5M0TA

Alpha-ketoglutarate-dependent non-heme iron oxygenase eash
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
287
Chain Sequence
b'SKPTLRRIPRSAGDEAIFQVLQEDGVVVIEGFMSADQVRRFNGEIDPHMKQWELGQKSYQESYLAGMRQLSSLPLFSKLFRDELMNDELLHGLCKRLFGPESGDYWLTTSSVLETEPGYHGQELHREHDGIPICTTLGRQSPESMLNFLTALTDFTAENGATRVLPGSHLWEDFSAPPPKADTAIPAVMNPGDAVLFTGKTLHGAGKNNTTDFLRRGFPLIMQSCQFTPVEASVALPRELVETMTPLAQKMVGWRTVSAKGVDIWTYDLKDLATGIDLKSNQVAKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent non-heme iron oxygenase EasH
publication title Structural characterization of EasH (Aspergillus japonicus) - an oxidase involved in cycloclavine biosynthesis.
pubmed doi rcsb
source organism Aspergillus japonicus
molecule tags Oxidoreductase
total genus 96
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5m0tA00
4Y5TA 5L9RA 5LBCA 4NHYA 5EP9A 3DKQA 2JIJA 2Y33A 3KT4A 5HV4A 2RDRA 3W20A 5ERLA 4BQYA 4XCBA 3NNFA 3NNMA 2FCVA 3BVCA 3GJBA 5DAQA 5IATA 5LBEA 5IAXA 3OUJA 3KT1A 5DAVA 5L9VA 2FCUA 4NHLA 4MHRA 4MHUA 4ZONA 4XCAA 4XC9A 2JIGA 2V4AA 3HQRA 3HQUA 5C5UA 5HV0A 2FCTA 5EPAA 5DAPA 5LATA 3OUHA 4Y5SA 4IW3A 4ZPIA 5C5TA 2G1MA 5LBFA 3KT7A 2RDQA 3EMRA 3OBZA 5IAVA 5L9BA 5EQUA 2HBUA 3MGUA 2OPWA 4Q5OA 2RDNA 5LA9A 2G19A 4NMIA 3NNJA 5DAWA 3PL0A 4KBZA 5A3UA 3OUIA 3NNLA 4NAOA 3GJAA 5M0TA 4XABA 2Y34A 4JZRA 3GZEA 4BQWA 2A1XA 2RDSA 4NHXA 2RG4A 4XACA 4NHKA 4J25A 4UWDA 5LB6A 3W21A 2HBTA 5LBBA 4XAAA 5DAXA 4BQXA 4NHMA 3ITQA 5LASA
chains in the Genus database with same CATH superfamily
3DV8A 2GAUA 3P3NA 3S57A 2ZA9A 4YNIA 3O12A 1NCQA 5KC6A 4LO6B 4QMAA 1XE0A 1OA3A 2VQUA 4HKOA 5BNNB 2JIJA 3OBAA 2CTVA 4CUCA 5JOYA 2J1RA 3MLKA 4A45A 2FZ2A 4QWNA 4ITCA 1EYBA 1MR5A 2QE3A 3WNXA 3LEKA 4KQ7A 2ZZJA 4LUKA 4UFLA 5C71A 4LBKA 1S0GA 2P3KA 2PQQA 2RS11 4NWVA 1QY4A 3VGIA 4Y4RA 1W8ZA 1YO8A 4S2HA 2WDBA 4CCCA 3IPVA 4QU2A 1OBNA 5FMOL 4IEYA 2HWB1 4CXWA 4MGKE 1SG3A 2R062 4O9EA 2LALA 4XFBA 1EP0A 4CDXC 5GJ6A 1GP6A 1SLCA 1DHKB 1UX6A 1DZQA 4R4ZA 4XYXA 5HPOA 3A0KA 1O7FA 3AYEA 1ZZ6A 2WZR1 4UAPA 5FUNA 4WZFA 2VY0A 2VNVA 4Y3OA 5I8TA 4K9SA 1DGLA 5C7GA 5HV0A 4MZUA 1PK6C 5A32A 4N53A 2JDMA 3O1UA 1OF3A 1GZWB 2H6CA 4BMEA 