2JIJA

Crystal structure of the apo form of chlamydomonas reinhardtii prolyl- 4 hydroxylase type i
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
206
Chain Sequence
b'MVGFGELKEEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKRTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROLYL-4 HYDROXYLASE
publication title The Active Site of an Algal Prolyl 4-Hydroxylase Has a Large Structural Plasticity.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 58
structure length 206
sequence length 224
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2jijA00
4NAOA 5LB6A 2Y33A 4MHUA 3MGUA 5IAVA 3NNLA 4IW3A 5C5TA 2JIJA 3HQRA 4NMIA 2RDSA 5EQUA 4Y5SA 4NHXA 4XAAA 4BQXA 2G19A 4UWDA 5L9VA 5DAQA 3GJAA 5DAVA 5LBCA 3KT4A 5C5UA 2A1XA 3W20A 4MHRA 5LBEA 2HBUA 2RG4A 5DAWA 5LASA 5A3UA 3NNMA 4J25A 3NNFA 3OUHA 5IAXA 2JIGA 5HV0A 5DAXA 4Q5OA 5IATA 4JZRA 2FCTA 2RDNA 5LBBA 4XCBA 3OUIA 3HQUA 3ITQA 2OPWA 3GJBA 4XC9A 4ZPIA 5ERLA 4Y5TA 4BQYA 4NHYA 4XCAA 2FCVA 2G1MA 4NHLA 5M0TA 3OUJA 5L9BA 3PL0A 3OBZA 3W21A 3BVCA 5LATA 4XACA 5LBFA 5L9RA 5LA9A 4BQWA 4NHKA 5DAPA 4XABA 2HBTA 4ZONA 5HV4A 3NNJA 2FCUA 3KT7A 5EP9A 4KBZA 3DKQA 3EMRA 4NHMA 3GZEA 2RDQA 3KT1A 2Y34A 2RDRA 5EPAA 2V4AA
chains in the Genus database with same CATH superfamily
3NWKA 3O7OA 1AR82 1DLCA 3I2DA 3NNLA 2DDUA 1NG0A 1QXRA 2X29A 2PHXA 2QQVA 4LKFA 1G7YA 4GAZA 4KL1A 3SNMA 4WM8A 2GH8A 2V73A 4FT8A 3SH3A 4Y5SA 4B1LA 1AR72 2YBSA 1V9U3 2QCSB 5T3NA 1UWWA 2NM1A 4AI0A 4QHBA 1Q3EA 2CHHA 2GC0A 2G19A 3NSTA 4R52A 4UI9L 5C71A 1VBB1 5I8TA 3ZXAC 4MGTA 3ZR5A 1JMUB 2D3SA 3C3VA 1RUD2 1XU2A 3O1RA 3LA3A 2O0OA 1LTEA 1RUJ2 2VW2A 4XFGA 4B4QA 1J1LA 2VXRA 3MPPG 4QX0A 3VBOB 1JYTA 1VP6A 3JB4C 5FMOS 2QVSB 3USSA 3LQCA 2WFPA 3O1VA 1UL9A 1ASJ2 2LALA 2EAKA 1NY71 3IAPA 2SBAA 2Y64A 3RJ2X 3LSEA 4Q4Y2 1Y7BA 4QU2A 2EIBA 3MHZA 3Q8FA 4QHOA 1J3RA 5FZBA 1CONA 2JE9A 3NKGA 4Y1XA 5F3CA 4BZ4A 4HONA 4LBLA 1QIQA 2PLV1 2WNOA 4AFAA 4JGYA 4CEYA 5JZGB 1O4YA 4EWEA 5DZGA 1RVF3 4XIOA 2W92A 4YRDA 1Z0HA 3MUY1 1XPWA 4PIXA 2VMIA 5ISLA 1SLCA 1BVVA 2ZJCA 3AZVA 2W87A 2SLIA 1AR62 3VLBB 3N4MA 3FBYA 4XJ9A 1O5LA 2FCVA 2H6BA 2CGOA 3MW4A 1LGNA 2G9ZA 3OSDA 3ILFA 5FYTA 3TOJA 2AGSA 3VDAA 2HWF3 4CEWA 1S0DA 2VOWA 4LITA 2C0ZA 3CF6E 4EYUA 1IS4A 4Z2WA 4FFFA 3RZJA 2ZGMA 1W6MA 1JYCA 1Z78A 3MEPA 4FI9A 3OBRA 4CZSA 3USUA 5L9RA 4RGGA 3A0NA 1JZ5A 5EV7A 2HWD3 1J1TA 1ZNPA 5J37A 1ZBA2 4CCDA 1IPSA 2OYZA 3I2FA 1OLMA 2JDAA 3H1YA 2HWC2 4K8RB 2HH9A 5FJHA 1SFYA 1G86A 3UGFA 4AW7A 1W9SA 1XNKA 1NA1C 1SPPA 3EO6A 2L9LA 1VAMA 3S57A 2AYHA 2DU1A 1TMF1 4ZXKA 4MSVA 1QJX2 2X5IC 1NQJA 4META 4ISQA 3SQOA 1PHMA 2ZOEB 1W3XA 4M3CA 3T3YA 1LR5A 1EAH1 2X05A 1PM7A 2VUJA 4MGZE 3HR9A 3ZYPA 2ADEA 3A4UA 3C7EA 2YY1A 3WDUA 4MXWA 3SITA 4BCUA 2HWE3 2WWUA 1W0PA 4S2GA 2CWSA 4L9BA 5ACA2 3O1OA 2YHJA 5JPNB 4CDXC 4ASKA 1FMD2 1R1A2 4JHTA 2VULA 4MHUA 2QQUA 5E8AA 5FYHA 1EPZA 2ZGPA 1G9DA 2VMHA 3E5QA 4PJYA 5A32B 2GZWA 3FMGA 4V2VA 5FV3A 3E6BA 1UMZA 2R32A 4AAPA 1H8TC 1RGSA 1CVNA 1FATA 2CV6A 2JDKA 2FHRA 1GANA 5LRSA 4WZCA 4YZ3A 1RUF3 4SLIA 5ABJC 4LKEA 2K0GA 3HAGA 1LOAA 5JSPA 4AI8A 3E5UA 1W6PB 3NAPC 3KD4A 4UW6A 3T09A 1UOFA 4NE9A 4LO8A 1S0FA 3WY6A 2YGLA 3LSDA 1NYWA 1D4VB 2WYFA 2YV8A 2ERFA 1W8HA 2JKBA 3PURA 4INDA 3JD73 3DXUA 5HXVA 4LA2A 2I74A 4QD2A 1RUH2 3W5MA 4OI2A 2C5DA 2RJ2A 4YVWA 4L8QA 3NNFA 2Q8DA 1W05A 2RS11 3JQXA 3KQRA 4B3NA 4E2QA 1FXZA 3PLQA 3GXUA 1PX4A 1YC61 3I2JA 1JXNA 1U5IA 3BALA 3FHQA 1RUI2 4PF1A 5FY5A 4XETA 5IATA 4XF3A 2XVLA 1AR91 1YHFA 2D93A 1LOCA 5F32A 1N1VA 2ZPXA 4AFMA 1DGWA 5F5QA 4WVMA 3RDIA 4MYEA 4N7IA 1XE0A 1PNFA 3DN7A 3ZOIA 1VBC2 3B01A 1NCRC 4P5HA 4XFIA 4ARYA 4YPJA 3ZVXA 2WAOA 3E5XA 3RVHA 5JLVA 1AJKA 4IXLA 3FBMA 2JE8A 4XHXA 4K7JA 2E9QA 4R4XA 5FZ4A 4BMBA 3AZYA 3PHMA 1PZ9A 3IDEA 2YPJA 3ZN5A 2DVBA 2C1FA 1KFXL 1TG7A 1ULDA 2JDPA 3J9SA 2XUMA 3DCQA 1AXKA 2DVAA 3PL0A 4ES9A 1JYWA 3HD8B 2XLFA 2BGCA 1RUE2 2XBO3 4HBNA 3IDAA 5GKAC 2D7FA 1W9WA 1TME3 4YW5A 4M0HA 1W8NA 4MV2A 5KBFA 1PIV2 1RMU2 4TYSA 1CAUB 1AYN3 2DV9A 5EYYA 4GH4A 3VBUA 5L7OB 3NJZA 3ZMOA 4NOTA 4QPGC 2AUYA 5FMBA 2WQ4A 5IVFA 2YROA 4MO3M 1ZZ9A 4GZ9A 1LJ7A 4E8CA 1KDMA 2OQ6A 1NKGA 1S2EA 1NA1B 1APNA 4Y4RA 5EP9A 4KBZA 3I3BA 2WFF1 2X5IB 1RUC1 1SCRA 4IDZA 2RS51 3WW3A 3ALQA 3H8XA 2X53S 2XH6A 4QPIC 3H42B 3VD3A 2QQLA 4QX8A 3H8RA 4MGYE 4OHYA 4YW3A 2J1TA 2OZ6A 1N47A 1OC1A 1Q56A 5CG8A 3NVCA 3DF0A 3U37A 3WZ1A 1B35C 4ARXA 3VHPA 5FUPA 4JKKA 1D0GA 4IEVA 4CU9A 4QKBA 1OXCA 1JW6A 4CDXB 2NPIA 3C7OA 1N1SA 1BKZA 1RHI3 5IK8A 1YIPA 5A3LA 1L3JA 1HXS2 1ULFA 1YFXA 4LO5B 4M3CF 4KWUA 1PNGA 2CAUA 5FO9B 1JHNA 1PVC3 4CP0A 3H50A 2B4KA 1QQP1 1H8TB 4JKLA 1TE1B 2VCAA 2VBPA 3H9AA 2Y0OA 4LO6B 4PI0A 4XDOA 2X10A 3UESA 5CA6A 3WP6A 5ABJB 1VJ2A 5FZIA 5JOZA 4KGQA 2BJSA 1PO13 5D2AA 1C8M3 2ZGSA 1BHGA 5L19A 2ZX3A 3NAPB 5I8SA 3VZKA 5JAXA 2ZMLA 4E4SA 5C7GA 1OURA 5JSRA 1EV12 5A6XA 1PO21 2ZKNA 1OFNA 2A1XA 2FDJA 2ZGUA 1L7LA 1QU0A 4HLTA 1ZYBA 5FZ6A 5FZKA 3RZGA 2B7YA 3DPRC 1O3RA 5FZ1A 2GNBA 5FPZA 3OEAA 4P9GA 5LBEA 4FCAA 4YNIA 4WM7A 4E2SA 1GNYA 1AYM3 3KF3A 5A3UA 2VCBA 3VKNA 3K3NA 2RS31 4QKDA 3EBRA 3HNYM 4FPYA 4QGMA 4EN8B 1AHSA 3AKRA 3M7AA 5J96B 2FDKA 5DAXA 4MZUA 1W2NA 4M4RA 4PBPA 1EYBA 3ZSMA 4IV3C 2A71A 4B4PA 3DUIA 1YFUA 2VMEA 3N9QA 1W2OA 2VGDA 3BODA 2YC0A 4TLGA 1RJ7A 5FOJB 5J48A 2HWB2 2VQUA 4K6BA 3WQ0A 4EN7B 1RUG1 3OYWA 1OF4A 1LHOA 3C8XA 3PMSA 3WUDA 4XYXA 4JGYB 3ZFEB 4QM8A 4DINB 4CU8A 2R49A 1NCRB 1UPSA 3HOBA 5FY8A 1GICA 1VRH3 3OJBA 3ACGA 4AXOA 1BEV1 4AQTA 4GB32 4BJ0A 4LPLA 4QX2A 1Y9GA 4RHV2 4EE2A 5DN2A 2R041 3SLIA 1CESA 3OUJA 1JTZX 4UFLA 1OH4A 4FBFA 1T6BX 1DBNA 3M4FA 2JDMA 5BUVA 1CZVA 1CR7A 3WF4A 1YXWA 4TWTA 4AEDC 4RGKA 4O7XA 3PUQA 3ZXGA 4MGIE 2QNKA 1XOYA 2PHFA 3LKJA 1QXJA 1LENA 4A6OA 3T0DA 1XNBA 2I07B 4ZU7A 4W50A 1YQ8A 2CAVA 4NHKA 1W06A 2ZGKA 3OF1A 5A7WA 2D40A 1NQDA 4QPGB 2VCMA 3ZM8A 2Y26A 3M8LA 4NIDA 3SKJE 1IKPA 3AYEA 5A7NA 2ET7A 3VBSA 1GZ9A 4JGZB 3DYOA 4NWVA 3VBHC 1S4CA 1KRIA 4QU1A 4RR3A 1F4HA 4DO0A 2QQIA 2Y6HA 2ES3A 4NHMA 1CAXB 1S0GA 3WNPA 1VBB3 3B9IA 4QPIB 5DDJ2 1AJOA 5BNOC 1SMVA 3TYJA 2JEMA 3O0WA 1V0AA 2JD4A 1PX3A 4AE2A 3HBKA 1QNYA 5LW9A 3T1MA 3B94A 4PHZA 4LT5A 1B35B 2ARBA 1F9KA 1V6OA 3D82A 2P2KA 3DXTA 4L0PA 4N8MA 3OGGA 3ZYBA 4CDWC 5C9AC 2YU1A 3KSCA 2ZX0A 1ZVFA 4OULA 1DU3D 4XJWA 2BGOA 1AL0G 2WZR1 3CNAA 4JAAA 2J1AA 5C5TA 5LK7B 4XZPA 1ND2C 1XE7A 1W8OA 1UU4A 5EQUA 4EJRA 2E51A 2BZDA 4HETA 2CU5A 2FMDA 4Z8BA 2VW0A 1REFA 4FO9A 5HCBA 2OT7A 3LEKA 4HL0A 2H0VA 3K46A 4HN1A 1GNHA 3HIFA 3MICA 1LODA 3PTRB 4IEZA 5IFTA 4AGVA 1QJY2 2PLV3 4HKOA 4FPLA 1HJGA 4MH0E 4AEJA 2VOVA 4JQRA 1AX2A 2BBVA 2Y6LA 4Y1ZA 1UY1A 5KXEA 5KR7A 2XPJA 2HKXA 2ARAA 1DDLA 3GM8A 5DXDA 1QJFA 3JQWA 4XILA 3J8F1 5HI0A 4GIQA 5C5UA 2IVIB 2QDRA 3CEWA 2WSUA 4KQ7A 3ZR6A 3AYCA 4MHRA 3HMYA 3LD8A 2XJPA 3DPRB 3POBA 1Y43B 4BPZA 4LBQB 1W0NA 1VR3A 4S2FA 2EVXA 3RGBA 4COUA 1VBD1 3WNXA 1R081 2Q4SA 3QLQA 4FPCA 2RR12 1DFQA 2ZHKA 1XJAA 2UYBA 4JV4A 3SCHA 4OLLA 3RMXA 3K4DA 1LEDA 2PHLA 5GLTA 2XOMA 3LOBA 3ST7A 1HRI1 2CL2A 2Q0AA 2ZTNA 5FZCA 2H6CA 3JCIA 2QE3A 1BXHA 4NPLA 5D8AC 5FOBB 4KWKA 4UFHA 5FZ3A 4XF0A 3MZHA 1S0EA 2CTVA 1JU4A 1GFF2 4Q4X1 1ENRA 2G9FA 4LNVA 1WMDA 3INAA 4J6GA 1GQHA 1FOD1 3I2IA 4A42A 1UAIA 2LM3A 1TMF3 1V6KA 2AEZA 3IT8A 5FUNA 3CDZB 1IZ3A 2Z4FA 1VBA2 4XPVA 1XQNA 3WW4A 1EAH3 4YVSA 3POWA 5I0UA 4UW4A 5C4WA 4HVQA 4Y1UA 1SCSA 4AEDB 2LRPA 3O1TA 4Y24A 1JYIA 4CCOA 2XJTA 4QB1A 3S30A 3KHBA 4FVVA 1KS5A 3HNMA 5FPAA 4G4FA 4A3ZA 1UZ0A 1V6JA 5G04L 1JZ4A 2NMNA 4LUKA 5BXXA 3LF7A 3RG0A 1C1LA 1U5XA 3AKTA 3I49A 2FCUA 3ENRA 3RNSA 2BEOA 4AI3A 2V4VA 3TNQA 3VBHB 5K9YA 5JXGA 1BQPA 3VZOA 1X7NA 4K20A 3BIEA 1JODA 1DZQA 3ZFGC 3SCGA 4KWLA 2WLPA 3ILRA 3LPGA 1H2LA 2I2SA 3OY8A 4X6QB 3ETQA 1EP0A 2VQAA 4ZHNA 3NL1A 4CRQA 1K5MC 2Y34A 5DQ0A 4Q4V1 3ZXLA 4IERA 2DVGA 5CFDA 4LOSA 3KS7A 4DQAA 1O4ZA 1ZM1A 2ZS6B 2MEV2 4LLFA 1OOPA 5A1FA 2R072 1OA4A 2V4AA 3KCCA 4OMDA 3ZYHA 5FBZA 4XTPA 4Y4YA 2DCYA 5C9AB 4YWAA 1HB1A 3D4KA 4KBBA 3NV4A 1B09A 3HQRA 1V9U2 3IAQA 4L11A 5F3EA 4LO7A 3K77A 3FLTA 1ND2B 4LK7A 3VD9A 3VKFC 4A6SA 2UU8A 4W4ZA 3V0BA 3E97A 2A70A 2J22A 3P6BA 4OZXA 1OUXA 2RS13 4A7YA 5CKQA 4HPKA 1FPN1 2BP6A 1AXYA 5KHJA 2VBDA 3H8UA 1YFWA 3KV6A 2X09A 1IPKA 3CIHA 4OI0A 3GJAA 1XC6A 1AR93 4NRPA 4CA9A 4AOCA 3U1XA 5AC92 1CAWA 4WZFA 1SEFA 3N7JA 1MZ6A 3K75B 4CVUA 4K8FA 3CJXA 4B7EA 3X29B 2ET1A 4LBOA 1MZFA 5T5LA 1OKQA 3MLKA 5EZWA 3OD4A 4WBBA 5ANQA 4FAGA 1GP5A 2C4XA 3IPVB 1KJLA 2Z5WA 5DZEA 2OKXA 1F4AA 1WD4A 2UURA 2W9XA 5EJ3A 3SEPA 3NNMA 1CIYA 1ASJ1 2WNUA 3AXEA 5AVPA 5C8WA 5FMOL 4MXVA 2XMLA 1KQRA 4ITCA 4I09A 2O8QA 4Q4Y1 3UYJA 1W6QA 4BQ3A 1QDCA 1W90A 4IEOA 4UF0A 3G7DA 1MEC1 4JTOA 3WEZA 4COZA 4UFJA 1O91A 3R0RA 4AVSA 3QBQA 5LY1A 1QJZA 2BERA 4YLZA 3CO2A 3UL2A 4RFT0 4Y26A 5LBBA 4B8EA 3FN9A 