4C1X A;  3N35 A;  4UW3 A;  1H1M A;  2YC2 A;  4A3Z A;  4NRP A;  1RIN A;  4KU7 A;  3O14 A;  3T3Y A;  5B4N A;  5ISL A;  2RV9 A;  1VB4 A;  3HT2 A;  5FZE A;  1JZ4 A;  3SIT A;  3KT1 A;  3H0O A;  1IS5 A;  2VU9 A;  4LO7 A;  4OQ8 A;  3B3Q E;  2YU2 A;  4MGY E;  5FPV A;  3WY6 A;  4CDX B;  3I2F A;  1AR9 3;  1H9P A;  2VD7 A;  1NCQ B;  1HB2 A;  1AXY A;  4AHZ A;  1XND A;  3RZM A;  2C4X A;  4FVV A;  2RS1 2;  3TB0 A;  1FV3 A;  1POV 0;  1V70 A;  1I1E A;  1ACC A;  5IVJ A;  2DFB A;  5CEH A;  3U1X A;  3ZYJ B;  1GWK A;  1Q43 A;  4HXC A;  2DCY A;  2FCT A;  4QDS A;  4AGG A;  1KJR A;  2PAE A;  1OXC A;  5F3G A;  4COU A;  2P2K A;  1A78 A;  3IMM A;  2PLV 2;  2VMF A;  4UT5 A;  5IK4 A;  2P34 A;  4YZ3 A;  1OT5 A;  3H50 A;  5JR7 B;  1LGN A;  2XOM A;  5FWE A;  1TVG A;  1VRH 2;  5FPZ A;  4JAA A;  1IQA A;  4A44 A;  2JD4 A;  1C57 A;  4NO4 A;  3K77 A;  4QQL A;  1O4T A;  1W6Q B;  5CBL A;  1SBD A;  3PVO A;  5D8A B;  4EN8 B;  4ARX A;  4JV4 A;  1GNY A;  2VOV A;  4CP9 B;  2A1X A;  4RQP B;  3WNO A;  3AKP A;  1ZNP A;  1BVP 1;  1O91 A;  3ZN6 A;  3RZJ A;  3O1T A;  1VBE 1;  3IPV B;  3LEM A;  1ZZB A;  2AEZ A;  2BVB A;  5BPX A;  5JXI A;  1ZBA 1;  2ZJC A;  3ON7 A;  4R52 A;  2GC0 A;  2XHN A;  3N9N A;  3I59 B;  3RRD A;  4N9I A;  4M3C B;  1PK6 B;  4TLG A;  2NM1 A;  4XYX A;  5FBJ A;  1K3I A;  3JBG 2;  5DMY A;  1VBD 1;  1QQP 2;  3WW1 A;  4SBV A;  1JUH A;  1CJD A;  4LHS A;  4CEY B;  1YFY A;  1JYV A;  5DQ0 A;  2W08 A;  1BXH A;  3FHI B;  1PO1 2;  1EY2 A;  2O8O A;  3RVH A;  1W90 A;  1PIV 3;  2BVV A;  2D6K A;  4YZ2 A;  1RUJ 2;  2JKX A;  4FCA A;  4HOO A;  3EBR A;  2W91 A;  4OUS A;  1S2E A;  1W6M A;  4Q0Q A;  3TNP B;  1UL9 A;  5A3N A;  3CNA A;  2DCT A;  3M3O A;  4W50 A;  2CAU A;  2OZ6 A;  3TEZ A;  2WO1 A;  4IEX A;  4QQH A;  3LF7 A;  1W9F A;  1BJQ A;  3KHC A;  1GQH A;  3PMS A;  5AFE A;  4CDQ A;  3TAY A;  1LU1 A;  3ORJ A;  4JGZ C;  4UW6 A;  4NIA A;  4PF5 A;  2B9U A;  4XJ8 A;  2Q1M A;  1RUG 2;  4P9X A;  5FMC A;  5F2W A;  1R09 3;  2RVA A;  1WKY A;  4EV0 A;  3OYW A;  3V0B B;  3NMB A;  4IV3 C;  4LBM A;  3T0B A;  3KCC A;  4E8D A;  2K9Z A;  4G4F A;  1OD3 A;  1YNA A;  4PQQ A;  3OPW A;  4N8M A;  2O1Q A;  1RUI 1;  3NNM A;  2XVL A;  1IGO A;  2VZU A;  5DDJ 2;  1NXM A;  3AM2 A;  4BK5 A;  3HD8 B;  1W6P B;  4X6Q B;  5CU1 A;  2V4V A;  5D1I A;  2OII A;  2WO2 A;  1PVC 3;  1NZC A;  4L2N A;  4RYD A;  4I3P A;  2VMC A;  1G7Y A;  3BKZ A;  3ILN A;  4RR3 C;  2A75 