3LEMA 1LJ7A 4DY5A 5IVFA 1AXYA 3AB0A 1QOSA 2C9AA 4FXKB 1H2MA 4AGRA 2W0XA 4I3GA 4D7TA 4CDQC 1VAVA 5A7WB 1ZZ8A 3F2ZA 3JUUA 1CZSA 2W1WA 4IEQA 2RS32 4N8MA 4AWDA 3BALA 3R0RA 1XU1A 4OMDA 2ARAA 1UWWA 1XNTA 4QPIA 2XDVA 4QKNA 4U2AA 1PVC2 2DCKA 4FQ4A 2WL1A 4YGDA 3I3EA 2QQVA 1W8WA 3FZ3A 4M3CF 3ZMOA 5CNAA 3N7LA 3VBSB 2AREA 5FQ0A 3CJIC 2PHXA 4OZOA 1ZZCA 2BOJA 3TEWA 3V0BB 1H8TB 3T08A 4YW3A 2ORXA 1W9FA 2XQXA 2MEV2 2R063 4IGPA 2VW0A 1NLQA 3N7JA 1H1MA 4BXFA 3OUIA 1YXWA 3MICA 2OXBA 2W1SA 1JH5A 4HPKB 1Y43B 3MIFA 3GXUA 3MW4A 3PVBB 2ZX3A 3IKWA 1W3VA 1XB9A 1I6XA 2CGNA 2VVFA 1RUJ1 1FPN1 4Y20A 5D21A 5I0TA 2WLQA 2ZGUA 4QAWA 1W2NA 2W08A 4BIFA 4CU6A 5A1LA 1LTEA 1DZRA 4RQPA 2XH6A 4CVUA 2Z4FA 4B7KA 2R32A 1OLMA 4WVZA 4HMZA 1ND3A 4H7LA 2R041 3ABZA 5FZEA 4F83A 1SBDA 3LQCA 5T52A 2RS33 4F7ZA 4GWIA 5HCHA 4HVRA 1TG7A 1HW5A 5SV8A 4BQXA 4YVSC 5AC92 3MZHA 2I74A 1F5FA 1PVC3 1YEWA 2BDRA 3RDIA 5JSPA 1AXKA 3DGTA 3TWIA 3IDBB 4DQAA 5LZ6A 5EWSA 1JS9A 4I3PA 3RMYA 1HDKA 4BE3A 1RB8G 4FPCA 5LEJA 3NQHA 5EP9A 3VL9A 1ULEA 3ZKUA 1R082 4XF9A 3O1PA 5ANNA 2YYOA 1H9PA 5EV7A 4NRQA 3ZN5A 3MW2A 3USUB 2EIBA 5HV4A 1QJX1 1CGPA 4UFJA 1ZM1A 2MEV3 2YC0A 5FZAA 4BQYA 1L7LA 1SPPA 1W6MB 2AUYA 2GNTA 3UJOA 2CGPA 1BMV2 3TEXA 2DVBA 5E6HA 1F4HA 1SLLA 2QQMA 4XIOA 1GQGA 1RUC1 1LOCA 2A6XA 2LRPA 1C8M1 1LKNA 5T50A 4M3CE 3RS6A 5T5JA 4RD7A 5JR7B 4AOCA 5A3WA 3T2TA 3M2MA 2WRAA 4LBLA 2YU1A 2ZZQA 5FLHA 5JVVA 5FBJA 1SCSA 4DNYA 1S0DA 3FBMA 5GLTA 3ZXGA 3VD4A 4YZ1A 5J37A 2YC4A 4D69A 3RZLA 4LHNA 3WNMA 3ZFGC 1GV9A 4GH4B 4ZHNA 4B1MA 2NN8A 1MEC2 2JDKA 1E5IA 2PLV1 4HL0A 4K6BA 1I5PA 5C5UA 3PIGA 2TBVA 2VE1A 5CEHA 1RJ8A 1VB2A 3E6BA 1WLTA 2DU0A 2JECA 1Z0HA 5AC93 2PHFA 2D6NA 3H3UA 1GFF2 4FP2A 4Y1UA 5D8AC 3ZFFC 4DFSA 5CG9A 3NAPA 2X05A 2VNOA 4PDWB 3O0WA 3VBRC 3IBMA 2IVIB 3AP9A 3LA3A 5EIYB 1X82A 1R083 2OPKA 1BK0A 2A6VA 4DOUA 5F39A 3VZMA 4BB3A 1IOAA 1CQ9A 2WT0A 1UX7A 2VVDA 2WIIB 1MZFA 1OOPC 2HWC1 2WQ8A 3OBRA 4W4ZA 1NG0A 3UGGA 1LECA 4CZSA 5T5LA 2EA7A 4ASLA 4LKSA 1POV3 5FCCA 4AVAA 1A8MA 1I9RA 1LESA 3NV4A 3R4UA 2B9VA 3ZXLA 5C4WC 2ZBJA 1HXS3 1QXRA 2JG9B 3A22A 1QDOA 4HBNA 4GWNA 4FTBA 2I45A 1BJQA 1D2QA 3ZOIA 2XUEA 3P6BA 3K3NA 1W6QB 