2JIJA

Crystal structure of the apo form of chlamydomonas reinhardtii prolyl- 4 hydroxylase type i
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
206
Chain Sequence
b'MVGFGELKEEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKRTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROLYL-4 HYDROXYLASE
molecule tags Hydrolase
source organism Chlamydomonas reinhardtii
publication title The Active Site of an Algal Prolyl 4-Hydroxylase Has a Large Structural Plasticity.
pubmed doi rcsb
total genus 58
structure length 206
sequence length 224
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2jijA00
3HQUA 4ZPIA 5LBCA 3NNFA 5IAVA 3GJAA 4NHKA 4MHRA 5DAWA 4NHLA 4Q5OA 5LB6A 5EP9A 3KT7A 3DKQA 5M0TA 2HBTA 2JIGA 3PL0A 4NHMA 4NHXA 5IATA 5IAXA 3MGUA 2A1XA 4XC9A 5DAPA 3NNLA 3W20A 4XAAA 3EMRA 4XCAA 4Y5SA 5LBEA 4UWDA 2G19A 4Y5TA 4XACA 2G1MA 4IW3A 5LASA 5L9RA 2FCVA 5HV0A 3W21A 4BQXA 3OUJA 5LBBA 3OBZA 5DAQA 5DAVA 3ITQA 2RDQA 3HQRA 4NAOA 5L9BA 4XABA 5LA9A 2RG4A 5DAXA 5LATA 3KT4A 3KT1A 3GJBA 4BQWA 2FCTA 5LBFA 3NNJA 3NNMA 3GZEA 2HBUA 5A3UA 2FCUA 4JZRA 2RDSA 2V4AA 2Y34A 5C5UA 4XCBA 4MHUA 4J25A 5C5TA 5EQUA 4KBZA 4NHYA 2OPWA 5L9VA 4NMIA 4ZONA 3BVCA 4BQYA 3OUHA 5HV4A 2RDRA 2JIJA 2RDNA 3OUIA 5EPAA 2Y33A 5ERLA
chains in the Genus database with same CATH superfamily
2W1WA 4QPGC 2AREA 2QQLA 4YNIA 4CZSA 1RUD3 1VR3A 4BQ4A 5TSWA 1VBD1 3O0VA 1AHSA 1EUUA 5J3UA 2OW4A 3NJVA 5C8WA 1GZTA 2WFF2 1AL22 1C8M2 1LU1A 4P14A 1S0CA 4Q4X3 2P1BA 1DGLA 1S0IA 5IJRA 3HN3A 4KBBA 4I3GA 4YWAA 3ZOIA 3GZTB 3VBOB 2ZGQA 5JOZA 4DUXA 4DFSA 2BBVA 2EVXA 3AZXA 4I0AA 3HBZA 3FLTA 4XIKA 5IK4A 4RGKA 3LPFA 1XNBA 3K2OA 4N7IA 4R9BA 2WNVC 1WA6X 2AR6A 3CJIA 3SMHA 3VBHB 4MG2A 1RMU1 1OLQA 4Q0VA 3OEAA 4W6XA 1MS8A 3VDDC 1H2KA 5C33A 3T2TA 5BNNC 5E16A 2PMWB 1ENXA 2A6WA 1VB4A 1S2EA 2E7TA 5FK8A 1VBC2 1W39A 3LFMA 4HKLA 2UYBA 3POSA 4CEYC 3BOWA 2A1XA 2UYAA 3RZMA 2GH8A 3U4SA 4D7YA 3B00A 3MLLA 5CIRA 3VKOA 2KR2A 5FUIA 1RXFA 2JDMA 1ASJ2 3CBNA 3ZSEA 2VTXA 4GMP3 3P1IA 3O5SA 4UWDA 3OBTA 3N4MA 1N3PA 1W90A 1T6GC 3VZKA 1MVEA 4MVTA 4O9EA 4A42A 1OFSA 1JU4A 1UXXX 1F35A 1ND3A 3K46A 5F32A 4XILA 1ZBA1 3RZJA 4WM8C 5ERLA 1PGW2 1RVF1 2HWE3 5E89A 2VNVA 3GCXA 1ULEA 3FHQA 2ZKNA 2VVDA 2LALA 4NAOA 2B8MA 2XUMA 4FPYA 5HCFA 3HOBA 1RTVA 5A33A 5FYVA 1S0JA 5FQ0B 1OOPB 1F4HA 4AI3A 1YFWA 2FDIA 4COZA 5DUXA 1PO21 3RI8A 3PVNA 1RUOA 3WV6A 1HRV2 2C0ZA 2DBNA 1D4M2 1ENSA 3IZOA 1JZ7A 1PO22 3E6BA 1UIKA 4MGTA 5FZ3A 4KG0A 4JGYC 4A6OA 3DF0A 2ZBJA 2DVGA 2WBKA 3FBMA 1PMJX 3CMGA 3VBHC 2XHNA 3LA3A 4FTSA 1JOBA 2RDSA 1HQWA 3N9PA 2HKXA 3OEBA 1QJY3 3S30A 3MYXA 2G9FA 4LXLA 4BQ1A 4PI2A 4DS0A 4GH4B 4H3WA 4XFHA 5A3WA 4Z8BA 5A80A 5A32A 4ARXA 3WF2A 4EN7B 3VBUB 1Q3EA 4QDRA 4OLLA 3BKZA 5FP8A 1J3PA 2AACA 5EQUA 4B7KA 5C3QA 1CWPA 1CR7A 2CWMA 5FZ8A 4LBQA 4MGZE 5DZFA 5FPBA 4ISRA 3WW2A 3VBFC 1QOSA 1J83A 4LMFA 3I2FA 2QE3A 1AYM3 2ZEYA 3WG3A 1DGWX 5T5JA 4B1MA 4X6QB 4BYYA 1TE1B 2WWUA 2ZX4A 2QCSB 4CDUC 3BPSA 2PHXA 1D4VB 1D2QA 1WMDA 1XYOA 1DP0A 3KQ4B 4GULA 4UW3A 4AYUA 3H8XA 2VMFA 1D7PM 1WMFA 3I2HA 5JPNB 3ROUA 3ZMOA 1XJAA 1UKGA 2YPJA 2D3SA 1CAUB 2GMEA 2E63A 2Y6FA 5FZDA 4XFCA 1N1YA 2B4KA 1AR81 1OD5A 3NJXA 4P9YA 5E8AA 4RHV1 5A7QA 1CAVB 2BGPA 5DMYA 4GQ7A 4QGLA 5JCTA 2O8OA 1AVBA 3PNAA 1AJOA 1VBC3 4GZ9A 3N9OA 1H1MA 3O7OA 2FMYA 2X5IA 2QQNA 4O61A 4Q5OA 4OHXA 4AW7A 3RZGA 3PUSA 4QM9A 3ZDSA 3DGTA 3NO8A 1AR93 4PDWB 2P3JA 4I0BA 4QHOA 2XQXA 5ABJA 4XVHA 1SLAA 2Z69A 4KQ7A 3KV4A 4CU9A 5JOXA 5GLWA 3E97A 3N9QA 2Y6KA 3SKVA 3S5QA 3N9LA 1E5HA 5FYBA 4DXSA 3FLRA 3IKWA 1GSLA 1LGCA 1HXS2 3LQCA 1DCSA 1N3QA 4GWIA 4LE3A 5IK7A 1RHI2 1GZWA 3ACGA 4PT6A 5FZ4A 1RHI1 1SCRA 5JAXA 1I1EA 1EAH2 2FBEA 4DO0A 4XBNA 1VBD3 1XNKA 3ZFEC 2GNDA 4CCCA 4XJ9A 3ZN4A 4CUCA 2QQUA 3THDA 3B9IA 4X8NA 2WZR2 4KU8A 4RR3B 4QHZA 2Z42A 5JR2A 1UZVA 4SLIA 4Y1YA 1SMVA 3DN7A 1S1AA 3KZ4C 2PQSA 1AX0A 1BEV2 4LBOA 2ID4A 5JR7B 1ZA4A 1ZBE1 1Z7S2 2D6KA 1QQP1 4RGAA 2Y64A 1KS5A 1TME3 4RN5A 3AC0A 3C7OA 1WA4A 1WZXA 4Q4W3 4YRDA 2NMOA 3PHMA 1Y9MA 2ZS6B 2J1RA 3JBG1 4OFGA 1O3QA 2HYXA 4FPOB 3VBSA 3TN91 4M3CE 1R082 1OD3A 4EJRA 3OG2A 2IVIB 5A3LA 1IQDC 4ZZ5A 2ZGUA 3OYWA 1OURA 1JODA 4N9IA 1OQDA 3D5OA 4COVA 1J3RA 4E2SA 4E27A 1JXNA 2VXRA 1J84A 4N43B 4BMBA 1MZ6A 3CZUA 3PIGA 5EZWA 3OOXA 4FFFA 4AFDA 3B7MA 2ZJCA 5CA6A 5FO8B 1PGL2 3MIDA 1CAUA 5LA1A 1R093 2ZGSA 2D6NA 2F4LA 4KL1A 3M3EA 3BB6A 1W6OA 1QXPA 1LGBA 2Y60A 2H0VA 1GWKA 1DQ2A 2VCMA 1NZIA 3AKRA 4WVMB 5FZ7A 1Q56A 4QDQA 3RFRA 3VBSB 4E4ZA 5CKQA 4Q1RA 2VZRA 2EXHA 3POGA 4XUNA 3NVCA 5EWSA 3GALA 1K5MA 1I3HA 1WLTA 2X05A 2GP5A 2PHRA 2X5IC 2XL9A 3ON7A 2WA3A 4XQDA 1POQA 1O4TA 2D97A 2P2KA 3P6BA 2R6QA 1S0FA 3DUIA 2CGOA 2VC9A 4UFHA 2WC2A 4XQWA 5BNPB 4YG6A 1IPSA 4FTBA 1H9WA 1UAIA 3RWNA 3NW4A 5A6YA 4PDWC 1LEMA 2IXHA 3FN9A 5CYYA 4FBFA 4IE0A 5JZGB 1XNDA 4JDMA 5FMBA 3AFKA 3WDXA 4P9IA 2WS93 3V56A 4XW3A 2VQUA 2K9ZA 3VLBB 1LOFC 2WJSA 5EYXA 3ZKYA 1UCXA 4XUOA 4CCDA 4URTA 2P5BA 3WHTA 1W6NA 3LIHA 5FZIA 4FP2A 1YNAA 2WT0A 1E5RA 1JZ6A 1RUH2 1XNAA 4CDUB 5C4WA 3J4UH 3FX3A 1OBNA 3J7MA 4LHKA 3UESA 2RS51 5FFOC 1NQJA 1T2XA 3MICA 1RUF3 4ES8A 5JSRA 3W5NA 1NT0A 2Q8DA 3VZMA 1H6YA 2D44A 1QDOA 4QQPA 1PK6A 2G9ZA 3VD5A 1QHDA 1F2NA 2NZ9A 3PU3A 4LBQB 5DZEA 5G04L 5K9YA 4UFMA 2IXKA 1XU1A 4TXWA 5CG8A 4MXVA 4LITA 4P5HA 2V73A 4EN9B 1JYNA 1O7FA 1C28A 4KGQA 4V1PA 4EE2A 1OVSA 1DIWA 3LCPA 3B9CA 3GBGA 4OUMA 3BIEA 2DCJA 4A7YA 1UPIA 1O6UA 1TMF1 1Y9QA 3OUJA 5FP3A 1VAKA 1LOGA 4YFZA 4RYDA 3S7EA 3T09A 1VRH1 4NIGA 2J1TA 4CDWA 5J98B 1HKDA 4LBJA 1NE6A 3AMHA 1YXWA 3LB9A 5FY8A 4CUBA 1UPSA 2GALA 2UU8A 4J1XA 5FY5A 4PLMA 1G9AA 4XF1A 3C7HA 1NG0A 4CU8A 1NCRB 2RMU3 4YW1A 2H6BA 1DLLA 2GMPA 3H9AA 1OA4A 4BQWA 3N35A 4Q0UA 1WCUA 2AEZA 2PQQA 4M3CA 5F8PA 4DINB 2W3JA 1OUXA 5AC91 5C4WB 1A8DA 4Q1PA 4RQPA 1NAEA 4M00A 3RRDA 2JD9A 3WX5A 3BTZA 3WQBA 3OF1A 3JXSA 3KCYA 3PUIA 4A7KA 1ZBE2 3MDPA 3OCPA 4AE2A 3FE5A 4XF4A 2JB4A 4ZU7A 4QKFA 4NRQA 5FP4A 4R9AA 1ULFA 3JD71 4Q4V1 3NAPA 3IIIA 1FMD3 4NPMA 1VBE3 3MZHA 2WS92 4MXWB 4ARYA 5LCWL 1MS1A 3QD6A 2Q8CA 4OULA 3V0AB 1AR91 1FOD3 1K3IA 1AR92 2VZUA 2J22A 3ZN6B 1SBFA 1AXZA 1UX6A 3OY8A 2OIIA 1HLCA 2VY0A 2PAMA 1AZDA 4XUTA 1QH6A 1LOCA 2W68A 4META 4BLIA 2OA2A 3VN4A 1RUH3 4OMCA 4MGKE 1VMHA 1C3HA 1LNSA 3ZXLA 4AG4A 1PX3A 3RQ0A 4D3WA 1YI9A 3TEWA 3H7JA 1QJFA 4CEWC 5FY0A 1J59A 1HB4A 1UF2C 2WFF3 2A6ZA 5FYUA 1C8M3 1XE0A 2WAOA 2YZ4A 4HETA 3UKTA 4NROA 3K51A 4PHZA 2ZEXA 2CY6A 4AVCA 1QNWA 1BMV1 1PNGA 1UXZA 5F5CA 3RVHA 1VB2A 1YC61 2WZR3 3U10A 1WKYA 4DOUA 1CAXA 2W5FA 4EWEA 1W9SA 2Y0IA 2AH2A 4P00B 4HVOA 1TNFA 3MBWA 3EB7A 3VD9A 4V2WA 1PMIA 5FY1A 1AL23 2NMNA 1JZ3A 1W03A 4H7MA 4F8AA 1VIWB 3OGVA 5FCCA 2F4PA 1GKBA 5IUQA 1MPXA 4FOYA 4AEMA 4BIFA 5CISA 1JUIA 2BDRA 5FYSA 4HMZA 1D0HA 2RS32 3POFA 3BIWE 3VD3A 1EUTA 2ET7A 2VE1A 1PVC1 2GN7A 3TEXA 5BNOB 4IGQA 3ME2A 5FAXA 4CVUA 1KS4A 4GWJA 4YGBA 5EJZB 4QAWA 3VKNA 1BZWA 1YLLA 1F9KA 2C5DA 2SLIA 1OPOA 3POBA 4X8PA 2JG9A 4ZU5A 5FJHA 2KD7A 2FZ2A 2BTVC 2HWE2 2C1FA 5DAVA 2A6VA 1WCQA 2XBO2 2O0OA 5GZGA 3OPWA 4HK8A 3MUZ1 4YYOA 5A6QA 4AVAA 4UW4A 1H2MA 2E33A 4WV8A 2HEYF 2Z5WA 4IEXA 4JTOA 4BISA 3B93A 2R063 3ACLA 4LKEA 3ZIXA 1D4M3 1OVPA 2QQJA 3ZMNA 3ACHA 2WN3A 2BP6A 4XFGA 4AI1A 4CSWA 2WZR1 4QXCA 2LW8A 3OJBA 2ZZQA 4WVWA 1OA2A 5LATA 3WOGA 3ZDVA 2DVAA 3OPZA 3VKLA 2DBIA 2WSVA 1MS9A 1UMZA 2VL4A 1L7LA 1W2AX 4Q8LA 5IVYA 1EV11 3C7GA 3FFZA 4Q2FA 1I5ZA 2XMLA 3ZN5A 1US2A 4U36A 2R1BA 1UOFA 4FP3A 1R1A3 3Q8CA 4IEUA 5T5PA 3TEZA 1PIV2 2JKXA 3MFAA 4XMIA 3CO2A 1LESA 4IE6A 2J1SA 4NHYA 4JHZA 4GJYA 3ZFGC 4H7LA 3PURA 4UI9L 2R49A 5GALA 5IFPA 5L9VA 3I2JA 1ZNPA 3DECA 1NCQB 4NMIA 3SH3A 1RUC3 1GMMA 3ZXGA 1PO13 5A7NA 2XVGA 2EICA 2WO2A 3K3OA 2JXAA 3NKGA 5D8AC 5A32B 1W6QA 2ZHLA 2VAUA 3BODA 1WW6A 1DDLA 1W8UA 3RZHA 4LBNA 3PUAA 4CP1A 3DYPA 2YROA 5FZFA 1H30A 1UOJA 3HQUA 2GNMA 4CDQB 1H2LA 2D5FA 2QKDA 4FFIA 4CEYA 3WF0A 4CDXB 4Q4V2 1POV3 5IVVA 5CVRA 2WZPP 1AYM2 4L0PA 3AP6A 1V9U1 3BI3A 5A1LA 2L9LA 5DAWA 1Y4WA 2RM23 5FY7A 3PVBB 3ZYBA 3CJIC 2OZJA 5T54A 4DXZA 3MFCA 3ZR6A 4OQ8A 1H4GA 3CL1A 3M7AA 2QQOA 2EXKA 3ZSMA 4XDOA 5FYYA 4QD2A 4QX1A 1MZEA 3K4DA 4XDQA 2VCBA 5DDJ3 2WLPA 2Q5TA 4AEDC 1RINA 3DV8A 4PIXA 2VNGA 4HK9A 2XHKA 1CJDA 4YG3A 2BPA2 3AP5A 1W8ZA 3CF6E 1QY4A 4Y1UA 5A6XA 4XC9A 4QPIC 3THCA 4C8DA 4OVEA 4EROA 3T4HB 2X10A 3I59B 3H1WA 1Y3TA 2PELA 2PTMA 2JKBA 4PLNA 3RPQA 5K4LA 4NIDA 1D2SA 1HRI2 2ORZA 1VAVA 1KDKA 5D21A 1LR5A 2G19A 4NAMA 1VBD2 4LO7A 4PIZA 4CXWA 3O0XA 3G6JB 4ATEA 2R32A 4FAHA 5ACA1 4XACA 5F2WA 1Q8QA 4WM8A 3WDUA 1K12A 1ASJ3 1N1SA 5LASA 1M4WA 3LEIA 4RGGA 3G7DA 1QKQA 1KFXL 2YGLA 5HV0A 5CKNA 1H8TA 4CPBD 1RHI3 1LCLA 2JE9A 3RGBA 2A75A 2MEV2 2EAAA 2QFEA 1K5MB 1FNZA 4XABA 3R05A 1LHNA 2VZSA 2RR13 3M70A 4HZFA 5FY9A 4L11A 5ANNA 2VECA 1G7YA 4WBBA 4YARA 1GANA 