4BK5A 1JU3A 4RYDA 5KC6A 2VNVA 5FP3A 4IE4A 5A33A 1UZZA 3WVJA 4RQPA 4HVRA 4LE3A 3CU7A 1JZ2A 4FFGA 1ZA7A 2HWF2 5FZFA 1G8WA 1I3HA 3WG4A 2W94A 2PHUA 3AKSA 3ZXFA 5F2WA 4UOJA 2UY9A 2WFF3 1S1AA 1RUC3 1Y9QA 4NHLA 4DNYA 1YFYA 1H1IA 4CU7A 3M3IA 2RS53 1AR61 2QTWB 2ADDA 2HWD2 4JTNA 4GMP0 3TB0A 2JXAA 2WIIB 1DGLA 5JZGC 1FI2A 4I2OA 4ES8A 5C8CB 3BU0A 2YDEA 1UOBA 4XE9A 1W8ZA 2A6VA 2D5HA 2ORZA 1DQ4A 4IUGA 1AVBA 2EXHA 1GZTA 4MOAA 1EY2A 4QDQA 3LWCA 2OQ7A 3ZFFA 5DUUA 4F3JA 4QMAA 2JD9A 4IE0A 5LK5A 3KGLA 2WSVA 1QQP3 2NMOA 2ZEZA 3T30A 2HWC1 4RS5C 3GALA 1S0CA 1R64A 2IXKA 1CAVB 1DG6A 1HX6A 4A3XA 1SACA 1UMIA 2R6QA 3ZFGB 2HWE2 1H2KA 5SV5A 4IESA 1QJX1 5CU1A 1OUSA 3ON7A 2XG3A 2RDQA 3HWJA 1H2MA 3W58A 1VB4A 3TEZA 1L7QA 5JOYA 1RUNA 1K5MB 2DCZA 1EPWA 1ZX5A 2MNGA 4QGNA 2YYOA 3MI8A 4QXCA 4XUTA 1PO23 1RJ8A 3AFKA 1CIWA 2EXIA 4I3GA 2GMMA 3CQOA 1KFUL 4LO4B 1LULA 2EF6A 3WOGA 1ACCA 3GNEA 2VU9A 1G9FA 4DXZA 4YW2A 5B4XA 4F7ZA 5ACA1 1O7FA 1XSRA 3BYWA 1FMD1 1R1A1 3UKTA 2RS33 1J83A 2GMEA 5FQ0B 5CFCC 1MS1A 2F6BA 4X6RB 5BNNC 1H8VA 4DY5A 1SZBA 4KU7A 1D2QA 2ZA9A 1FNYA 1QDOA 4JKMA 3J7MA 1Q8OA 1T2XA 4QQHA 3AXDA 1K3IA 2BWAA 3ATGA 5DAQA 2GC3A 3I7DA 5FZOB 5FMCA 2R0HA 3JD72 3R4DB 5FIXA 1S2KA 1RUG3 3NV3A 5B2GB 2BWCA 3W20A 3RPQA 5CYYA 3VZMA 3WP3A 2JG8C 2KA3A 4LMFA 3ZYGA 4YM0A 3AB0A 3WF1A 2HBUA 2CY6A 1W6NB 2D98A 1BEV3 5DAWA 1C28A 3N7MA 2IWGB 3RZKA 3NRUA 2R043 2PFWA 2WNVC 4O65A 4XURA 5IVBA 4DPNA 5IAXA 4BLIA 3VDCA 2WABA 1YIFA 1XU1A 3LEMA 2CYFA 1CPMA 1E57A 4QPWA 3WF0A 5FK8A 4CE8A 1GU3A 3K4ZA 2E26A 4GJYA 4OI4A 5AFBA 5TSWA 2FCTA 4N43C 2UYAA 4I01A 2FZ1A 5DUWA 1EUUA 5K0UA 3QH7A 2ETEA 1QKQA 1RUI1 3OUIA 4XCBA 3ZO0B 3S6PA 5IVYA 5LEKA 3MW3A 5DG1A 4BQYA 1CQ9A 2D5FA 1ENQA 3MIDA 2XONA 1ZRCA 4FOVA 1IS6A 4PLMA 1VBC1 3ACFA 1SLTA 4XFAA 2RM21 1JZ7A 3FLRA 3V0AA 1TQ5A 4H7LA 3IZOA 4LBMA 2RJKA 1HRV1 1SHWB 3DGTA 4LA3A 3ZPYA 2LROA 4Q4W1 1AYN2 4Y22A 4C0HA 4FSJA 2JG9C 4HVOA 1DLLA 4XUNA 5GLWA 4CP9B 2UWAA 4H2AA 2BOIA 4Y20A 5JWPA 2Z79A 3KVBA 3T4VA 2WO7A 3AP9A 1KITA 2YPDA 3ZXKA 2WZR3 3TEXA 4OVEA 1LGBA 1PIV1 1RMU1 1YI9A 3W9AA 2HBTA 3NW4A 1WLCA 3I4IA 4RSUA 1RIRA 3J7NA 1LHVA 2FDHA 4RS5B 1UN1A 3M3OA 2QUOA 1BMV2 4BM8A 4N53C 3MV01 3OPWA 2A3YA 4KG8A 2Q30A 4UFIA 1AX0A 4WVVA 5EWSA 3UJQA 1ENSA 1UOJA 1N1TA 2EIEA 3KT1A 5HBAA 1U5YA 1HLCA 2XJSA 1ODMA 2J1RA 1W39A 2E32A 2IXCA 2VZOA 2ZGLA 3POEA 1COV1 3J8F3 3KV4A 3C2UA 4AI2A 1W9FA 4UFMA 3A7QA 1PM4A 2VUAA 2RVAA 5L7OC 2UWCA 5T55A 3IMMA 3AZXA 3VL8A 3ZYIB 3LFIA 5JR7B 4NMIA 3AP6A 4Y5Z0 3U10A 3WDWA 1URXA 1VBD3 2D44A 2VZ1A 3V65A 3VV1A 3WNLA 4CPBD 2A3WA 2R7EB 4OMCA 1R083 3UKNA 5CFCB 2OW4A 3HN1A 3AKPA 5FXVA 2WYSA 4NHXA 5FPLA 1PO12 1C8M2 4CDUA 5A6ZA 2QQJA 1O6UA 4COVA 5BNNB 2Q1ZB 3BN6A 5F7UA 2A3XA 2FMYA 1W28A 2HEYF 5GZGA 1HRI3 1KGYA 4EQVA 5FYIA 5C3SA 3THDA 4ZY9A 3LE0A 3L2HA 1IS3A 4G9SB 4R4ZA 3PIJA 1J3QA 4GXLA 4YM3A 3BTYA 2B9UA 3PUIA 4M01A 1MPXA 4ZZ8A 2DF7A 4Q4X3 2C6SA 2BNMA 1UYYA 2QQOA 1AL22 1HQLA 1H6XA 1UY3A 1QXPA 2VMCA 3CJIC 1GWKA 1ZA4A 3NJVA 1FOD3 4AK3A 2JG8B 4GMP1 1A6CA 4AVBA 4B4RA 3POFA 1EV11 2MHFA 1UY0A 1TNRA 3ZXEA 1ZRFA 1T6GC 1F15A 3I59B 2BU9A 1VMFA 2RHPA 3LDRA 4URTA 1D4M1 5T5OA 1LB2A 2WNVB 5FTTC 2B9VA 5DUVA 4LJHA 3DECA 4D8MA 4A41A 5FAXA 1FV3A 2BOJA 1SBDA 5SV8A 1DP0A 4JQTA 4WM8C 1YO8A 4DB5A 1GYKA 4MADA 4D6SA 1GP4A 1PGL2 1S0BA 2WINB 4Q1PA 4QXHA 2HJIA 1GOFA 2NLRA 2QKDA 3D8CA 4GKYA 4N43B 5IJRA 2W95A 3LZZA 4AFBA 1I6XA 3GHMA 3ITQA 3ZSEA 5C33A 1IG3A 5FPBA 3VDDA 4AR2A 1WLTA 1F5FA 4W65A 2HWB1 1D2SA 4XCAA 4YZ1A 5JPMB 3PVNA 4CCEA 1OHFA 2VQTA 5AFEA 4TLFA 4E2GA 5FLHA 5L9BA 1HB3A 4AQSA 4EN9B 4R8HA 1GUIA 4GB31 3BVCA 4RHV1 1UW8A 4QM9A 3UT0A 4Q4V3 4LTAA 2JG9B 5AVAA 4QQ2A 3RWKX 4D6RA 2A6ZA 2F4LA 2YGMA 3IMNA 4EWDA 5FYMA 1ZZBA 2GN7A 2YBKA 1ULOA 2DFCA 4EWAA 3LCPA 3U11A 5CBLA 2ZAHA 4IQPA 4KG0A 2B5HA 1VBE2 1OT5A 4JGYC 3ZFEC 5BNPA 4KGGA 4UBGA 3GBFA 5DMYA 4IE7A 2WT2A 4XQDA 3MLJA 3U75A 3WUCA 5JMOA 1O5UA 4QAWA 5K8SA 5F2SA 2FZ2A 1OLQA 2OA2A 2TNFA 3FUOA 2IFRA 2P17A 1FPN3 1OF3A 1YYNA 2QQWA 4N53B 4DUVA 1Q8SA 2VMGA 4QX7A 3UKVA 1RYYA 2WKKA 4XTMA 3CL1A 3RRDA 3ZN4A 2JICA 4DOUA 2VVDA 4BOWA 4CEWC 3AJYA 3WHTA 3N9OA 3WG1A 5DDJ1 1YQ5A 5A3NA 5LB6A 2P3IA 1OMIA 3Q8BA 2QBXA 4CCMA 4HMZA 4P9LA 1GBGA 2DTWA 4I0WB 4J1XA 1DCSA 1OBNA 3AL5A 1HB4A 3WG2A 1WA4A 5CAZA 4Z07A 1YCIA 4JGZC 3ECQA 2PLV2 2W1UA 4NROA 1ASJ3 2GU9A 3KQ4B 2BNOA 3WQ7A 4C1WA 4I3PA 4Q4Y3 5FRAA 2DURA 1BYHA 1JUHA 2R1BA 2W0XA 4UAPA 4CSWA 4C91A 1V00A 1MEC3 1LNSA 2QDNA 1DYKA 3CBNA 4PCRA 1MS9A 2YB7A 5KXBA 4OYUA 1H6YA 4JRAA 1HW5A 1CZSA 4LORA 3TN91 2PHRA 1LAJA 2XLGA 1NXMA 2BNNA 4FPHA 1LHUA 1JS9A 2Q1MA 3B69A 2J1UA 1J3PA 1GZWB 4AFCA 4CCLA 3CJIB 1GNZA 1R092 2GAUA 4P08A 4QQOA 3HEIA 5BNOA 3WNMA 3KHCA 3ACLA 1S2BA 1XNTA 5JUVA 4LHSA 2BVVA 4DFSA 5BY5A 3AP7A 3M1HA 1RITA 1F35A 1NCQA 1AR63 5A3WA 5IUQA 4OQ9A 4CDWA 4TTGA 2W68A 1V70A 3DV8A 1QH7A 1ND3A 4QB6A 1ULCA 1MS5A 2RMU1 3Q8EA 3NMBA 3PVBB 3FL7A 3VB9A 4WM8B 2XDVA 2GP5A 2VW1A 5LZ6A 4NWWA 4CPBA 1HV1A 4CCCA 1PVXA 5JSOA 4K3UA 1DQ2A 3T2TA 3IKWA 1C57A 1W6OA 1C5HA 4XMIA 1UZYA 4JVAA 3FZ3A 4NHYA 4DS0A 2WWSA 5FO8B 1EAH2 2HWC3 2IVJA 3ROUA 3VHOA 5K0UB 3CZJA 3UETA 1RB8G 4ASLA 4IL7A 1U0AA 1OD3A 1TNFA 1XYNA 3JBG2 1PK6A 2W1QA 1OH3A 1FYUA 1QJX3 4IEWA 3ZXJA 1LECA 4XJUA 5E1RA 1W2AX 4E4ZA 4YVWC 1LOFA 3KV9A 2EXJA 1PGSA 1PMHX 4LHLA 2GNDA 1REEA 4XJ8A 4QX1A 3APBA 3T0AA 1A8DA 4Z1VA 1W2UA 2GNMA 3VHRA 4GQ7A 4CEYB 5ACA3 4QX3A 5CISA 2E6VA 3PTYA 3LB9A 4HOOA 1FMD3 1R1A3 1DZTA 3NNJA 4AQ6A 4AVVA 4LULA 4CP1A 2LUWA 5H9RA 1Z7S1 3E1F1 1WBLA 3N7LA 4AVAA 3OPZA 3EJKA 5I93A 4ZZ5A 2ZAAA 5FP8A 2PAMA 3AVRA 2P1BA 3BPZA 5DABA 4DRVA 1HJFA 1ZREA 3I3EA 3WNKA 2AEYA 5FYUA 3SISA 1QJU1 1QWRA 5FYBA 3Q8AA 2D43A 2WC2A 3EXUA 4FOQA 4CEWB 3CZUA 3JZVA 3VBFA 1XB9A 1UXXX 1BBT2 4OFGA 5F9TA 1ZBE2 2Y33A 1UO9A 3MGUA 4CUCA 2GN3A 3WG3A 1W6MB 3ES1A 2MEV1 4BA6A 5LRRA 2R071 2RS12 3WV6A 4IGOA 3USUB 3PUHA 3B00A 1CZTA 1WW4A 5EYXA 3ZN6A 3HN3A 4FPJA 3VBUC 4AHZA 3ZYJB 3WW2A 3FLPA 2D97A 4YG0A 4YZ5A 5HXMA 2P5BA 5LA0A 1IG0A 4S2HA 5FREA 4CU6A 5L36A 4D3WA 3EYPA 3LDKA 4HANA 3WNNA 2FDGA 1WLWA 3S5QA 4CDQA 4R9DA 3RYRA 2C26A 4AAXA 3IIAA 4IV1A 1SPPB 2VZVA 5LBCA 5KXDA 1MQTA 4I0AA 2W52A 3VHNA 5F3GA 1WA6X 4JDMA 3BTXA 1RUI3 1F2NA 4DMIA 1JZ8A 3POGA 2W5FA 2ZGQA 4G3YC 4OQ8A 3GF6A 4M3CB 4PDWA 3AKQA 5AC91 2JENA 2WJSA 5CEHA 4MLOA 5CIRA 1XBFA 5J09A 2OUJA 2VMDA 1VBC3 1WMXA 2P6HA 2AR6A 4MXWB 4XEZA 2RM23 5I0DA 1OSGA 2JDUA 3K2OA 3MW2A 3OBTA 4J25A 1OVPA 2Q8EA 1HRV3 2ZGNA 2AH2A 5HV0A 4Q4W3 3Q8CA 2PYTA 2VTFA 2Q5TA 4MGQA 5A3OA 1W8UA 3VKOA 2ZKLA 4YZ2A 2BGPA 1U12A 1Y3TA 1H9PA 1WUVA 5F37A 3H3LA 3I2HA 2OZJA 1SDDB 4URAA 3O1MA 1POQA 4D7TA 4CXYA 2XJRA 5L73A 1J84A 2Q8CA 3VBRA 3S5AA 1MS8A 3HQUA 5C6CA 1AF9A 1PIV3 1RMU3 3AYAA 1LKNA 1RUC2 3DKWA 4AGGA 5A6YA 1K12A 4RN5A 1POV1 4N9IA 2RS52 1VB2A 3A23A 4FPGA 1LEMA 2EICA 4EN6B 2Z69A 3WSOA 3O0VA 5FYCA 4PF5A 5I0TA 3BIWE 4N7UA 4J1WA 4A4AA 2VVEA 3UJOA 3WCSA 3I2OA 3ZSKA 1PZ8A 1JHJA 2IFWA 2E7QA 2VMFA 3GDBA 3H3UA 3FWEA 5GZDA 2I45A 4WM7C 2VQ0A 3E6DA 1A8MA 3KWVA 5GLUA 4BIOA 4JDNA 1VMHA 2XJVA 4IE6A 4D7YA 5IVJA 1COV3 3LIGA 5HCHA 4YVWB 4QX5A 4IGPA 1H4HA 4LQRA 3KGZA 2V5YA 1N3QA 2W91A 3PU8A 2BTVC 1ALYA 1SFPA 4NRMA 1QQP2 3RI8A 2JB8A 4PQQA 4FFIA 5JDBA 3OTFA 1JYNA 5IVCA 5IVEA 3PDQA 3AMQA 3UV9A 4TZDA 2VTXA 5FY4A 5GLVA 4IEUA 3ZIWA 1WMFA 3O12A 4K1ZA 2WS91 1YQCA 1D7PM 4NN0A 4K40A 4WVMB 3VBOA 3WD5A 5J98B 3U14A 5KHGA 1JYXA 4FTBA 2FQPA 3RMYA 3LA7A 4JRLA 2ID4A 4R9CA 4UT5A 3E6CC 1IGOA 1PO22 3H8OA 2WR9A 1NOVA 4MUVA 5C8CC 4XW3A 3DL3A 3PJYA 2OIIA 4R9AA 1Y4WA 1LOBA 4XIKA 1CX1A 1DQ5A 2DVDA 1H1AA 4BHPA 4IW3A 4V1PA 4FTEA 3EQEA 4GMP3 5J36A 2XHNA 2BQPA 4HFSA 1EV13 5JZGA 2Y6GA 4IETA 2RDSA 3QACA 4PIYA 3LFMA 4Y33A 1D4M3 3OBAA 4GH4B 3VBUB 4CXWA 2R062 2JB4A 3RJRA 4TSVA 3VBSC 1RUG2 3MIBA 2XQRA 5DAVA 3RQ0A 5IK4A 5JVVA 3AJZA 4L92A 1AXZA 4RR3C 2IXJA 2OXBA 4CUBA 2IC1A 1VLNA 1A34A 4YFWA 1JOJA 4OUSA 4O9EA 3ZIXA 1IPJA 2R30A 5FMDA 4ZKTB 5B4NA 2R042 1OKOA 2HWB3 2XR4A 2Z2SB 4P9JA 1I1EA 2YBPA 4UXAA 2CGNA 5A7OA 1O3QA 2VXJA 2WA4A 3AL6A 5F6KA 3RSJA 1AR81 2NN8A 1W9YA 4GWIA 3WLUA 4DXRA 1IKQA 5KXCA 3OUHA 2JWPA 2CDPA 2JIGA 3KLSA 1M4WA 4GB33 4RA0A 4RHV3 4OUEA 2VZRA 2K9ZA 2CDOA 3N9NA 3D0SA 5FZHA 2VE1A 4Q0QA 1AR71 3O1SA 1C5IA 1SG3A 4L99A 2ZMKA 1JZ6A 2VZTA 3ES4A 1RUD1 1YJLA 2D6OX 5K7PA 5KHKA 2AREA 5FLIA 4EV0A 3AC0A 5ERLA 4LBKA 1RUJ1 1KDKA 1ENXA 4HKLA 2ORXA 2PA7A 3GZTB 4QKNA 2BPA2 3I3MA 1MS3A 3RWNA 1GQGA 2WO1A 1RXFA 1RVF2 3THTA 4PI2A 3VD4A 2WLQA 3POIA 3B93A 3VL9A 1FX5A 2W3JA 1WLDA 3ACIA 2GC1A 2Y38A 4WM7B 5LBFA 5LATA 5A32A 5JIUA 1OPMA 2WWJA 3HJRA 2F17A 1DF0A 1ULGA 2OPKA 5DDJ3 1ULEA 4OCTA 2ZACA 1I9RA 4PT6A 1PK6B 3AMNA 3IDBB 5H9SA 1QOTA 5BNQA 3R05A 1H4GA 2VCCA 2WN2A 5LA2A 2VM9A 4P9XA 3MIHA 4LLOA 5T50A 4XF4A 5FZEA 1VAKA 3WQ1A 4WVZA 2DU0A 1ZZ6A 