4FOVA 3NVCA 4UFHA 1QKQA 3RZJA 2HYXA 4YWAA 1G9BA 3BODA 4M01A 1H8VA 3JD72 1IHMA 1MEC3 2WZPP 3VZOA 2NYYA 5D1IA 5LRRA 2YGLA 1OKQA 4W6WA 4Q8LA 5FZ6A 1W9SA 3JB4C 4B7EA 2ADDA 2CWSA 3RYKA 1D0HA 1XYOA 2E7AA 4H7MA 4XPVA 4DRRA 2KR2A 2WNVB 3RZKA 3QLQA 4URTA 3KHBA 4B1LA 5FPVA 1SFPA 1DQ0A 4IV3A 5T55A 3WUDA 3WG4A 1X36A 4BZ4A 3WG3A 1CAVA 1TMF1 3OG2A 2DUOA 3V56A 3VD9A 2IZWA 2C24A 3K4DA 1WCQA 4GJYA 5FUIA 5LASA 2MPFA 3D0JA 4XAEA 2SBAA 2WA3A 3GM8A 1NE6A 2IXCA 5L9RA 1NQJA 2QQOA 1LAJA 2YUEA 1WLWA 3G7DA 1OURA 3POWA 4UW3A 2DVFA 4JGZA 3CBNA 2VUDA 1VMJA 1YFYA 4QX8A 3UGHA 2VH9A 1I5ZA 3ZFEB 2YROA 1K45A 5ABJA 4ES8A 2BNOA 4D7SA 5I8YA 3AZWA 3DXUA 4IV1A 1QJU1 1QMJA 5FZBA 3PJYA 2EIDA 3ZMNA 3SNMA 3WHUA 1UMZA 2ZTNA 1W9YA 2EICA 1P8JA 1SMVA 3NNFA 4XBLA 4RS5B 2GC1A 5KHKA 1AR72 1D4M2 2JDUA 4GA9A 1OC1A 3KSCA 4LUMA 5IW0A 4LA3A 4QX2A 4WVMB 3W9AA 1O6UA 1GR3A 2BP6A 3S7IA 3ZX7A 2ZGPA 5FBZA 2KD7A 2UY8A 2ZACA 4UW4A 2G9ZA 4QQHA 3TEZA 4P00B 2Y38A 5JUVA 5GLZA 5FO9B 2ZHMA 3FHIB 4P08A 1CAUA 2F17A 5FYSA 5FFOC 1AHSA 1E57A 4XILA 2WNOA 2XJRA 1FYUA 2R071 2OT7A 2WYSA 3GGLA 4HZFA 5F6LB 2LROA 3S30A 2DCYA 4OZXA 5FJHA 3WZ1A 2YV8A 3C7OA 2BVVA 2A70A 4FCAA 2VG9A 5F37A 1OXCA 4FOYA 5FZOB 1ZBE1 1MPXA 1WLDA 2ZCWA 2FDJA 2R061 4KU7A 4AQ2A 2DFCA 2NLRA 3D4KA 3M3QA 1ST8A 3WW3A 3N7KA 4E4HA 1A3KA 1S2BA 2ARBA 1O3TA 4CU7A 1MQTA 2BJSA 1JZ6A 4LLFA 1QOTA 3KCXA 4NAMA 3ROUA 3DPRB 5FTTC 5C70A 4BPZA 5FZCA 3BTYA 1GWKA 2VZVA 2WS92 1BYHA 2Y8KA 3IZOA 2Q8CA 4N43C 4Z1VA 3HBKA 4R8HA 1AR73 1D4M3 1N1YA 1ULOA 5FPBA 4QHOA 1NCQB 1GLHA 3MW3A 3VBSC 3LDRA 4Y4YA 2QQPA 1LGBA 2OPWA 5A7QA 1PNGA 4EE2A 3BTZA 1H8TC 5FXVA 2W9XA 4ZU7A 2RS31 2B9UA 4IDZA 2E26A 1YQ8A 3NNLA 4HG6B 4CUGA 3ILNA 4Y1ZA 3DF0A 2NQYA 4AI1A 3O1MA 1XE8A 1LU1A 2DUQA 1QNYA 3GZEA 1KDKA 3K46A 3U1XA 3DCQA 3GHMA 4NPLA 4YW1A 5DZEA 3CF6E 1O8SA 3LCPA 2ZEXA 1YLLA 1MS8A 3IPVB 2XOMA 4NHKA 4J25A 4RHV1 1RINA 1Z7S2 4D0QA 3T3YA 1VBA1 1V6JA 4OHWA 3VKLA 3OGSA 2K46A 2MEV1 4HOOA 1ZZ7A 3APBA 1QEXA 4FAGA 1LOEA 3ASIA 2CHHA 1T2XA 3ME2A 1AYN2 2JDPA 5KXBA 2XG3A 4FFGA 5IWFA 4ZS2A 2FHRA 2PTMA 3PMSA 2JG8A 4GMP0 4XEZA 4N53B 5A32B 3T1LA 3WW1A 2WS93 4C0BA 2FDIA 2XONA 4Q0UA 4XQWA 3PHMA 2CL2A 3UNPA 