4GKYA 3W59A 1JU3A 3ETQA 3H1MA 2RS11 5EJ1B 1PGSA 2XKPA 2XR4A 4JGYA 3SEPA 1PVC2 5A33B 1R1A2 3KT4A 5C8CA 1NA1A 2WNOA 4W4ZA 1OQ1A 1LULA 4L2NA 3NSTA 2LM3A 1S0GA 3WW4A 4EZHA 5BXXA 4Q4W2 1S4CA 1O91A 3O14A 5FUNA 2W46A 2CU5A 3N9NA 1KJRA 3HD8B 3ZYGA 4FTEA 4OI2A 2Y34A 5FYTA 5I91A 2OS2A 4WVVA 4OI1A 3C7FA 5FZLA 1AR83 4FPHA 5JIUA 3VDCA 2J1AA 3ILFA 1COV2 4UBHA 2G9GA 5CNAA 1QJY2 1PM4A 4YGDA 5T3NA 3I59A 4CRQA 3HR9A 1XNCA 4COYA 4UOJA 1ZZBA 1Q8VA 5F39A 2CGNA 4YW3A 3V0BB 1CZTA 2ZGMA 4BXSV 2JX9A 4CE8A 3NKTA 1LOEA 1YFXA 4YFWA 4FSJA 1D4M1 1LOBA 2RDNA 1RB8G 4XFIA 1RUI2 4YVWC 4C0HA 4XF9A 1K45A 4A45A 4BIOA 2Y33A 4Q29A 3LEKA 1JH5A 1EAH1 2B7YA 3MW4A 4B4PA 3LZZA 4FPKA 1W04A 1GFF2 1YQ2A 3N9MA 3POIA 3ZX7A 2WWSA 1CGPA 4AHWA 1DG6A 2DTYA 1UU5A 1REEA 1GICA 3POJA 4YW2A 5I8YA 3NAPC 5T5LA 4UFIA 2ZMKA 4NHKA 5F3GA 1SFYA 4DY3A 1P8JA 2HEWF 4DEQA 2ZGLA 3ATGA 3NV3A 2XJQA 4YLZA 3ZSLA 1IS4A 3VHPA 2HWD2 1A8MA 4DMIA 1S0BA 3M3QA 1STMA 5CFCA 4HG6B 3IN9A 2C26A 5EP9A 4K40A 1IKPA 3KF5A 2ZX3A 4OHWA 5FP9A 1HW5A 5A7OA 1W2NA 4KMQA 3TN92 3WEZA 2XBO3 3E1F1 4CDQC 4XZUG 4MZUA 4K7JA 2BUKA 3NNGA 1WLWA 4AR2A 2DF7A 4MGIE 2FDFA 1G6NA 4YZ1A 4Q4Y1 3VKMA 4K1ZA 5FXZA 5DUUA 3ZIWA 3O1RA 1JYTA 1XNTA 3UJQA 5I0RA 4XFBA 3ORJA 4CEWB 1QMJA 2ZA9A 3FHAA 4M0HA 1BK1A 1I9RA 5JUVA 2W92A 4HSLA 3A0KA 1C8NA 5I0DA 1UD1A 3BCWA 1CZSA 1V6NA 5GLVA 5FOBB 2VUDA 3SISA 4TTGA 2O1QA 4XIOA 1EPWA 4XUQA 2GNTA 4AI2A 1X9PA 4AGGA 3GHMA 2XONA 2PAKA 5T50A 2RR11 4N7UA 5C3RA 1XOYA 4YGEA 1ZYBA 3T1MA 2R041 3MIEA 2CAVA 1CN1A 5FLHA 2RG4A 1RUE1 1RUNA 2B46X 2G4IA 3DYOA 3TWIA 2FQPA 2Y8KA 1RUC1 5LK7B 4OCTA 4D7SA 1Z0HA 3O1OA 1RUC2 3AL5A 4P08A 4DQAA 2HJIA 5ACA2 3L2HA 5HXVA 1XRUA 1PHMA 2R071 2WABA 3B3QE 4RD7A 3UJOA 2GU9A 2HWB2 2YPDA 1YCIA 1PZ9A 3R4DB 3WR0A 1R1ZA 1BXHA 2P3KA 4QMAA 2UWCA 3Q8FA 3NWKA 2QNKA 3U1XA 2A6XA 2MEV1 2W87A 3THTA 3URFA 1IHMA 4YM3A 1ULDA 3AXDA 2DFBA 2HWC2 1H6XA 2PHWA 1DGWA 4LLFA 2C9KA 4UFLA 5FWEA 3WF1A 1F8VA 4QPGB 4XXAA 4K3UA 1LOFA 1RUE3 4UF0B 1RL3A 5L36A 1BEV1 1NOVA 1W9TA 1FMD2 2E53A 2YGMA 3ASIA 4I30A 1TEIA 2TNFA 2WQ8A 3ZSJA 4ZKTB 3RZLA 2WIIB 4LHSA 1VBB3 4ZONA 3WDVA 5IVJA 1SLIA 1UZ0A 4LT5A 5SV5A 1K42A 3C7EA 1ND3C 3JBG2 3H8OA 3VDDB 4Y20A 4UT5A 4HLTA 3HNMA 3LAGA 5DDJ2 3WDTA 1YQ6A 4AGRA 1W0OA 1CZVA 3MPPG 2VUCA 3ZYIB 4AGVA 4CEYB 2EIDA 4A4AA 5C6CA 4A3XA 2XLFA 2YC4A 3U37A 1HV1A 1X7NA 3KF3A 1W6PA 4W50A 4QX3A 3KQRA 3RYKA 3ZFGB 3I2IA 1QDCA 3ZFFB 5FLIA 2YB7A 4AVTA 2WA4A 5C9AA 2DV9A 5AVAA 2QQKA 4RFRB 2JDPA 2ZABA 3VD4A 4C0BA 4J1WA 4ZS3A 5FREA 2HWF2 1KD7A 3KT7A 4AVVA 5CEHA 3ZPYA 5FO7B 3WINE 1W6NB 4ORFA 5FXXA 2VD7A 2VH9A 2LUWA 4COUA 2YC0A 4HN1A 2WNVA 4MGYE 1CIYA 4HPKA 3RNSA 2X53S 4FOWA 3R0RA 3LEGA 1H2NA 2NP0A 4XUPA 4NIHA 1AR62 1X36A 4FPEA 1RUF2 2JECA 4LBMA 5ANQA 4LA2A 3T08A 4QQ2A 4XJ8A 3ZXEA 2BFUS 2YYOA 3N7LA 5FYZA 4PLOA 1LHOA 2VR4A 1ENQA 2WNUC 3LFIA 3WZ1A 4AVSA 4E2QA 5IK8A 5F7UA 2JICA 2XWJB 3ZXDA 3M8LA 4YM2A 2VMDA 3S6PA 4L97A 1QNYA 2Y6LA 5EHDA 5H9QA 3FBYA 3P5BA 3IPVB 3A22A 3AFGA 1UNBA 3GF6A 2ZACA 5D2AA 4CUAA 5KXBA 3VDBA 2I45A 4JRAA 5LBBA 1QQP3 1J3QA 2VULA 3PTYA 4HT1T 5ACA3 4XTMA 1NUKA 1RUH1 4GWMA 5L9BA 5FWJA 2W1UA 1MS0A 4NRPA 1W6PB 3JD73 4YPJA 3T0DA 4IESA 1OOPC 1PM7A 3HN1A 3IB3A 2VQTA 1W6OB 2UWAA 2VMGA 3VBUC 2Q30A 5LWBA 5FIXA 5FPUA 4G9SB 3GJBA 3WT3A 5HCBA 1ULCA 3MUY1 2FCTA 5LA0A 3SHRA 2IVJA 3JB4C 2AZ5A 5FPVA 1JYVA 1OPMA 3VV1A 2VG9A 1QOTA 2ZXQA 4N43C 2WINB 3WUDA 1WW4A 1CAWA 1REFA 1V0AA 3M4FA 1W9WA 4J25A 3KLSA 2A5ZA 3PMSA 3DCQA 4P9GA 4CCOA 5C9AC 1QJU1 2P37A 5FPAA 5KR7A 3AVRA 3HMYA 4AI0A 5C8CC 1W05A 2WZ8A 3B94A 1GNHA 4QX5A 4RA0A 4SBVA 5G05L 4BDVB 4OUEA 4DUVA 2ZMNA 3RYRA 4XJZA 3NL1A 2WNVB 4HFSA 5HBAA 1FT9A 1RMU2 4YW4A 5GLZA 2JDZA 3AMQA 2D6LX 1CVNA 2ZHNA 3ILRA 1UN1A 2P17A 3VL8A 4WM7B 4YM1A 1IKQA 5D1IA 5A7PA 1B35B 1BBT3 4PI0A 2Z2SB 5EV7A 3WCSA 2ZOEB 4CDUA 4LKSA 2WNEA 4MV2A 2UY9A 1X8MA 3CIHA 1DGRN 2CL2A 1ZZ8A 3ELNA 1MS5A 3RS6A 5LBCA 1GZ9A 1SQ4A 5JVVA 1GUIA 1FPN2 4WVZA 5SV8A 1IS5A 1JOPA 1SG3A 2LRPA 1F31A 3IDCB 1FPN1 3GGLA 1FATA 2EALA 1ASJ1 3M3CA 4QKDA 4XHBA 4LBKA 5APAA 4NHLA 2IFRA 4JTNA 4LPLA 3LOIA 4UAPA 2JDNA 2CV6A 4P9WA 2B5HA 3DKQA 1OH4A 1U12A 1ZZ7A 5JXIA 2ZHMA 1I6XA 3I3QA 2BV4A 2HYKA 1VMJA 3EQEA 3RZKA 4BH9A 5IYYA 5HCHA 4EZ4A 3VHOA 4NPLA 5DZGA 3X29B 2WYSA 2VCCA 2Q8EA 1QJX3 2BBAA 4RQPC 4JX0A 3HEIA 4NHXA 4P9JA 4RL7A 4P9LA 1U0AA 2DUPA 4M01A 4NWVA 3I2GA 1OKQA 4AI8A 3INAA 4AHZA 2DURA 1W9YA 2IUWA 3RJ2X 1ZRDA 5DAPA 1JHJA 1FV3A 5C8CB 1W8HA 3NNLA 2P34A 3VBUA 5FV3A 4FQ4A 1PMHX 5LBEA 3VB9A 2GC2A 2R073 2W0XA 4IL7A 5C3OA 5CFCC 2WZEA 3CJXA 5DN2A 5A7WA 3ZPOA 2D6PA 4Z2WA 2WR9A 4Q0PA 1KITA 1RUJ2 2Q0AA 2XJUA 2XLAA 5C7GA 3O1MA 5C4WC 3U11A 1XU2A 4BPZA 4GALA 4UBGA 5CB7A 4YSFA 3OBZA 5AVPA 5K0UA 1HRI1 5DUWA 5L19A 1AR73 2WFPA 1W8FA 3W58A 1CPNA 1MQTA 1PZ7A 4FQZA 5AFBA 1RXGA 1XXNA 5FMOS 4A7ZA 4P9XA 4AEKA 4RQPB 1RUF1 4RS5C 1SDDB 4FPCA 1LB2A 2ZX1A 2W91A 1IPKA 1HRV3 1QJEA 2XL7A 3AP4A 3CNAA 4IERA 4H2AA 5GKAC 1A34A 4IEWA 1PVC3 3FFQA 4AF9A 3DYMA 5AC93 5IVFA 2VU9A 1JUHA 1W2OA 2JD4A 1O3RA 2R062 3TRSB 5F1RA 2MEV3 4EQVA 4WM7A 4OMDA 2R061 1EYBA 2FCUA 3IMMA 4JZRA 4CP2A 2KA3A 4K1YA 3UYJA 4JDOA 4QPIB 2FDHA 3UGGA 1TVGA 1LJ7A 1UYYA 1Y9GA 2W2IA 3N7KA 3KS7A 3THPA 1GYKA 5C5UA 5B4NA 5DABA 1DQ5A 4MHUA 3Q9OA 2VVEA 4QU2A 1X33A 1AR82 3WCRA 5H9RA 2VBDA 2XVKA 3IDEA 4B4RA 2BGOA 3JUUA 5CFCB 5CG9A 1F5JA 1NKGA 4Q4W1 1LHWA 1V9U3 2VOTA 3U0ZA 4GKXA 3GXUA 4XZPA 5HCAA 5GM0A 1CJPA 3BVCA 4D6QA 2ZMLA 4ISQA 3WG1A 1JOJA 3B02A 3B5LB 2RDRA 5L7OC 5FTTC 2BRTA 4CDXC 1ZBA3 1OLMA 2LROA 1OFNA 1COV3 2VPVA 4M3CB 4LE4A 3GHNA 3Q8EA 1GP5A 5C9AB 2QZ2A 4AEDA 2PHFA 1MQTB 2ARXA 2ERFA 2OQ6A 2ZEZA 2ZGPA 3AZVA 1QIQA 4GD4A 1GU3A 4HN0A 4LA3A 1UMHA 4LJHA 4NVPA 5IAVA 3UL2A 3VBRA 4E4DX 4A41A 2DCTA 1CD3G 3ZXFA 5JDBA 4NN0A 1HQNA 3H50A 4AK3A 3N36A 4O9GA 4XYXA 2RS53 1SFPA 1OSGA 4XBLA 1JZ8A 2AUYA 5LB6A 1TQ5A 2CHHA 4Y24A 1KEXA 4DRVA 1PIV1 1HX6A 2GP3A 4LIUA 4Q4V3 4JGZA 5GZFA 2HBTA 2D93A 3AJZA 4IETA 4IEYA 2YMZA 4Y3OA 3V0AA 1H8VA 2NYYA 2B39A 3KD4A 4L9BA 1HIXA 4IEZA 2R7EB 1GOFA 2VXJA 5F6KA 1S2KA 2RS12 1Z7S1 3POYA 1OLME 4HVRA 3WVJA 2Q8OA 2D3RA 4O65A 4XF3A 4B4QA 5IAXA 3D0SA 4MOAA 4EWAA 5F3CA 1HN1A 3N7JA 1SZBA 3AP9A 4KNCA 3HNBM 2JB8A 4AOCA 4LUMA 2XUEA 3IM0A 4F3JA 2JG8A 1W6MA 2HWE1 4ZZ8A 1Q8PA 2Y0OA 2ZPXA 4XOGA 4AFCA 3DL3A 2JEMA 4UW5A 4BOWA 2UWBA 1AX2A 1G9CA 3PLQA 2JDUA 1AYM1 2YFUA 5L9RA 5I0SA 3SITA 1COV1 2WNUB 4QHBA 5DAQA 4YW6A 3PUQA 1PGL1 3I49A 2Z79A 1PGW1 1RVF2 1ACCA 2RDQA 3Q8AA 2DU1A 4FPGA 3KVAA 4PIYA 3E6CC 3WUCA 2BYVE 1Z78A 5LY2A 4YVSB 1DQ0A 4A3ZA 1AJKA 4M4RA 1TME2 2E51A 1SDWA 4L8QA 3LD8A 5I0TA 1AYN2 1VRBA 5J09A 1VBE2 4N9HA 5DXDA 3RI9A 3VBRB 2CWSA 5J1XA 1AYN1 3BGAA 1YO8A 2B45X 1OHFA 2C24A 3OGJA 1V70A 5H9PA 3KV9A 5A3OA 4C1XA 5FXWA 1EV12 2YBPA 2BNMA 3HVDA 2ILMA 4A2UA 1GWLA 2XVLA 4CU7A 4AI9A 3P3PA 1J1TA 3VZJA 4CCJA 3AX4A 3FHIB 3NNJA 1CPMA 1UU6A 2P3IA 3GZUC 4IXLA 4ET7A 5FZ6A 4QPWA 2HWB3 1UYZA 1JW6A 3DPRC 5F5QA 3RG0A 2XQRA 2EA7A 2PYTA 4XDPA 4CP9A 1SHWB 2D5HA 4FXKB 4Q27A 4DRRA 1QXJA 2ZTNA 3JZVA 4I0WB 1VE0A 1RUG3 4XPVA 2ZGNA 1FPN3 1WMEA 2V09A 2CNAA 4MLOA 2E7AA 5FMDA 1FX5A 4S2FA 4AXOA 3UV9A 1YQ5A 4CCNA 2WT1A 4BK4A 1UIJA 2JDHA 2QQWA 1EY2A 2OPWA 4JGZB 1OF3A 2JG8B 5KXCA 2DCYA 3LIGA 1H0BA 1NXD1 2QQIA 3ZYPA 1Q43A 3RMYA 3ZFEB 5BNQA 4MXWA 1DQ6A 2W47A 4E4HA 3MW3A 1QOOA 4AEJA 2RS52 4FXGB 1FOD1 2YDEA 2FHRA 2HWC3 3BU7A 3OUIA 4KWJA 4N43A 4W6YA 2OKXA 4R8HA 1V6KA 4ZXKA 1H9PA 1NLQA 1FNYA 4NIAA 1JYCA 3AB0A 4RHV2 5EFUA 1AL0G 4CDWB 2DU0A 3E6DA 1C5HA 2WUHA 3M1HA 3M3OA 2VTFA 5CAZA 3KHCA 4YZ5A 3NV4A 2OYZA 3TNPB 2GZWA 2JJ6A 2ADDA 2ZKLA 2RJ2A 2XXZA 1DBNA 1NQDA 1IGOA 2QUOA 3HNYM 4LO6B 4ZY9A 4B8EA 1QGLA 4OQ9A 3ZXAC 4LK7A 1NY72 1SLTA 1OH3A 4BWOA 3WW1A 5HI0A 5FYCA 1KGYA 5JZGC 1TMF2 1HJGA 1SBEA 3R4UA 4RR3A 2LS6A 2MNGA 3NMBA 1IZ3A 4PF1A 3PL0A 5C3PA 4WVMA 1GNYA 5E88A 2FD8A 4ASLA 1EAH3 4IV1C 4EN8B 4JDNA 1OT5A 3A4UA 5GZCA 2OPKA 3TN93 1NX9A 1RUI1 4INDA 2VUAA 4XAAA 3FMGA 4GIQA 3PJYA 3E5UA 2WT2A 3MI8A 1I5PA 4Y5TA 4AHYA 3AXEA 2Y6JA 4QPYA 5CU1A 5DG2A 2R043 5FZ9A 2ORXA 3H7YA 1YQ8A 2DVFA 2C9AA 3ZN6A 3ACFA 4UFJA 4NJ4A 2Q1ZB 1KFUL 2JDYA 5F3EA 5EYYA 4A6SA 1R083 2FMDA 3HQRA 5JXHA 1XBFA 4OYUA 5FMOL 1DQ4A 2DCZA 3FZ3A 2EIEA 5IFTA 1GBGA 1UX7A 1YYNA 1SLLA 2D3PA 3KM5A 4PF5A 4AQ6A 4Y4RA 5A1FA 3RJRA 4QGMA 3KHBA 1BEV3 3W9AA 4BQ5A 4OHYA 2VZPA 3MIGA 4FOVA 3ZM8A 3KMHA 3J26N 5FBJA 4LOSA 2UURA 1PO12 2HH9A 4Z92B 4LULA 5KHHA 5I8SA 1MEC1 5BNNB 1FI2A 2K46A 2VNRA 1G9BA 2XJRA 4AAPA 4BK5A 2HBUA 4MO3M 1MEC2 3AYEA 4LR4A 1QJY1 2C6SA 3PJQA 1ZBA2 3LE0A 3DKWA 2O8QA 1UY0A 2WSUA 2V5DA 4Y22B 1UZYA 5T55A 3I2OA 4DNYA 3AL6A 4AVBA 2BEOA 4FPJA 4IV3C 1UY3A 2QZ3A 1GR3A 2VNOA 3CLPA 4N53C 3MO4A 2NN8A 5JWPA 1E5IA 3NV2A 4IEQA 1ZRCA 1GWMA 5C5TA 4HSJA 1V6JA 2HWF1 4C90A 5DG1A 2VOKA 1O4YA 1W6MB 4OI0A 