4YG3A 3A22A 4F8AA 1KJRA 4UW5A 3TEYA 1TZOA 5I0SA 3OEBA 3OYWB 5DPNA 1H0BA 1GP6A 1V6LA 1BCXA 3J8F2 4DEQA 3JB8A 3ZLIA 1BZWA 2C24A 3J4UH 2IZWA 1BMV1 2DUQA 3TN93 5I91A 1UZWA 4NVPA 3AMHA 5JXIA 3H1WA 3VDBA 5CZKA 3FC0A 1Y9MA 1WD3A 4CP2A 3I3DA 4YVSC 1J58A 2DCKA 3LA2A 1O8SA 3LDBA 1R082 4FPFA 4AI1A 5HCAA 3PJQA 2KR2A 2FDIA 3MYXA 1S0JA 2Y6FA 3C7HA 1ZBA1 5BV6A 5GZEA 2D6LX 3O0XA 4XUOA 4KU8A 4QXBA 3TAYA 2D3PA 3BOWA 2AENA 4LBNA 2IXLA 2WT1A 5A7WB 1W3VA 2XL9A 4NJ4A 2RMU3 4UWDA 4YM2A 4I02A 1RL3A 4KMQA 4RFRB 3VBSB 2QZ3A 2VZUA 3WQBA 4GA9A 2E33A 2G4IA 4RR3B 1FT9A 3THPA 1E5HA 5FY9A 3BTZA 4LXLA 1WCDJ 4ZXEA 2O1QA 4FOYA 4P14A 1QHDA 1KS4A 2ZHMA 5FUIA 3WDVA 5A3TA 5EIYB 4XFFA 3M70A 2E63A 5CFDC 1AL21 1RUF2 3NJXA 3WNOA 1OOPC 1IQDC 2VH9A 1CAUA 4I0BA 4CCJA 1VALA 5IVVA 2R1DA 3GZAA 4BXSV 4HN0A 1UD1A 3MFAA 3CLPA 3D0JA 2A6WA 3MUZ1 5GZFA 5LWBA 4A44A 3KB5A 3L2YA 1UIKA 3R4SA 5FZ0A 1STMA 4Q5OA 1HDKA 3U4SA 2OX0A 3I2GA 1NA1A 4M0NA 3SKVA 1WW7A 5KWRA 1UIJA 2X5IA 5A7QA 3ZSJA 3ZXDA 1UXZA 2P34A 3VZNA 2BYVE 1AUYA 5C3PA 3OOXA 1PGL1 1A78A 1O4TA 3N9MA 1CN1A 1NZIA 2Y0IA 3A0KA 4LBQD 5JXJA 2PN5A 1Z7S3 2XKPA 1K42A 1HQWA 1UYXA 2CWMA 1Q8QA 4AEKA 1LGCA 3VBRB 2TUNA 2QQPA 5F39A 4CDXA 3FJSA 4FXKB 4HK8A 4WV8A 1NXD1 1RUH1 4QXKA 4UFKA 4KNCA 1QJU3 1YJKA 2N7GA 2DVFA 2ZBJA 1BK0A 1XNCA 3Q9OA 4QPYA 2WNUC 5BYNA 3HNBM 1H8TA 2VOKA 1QY4A 4YGBA 1OI6A 1GKBA 2JKXA 3O1PA 2FBEA 2C9AA 4BK4A 4F83A 5DG2A 1WMEA 5ABJA 2MEV3 1NZCA 2R073 2QJVA 2CNAA 2VNGA 3M3QA 2XJUA 3RZZA 1FPN2 3SC7X 3NAPA 3BKZA 1AZDA 3AP4A 1VBE1 2XBO2 3UGGA 2TEPA 1TME2 1S55A 2XGXA 4RQPC 4X8NA 4CYDA 3J7LA 4U2AA 4BQ2A 4AI9A 1Q8PA 4Y1VA 5T54A 4GJZA 4NRQA 1VRBA 2WQZC 2QQMA 1Q43A 1US2A 5IT6A 4QQPA 1JZ3A 5D21A 1RUE1 2Y6JA 2ZABA 5IAVA 4YVSB 4ZU4A 5F1RA 1H2NA 2A6YA 4H55A 5AC93 2JX9A 2BFUS 2V5DA 5C4WB 4RL7A 2JECA 3RFRA 5A7SA 4FP2A 4PLNA 4AG4A 3MLLA 5FXWA 3J26N 1RC6A 1GMMA 4XJZA 4B1MA 1IOAA 3HPNA 1MEC2 1UZVA 3VZJA 3VN4A 3S0MA 1E5RA 4GWNA 1IHMA 2DWRA 1W9TA 3ZFFC 4XUPA 3AK0A 1QMJA 3ZFEA 2B39A 5LY2A 5L9VA 4LBJA 1NCRA 4HZFA 1GZCA 1PMJX 4FQ4A 1GWLA 4PBOA 3KF5A 3NNGA 5LEJA 1RHI2 3CKHA 2DBIA 5FXZA 3W5NA 2ATFA 1LOEA 1PVC2 2D6KA 3OY8B 1MS0A 4FP3A 3U07A 1POV3 5GM0A 2B8MA 1GWMA 2ZZJA 4HXCA 4ATFA 3P1IA 3SCFA 2W47A 4YW7A 2FD8A 5F5IA 5CFDB 1R091 1BJQA 1X82A 1OOPB 4Z82A 4BU2A 1VAVA 3V64A 4RD7A 2RE9A 4IEXA 4XQWA 2NP0A 1SDWA 1HXS1 1ZRRA 5FXXA 4Q26A 2J1EA 4NUBA 4XFHA 5F8PA 1GV9A 2ZEYA 4QPGA 4SBVA 3RS6A 1LHWA 5FZMA 1RUOA 3BCWA 4FPKA 2VECA 4MX3A 1SLLA 4OI1A 5E16A 4JGZA 1RINA 3V0BB 2H0BA 2JDZA 5CG9A 4QT6A 1GOGA 2G9GA 4AF9A 3GHNA 1AYM2 2ZEWA 4HPKB 3GJBA 1CAXA 2V09A 4LHNA 4IEPA 5FZLA 4QPIA 4BISA 1UY4A 5BPXA 2BRTA 5JIAA 3IDCB 3LEIA 2JDHA 3ACHA 1G6NA 2YMZA 1JH5A 2WS93 1XYOA 3ILNA 3AMMA 1MR5A 1VPHA 3FX3A 1CAWB 3KMHA 1B35A 3PU3A 1CWPA 5FJKA 4Q29A 5A80A 2D6PA 1L7RA 4YW1A 1K45A 2VPVA 1QGLA 2VZPA 2ARXA 2W1WA 3O14A 2KXLA 3A21A 3HT1A 4HK9A 4LKDA 3JBG1 2YFZA 1ZZ7A 3GGLA 3LAGA 3ELNA 1WZXA 1Q8VA 1XRUA 3QD6A 2R0FA 3LIHA 4K21A 3VD5A 1DGRN 2WNUB 1CD3G 1QOSA 3OPTA 1UCXA 4W6YA 4Q2FA 4AHWA 2IXHA 3T2OA 1CGPA 4XDPA 3NJYA 1VRH2 2WN3A 5DAPA 1JN2P 1W6QB 2GALA 1GQPA 1ZRDA 3HBZA 3MF6A 4L2NA 4UF0B 5FY1A 3N35A 1W99A 1DHKB 4ZONA 5HV4A 2ZHLA 5C70A 2Y8KA 5K0UC 3F2ZA 4P02B 5FZ9A 3O1UA 4QDRA 2BUKA 3GZUC 2WO2A 3DKQA 2GMPA 4NO4A 5A33B 3SMHA 4RQPB 4DXTA 4BH9A 1PGW2 5JOWA 2P4EA 3DPRA 3HT2A 1SFNA 1DYOA 2JDNA 3EHKA 5FWEA 5HCFA 1JBCA 4LBQA 1WWYA 2RDRA 2WZEA 1LU1A 1XSQA 2YC2A 4FAHA 2ENRA 4AGRA 1C4RA 1LU2A 2J7MA 4XQ4A 3CHXA 4PQ9A 5FLJA 2ZCWA 4YGEA 1WGPA 3VKLA 2WZ8A 2QQKA 4FTSA 4Q0PA 1QOOA 4CEYC 2JIJA 2P37A 4IV3A 1UY2A 2EIGA 4CXXA 1GLHA 1BBT1 2W46A 2XUEA 1AR83 1ZBE1 4NIHA 4BIFA 4ZU5A 3DYPA 3NO8A 4DZGA 1VBB2 1W0OA 2HEVF 2J1VA 4XAAA 2OS2A 2EA7A 5GJ6A 1A3KA 4CTEA 1WW5A 4IGQA 1CJPA 2DTYA 3ZFFB 1JOPA 1NX9A 5JMCA 2HLEA 4JCKA 1POV0 1AR73 3WINE 2IXIA 2K46A 4XXAA 4BYYA 1XE8A 4AQ2A 2ZX2A 2XLAA 4CUGA 4N9HA 2VNOA 1NY72 3I8TA 1WW6A 1RUD3 4D94A 1DZRA 3S7IA 4D0QA 1W04A 4OHWA 2RM22 1RUJ3 2NYYA 2EAAA 4S2DA 4HKWA 3BUCA 1HRV2 2RG4A 3RI9A 3K4AA 4AEDA 1SLAA 5A1LA 2J1SA 4Q4W2 1QH6A 2HEWF 1MS4A 2WNEA 5ANNA 4ATEA 4BDVB 1JYVA 4NPRA 5FZDA 3WDYA 1UOGA 4B29A 4KI5M 4LEJA 4BQ5A 2XHKA 1RXGA 3D3AA 4EZHA 3R4UA 2XWBB 1UX7A 2BBAA 2WL1A 1LCLA 4JZRA 2WDBA 3UK9A 3ORJA 3JU9A 2QFEA 4Q0UA 2E53A 3AM2A 3VBHA 5FY7A 3NV1A 3ZPOA 1QJY1 4CDUC 2XKOA 2ZGTA 4JDOA 4XMAA 1SLBA 4LIVA 1WBFA 1E5SA 4H7MA 2OPWA 5GALA 2E31A 1X9TA 5I8YA 4NR1A 2O8OA 3O5SA 3P5BA 1DYPA 2XWJB 3QOPA 1PZ7A 1NE6A 3LEGA 3OB8A 4U36A 4DRRA 2ARCA 3LPFA 3H7JA 3VD7A 3C7FA 1SBFA 4ISRA 4K1YA 4E8DA 4W6WA 3MO4A 5FFOC 1CX4A 3NKTA 1VE0A 2XVKA 1COV2 1OD5A 1QEXA 4LUMA 4EN0A 5C9AA 1DQ6A 2A7AA 4XACA 3ZKYA 2JDYA 2KM2A 1FAYA 2WQ8A 1ND2A 2RR11 3BGAA 1E5IA 1UKGA 4Q8LA 2ZEXA 3FE5A 4E27A 1P8JA 1HIXA 3UGHA 3K48A 2WBKA 3IB3A 5FZ7A 1TMF2 2CGPA 2W1SA 3WX5A 4LE4A 1SLIA 4Q0VA 4YSFA 1ZBA3 1BVP1 1J59A 1NLQA 4DY3A 4DUWA 4YFZA 5FPVA 2TBVA 3ZYRA 5FCCA 5FPXA 4Z2AA 3B5LB 1KXGA 1KEXA 3FFQA 2YZ4A 2P3KA 3KM5A 4XFCA 3M2MA 1I5ZA 3VDDC 5FPUA 2A75A 1F31A 2P3YA 4BMEA 3SHRA 3ME2A 4NIAA 4JC1A 4AL9A 1VBA1 3IPVA 5K4LA 2A5ZA 4XVHA 1EUTA 3ZKUA 5C3OA 3V0AB 4Z92B 4FPOB 4NAOA 3U4XA 3OGVA 1VIWB 2Y6KA 1O3SA 1HN1A 1D4M2 4Y22B 3RZHA 1UPIA 3F95A 3WDTA 5FZGA 1AL23 1OVSA 4H3WA 2VAUA 4GKXA 4RGAA 4Y20B 4A7KA 5FYZA 4QHZA 1NLSA 3M3CA 5D8AA 4C8DA 2VY0A 2R16A 2VJXA 4BQXA 1LESA 1WCUA 2XB6C 2X8KA 3S7EA 5BNPC 4O9GA 3GBGA 4MG2A 4HSLA 3FHAA 3ZDVA 1OLME 4DXSA 1NLRA 3SEEA 3B9CA 3I3QA 1XNAA 2KD7A 2R061 3GBWA 2LTNA 2GNTA 4Y3OA 2VG9A 5IW0A 1YRZA 4BB3A 3VUOA 3NV2A 5A70A 3VKMA 1YQ2A 3WT3A 1YQ6A 3I2KA 1DQ0A 3EB7A 4TN7A 4COYA 1XYPA 4P5YA 5E6HA 5FYYA 1V6MA 3W59A 2PXJA 4M3CE 5C8CA 4IEQA 4UW3A 3SH5A 4YGCA 5LASA 5JI9A 5T52A 3H7YA 1H9WA 4YZ4A 4GH4C 4YGDA 3B3QE 3FFZA 5FYSA 3TNPB 2Q1FA 1CPNA 1AR92 2DCTA 1V9U1 3G6JB 3VZLA 4LIUA 1RUH3 5G05L 3OCPA 1OA2A 4O61A 2YC4A 5FYVA 2BW8A 2VVFA 4JX0A 2PTMA 2VUCA 5IHRA 1QF3A 4LKSA 2GDFA 2HYKA 1W03A 1CAVA 4CDUB 2VNRA 2VTXJ 3ZFGA 3V56A 3M3EA 4XC9A 3TBDA 2A6XA 2J42A 3KV5A 4P9YA 1K5MA 4OHZA 4GULA 1G9AA 1VBE3 5FZ8A 5JXHA 3SXWA 5FP7A 3MBWA 4BXFA 3URFA 3K51A 1X9PA 5A6QA 5GZCA 3ASIA 2VC9A 3OGJA 1R1ZA 4BQ4A 1QNWA 3AP5A 1LRHA 3H0OA 3OBZA 4KWJA 4NPMA 1HB2A 3I97A 4XAEA 4E4HA 3K3OA 3PIGA 4HT1T 5KHIA 3MFCA 5GLZA 3AZZA 1OFSA 2W39A 3N9PA 3MIEA 2YU2A 2DYCA 4ONUA 1NCQC 1RVF1 5APAA 4Q8KA 5FQ0A 4IE5A 1RUE3 1SBEA 2ZXQA 1W8FA 2YFUA 2WA3A 2LW8A 1ND3C 2W2IA 4OHVA 2WFF2 4XABA 4Y1YA 3P3PA 2WZPP 5FZOA 2AC1A 3ABZA 5C3QA 3RZMA 3P3NA 1HN0A 3KCYA 4YYOA 2K2SA 1V6NA 1DGRA 2HWF1 4XFBA 2PAKA 3TN92 4XHBA 5T5PA 5J7MA 3EMRA 2GP3A 4XBNA 4TXWA 4ZS3A 2O14A 2P6CA 2PMWB 4OHXA 3VDDB 1X8EA 2BV4A 2QZ2A 5FBJA 1TEIA 1W6NA 5JR2A 1YNAA 2ZGRA 2PQSA 2ZZQA 5EPAA 1FV2A 2HWD1 2PELA 2PHDA 3HQXA 1PK6C 4XOGA 4EZ4A 4YM1A 5T5JA 4NIIA 2QQNA 2B46X 5F5CA 4ASMB 4DIQA 1Q5OA 2IUWA 2AACA 1R093 5FDBA 3N9LA 2RMU2 1LOFC 1BLZA 3UNPA 1O59A 2OVUA 1ODNA 3B7MA 2XQXA 1HXS3 2GSYA 5FP4A 2E7TA 5F6LB 3FUQA 4AHYA 4XJAA 3KZ4C 2XXZA 1OPOA 4B7KA 4IV3B 5BNPB 1AX1A 3POYA 2EIDA 4NIGA 1UF2C 1WCSA 4LR4A 3BB6A 3KT4A 1HKDA 1O3TA 2RJLA 2HWE1 2VO5A 4BQ1A 3D6EA 1ZRIA 4K9SA 2VOTA 3AMPA 3GYDA 3PUAA 3TRSB 2RS32 5CVRA 1SQ4A 4HG6B 1WCKA 3WF3A 2OUHA 4Q0SA 5IWFA 2UY8A 3PUSA 4CP9A 5LA1A 2YG0A 3AZWA 3VBFC 3AYDA 2E7AA 5KC5A 3MV11 3DEMA 2D3RA 3ZDSA 2A73B 3THCA 1XNDA 1RUF1 4XBLA 5F3IA 1XXNA 1MZ5A 3JBG3 5EJZB 1JI6A 4C0BA 4GD4A 4E4DX 4COWA 1U5ZA 3ZYFA 3T1LA 5FR3A 4QKFA 2PHWA 3VGIA 1REDA 1RTVA 3MDPA 2DCJA 4ORFA 4RS5A 1C1FA 2HYXA 2RDNA 2Q8OA 4YW4A 1YWKA 1Z7S2 3RYKA 2DFBA 3ZMNA 4D6QA 4QQLA 5FK7A 4HSJA 1BEV2 1DGWX 1OQDA 4L97A 5C3RA 5J3UA 1F8VA 4ZPIA 1X8MA 1UYZA 4CDQC 1K5JA 2XL7A 3BTAA 3JD71 4Y5TA 1YEWA 4IV1C 1MQTC 3I54A 4Q1RA 1N3PA 2VZQA 3JXSA 2DBNA 2G1MA 4C1XA 3AX4A 1X36A 3T0BA 2GH2A 1QJU2 5M0TA 1YUDA 2XVGA 4FQZA 4P9IA 4PDWC 3JUUA 4H14A 5JOXA 3BU7A 1MACA 2B42B 5FO7B 5I0RA 4EROA 1UU5A 4XF1A 3OD0A 4XUQA 5BNOB 3SH4A 3RYPA 4XXPA 3U78A 1H1MA 1VMJA 3N7KA 2WRAA 3R6SA 1JUIA 1YLLA 2WT0A 4NAMA 5CFCA 4BQWA 1NCQB 1LHNA 1TVGA 1X33A 2Z42A 4AVCA 4AVTA 4CDWB 5BNNA 2BVBA 2JE7A 2XJQA 2CSGA 1IQAA 3DYMA 4I30A 1LOGA 1ND3B 5DUXA 1QJEA 1V6IA 3ZSLA 4ET7A 1BBT3 1GSLA 4P9WA 5IYYA 1ZBE3 1NT0A 4GALA 3AVSA 1W8WA 4D7SA 3VBRC 1UKRA 2VZSA 2BDRA 1C8NA 2GC2A 3LGRA 4CCNA 5CADA 3WP4A 3WP5A 3WXPA 1YI7A 4CCKA 5A1AA 1G9BA 1W6OB 4OUMA 1DIWA 4R9BA 1H30A 2VD7A 2JG8A 4QWNA 2XBO1 1CJDA 1TME1 4MVTA 5H9PA 2WZR2 4MGKE 5LCWL 4KH9A 1NE4A 3I59A 5FKBA 1UYPA 3PVEA 5EJ1B 1AYN1 2WNVA 1MVQA 1NAEA 5A3MA 4AYUA 3MIFA 2D6MA 2EALA 3CMGA 1OQ1A 1MZEA 1KD7A 2AZ5A 5E88A 5J1XA 3OGSA 1X50A 4LK6A 2FDFA 5H9QA 2PAEA 1W6PA 1UNBA 5KHHA 2NQYA 3MIGA 2VL4A 3NQHA 1W8TA 1US3A 3GCXA 3KVAA 4N43A 3D5OA 2VR4A 1D0HA 3POJA 4IEYA 4M00A 4DUXA 5IFPA 1ST8A 2PHTA 1F5JA 2C9KA 4JHZA 4LOTA 2BFUL 3PNAA 