4P9WA 4A6SA 4HK8A 1MACA 1RMU2 1Y9MA 5JXHA 2XUMA 2VULA 3AZYA 4RGAA 4AFDA 4DUWA 1KD7A 5DZFA 4BM8A 5JMCA 4HN0A 4B29A 1QJZA 5AVPA 4QPIB 2AZ5A 2GZWA 2P1BA 2AACA 1PZ7A 3AZVA 1BVVA 4ZXEA 2XKOA 4NIDA 3ZN6A 5AC91 1H0BA 4OUEA 1WBFA 4DXTA 4IGQA 3B01A 4LBQD 4LKDA 5FQ0B 5H9QA 4GMP1 4AFCA 1WKYA 2FCUA 3AP7A 3GF6A 4XQDA 2AR6A 4HVOA 3ZXDA 1YWKA 1Z7S3 3NKTA 4K40A 3WX5A 4E8CA 2ZHKA 3CZJA 1LENA 3DECA 4XCAA 2JIGA 2X5IA 2A6ZA 4GH4C 4I09A 4GWMA 4A44A 3LIHA 2XQRA 4LBMA 4QHBA 1BMV1 4QU1A 5JZGA 4OHXA 4AI3A 5FAXA 5EXOA 1WMFA 4Y20B 2YY1A 3B02A 2BOIA 4Y5SA 3TYJA 4LT5A 3M3OA 4RQPB 3T2OA 2QQWA 2QQIA 4PDWC 3B3QE 3OCPA 1KFXL 1ND3B 1W2OA 3DEMA 1RMU3 3PDQA 4H3WA 2E63A 1XSQA 1MVEA 5DUXA 1IPKA 1MEC1 2A73B 5FPZA 5HCBA 2XB6C 4XFCA 4FQZA 4EYUA 4OCTA 5HXMA 4DEVA 2BNMA 2JDYA 1J1TA 1HX6A 2CSGA 2D43A 2VO5A 2XJSA 1WBLA 3MGUA 4UYBA 4P02B 4K21A 4KNCA 2RDNA 4IXLA 3WF0A 2YFUA 1FNZA 1W90A 2ATFA 5CU1A 2BGCA 4KBZA 5A3UA 4I2OA 5BV6A 1RXFA 1B09A 4LULA 1IKPA 3ZXAC 3TEYA 2VZQA 4JZRA 1UKRA 1NE4A 3POGA 4Y33A 4CDWA 1EV12 2VMDA 4CP9A 3U78A 3VBFA 1HRI2 4Z2WA 1DQ4A 1LHOA 2ZX1A 4LEJA 4MUVA 2D6PA 4FPGA 4CYDA 2KXLA 2RJLA 4DO0A 4TYSA 3POEA 4LNVA 3WF2A 3LD8A 2VZUA 3QD6A 3HT2A 3ZSJA 2WNVC 5LW9A 1IGOA 2AC1A 4GKYA 1UCXA 4HKWA 3WXPA 3EHKA 1GSLA 1IG0A 1UOBA 3PURA 4OYUA 4R4XA 1RUOA 5LCWL 3VDDA 4AQSA 1JOBA 1Q56A 5A1FA 1R1A2 3IM0A 3SITA 1G9AA 3JD71 5F3GA 3RRDA 1UNBA 3O1OA 1D7PM 3CMGA 4DXZA 4MLOA 3J26N 2EAKA 5EJZB 5I0RA 2WWSA 3NAPB 2NPIA 3JCIA 3N9OA 1CR7A 1Q3EA 2ARCA 4MGSA 3U0ZA 3ZFEC 3I2FA 1JZ7A 5ERLA 1CAWA 1NOVA 2EXHA 1RVF2 1ZNPA 3MDPA 2I2SA 4IGOA 4KH9A 4NROA 2X8KA 1A78A 1CZTA 4AQ6A 3UGFA 3UESA 3CNAA 1V6KA 2ORZA 3D82A 4KGGA 3KCCA 3VKFC 4QDQA 1VIWB 4RS5C 3IT8A 1EV13 3HT1A 3KGZA 4AR2A 1HRI3 2JE7A 4XDPA 1NUKA 4AHZA 4GJZA 2RE9A 3WSOA 2XJUA 3WG1A 2JKBA 4BIOA 5KWRA 3Q8AA 2VR4A 4INDA 4DXSA 2HH9A 5A3LA 5JLVA 4E2GA 1BLZA 3FC0A 3N9QA 3I2IA 3DYOA 3RFRA 2GMPA 4DIQA 3MEPA 4XJ9A 2A6WA 4IUGA 1NAEA 2A75A 2GU9A 1RTVA 4CPBD 3KLSA 4FPJA 2BEOA 5JXJA 1JMUB 1AR71 1J84A 1R1A3 2ERFA 1D4M1 4MO3M 3T0BA 2RJKA 2QBXA 3BB6A 1DGWA 4PLOA 1C28A 2YFZA 5FZ9A 3D8CA 2DTYA 5FMOS 5CISA 2R6QA 1BEV2 4ZPIA 3GZAA 5J7MA 4KWUA 2VOKA 2W2IA 4IV3B 