A;  1ZBE 3;  4FXG B;  3ZLI A;  2R04 1;  4COV A;  1JHJ A;  1OH4 A;  5E16 A;  3WEZ A;  1W2T A;  3AZW A;  2WR9 A;  4LTA A;  1W6N B;  5JVV A;  1V0A A;  2C9K A;  1GNH A;  1K5J A;  1N1V A;  3AKT A;  3VBU A;  4AI3 A;  4CRQ A;  4DRR A;  5JWP A;  1WME A;  1SLA A;  1GOH A;  4RS5 C;  1P8J A;  4W6X A;  4YW5 A;  1GLH A;  4CP2 A;  3U4X A;  1G8W A;  4YZ5 A;  2GC2 A;  5CKN A;  3T0D A;  2DU0 A;  3JQX A;  5ABJ A;  5FZO B;  2RR1 1;  3ZFF A;  2AR6 A;  1CZS A;  3T2P A;  1W0P A;  3SCG A;  5DN2 A;  3ZSE A;  4HPK A;  3QAC A;  4E2S A;  4TWT A;  2BW8 A;  2QQP A;  1H8V A;  4IE0 A;  2B42 B;  1VAK A;  4A42 A;  1W8U A;  2ET7 A;  5C9A B;  2YRO A;  3AKS A;  3Q8F A;  4AEJ A;  2FDG A;  3KQR A;  4JZR A;  1RIT A;  2RHP A;  1W04 A;  1RHI 1;  4I01 A;  4G9S B;  1LOF A;  2YGM A;  5KXB A;  5LEJ A;  2XML A;  2X05 A;  1DHK B;  4FI9 A;  1R1A 2;  5K4L A;  3FFZ A;  2E32 A;  4PI2 A;  3ZKY A;  4OUM A;  3CF6 E;  5FZ4 A;  1WLW A;  2UWC A;  3RI9 A;  3L2H A;  5FZB A;  4CEW C;  3EHK A;  3UGH A;  4FPH A;  4N53 A;  4ZKT B;  3PIG A;  2EIC A;  5FO8 B;  4OI4 A;  4K9S A;  1UIK A;  1PMJ X;  2WNV A;  4NWV A;  4JKM A;  2DDU A;  5EQU A;  1YXW A;  3H1W A;  3NNG A;  3K4A A;  1YO8 A;  1QKQ A;  3EJK A;  4L9B A;  1KXG A;  5FXW A;  3WF1 A;  3ACL A;  3DN7 A;  2HBT A;  1CWP A;  2OKX A;  1AYN 3;  2NPI A;  1GAN A;  3ZXG A;  1XJA A;  3VD3 A;  3EXU A;  3FLP A;  4I0A A;  1W8N A;  4BDV B;  2D6M A;  1DQ1 A;  1ENQ A;  1A3K A;  3HBZ A;  1IOA A;  3S30 A;  3MLL A;  2BWC A;  2XJU A;  1JZ2 A;  2WYF A;  5FTT C;  4A41 A;  3BTA A;  4JHT A;  4DS0 A;  1LNS A;  4MOA A;  2XLG A;  5IK5 A;  4FT8 A;  1XYO A;  3OD4 A;  2RDQ A;  4BK4 A;  4H55 A;  1R1Z A;  1V00 A;  3TOJ A;  2NP0 A;  3OEA A;  3SCH A;  1VBE 3;  4XUP A;  1OF4 A;  4TZD A;  3BOP A;  1W9T A;  5GLV A;  1E5I A;  1ZBA 3;  1H2N A;  1PGW 2;  2HEV F;  2WZE A;  2YZ4 A;  4JGZ B;  3U07 A;  3U37 A;  3RYK A;  1ZA4 A;  1FNY A;  1ODM A;  4DXS A;  3BCW A;  2J1S A;  2A3Y A;  4QM9 A;  5C3Q A;  1VBD 3;  3ENR A;  2VMG A;  3WF3 A;  2RG4 A;  5A6Z A;  3R4D B;  3O1M A;  1IZ3 A;  1QJY 1;  4WBB A;  5BNP A;  1AX2 A;  3V56 A;  4JQR A;  3M2M A;  1GZC A;  4GH4 C;  4RSU A;  2ET1 A;  1H8T B;  2WQ8 A;  2C6S A;  2XBO 2;  4AGR A;  3I3Q A;  1W0O A;  5A1L A;  5HXM A;  3QLQ A;  1N3P A;  3MIF A;  5C4W C;  1W2U A;  3I2J A;  4O61 A;  1TMF 2;  1W06 A;  1YI9 A;  4Q0S A;  4AEM A;  4CU6 A;  2HKX A;  4GJY A;  4Y26 A;  1OLM A;  4KBZ A;  3PTR B;  3JU9 A;  3PNA