4MGSA 4W8JA 5FWJA 3BPSA 4YG6A 4LHKA 2RV9A 4M4PA 1HV0A 3OG2A 2B45X 2DUPA 1QJY3 2LS6A 3J7HA 2JJ6A 5D8AB 2W08A 5CKMA 3VBOC 3QCWA 4XDQA 4P00B 3WF2A 4CUAA 3C7GA 4D69A 5A3PA 1VBD2 1GOHA 3WW1A 5IK7A 3POSA 3WDXA 5C4WC 3WCRA 1RHI1 4FFHA 1UX6A 2JG9A 2VUDA 5A7PA 4XBQA 4PLOA 4BE3A 3U0ZA 4W6XA 2WAAA 4DEVA 3TEWA 1PVC1 2EXKA 3MF9A 3VBFB 5FP9A 1HRI2 3IBMA 3IM0A 3T4HB 3H3ZA 3T08A 3BI3A 3IWZA 4FXGB 3RZLA 5D1IA 1WKYA 2PQQA 1OLRA 4Q27A 2ZGOA 1W2TA 3IN9A 1ZZCA 4Q4X2 1UU6A 3IIIA 1PO11 5FZAA 1C8M1 2MPFA 2RR13 5EFUA 3ZN6B 3N3HA 4UYBA 1I5PA 1JOBA 4E9KA 1PMIA 1FOD2 1FNZA 4YW6A 5JI7A 5CB7A 3T2PA 3WHUA 2DUOA 1ONAA 1UMHA 5EHDA 2WS92 4N53A 1N1YA 4WVWA 4XZUG 4A2UA 2WUHA 3N36A 4CDQB 4YARA 5HPOA 2VOXA 4IV1B 1MQTB 5JCTA 3QH6A 1AYM1 1M06G 1GR3A 4A45A 3FHIB 1DQ1A 4BWOA 4AHXA 4AEMA 4GWMA 2F4PA 2V72A 4PDWB 5L7OA 2NZ9A 3BOPA 4ZS2A 2ZMNA 4QB2A 3W21A 3GCWA 1C3HA 2VBBA 4N90A 1VBA3 3B02A 2YXSA 1S0IA 4QDSA 3PVOA 4PIZA 2VZ3A 3PMEA 4OZOA 5F5AA 5LA9A 4QGLA 4XF9A 3WR0A 3MPBA 3TWIA 1ZZ8A 3ETPA 4FOWA 3AFGA 1N3OA 2ZX1A 4X8PA 1OQEA 3LOIA 2D6NA 2P3JA 4AWDA 3H1MA 5CNAA 2Y60A 2ILMA 3KT7A 1VRH1 5FY0A 1BK1A 4UBHA 4AZZA 1IS5A 4FPEA 2WO3A 2YUEA 4BLJA 4Q4V2 2ZHNA 3OGRA 5EXOA 5FKCA 1GZWA 3ZX7A 4C90A 3CJIA 3KCXA 3L9JT 1WCQA 3GZEA 1HQNA 1O8PA 4GWJA 4V2WA 1G9CA 2ZX4A 3HVDA 2UWBA 5CKNA 5IK5A 1NUKA 2R063 5E89A 1UQXA 1OA3A 1ULPA 4AFDA 4A7ZA 1PGW1 1MVEA 3T2QA 5DZFA
chains in the Genus database with same CATH topology
4NAOA 5LB6A 2Y33A 4MHUA 3MGUA 5IAVA 3NNLA 4IW3A 5C5TA 2JIJA 3HQRA 4NMIA 2RDSA 5EQUA 4Y5SA 4NHXA 4XAAA 4BQXA 2G19A 4UWDA 5L9VA 5DAQA 3GJAA 5DAVA 5LBCA 3KT4A 5C5UA 2A1XA 3W20A 4MHRA 5LBEA 2HBUA 2RG4A 5DAWA 5LASA 5A3UA 3NNMA 4J25A 3NNFA 3OUHA 5IAXA 2JIGA 5HV0A 5DAXA 4Q5OA 5IATA 4JZRA 2FCTA 2RDNA 5LBBA 4XCBA 3OUIA 3HQUA 3ITQA 2OPWA 3GJBA 4XC9A 4ZPIA 5ERLA 4Y5TA 4BQYA 4NHYA 4XCAA 2FCVA 2G1MA 4NHLA 5M0TA 3OUJA 5L9BA 3PL0A 3OBZA 3W21A 3BVCA 5LATA 4XACA 5LBFA 5L9RA 5LA9A 4BQWA 4NHKA 5DAPA 4XABA 2HBTA 4ZONA 5HV4A 3NNJA 2FCUA 3KT7A 5EP9A 4KBZA 3DKQA 3EMRA 4NHMA 3GZEA 2RDQA 3KT1A 2Y34A 2RDRA 5EPAA 2V4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAO A;  5LB6 A;  2Y33 A;  4MHU A;  3MGU A;  5IAV A;  3NNL A;  4IW3 A;  5C5T A;  2JIJ A;  3HQR A;  4NMI A;  2RDS A;  5EQU A;  4Y5S A;  4NHX A;  4XAA A;  4BQX A;  2G19 A;  4UWD A;  5L9V A;  5DAQ A;  3GJA A;  5DAV A;  5LBC A;  3KT4 A;  5C5U A;  2A1X A;  3W20 A;  4MHR A;  5LBE A;  2HBU A;  2RG4 A;  5DAW A;  5LAS A;  5A3U A;  3NNM A;  4J25 A;  3NNF A;  3OUH A;  5IAX A;  2JIG A;  5HV0 A;  5DAX A;  4Q5O A;  5IAT A;  4JZR A;  2FCT A;  2RDN A;  5LBB A;  4XCB A;  3OUI A;  3HQU A;  3ITQ A;  2OPW A;  3GJB A;  4XC9 A;  4ZPI A;  5ERL A;  4Y5T A;  4BQY A;  4NHY A;  4XCA A;  2FCV A;  2G1M A;  4NHL A;  5M0T A;  3OUJ A;  5L9B A;  3PL0 A;  3OBZ A;  3W21 A;  3BVC A;  5LAT A;  4XAC A;  5LBF A;  5L9R A;  5LA9 A;  4BQW A;  4NHK A;  5DAP A;  4XAB A;  2HBT A;  4ZON A;  5HV4 A;  3NNJ A;  2FCU A;  3KT7 A;  5EP9 A;  4KBZ A;  3DKQ A;  3EMR A;  4NHM A;  3GZE A;  2RDQ A;  3KT1 A;  2Y34 A;  2RDR A;  5EPA A;  2V4A A; 
#chains in the Genus database with same CATH topology
 3NWK A;  3O7O A;  1AR8 2;  1DLC A;  3I2D A;  3NNL A;  2DDU A;  1NG0 A;  1QXR A;  2X29 A;  2PHX A;  2QQV A;  4LKF A;  1G7Y A;  4GAZ A;  4KL1 A;  3SNM A;  4WM8 A;  2GH8 A;  2V73 A;  4FT8 A;  3SH3 A;  4Y5S A;  4B1L A;  1AR7 2;  2YBS A;  1V9U 3;  2QCS B;  5T3N A;  1UWW A;  2NM1 A;  4AI0 A;  4QHB A;  1Q3E A;  2CHH A;  2GC0 A;  2G19 A;  3NST A;  4R52 A;  4UI9 L;  5C71 A;  1VBB 1;  5I8T A;  3ZXA C;  4MGT A;  3ZR5 A;  1JMU B;  2D3S A;  3C3V A;  1RUD 2;  1XU2 A;  3O1R A;  3LA3 A;  2O0O A;  1LTE A;  1RUJ 2;  2VW2 A;  4XFG A;  4B4Q A;  1J1L A;  2VXR A;  3MPP G;  4QX0 A;  3VBO B;  1JYT A;  1VP6 A;  3JB4 C;  5FMO S;  2QVS B;  3USS A;  3LQC A;  2WFP A;  3O1V A;  1UL9 A;  1ASJ 2;  2LAL A;  2EAK A;  1NY7 1;  3IAP A;  2SBA A;  2Y64 A;  3RJ2 X;  3LSE A;  4Q4Y 2;  1Y7B A;  4QU2 A;  2EIB A;  3MHZ A;  3Q8F A;  4QHO A;  1J3R A;  5FZB A;  1CON A;  2JE9 A;  3NKG A;  4Y1X A;  5F3C A;  4BZ4 A;  4HON A;  4LBL A;  1QIQ A;  2PLV 1;  2WNO A;  4AFA A;  4JGY A;  4CEY A;  5JZG B;  1O4Y A;  4EWE A;  5DZG A;  1RVF 3;  4XIO A;  2W92 A;  4YRD A;  1Z0H A;  3MUY 1;  1XPW A;  4PIX A;  2VMI A;  5ISL A;  1SLC A;  1BVV A;  2ZJC A;  3AZV A;  2W87 A;  2SLI A;  1AR6 2;  3VLB B;  3N4M A;  3FBY A;  4XJ9 A;  1O5L A;  2FCV A;  2H6B A;  2CGO A;  3MW4 A;  1LGN A;  2G9Z A;  3OSD A;  3ILF A;  5FYT A;  3TOJ A;  2AGS A;  3VDA A;  2HWF 3;  4CEW A;  1S0D A;  2VOW A;  4LIT A;  2C0Z A;  3CF6 E;  4EYU A;  1IS4 A;  4Z2W A;  4FFF A;  3RZJ A;  2ZGM A;  1W6M A;  1JYC A;  1Z78 A;  3MEP A;  4FI9 A;  3OBR A;  4CZS A;  3USU A;  5L9R A;  4RGG A;  3A0N A;  1JZ5 A;  5EV7 A;  2HWD 3;  1J1T A;  1ZNP A;  5J37 A;  1ZBA 2;  4CCD A;  1IPS A;  2OYZ A;  3I2F A;  1OLM A;  2JDA A;  3H1Y A;  2HWC 2;  4K8R B;  2HH9 A;  5FJH A;  1SFY A;  1G86 A;  3UGF A;  4AW7 A;  1W9S A;  1XNK A;  1NA1 C;  1SPP A;  3EO6 A;  2L9L A;  1VAM A;  3S57 A;  2AYH A;  2DU1 A;  1TMF 1;  4ZXK A;  4MSV A;  1QJX 2;  2X5I C;  1NQJ A;  4MET A;  4ISQ A;  3SQO A;  1PHM A;  2ZOE B;  1W3X A;  4M3C A;  3T3Y A;  1LR5 A;  1EAH 1;  2X05 A;  1PM7 A;  2VUJ A;  4MGZ E;  3HR9 A;  3ZYP A;  2ADE A;  3A4U A;  3C7E A;  2YY1 A;  3WDU A;  4MXW A;  3SIT A;  4BCU A;  2HWE 3;  2WWU A;  1W0P A;  4S2G A;  2CWS A;  4L9B A;  5ACA 2;  3O1O A;  2YHJ A;  5JPN B;  4CDX C;  4ASK A;  1FMD 2;  1R1A 2;  4JHT A;  2VUL A;  4MHU A;  2QQU A;  5E8A A;  5FYH A;  1EPZ A;  2ZGP A;  1G9D A;  2VMH A;  3E5Q A;  4PJY A;  5A32 B;  2GZW A;  3FMG A;  4V2V A;  5FV3 A;  3E6B A;  1UMZ A;  2R32 A;  4AAP A;  1H8T C;  1RGS A;  1CVN A;  1FAT A;  2CV6 A;  2JDK A;  2FHR A;  1GAN A;  5LRS A;  4WZC A;  4YZ3 A;  1RUF 3;  4SLI A;  5ABJ C;  4LKE A;  2K0G A;  3HAG A;  1LOA A;  5JSP A;  4AI8 A;  3E5U A;  1W6P B;  3NAP C;  3KD4 A;  4UW6 A;  3T09 A;  1UOF A;  4NE9 A;  4LO8 A;  1S0F A;  3WY6 A;  2YGL A;  3LSD A;  1NYW A;  1D4V B;  2WYF A;  2YV8 A;  2ERF A;  1W8H A;  2JKB A;  3PUR A;  4IND A;  3JD7 3;  3DXU A;  5HXV A;  4LA2 A;  2I74 A;  4QD2 A;  1RUH 2;  3W5M A;  4OI2 A;  2C5D A;  2RJ2 A;  4YVW A;  4L8Q A;  3NNF A;  2Q8D A;  1W05 A;  2RS1 1;  3JQX A;  3KQR A;  4B3N A;  4E2Q A;  1FXZ A;  3PLQ A;  3GXU A;  1PX4 A;  1YC6 1;  3I2J A;  1JXN A;  1U5I A;  3BAL A;  3FHQ A;  1RUI 2;  4PF1 A;  5FY5 A;  4XET A;  5IAT A;  4XF3 A;  2XVL A;  1AR9 1;  1YHF A;  2D93 A;  1LOC A;  5F32 A;  1N1V A;  2ZPX A;  4AFM A;  1DGW A;  5F5Q A;  4WVM A;  3RDI A;  4MYE A;  4N7I A;  1XE0 A;  1PNF A;  3DN7 A;  3ZOI A;  1VBC 2;  3B01 A;  1NCR C;  4P5H A;  4XFI A;  4ARY A;  4YPJ A;  3ZVX A;  2WAO A;  3E5X A;  3RVH A;  5JLV A;  1AJK A;  4IXL A;  3FBM A;  2JE8 A;  4XHX A;  4K7J A;  2E9Q A;  4R4X A;  5FZ4 A;  4BMB A;  3AZY A;  3PHM A;  1PZ9 A;  3IDE A;  2YPJ A;  3ZN5 A;  2DVB A;  2C1F A;  1KFX L;  1TG7 A;  1ULD A;  2JDP A;  3J9S A;  2XUM A;  3DCQ A;  1AXK A;  2DVA A;  3PL0 A;  4ES9 A;  1JYW A;  3HD8 B;  2XLF A;  2BGC A;  1RUE 2;  2XBO 3;  4HBN A;  3IDA A;  5GKA C;  2D7F A;  1W9W A;  1TME 3;  4YW5 A;  4M0H A;  1W8N A;  4MV2 A;  5KBF A;  1PIV 2;  1RMU 2;  4TYS A;  1CAU B;  1AYN 3;  2DV9 A;  5EYY A;  4GH4 A;  3VBU A;  5L7O B;  3NJZ A;  3ZMO A;  4NOT A;  4QPG C;  2AUY A;  5FMB A;  2WQ4 A;  5IVF A;  2YRO A;  4MO3 M;  1ZZ9 A;  4GZ9 A;  1LJ7 A;  4E8C A;  1KDM A;  2OQ6 A;  1NKG A;  1S2E A;  1NA1 B;  1APN A;  4Y4R A;  5EP9 A;  4KBZ A;  3I3B A;  2WFF 1;  2X5I B;  1RUC 1;  1SCR A;  4IDZ A;  2RS5 1;  3WW3 A;  3ALQ A;  3H8X A;  2X53 S;  2XH6 A;  4QPI C;  3H42 B;  3VD3 A;  2QQL A;  4QX8 A;  3H8R A;  4MGY E;  4OHY A;  4YW3 A;  2J1T A;  2OZ6 A;  1N47 A;  1OC1 A;  1Q56 A;  5CG8 A;  3NVC A;  3DF0 A;  3U37 A;  3WZ1 A;  1B35 C;  4ARX A;  3VHP A;  5FUP A;  4JKK A;  1D0G A;  4IEV A;  4CU9 A;  4QKB A;  1OXC A;  1JW6 A;  4CDX B;  2NPI A;  3C7O A;  1N1S A;  1BKZ A;  1RHI 3;  5IK8 A;  1YIP A;  5A3L A;  1L3J A;  1HXS 2;  1ULF A;  1YFX A;  4LO5 B;  4M3C F;  4KWU A;  1PNG A;  2CAU A;  5FO9 B;  1JHN A;  1PVC 3;  4CP0 A;  3H50 A;  2B4K A;  1QQP 1;  1H8T B;  4JKL A;  1TE1 B;  2VCA A;  2VBP A;  3H9A A;  2Y0O A;  4LO6 B;  4PI0 A;  4XDO A;  2X10 A;  3UES A;  5CA6 A;  3WP6 A;  5ABJ B;  1VJ2 A;  5FZI A;  5JOZ A;  4KGQ A;  2BJS A;  1PO1 3;  5D2A A;  1C8M 3;  2ZGS A;  1BHG A;  5L19 A;  2ZX3 A;  3NAP B;  5I8S A;  3VZK A;  5JAX A;  2ZML A;  4E4S A;  5C7G A;  1OUR A;  5JSR A;  1EV1 2;  5A6X A;  1PO2 1;  2ZKN A;  1OFN A;  2A1X A;  2FDJ A;  2ZGU A;  1L7L A;  1QU0 A;  4HLT A;  1ZYB A;  5FZ6 A;  5FZK A;  3RZG A;  2B7Y A;  3DPR C;  1O3R A;  5FZ1 A;  2GNB A;  5FPZ A;  3OEA A;  4P9G A;  5LBE A;  4FCA A;  4YNI A;  4WM7 A;  4E2S