5FWEA 2G1MA 1ENXA 1TZOA 3FJSA 1DU3D 4CCKA 3AJYA 1CAVB 4O9GA 3PUAA 1RVF3 1ULPA 4CCDA 4G3YC 3BIEA 3AL6A 4OLLA 1YFWA 4NE9A 4ARYA 5FO7B 5L9BA 1RGSA 3O1SA 3KF5A 3DPRC 5BY5A 3I3BA 5LA1A 4DEQA 4JGZB 2TNFA 1NCQC 4FBFA 3K77A 3E5UA 4HFSA 4W8JA 5IVYA 4FT8A 2H0BA 2HEYF 5SV5A 4UW5A 2E9QA 3KWVA 4BCUA 4Q4W2 5C3OA 5ABJB 4AFBA 4COZA 3A21A 1W99A 5JR2A 4IV1B 5GALA 1UAIA 4XFIA 2VOWA 1NCRA 3VBOA 2GC0A 3WW4A 2WWJA 1QDCA 4P9IA 4ZKTB 4BLJA 2QCSB 4Y22A 3VUOA 5KHHA 1G7YA 2CDPA 3O7OA 4YM1A 4TZDA 4GWJA 3ZYFA 1FXZA 4A3ZA 2WS91 5FZFA 1GKBA 5CIRA 5A80A 3IDEA 1AJKA 2BUKA 2FZ1A 4LITA 4XF3A 3AMHA 2YZ4A 2BFUL 3CEWA 1K5MA 1XE7A 5EJ3A 2TUNA 3JBG2 4RR3A 1BEV3 1RUI2 3LIGA 1KS4A 3CO2A 4XE9A 2ZEZA 5IVBA 3BCWA 4IL7A 5AFBA 3ELNA 1CAUB 2Y6JA 4LLOA 3WT3A 4AEJA 2A3WA 1YC61 3LDKA 5CFDA 5FKBA 3QACA 4LTAA 2PHLA 1QJY2 1GOHA 3RQ0A 1B35A 2VGDA 4N53C 3C7FA 5FZ7A 5F3IA 4BQ5A 4MGZE 3VHRA 4F8AA 2RDRA 2VUAA 2XWBB 3IN9A 4QB6A 1DG6A 3LKJA 4CCMA 3E6CC 1NY72 4QKBA 3GBWA 5I8SA 4A7KA 1MQTB 4Q4W3 4X8PA 1DQ6A 3AMPA 3GJBA 3VBHA 5LA0A 4XJWA 1H1AA 3PVNA 1AYN1 4QPIC 3VBUA 3VKNA 4CA9A 4QB2A 4OUSA 3B93A 5LBEA 4TXWA 3OJBA 3RYPA 5IK5A 3VKOA 2QJVA 3B69A 1SHWB 1XNCA 4W65A 3N4MA 3HR9A 5L9VA 5CYYA 4NVPA 1ZA4A 4UOJA 1J3QA 3WDXA 2P6HA 1D0GA 1GQPA 3I54A 4YW7A 4BA6A 2EIEA 1LR5A 1WW6A 3IDAA 2OS2A 3OPZA 5GZEA 5JXIA 2WSUA 1JXNA 1UZVA 4Y1YA 3TNQA 1FX5A 3RI9A 1QOOA 4AEKA 1LB2A 3HQRA 2P37A 3JBG3 1HIXA 1RUI3 1W2UA 2RHPA 3ZIXA 4JDMA 3TB0A 2W39A 4Y26A 1MS9A 2JB8A 4ASKA 4CDUA 2C26A 4KBBA 1TVGA 4JDOA 3RJRA 2CYFA 2XMLA 1OFSA 3CKHA 4Y24A 2AH2A 5DAPA 5I0SA 5J96B 3NSTA 2O1QA 1WW7A 2XJTA 1G9FA 1QJY3 3E6DA 4Q1RA 3ZYPA 4BK4A 2W91A 5FWJA 3VDBA 5KHJA 3CJXA 1VBC2 1VMFA 5GKAC 1UQXA 1WCDJ 2Z42A 3SHRA 4FPYA 2OUHA 4CRQA 1JOJA 3D6EA 4RQPC 1IS3A 1ASJ1 1UOJA 3RZZA 3WR0A 1MS5A 3GCWA 3KT7A 3AVSA 4RFRB 5IHRA 1ND3C 5C3SA 1F15A 2BERA 5F7UA 3GHNA 2J1TA 1W28A 3RPQA 1PO12 3JU9A 2V72A 5IAVA 4AHYA 5F8PA 2WAOA 2JG8B 3AMNA 4IE0A 1NKGA 3BKZA 1WA4A 2VAUA 5LA9A 4IEXA 2DDUA 2SLIA 2WZ8A 4XW3A 3BN6A 3NJVA 5DDJ2 1LULA 5JI9A 5JCTA 2VVEA 4LXLA 2WN2A 4A6OA 2VCBA 4XABA 4YARA 5IK8A 2D44A 3LSDA 4HK9A 2B5HA 3SH3A 5DG1A 1TME2 3ST7A 3T1MA 5F5AA 4I02A 4AEDA 