A;  3DCQ A;  5CKQ A;  1QIQ A;  1VMF A;  4Q26 A;  4YG6 A;  3VBO B;  4COZ A;  5FQ0 A;  4EWE A;  4TXW A;  2R06 1;  5FY5 A;  2R0H A;  2VUJ A;  5H9P A;  2JE7 A;  1J58 A;  1D4M 3;  4LO5 B;  4S2G A;  2VOW A;  1E5R A;  3B69 A;  2GZW A;  4MXW B;  3Q8A A;  3PUR A;  5CAZ A;  1MVQ A;  1OF3 A;  2OXB A;  2ADD A;  5GLW A;  1JBC A;  1MEC 2;  3J4U H;  2RMU 1;  4ISR A;  4AXO A;  5K7P A;  1OA4 A;  4GAL A;  4OQ9 A;  2QJV A;  5GZD A;  5I0S A;  3OGV A;  2UYA A;  4B3N A;  5J3U A;  1QJU 3;  2VZR A;  3LPF A;  3ZXA C;  4CCJ A;  5LA9 A;  2AGS A;  2H0V A;  5I0D A;  3FHA A;  3IZO A;  4B1L A;  2W68 A;  3KV6 A;  3POJ A;  2DU1 A;  2GMM A;  2PQS A;  3USU B;  4MHU A;  4M4R A;  3VHR A;  4J1W A;  4Y22 A;  4CEW B;  3FHQ A;  2P5B A;  4RGG A;  3T2T A;  1KS5 A;  2D7F A;  4BQX A;  4UW4 A;  3PU3 A;  3VLB B;  1BKZ A;  2PHL A;  3X29 B;  3O7O A;  4XXA A;  2J1A A;  3N4M A;  5DAQ A;  1VAV A;  1QH7 A;  5L9V A;  1XC6 A;  2OPW A;  2PLV 1;  1UMZ A;  3A22 A;  4CDW B;  3WZ1 A;  1SDD B;  3ZMO A;  2YU1 A;  1UYY A;  4GB3 1;  2D40 A;  2IWG B;  4MLO A;  4BWO A;  3H8O A;  5FK7 A;  4JKL A;  2FBE A;  4F8A A;  1HRV 2;  4XFC A;  4A7K A;  2BNM A;  2WQ4 A;  2VBD A;  2YV8 A;  1UO9 A;  4P02 B;  2HWD 1;  2VUL A;  3K4Z A;  4PDW A;  5IHR A;  3BUC A;  3AZV A;  2ZAB A;  2C5D A;  3A7Q A;  1OMI A;  4FO9 A;  5A70 A;  2NMN A;  2Z69 A;  4HET A;  3T4V A;  1BZW A;  1KRI A;  2I07 B;  5A6Y A;  3O12 A;  3OG2 A;  5DAW A;  2CGP A;  1HQN A;  5FLH A;  1TME 3;  3S7I A;  3VBS A;  1V6O A;  2KD7 A;  4FTE A;  2H0B A;  1L7L A;  4KU8 A;  1D2Q A;  1QGL A;  4JGY C;  2WWU A;  1RMU 1;  5FZ6 A;  1S0E A;  4AR2 A;  3VZK A;  2MEV 3;  4AVC A;  1E5S A;  1ZRE A;  1S0I A;  5KHH A;  1C8M 3;  3JBG 1;  5F39 A;  1QQP 1;  3C7O A;  4YFW A;  4XUN A;  5FO7 B;  1KJL A;  5CFC A;  1F5J A;  1J1T A;  3NVC A;  4U2A A;  1YUD A;  1OFN A;  2AH2 A;  2IXK A;  3M3Q A;  4AVT A;  1ZRI A;  3DYP A;  1RUJ 1;  2JG9 C;  4WVM B;  2VW1 A;  5FLJ A;  3DPR C;  5A1F A;  2ZOE B;  4GH4 B;  3BPS A;  1VMH A;  1LHN A;  2XVG A;  3ACH A;  4PJY A;  1PIV 2;  5FZL A;  5JR2 A;  1QXR A;  3N7J A;  4XF9 A;  3ACI A;  2D6L X;  1RUO A;  2VUA A;  1YQ2 A;  4BQ5 A;  2TNF A;  5L73 A;  5C4W B;  4CDQ C;  1CGP A;  1GIC A;  1S0C A;  4QX1 A;  2RS5 3;  2YFU A;  3J9S A;  1JYI A;  1GZT A;  4XMA A;  4AZZ A;  3LEI A;  1DLC A;  4MXV A;  5FZI A;  3RSJ A;  4TN7 A;  4AHX A;  5KHJ A;  4NIG A;  3U14 A;  3C8X A;  2HYK A;  1XRU A;  3R05 A;  3MO4 A;  