A;  1GNY A;  1AYM 3;  3KF3 A;  5A3U A;  2VCB A;  3VKN A;  3K3N A;  2RS3 1;  4QKD A;  3EBR A;  3HNY M;  4FPY A;  4QGM A;  4EN8 B;  1AHS A;  3AKR A;  3M7A A;  5J96 B;  2FDK A;  5DAX A;  4MZU A;  1W2N A;  4M4R A;  4PBP A;  1EYB A;  3ZSM A;  4IV3 C;  2A71 A;  4B4P A;  3DUI A;  1YFU A;  2VME A;  3N9Q A;  1W2O A;  2VGD A;  3BOD A;  2YC0 A;  4TLG A;  1RJ7 A;  5FOJ B;  5J48 A;  2HWB 2;  2VQU A;  4K6B A;  3WQ0 A;  4EN7 B;  1RUG 1;  3OYW A;  1OF4 A;  1LHO A;  3C8X A;  3PMS A;  3WUD A;  4XYX A;  4JGY B;  3ZFE B;  4QM8 A;  4DIN B;  4CU8 A;  2R49 A;  1NCR B;  1UPS A;  3HOB A;  5FY8 A;  1GIC A;  1VRH 3;  3OJB A;  3ACG A;  4AXO A;  1BEV 1;  4AQT A;  4GB3 2;  4BJ0 A;  4LPL A;  4QX2 A;  1Y9G A;  4RHV 2;  4EE2 A;  5DN2 A;  2R04 1;  3SLI A;  1CES A;  3OUJ A;  1JTZ X;  4UFL A;  1OH4 A;  4FBF A;  1T6B X;  1DBN A;  3M4F A;  2JDM A;  5BUV A;  1CZV A;  1CR7 A;  3WF4 A;  1YXW A;  4TWT A;  4AED C;  4RGK A;  4O7X A;  3PUQ A;  3ZXG A;  4MGI E;  2QNK A;  1XOY A;  2PHF A;  3LKJ A;  1QXJ A;  1LEN A;  4A6O A;  3T0D A;  1XNB A;  2I07 B;  4ZU7 A;  4W50 A;  1YQ8 A;  2CAV A;  4NHK A;  1W06 A;  2ZGK A;  3OF1 A;  5A7W A;  2D40 A;  1NQD A;  4QPG B;  2VCM A;  3ZM8 A;  2Y26 A;  3M8L A;  4NID A;  3SKJ E;  1IKP A;  3AYE A;  5A7N A;  2ET7 A;  3VBS A;  1GZ9 A;  4JGZ B;  3DYO A;  4NWV A;  3VBH C;  1S4C A;  1KRI A;  4QU1 A;  4RR3 A;  1F4H A;  4DO0 A;  2QQI A;  2Y6H A;  2ES3 A;  4NHM A;  1CAX B;  1S0G A;  3WNP A;  1VBB 3;  3B9I A;  4QPI B;  5DDJ 2;  1AJO A;  5BNO C;  1SMV A;  3TYJ A;  2JEM A;  3O0W A;  1V0A A;  2JD4 A;  1PX3 A;  4AE2 A;  3HBK A;  1QNY A;  5LW9 A;  3T1M A;  3B94 A;  4PHZ A;  4LT5 A;  1B35 B;  2ARB A;  1F9K A;  1V6O A;  3D82 A;  2P2K A;  3DXT A;  4L0P A;  4N8M A;  3OGG A;  3ZYB A;  4CDW C;  5C9A C;  2YU1 A;  3KSC A;  2ZX0 A;  1ZVF A;  4OUL A;  1DU3 D;  4XJW A;  2BGO A;  1AL0 G;  2WZR 1;  3CNA A;  4JAA A;  2J1A A;  5C5T A;  5LK7 B;  4XZP A;  1ND2 C;  1XE7 A;  1W8O A;  1UU4 A;  5EQU A;  4EJR A;  2E51 A;  2BZD A;  4HET A;  2CU5 A;  2FMD A;  4Z8B A;  2VW0 A;  1REF A;  4FO9 A;  5HCB A;  2OT7 A;  3LEK A;  4HL0 A;  2H0V A;  3K46 A;  4HN1 A;  1GNH A;  3HIF A;  3MIC A;  1LOD A;  3PTR B;  4IEZ A;  5IFT A;  4AGV A;  1QJY 2;  2PLV 3;  4HKO A;  4FPL A;  1HJG A;  4MH0 E;  4AEJ A;  2VOV A;  4JQR A;  1AX2 A;  2BBV A;  2Y6L A;  4Y1Z A;  1UY1 A;  5KXE A;  5KR7 A;  2XPJ A;  2HKX A;  2ARA A;  1DDL A;  3GM8 A;  5DXD A;  1QJF A;  3JQW A;  4XIL A;  3J8F 1;  5HI0 A;  4GIQ A;  5C5U A;  2IVI B;  2QDR A;  3CEW A;  2WSU A;  4KQ7 A;  3ZR6 A;  3AYC A;  4MHR A;  3HMY A;  3LD8 A;  2XJP A;  3DPR B;  3POB A;  1Y43 B;  4BPZ A;  4LBQ B;  1W0N A;  1VR3 A;  4S2F A;  2EVX A;  3RGB A;  4COU A;  1VBD 1;  3WNX A;  1R08 1;  2Q4S A;  3QLQ A;  4FPC A;  2RR1 2;  1DFQ A;  2ZHK A;  1XJA A;  2UYB A;  4JV4 A;  3SCH A;  4OLL A;  3RMX A;  3K4D A;  1LED A;  2PHL A;  5GLT A;  2XOM A;  3LOB A;  3ST7 A;  1HRI 1;  2CL2 A;  2Q0A A;  2ZTN A;  5FZC A;  2H6C A;  3JCI A;  2QE3 A;  1BXH A;  4NPL A;  5D8A C;  5FOB B;  4KWK A;  4UFH A;  5FZ3 A;  4XF0 A;  3MZH A;  1S0E A;  2CTV A;  1JU4 A;  1GFF 2;  4Q4X 1;  1ENR A;  2G9F A;  4LNV A;  1WMD A;  3INA A;  4J6G A;  1GQH A;  1FOD 1;  3I2I A;  4A42 A;  1UAI A;  2LM3 A;  1TMF 3;  1V6K A;  2AEZ A;  3IT8 A;  5FUN A;  3CDZ B;  1IZ3 A;  2Z4F A;  1VBA 2;  4XPV A;  1XQN A;  3WW4 A;  1EAH 3;  4YVS A;  3POW A;  5I0U A;  4UW4 A;  5C4W A;  4HVQ A;  4Y1U A;  1SCS A;  4AED B;  2LRP A;  3O1T A;  4Y24 A;  1JYI A;  4CCO A;  2XJT A;  4QB1 A;  3S30 A;  3KHB A;  4FVV A;  1KS5 A;  3HNM A;  5FPA A;  4G4F A;  4A3Z A;  1UZ0 A;  1V6J A;  5G04 L;  1JZ4 A;  2NMN A;  4LUK A;  5BXX A;  3LF7 A;  3RG0 A;  1C1L A;  1U5X A;  3AKT A;  3I49 A;  2FCU A;  3ENR A;  3RNS A;  2BEO A;  4AI3 A;  2V4V A;  3TNQ A;  3VBH B;  5K9Y A;  5JXG A;  1BQP A;  3VZO A;  1X7N A;  4K20 A;  3BIE A;  1JOD A;  1DZQ A;  3ZFG C;  3SCG A;  4KWL A;  2WLP A;  3ILR A;  3LPG A;  1H2L A;  2I2S A;  3OY8 A;  4X6Q B;  3ETQ A;  1EP0 A;  2VQA A;  4ZHN A;  3NL1 A;  4CRQ A;  1K5M C;  2Y34 A;  5DQ0 A;  4Q4V 1;  3ZXL A;  4IER A;  2DVG A;  5CFD A;  4LOS A;  3KS7 A;  4DQA A;  1O4Z A;  1ZM1 A;  2ZS6 B;  2MEV 2;  4LLF A;  1OOP A;  5A1F A;  2R07 2;  1OA4 A;  2V4A A;  3KCC A;  4OMD A;  3ZYH A;  5FBZ A;  4XTP A;  4Y4Y A;  2DCY A;  5C9A B;  4YWA A;  1HB1 A;  3D4K A;  4KBB A;  3NV4 A;  1B09 A;  3HQR A;  1V9U 2;  3IAQ A;  4L11 A;  5F3E A;  4LO7 A;  3K77 A;  3FLT A;  1ND2 B;  4LK7 A;  3VD9 A;  3VKF C;  4A6S A;  2UU8 A;  4W4Z A;  3V0B A;  3E97 A;  2A70 A;  2J22 A;  3P6B A;  4OZX A;  1OUX A;  2RS1 3;  4A7Y A;  5CKQ A;  4HPK A;  1FPN 1;  2BP6 A;  1AXY A;  5KHJ A;  2VBD A;  3H8U A;  1YFW A;  3KV6 A;  2X09 A;  1IPK A;  3CIH A;  4OI0 A;  3GJA A;  1XC6 A;  1AR9 3;  4NRP A;  4CA9 A;  4AOC A;  3U1X A;  5AC9 2;  1CAW A;  4WZF A;  1SEF A;  3N7J A;  1MZ6 A;  3K75 B;  4CVU A;  4K8F A;  3CJX A;  4B7E A;  3X29 B;  2ET1 A;  4LBO A;  1MZF A;  5T5L A;  1OKQ A;  3MLK A;  5EZW A;  3OD4 A;  4WBB A;  5ANQ A;  4FAG A;  1GP5 A;  2C4X A;  3IPV B;  1KJL A;  2Z5W A;  5DZE A;  2OKX A;  1F4A A;  1WD4 A;  2UUR A;  2W9X A;  5EJ3 A;  3SEP A;  3NNM A;  1CIY A;  1ASJ 1;  2WNU A;  3AXE A;  5AVP A;  5C8W A;  5FMO L;  4MXV A;  2XML A;  1KQR A;  4ITC A;  4I09 A;  2O8Q A;  4Q4Y 1;  3UYJ A;  1W6Q A;  4BQ3 A;  1QDC A;  1W90 A;  4IEO A;  4UF0 A;  3G7D A;  1MEC 1;  4JTO A;  3WEZ A;  4COZ A;  4UFJ A;  1O91 A;  3R0R A;  4AVS A;  3QBQ A;  5LY1 A;  1QJZ A;  2BER A;  4YLZ A;  3CO2 A;  3UL2 A;  4RFT 0;  4Y26 A;  5LBB A;  4B8E A;  3FN9 A;  4BK5 A;  1JU3 A;  4RYD A;  5KC6 A;  2VNV A;  5FP3 A;  4IE4 A;  5A33 A;  1UZZ A;  3WVJ A;  4RQP A;  4HVR A;  4LE3 A;  3CU7 A;  1JZ2 A;  4FFG A;  1ZA7 A;  2HWF 2;  5FZF A;  1G8W A;  1I3H A;  3WG4 A;  2W94 A;  2PHU A;  3AKS A;  3ZXF A;  5F2W A;  4UOJ A;  2UY9 A;  2WFF 3;  1S1A A;  1RUC 3;  1Y9Q A;  4NHL A;  4DNY A;  1YFY A;  1H1I A;  4CU7 A;  3M3I A;  2RS5 3;  1AR6 1;  2QTW B;  2ADD A;  2HWD 2;  4JTN A;  4GMP 0;  3TB0 A;  2JXA A;  2WII B;  1DGL A;  5JZG C;  1FI2 A;  4I2O A;  4ES8 A;  5C8C B;  3BU0 A;  2YDE A;  1UOB A;  4XE9 A;  1W8Z A;  2A6V A;  2D5H A;  2ORZ A;  1DQ4 A;  4IUG A;  1AVB A;  2EXH A;  1GZT A;  4MOA A;  1EY2 A;  4QDQ A;  3LWC A;  2OQ7 A;  3ZFF A;  5DUU A;  4F3J A;  4QMA A;  2JD9 A;  4IE0 A;  5LK5 A;  3KGL A;  2WSV A;  1QQP 3;  2NMO A;  2ZEZ A;  3T30 A;  2HWC 1;  4RS5 C;  3GAL A;  1S0C A;  1R64 A;  2IXK A;  1CAV B;  1DG6 A;  1HX6 A;  4A3X A;  1SAC A;  1UMI A;  2R6Q A;  3ZFG B;  2HWE 2;  1H2K A;  5SV5 A;  4IES A;  1QJX 1;  5CU1 A;  1OUS A;  3ON7 A;  2XG3 A;  2RDQ A;  3HWJ A;  1H2M A;  3W58 A;  1VB4 A;  3TEZ A;  1L7Q A;  5JOY A;  1RUN A;  1K5M B;  2DCZ A;  1EPW A;  1ZX5 A;  2MNG A;  4QGN A;  2YYO A;  3MI8 A;  4QXC A;  4XUT A;  1PO2 3;  1RJ8 A;  3AFK A;  1CIW A;  2EXI A;  4I3G A;  2GMM A;  3CQO A;  1KFU L;  4LO4 B;  1LUL A;  2EF6 A;  3WOG A;  1ACC A;  3GNE A;  2VU9 A;  1G9F A;  4DXZ A;  4YW2 A;  5B4X A;  4F7Z A;  5ACA 1;  1O7F A;  1XSR A;  3BYW A;  1FMD 1;  1R1A 1;  3UKT A;  2RS3 3;  1J83 A;  2GME A;  5FQ0 B;  5CFC C;  1MS1 A;  2F6B A;  4X6R B;  5BNN C;  1H8V A;  4DY5 A;  1SZB A;  4KU7 A;  1D2Q A;  2ZA9 A;  1FNY A;  1QDO A;  4JKM A;  3J7M A;  1Q8O A;  1T2X A;  4QQH A;  3AXD A;  1K3I A;  2BWA A;  3ATG A;  5DAQ A;  2GC3 A;  3I7D A;  5FZO B;  5FMC A;  2R0H A;  3JD7 2;  3R4D B;  5FIX A;  1S2K A;  1RUG 3;  3NV3 A;  5B2G B;  2BWC A;  3W20 A;  3RPQ A;  5CYY A;  3VZM A;  3WP3 A;  2JG8 C;  2KA3 A;  4LMF A;  3ZYG A;  4YM0 A;  3AB0 A;  3WF1 A;  2HBU A;  2CY6 A;  1W6N B;  2D98 A;  1BEV 3;  5DAW A;  1C28 A;  3N7M A;  2IWG B;  3RZK A;  3NRU A;  2R04 3;  2PFW A;  2WNV C;  4O65 A;  4XUR A;  5IVB A;  4DPN A;  5IAX A;  4BLI A;  3VDC A;  2WAB A;  1YIF A;  1XU1 A;  3LEM A;  2CYF A;  1CPM A;  1E57 A;  4QPW A;  3WF0 A;  5FK8 A;  4CE8 A;  1GU3 A;  3K4Z A;  2E26 A;  4GJY A;  4OI4 A;  5AFB A;  5TSW A;  2FCT A;  4N43 C;  2UYA A;  4I01 A;  2FZ1 A;  5DUW A;  1EUU A;  5K0U A;  3QH7 A;  2ETE A;  1QKQ A;  1RUI 1;  3OUI A;  4XCB A;  3ZO0 B;  3S6P A;  5IVY A;  5LEK A;  3MW3 A;  5DG1 A;  4BQY A;  1CQ9 A;  2D5F A;  1ENQ A;  3MID A;  2XON A;  1ZRC A;  4FOV A;  1IS6 A;  4PLM A;  1VBC 1;  3ACF A;  1SLT A;  4XFA A;  2RM2 1;  1JZ7 A;  3FLR A;  3V0A A;  1TQ5 A;  4H7L A;  3IZO A;  4LBM A;  2RJK A;  1HRV 1;  1SHW B;  3DGT A;  4LA3 A;  3ZPY A;  2LRO A;  4Q4W 1;  1AYN 2;  4Y22 A;  4C0H A;  4FSJ A;  2JG9 C;  4HVO A;  1DLL A;  4XUN A;  5GLW A;  4CP9 B;  2UWA A;  4H2A A;  2BOI A;  4Y20 A;  5JWP A;  2Z79 A;  3KVB A;  3T4V A;  2WO7 A;  3AP9 A;  1KIT A;  2YPD A;  3ZXK A;  2WZR 3;  3TEX A;  4OVE A;  1LGB A;  1PIV 1;  1RMU 1;  1YI9 A;  3W9A A;  2HBT A;  3NW4 A;  1WLC A;  3I4I A;  