1AR81 2A1XA 3CU7A 4YGCA 3QH6A 4XUPA 4NHXA 2P17A 4GIQA 3ZN6B 2WNEA 1X7NA 1FOD2 1X33A 2VW1A 4H14A 5FXZA 1VRH1 2N7GA 1Q8SA 4Q4Y2 5F2WA 5A6XA 5KXDA 3BUCA 3RJ2X 4JQRA 1X9TA 2Q4SA 2A5ZA 1VLNA 2VD7A 3N9MA 3P5BA 4DZGA 2HWE1 1VBC3 1F5JA 1OI6A 4NN0A 2PHTA 1O3QA 1HLCA 4QGLA 3SH5A 4CU9A 1OD3A 3R6SA 3I3MA 4XXPA 4IERA 4KWJA 1LEDA 1XNDA 2EALA 5LA2A 1W8HA 4BK5A 2X5IB 4COYA 3OEAA 2O0OA 4J1WA 2MHFA 4COVA 2C4XA 5GLWA 4XF4A 5C6CA 1EV11 4CEYC 3S0MA 1HRI1 1GP5A 1YJLA 4FO9A 1PO13 1C5HA 3TBDA 1AZDA 5JZGB 3E5QA 3GALA 3I2DA 3MYXA 2CY6A 5FREA 3RMXA 2VECA 4E2SA 1JW6A 3NAPC 1H2KA 5A7SA 2IUWA 2QTWB 3WW2A 1IQAA 2DV9A 4XZUG 4Z2AA 1H1IA 4FPFA 5DDJ3 4YW2A 2PHWA 1W04A 4RFT0 1Q8VA 3RZGA 2D3PA 1GNHA 5FOJB 4EN8B 2VPVA 4YM3A 1PO21 5T54A 4Q29A 1POQA 3MLJA 3WQ0A 1TME3 3JXSA 4AAXA 5DN2A 3CL1A 4AEMA 4BQ1A 1TE1B 5LRSA 2WYFA 5TSWA 2R1DA 3WF1A 5CBLA 1FOD3 4DPNA 1G9CA 3O5SA 4P14A 3T4VA 1V6OA 2QDNA 4QXHA 4PIYA 2DU1A 2DVGA 4Q4Y3 5E88A 2ZGLA 1DQ5A 3LOBA 2CGOA 3B7MA 4XC9A 4CCLA 2W92A 1H4HA 1WGPA 3POFA 4SLIA 3POBA 4URAA 3T2QA 1J59A 3ZXEA 1OPMA 4I01A 3HD8B 3NRUA 4Y5Z0 3HNBM 3FN9A 4UF0A 4CDWB 4CP9B 3VBFB 1S55A 3FHQA 4H55A 3FLPA 5LATA 4G9SB 1HXS2 3I2GA 4OQ8A 3K51A 1AF9A 1GP4A 2JD4A 1SDDB 4EROA 2Z69A 1OD5A 2LUWA 4Q0VA 1NLRA 1U5YA 4PIXA 4MXVA 5FPXA 3PU8A 2OQ6A 1KRIA 1OLQA 2AEYA 5IK4A 5C5TA 1CJDA 2ZGRA 1EUUA 1QGLA 4V2WA 5FZHA 4IV3C 4UFMA 1RUG2 1R1ZA 1O4YA 1MZ6A 4Z07A 3VDDB 1AJOA 3WNLA 3THDA 5A70A 3NL1A 4YG6A 3BIWE 4AVTA 4YLZA 2E7TA 3S7EA 1QWRA 5B4NA 2EXKA 3L9JT 1W9WA 2UY9A 3GNEA 2C9KA 5FIXA 3VL8A 4Z92B 4IETA 5FK8A 4C90A 4QB1A 5A3NA 1STMA 1U5XA 2XHNA 5F32A 1BZWA 3ACIA 4A42A 2ZKNA 5FRAA 1W6NA 5C9AB 4Q0SA 4XBQA 1RC6A 2QNKA 1LNSA 1N3PA 2KM2A 3BTAA 3MPPG 4JGZC 3SEPA 3VN4A 5J36A 1PIV2 3AXEA 4D3WA 5ABJC 3AXDA 2DVDA 3J7HA 3LEIA 3DL3A 1CAWB 2CDOA 5BNPB 3KF3A 1S2EA 4ZXKA 4IV1C 3EXUA 1RUH2 1QXJA 3I2JA 4WM8A 3WP5A 1QH7A 2XJQA 4IQPA 5F5CA 5HBAA 3AFKA 3ZDVA 3B5LB 2DF7A 1UU6A 3EJKA 2HLEA 5FYCA 3ENRA 3HN3A 2WQ4A 1G8WA 3AYAA 3PUSA 4AK3A 2BV4A 1N1SA 1VR3A 5KXEA 5IK7A 1RUNA 4OFGA 1AL22 1AX0A 2CU5A 3MBWA 2VM9A 2Y0IA 3MIHA 5JPMB 4V1PA 1FI2A 4L97A 4L11A 3I2KA 3LEGA 4YVWA 2ZHLA 1RUG3 3K2OA 1OLRA 1O5UA 1ENSA 