2HWE 3;  4XF1 A;  3H1M A;  4X8N A;  2R07 2;  1AHS A;  1D2S A;  1STM A;  5A32 A;  2BYV E;  3B00 A;  4DFS A;  2ZTN A;  3E97 A;  1WW7 A;  4DO0 A;  4WM7 C;  4CPB D;  3BU0 A;  2V5Y A;  1B35 C;  4YG0 A;  5CKM A;  4AOC A;  4AVA A;  1VRB A;  3DV8 A;  4LUK A;  1PHM A;  1WCQ A;  3WLU A;  1PVX A;  3KZ4 C;  1PVC 2;  1PO2 1;  5SV5 A;  3A23 A;  1NA1 A;  2PN5 A;  3TRS B;  4CUA A;  4W8J A;  5FZ1 A;  1WLT A;  4I0B A;  1XNK A;  5CFD C;  2ZX4 A;  4COY A;  1W8F A;  1E57 A;  4HG6 B;  2VZV A;  4DEV A;  2R1D A;  1OC1 A;  1TZO A;  3IT8 A;  3MV1 1;  4MHR A;  2VQ0 A;  4YZ4 A;  2BRT A;  4R4X A;  2WIN B;  5KXE A;  1VBC 2;  1QWR A;  5K9Y A;  3VDC A;  4M01 A;  2WZR 2;  3MFA A;  2YMZ A;  5EXO A;  1CAV A;  3J7M A;  3J8F 2;  1MS1 A;  2JG8 C;  4HAN A;  2WSU A;  2Q8D A;  1M4W A;  1W8O A;  2FDJ A;  3ZM8 A;  2P37 A;  2C9A A;  5BNO C;  5J96 B;  2Q8E A;  4ERO A;  1JW6 A;  3UGF A;  3KMH A;  3BN6 A;  2DBI A;  4IUG A;  3MIC A;  1RUC 1;  4LE4 A;  4PCR A;  4IES A;  2HWB 1;  3LD8 A;  4QGN A;  3PVB B;  4Z07 A;  5DUX A;  5FWJ A;  1QOO A;  1R1A 1;  5AFB A;  4UFM A;  3U0Z A;  5LRS A;  4AF9 A;  1XU1 A;  3ZIW A;  4SLI A;  1OVS A;  5FYV A;  1U5I A;  1VMJ A;  2D3P A;  2ZZQ A;  1GBG A;  2HWF 1;  2QQV A;  3VDD A;  1TE1 B;  3N9O A;  1I9R A;  2FHR A;  3ZN6 B;  2OVU A;  3PU8 A;  4HBN A;  4YM1 A;  4BU2 A;  4QPW A;  4LKF A;  3WCS A;  1Q3E A;  5JPN B;  1L7Q A;  5A33 A;  3KHB A;  2CL2 A;  3HNM A;  3ZSJ A;  3BTX A;  3IDC B;  1C5I A;  1J3P A;  4HL0 A;  4QKN A;  4TYS A;  4H7L A;  4EWA A;  1HJG A;  2A3W A;  3UV9 A;  5GZG A;  4GB3 3;  1R08 2;  3IDE A;  4YFZ A;  3VZM A;  2UUR A;  5JOX A;  2Y6L A;  4XFH A;  2ZA9 A;  3GAL A;  1WA4 A;  2YBS A;  3P3P A;  1ST8 A;  2A70 A;  4LNV A;  1F31 A;  1KFX L;  2Q0A A;  2Y64 A;  4E2Q A;  3RZZ A;  2JG9 B;  3HVD A;  4NPR A;  4Z2W A;  2NQY A;  2JJ6 A;  1NQD A;  3IAP A;  3I4I A;  2D43 A;  4Q4X 2;  4AI1 A;  5JXG A;  1G9A A;  5C3R A;  5HI0 A;  1GP4 A;  4FSJ A;  1UX6 A;  3NJV A;  2RJ2 A;  4E4Z A;  4CDQ B;  3GZA A;  4JDM A;  1UOG A;  2X53 S;  1PGW 1;  5FY0 A;  1KIT A;  2BFU L;  3VHN A;  3B9I A;  3E5X A;  4I0W B;  4XJW A;  2PHD A;  2JB4 A;  5JSO A;  2I2S A;  2LRO A;  2RM2 2;  3AL6 A;  3NKT A;  3ZN5 A;  1JYN A;  1FPN 3;  4QPI A;  2J7M A;  4JC1 A;  3WF0 A;  5DG1 A;  4Q1P A;  1HKD A;  3I2H A;  4IE5 A;  3T08 A;  5IK8 A;  1SCR A;  3LGR A;  3J7N A;  2VUC A;  2IFW A;  4WM7 B;  1TQ5 A;  3M3I A;  1B35 B;  2Y6F A;  1QMJ A;  1TG7 A;  