4RSU A;  1RIR A;  3J7N A;  1LHV A;  2FDH A;  4RS5 B;  1UN1 A;  3M3O A;  2QUO A;  1BMV 2;  4BM8 A;  4N53 C;  3MV0 1;  3OPW A;  2A3Y A;  4KG8 A;  2Q30 A;  4UFI A;  1AX0 A;  4WVV A;  5EWS A;  3UJQ A;  1ENS A;  1UOJ A;  1N1T A;  2EIE A;  3KT1 A;  5HBA A;  1U5Y A;  1HLC A;  2XJS A;  1ODM A;  2J1R A;  1W39 A;  2E32 A;  2IXC A;  2VZO A;  2ZGL A;  3POE A;  1COV 1;  3J8F 3;  3KV4 A;  3C2U A;  4AI2 A;  1W9F A;  4UFM A;  3A7Q A;  1PM4 A;  2VUA A;  2RVA A;  5L7O C;  2UWC A;  5T55 A;  3IMM A;  3AZX A;  3VL8 A;  3ZYI B;  3LFI A;  5JR7 B;  4NMI A;  3AP6 A;  4Y5Z 0;  3U10 A;  3WDW A;  1URX A;  1VBD 3;  2D44 A;  2VZ1 A;  3V65 A;  3VV1 A;  3WNL A;  4CPB D;  2A3W A;  2R7E B;  4OMC A;  1R08 3;  3UKN A;  5CFC B;  2OW4 A;  3HN1 A;  3AKP A;  5FXV A;  2WYS A;  4NHX A;  5FPL A;  1PO1 2;  1C8M 2;  4CDU A;  5A6Z A;  2QQJ A;  1O6U A;  4COV A;  5BNN B;  2Q1Z B;  3BN6 A;  5F7U A;  2A3X A;  2FMY A;  1W28 A;  2HEY F;  5GZG A;  1HRI 3;  1KGY A;  4EQV A;  5FYI A;  5C3S A;  3THD A;  4ZY9 A;  3LE0 A;  3L2H A;  1IS3 A;  4G9S B;  4R4Z A;  3PIJ A;  1J3Q A;  4GXL A;  4YM3 A;  3BTY A;  2B9U A;  3PUI A;  4M01 A;  1MPX A;  4ZZ8 A;  2DF7 A;  4Q4X 3;  2C6S A;  2BNM A;  1UYY A;  2QQO A;  1AL2 2;  1HQL A;  1H6X A;  1UY3 A;  1QXP A;  2VMC A;  3CJI C;  1GWK A;  1ZA4 A;  3NJV A;  1FOD 3;  4AK3 A;  2JG8 B;  4GMP 1;  1A6C A;  4AVB A;  4B4R A;  3POF A;  1EV1 1;  2MHF A;  1UY0 A;  1TNR A;  3ZXE A;  1ZRF A;  1T6G C;  1F15 A;  3I59 B;  2BU9 A;  1VMF A;  2RHP A;  3LDR A;  4URT A;  1D4M 1;  5T5O A;  1LB2 A;  2WNV B;  5FTT C;  2B9V A;  5DUV A;  4LJH A;  3DEC A;  4D8M A;  4A41 A;  5FAX A;  1FV3 A;  2BOJ A;  1SBD A;  5SV8 A;  1DP0 A;  4JQT A;  4WM8 C;  1YO8 A;  4DB5 A;  1GYK A;  4MAD A;  4D6S A;  1GP4 A;  1PGL 2;  1S0B A;  2WIN B;  4Q1P A;  4QXH A;  2HJI A;  1GOF A;  2NLR A;  2QKD A;  3D8C A;  4GKY A;  4N43 B;  5IJR A;  2W95 A;  3LZZ A;  4AFB A;  1I6X A;  3GHM A;  3ITQ A;  3ZSE A;  5C33 A;  1IG3 A;  5FPB A;  3VDD A;  4AR2 A;  1WLT A;  1F5F A;  4W65 A;  2HWB 1;  1D2S A;  4XCA A;  4YZ1 A;  5JPM B;  3PVN A;  4CCE A;  1OHF A;  2VQT A;  5AFE A;  4TLF A;  4E2G A;  5FLH A;  5L9B A;  1HB3 A;  4AQS A;  4EN9 B;  4R8H A;  1GUI A;  4GB3 1;  3BVC A;  4RHV 1;  1UW8 A;  4QM9 A;  3UT0 A;  4Q4V 3;  4LTA A;  2JG9 B;  5AVA A;  4QQ2 A;  3RWK X;  4D6R A;  2A6Z A;  2F4L A;  2YGM A;  3IMN A;  4EWD A;  5FYM A;  1ZZB A;  2GN7 A;  2YBK A;  1ULO A;  2DFC A;  4EWA A;  3LCP A;  3U11 A;  5CBL A;  2ZAH A;  4IQP A;  4KG0 A;  2B5H A;  1VBE 2;  1OT5 A;  4JGY C;  3ZFE C;  5BNP A;  4KGG A;  4UBG A;  3GBF A;  5DMY A;  4IE7 A;  2WT2 A;  4XQD A;  3MLJ A;  3U75 A;  3WUC A;  5JMO A;  1O5U A;  4QAW A;  5K8S A;  5F2S A;  2FZ2 A;  1OLQ A;  2OA2 A;  2TNF A;  3FUO A;  2IFR A;  2P17 A;  1FPN 3;  1OF3 A;  1YYN A;  2QQW A;  4N53 B;  4DUV A;  1Q8S A;  2VMG A;  4QX7 A;  3UKV A;  1RYY A;  2WKK A;  4XTM A;  3CL1 A;  3RRD A;  3ZN4 A;  2JIC A;  4DOU A;  2VVD A;  4BOW A;  4CEW C;  3AJY A;  3WHT A;  3N9O A;  3WG1 A;  5DDJ 1;  1YQ5 A;  5A3N A;  5LB6 A;  2P3I A;  1OMI A;  3Q8B A;  2QBX A;  4CCM A;  4HMZ A;  4P9L A;  1GBG A;  2DTW A;  4I0W B;  4J1X A;  1DCS A;  1OBN A;  3AL5 A;  1HB4 A;  3WG2 A;  1WA4 A;  5CAZ A;  4Z07 A;  1YCI A;  4JGZ C;  3ECQ A;  2PLV 2;  2W1U A;  4NRO A;  1ASJ 3;  2GU9 A;  3KQ4 B;  2BNO A;  3WQ7 A;  4C1W A;  4I3P A;  4Q4Y 3;  5FRA A;  2DUR A;  1BYH A;  1JUH A;  2R1B A;  2W0X A;  4UAP A;  4CSW A;  4C91 A;  1V00 A;  1MEC 3;  1LNS A;  2QDN A;  1DYK A;  3CBN A;  4PCR A;  1MS9 A;  2YB7 A;  5KXB A;  4OYU A;  1H6Y A;  4JRA A;  1HW5 A;  1CZS A;  4LOR A;  3TN9 1;  2PHR A;  1LAJ A;  2XLG A;  1NXM A;  2BNN A;  4FPH A;  1LHU A;  1JS9 A;  2Q1M A;  3B69 A;  2J1U A;  1J3P A;  1GZW B;  4AFC A;  4CCL A;  3CJI B;  1GNZ A;  1R09 2;  2GAU A;  4P08 A;  4QQO A;  3HEI A;  5BNO A;  3WNM A;  3KHC A;  3ACL A;  1S2B A;  1XNT A;  5JUV A;  4LHS A;  2BVV A;  4DFS A;  5BY5 A;  3AP7 A;  3M1H A;  1RIT A;  1F35 A;  1NCQ A;  1AR6 3;  5A3W A;  5IUQ A;  4OQ9 A;  4CDW A;  4TTG A;  2W68 A;  1V70 A;  3DV8 A;  1QH7 A;  1ND3 A;  4QB6 A;  1ULC A;  1MS5 A;  2RMU 1;  3Q8E A;  3NMB A;  3PVB B;  3FL7 A;  3VB9 A;  4WM8 B;  2XDV A;  2GP5 A;  2VW1 A;  5LZ6 A;  4NWW A;  4CPB A;  1HV1 A;  4CCC A;  1PVX A;  5JSO A;  4K3U A;  1DQ2 A;  3T2T A;  3IKW A;  1C57 A;  1W6O A;  1C5H A;  4XMI A;  1UZY A;  4JVA A;  3FZ3 A;  4NHY A;  4DS0 A;  2WWS A;  5FO8 B;  1EAH 2;  2HWC 3;  2IVJ A;  3ROU A;  3VHO A;  5K0U B;  3CZJ A;  3UET A;  1RB8 G;  4ASL A;  4IL7 A;  1U0A A;  1OD3 A;  1TNF A;  1XYN A;  3JBG 2;  1PK6 A;  2W1Q A;  1OH3 A;  1FYU A;  1QJX 3;  4IEW A;  3ZXJ A;  1LEC A;  4XJU A;  5E1R A;  1W2A X;  4E4Z A;  4YVW C;  1LOF A;  3KV9 A;  2EXJ A;  1PGS A;  1PMH X;  4LHL A;  2GND A;  1REE A;  4XJ8 A;  4QX1 A;  3APB A;  3T0A A;  1A8D A;  4Z1V A;  1W2U A;  2GNM A;  3VHR A;  4GQ7 A;  4CEY B;  5ACA 3;  4QX3 A;  5CIS A;  2E6V A;  3PTY A;  3LB9 A;  4HOO A;  1FMD 3;  1R1A 3;  1DZT A;  3NNJ A;  4AQ6 A;  4AVV A;  4LUL A;  4CP1 A;  2LUW A;  5H9R A;  1Z7S 1;  3E1F 1;  1WBL A;  3N7L A;  4AVA A;  3OPZ A;  3EJK A;  5I93 A;  4ZZ5 A;  2ZAA A;  5FP8 A;  2PAM A;  3AVR A;  2P1B A;  3BPZ A;  5DAB A;  4DRV A;  1HJF A;  1ZRE A;  3I3E A;  3WNK A;  2AEY A;  5FYU A;  3SIS A;  1QJU 1;  1QWR A;  5FYB A;  3Q8A A;  2D43 A;  2WC2 A;  3EXU A;  4FOQ A;  4CEW B;  3CZU A;  3JZV A;  3VBF A;  1XB9 A;  1UXX X;  1BBT 2;  4OFG A;  5F9T A;  1ZBE 2;  2Y33 A;  1UO9 A;  3MGU A;  4CUC A;  2GN3 A;  3WG3 A;  1W6M B;  3ES1 A;  2MEV 1;  4BA6 A;  5LRR A;  2R07 1;  2RS1 2;  3WV6 A;  4IGO A;  3USU B;  3PUH A;  3B00 A;  1CZT A;  1WW4 A;  5EYX A;  3ZN6 A;  3HN3 A;  4FPJ A;  3VBU C;  4AHZ A;  3ZYJ B;  3WW2 A;  3FLP A;  2D97 A;  4YG0 A;  4YZ5 A;  5HXM A;  2P5B A;  5LA0 A;  1IG0 A;  4S2H A;  5FRE A;  4CU6 A;  5L36 A;  4D3W A;  3EYP A;  3LDK A;  4HAN A;  3WNN A;  2FDG A;  1WLW A;  3S5Q A;  4CDQ A;  4R9D A;  3RYR A;  2C26 A;  4AAX A;  3IIA A;  4IV1 A;  1SPP B;  2VZV A;  5LBC A;  5KXD A;  1MQT A;  4I0A A;  2W52 A;  3VHN A;  5F3G A;  1WA6 X;  4JDM A;  3BTX A;  1RUI 3;  1F2N A;  4DMI A;  1JZ8 A;  3POG A;  2W5F A;  2ZGQ A;  4G3Y C;  4OQ8 A;  3GF6 A;  4M3C B;  4PDW A;  3AKQ A;  5AC9 1;  2JEN A;  2WJS A;  5CEH A;  4MLO A;  5CIR A;  1XBF A;  5J09 A;  2OUJ A;  2VMD A;  1VBC 3;  1WMX A;  2P6H A;  2AR6 A;  4MXW B;  4XEZ A;  2RM2 3;  5I0D A;  1OSG A;  2JDU A;  3K2O A;  3MW2 A;  3OBT A;  4J25 A;  1OVP A;  2Q8E A;  1HRV 3;  2ZGN A;  2AH2 A;  5HV0 A;  4Q4W 3;  3Q8C A;  2PYT A;  2VTF A;  2Q5T A;  4MGQ A;  5A3O A;  1W8U A;  3VKO A;  2ZKL A;  4YZ2 A;  2BGP A;  1U12 A;  1Y3T A;  1H9P A;  1WUV A;  5F37 A;  3H3L A;  3I2H A;  2OZJ A;  1SDD B;  4URA A;  3O1M A;  1POQ A;  4D7T A;  4CXY A;  2XJR A;  5L73 A;  1J84 A;  2Q8C A;  3VBR A;  3S5A A;  1MS8 A;  3HQU A;  5C6C A;  1AF9 A;  1PIV 3;  1RMU 3;  3AYA A;  1LKN A;  1RUC 2;  3DKW A;  4AGG A;  5A6Y A;  1K12 A;  4RN5 A;  1POV 1;  4N9I A;  2RS5 2;  1VB2 A;  3A23 A;  4FPG A;  1LEM A;  2EIC A;  4EN6 B;  2Z69 A;  3WSO A;  3O0V A;  5FYC A;  4PF5 A;  5I0T A;  3BIW E;  4N7U A;  4J1W A;  4A4A A;  2VVE A;  3UJO A;  3WCS A;  3I2O A;  3ZSK A;  1PZ8 A;  1JHJ A;  2IFW A;  2E7Q A;  2VMF A;  3GDB A;  3H3U A;  3FWE A;  5GZD A;  2I45 A;  4WM7 C;  2VQ0 A;  3E6D A;  1A8M A;  3KWV A;  5GLU A;  4BIO A;  4JDN A;  1VMH A;  2XJV A;  4IE6 A;  4D7Y A;  5IVJ A;  1COV 3;  3LIG A;  5HCH A;  4YVW B;  4QX5 A;  4IGP A;  1H4H A;  4LQR A;  3KGZ A;  2V5Y A;  1N3Q A;  2W91 A;  3PU8 A;  2BTV C;  1ALY A;  1SFP A;  4NRM A;  1QQP 2;  3RI8 A;  2JB8 A;  4PQQ A;  4FFI A;  5JDB A;  3OTF A;  1JYN A;  5IVC A;  5IVE A;  3PDQ A;  3AMQ A;  3UV9 A;  4TZD A;  2VTX A;  5FY4 A;  5GLV A;  4IEU A;  3ZIW A;  1WMF A;  3O12 A;  4K1Z A;  2WS9 1;  1YQC A;  1D7P M;  4NN0 A;  4K40 A;  4WVM B;  3VBO A;  3WD5 A;  5J98 B;  3U14 A;  5KHG A;  1JYX A;  4FTB A;  2FQP A;  3RMY A;  3LA7 A;  4JRL A;  2ID4 A;  4R9C A;  4UT5 A;  3E6C C;  1IGO A;  1PO2 2;  3H8O A;  2WR9 A;  1NOV A;  4MUV A;  5C8C C;  4XW3 A;  3DL3 A;  3PJY A;  2OII A;  4R9A A;  1Y4W A;  1LOB A;  4XIK A;  1CX1 A;  1DQ5 A;  2DVD A;  1H1A A;  4BHP A;  4IW3 A;  4V1P A;  4FTE A;  3EQE A;  4GMP 3;  5J36 A;  2XHN A;  2BQP A;  4HFS A;  1EV1 3;  5JZG A;  2Y6G A;  4IET A;  2RDS A;  3QAC A;  4PIY A;  3LFM A;  4Y33 A;  1D4M 3;  3OBA A;  4GH4 B;  3VBU B;  4CXW A;  2R06 2;  2JB4 A;  3RJR A;  4TSV A;  3VBS C;  1RUG 2;  3MIB A;  2XQR A;  5DAV A;  3RQ0 A;  5IK4 A;  5JVV A;  3AJZ A;  4L92 A;  1AXZ A;  4RR3 C;  2IXJ A;  2OXB A;  4CUB A;  2IC1 A;  1VLN A;  1A34 A;  4YFW A;  1JOJ A;  4OUS A;  4O9E A;  3ZIX A;  1IPJ A;  2R30 A;  5FMD A;  4ZKT B;  5B4N A;  2R04 2;  1OKO A;  2HWB 3;  2XR4 A;  2Z2S B;  4P9J A;  1I1E