1JYNA 3KV5A 4CP0A 1LGNA 1YCIA 1ZBA2 4IEPA 4UW6A 1PM7A 5GM0A 2ZOEB 5G04L 2VJXA 1Q8QA 5B2GB 3TNPB 3H7JA 5K4LA 3B9IA 1CPMA 3LAGA 1GU3A 2E51A 2PAMA 2R30A 1WZXA 2WC2A 3OF1A 4I0WB 4ZY9A 5DXDA 1RUI1 3I7DA 1XJAA 1C57A 1PIV3 1CIYA 5FMDA 1GZTA 5APAA 1MQTC 2I07B 3ZR6A 2QQUA 4KMQA 2J7MA 4AI2A 4HKLA 4QXCA 2Q8EA 4XFHA 1VALA 3WF3A 1RUH3 3AMQA 4QX0A 1SLTA 1DYKA 2Q5TA 4XHBA 3AYDA 4UFKA 3I59A 4M4PA 5HXVA 5JOWA 2B42B 1L7RA 2ILMA 3FWEA 3NNGA 4FPLA 5KC5A 5FZ0A 3OD0A 5FDBA 4XQ4A 5J98B 5CFCA 5K8SA 1I3HA 3D5OA 4IEZA 5G05L 1O4ZA 5BNNC 1Q8PA 2ZGSA 1DDLA 5IFPA 1AL23 1V6MA 1DGRN 1NY71 2W1QA 4Q27A 4S2GA 1NCRB 3VBOB 1V70A 4HANA 2D98A 4FI9A 3I49A 1FAYA 1RHI2 4PLMA 4Y22B 4PBOA 2GALA 2D6MA 1L3JA 4YZ3A 1CX1A 4AHXA 2DBIA 1VBD3 5FZGA 4A2UA 3S6PA 3VDCA 3GYDA 2ZGNA 3A23A 1Q8OA 4XF1A 2O8QA 1ZBA3 3OOXA 3O1VA 4KG8A 3CHXA 3JB8A 3SXWA 5GZGA 2RJ2A 2Y6FA 4LJHA 1JYWA 4KG0A 1EPZA 4JRLA 1Y3TA 1EAH2 1NT0A 4A3XA 5J09A 1K5MB 1BVP1 1IG3A 2RDQA 1ONAA 3E1F1 3IIIA 3J8F2 4RR3B 4EV0A 4MOAA 3QH7A 1JU3A 4IESA 2LM3A 4E27A 1U0AA 5FYTA 1UY3A 1S0FA 1OOPA 4QDSA 3W59A 5ACA2 5KXCA 5CFDB 5JWPA 4DUXA 2GMMA 3VKMA 1QJEA 2W52A 5IVEA 1W9TA 2VMCA 3POJA 1B35B 2NMNA 2WWUA 3AYCA 4N7UA 1OPOA 2D6KA 2JG8C 3Q8FA 4BQ3A 3MPBA 4JKMA 1XSRA 3H8XA 2WR9A 1VBC1 4C0HA 2JICA 2ZKLA 2XLGA 1QHDA 3PNAA 3KGLA 1QU0A 3F95A 4XDOA 1W6PA 3KV6A 3IMNA 2VUJA 4BQWA 2FBEA 3IWZA 1UYPA 5E8AA 4LBNA 2CNAA 3VBHB 4GXLA 3VBUB 1GWLA 5KHGA 4WZCA 3HNYM 1RHI3 5FP7A 5DUUA 1RIRA 3SLIA 1S0JA 4OMCA 4D6RA 2F4LA 2VMEA 3MLLA 4M3CA 4LE3A 2ES3A 1GNZA 2BYVE 1UD1A 3M3EA 1AVBA 2OX0A 1W03A 4MV2A 2RR12 4UT5A 2PA7A 3HNMA 2ET7A 4XIKA 4ZZ8A 2Y0OA 4CCEA 1EAH3 1YQ5A 4K8FA 2VTXJ 3RYRA 4ATEA 5IJRA 2QUOA 4PI2A 4E4SA 2C6SA 2OA2A 2VTXA 3J8F3 1TME1 3ORJA 5HCAA 1RUF2 3WY6A 2X5IC 4CDUB 1HKDA 3C7HA 4QGNA 3WDUA 1JUIA 1N1TA 1PVC1 1UO9A 5ACA3 2OUJA 5FV3A 4EJRA 1YUDA 3NV3A 1FOD1 2FDHA 3VLBB 2GSYA 2ZPXA 5FUPA 5FY0A 5C3PA 5JZGC 3OPWA 2C5DA 4Q4Y1 3ETPA 2EVXA 1TNFA 3W20A 4RA0A 2RS52 1HB2A 4BHPA 2DTWA 1O3SA 2J1AA 3WQ1A 5FP3A 4LBOA 4LIUA 2ZHNA 1CVNA 2WINB 4LOSA 4QX5A 1WCKA 4Z8BA 5F5IA 1V00A 1CONA 1UZWA 2RV9A 3Q8BA 4QD2A 5F1RA 1X50A 3OGGA 3OUJA 5GZDA 2J1EA 1PGW2 3J9SA 3SKVA 3VDAA 