5FXZ A;  1J1L A;  2ORZ A;  5DAX A;  4XCA A;  3ETP A;  1S1A A;  1UOF A;  2E53 A;  2PYT A;  3WHT A;  4CPB A;  1AXK A;  3HN1 A;  1WMF A;  4NPL A;  3UT0 A;  1OHF A;  4L0P A;  5I91 A;  3QCW A;  4XFF A;  2ZHN A;  4YW1 A;  2Q5T A;  4RGA A;  1F4A A;  4RHV 1;  4PT6 A;  1AZD A;  1QHD A;  4S2F A;  3R6S A;  3VBU B;  1RUE 1;  4AL9 A;  4D69 A;  5C3P A;  1M06 G;  2AEY A;  2VY0 A;  1PZ7 A;  3OEB A;  3W5N A;  2DUO A;  3LIH A;  1CAX A;  2ADE A;  2ARC A;  2DCZ A;  2ARX A;  3AMM A;  2Z4F A;  5FZG A;  3ZXF A;  2E9Q A;  2ENR A;  4LHK A;  4UF0 B;  4PF1 A;  2WNU C;  5ABJ B;  3ZFF B;  3OCP A;  2XB6 C;  1D4M 2;  2JG8 B;  5A7Q A;  1WW5 A;  2Q1F A;  1RVF 3;  2AUY A;  4IGP A;  4KGQ A;  3U10 A;  3PUQ A;  5C3S A;  1US2 A;  2EIB A;  3GM8 A;  4YVS A;  1OVP A;  1Z7S 2;  2YFZ A;  1G9D A;  3KD4 A;  3W59 A;  1UXX X;  5JZG C;  3EO6 A;  4Q2F A;  4E4D X;  3GDB A;  4CVU A;  1AYM 2;  1QJU 2;  4LHL A;  4IER A;  3LCP A;  2VMI A;  1W2O A;  4XJU A;  4XQ4 A;  3ACF A;  2NLR A;  2R32 A;  3WG3 A;  4AFD A;  2FCV A;  1D0G A;  3NNJ A;  2Y38 A;  4P08 A;  1LEC A;  3OBT A;  4V2V A;  1FAY A;  4BLJ A;  3IN9 A;  1RXF A;  4O65 A;  2R30 A;  3KT4 A;  4Q4Y 1;  3HT1 A;  1C1L A;  3O5S A;  2W1W A;  2Q8O A;  3TWI A;  4A7Y A;  5JMC A;  2GC3 A;  1YRZ A;  4N43 A;  4D7T A;  5K0U A;  3O1R A;  1FOD 2;  2WZP P;  1DYO A;  1HW5 A;  1LGC A;  3RWN A;  1UNB A;  2BGO A;  4ZU4 A;  3MUZ 1;  4ZON A;  1W03 A;  4JCK A;  2BJS A;  2HWB 3;  2VZP A;  2W87 A;  4M0H A;  4NRO A;  5FP3 A;  1O4Y A;  5ACA 1;  4AK3 A;  1GR3 A;  5FDB A;  3UNP A;  1DGW A;  4QDR A;  5IVY A;  1O7F A;  2VW0 A;  5D2A A;  4CXW A;  4DY3 A;  2HWF 3;  1HXS 1;  4YM0 A;  4P9I A;  4Y5S A;  4B7K A;  5FXX A;  5E1R A;  5D8A C;  5EJ1 B;  3NV3 A;  1UU4 A;  5DXD A;  2EIG A;  4P9L A;  1TME 2;  2WAA A;  5GJ6 A;  3B7M A;  4LT5 A;  1OQD A;  2WJS A;  3VKO A;  2ATF A;  3I97 A;  2EXI A;  3VZN A;  1Q8S A;  2MEV 2;  4QX5 A;  1GZW A;  3W20 A;  2FZ1 A;  1OLR A;  5T3N A;  4XVH A;  3P6B A;  1C8M 2;  1O6U A;  1W6O A;  1HIX A;  2P17 A;  2EAK A;  2WNO A;  4LBN A;  3TNQ A;  5BNP B;  1W28 A;  5HXV A;  3ZYH A;  4MH0 E;  1ND2 C;  2Y8K A;  3AMN A;  2V09 A;  2JIC A;  2BNN A;  3AP6 A;  1RGS A;  4XBQ A;  1QJX 3;  1UIJ A;  3P1I A;  5CG9 A;  2W39 A;  2XJS A;  1LGB A;  4CCM A;  2BOI A;  1UZV A;  4QPG A;  4G3Y C;  4V1P A;  4YGE A;  2XHK A;  4GD4 A;  5LZ6 A;  2KA3 A;  2Q1Z B;  4YAR A;  3EQE A;  3NWK A;  1O4Z A;  5HCB A;  2B39 A;  5CG8 