1R092 3ZO0B 1IS6A 3QBQA 4CYDA 2RM21 4NE9A 2EF6A 1WCSA 4JAAA 2XWBB 1ENRA 5LK5A 1X50A 1QU0A 2RM22 4ES9A 3NJZA 4E8CA 2AC1A 2GAUA 4PCRA 4XFAA 2P3YA 4MUVA 3IIAA 4FT8A 4MGQA 1RUE2 4H14A 1LU2A 4AQTA 4WM7C 1C57A 4F7ZA 3J9SA 3WP4A 4BE3A 5E6HA 3J7HA 2A3YA 1RJ8A 2ET1A 3I3DA 4UFKA 4QX2A 2Z4FA 4QB2A 3U4XA 1PZ8A 2BOJA 4R52A 2OUHA 1HN0A 5A6ZA 5K8SA 3VBOC 1VRH3 3EBRA 5EJ3A 3TBDA 1BBT2 1H1AA 2Q1MA 3I2DA 1ALYA 4Q0SA 1XPWA 3T2QA 5A7WB 4GMP1 1OC1A 3DXUA 4TWTA 5FKBA 3NV1A 3UK9A 3IBMA 4TZDA 1RMU3 3NAPB 4WZCA 3QH7A 1UY4A 4MSVA 1LODA 5JI7A 3FWEA 3OB8A 1GP6A 4E2GA 4ZHNA 2B9VA 2CAUA 2I2SA 4AAXA 4N8MA 3NQHA 4Q4Y3 3MF6A 4OHZA 4XEZA 3VD7A 4CCMA 1LAJA 5BNNA 2RJLA 1DFQA 3D3AA 2CGPA 2K0GA 4NOTA 3BTXA 1Y7BA 1XE7A 3F2ZA 3MIBA 4QWNA 3SEEA 1EP0A 3TB0A 3MIHA 4IEVA 4BQ3A 2IXCA 3HAGA 3LDRA 1AXYA 2WWJA 4TLGA 5IATA 2FDKA 3LF7A 3AZZA 4QM8A 2XOMA 1DZQA 5DDJ1 1L7QA 2A70A 3T2PA 1KRIA 3MV01 3P3NA 2RVAA 4FO9A 4Q4X2 3H3LA 2E26A 4I3PA 4Y5SA 5F5AA 4M4PA 4Q4X1 3E5XA 5FKCA 3U78A 3O1TA 1KXGA 2Y6HA 3QH6A 2WO3A 4QXHA 5J37A 1Y43B 2XJTA 1DQ1A 1W99A 3ACIA 5LEKA 2FCVA 4YG0A 3W21A 5CADA 5KXEA 3A23A 3M3IA 4BMEA 1F15A 2ETEA 2VZ1A 4HXCA 4LBLA 2N7GA 2R072 4LHNA 4QKBA 5L7OB 2DUQA 3ZLIA 3J7NA 5GLUA 1XE8A 1XSRA 3OGRA 4UXAA 2DUOA 3HPNA 4P02B 3AP7A 5F3IA 4EV0A 2IZWA 1MR5A 4BXFA 4RS5B 4QX0A 4GH4C 1TNRA 2OX0A 5FP7A 1UWWA 1V6OA 5AC92 1EPZA 1CAXB 2I74A 1OQEA 2GDFA 2XGXA 3BN6A 3GZEA 4QQLA 1XYNA 4S2DA 2RMU2 2VZQA 1NA1C 3EYPA 2B9UA 3OY8B 1US3A 2DWRA 2RMU1 2RV9A 3LSEA 2BU9A 1HQLA 4QX8A 5LW9A 2QVSB 2QTWB 4FFGA 2BFUL 1DYPA 4RHV3 3OPTA 3FL7A 4B1LA 3VZNA 1ZA7A 2X8KA 1SBDA 4CP0A 4MGSA 1B35C 2QDNA 4QX7A 2GC0A 2XG3A 1R081 3WNXA 3ZXJA 1DZTA 1V9U2 3KGLA 5IHRA 3GBWA 1GQGA 3AMPA 1LTEA 2WS91 1WBLA 5GLTA 2C4XA 2IXJA 3KB5A 4IEPA 3WD5A 1UKRA 3V64A 5CFDA 1ZZ6A 2JIJA 1DLCA 5A7SA 2PLV3 4YM0A 4E8DA 4BJ0A 2VJXA 4LBQD 3LWCA 1D0GA 3H8RA 1JYIA 4QQHA 2JE8A 4CCKA 5KHGA 3FJSA 4YVWA 3SCFA 1VBA3 2BWCA 1FAYA 1M06G 3WLUA 1UO9A 1PVXA 2YFZA 2AEYA 2X5IB 4B29A 4FPFA 2KM2A 5FZOB 1JMUB 1N47A 1NXMA 4YGCA 5FXVA 3WXPA 5AFEA 2QQVA 3KWVA 2ZAHA 3GZAA 4R4ZA 3OD0A 2XLGA 2W95A 4AFBA 3C2UA 3QOPA 3EXUA 4CPBA 1Q5OA 3KCXA 3QLQA 4KGGA 4LIVA 2CYFA 3IWZA 4IV1B 5IVCA 1FV2A 3I4IA 2XB6C 2D43A 1S0DA 3WQ0A 1J58A 1OI6A 2AYHA 1R64A 4G4FA 1SCSA 2OVUA 3RSJA 1MS4A 4EN6B 2YBKA 1S0EA 2VW0A 3PVOA 3UGFA 5K0UC 3MPBA 4E4SA 4GB31 3C3VA 1UY1A 1LHVA 1ZM1A 2ZX2A 1YI7A 5F6LB 4KWLA 1JS9A 1YRZA 1YIFA 1REDA 3AKSA 4K6BA 5DUVA 1QH7A 2XJSA 5FZOA 3S57A 4OZOA 3FUOA 2YC2A 4C91A 1OF4A 2DCKA 3K4AA 4LORA 2AGSA 2ZX0A 4RS5A 4ASMB 1HJFA 2E7QA 3CJIB 1WD4A 4XCAA 3HBKA 4Z07A 3WHUA 3ZSKA 1JZ2A 3O1VA 2VGDA 3ZYHA 1VBC1 4ATFA 1AR71 4BCUA 2Q1FA 5LZ6A 1L7RA 2W94A 3NJYA 1U5IA 5IT6A 3S0MA 1VALA 2PLV1 1YWKA 5KHJA 2PN5A 5CFDB 3LKJA 4RR3C 3LDKA 2DFCA 1ZZ9A 2WQZC 4BQXA 1MQTC 4TN7A 5JOWA 1ND2A 4JQTA 5T5OA 1A78A 1G8WA 1RUJ3 1AUYA 1XYPA 3AKTA 4FCAA 3VUOA 2OQ7A 1QEXA 4OI4A 5FBZA 2UY8A 1QJZA 4BZ4A 4GB33 1GV9A 1RUD1 5FPLA 1U5YA 3OYWB 5FZKA 5FRAA 2MPFA 3H8UA 3ECQA 4R9DA 4S2HA 5IK5A 4XHXA 3T0AA 5KHIA 4K21A 3BOPA 2WNUA 1WWYA 2YG0A 3FLPA 5FPZA 1C5IA 3KT1A 3K48A 4QXKA 2V5YA 4LEJA 4GMP0 2IFWA 4I02A 1C1LA 5A3TA 5FZ1A 5J48A 2JG9B 3I8TA 1WCDJ 1VBE1 4Q26A 3H1YA 3AYDA 2XKOA 4KWKA 1AL21 1AYN3 1VRH2 3IPVA 3WNNA 3ZFFC 2VZ3A 3LA2A 1N1VA 3AMMA 5FY4A 1Z7S3 5B4XA 1GOGA 2K2SA 2JDKA 4KWUA 3LA7A 1G9DA 2OT7A 4HKOA 5CKMA 3VBRC 1GNZA 3USUA 4CUGA 5ABJB 1UL9A 4AQSA 4D94A 4W65A 1PIV3 1RGSA 1V6MA 3CEWA 3PU8A 4LHLA 3OUHA 4YVSC 3UKVA 3HT2A 3WNKA 2ZGTA 5FOJB 1O4ZA 1WD3A 1RUG2 2A73B 5EPAA 5HPOA 1AXKA 4DUWA 4M0NA 3IT8A 4GWNA 2ZCWA 4A44A 1BCXA 4XE9A 3U07A 2VVFA 3IAPA 4N53B 3NNFA 3ENRA 4IV3B 1NCRA 3GJAA 3SQOA 2NLRA 3ES1A 2VBBA 3TYJA 2VW2A 4JV4A 4TSVA 3VBSC 1NLSA 2EIGA 2JDAA 3WNPA 4E9KA 3O1PA 1V6IA 4JKLA 5F37A 2TUNA 3A21A 4EWDA 3HJRA 2ES3A 3CZJA 3V0BA 4XQ4A 1RIRA 4QXBA 3LOBA 3AM2A 4QB1A 1SACA 3VBOA 4EN0A 1K5JA 2PAEA 4PBOA 2ZGRA 1LRHA 3WNMA 5BUVA 2PXJA 5DPNA 2P6HA 1BVP1 3AK0A 3T30A 2RS13 2VO5A 2ENRA 1WMXA 1POV1 3O1UA 2RJKA 2GMMA 5EIYB 2WQ4A 1K5MC 1H1IA 3LGRA 2R30A 2YUEA 1JHNA 1QF3A 3NRUA 3POWA 3ZYRA 3GYDA 4LKFA 1C8M1 1W2UA 2WYFA 3LEMA 2PFWA 5BY5A 1XQNA 2ZHKA 3OTFA 5F9TA 1HRI3 1DHKB 4D7TA 3VDDA 4NWWA 4AQ2A 3VKFC 4Q0QA 5L7OA 1OKOA 3VGIA 1YHFA 1IPJA 4QKNA 4BLJA 5LEJA 1VBB1 4MADA 2ADEA 4QGNA 3PVEA 1RVF3 4UYBA 3USSA 4Y33A 2V4VA 2RS31 5B2GB 4CCEA 2CDPA 1BJQA 3C8XA 2WO1A 5F2SA 5FYIA 1UOBA 5LA2A 5T52A 4YVSA 3D82A 4I01A 1DU3D 1DZRA 1OXCA 3WQ7A 1OOPA 4F83A 1R1A1 3BYWA 2VOVA 4YZ4A 3AKQA 1OLRA 1UW8A 2PLV2 4QDSA 2RHPA 4IGPA 2ZGOA 4ZS2A 5A3UA 1MEC3 1RJ7A 2ZEWA 3I97A 5FZBA 2V4AA 1KJLA 2Y38A 4K8RB 4HL0A 3I7DA 3K3NA 4LUKA 1FYUA 4RFT0 3WP6A 1LKNA 1OUSA 2VTXJ 5JIAA 2P4EA 3TEYA 4HKWA 5K0UB 1JN2P 1NY71 2EAKA 1O3SA 5BNOA 3ZFEA 3FC0A 1LOAA 3GM8A 3RMXA 2VOWA 2DYCA 3ES4A 3LDBA 3DEMA 5IVBA 2W1SA 3H3UA 3POEA 4GH4A 4CU6A 5J96B 3J8F3 4S2GA 3D4KA 4DZGA 2WKKA 4CXYA 1J1LA 4IUGA 4XFFA 2QJVA 2R16A 3WG2A 5C70A 5HV4A 4GXLA 3VL9A 4AFMA 4IE5A 2A7AA 2BJSA 4OZXA 3QCWA 3T4VA 4B3NA 1ZRFA 3RYPA 3H3ZA 2WN2A 3UT0A 2WAAA 3WQ1A 4QB6A 3ZXKA 3H0OA 4URAA 1HDKA 1WLDA 3H42B 3A0NA 5K7PA 3WG4A 2DVBA 2WL1A 1IG0A 3B01A 3D6EA 3AYAA 3KVBA 1S55A 1ZX5A 2OUJA 1UYXA 1ZBE3 2P6CA 3AMNA 1ZRIA 1ODMA 1GOHA 4YW7A 2J42A 2XH6A 1ONAA 3IDAA 5KXDA 3BTYA 2HWD1 1MZ5A 1QJU3 4IE4A 4UF0A 4D6SA 3T0BA 4JKMA 1O3TA 3VBFA 3LSDA 1YUDA 4L99A 5JZGA 2QDRA 5EXOA 3SC7X 2ZZJA 3JB8A 4QQOA 4DB5A 5A70A 1BKZA 1LEDA 2A71A 1L3JA 1XSQA 4ITCA 2JIGA 2E32A 1CX4A 3R4SA 1HXS3 3SH5A 1H4HA 4CDWC 3GBFA 1TZOA 3WY6A 2XDVA 2VCAA 5CBLA 4LKDA 3DPRA 4HOOA 2R1DA 4NIIA 3MV11 1CAWB 2IXIA 3USUB 3WF4A 1V00A 3KV6A 1NYWA 1O8SA 4TYSA 4Q4Y2 4YZ3A 4LO5B 4XXPA 5KBFA 4Y26A 2W9XA 3D8CA 1O5UA 2J1UA 1W9FA 5FDBA 1AX1A 1U5ZA 2PA7A 2Y26A 5FK7A 4ASKA 1GZWB 5ABJC 1TME1 4IW3A 1PO23 5FO9B 4CCLA 3AKPA 4W6WA 4ZXEA 4XJAA 4BU2A 3I3MA 5C71A 3IDBB 4DEVA 4ZU4A 2E31A 1SFNA 1GP4A 3JCIA 4MX3A 1WGPA 2R042 3ITQA 3UGHA 2J1EA 1GQHA 2B42B 4IV3A 1HB3A 2RR12 3PMEA 1W0PA 4AL9A 4OUSA 5GJ6A 1ULPA 1VP6A 5BNOC 2I07B 3R6SA 1E57A 1SLBA 3BPZA 2QQPA 5LY1A 1LECA 1NZCA 1VMFA 3K75B 4X6RB 3ZVXA 4CP9B 1MS3A 1O59A 2AENA 2JG8C 3LPGA 4JGZC 3MF9A 3QACA 4LTAA 2BQPA 2J1VA 4L92A 4CA9A 2LTNA 1NE4A 1IS3A 1Q8SA 1DGRA 2HWB1 3T1LA 2O14A 4I2OA 3RDIA 3KSCA 1BLZA 2JENA 4JVAA 3UKNA 3J8F2 4U2AA 1BQPA 1ND2C 3SNMA 2MHFA 4LK6A 3Q8BA 4PJYA 3WNLA 4XAEA 3O12A 1W8TA 4XCBA 5JLVA 1ZREA 4YZ2A 3BALA 5I93A 4BA6A 3UNPA 3DXTA 3DPRB 5KC6A 5A3NA 1VBB2 3AYCA 3HWJA 2BNOA 2WO7A 3ZFGA 2HWC1 4IV1A 1UZWA 3ZYJB 4LO4B 5BNPA 2CDOA 3HT1A 1FXZA 4N90A 2ZGKA 4R9CA 4EYUA 4K9SA 4Z82A 5C3SA 5FZCA 4JRLA 2KXLA 2OZ6A 4DY5A 3AVSA 5JSPA 4Y1VA 1NLRA 2QQMA 5FUPA 4D6RA 1UQXA 2VZOA 3GCWA 4IEOA 1WW7A 2R0FA 1POV0 4D8MA 1N1TA 4Q8KA 2GC1A 1ZVFA 4DPNA 1HB2A 1PO11 3VZOA 5A3PA 1GZCA 4XMAA 3J7LA 4O7XA 5FZEA 1JTZX 2CSGA 3ALQA 2YY1A 4PDWA 4CDXA 5DQ0A 2YU2A 5JMOA 3HIFA 4GAZA 2CTVA 1G9FA 3UETA 2GNBA 4R4XA 1VBA2 4HBNA 1URXA 5A1AA 2BZDA 3M2MA 2F17A 1RYYA 1OA3A 5J7MA 3ZKUA 3L2YA 4MHRA 3BU0A 3PDQA 2A6YA 2VBPA 5IW0A 1W3VA 1ODNA 1JBCA 3PIJA 3CDZB 5IWFA 2JE7A 1GQPA 5JOYA 4XJUA 4YVWB 1HXS1 1O5LA 5FPXA 1B09A 4FAGA 4AZZA 4J6GA 1IQAA 2XJPA 4IE7A 4P5YA 2VMEA 1LHUA 2DDUA 3MEPA 1BMV2 2PHTA 5E1RA 4NHMA 3GNEA 2PHUA 1AF9A 4QT6A 1XB9A 1QJX2 2GN3A 3ABZA 1W2TA 3MW2A 5FZHA 3MGUA 1NCRC 2DVDA 3AZWA 3SKJE 3T2OA 4Y1ZA 2J7MA 3OBAA 1JYXA 4RSUA 3JU9A 2VW1A 3MLKA 4WM8B 4XURA 4KG8A 3PUHA 2BERA 1PK6B 4G3YC 5FZ0A 1PX4A 3I3BA 3WP5A 1QQP2 3ZYFA 4NRMA 5I8TA 4BHPA 4XJWA 3S5AA 1ZRRA 3JQXA 2D7FA 4I09A 4JKKA 2VOXA 1W8OA 3W5MA 1Q8OA 4MYEA 1ST8A 1W28A 3JD72 3I54A 2PHLA 3FUQA 4KI5M 4TLFA 3RZZA 3HQXA 2PHDA 1F5FA 1DYKA 1ND3B 1YIPA 1AR72 1IG3A 2WLQA 1PK6C 3EJKA 2BWAA 3EO6A 5FMCA 1CESA 5LA9A 5LRSA 4JGYB 3WF3A 2W39A 4CXXA 4Y22A 1SPPB 4PQ9A 1UY2A 1MACA 1C1FA 2V72A 4FOQA 4AEDB 5HXMA 5JXGA 1NA1B 4COWA 2E9QA 5DAXA 3VBFB 3VDAA 2TEPA 2VMIA 5FQ0A 3RWKX 3CU7A 1UYPA 4C1WA 1PNFA 1W6QB 1X8EA 4LQRA 5JI9A 2XPJA 4CTEA 3SCHA 2BGCA 3EHKA 2EXIA 2OXBA 3D0JA 4AFAA 5LBFA 1JZ5A 5D8AA 3NNMA 2A3WA 2W1QA 4AWDA 2VMHA 5CFDC 1WLCA 3WDWA 3N3HA 1R091 5FLJA 5FZAA 5JSOA 4V2VA 5IVEA 1KQRA 4LNVA 1DF0A 1SEFA 2FZ1A 2GSYA 5L73A 4JQRA 3U14A 1YEWA 1BK0A 1B35A 3B69A 3OGSA 2D40A 1UMIA 3E5QA 2BW8A 1CONA 3K4ZA 2WFF1 5BPXA 3JQWA 3MLJA 1W0NA 3I2KA 2HEVF 4LLOA 5LRRA 1CQ9A 3SH4A 2GC3A 3KV5A 3OGGA 3WW3A 1QJU2 4DXRA 4AHXA 5CZKA 2BOIA 5JMCA 2X09A 4JCKA 2EIBA 1BYHA 1JI6A 1CX1A 1MZFA 4XBQA 2YU1A 3GDBA 3JBG3 4IQPA 5JXJA 1BBT1 1UZZA 1MVQA 4PQQA 2IXLA 1HB1A 5FYHA 3ZR5A 1VLNA 5FZMA 1LENA 1TMF3 1WW5A 3MIFA 3CKHA 3SCGA 3BTAA 1YFYA 3J8F1 4NPRA 3SXWA 4KU7A 3TOJA 4DIQA 3ETPA 2VMCA 4LO8A 1YQCA 2A3XA 2BVBA 1T6BX 2RE9A 3MHZA 4ZPIA 1O8PA 2QBXA 1H8TC 3WSOA 4DXTA 4QPIA 1W3XA 1E5SA 1YFUA 4Y1XA 4XETA 2TBVA 1BVVA 1YJLA 1X82A 3APBA 1APNA 3AZYA 1ULGA 