A;  2YBP A;  4UXA A;  2CGN A;  5A7O A;  1O3Q A;  2VXJ A;  2WA4 A;  3AL6 A;  5F6K A;  3RSJ A;  1AR8 1;  2NN8 A;  1W9Y A;  4GWI A;  3WLU A;  4DXR A;  1IKQ A;  5KXC A;  3OUH A;  2JWP A;  2CDP A;  2JIG A;  3KLS A;  1M4W A;  4GB3 3;  4RA0 A;  4RHV 3;  4OUE A;  2VZR A;  2K9Z A;  2CDO A;  3N9N A;  3D0S A;  5FZH A;  2VE1 A;  4Q0Q A;  1AR7 1;  3O1S A;  1C5I A;  1SG3 A;  4L99 A;  2ZMK A;  1JZ6 A;  2VZT A;  3ES4 A;  1RUD 1;  1YJL A;  2D6O X;  5K7P A;  5KHK A;  2ARE A;  5FLI A;  4EV0 A;  3AC0 A;  5ERL A;  4LBK A;  1RUJ 1;  1KDK A;  1ENX A;  4HKL A;  2ORX A;  2PA7 A;  3GZT B;  4QKN A;  2BPA 2;  3I3M A;  1MS3 A;  3RWN A;  1GQG A;  2WO1 A;  1RXF A;  1RVF 2;  3THT A;  4PI2 A;  3VD4 A;  2WLQ A;  3POI A;  3B93 A;  3VL9 A;  1FX5 A;  2W3J A;  1WLD A;  3ACI A;  2GC1 A;  2Y38 A;  4WM7 B;  5LBF A;  5LAT A;  5A32 A;  5JIU A;  1OPM A;  2WWJ A;  3HJR A;  2F17 A;  1DF0 A;  1ULG A;  2OPK A;  5DDJ 3;  1ULE A;  4OCT A;  2ZAC A;  1I9R A;  4PT6 A;  1PK6 B;  3AMN A;  3IDB B;  5H9S A;  1QOT A;  5BNQ A;  3R05 A;  1H4G A;  2VCC A;  2WN2 A;  5LA2 A;  2VM9 A;  4P9X A;  3MIH A;  4LLO A;  5T50 A;  4XF4 A;  5FZE A;  1VAK A;  3WQ1 A;  4WVZ A;  2DU0 A;  1ZZ6 A;  4YG3 A;  3A22 A;  4F8A A;  1KJR A;  4UW5 A;  3TEY A;  1TZO A;  5I0S A;  3OEB A;  3OYW B;  5DPN A;  1H0B A;  1GP6 A;  1V6L A;  1BCX A;  3J8F 2;  4DEQ A;  3JB8 A;  3ZLI A;  1BZW A;  2C24 A;  3J4U H;  2IZW A;  1BMV 1;  2DUQ A;  3TN9 3;  5I91 A;  1UZW A;  4NVP A;  3AMH A;  5JXI A;  3H1W A;  3VDB A;  5CZK A;  3FC0 A;  1Y9M A;  1WD3 A;  4CP2 A;  3I3D A;  4YVS C;  1J58 A;  2DCK A;  3LA2 A;  1O8S A;  3LDB A;  1R08 2;  4FPF A;  4AI1 A;  5HCA A;  3PJQ A;  2KR2 A;  2FDI A;  3MYX A;  1S0J A;  2Y6F A;  3C7H A;  1ZBA 1;  5BV6 A;  5GZE A;  2D6L X;  3O0X A;  4XUO A;  4KU8 A;  4QXB A;  3TAY A;  2D3P A;  3BOW A;  2AEN A;  4LBN A;  2IXL A;  2WT1 A;  5A7W B;  1W3V A;  2XL9 A;  4NJ4 A;  2RMU 3;  4UWD A;  4YM2 A;  4I02 A;  1RL3 A;  4KMQ A;  4RFR B;  3VBS B;  2QZ3 A;  2VZU A;  3WQB A;  4GA9 A;  2E33 A;  2G4I A;  4RR3 B;  1FT9 A;  3THP A;  1E5H A;  5FY9 A;  3BTZ A;  4LXL A;  1WCD J;  4ZXE A;  2O1Q A;  4FOY A;  4P14 A;  1QHD A;  1KS4 A;  2ZHM A;  5FUI A;  3WDV A;  5A3T A;  5EIY B;  4XFF A;  3M70 A;  2E63 A;  5CFD C;  1AL2 1;  1RUF 2;  3NJX A;  3WNO A;  1OOP C;  1IQD C;  2VH9 A;  1CAU A;  4I0B A;  4CCJ A;  1VAL A;  5IVV A;  2R1D A;  3GZA A;  4BXS V;  4HN0 A;  1UD1 A;  3MFA A;  3CLP A;  3D0J A;  2A6W A;  3MUZ 1;  5GZF A;  5LWB A;  4A44 A;  3KB5 A;  3L2Y A;  1UIK A;  3R4S A;  5FZ0 A;  1STM A;  4Q5O A;  1HDK A;  3U4S A;  2OX0 A;  3I2G A;  1NA1 A;  4M0N A;  3SKV A;  1WW7 A;  5KWR A;  1UIJ A;  2X5I A;  5A7Q A;  3ZSJ A;  3ZXD A;  1UXZ A;  2P34 A;  3VZN A;  2BYV E;  1AUY A;  5C3P A;  3OOX A;  1PGL 1;  1A78 A;  1O4T A;  3N9M A;  1CN1 A;  1NZI A;  2Y0I A;  3A0K A;  4LBQ D;  5JXJ A;  2PN5 A;  1Z7S 3;  2XKP A;  1K42 A;  1HQW A;  1UYX A;  2CWM A;  1Q8Q A;  4AEK A;  1LGC A;  3VBR B;  2TUN A;  2QQP A;  5F39 A;  4CDX A;  3FJS A;  4FXK B;  4HK8 A;  4WV8 A;  1NXD 1;  1RUH 1;  4QXK A;  4UFK A;  4KNC A;  1QJU 3;  1YJK A;  2N7G A;  2DVF A;  2ZBJ A;  1BK0 A;  1XNC A;  3Q9O A;  4QPY A;  2WNU C;  5BYN A;  3HNB M;  1H8T A;  2VOK A;  1QY4 A;  4YGB A;  1OI6 A;  1GKB A;  2JKX A;  3O1P A;  2FBE A;  2C9A A;  4BK4 A;  4F83 A;  5DG2 A;  1WME A;  5ABJ A;  2MEV 3;  1NZC A;  2R07 3;  2QJV A;  2CNA A;  2VNG A;  3M3Q A;  2XJU A;  3RZZ A;  1FPN 2;  3SC7 X;  3NAP A;  3BKZ A;  1AZD A;  3AP4 A;  1VBE 1;  2XBO 2;  3UGG A;  2TEP A;  1TME 2;  1S55 A;  2XGX A;  4RQP C;  4X8N A;  4CYD A;  3J7L A;  4U2A A;  4BQ2 A;  4AI9 A;  1Q8P A;  4Y1V A;  5T54 A;  4GJZ A;  4NRQ A;  1VRB A;  2WQZ C;  2QQM A;  1Q43 A;  1US2 A;  5IT6 A;  4QQP A;  1JZ3 A;  5D21 A;  1RUE 1;  2Y6J A;  2ZAB A;  5IAV A;  4YVS B;  4ZU4 A;  5F1R A;  1H2N A;  2A6Y A;  4H55 A;  5AC9 3;  2JX9 A;  2BFU S;  2V5D A;  5C4W B;  4RL7 A;  2JEC A;  3RFR A;  5A7S A;  4FP2 A;  4PLN A;  4AG4 A;  3MLL A;  5FXW A;  3J26 N;  1RC6 A;  1GMM A;  4XJZ A;  4B1M A;  1IOA A;  3HPN A;  1MEC 2;  1UZV A;  3VZJ A;  3VN4 A;  3S0M A;  1E5R A;  4GWN A;  1IHM A;  2DWR A;  1W9T A;  3ZFF C;  4XUP A;  3AK0 A;  1QMJ A;  3ZFE A;  2B39 A;  5LY2 A;  5L9V A;  4LBJ A;  1NCR A;  4HZF A;  1GZC A;  1PMJ X;  4FQ4 A;  1GWL A;  4PBO A;  3KF5 A;  3NNG A;  5LEJ A;  1RHI 2;  3CKH A;  2DBI A;  5FXZ A;  3W5N A;  2ATF A;  1LOE A;  1PVC 2;  2D6K A;  3OY8 B;  1MS0 A;  4FP3 A;  3U07 A;  1POV 3;  5GM0 A;  2B8M A;  1GWM A;  2ZZJ A;  4HXC A;  4ATF A;  3P1I A;  3SCF A;  2W47 A;  4YW7 A;  2FD8 A;  5F5I A;  5CFD B;  1R09 1;  1BJQ A;  1X82 A;  1OOP B;  4Z82 A;  4BU2 A;  1VAV A;  3V64 A;  4RD7 A;  2RE9 A;  4IEX A;  4XQW A;  2NP0 A;  1SDW A;  1HXS 1;  1ZRR A;  5FXX A;  4Q26 A;  2J1E A;  4NUB A;  4XFH A;  5F8P A;  1GV9 A;  2ZEY A;  4QPG A;  4SBV A;  3RS6 A;  1LHW A;  5FZM A;  1RUO A;  3BCW A;  4FPK A;  2VEC A;  4MX3 A;  1SLL A;  4OI1 A;  5E16 A;  4JGZ A;  1RIN A;  3V0B B;  2H0B A;  2JDZ A;  5CG9 A;  4QT6 A;  1GOG A;  2G9G A;  4AF9 A;  3GHN A;  1AYM 2;  2ZEW A;  4HPK B;  3GJB A;  1CAX A;  2V09 A;  4LHN A;  4IEP A;  5FZL A;  4QPI A;  4BIS A;  1UY4 A;  5BPX A;  2BRT A;  5JIA A;  3IDC B;  3LEI A;  2JDH A;  3ACH A;  1G6N A;  2YMZ A;  1JH5 A;  2WS9 3;  1XYO A;  3ILN A;  3AMM A;  1MR5 A;  1VPH A;  3FX3 A;  1CAW B;  3KMH A;  1B35 A;  3PU3 A;  1CWP A;  5FJK A;  4Q29 A;  5A80 A;  2D6P A;  1L7R A;  4YW1 A;  1K45 A;  2VPV A;  1QGL A;  2VZP A;  2ARX A;  2W1W A;  3O14 A;  2KXL A;  3A21 A;  3HT1 A;  4HK9 A;  4LKD A;  3JBG 1;  2YFZ A;  1ZZ7 A;  3GGL A;  3LAG A;  3ELN A;  1WZX A;  1Q8V A;  1XRU A;  3QD6 A;  2R0F A;  3LIH A;  4K21 A;  3VD5 A;  1DGR N;  2WNU B;  1CD3 G;  1QOS A;  3OPT A;  1UCX A;  4W6Y A;  4Q2F A;  4AHW A;  2IXH A;  3T2O A;  1CGP A;  4XDP A;  3NJY A;  1VRH 2;  2WN3 A;  5DAP A;  1JN2 P;  1W6Q B;  2GAL A;  1GQP A;  1ZRD A;  3HBZ A;  3MF6 A;  4L2N A;  4UF0 B;  5FY1 A;  3N35 A;  1W99 A;  1DHK B;  4ZON A;  5HV4 A;  2ZHL A;  5C70 A;  2Y8K A;  5K0U C;  3F2Z A;  4P02 B;  5FZ9 A;  3O1U A;  4QDR A;  2BUK A;  3GZU C;  2WO2 A;  3DKQ A;  2GMP A;  4NO4 A;  5A33 B;  3SMH A;  4RQP B;  4DXT A;  4BH9 A;  1PGW 2;  5JOW A;  2P4E A;  3DPR A;  3HT2 A;  1SFN A;  1DYO A;  2JDN A;  3EHK A;  5FWE A;  5HCF A;  1JBC A;  4LBQ A;  1WWY A;  2RDR A;  2WZE A;  1LU1 A;  1XSQ A;  2YC2 A;  4FAH A;  2ENR A;  4AGR A;  1C4R A;  1LU2 A;  2J7M A;  4XQ4 A;  3CHX A;  4PQ9 A;  5FLJ A;  2ZCW A;  4YGE A;  1WGP A;  3VKL A;  2WZ8 A;  2QQK A;  4FTS A;  4Q0P A;  1QOO A;  4CEY C;  2JIJ A;  2P37 A;  4IV3 A;  1UY2 A;  2EIG A;  4CXX A;  1GLH A;  1BBT 1;  2W46 A;  2XUE A;  1AR8 3;  1ZBE 1;  4NIH A;  4BIF A;  4ZU5 A;  3DYP A;  3NO8 A;  4DZG A;  1VBB 2;  1W0O A;  2HEV F;  2J1V A;  4XAA A;  2OS2 A;  2EA7 A;  5GJ6 A;  1A3K A;  4CTE A;  1WW5 A;  4IGQ A;  1CJP A;  2DTY A;  3ZFF B;  1JOP A;  1NX9 A;  5JMC A;  2HLE A;  4JCK A;  1POV 0;  1AR7 3;  3WIN E;  2IXI A;  2K46 A;  4XXA A;  4BYY A;  1XE8 A;  4AQ2 A;  2ZX2 A;  2XLA A;  4CUG A;  4N9H A;  2VNO A;  1NY7 2;  3I8T A;  1WW6 A;  1RUD 3;  4D94 A;  1DZR A;  3S7I A;  4D0Q A;  1W04 A;  4OHW A;  2RM2 2;  1RUJ 3;  2NYY A;  2EAA A;  4S2D A;  4HKW A;  3BUC A;  1HRV 2;  2RG4 A;  3RI9 A;  3K4A A;  4AED A;  1SLA A;  5A1L A;  2J1S A;  4Q4W 2;  1QH6 A;  2HEW F;  1MS4 A;  2WNE A;  5ANN A;  4ATE A;  4BDV B;  1JYV A;  4NPR A;  5FZD A;  3WDY A;  1UOG A;  4B29 A;  4KI5 M;  4LEJ A;  4BQ5 A;  2XHK A;  1RXG A;  3D3A A;  4EZH A;  3R4U A;  2XWB B;  1UX7 A;  2BBA A;  2WL1 A;  1LCL A;  4JZR A;  2WDB A;  3UK9 A;  3ORJ A;  3JU9 A;  2QFE A;  4Q0U A;  2E53 A;  3AM2 A;  3VBH A;  5FY7 A;  3NV1 A;  3ZPO A;  1QJY 1;  4CDU C;  2XKO A;  2ZGT A;  4JDO A;  4XMA A;  1SLB A;  4LIV A;  1WBF A;  1E5S A;  4H7M A;  2OPW A;  5GAL A;  2E31 A;  1X9T A;  5I8Y A;  4NR1 A;  2O8O A;  3O5S A;  3P5B A;  1DYP A;  2XWJ B;  3QOP A;  1PZ7 A;  1NE6 A;  3LEG A;  3OB8 A;  4U36 A;  4DRR A;  2ARC A;  3LPF A;  3H7J A;  3VD7 A;  3C7F A;  1SBF A;  4ISR A;  4K1Y A;  4E8D A;  4W6W A;  3MO4 A;  5FFO C;  1CX4 A;  3NKT A;  1VE0 A;  2XVK A;  1COV 2;  1OD5 A;  1QEX A;  4LUM A;  4EN0 A;  5C9A A;  1DQ6 A;  2A7A A;  4XAC A;  3ZKY A;  2JDY A;  2KM2 A;  1FAY A;  2WQ8 A;  1ND2 A;  2RR1 1;  3BGA A;  1E5I A;  1UKG A;  4Q8L A;  2ZEX A;  3FE5 A;  4E27 A;  1P8J A;  1HIX A;  3UGH A;  3K48 A;  2WBK A;  3IB3 A;  5FZ7 A;  1TMF 2;  2CGP A;  2W1S A;  3WX5 A;  4LE4 A;  1SLI A;  4Q0V A;  4YSF A;  1ZBA 3;  1BVP 1;  1J59 A;  1NLQ A;  4DY3 A;  4DUW A;  4YFZ A;  5FPV A;  2TBV A;  3ZYR A;  5FCC A;  5FPX A;  4Z2A A;  3B5L B;  1KXG A;  1KEX A;  3FFQ A;  2YZ4 A;  2P3K A;  3KM5 A;  4XFC A;  3M2M A;  1I5Z A;  3VDD C;  5FPU A;  2A75 A;  1F31 A;  2P3Y A;  