A;  2W52 A;  3VKF C;  5FQ0 B;  2RS5 2;  2WFF 1;  4FFH A;  1CVN A;  4V2W A;  4IEO A;  3VBR A;  3BU7 A;  5KC6 A;  1SZB A;  4R4Z A;  4JHZ A;  4YM3 A;  3MPB A;  2R07 1;  1EYB A;  1G6N A;  3OUH A;  3ZN4 A;  4KBB A;  1ZRC A;  1V6J A;  3RG0 A;  2CAV A;  2HWE 2;  2P3J A;  1OOP C;  3MV0 1;  3AJY A;  4R9C A;  2GP3 A;  4WV8 A;  5EPA A;  2C24 A;  4N7U A;  1DLL A;  5FUP A;  2WA4 A;  2VBP A;  4CEY A;  1ULG A;  3T4H B;  1IS4 A;  2BGC A;  1MQT C;  1UCX A;  1URX A;  1EAH 1;  3A0N A;  2AAC A;  2BGP A;  1RL3 A;  2WAB A;  3FC0 A;  4Q4V 3;  3OOX A;  3MF6 A;  2VZ3 A;  1POV 3;  4P00 B;  5JZG B;  2ZGK A;  1CX1 A;  3JZV A;  1BHG A;  1OA3 A;  4JQT A;  3NV2 A;  5I93 A;  3N7L A;  4ISQ A;  1CZT A;  4FPE A;  4Y22 B;  1FMD 3;  4OCT A;  3LA7 A;  1VBB 2;  1D7P M;  1XSR A;  3D82 A;  3JD7 1;  3KB5 A;  5BUV A;  5FPX A;  2WT1 A;  1QNY A;  4IE4 A;  3VD4 A;  2VTX A;  4BOW A;  5BYN A;  3BPZ A;  4QB6 A;  4B4R A;  1MZ6 A;  1XNB A;  1JTZ X;  4Q0P A;  2ZAA A;  3Q9O A;  1CES A;  2HWC 2;  4A4A A;  2DVD A;  2XVK A;  1AR8 3;  3BGA A;  3HR9 A;  4AFC A;  1O5U A;  1A8M A;  4PHZ A;  5FYU A;  2LRP A;  1W9Y A;  2K46 A;  3PME A;  2YYO A;  2XQX A;  1IG3 A;  3UK9 A;  3AMP A;  2QZ3 A;  4Q4W 2;  4PDW B;  3ROU A;  2W5F A;  1F2N A;  2QDR A;  5AC9 1;  1S55 A;  3G6J B;  1DFQ A;  3SKV A;  2WSV A;  3ILR A;  2ZGM A;  4LKS A;  1H1I A;  3VHO A;  4A6O A;  3GF6 A;  1WMD A;  3ZFE A;  5C9A C;  1RUF 3;  2VVF A;  2R0F A;  3H1Y A;  2PHX A;  2QQO A;  3VKN A;  2OX0 A;  3R4S A;  4NIH A;  4H14 A;  1CAU A;  2FQP A;  4HVO A;  4PIZ A;  5FMB A;  3VBS B;  1SEF A;  2ARE A;  5FYH A;  3OPZ A;  2FDF A;  3RS6 A;  2YB7 A;  1VBA 3;  1Y3T A;  4TSV A;  4DZG A;  4I09 A;  4XF4 A;  5K8S A;  3KV4 A;  1TNR A;  3WNM A;  2HYX A;  1T2X A;  4CXX A;  2KM2 A;  4QM8 A;  1DGR N;  4L97 A;  2ARA A;  3B94 A;  2P6C A;  1R08 1;  2VE1 A;  4QXB A;  1Y9M A;  5CFC B;  3H8X A;  4Q29 A;  1T6B X;  1B09 A;  1NCR A;  2JKB A;  3T2O A;  3A0K A;  4DEQ A;  2K0G A;  3RMX A;  5A3T A;  1COV 3;  1ND2 B;  3OUJ A;  1UZW A;  2W95 A;  2X29 A;  2DVG A;  4LK6 A;  4ZXE A;  1A8D A;  4AE2 A;  1NKG A;  4FP2 A;  4CYD A;  5A7O A;  3JCI A;  3OD0 A;  4QB2 A;  1OD5 A;  2JDM A;  2RDS A;  5F3I A;  3VZO A;  3K2O A;  5JSP A;  3CQO A;  4Z92 B;  2Y60 A;  1JZ5 A;  3LIG A;  3KQ4 B;  2L9L A;  1DQ4 A;  1VLN A;  1K5M A;  4QDQ A;  3GCX A;  1AR7 3;  3V65 A;  3Q8B A;  3PJQ A;  3C7E A;  3E6B A;  1G9B A;  1R64 A;  3LSE A;  1JOP A;  3POW