3IAQA 2FDJA 1SPPA 1RUG1 1IOAA 1DYOA 2FDGA 4GA9A 1S2BA 1FMD1 4WZFA 3KCCA 2HWF3 1WBFA 1HV0A 5GZDA 2XBO1 2YHJA 1H8TB 2VM9A 1F4AA 1WUVA 3VHNA 5FYMA 1RUD2 3OBRA 4NUBA 5M0TA 5D8AB 2D6MA 2BNNA 2YBSA 4XTPA 4CDQA 4D69A 1V6LA 2VQ0A 4N53A 4NO4A 2VQAA 1RUI3 4OHVA 1NCQC 2RS33 2VUJA 4FFHA 5H9SA 3TNQA 3VZLA 4QPGA 5KWRA 4Z1VA 1JYWA 1AR63 4W8JA 2X29A 4GJZA 2EXJA 4K20A 2D6OX 3IMNA 1VBA1 4CEWA 4BM8A 3WP3A 2WRAA 2ZAAA 3CHXA 2XJVA 3K77A 1HRV1 1BHGA 3OD4A 1SLCA 3W20A 5KC5A 3O1SA 4Y5Z0 4YW5A 3EMRA 1LGNA 2R0HA 1OMIA 3CQOA 1VAMA 4FI9A 3V65A 1RUJ1 4UW6A 2HWD3 3N7MA 2BVVA 4HANA 3SLIA 1CIWA 2GH2A 1KDMA 4HONA 2G1MA 4FVVA 1UOGA 2SBAA 2Y6GA 4HVQA 5GZEA 4FPLA 4MH0E 3KGZA 3U75A 1ZZCA 1RC6A 1W8WA 2ARAA 3PTRB 2H6CA 2JG9C 4QU1A 3ST7A 1X9TA 3TAYA 3ZFFA 1QXRA 3L9JT 1QJX1 2VZVA 4JHTA 3WDYA 1AR61 1JZ4A 2E6VA 3AJYA 5BNPC 4NR1A 4K8FA 4Z2AA 1ND2B 2HLEA 5ISLA 1TG7A 3S7IA 3BUCA 4PBPA 4GB32 1CAVA 1C4RA 4XF0A 2YV8A 1EV13 5JPMB 2NPIA 4H55A 5F5IA 5I0UA 3T3YA 4BB3A 5FZGA 1QWRA 1U5XA 3I3EA 4BQ2A 2F6BA 1FOD2 1UU4A 2ARBA 2WDBA 4HPKB 1W06A 2ARCA 2W52A 1W8NA 1A6CA 3ILNA 4Y4YA 2H0BA 5BYNA 2DTWA 1VPHA 1VJ2A 4D0QA 1WCKA 2NM1A 4LOTA 5A3MA 3F95A 4KBZA 2YXSA 3OSDA 4JC1A 4Y20B 1GLHA 2VZTA 2IWGB 5FJKA 1RITA 1ULOA 2D98A 3WNOA 2JWPA 4B7EA 1G86A 1YJKA 2IC1A 4BQYA 2Q4SA 5BV6A 5FR3A 5J36A 3VHRA 2W08A 4KH9A 4ONUA 4M3CF 4IDZA 5KHKA 3O0WA 4IGOA 1N3OA 2NQYA 3VBHA 1NCQA 1XC6A 2ATFA 3A7QA 1A3KA
chains in the Genus database with same CATH topology
3HQUA 4ZPIA 5LBCA 3NNFA 5IAVA 3GJAA 4NHKA 4MHRA 5DAWA 4NHLA 4Q5OA 5LB6A 5EP9A 3KT7A 3DKQA 5M0TA 2HBTA 2JIGA 3PL0A 4NHMA 4NHXA 5IATA 5IAXA 3MGUA 2A1XA 4XC9A 5DAPA 3NNLA 3W20A 4XAAA 3EMRA 4XCAA 4Y5SA 5LBEA 4UWDA 2G19A 4Y5TA 4XACA 2G1MA 4IW3A 5LASA 5L9RA 2FCVA 5HV0A 3W21A 4BQXA 3OUJA 5LBBA 3OBZA 5DAQA 5DAVA 3ITQA 2RDQA 3HQRA 4NAOA 5L9BA 4XABA 5LA9A 2RG4A 5DAXA 5LATA 3KT4A 3KT1A 3GJBA 4BQWA 2FCTA 5LBFA 3NNJA 3NNMA 3GZEA 2HBUA 5A3UA 2FCUA 4JZRA 2RDSA 2V4AA 2Y34A 5C5UA 4XCBA 4MHUA 4J25A 5C5TA 5EQUA 4KBZA 4NHYA 2OPWA 5L9VA 4NMIA 4ZONA 3BVCA 4BQYA 3OUHA 5HV4A 2RDRA 2JIJA 2RDNA 3OUIA 5EPAA 2Y33A 5ERLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQU A;  4ZPI A;  5LBC A;  3NNF A;  5IAV A;  3GJA A;  4NHK A;  4MHR A;  5DAW A;  4NHL A;  4Q5O A;  5LB6 A;  5EP9 A;  3KT7 A;  3DKQ A;  5M0T A;  2HBT A;  2JIG A;  3PL0 A;  4NHM A;  4NHX A;  5IAT A;  5IAX A;  3MGU A;  2A1X A;  4XC9 A;  5DAP A;  3NNL A;  3W20 A;  4XAA A;  3EMR A;  4XCA A;  4Y5S A;  5LBE A;  4UWD A;  2G19 A;  4Y5T A;  4XAC A;  2G1M A;  4IW3 A;  5LAS A;  5L9R A;  2FCV A;  5HV0 A;  3W21 A;  4BQX A;  3OUJ A;  5LBB A;  3OBZ A;  5DAQ A;  5DAV A;  3ITQ A;  2RDQ A;  3HQR A;  4NAO A;  5L9B A;  4XAB A;  5LA9 A;  2RG4 A;  5DAX A;  5LAT A;  3KT4 A;  3KT1 A;  3GJB A;  4BQW A;  2FCT A;  5LBF A;  3NNJ A;  3NNM A;  3GZE A;  2HBU A;  5A3U A;  2FCU A;  4JZR A;  2RDS A;  2V4A A;  2Y34 A;  5C5U A;  4XCB A;  4MHU A;  4J25 A;  5C5T A;  5EQU A;  4KBZ A;  4NHY A;  2OPW A;  5L9V A;  4NMI A;  4ZON A;  3BVC A;  4BQY A;  3OUH A;  5HV4 A;  2RDR A;  2JIJ A;  2RDN A;  3OUI A;  5EPA A;  2Y33 A;  5ERL A; 
#chains in the Genus database with same CATH topology
 2W1W A;  4QPG C;  2ARE A;  2QQL A;  4YNI A;  4CZS A;  1RUD 3;  1VR3 A;  4BQ4 A;  5TSW A;  1VBD 1;  3O0V A;  1AHS A;  1EUU A;  5J3U A;  2OW4 A;  3NJV A;  5C8W A;  1GZT A;  2WFF 2;  1AL2 2;  1C8M 2;  1LU1 A;  4P14 A;  1S0C A;  4Q4X 3;  2P1B A;  1DGL A;  1S0I A;  5IJR A;  3HN3 A;  4KBB A;  4I3G A;  4YWA A;  3ZOI A;  3GZT B;  3VBO B;  2ZGQ A;  5JOZ A;  4DUX A;  4DFS A;  2BBV A;  2EVX A;  3AZX A;  4I0A A;  3HBZ A;  3FLT A;  4XIK A;  5IK4 A;  4RGK A;  3LPF A;  1XNB A;  3K2O A;  4N7I A;  4R9B A;  2WNV C;  1WA6 X;  2AR6 A;  3CJI A;  3SMH A;  3VBH B;  4MG2 A;  1RMU 1;  1OLQ A;  4Q0V A;  3OEA A;  4W6X A;  1MS8 A;  3VDD C;  1H2K A;  5C33 A;  3T2T A;  5BNN C;  5E16 A;  2PMW B;  1ENX A;  2A6W A;  1VB4 A;  1S2E A;  2E7T A;  5FK8 A;  1VBC 2;  1W39 A;  3LFM A;  4HKL A;  2UYB A;  3POS A;  4CEY C;  3BOW A;  2A1X A;  2UYA A;  3RZM A;  2GH8 A;  3U4S A;  4D7Y A;  3B00 A;  3MLL A;  5CIR A;  3VKO A;  2KR2 A;  5FUI A;  1RXF A;  2JDM A;  1ASJ 2;  3CBN A;  3ZSE A;  2VTX A;  4GMP 3;  3P1I A;  3O5S A;  4UWD A;  3OBT A;  3N4M A;  1N3P A;  1W90 A;  1T6G C;  3VZK A;  1MVE A;  4MVT A;  4O9E A;  4A42 A;  1OFS A;  1JU4 A;  1UXX X;  1F35 A;  1ND3 A;  3K46 A;  5F32 A;  4XIL A;  1ZBA 1;  3RZJ A;  4WM8 C;  5ERL A;  1PGW 2;  1RVF 1;  2HWE 3;  5E89 A;  2VNV A;  3GCX A;  1ULE A;  3FHQ A;  2ZKN A;  2VVD A;  2LAL A;  4NAO A;  2B8M A;  2XUM A;  4FPY A;  5HCF A;  3HOB A;  1RTV A;  5A33 A;  5FYV A;  1S0J A;  5FQ0 B;  1OOP B;  1F4H A;  4AI3 A;  1YFW A;  2FDI A;  4COZ A;  5DUX A;  1PO2 1;  3RI8 A;  3PVN A;  1RUO A;  3WV6 A;  1HRV 2;  2C0Z A;  2DBN A;  1D4M 2;  1ENS A;  3IZO A;  1JZ7 A;  1PO2 2;  3E6B A;  1UIK A;  4MGT A;  5FZ3 A;  4KG0 A;  4JGY C;  4A6O A;  3DF0 A;  2ZBJ A;  2DVG A;  2WBK A;  3FBM A;  1PMJ X;  3CMG A;  3VBH C;  2XHN A;  3LA3 A;  4FTS A;  1JOB A;  2RDS A;  1HQW A;  3N9P A;  2HKX A;  3OEB A;  1QJY 3;  3S30 A;  3MYX A;  2G9F A;  4LXL A;  4BQ1 A;  4PI2 A;  4DS0 A;  4GH4 B;  4H3W A;  4XFH A;  5A3W A;  4Z8B A;  5A80 A;  5A32 A;  4ARX A;  3WF2 A;  4EN7 B;  3VBU B;  1Q3E A;  4QDR A;  4OLL A;  3BKZ A;  5FP8 A;  1J3P A;  2AAC A;  5EQU A;  4B7K A;  5C3Q A;  1CWP A;  1CR7 A;  2CWM A;  5FZ8 A;  4LBQ A;  4MGZ E;  5DZF A;  5FPB A;  4ISR A;  3WW2 A;  3VBF C;  1QOS A;  1J83 A;  4LMF A;  3I2F A;  2QE3 A;  1AYM 3;  2ZEY A;  3WG3 A;  1DGW X;  5T5J A;  4B1M A;  4X6Q B;  4BYY A;  1TE1 B;  2WWU A;  2ZX4 A;  2QCS B;  4CDU C;  3BPS A;  2PHX A;  1D4V B;  1D2Q A;  1WMD A;  1XYO A;  1DP0 A;  3KQ4 B;  4GUL A;  4UW3 A;  4AYU A;  3H8X A;  2VMF A;  1D7P M;  1WMF A;  3I2H A;  5JPN B;  3ROU A;  3ZMO A;  1XJA A;  1UKG A;  2YPJ A;  2D3S A;  1CAU B;  2GME A;  2E63 A;  2Y6F A;  5FZD A;  4XFC A;  1N1Y A;  2B4K A;  1AR8 1;  1OD5 A;  3NJX A;  4P9Y A;  5E8A A;  4RHV 1;  5A7Q A;  1CAV B;  2BGP A;  5DMY A;  4GQ7 A;  4QGL A;  5JCT A;  2O8O A;  1AVB A;  3PNA A;  1AJO A;  1VBC 3;  4GZ9 A;  3N9O A;  1H1M A;  3O7O A;  2FMY A;  2X5I A;  2QQN A;  4O61 A;  4Q5O A;  4OHX A;  4AW7 A;  3RZG A;  3PUS A;  4QM9 A;  3ZDS A;  3DGT A;  3NO8 A;  1AR9 3;  4PDW B;  2P3J A;  4I0B A;  4QHO A;  2XQX A;  5ABJ A;  4XVH A;  1SLA A;  2Z69 A;  4KQ7 A;  3KV4 A;  4CU9 A;  5JOX A;  5GLW A;  3E97 A;  3N9Q A;  2Y6K A;  3SKV A;  3S5Q A;  3N9L A;  1E5H A;  5FYB A;  4DXS A;  3FLR A;  3IKW A;  1GSL A;  1LGC A;  1HXS 2;  3LQC A;  1DCS A;  1N3Q A;  4GWI A;  4LE3 A;  5IK7 A;  1RHI 2;  1GZW A;  3ACG A;  4PT6 A;  5FZ4 A;  1RHI 1;  1SCR A;  5JAX A;  1I1E A;  1EAH 2;  2FBE A;  4DO0 A;  4XBN A;  1VBD 3;  1XNK A;  3ZFE C;  2GND A;  4CCC A;  4XJ9 A;  3ZN4 A;  4CUC A;  2QQU A;  3THD A;  3B9I A;  4X8N A;  2WZR 2;  4KU8 A;  4RR3 B;  4QHZ A;  2Z42 A;  5JR2 A;  1UZV A;  4SLI A;  4Y1Y A;  1SMV A;  3DN7 A;  1S1A A;  3KZ4 C;  2PQS A;  1AX0 A;  1BEV 2;  4LBO A;  2ID4 A;  5JR7 B;  1ZA4 A;  1ZBE 1;  1Z7S 2;  2D6K A;  1QQP 1;  4RGA A;  2Y64 A;  1KS5 A;  1TME 3;  4RN5 A;  3AC0 A;  3C7O A;  1WA4 A;  1WZX A;  4Q4W 3;  4YRD A;  2NMO A;  3PHM A;  1Y9M A;  2ZS6 B;  2J1R A;  3JBG 1;  4OFG A;  1O3Q A;  2HYX A;  4FPO B;  3VBS A;  3TN9 1;  4M3C E;  1R08 2;  1OD3 A;  4EJR A;  3OG2 A;  2IVI B;  5A3L A;  1IQD C;  4ZZ5 A;  2ZGU A;  3OYW A;  1OUR A;  1JOD A;  4N9I A;  1OQD A;  3D5O A;  4COV A;  1J3R A;  4E2S A;  4E27 A;  1JXN A;  2VXR A;  1J84 A;  4N43 B;  4BMB A;  1MZ6 A;  3CZU A;  3PIG A;  5EZW A;  3OOX A;  4FFF A;  4AFD A;  3B7M A;  2ZJC A;  5CA6 A;  5FO8 B;  1PGL 2;  3MID A;  1CAU A;  5LA1 A;  1R09 3;  2ZGS A;  2D6N A;  2F4L A;  4KL1 A;  3M3E A;  3BB6 A;  1W6O A;  1QXP A;  1LGB A;  2Y60 A;  2H0V A;  1GWK A;  1DQ2 A;  2VCM A;  1NZI A;  3AKR A;  4WVM B;  5FZ7 A;  1Q56 A;  4QDQ A;  3RFR A;  3VBS B;  4E4Z A;  5CKQ A;  4Q1R A;  2VZR A;  2EXH A;  3POG A;  4XUN A;  3NVC A;  5EWS A;  3GAL A;  1K5M A;  1I3H A;  1WLT A;  2X05 A;  2GP5 A;  2PHR A;  2X5I C;  2XL9 A;  3ON7 A;  2WA3 A;  4XQD A;  1POQ A;  1O4T A;  2D97 A;  2P2K A;  3P6B A;  2R6Q A;  1S0F A;  3DUI A;  2CGO A;  2VC9 A;  4UFH A;  2WC2 A;  4XQW A;  5BNP B;  4YG6 A;  1IPS A;  4FTB A;  1H9W A;  1UAI A;  3RWN A;  3NW4 A;  5A6Y A;  4PDW C;  1LEM A;  2IXH A;  3FN9 A;  5CYY A;  4FBF A;  4IE0 A;  5JZG B;  1XND A;  4JDM A;  5FMB A;  3AFK A;  3WDX A;  4P9I A;  2WS9 3;  3V56 A;  4XW3 A;  2VQU A;  2K9Z A;  3VLB B;  1LOF C;  2WJS A;  5EYX A;  3ZKY A;  1UCX A;  4XUO A;  4CCD A;  4URT A;  2P5B A;  3WHT A;  1W6N A;  3LIH A;  5FZI A;  4FP2 A;  1YNA A;  2WT0 A;  1E5R A;  1JZ6 A;  1RUH 2;  1XNA A;  4CDU B;  5C4W A;  3J4U H;  3FX3 A;  1OBN A;  3J7M A;  4LHK