4BME A;  3SHR A;  3ME2 A;  4NIA A;  4JC1 A;  4AL9 A;  1VBA 1;  3IPV A;  5K4L A;  2A5Z A;  4XVH A;  1EUT A;  3ZKU A;  5C3O A;  3V0A B;  4Z92 B;  4FPO B;  4NAO A;  3U4X A;  3OGV A;  1VIW B;  2Y6K A;  1O3S A;  1HN1 A;  1D4M 2;  4Y22 B;  3RZH A;  1UPI A;  3F95 A;  3WDT A;  5FZG A;  1AL2 3;  1OVS A;  4H3W A;  2VAU A;  4GKX A;  4RGA A;  4Y20 B;  4A7K A;  5FYZ A;  4QHZ A;  1NLS A;  3M3C A;  5D8A A;  4C8D A;  2VY0 A;  2R16 A;  2VJX A;  4BQX A;  1LES A;  1WCU A;  2XB6 C;  2X8K A;  3S7E A;  5BNP C;  4O9G A;  3GBG A;  4MG2 A;  4HSL A;  3FHA A;  3ZDV A;  1OLM E;  4DXS A;  1NLR A;  3SEE A;  3B9C A;  3I3Q A;  1XNA A;  2KD7 A;  2R06 1;  3GBW A;  2LTN A;  2GNT A;  4Y3O A;  2VG9 A;  5IW0 A;  1YRZ A;  4BB3 A;  3VUO A;  3NV2 A;  5A70 A;  3VKM A;  1YQ2 A;  3WT3 A;  1YQ6 A;  3I2K A;  1DQ0 A;  3EB7 A;  4TN7 A;  4COY A;  1XYP A;  4P5Y A;  5E6H A;  5FYY A;  1V6M A;  3W59 A;  2PXJ A;  4M3C E;  5C8C A;  4IEQ A;  4UW3 A;  3SH5 A;  4YGC A;  5LAS A;  5JI9 A;  5T52 A;  3H7Y A;  1H9W A;  4YZ4 A;  4GH4 C;  4YGD A;  3B3Q E;  3FFZ A;  5FYS A;  3TNP B;  2Q1F A;  1CPN A;  1AR9 2;  2DCT A;  1V9U 1;  3G6J B;  3VZL A;  4LIU A;  1RUH 3;  5G05 L;  3OCP A;  1OA2 A;  4O61 A;  2YC4 A;  5FYV A;  2BW8 A;  2VVF A;  4JX0 A;  2PTM A;  2VUC A;  5IHR A;  1QF3 A;  4LKS A;  2GDF A;  2HYK A;  1W03 A;  1CAV A;  4CDU B;  2VNR A;  2VTX J;  3ZFG A;  3V56 A;  3M3E A;  4XC9 A;  3TBD A;  2A6X A;  2J42 A;  3KV5 A;  4P9Y A;  1K5M A;  4OHZ A;  4GUL A;  1G9A A;  1VBE 3;  5FZ8 A;  5JXH A;  3SXW A;  5FP7 A;  3MBW A;  4BXF A;  3URF A;  3K51 A;  1X9P A;  5A6Q A;  5GZC A;  3ASI A;  2VC9 A;  3OGJ A;  1R1Z A;  4BQ4 A;  1QNW A;  3AP5 A;  1LRH A;  3H0O A;  3OBZ A;  4KWJ A;  4NPM A;  1HB2 A;  3I97 A;  4XAE A;  4E4H A;  3K3O A;  3PIG A;  4HT1 T;  5KHI A;  3MFC A;  5GLZ A;  3AZZ A;  1OFS A;  2W39 A;  3N9P A;  3MIE A;  2YU2 A;  2DYC A;  4ONU A;  1NCQ C;  1RVF 1;  5APA A;  4Q8K A;  5FQ0 A;  4IE5 A;  1RUE 3;  1SBE A;  2ZXQ A;  1W8F A;  2YFU A;  2WA3 A;  2LW8 A;  1ND3 C;  2W2I A;  4OHV A;  2WFF 2;  4XAB A;  4Y1Y A;  3P3P A;  2WZP P;  5FZO A;  2AC1 A;  3ABZ A;  5C3Q A;  3RZM A;  3P3N A;  1HN0 A;  3KCY A;  4YYO A;  2K2S A;  1V6N A;  1DGR A;  2HWF 1;  4XFB A;  2PAK A;  3TN9 2;  4XHB A;  5T5P A;  5J7M A;  3EMR A;  2GP3 A;  4XBN A;  4TXW A;  4ZS3 A;  2O14 A;  2P6C A;  2PMW B;  4OHX A;  3VDD B;  1X8E A;  2BV4 A;  2QZ2 A;  5FBJ A;  1TEI A;  1W6N A;  5JR2 A;  1YNA A;  2ZGR A;  2PQS A;  2ZZQ A;  5EPA A;  1FV2 A;  2HWD 1;  2PEL A;  2PHD A;  3HQX A;  1PK6 C;  4XOG A;  4EZ4 A;  4YM1 A;  5T5J A;  4NII A;  2QQN A;  2B46 X;  5F5C A;  4ASM B;  4DIQ A;  1Q5O A;  2IUW A;  2AAC A;  1R09 3;  5FDB A;  3N9L A;  2RMU 2;  1LOF C;  1BLZ A;  3UNP A;  1O59 A;  2OVU A;  1ODN A;  3B7M A;  2XQX A;  1HXS 3;  2GSY A;  5FP4 A;  2E7T A;  5F6L B;  3FUQ A;  4AHY A;  4XJA A;  3KZ4 C;  2XXZ A;  1OPO A;  4B7K A;  4IV3 B;  5BNP B;  1AX1 A;  3POY A;  2EID A;  4NIG A;  1UF2 C;  1WCS A;  4LR4 A;  3BB6 A;  3KT4 A;  1HKD A;  1O3T A;  2RJL A;  2HWE 1;  2VO5 A;  4BQ1 A;  3D6E A;  1ZRI A;  4K9S A;  2VOT A;  3AMP A;  3GYD A;  3PUA A;  3TRS B;  2RS3 2;  5CVR A;  1SQ4 A;  4HG6 B;  1WCK A;  3WF3 A;  2OUH A;  4Q0S A;  5IWF A;  2UY8 A;  3PUS A;  4CP9 A;  5LA1 A;  2YG0 A;  3AZW A;  3VBF C;  3AYD A;  2E7A A;  5KC5 A;  3MV1 1;  3DEM A;  2D3R A;  3ZDS A;  2A73 B;  3THC A;  1XND A;  1RUF 1;  4XBL A;  5F3I A;  1XXN A;  1MZ5 A;  3JBG 3;  5EJZ B;  1JI6 A;  4C0B A;  4GD4 A;  4E4D X;  4COW A;  1U5Z A;  3ZYF A;  3T1L A;  5FR3 A;  4QKF A;  2PHW A;  3VGI A;  1RED A;  1RTV A;  3MDP A;  2DCJ A;  4ORF A;  4RS5 A;  1C1F A;  2HYX A;  2RDN A;  2Q8O A;  4YW4 A;  1YWK A;  1Z7S 2;  3RYK A;  2DFB A;  3ZMN A;  4D6Q A;  4QQL A;  5FK7 A;  4HSJ A;  1BEV 2;  1DGW X;  1OQD A;  4L97 A;  5C3R A;  5J3U A;  1F8V A;  4ZPI A;  1X8M A;  1UYZ A;  4CDQ C;  1K5J A;  2XL7 A;  3BTA A;  3JD7 1;  4Y5T A;  1YEW A;  4IV1 C;  1MQT C;  3I54 A;  4Q1R A;  1N3P A;  2VZQ A;  3JXS A;  2DBN A;  2G1M A;  4C1X A;  3AX4 A;  1X36 A;  3T0B A;  2GH2 A;  1QJU 2;  5M0T A;  1YUD A;  2XVG A;  4FQZ A;  4P9I A;  4PDW C;  3JUU A;  4H14 A;  5JOX A;  3BU7 A;  1MAC A;  2B42 B;  5FO7 B;  5I0R A;  4ERO A;  1UU5 A;  4XF1 A;  3OD0 A;  4XUQ A;  5BNO B;  3SH4 A;  3RYP A;  4XXP A;  3U78 A;  1H1M A;  1VMJ A;  3N7K A;  2WRA A;  3R6S A;  1JUI A;  1YLL A;  2WT0 A;  4NAM A;  5CFC A;  4BQW A;  1NCQ B;  1LHN A;  1TVG A;  1X33 A;  2Z42 A;  4AVC A;  4AVT A;  4CDW B;  5BNN A;  2BVB A;  2JE7 A;  2XJQ A;  2CSG A;  1IQA A;  3DYM A;  4I30 A;  1LOG A;  1ND3 B;  5DUX A;  1QJE A;  1V6I A;  3ZSL A;  4ET7 A;  1BBT 3;  1GSL A;  4P9W A;  5IYY A;  1ZBE 3;  1NT0 A;  4GAL A;  3AVS A;  1W8W A;  4D7S A;  3VBR C;  1UKR A;  2VZS A;  2BDR A;  1C8N A;  2GC2 A;  3LGR A;  4CCN A;  5CAD A;  3WP4 A;  3WP5 A;  3WXP A;  1YI7 A;  4CCK A;  5A1A A;  1G9B A;  1W6O B;  4OUM A;  1DIW A;  4R9B A;  1H30 A;  2VD7 A;  2JG8 A;  4QWN A;  2XBO 1;  1CJD A;  1TME 1;  4MVT A;  5H9P A;  2WZR 2;  4MGK E;  5LCW L;  4KH9 A;  1NE4 A;  3I59 A;  5FKB A;  1UYP A;  3PVE A;  5EJ1 B;  1AYN 1;  2WNV A;  1MVQ A;  1NAE A;  5A3M A;  4AYU A;  3MIF A;  2D6M A;  2EAL A;  3CMG A;  1OQ1 A;  1MZE A;  1KD7 A;  2AZ5 A;  5E88 A;  5J1X A;  3OGS A;  1X50 A;  4LK6 A;  2FDF A;  5H9Q A;  2PAE A;  1W6P A;  1UNB A;  5KHH A;  2NQY A;  3MIG A;  2VL4 A;  3NQH A;  1W8T A;  1US3 A;  3GCX A;  3KVA A;  4N43 A;  3D5O A;  2VR4 A;  1D0H A;  3POJ A;  4IEY A;  4M00 A;  4DUX A;  5IFP A;  1ST8 A;  2PHT A;  1F5J A;  2C9K A;  4JHZ A;  4LOT A;  2BFU L;  3PNA A;  4MGS A;  4W8J A;  5FWJ A;  3BPS A;  4YG6 A;  4LHK A;  2RV9 A;  4M4P A;  1HV0 A;  3OG2 A;  2B45 X;  2DUP A;  1QJY 3;  2LS6 A;  3J7H A;  2JJ6 A;  5D8A B;  2W08 A;  5CKM A;  3VBO C;  3QCW A;  4XDQ A;  4P00 B;  3WF2 A;  4CUA A;  3C7G A;  4D69 A;  5A3P A;  1VBD 2;  1GOH A;  3WW1 A;  5IK7 A;  3POS A;  3WDX A;  5C4W C;  3WCR A;  1RHI 1;  4FFH A;  1UX6 A;  2JG9 A;  2VUD A;  5A7P A;  4XBQ A;  4PLO A;  4BE3 A;  3U0Z A;  4W6X A;  2WAA A;  4DEV A;  3TEW A;  1PVC 1;  2EXK A;  3MF9 A;  3VBF B;  5FP9 A;  1HRI 2;  3IBM A;  3IM0 A;  3T4H B;  3H3Z A;  3T08 A;  3BI3 A;  3IWZ A;  4FXG B;  3RZL A;  5D1I A;  1WKY A;  2PQQ A;  1OLR A;  4Q27 A;  2ZGO A;  1W2T A;  3IN9 A;  1ZZC A;  4Q4X 2;  1UU6 A;  3III A;  1PO1 1;  5FZA A;  1C8M 1;  2MPF A;  2RR1 3;  5EFU A;  3ZN6 B;  3N3H A;  4UYB A;  1I5P A;  1JOB A;  4E9K A;  1PMI A;  1FOD 2;  1FNZ A;  4YW6 A;  5JI7 A;  5CB7 A;  3T2P A;  3WHU A;  2DUO A;  1ONA A;  1UMH A;  5EHD A;  2WS9 2;  4N53 A;  1N1Y A;  4WVW A;  4XZU G;  4A2U A;  2WUH A;  3N36 A;  4CDQ B;  4YAR A;  5HPO A;  2VOX A;  4IV1 B;  1MQT B;  5JCT A;  3QH6 A;  1AYM 1;  1M06 G;  1GR3 A;  4A45 A;  3FHI B;  1DQ1 A;  4BWO A;  4AHX A;  4AEM A;  4GWM A;  2F4P A;  2V72 A;  4PDW B;  5L7O A;  2NZ9 A;  3BOP A;  4ZS2 A;  2ZMN A;  4QB2 A;  3W21 A;  3GCW A;  1C3H A;  2VBB A;  4N90 A;  1VBA 3;  3B02 A;  2YXS A;  1S0I A;  4QDS A;  3PVO A;  4PIZ A;  2VZ3 A;  3PME A;  4OZO A;  5F5A A;  5LA9 A;  4QGL A;  4XF9 A;  3WR0 A;  3MPB A;  3TWI A;  1ZZ8 A;  3ETP A;  4FOW A;  3AFG A;  1N3O A;  2ZX1 A;  4X8P A;  1OQE A;  3LOI A;  2D6N A;  2P3J A;  4AWD A;  3H1M A;  5CNA A;  2Y60 A;  2ILM A;  3KT7 A;  1VRH 1;  5FY0 A;  1BK1 A;  4UBH A;  4AZZ A;  1IS5 A;  4FPE A;  2WO3 A;  2YUE A;  4BLJ A;  4Q4V 2;  2ZHN A;  3OGR A;  5EXO A;  5FKC A;  1GZW A;  3ZX7 A;  4C90 A;  3CJI A;  3KCX A;  3L9J T;  1WCQ A;  3GZE A;  1HQN A;  1O8P A;  4GWJ A;  4V2W A;  1G9C A;  2ZX4 A;  3HVD A;  2UWB A;  5CKN A;  5IK5 A;  1NUK A;  2R06 3;  5E89 A;  1UQX A;  1OA3 A;  1ULP A;  4AFD A;  4A7Z A;  1PGW 1;  1MVE A;  3T2Q A;  5DZF A; 
#chains in the Genus database with same CATH homology
 4NAO A;  5LB6 A;  2Y33 A;  4MHU A;  3MGU A;  5IAV A;  3NNL A;  4IW3 A;  5C5T A;  2JIJ A;  3HQR A;  4NMI A;  2RDS A;  5EQU A;  4Y5S A;  4NHX A;  4XAA A;  4BQX A;  2G19 A;  4UWD A;  5L9V A;  5DAQ A;  3GJA A;  5DAV A;  5LBC A;  3KT4 A;  5C5U A;  2A1X A;  3W20 A;  4MHR A;  5LBE A;  2HBU A;  2RG4 A;  5DAW A;  5LAS A;  5A3U A;  3NNM A;  4J25 A;  3NNF A;  3OUH A;  5IAX A;  2JIG A;  5HV0 A;  5DAX A;  4Q5O A;  5IAT A;  4JZR A;  2FCT A;  2RDN A;  5LBB A;  4XCB A;  3OUI A;  3HQU A;  3ITQ A;  2OPW A;  3GJB A;  4XC9 A;  4ZPI A;  5ERL A;  4Y5T A;  4BQY A;  4NHY A;  4XCA A;  2FCV A;  2G1M A;  4NHL A;  5M0T A;  3OUJ A;  5L9B A;  3PL0 A;  3OBZ A;  3W21 A;  3BVC A;  5LAT A;  4XAC A;  5LBF A;  5L9R A;  5LA9 A;  4BQW A;  4NHK A;  5DAP A;  4XAB A;  2HBT A;  4ZON A;  5HV4 A;  3NNJ A;  2FCU A;  3KT7 A;  5EP9 A;  4KBZ A;  3DKQ A;  3EMR A;  4NHM A;  3GZE A;  2RDQ A;  3KT1 A;  2Y34 A;  2RDR A;  5EPA A;  2V4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...