A;  4AAX A;  2R1B A;  2B7Y A;  2CYF A;  2JXA A;  2MNG A;  2QQK A;  4L11 A;  1W9S A;  4FOY A;  4BM8 A;  4HMZ A;  1OOP B;  5LAT A;  3C3V A;  1MPX A;  5CNA A;  3V0A A;  1RYY A;  3FL7 A;  4YM2 A;  3CL1 A;  5F6L B;  1MQT B;  2OA2 A;  3M4F A;  2Z42 A;  4HZF A;  5EYY A;  1NA1 B;  3ZSL A;  1H8T C;  1DGL A;  2VR4 A;  4QU1 A;  4AFM A;  2E7A A;  3C7G A;  4WM8 C;  2ZX2 A;  3M3E A;  4XUQ A;  1U5X A;  1SAC A;  2EVX A;  4YPJ A;  1REF A;  1JXN A;  4C90 A;  1DG6 A;  1BBT 1;  1ULD A;  2EXJ A;  3IAQ A;  5BNN A;  1SCS A;  3PUS A;  3WDW A;  2ZGU A;  3RFR A;  5A3M A;  3I2O A;  1CAV B;  4NR1 A;  5A80 A;  1BK1 A;  4JTO A;  4R9B A;  1E5H A;  4UXA A;  3VBO C;  3SEE A;  5F7U A;  1UWW A;  1MS9 A;  3VL8 A;  2WFP A;  2D3R A;  1EUU A;  5F1R A;  1YFX A;  4Y20 A;  4AQ6 A;  1EAH 3;  3FWE A;  4P9G A;  1FAT A;  1ULC A;  3LDK A;  2D5H A;  4H3W A;  3WQ7 A;  2FDI A;  5JOY A;  4Y5T A;  2XR4 A;  4CCC A;  3HPN A;  1HRI 3;  4P14 A;  3DKQ A;  5T55 A;  1XXN A;  1LKN A;  2VEC A;  3WF2 A;  1V9U 2;  2YDE A;  3VBF A;  2Y6K A;  1AR6 2;  4E9K A;  2QNK A;  3MI8 A;  3N7K A;  2GU9 A;  2OT7 A;  3VDD B;  3B93 A;  2B9V A;  3POB A;  2C0Z A;  5FMO L;  1UYX A;  1YWK A;  3CJI A;  3POG A;  4QKB A;  4DPN A;  5A33 B;  2PQQ A;  2PEL A;  4YZ1 A;  5LEK A;  1PGL 1;  4E27 A;  1C3H A;  3BIE A;  1UX7 A;  2YUE A;  1S0F A;  2RDN A;  1FOD 1;  3CZJ A;  3M1H A;  3ZX7 A;  1WZX A;  3DEC A;  5IVE A;  3WP4 A;  2Y26 A;  3WUD A;  1SFN A;  4IEV A;  4I3G A;  5ANQ A;  2RE9 A;  4IND A;  1YQ5 A;  5FZD A;  1KDK A;  5J7M A;  2WQZ C;  2VXR A;  1NLQ A;  1AL2 1;  1ASJ 2;  4RGK A;  3MPP G;  3ZSM A;  1SQ4 A;  4CDW C;  3WDU A;  2NZ9 A;  2VPV A;  1RUH 1;  3OPT A;  2GH8 A;  3WQB A;  4CCO A;  1XB9 A;  1GMM A;  1LJ7 A;  2RS3 1;  2VW2 A;  2ZGL A;  4ES9 A;  3BTY A;  4DRV A;  4FPK A;  4OYU A;  3POE A;  4BHP A;  1NXD 1;  4OHX A;  4CSW A;  1UXZ A;  3OTF A;  2BV4 A;  1X33 A;  3AVR A;  2WAO A;  1DQ0 A;  4IEP A;  1H0B A;  2ZGQ A;  5B2G B;  4QD2 A;  2O0O A;  5FUN A;  3ABZ A;  3MIB A;  3I2G A;  5A7S A;  3RZH A;  3CEW A;  1XPW A;  1RUD 1;  1RB8 G;  1MR5 A;  3ES1 A;  3KGL A;  5KHK A;  3TN9 1;  3A21 A;  3ZXL A;  3TEX A;  1AL0 G;  2NYY A;  2W1Q A;  1CAW A;  1YIP A;  1WCD J;  3WP3 A;  5FK8 A;  1WD3 A;  3I2I A;  1C8N A;  4O9G A;  2WS9 1;  3FBY A;  4P9W A;  4EN0 A;  3VUO A;  4AFB A;  1XSQ A;  1SDW A;  1NZI A;  4XHX A;  3N9P A;  3AXE A;  4LMF A;  3JQW A;  4YNI A;  4IV1 A;  2W47 A;  1QJX 2;  