A;  3UES A;  2RS5 1;  5FFO C;  1NQJ A;  1T2X A;  3MIC A;  1RUF 3;  4ES8 A;  5JSR A;  3W5N A;  1NT0 A;  2Q8D A;  3VZM A;  1H6Y A;  2D44 A;  1QDO A;  4QQP A;  1PK6 A;  2G9Z A;  3VD5 A;  1QHD A;  1F2N A;  2NZ9 A;  3PU3 A;  4LBQ B;  5DZE A;  5G04 L;  5K9Y A;  4UFM A;  2IXK A;  1XU1 A;  4TXW A;  5CG8 A;  4MXV A;  4LIT A;  4P5H A;  2V73 A;  4EN9 B;  1JYN A;  1O7F A;  1C28 A;  4KGQ A;  4V1P A;  4EE2 A;  1OVS A;  1DIW A;  3LCP A;  3B9C A;  3GBG A;  4OUM A;  3BIE A;  2DCJ A;  4A7Y A;  1UPI A;  1O6U A;  1TMF 1;  1Y9Q A;  3OUJ A;  5FP3 A;  1VAK A;  1LOG A;  4YFZ A;  4RYD A;  3S7E A;  3T09 A;  1VRH 1;  4NIG A;  2J1T A;  4CDW A;  5J98 B;  1HKD A;  4LBJ A;  1NE6 A;  3AMH A;  1YXW A;  3LB9 A;  5FY8 A;  4CUB A;  1UPS A;  2GAL A;  2UU8 A;  4J1X A;  5FY5 A;  4PLM A;  1G9A A;  4XF1 A;  3C7H A;  1NG0 A;  4CU8 A;  1NCR B;  2RMU 3;  4YW1 A;  2H6B A;  1DLL A;  2GMP A;  3H9A A;  1OA4 A;  4BQW A;  3N35 A;  4Q0U A;  1WCU A;  2AEZ A;  2PQQ A;  4M3C A;  5F8P A;  4DIN B;  2W3J A;  1OUX A;  5AC9 1;  5C4W B;  1A8D A;  4Q1P A;  4RQP A;  1NAE A;  4M00 A;  3RRD A;  2JD9 A;  3WX5 A;  3BTZ A;  3WQB A;  3OF1 A;  3JXS A;  3KCY A;  3PUI A;  4A7K A;  1ZBE 2;  3MDP A;  3OCP A;  4AE2 A;  3FE5 A;  4XF4 A;  2JB4 A;  4ZU7 A;  4QKF A;  4NRQ A;  5FP4 A;  4R9A A;  1ULF A;  3JD7 1;  4Q4V 1;  3NAP A;  3III A;  1FMD 3;  4NPM A;  1VBE 3;  3MZH A;  2WS9 2;  4MXW B;  4ARY A;  5LCW L;  1MS1 A;  3QD6 A;  2Q8C A;  4OUL A;  3V0A B;  1AR9 1;  1FOD 3;  1K3I A;  1AR9 2;  2VZU A;  2J22 A;  3ZN6 B;  1SBF A;  1AXZ A;  1UX6 A;  3OY8 A;  2OII A;  1HLC A;  2VY0 A;  2PAM A;  1AZD A;  4XUT A;  1QH6 A;  1LOC A;  2W68 A;  4MET A;  4BLI A;  2OA2 A;  3VN4 A;  1RUH 3;  4OMC A;  4MGK E;  1VMH A;  1C3H A;  1LNS A;  3ZXL A;  4AG4 A;  1PX3 A;  3RQ0 A;  4D3W A;  1YI9 A;  3TEW A;  3H7J A;  1QJF A;  4CEW C;  5FY0 A;  1J59 A;  1HB4 A;  1UF2 C;  2WFF 3;  2A6Z A;  5FYU A;  1C8M 3;  1XE0 A;  2WAO A;  2YZ4 A;  4HET A;  3UKT A;  4NRO A;  3K51 A;  4PHZ A;  2ZEX A;  2CY6 A;  4AVC A;  1QNW A;  1BMV 1;  1PNG A;  1UXZ A;  5F5C A;  3RVH A;  1VB2 A;  1YC6 1;  2WZR 3;  3U10 A;  1WKY A;  4DOU A;  1CAX A;  2W5F A;  4EWE A;  1W9S A;  2Y0I A;  2AH2 A;  4P00 B;  4HVO A;  1TNF A;  3MBW A;  3EB7 A;  3VD9 A;  4V2W A;  1PMI A;  5FY1 A;  1AL2 3;  2NMN A;  1JZ3 A;  1W03 A;  4H7M A;  4F8A A;  1VIW B;  3OGV A;  5FCC A;  2F4P A;  1GKB A;  5IUQ A;  1MPX A;  4FOY A;  4AEM A;  4BIF A;  5CIS A;  1JUI A;  2BDR A;  5FYS A;  4HMZ A;  1D0H A;  2RS3 2;  3POF A;  3BIW E;  3VD3 A;  1EUT A;  2ET7 A;  2VE1 A;  1PVC 1;  2GN7 A;  3TEX A;  5BNO B;  4IGQ A;  3ME2 A;  5FAX A;  4CVU A;  1KS4 A;  4GWJ A;  4YGB A;  5EJZ B;  4QAW A;  3VKN A;  1BZW A;  1YLL A;  1F9K A;  2C5D A;  2SLI A;  1OPO A;  3POB A;  4X8P A;  2JG9 A;  4ZU5 A;  5FJH A;  2KD7 A;  2FZ2 A;  2BTV C;  2HWE 2;  2C1F A;  5DAV A;  2A6V A;  1WCQ A;  2XBO 2;  2O0O A;  5GZG A;  3OPW A;  4HK8 A;  3MUZ 1;  4YYO A;  5A6Q A;  4AVA A;  4UW4 A;  1H2M A;  2E33 A;  4WV8 A;  2HEY F;  2Z5W A;  4IEX A;  4JTO A;  4BIS A;  3B93 A;  2R06 3;  3ACL A;  4LKE A;  3ZIX A;  1D4M 3;  1OVP A;  2QQJ A;  3ZMN A;  3ACH A;  2WN3 A;  2BP6 A;  4XFG A;  4AI1 A;  4CSW A;  2WZR 1;  4QXC A;  2LW8 A;  3OJB A;  2ZZQ A;  4WVW A;  1OA2 A;  5LAT A;  3WOG A;  3ZDV A;  2DVA A;  3OPZ A;  3VKL A;  2DBI A;  2WSV A;  1MS9 A;  1UMZ A;  2VL4 A;  1L7L A;  1W2A X;  4Q8L A;  5IVY A;  1EV1 1;  3C7G A;  3FFZ A;  4Q2F A;  1I5Z A;  2XML A;  3ZN5 A;  1US2 A;  4U36 A;  2R1B A;  1UOF A;  4FP3 A;  1R1A 3;  3Q8C A;  4IEU A;  5T5P A;  3TEZ A;  1PIV 2;  2JKX A;  3MFA A;  4XMI A;  3CO2 A;  1LES A;  4IE6 A;  2J1S A;  4NHY A;  4JHZ A;  4GJY A;  3ZFG C;  4H7L A;  3PUR A;  4UI9 L;  2R49 A;  5GAL A;  5IFP A;  5L9V A;  3I2J A;  1ZNP A;  3DEC A;  1NCQ B;  4NMI A;  3SH3 A;  1RUC 3;  1GMM A;  3ZXG A;  1PO1 3;  5A7N A;  2XVG A;  2EIC A;  2WO2 A;  3K3O A;  2JXA A;  3NKG A;  5D8A C;  5A32 B;  1W6Q A;  2ZHL A;  2VAU A;  3BOD A;  1WW6 A;  1DDL A;  1W8U A;  3RZH A;  4LBN A;  3PUA A;  4CP1 A;  3DYP A;  2YRO A;  5FZF A;  1H30 A;  1UOJ A;  3HQU A;  2GNM A;  4CDQ B;  1H2L A;  2D5F A;  2QKD A;  4FFI A;  4CEY A;  3WF0 A;  4CDX B;  4Q4V 2;  1POV 3;  5IVV A;  5CVR A;  2WZP P;  1AYM 2;  4L0P A;  3AP6 A;  1V9U 1;  3BI3 A;  5A1L A;  2L9L A;  5DAW A;  1Y4W A;  2RM2 3;  5FY7 A;  3PVB B;  3ZYB A;  3CJI C;  2OZJ A;  5T54 A;  4DXZ A;  3MFC A;  3ZR6 A;  4OQ8 A;  1H4G A;  3CL1 A;  3M7A A;  2QQO A;  2EXK A;  3ZSM A;  4XDO A;  5FYY A;  4QD2 A;  4QX1 A;  1MZE A;  3K4D A;  4XDQ A;  2VCB A;  5DDJ 3;  2WLP A;  2Q5T A;  4AED C;  1RIN A;  3DV8 A;  4PIX A;  2VNG A;  4HK9 A;  2XHK A;  1CJD A;  4YG3 A;  2BPA 2;  3AP5 A;  1W8Z A;  3CF6 E;  1QY4 A;  4Y1U A;  5A6X A;  4XC9 A;  4QPI C;  3THC A;  4C8D A;  4OVE A;  4ERO A;  3T4H B;  2X10 A;  3I59 B;  3H1W A;  1Y3T A;  2PEL A;  2PTM A;  2JKB A;  4PLN A;  3RPQ A;  5K4L A;  4NID A;  1D2S A;  1HRI 2;  2ORZ A;  1VAV A;  1KDK A;  5D21 A;  1LR5 A;  2G19 A;  4NAM A;  1VBD 2;  4LO7 A;  4PIZ A;  4CXW A;  3O0X A;  3G6J B;  4ATE A;  2R32 A;  4FAH A;  5ACA 1;  4XAC A;  5F2W A;  1Q8Q A;  4WM8 A;  3WDU A;  1K12 A;  1ASJ 3;  1N1S A;  5LAS A;  1M4W A;  3LEI A;  4RGG A;  3G7D A;  1QKQ A;  1KFX L;  2YGL A;  5HV0 A;  5CKN A;  1H8T A;  4CPB D;  1RHI 3;  1LCL A;  2JE9 A;  3RGB A;  2A75 A;  2MEV 2;  2EAA A;  2QFE A;  1K5M B;  1FNZ A;  4XAB A;  3R05 A;  1LHN A;  2VZS A;  2RR1 3;  3M70 A;  4HZF A;  5FY9 A;  4L11 A;  5ANN A;  2VEC A;  1G7Y A;  4WBB A;  4YAR A;  1GAN A;  4GKY A;  3W59 A;  1JU3 A;  3ETQ A;  3H1M A;  2RS1 1;  5EJ1 B;  1PGS A;  2XKP A;  2XR4 A;  4JGY A;  3SEP A;  1PVC 2;  5A33 B;  1R1A 2;  3KT4 A;  5C8C A;  1NA1 A;  2WNO A;  4W4Z A;  1OQ1 A;  1LUL A;  4L2N A;  3NST A;  2LM3 A;  1S0G A;  3WW4 A;  4EZH A;  5BXX A;  4Q4W 2;  1S4C A;  1O91 A;  3O14 A;  5FUN A;  2W46 A;  2CU5 A;  3N9N A;  1KJR A;  3HD8 B;  3ZYG A;  4FTE A;  4OI2 A;  2Y34 A;  5FYT A;  5I91 A;  2OS2 A;  4WVV A;  4OI1 A;  3C7F A;  5FZL A;  1AR8 3;  4FPH A;  5JIU A;  3VDC A;  2J1A A;  3ILF A;  1COV 2;  4UBH A;  2G9G A;  5CNA A;  1QJY 2;  1PM4 A;  4YGD A;  5T3N A;  3I59 A;  4CRQ A;  3HR9 A;  1XNC A;  4COY A;  4UOJ A;  1ZZB A;  1Q8V A;  5F39 A;  2CGN A;  4YW3 A;  3V0B B;  1CZT A;  2ZGM A;  4BXS V;  2JX9 A;  4CE8 A;  3NKT A;  1LOE A;  1YFX A;  4YFW A;  4FSJ A;  1D4M 1;  1LOB A;  2RDN A;  1RB8 G;  4XFI A;  1RUI 2;  4YVW C;  4C0H A;  4XF9 A;  1K45 A;  4A45 A;  4BIO A;  2Y33 A;  4Q29 A;  3LEK A;  1JH5 A;  1EAH 1;  2B7Y A;  3MW4 A;  4B4P A;  3LZZ A;  4FPK A;  1W04 A;  1GFF 2;  1YQ2 A;  3N9M A;  3POI A;  3ZX7 A;  2WWS A;  1CGP A;  4AHW A;  1DG6 A;  2DTY A;  1UU5 A;  1REE A;  1GIC A;  3POJ A;  4YW2 A;  5I8Y A;  3NAP C;  5T5L A;  4UFI A;  2ZMK A;  4NHK A;  5F3G A;  1SFY A;  4DY3 A;  1P8J A;  2HEW F;  4DEQ A;  2ZGL A;  3ATG A;  3NV3 A;  2XJQ A;  4YLZ A;  3ZSL A;  1IS4 A;  3VHP A;  2HWD 2;  1A8M A;  4DMI A;  1S0B A;  3M3Q A;  1STM A;  5CFC A;  4HG6 B;  3IN9 A;  2C26 A;  5EP9 A;  4K40 A;  1IKP A;  3KF5 A;  2ZX3 A;  4OHW A;  5FP9 A;  1HW5 A;  5A7O A;  1W2N A;  4KMQ A;  3TN9 2;  3WEZ A;  2XBO 3;  3E1F 1;  4CDQ C;  4XZU G;  4MZU A;  4K7J A;  2BUK A;  3NNG A;  1WLW A;  4AR2 A;  2DF7 A;  4MGI E;  2FDF A;  1G6N A;  4YZ1 A;  4Q4Y 1;  3VKM A;  4K1Z A;  5FXZ A;  5DUU A;  3ZIW A;  3O1R A;  1JYT A;  1XNT A;  3UJQ A;  5I0R A;  4XFB A;  3ORJ A;  4CEW B;  1QMJ A;  2ZA9 A;  3FHA A;  4M0H A;  1BK1 A;  1I9R A;  5JUV A;  2W92 A;  4HSL A;  3A0K A;  1C8N A;  5I0D A;  1UD1 A;  3BCW A;  1CZS A;  1V6N A;  5GLV A;  5FOB B;  2VUD A;  3SIS A;  4TTG A;  2O1Q A;  4XIO A;  1EPW A;  4XUQ A;  2GNT A;  4AI2 A;  1X9P A;  4AGG A;  3GHM A;  2XON A;  2PAK A;  5T50 A;  2RR1 1;  4N7U A;  5C3R A;  1XOY A;  4YGE A;  1ZYB A;  3T1M A;  2R04 1;  3MIE A;  2CAV A;  1CN1 A;  5FLH A;  2RG4 A;  1RUE 1;  1RUN A;  2B46 X;  2G4I A;  3DYO A;  3TWI A;  2FQP A;  2Y8K A;  1RUC 1;  5LK7 B;  4OCT A;  4D7S A;  1Z0H A;  3O1O A;  1RUC 2;  3AL5 A;  4P08 A;  4DQA A;  2HJI A;  5ACA 2;  3L2H A;  5HXV A;  1XRU A;  1PHM A;  2R07 1;  2WAB A;  3B3Q E;  4RD7 A;  3UJO A;  2GU9 A;  2HWB 2;  2YPD A;  1YCI A;  1PZ9 A;  3R4D B;  3WR0 A;  1R1Z A;  1BXH A;  2P3K A;  4QMA A;  2UWC A;  3Q8F A;  3NWK A;  2QNK A;  3U1X A;  2A6X A;  2MEV 1;  2W87 A;  3THT A;  3URF A;  1IHM A;  4YM3 A;  1ULD A;  3AXD A;  2DFB A;  2HWC 2;  1H6X A;  2PHW A;  1DGW A;  4LLF A;  2C9K A;  4UFL A;  5FWE A;  3WF1 A;  1F8V A;  4QPG B;  4XXA A;  4K3U A;  1LOF A;  1RUE 3;  4UF0 B;  1RL3 A;  5L36 A;  1BEV 1;  1NOV A;  1W9T A;  1FMD 2;  2E53 A;  2YGM A;  3ASI A;  4I30 A;  1TEI A;  2TNF A;  2WQ8 A;  3ZSJ A;  4ZKT B;  3RZL A;  2WII B;  4LHS A;  1VBB 3;  4ZON A;  3WDV A;  5IVJ A;  1SLI A;  1UZ0 