2DTW A;  3D3A A;  1C4R A;  3PJY A;  4S2D A;  4XAE A;  3UJO A;  1EV1 2;  1UY1 A;  2XWB B;  1LAJ A;  2XJP A;  4WM8 B;  3O1P A;  2V72 A;  4L8Q A;  4FOV A;  5GZF A;  5IAX A;  1AUY A;  4J6G A;  3DF0 A;  4DIQ A;  3OBZ A;  3LDB A;  4UFJ A;  5CAD A;  5JSR A;  4EN9 B;  4GMP 1;  4LJH A;  3SH3 A;  1OUR A;  1CIW A;  1VE0 A;  2QE3 A;  2X5I A;  4BZ4 A;  4RFR B;  2IC1 A;  1SFP A;  2YC0 A;  5E88 A;  4YW4 A;  5FP4 A;  4DXZ A;  4I2O A;  2JDZ A;  5FAX A;  1BEV 1;  4AW7 A;  2CHH A;  1RUI 3;  2ZX1 A;  4YVS B;  2OQ6 A;  2XLF A;  4KWJ A;  4XIO A;  4YVW C;  2W94 A;  1MZF A;  5IVF A;  4CTE A;  1WBF A;  5JCT A;  4P5H A;  3Q8C A;  4Q4V 2;  4K21 A;  2OUJ A;  4K1Y A;  4D0Q A;  5FZ7 A;  1PNG A;  2DVF A;  2ZGP A;  2HEW F;  1N1T A;  1NUK A;  1VBB 1;  2R04 3;  1JOD A;  5GM0 A;  1BBT 3;  4GA9 A;  3WP6 A;  5CYY A;  4LLO A;  3EB7 A;  1TNF A;  5HCF A;  1NG0 A;  4KWU A;  2PHT A;  2WNE A;  1FMD 2;  3HQX A;  2WBK A;  4MSV A;  1GFF 2;  3GHM A;  3N9M A;  4LBQ B;  1CPM A;  1GZ9 A;  2OS2 A;  1MS4 A;  3DXU A;  4LA2 A;  3WHU A;  3BOD A;  5F8P A;  1O3R A;  3AFG A;  5K0U B;  2GDF A;  2UWB A;  2RS1 1;  1SLI A;  2XXZ A;  3JB4 C;  5T50 A;  4E2G A;  2XJQ A;  4Q8L A;  1AR9 2;  2GMP A;  2UWA A;  1AR8 2;  4XW3 A;  2ZGR A;  3AC0 A;  3GBG A;  1KD7 A;  3VBH A;  4OI0 A;  1DIW A;  5JLV A;  2RR1 3;  5IAV A;  4DY5 A;  3ES4 A;  2MHF A;  2VQA A;  4MGS A; 
#chains in the Genus database with same CATH homology
 2V4A A;  2G1M A;  4BQW A;  4Y5S A;  4ZPI A;  3BVC A;  4J25 A;  4XAB A;  5DAV A;  3NNF A;  3GJB A;  2Y34 A;  2RG4 A;  4IW3 A;  5LBF A;  4NHK A;  2JIJ A;  3W20 A;  5C5T A;  2FCU A;  3OUJ A;  4NAO A;  3NNM A;  4XAC A;  5DAP A;  3HQR A;  5C5U A;  2RDS A;  5LBB A;  5L9B A;  3OUI A;  4NHY A;  4KBZ A;  5DAX A;  4XCA A;  3KT7 A;  3GZE A;  4XAA A;  3MGU A;  3PL0 A;  3KT1 A;  5LAT A;  3OUH A;  2RDR A;  5EPA A;  5HV4 A;  5IAX A;  3W21 A;  5LBE A;  3OBZ A;  4NHM A;  5LAS A;  4MHR A;  5LA9 A;  5A3U A;  2FCT A;  3HQU A;  4JZR A;  3NNL A;  4MHU A;  5HV0 A;  3GJA A;  5ERL A;  5LBC A;  4BQY A;  4NHL A;  4BQX A;  5L9R A;  2G19 A;  2HBU A;  5EP9 A;  5DAQ A;  5L9V A;  4NHX A;  2OPW A;  4XC9 A;  5EQU A;  2FCV A;  3NNJ A;  2A1X A;  4Y5T A;  3KT4 A;  3DKQ A;  5M0T A;  2HBT A;  4UWD A;  4NMI A;  2JIG A;  5DAW A;  4ZON A;  4XCB A;  5IAT A;  5LB6 A;  3EMR A;  2RDN A;  4Q5O A;  5IAV A;  2RDQ A;  3ITQ A;  2Y33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...