A;  4LT5 A;  5SV5 A;  1K42 A;  3C7E A;  1ND3 C;  3JBG 2;  3H8O A;  3VDD B;  4Y20 A;  4UT5 A;  4HLT A;  3HNM A;  3LAG A;  5DDJ 2;  3WDT A;  1YQ6 A;  4AGR A;  1W0O A;  1CZV A;  3MPP G;  2VUC A;  3ZYI B;  4AGV A;  4CEY B;  2EID A;  4A4A A;  5C6C A;  4A3X A;  2XLF A;  2YC4 A;  3U37 A;  1HV1 A;  1X7N A;  3KF3 A;  1W6P A;  4W50 A;  4QX3 A;  3KQR A;  3RYK A;  3ZFG B;  3I2I A;  1QDC A;  3ZFF B;  5FLI A;  2YB7 A;  4AVT A;  2WA4 A;  5C9A A;  2DV9 A;  5AVA A;  2QQK A;  4RFR B;  2JDP A;  2ZAB A;  3VD4 A;  4C0B A;  4J1W A;  4ZS3 A;  5FRE A;  2HWF 2;  1KD7 A;  3KT7 A;  4AVV A;  5CEH A;  3ZPY A;  5FO7 B;  3WIN E;  1W6N B;  4ORF A;  5FXX A;  2VD7 A;  2VH9 A;  2LUW A;  4COU A;  2YC0 A;  4HN1 A;  2WNV A;  4MGY E;  1CIY A;  4HPK A;  3RNS A;  2X53 S;  4FOW A;  3R0R A;  3LEG A;  1H2N A;  2NP0 A;  4XUP A;  4NIH A;  1AR6 2;  1X36 A;  4FPE A;  1RUF 2;  2JEC A;  4LBM A;  5ANQ A;  4LA2 A;  3T08 A;  4QQ2 A;  4XJ8 A;  3ZXE A;  2BFU S;  2YYO A;  3N7L A;  5FYZ A;  4PLO A;  1LHO A;  2VR4 A;  1ENQ A;  2WNU C;  3LFI A;  3WZ1 A;  4AVS A;  4E2Q A;  5IK8 A;  5F7U A;  2JIC A;  2XWJ B;  3ZXD A;  3M8L A;  4YM2 A;  2VMD A;  3S6P A;  4L97 A;  1QNY A;  2Y6L A;  5EHD A;  5H9Q A;  3FBY A;  3P5B A;  3IPV B;  3A22 A;  3AFG A;  1UNB A;  3GF6 A;  2ZAC A;  5D2A A;  4CUA A;  5KXB A;  3VDB A;  2I45 A;  4JRA A;  5LBB A;  1QQP 3;  1J3Q A;  2VUL A;  3PTY A;  4HT1 T;  5ACA 3;  4XTM A;  1NUK A;  1RUH 1;  4GWM A;  5L9B A;  5FWJ A;  2W1U A;  1MS0 A;  4NRP A;  1W6P B;  3JD7 3;  4YPJ A;  3T0D A;  4IES A;  1OOP C;  1PM7 A;  3HN1 A;  3IB3 A;  2VQT A;  1W6O B;  2UWA A;  2VMG A;  3VBU C;  2Q30 A;  5LWB A;  5FIX A;  5FPU A;  4G9S B;  3GJB A;  3WT3 A;  5HCB A;  1ULC A;  3MUY 1;  2FCT A;  5LA0 A;  3SHR A;  2IVJ A;  3JB4 C;  2AZ5 A;  5FPV A;  1JYV A;  1OPM A;  3VV1 A;  2VG9 A;  1QOT A;  2ZXQ A;  4N43 C;  2WIN B;  3WUD A;  1WW4 A;  1CAW A;  1REF A;  1V0A A;  3M4F A;  1W9W A;  4J25 A;  3KLS A;  2A5Z A;  3PMS A;  3DCQ A;  4P9G A;  4CCO A;  5C9A C;  1QJU 1;  2P37 A;  5FPA A;  5KR7 A;  3AVR A;  3HMY A;  4AI0 A;  5C8C C;  1W05 A;  2WZ8 A;  3B94 A;  1GNH A;  4QX5 A;  4RA0 A;  4SBV A;  5G05 L;  4BDV B;  4OUE A;  4DUV A;  2ZMN A;  3RYR A;  4XJZ A;  3NL1 A;  2WNV B;  4HFS A;  5HBA A;  1FT9 A;  1RMU 2;  4YW4 A;  5GLZ A;  2JDZ A;  3AMQ A;  2D6L X;  1CVN A;  2ZHN A;  3ILR A;  1UN1 A;  2P17 A;  3VL8 A;  4WM7 B;  4YM1 A;  1IKQ A;  5D1I A;  5A7P A;  1B35 B;  1BBT 3;  4PI0 A;  2Z2S B;  5EV7 A;  3WCS A;  2ZOE B;  4CDU A;  4LKS A;  2WNE A;  4MV2 A;  2UY9 A;  1X8M A;  3CIH A;  1DGR N;  2CL2 A;  1ZZ8 A;  3ELN A;  1MS5 A;  3RS6 A;  5LBC A;  1GZ9 A;  1SQ4 A;  5JVV A;  1GUI A;  1FPN 2;  4WVZ A;  5SV8 A;  1IS5 A;  1JOP A;  1SG3 A;  2LRP A;  1F31 A;  3IDC B;  1FPN 1;  3GGL A;  1FAT A;  2EAL A;  1ASJ 1;  3M3C A;  4QKD A;  4XHB A;  4LBK A;  5APA A;  4NHL A;  2IFR A;  4JTN A;  4LPL A;  3LOI A;  4UAP A;  2JDN A;  2CV6 A;  4P9W A;  2B5H A;  3DKQ A;  1OH4 A;  1U12 A;  1ZZ7 A;  5JXI A;  2ZHM A;  1I6X A;  3I3Q A;  2BV4 A;  2HYK A;  1VMJ A;  3EQE A;  3RZK A;  4BH9 A;  5IYY A;  5HCH A;  4EZ4 A;  3VHO A;  4NPL A;  5DZG A;  3X29 B;  2WYS A;  2VCC A;  2Q8E A;  1QJX 3;  2BBA A;  4RQP C;  4JX0 A;  3HEI A;  4NHX A;  4P9J A;  4RL7 A;  4P9L A;  1U0A A;  2DUP A;  4M01 A;  4NWV A;  3I2G A;  1OKQ A;  4AI8 A;  3INA A;  4AHZ A;  2DUR A;  1W9Y A;  2IUW A;  3RJ2 X;  1ZRD A;  5DAP A;  1JHJ A;  1FV3 A;  5C8C B;  1W8H A;  3NNL A;  2P34 A;  3VBU A;  5FV3 A;  4FQ4 A;  1PMH X;  5LBE A;  3VB9 A;  2GC2 A;  2R07 3;  2W0X A;  4IL7 A;  5C3O A;  5CFC C;  2WZE A;  3CJX A;  5DN2 A;  5A7W A;  3ZPO A;  2D6P A;  4Z2W A;  2WR9 A;  4Q0P A;  1KIT A;  1RUJ 2;  2Q0A A;  2XJU A;  2XLA A;  5C7G A;  3O1M A;  5C4W C;  3U11 A;  1XU2 A;  4BPZ A;  4GAL A;  4UBG A;  5CB7 A;  4YSF A;  3OBZ A;  5AVP A;  5K0U A;  1HRI 1;  5DUW A;  5L19 A;  1AR7 3;  2WFP A;  1W8F A;  3W58 A;  1CPN A;  1MQT A;  1PZ7 A;  4FQZ A;  5AFB A;  1RXG A;  1XXN A;  5FMO S;  4A7Z A;  4P9X A;  4AEK A;  4RQP B;  1RUF 1;  4RS5 C;  1SDD B;  4FPC A;  1LB2 A;  2ZX1 A;  2W91 A;  1IPK A;  1HRV 3;  1QJE A;  2XL7 A;  3AP4 A;  3CNA A;  4IER A;  4H2A A;  5GKA C;  1A34 A;  4IEW A;  1PVC 3;  3FFQ A;  4AF9 A;  3DYM A;  5AC9 3;  5IVF A;  2VU9 A;  1JUH A;  1W2O A;  2JD4 A;  1O3R A;  2R06 2;  3TRS B;  5F1R A;  2MEV 3;  4EQV A;  4WM7 A;  4OMD A;  2R06 1;  1EYB A;  2FCU A;  3IMM A;  4JZR A;  4CP2 A;  2KA3 A;  4K1Y A;  3UYJ A;  4JDO A;  4QPI B;  2FDH A;  3UGG A;  1TVG A;  1LJ7 A;  1UYY A;  1Y9G A;  2W2I A;  3N7K A;  3KS7 A;  3THP A;  1GYK A;  5C5U A;  5B4N A;  5DAB A;  1DQ5 A;  4MHU A;  3Q9O A;  2VVE A;  4QU2 A;  1X33 A;  1AR8 2;  3WCR A;  5H9R A;  2VBD A;  2XVK A;  3IDE A;  4B4R A;  2BGO A;  3JUU A;  5CFC B;  5CG9 A;  1F5J A;  1NKG A;  4Q4W 1;  1LHW A;  1V9U 3;  2VOT A;  3U0Z A;  4GKX A;  3GXU A;  4XZP A;  5HCA A;  5GM0 A;  1CJP A;  3BVC A;  4D6Q A;  2ZML A;  4ISQ A;  3WG1 A;  1JOJ A;  3B02 A;  3B5L B;  2RDR A;  5L7O C;  5FTT C;  2BRT A;  4CDX C;  1ZBA 3;  1OLM A;  2LRO A;  1OFN A;  1COV 3;  2VPV A;  4M3C B;  4LE4 A;  3GHN A;  3Q8E A;  1GP5 A;  5C9A B;  2QZ2 A;  4AED A;  2PHF A;  1MQT B;  2ARX A;  2ERF A;  2OQ6 A;  2ZEZ A;  2ZGP A;  3AZV A;  1QIQ A;  4GD4 A;  1GU3 A;  4HN0 A;  4LA3 A;  1UMH A;  4LJH A;  4NVP A;  5IAV A;  3UL2 A;  3VBR A;  4E4D X;  4A41 A;  2DCT A;  1CD3 G;  3ZXF A;  5JDB A;  4NN0 A;  1HQN A;  3H50 A;  4AK3 A;  3N36 A;  4O9G A;  4XYX A;  2RS5 3;  1SFP A;  1OSG A;  4XBL A;  1JZ8 A;  2AUY A;  5LB6 A;  1TQ5 A;  2CHH A;  4Y24 A;  1KEX A;  4DRV A;  1PIV 1;  1HX6 A;  2GP3 A;  4LIU A;  4Q4V 3;  4JGZ A;  5GZF A;  2HBT A;  2D93 A;  3AJZ A;  4IET A;  4IEY A;  2YMZ A;  4Y3O A;  3V0A A;  1H8V A;  2NYY A;  2B39 A;  3KD4 A;  4L9B A;  1HIX A;  4IEZ A;  2R7E B;  1GOF A;  2VXJ A;  5F6K A;  1S2K A;  2RS1 2;  1Z7S 1;  3POY A;  1OLM E;  4HVR A;  3WVJ A;  2Q8O A;  2D3R A;  4O65 A;  4XF3 A;  4B4Q A;  5IAX A;  3D0S A;  4MOA A;  4EWA A;  5F3C A;  1HN1 A;  3N7J A;  1SZB A;  3AP9 A;  4KNC A;  3HNB M;  2JB8 A;  4AOC A;  4LUM A;  2XUE A;  3IM0 A;  4F3J A;  2JG8 A;  1W6M A;  2HWE 1;  4ZZ8 A;  1Q8P A;  2Y0O A;  2ZPX A;  4XOG A;  4AFC A;  3DL3 A;  2JEM A;  4UW5 A;  4BOW A;  2UWB A;  1AX2 A;  1G9C A;  3PLQ A;  2JDU A;  1AYM 1;  2YFU A;  5L9R A;  5I0S A;  3SIT A;  1COV 1;  2WNU B;  4QHB A;  5DAQ A;  4YW6 A;  3PUQ A;  1PGL 1;  3I49 A;  2Z79 A;  1PGW 1;  1RVF 2;  1ACC A;  2RDQ A;  3Q8A A;  2DU1 A;  4FPG A;  3KVA A;  4PIY A;  3E6C C;  3WUC A;  2BYV E;  1Z78 A;  5LY2 A;  4YVS B;  1DQ0 A;  4A3Z A;  1AJK A;  4M4R A;  1TME 2;  2E51 A;  1SDW A;  4L8Q A;  3LD8 A;  5I0T A;  1AYN 2;  1VRB A;  5J09 A;  1VBE 2;  4N9H A;  5DXD A;  3RI9 A;  3VBR B;  2CWS A;  5J1X A;  1AYN 1;  3BGA A;  1YO8 A;  2B45 X;  1OHF A;  2C24 A;  3OGJ A;  1V70 A;  5H9P A;  3KV9 A;  5A3O A;  4C1X A;  5FXW A;  1EV1 2;  2YBP A;  2BNM A;  3HVD A;  2ILM A;  4A2U A;  1GWL A;  2XVL A;  4CU7 A;  4AI9 A;  3P3P A;  1J1T A;  3VZJ A;  4CCJ A;  3AX4 A;  3FHI B;  3NNJ A;  1CPM A;  1UU6 A;  2P3I A;  3GZU C;  4IXL A;  4ET7 A;  5FZ6 A;  4QPW A;  2HWB 3;  1UYZ A;  1JW6 A;  3DPR C;  5F5Q A;  3RG0 A;  2XQR A;  2EA7 A;  2PYT A;  4XDP A;  4CP9 A;  1SHW B;  2D5H A;  4FXK B;  4Q27 A;  4DRR A;  1QXJ A;  2ZTN A;  3JZV A;  4I0W B;  1VE0 A;  1RUG 3;  4XPV A;  2ZGN A;  1FPN 3;  1WME A;  2V09 A;  2CNA A;  4MLO A;  2E7A A;  5FMD A;  1FX5 A;  4S2F A;  4AXO A;  3UV9 A;  1YQ5 A;  4CCN A;  2WT1 A;  4BK4 A;  1UIJ A;  2JDH A;  2QQW A;  1EY2 A;  2OPW A;  4JGZ B;  1OF3 A;  2JG8 B;  5KXC A;  2DCY A;  3LIG A;  1H0B A;  1NXD 1;  2QQI A;  3ZYP A;  1Q43 A;  3RMY A;  3ZFE B;  5BNQ A;  4MXW A;  1DQ6 A;  2W47 A;  4E4H A;  3MW3 A;  1QOO A;  4AEJ A;  2RS5 2;  4FXG B;  1FOD 1;  2YDE A;  2FHR A;  2HWC 3;  3BU7 A;  3OUI A;  4KWJ A;  4N43 A;  4W6Y A;  2OKX A;  4R8H A;  1V6K A;  4ZXK A;  1H9P A;  1NLQ A;  1FNY A;  4NIA A;  1JYC A;  3AB0 A;  4RHV 2;  5EFU A;  1AL0 G;  4CDW B;  2DU0 A;  3E6D A;  1C5H A;  2WUH A;  3M1H A;  3M3O A;  2VTF A;  5CAZ A;  3KHC A;  4YZ5 A;  3NV4 A;  2OYZ A;  3TNP B;  2GZW A;  2JJ6 A;  2ADD A;  2ZKL A;  2RJ2 A;  2XXZ A;  1DBN A;  1NQD A;  1IGO A;  2QUO A;  3HNY M;  4LO6 B;  4ZY9 A;  4B8E A;  1QGL A;  4OQ9 A;  3ZXA C;  4LK7 A;  1NY7 2;  1SLT A;  1OH3 A;  4BWO A;  3WW1 A;  5HI0 A;  5FYC A;  1KGY A;  5JZG C;  1TMF 2;  1HJG A;  1SBE A;  3R4U A;  4RR3 A;  2LS6 A;  2MNG A;  3NMB A;  1IZ3 A;  4PF1 A;  3PL0 A;  5C3P A;  4WVM A;  1GNY A;  5E88 A;  2FD8 A;  4ASL A;  1EAH 3;  4IV1 C;  4EN8 B;  4JDN A;  1OT5 A;  3A4U A;  5GZC A;  2OPK A;  3TN9 3;  1NX9 A;  1RUI 1;  4IND A;  2VUA A;  4XAA A;  3FMG A;  4GIQ A;  3PJY A;  3E5U A;  2WT2 A;  3MI8 A;  1I5P A;  4Y5T A;  4AHY A;  3AXE A;  2Y6J A;  4QPY A;  5CU1 A;  5DG2 A;  2R04 3;  5FZ9 A;  2ORX A;  3H7Y A;  1YQ8 A;  2DVF A;  2C9A A;  3ZN6 A;  3ACF A;  4UFJ A;  4NJ4 A;  2Q1Z B;  1KFU L;  2JDY A;  5F3E A;  5EYY A;  4A6S A;  1R08 3;  2FMD A;  3HQR A;  5JXH A;  1XBF A;  4OYU A;  5FMO L;  1DQ4 A;  2DCZ A;  3FZ3 A;  2EIE A;  5IFT A;  1GBG A;  1UX7 A;  1YYN A;  1SLL A;  2D3P A;  3KM5 A;  4PF5 A;  4AQ6 A;  4Y4R A;  5A1F A;  3RJR A;  4QGM A;  3KHB A;  1BEV 3;  3W9A A;  4BQ5 A;  4OHY A;  2VZP A;  3MIG A;  4FOV A;  3ZM8 A;  3KMH A;  3J26 N;  5FBJ A;  4LOS A;  2UUR A;  1PO1 2;  2HH9 A;  4Z92 B;  4LUL A;  5KHH A;  5I8S A;  1MEC 1;  5BNN B;  1FI2 A;  2K46 A;  2VNR A;  1G9B A;  2XJR A;  4AAP A;  4BK5 A;  2HBU A;  4MO3 M;  1MEC 2;  3AYE A;  4LR4 A;  1QJY 1;  2C6S A;  3PJQ A;  1ZBA 2;  3LE0 A;  3DKW A;  2O8Q A;  1UY0 A;  2WSU A;  2V5D A;  4Y22 B;  1UZY A;  5T55 A;  3I2O A;  4DNY A;  3AL6 A;  4AVB A;  2BEO A;  4FPJ A;  4IV3 C;  1UY3 A;  2QZ3 A;  1GR3 A;  2VNO A;  3CLP A;  4N53 C;  3MO4 A;  2NN8 A;  5JWP A;  1E5I A;  3NV2 A;  4IEQ A;  1ZRC A;  1GWM A;  5C5T A;  4HSJ A;  1V6J A;  2HWF 1;  4C90 A;  5DG1 A;  2VOK A;  1O4Y A;  1W6M B;  4OI0 A;  1R09 2;  3ZO0 B;  1IS6 A;  3QBQ A;  4CYD A;  2RM2 1;  4NE9 A;  2EF6 A;  1WCS A;  4JAA A;  2XWB B;  1ENR A;  5LK5 A;  1X50 A;  1QU0 A;  2RM2 2;  4ES9 A;  3NJZ A;  4E8C A;  2AC1 A;  2GAU A;  4PCR A;  4XFA A;  2P3Y A;  4MUV A;  3IIA A;  4FT8 A;  4MGQ A;  1RUE 2;  4H14 A;  1LU2 A;  4AQT A;  4WM7 C;  1C57 A;  4F7Z A;  3J9S A;  3WP4 A;  4BE3 A;  5E6H A;  3J7H A;  2A3Y A;  1RJ8 A;  2ET1 A;  3I3D A;  4UFK A;  4QX2 A;  2Z4F A;  4QB2 A;  3U4X A;  1PZ8 A;  2BOJ A;  4R52 A;  2OUH A;  1HN0 A;  5A6Z A;  5K8S A;  3VBO C;  1VRH 3;  3EBR A;  5EJ3 A;  3TBD A;  1BBT 2;  1H1A A;  2Q1M A;  3I2D A;  1ALY A;  4Q0S A;  1XPW A;  3T2Q A;  5A7W B;  4GMP 1;  1OC1 A;  3DXU A;  4TWT A;  5FKB A;  3NV1 A;  3UK9 A;  3IBM A;  4TZD A;  1RMU 3;  3NAP B;  4WZC A;  3QH7 A;  1UY4 A;  4MSV A;  1LOD A;  5JI7 A;  3FWE A;  3OB8 A;  1GP6 A;  4E2G A;  4ZHN A;  2B9V A;  2CAU A;  2I2S A;  4AAX A;  4N8M A;  3NQH A;  4Q4Y 3;  3MF6 A;  4OHZ A;  4XEZ A;  3VD7 A;  4CCM A;  1LAJ A;  5BNN A;  2RJL A;  1DFQ A;  3D3A A;  2CGP A;  2K0G A;  4NOT A;  3BTX A;  1Y7B A;  1XE7 A;  3F2Z A;  3MIB A;  4QWN A;  3SEE A;  1EP0 A;  3TB0 A;  3MIH A;  4IEV A;  4BQ3 A;  2IXC A;  3HAG A;  3LDR A;  1AXY A;  2WWJ A;  4TLG A;  5IAT A;  2FDK A;  3LF7 A;  3AZZ A;  4QM8 A;  2XOM A;  1DZQ A;  5DDJ 1;  1L7Q A;  2A70 A;  3T2P A;  1KRI A;  3MV0 1;  3P3N A;  2RVA A;  4FO9 A;  4Q4X 2;  3H3L A;  2E26 A;  4I3P A;  4Y5S A;  5F5A A;  4M4P A;  4Q4X 1;  3E5X A;  5FKC A;  3U78 A;  3O1T A;  1KXG A;  2Y6H A;  3QH6 A;  2WO3 A;  4QXH A;  5J37 A;  1Y43 B;  2XJT A;  1DQ1 A;  1W99 A;  3ACI A;  5LEK A;  2FCV A;  4YG0 A;  3W21 A;  5CAD A;  5KXE A;  3A23 A;  3M3I A;  4BME A;  1F15 A;  2ETE A;  2VZ1 A;  4HXC A;  4LBL A;  2N7G A;  2R07 2;  4LHN A;  4QKB A;  5L7O B;  2DUQ A;  3ZLI A;  3J7N A;  5GLU A;  1XE8 A;  1XSR A;  3OGR A;  4UXA A;  2DUO A;  3HPN A;  4P02 B;  3AP7 A;  5F3I A;  4EV0 A;  2IZW A;  1MR5 A;  4BXF A;  4RS5 B;  4QX0 A;  4GH4 C;  1TNR A;  2OX0 A;  5FP7 A;  1UWW A;  1V6O A;  5AC9 2;  1EPZ A;  1CAX B;  2I74 A;  1OQE A;  2GDF A;  2XGX A;  3BN6 A;  3GZE A;  4QQL A;  1XYN A;  4S2D A;  2RMU 2;  2VZQ A;  1NA1 C;  3EYP A;  2B9U A;  3OY8 B;  1US3 A;  2DWR A;  2RMU 1;  2RV9 A;  3LSE A;  2BU9 A;  1HQL A;  4QX8 A;  5LW9 A;  2QVS B;  2QTW B;  4FFG A;  2BFU L;  1DYP A;  4RHV 3;  3OPT A;  3FL7 A;  4B1L A;  3VZN A;  1ZA7 A;  2X8K A;  1SBD A;  4CP0 A;  4MGS A;  1B35 C;  2QDN A;  4QX7 A;  2GC0 A;  2XG3 A;  1R08 1;  3WNX A;  3ZXJ A;  1DZT A;  1V9U 2;  3KGL A;  5IHR A;  3GBW A;  1GQG A;  3AMP A;  1LTE A;  2WS9 1;  1WBL A;  5GLT A;  2C4X A;  2IXJ A;  3KB5 A;  4IEP A;  3WD5 A;  1UKR A;  3V64 A;  5CFD A;  1ZZ6 A;  2JIJ A;  1DLC A;  5A7S A;  2PLV 3;  4YM0 A;  4E8D A;  4BJ0 A;  2VJX A;  4LBQ D;  3LWC A;  1D0G A;  3H8R A;  1JYI A;  4QQH A;  2JE8 A;  4CCK A;  5KHG A;  3FJS A;  4YVW A;  3SCF A;  1VBA 3;  2BWC A;  1FAY A;  1M06 G;  3WLU A;  1UO9 A;  1PVX A;  2YFZ A;  2AEY A;  2X5I B;  4B29 A;  4FPF A;  2KM2 A;  5FZO B;  1JMU B;  1N47 A;  1NXM A;  4YGC A;  5FXV A;  3WXP A;  5AFE A;  2QQV A;  3KWV A;  2ZAH A;  3GZA A;  4R4Z A;  3OD0 A;  2XLG A;  2W95 A;  4AFB A;  3C2U A;  3QOP A;  3EXU A;  4CPB A;  1Q5O A;  3KCX A;  3QLQ A;  4KGG A;  4LIV A;  2CYF A;  3IWZ A;  4IV1 B;  5IVC A;  1FV2 A;  3I4I A;  2XB6 C;  2D43 A;  1S0D A;  3WQ0 A;  1J58 A;  1OI6 A;  2AYH A;  1R64 A;  4G4F A;  1SCS A;  2OVU A;  3RSJ A;  1MS4 A;  4EN6 B;  2YBK A;  1S0E A;  2VW0 A;  3PVO A;  3UGF A;  5K0U C;  3MPB A;  4E4S A;  4GB3 1;  3C3V A;  1UY1 A;  1LHV A;  1ZM1 A;  2ZX2 A;  1YI7 A;  5F6L B;  4KWL A;  1JS9 A;  1YRZ A;  1YIF A;  1RED A;  3AKS A;  4K6B A;  5DUV A;  1QH7 A;  2XJS A;  5FZO A;  3S57 A;  4OZO A;  3FUO A;  2YC2 A;  4C91 A;  1OF4 A;  2DCK A;  3K4A A;  4LOR A;  2AGS A;  2ZX0 A;  4RS5 A;  4ASM B;  1HJF A;  2E7Q A;  3CJI B;  1WD4 A;  4XCA A;  3HBK A;  4Z07 A;  3WHU A;  3ZSK A;  1JZ2 A;  3O1V A;  2VGD A;  3ZYH A;  1VBC 1;  4ATF A;  1AR7 1;  4BCU A;  2Q1F A;  5LZ6 A;  1L7R A;  2W94 A;  3NJY A;  1U5I A;  5IT6 A;  3S0M A;  1VAL A;  2PLV 1;  1YWK A;  5KHJ A;  2PN5 A;  5CFD B;  3LKJ A;  4RR3 C;  3LDK A;  2DFC A;  1ZZ9 A;  2WQZ C;  4BQX A;  1MQT C;  4TN7 A;  5JOW A;  1ND2 A;  4JQT A;  5T5O A;  1A78 A;  1G8W A;  1RUJ 3;  1AUY A;  1XYP A;  3AKT A;  4FCA A;  3VUO A;  2OQ7 A;  1QEX A;  4OI4 A;  5FBZ A;  2UY8 A;  1QJZ A;  4BZ4 A;  4GB3 3;  1GV9 A;  1RUD 1;  5FPL A;  1U5Y A;  3OYW B;  5FZK A;  5FRA A;  2MPF A;  3H8U A;  3ECQ A;  4R9D A;  4S2H A;  5IK5 A;  4XHX A;  3T0A A;  5KHI A;  4K21 A;  3BOP A;  2WNU A;  1WWY A;  2YG0 A;  3FLP A;  5FPZ A;  1C5I A;  3KT1 A;  3K48 A;  4QXK A;  2V5Y A;  4LEJ A;  4GMP 0;  2IFW A;  4I02 A;  1C1L A;  5A3T A;  5FZ1 A;  5J48 A;  2JG9 B;  3I8T A;  1WCD J;  1VBE 1;  4Q26 A;  3H1Y A;  3AYD A;  2XKO A;  4KWK A;  1AL2 1;  1AYN 3;  1VRH 2;  3IPV A;  3WNN A;  3ZFF C;  2VZ3 A;  3LA2 A;  1N1V A;  3AMM A;  5FY4 A;  1Z7S 3;  5B4X A;  1GOG A;  2K2S A;  2JDK A;  4KWU A;  3LA7 A;  1G9D A;  2OT7 A;  4HKO A;  5CKM A;  3VBR C;  1GNZ A;  3USU A;  4CUG A;  5ABJ B;  1UL9 A;  4AQS A;  4D94 A;  4W65 A;  1PIV 3;  1RGS A;  1V6M A;  3CEW A;  3PU8 A;  4LHL A;  3OUH A;  4YVS C;  3UKV A;  3HT2 A;  3WNK A;  2ZGT A;  5FOJ B;  1O4Z A;  1WD3 A;  1RUG 2;  2A73 B;  5EPA A;  5HPO A;  1AXK A;  4DUW A;  4M0N A;  3IT8 A;  4GWN A;  2ZCW A;  4A44 A;  1BCX A;  4XE9 A;  3U07 A;  2VVF A;  3IAP A;  4N53 B;  3NNF A;  3ENR A;  4IV3 B;  1NCR A;  3GJA A;  3SQO A;  2NLR A;  3ES1 A;  2VBB A;  3TYJ A;  2VW2 A;  4JV4 A;  4TSV A;  3VBS C;  1NLS A;  2EIG A;  2JDA A;  3WNP A;  4E9K A;  3O1P A;  1V6I A;  4JKL A;  5F37 A;  2TUN A;  3A21 A;  4EWD A;  3HJR A;  2ES3 A;  3CZJ A;  3V0B A;  4XQ4 A;  1RIR A;  4QXB A;  3LOB A;  3AM2 A;  4QB1 A;  1SAC A;  3VBO A;  4EN0 A;  1K5J A;  2PAE A;  4PBO A;  2ZGR A;  1LRH A;  3WNM A;  5BUV A;  2PXJ A;  5DPN A;  2P6H A;  1BVP 1;  3AK0 A;  3T30 A;  2RS1 3;  2VO5 A;  2ENR A;  1WMX A;  1POV 1;  3O1U A;  2RJK A;  2GMM A;  5EIY B;  2WQ4 A;  1K5M C;  1H1I A;  3LGR A;  2R30 A;  2YUE A;  1JHN A;  1QF3 A;  3NRU A;  3POW A;  3ZYR A;  3GYD A;  4LKF A;  1C8M 1;  1W2U A;  2WYF A;  3LEM A;  2PFW A;  5BY5 A;  1XQN A;  2ZHK A;  3OTF A;  5F9T A;  1HRI 3;  1DHK B;  4D7T A;  3VDD A;  4NWW A;  4AQ2 A;  3VKF C;  4Q0Q A;  5L7O A;  1OKO A;  3VGI A;  1YHF A;  1IPJ A;  4QKN A;  4BLJ A;  5LEJ A;  1VBB 1;  4MAD A;  2ADE A;  4QGN A;  3PVE A;  1RVF 3;  4UYB A;  3USS A;  4Y33 A;  2V4V A;  2RS3 1;  5B2G B;  4CCE A;  2CDP A;  1BJQ A;  3C8X A;  2WO1 A;  5F2S A;  5FYI A;  1UOB A;  5LA2 A;  5T52 A;  4YVS A;  3D82 A;  4I01 A;  1DU3 D;  1DZR A;  1OXC A;  3WQ7 A;  1OOP A;  4F83 A;  1R1A 1;  3BYW A;  2VOV A;  4YZ4 A;  3AKQ A;  1OLR A;  1UW8 A;  2PLV 2;  4QDS A;  2RHP A;  4IGP A;  2ZGO A;  4ZS2 A;  5A3U A;  1MEC 3;  1RJ7 A;  2ZEW A;  3I97 A;  5FZB A;  2V4A A;  1KJL A;  2Y38 A;  4K8R B;  4HL0 A;  3I7D A;  3K3N A;  4LUK A;  1FYU A;  4RFT 0;  3WP6 A;  1LKN A;  1OUS A;  2VTX J;  5JIA A;  2P4E A;  3TEY A;  4HKW A;  5K0U B;  1JN2 P;  1NY7 1;  2EAK A;  1O3S A;  5BNO A;  3ZFE A;  3FC0 A;  1LOA A;  3GM8 A;  3RMX A;  2VOW A;  2DYC A;  3ES4 A;  3LDB A;  3DEM A;  5IVB A;  2W1S A;  3H3U A;  3POE A;  4GH4 A;  4CU6 A;  5J96 B;  3J8F 3;  4S2G A;  3D4K A;  4DZG A;  2WKK A;  4CXY A;  1J1L A;  4IUG A;  4XFF A;  2QJV A;  2R16 A;  3WG2 A;  5C70 A;  5HV4 A;  4GXL A;  3VL9 A;  4AFM A;  4IE5 A;  2A7A A;  2BJS A;  4OZX A;  3QCW A;  3T4V A;  4B3N A;  1ZRF A;  3RYP A;  3H3Z A;  2WN2 A;  3UT0 A;  2WAA A;  3WQ1 A;  4QB6 A;  3ZXK A;  3H0O A;  4URA A;  1HDK A;  1WLD A;  3H42 B;  3A0N A;  5K7P A;  3WG4 A;  2DVB A;  2WL1 A;  1IG0 A;  3B01 A;  3D6E A;  3AYA A;  3KVB A;  1S55 A;  1ZX5 A;  2OUJ A;  1UYX A;  1ZBE 3;  2P6C A;  3AMN A;  1ZRI A;  1ODM A;  1GOH A;  4YW7 A;  2J42 A;  2XH6 A;  1ONA A;  3IDA A;  5KXD A;  3BTY A;  2HWD 1;  1MZ5 A;  1QJU 3;  4IE4 A;  4UF0 A;  4D6S A;  3T0B A;  4JKM A;  1O3T A;  3VBF A;  3LSD A;  1YUD A;  4L99 A;  5JZG A;  2QDR A;  5EXO A;  3SC7 X;  2ZZJ A;  3JB8 A;  4QQO A;  4DB5 A;  5A70 A;  1BKZ A;  1LED A;  2A71 A;  1L3J A;  1XSQ A;  4ITC A;  2JIG A;  2E32 A;  1CX4 A;  3R4S A;  1HXS 3;  3SH5 A;  1H4H A;  4CDW C;  3GBF A;  1TZO A;  3WY6 A;  2XDV A;  2VCA A;  5CBL A;  4LKD A;  3DPR A;  4HOO A;  2R1D A;  4NII A;  3MV1 1;  1CAW B;  2IXI A;  3USU B;  3WF4 A;  1V00 A;  3KV6 A;  1NYW A;  1O8S A;  4TYS A;  4Q4Y 2;  4YZ3 A;  4LO5 B;  4XXP A;  5KBF A;  4Y26 A;  2W9X A;  3D8C A;  1O5U A;  2J1U A;  1W9F A;  5FDB A;  1AX1 A;  1U5Z A;  2PA7 A;  2Y26 A;  5FK7 A;  4ASK A;  1GZW B;  5ABJ C;  1TME 1;  4IW3 A;  1PO2 3;  5FO9 B;  4CCL A;  3AKP A;  4W6W A;  4ZXE A;  4XJA A;  4BU2 A;  3I3M A;  5C71 A;  3IDB B;  4DEV A;  4ZU4 A;  2E31 A;  1SFN A;  1GP4 A;  3JCI A;  4MX3 A;  1WGP A;  2R04 2;  3ITQ A;  3UGH A;  2J1E A;  1GQH A;  2B42 B;  4IV3 A;  1HB3 A;  2RR1 2;  3PME A;  1W0P A;  4AL9 A;  4OUS A;  5GJ6 A;  1ULP A;  1VP6 A;  5BNO C;  2I07 B;  3R6S A;  1E57 A;  1SLB A;  3BPZ A;  2QQP A;  5LY1 A;  1LEC A;  1NZC A;  1VMF A;  3K75 B;  4X6R B;  3ZVX A;  4CP9 B;  1MS3 A;  1O59 A;  2AEN A;  2JG8 C;  3LPG A;  4JGZ C;  3MF9 A;  3QAC A;  4LTA A;  2BQP A;  2J1V A;  4L92 A;  4CA9 A;  2LTN A;  1NE4 A;  1IS3 A;  1Q8S A;  1DGR A;  2HWB 1;  3T1L A;  2O14 A;  4I2O A;  3RDI A;  3KSC A;  1BLZ A;  2JEN A;  4JVA A;  3UKN A;  3J8F 2;  4U2A A;  1BQP A;  1ND2 C;  3SNM A;  2MHF A;  4LK6 A;  3Q8B A;  4PJY A;  3WNL A;  4XAE A;  3O12 A;  1W8T A;  4XCB A;  5JLV A;  1ZRE A;  4YZ2 A;  3BAL A;  5I93 A;  4BA6 A;  3UNP A;  3DXT A;  3DPR B;  5KC6 A;  5A3N A;  1VBB 2;  3AYC A;  3HWJ A;  2BNO A;  2WO7 A;  3ZFG A;  2HWC 1;  4IV1 A;  1UZW A;  3ZYJ B;  4LO4 B;  5BNP A;  2CDO A;  3HT1 A;  1FXZ A;  4N90 A;  2ZGK A;  4R9C A;  4EYU A;  4K9S A;  4Z82 A;  5C3S A;  5FZC A;  4JRL A;  2KXL A;  2OZ6 A;  4DY5 A;  3AVS A;  5JSP A;  4Y1V A;  1NLR A;  2QQM A;  5FUP A;  4D6R A;  1UQX A;  2VZO A;  3GCW A;  4IEO A;  1WW7 A;  2R0F A;  1POV 0;  4D8M A;  1N1T A;  4Q8K A;  2GC1 A;  1ZVF A;  4DPN A;  1HB2 A;  1PO1 1;  3VZO A;  5A3P A;  1GZC A;  4XMA A;  3J7L A;  4O7X A;  5FZE A;  1JTZ X;  2CSG A;  3ALQ A;  2YY1 A;  4PDW A;  4CDX A;  5DQ0 A;  2YU2 A;  5JMO A;  3HIF A;  4GAZ A;  2CTV A;  1G9F A;  3UET A;  2GNB A;  4R4X A;  1VBA 2;  4HBN A;  1URX A;  5A1A A;  2BZD A;  3M2M A;  2F17 A;  1RYY A;  1OA3 A;  5J7M A;  3ZKU A;  3L2Y A;  4MHR A;  3BU0 A;  3PDQ A;  2A6Y A;  2VBP A;  5IW0 A;  1W3V A;  1ODN A;  1JBC A;  3PIJ A;  3CDZ B;  5IWF A;  2JE7 A;  1GQP A;  5JOY A;  4XJU A;  4YVW B;  1HXS 1;  1O5L A;  5FPX A;  1B09 A;  4FAG A;  4AZZ A;  4J6G A;  1IQA A;  2XJP A;  4IE7 A;  4P5Y A;  2VME A;  1LHU A;  2DDU A;  3MEP A;  1BMV 2;  2PHT A;  5E1R A;  4NHM A;  3GNE A;  2PHU A;  1AF9 A;  4QT6 A;  1XB9 A;  1QJX 2;  2GN3 A;  3ABZ A;  1W2T A;  3MW2 A;  5FZH A;  3MGU A;  1NCR C;  2DVD A;  3AZW A;  3SKJ E;  3T2O A;  4Y1Z A;  2J7M A;  3OBA A;  1JYX A;  4RSU A;  3JU9 A;  2VW1 A;  3MLK A;  4WM8 B;  4XUR A;  4KG8 A;  3PUH A;  2BER A;  1PK6 B;  4G3Y C;  5FZ0 A;  1PX4 A;  3I3B A;  3WP5 A;  1QQP 2;  3ZYF A;  4NRM A;  5I8T A;  4BHP A;  4XJW A;  3S5A A;  1ZRR A;  3JQX A;  2D7F A;  4I09 A;  4JKK A;  2VOX A;  1W8O A;  3W5M A;  1Q8O A;  4MYE A;  1ST8 A;  1W28 A;  3JD7 2;  3I54 A;  2PHL A;  3FUQ A;  4KI5 M;  4TLF A;  3RZZ A;  3HQX A;  2PHD A;  1F5F A;  1DYK A;  1ND3 B;  1YIP A;  1AR7 2;  1IG3 A;  2WLQ A;  1PK6 C;  3EJK A;  2BWA A;  3EO6 A;  5FMC A;  1CES A;  5LA9 A;  5LRS A;  4JGY B;  3WF3 A;  2W39 A;  4CXX A;  4Y22 A;  1SPP B;  4PQ9 A;  1UY2 A;  1MAC A;  1C1F A;  2V72 A;  4FOQ A;  4AED B;  5HXM A;  5JXG A;  1NA1 B;  4COW A;  2E9Q A;  5DAX A;  3VBF B;  3VDA A;  2TEP A;  2VMI A;  5FQ0 A;  3RWK X;  3CU7 A;  1UYP A;  4C1W A;  1PNF A;  1W6Q B;  1X8E A;  4LQR A;  5JI9 A;  2XPJ A;  4CTE A;  3SCH A;  2BGC A;  3EHK A;  2EXI A;  2OXB A;  3D0J A;  4AFA A;  5LBF A;  1JZ5 A;  5D8A A;  3NNM A;  2A3W A;  2W1Q A;  4AWD A;  2VMH A;  5CFD C;  1WLC A;  3WDW A;  3N3H A;  1R09 1;  5FLJ A;  5FZA A;  5JSO A;  4V2V A;  5IVE A;  1KQR A;  4LNV A;  1DF0 A;  1SEF A;  2FZ1 A;  2GSY A;  5L73 A;  4JQR A;  3U14 A;  1YEW A;  1BK0 A;  1B35 A;  3B69 A;  3OGS A;  2D40 A;  1UMI A;  3E5Q A;  2BW8 A;  1CON A;  3K4Z A;  2WFF 1;  5BPX A;  3JQW A;  3MLJ A;  1W0N A;  3I2K A;  2HEV F;  4LLO A;  5LRR A;  1CQ9 A;  3SH4 A;  2GC3 A;  3KV5 A;  3OGG A;  3WW3 A;  1QJU 2;  4DXR A;  4AHX A;  5CZK A;  2BOI A;  5JMC A;  2X09 A;  4JCK A;  2EIB A;  1BYH A;  1JI6 A;  1CX1 A;  1MZF A;  4XBQ A;  2YU1 A;  3GDB A;  3JBG 3;  4IQP A;  5JXJ A;  1BBT 1;  1UZZ A;  1MVQ A;  4PQQ A;  2IXL A;  1HB1 A;  5FYH A;  3ZR5 A;  1VLN A;  5FZM A;  1LEN A;  1TMF 3;  1WW5 A;  3MIF A;  3CKH A;  3SCG A;  3BTA A;  1YFY A;  3J8F 1;  4NPR A;  3SXW A;  4KU7 A;  3TOJ A;  4DIQ A;  3ETP A;  2VMC A;  4LO8 A;  1YQC A;  2A3X A;  2BVB A;  1T6B X;  2RE9 A;  3MHZ A;  4ZPI A;  1O8P A;  2QBX A;  1H8T C;  3WSO A;  4DXT A;  4QPI A;  1W3X A;  1E5S A;  1YFU A;  4Y1X A;  4XET A;  2TBV A;  1BVV A;  1YJL A;  1X82 A;  3APB A;  1APN A;  3AZY A;  1ULG A;  3IAQ A;  2FDJ A;  1SPP A;  1RUG 1;  1IOA A;  1DYO A;  2FDG A;  4GA9 A;  1S2B A;  1FMD 1;  4WZF A;  3KCC A;  2HWF 3;  1WBF A;  1HV0 A;  5GZD A;  2XBO 1;  2YHJ A;  1H8T B;  2VM9 A;  1F4A A;  1WUV A;  3VHN A;  5FYM A;  1RUD 2;  3OBR A;  4NUB A;  5M0T A;  5D8A B;  2D6M A;  2BNN A;  2YBS A;  4XTP A;  4CDQ A;  4D69 A;  1V6L A;  2VQ0 A;  4N53 A;  4NO4 A;  2VQA A;  1RUI 3;  4OHV A;  1NCQ C;  2RS3 3;  2VUJ A;  4FFH A;  5H9S A;  3TNQ A;  3VZL A;  4QPG A;  5KWR A;  4Z1V A;  1JYW A;  1AR6 3;  4W8J A;  2X29 A;  4GJZ A;  2EXJ A;  4K20 A;  2D6O X;  3IMN A;  1VBA 1;  4CEW A;  4BM8 A;  3WP3 A;  2WRA A;  2ZAA A;  3CHX A;  2XJV A;  3K77 A;  1HRV 1;  1BHG A;  3OD4 A;  1SLC A;  3W20 A;  5KC5 A;  3O1S A;  4Y5Z 0;  4YW5 A;  3EMR A;  1LGN A;  2R0H A;  1OMI A;  3CQO A;  1VAM A;  4FI9 A;  3V65 A;  1RUJ 1;  4UW6 A;  2HWD 3;  3N7M A;  2BVV A;  4HAN A;  3SLI A;  1CIW A;  2GH2 A;  1KDM A;  4HON A;  2G1M A;  4FVV A;  1UOG A;  2SBA A;  2Y6G A;  4HVQ A;  5GZE A;  4FPL A;  4MH0 E;  3KGZ A;  3U75 A;  1ZZC A;  1RC6 A;  1W8W A;  2ARA A;  3PTR B;  2H6C A;  2JG9 C;  4QU1 A;  3ST7 A;  1X9T A;  3TAY A;  3ZFF A;  1QXR A;  3L9J T;  1QJX 1;  2VZV A;  4JHT A;  3WDY A;  1AR6 1;  1JZ4 A;  2E6V A;  3AJY A;  5BNP C;  4NR1 A;  4K8F A;  4Z2A A;  1ND2 B;  2HLE A;  5ISL A;  1TG7 A;  3S7I A;  3BUC A;  4PBP A;  4GB3 2;  1CAV A;  1C4R A;  4XF0 A;  2YV8 A;  1EV1 3;  5JPM B;  2NPI A;  4H55 A;  5F5I A;  5I0U A;  3T3Y A;  4BB3 A;  5FZG A;  1QWR A;  1U5X A;  3I3E A;  4BQ2 A;  2F6B A;  1FOD 2;  1UU4 A;  2ARB A;  2WDB A;  4HPK B;  1W06 A;  2ARC A;  2W52 A;  1W8N A;  1A6C A;  3ILN A;  4Y4Y A;  2H0B A;  5BYN A;  2DTW A;  1VPH A;  1VJ2 A;  4D0Q A;  1WCK A;  2NM1 A;  4LOT A;  5A3M A;  3F95 A;  4KBZ A;  2YXS A;  3OSD A;  4JC1 A;  4Y20 B;  1GLH A;  2VZT A;  2IWG B;  5FJK A;  1RIT A;  1ULO A;  2D98 A;  3WNO A;  2JWP A;  4B7E A;  1G86 A;  1YJK A;  2IC1 A;  4BQY A;  2Q4S A;  5BV6 A;  5FR3 A;  5J36 A;  3VHR A;  2W08 A;  4KH9 A;  4ONU A;  4M3C F;  4IDZ A;  5KHK A;  3O0W A;  4IGO A;  1N3O A;  2NQY A;  3VBH A;  1NCQ A;  1XC6 A;  2ATF A;  3A7Q A;  1A3K A; 
#chains in the Genus database with same CATH homology
 3HQU A;  4ZPI A;  5LBC A;  3NNF A;  5IAV A;  3GJA A;  4NHK A;  4MHR A;  5DAW A;  4NHL A;  4Q5O A;  5LB6 A;  5EP9 A;  3KT7 A;  3DKQ A;  5M0T A;  2HBT A;  2JIG A;  3PL0 A;  4NHM A;  4NHX A;  5IAT A;  5IAX A;  3MGU A;  2A1X A;  4XC9 A;  5DAP A;  3NNL A;  3W20 A;  4XAA A;  3EMR A;  4XCA A;  4Y5S A;  5LBE A;  4UWD A;  2G19 A;  4Y5T A;  4XAC A;  2G1M A;  4IW3 A;  5LAS A;  5L9R A;  2FCV A;  5HV0 A;  3W21 A;  4BQX A;  3OUJ A;  5LBB A;  3OBZ A;  5DAQ A;  5DAV A;  3ITQ A;  2RDQ A;  3HQR A;  4NAO A;  5L9B A;  4XAB A;  5LA9 A;  2RG4 A;  5DAX A;  5LAT A;  3KT4 A;  3KT1 A;  3GJB A;  4BQW A;  2FCT A;  5LBF A;  3NNJ A;  3NNM A;  3GZE A;  2HBU A;  5A3U A;  2FCU A;  4JZR A;  2RDS A;  2V4A A;  2Y34 A;  5C5U A;  4XCB A;  4MHU A;  4J25 A;  5C5T A;  5EQU A;  4KBZ A;  4NHY A;  2OPW A;  5L9V A;  4NMI A;  4ZON A;  3BVC A;  4BQY A;  3OUH A;  5HV4 A;  2RDR A;  2JIJ A;  2RDN A;  3OUI A;  5EPA A;  2Y33 A;  5ERL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...