4JVAA 4LQRA 4PBPA 5K0UA 1GOFA 1JTZX 1W05A 2OQ7A 3AJZA 2YG0A 4XUTA 3LB9A 3J7NA 4MHUA 2FDGA 3HQXA 2UWCA 3EYPA 3TOJA 4K3UA 4M0HA 3WD5A 4LMFA 5K9YA 1CN1A 2VBPA 2RM22 2RR13 2JDHA 1WCSA 3BTXA 1F9KA 2XLAA 4NOTA 5FP4A 3K48A 3PVEA 1POV0 2C1FA 1OUXA 4AEDB 4NRPA 5FPUA 2HYKA 3FL7A 4GALA 2D6OX 1REDA 1RUF3 4CDWC 1UXZA 3VBFC 2YMZA 3RNSA 1ULGA 2JB4A 1WMXA 5KBFA 1LGCA 2B4KA 2Q0AA 4NIGA 5FY1A 1U5IA 1VE0A 2Q8DA 3EO6A 1R081 4RSUA 3WNNA 2RS53 5H9SA 1JBCA 1JHJA 3P3PA 3R4SA 4PT6A 3N36A 1QJFA 2KA3A 2B8MA 4NPRA 5FLIA 1HV1A 5DQ0A 4PQ9A 3MUZ1 3WNKA 3WDYA 3VDDC 4NJ4A 2W1UA 5CKNA 3ZDSA 1POV1 4CCNA 2VL4A 2NZ9A 2Z79A 1W6OA 3B00A 1S1AA 3FUQA 4XUOA 5FY5A 1PGL2 1HXS1 2A6YA 2DYCA 3N3HA 1IS4A 3BPZA 2RS12 4N43A 4C1WA 1G9DA 1UZZA 1NZCA 4I0AA 3WUCA 3BYWA 1NLSA 2BNNA 2AEZA 3HOBA 3UKVA 4LK6A 4WV8A 3ZLIA 1YQ2A 4WVWA 1WD4A 2K9ZA 2RMU2 1ND2A 1LCLA 5L36A 1M06G 1RUG1 2ZMNA 1H9WA 4PF1A 1XXNA 2RM23 5FKCA 5BNPC 1CAXA 2UWAA 1DCSA 4XHXA 1O59A 5DPNA 5FR3A 4OI2A 4QXBA 3ILFA 1W0PA 4FPHA 5FZ8A 3SC7X 4ZZ5A 1ENQA 3M8LA 4E2QA 1SBEA 5LEKA 4DMIA 1OVSA 2VMIA 1YFUA 2VXRA 3INAA 1DGWX 2F4PA 4NO4A 4YSFA 2GN7A 4LBQA 2VMHA 5C3RA 5BNOA 1YYNA 2JG9C 4AGGA 4CCJA 3OY8A 1A8DA 3AZZA 3OSDA 1J58A 1E5RA 1JYVA 1PIV1 3K4AA 3ITQA 3IB3A 5FPLA 2Y6HA 4Y5TA 2FMYA 3THPA 5T3NA 1RUH1 5LBCA 3ZYRA 5JOZA 2HKXA 2G9FA 4UF0B 1DYOA 3WOGA 2WT2A 4NUBA 2GP3A 1JZ2A 4CSWA 1QIQA 2HWD2 2NM1A 1Y9QA 4PHZA 4QPGA 4GULA 4FSJA 2RS13 1UPIA 3GBGA 4NWWA 4IE7A 2DFBA 4S2FA 1O8PA 4JGYA 3SCGA 3VD5A 5FP9A 2FD8A 3I8TA 2BFUS 2FCVA 3M3CA 2RMU3 2YU2A 3ACGA 2PMWB 4DRVA 3URFA 3VHPA 1IKQA 3FFZA 3KM5A 1IQDC 3BPSA 2X09A 4DUVA 1DQ1A 2Y26A 1LHWA 1OVPA 2XBO2 4CP2A 2YBKA 2YPJA 1G86A 1LODA 3H9AA 1GWMA 3G6JB 4JHTA 4ZU4A 1U5ZA 2XR4A 3GDBA 4AI0A 1XYPA 4ET7A 3RVHA 1SBFA 1W6NB 3AZXA 2IFWA 3KQRA 4I30A 1COV2 4OUMA 4ZS3A 4ARXA 5CADA 5C9AA 1AX1A 1H30A 2Q1MA 5JPNB 2XL9A 5BUVA 2V4VA 5C8WA 2BWAA 4KL1A 1US3A 1RUD2 1NQDA 2Y6LA 3KMHA 3ES1A 3ATGA 4OHVA 1ULFA 1NCRC 3VBOC 2DURA 3EQEA 2BVBA 1DF0A 4WM8B 4GB32 5AVAA 4FTEA 3H3ZA 4QPWA 1LOGA 1ZX5A 2ZGQA 1GMMA 4Q1PA 2WN3A 2LS6A 1W8UA 2GP5A 4K7JA 4OI1A 1BBT2 1DBNA 4YPJA 4PQQA 3M70A 5H9RA 2JWPA 1OA2A 1UY1A 1HN0A 2HWD3 2JEMA 4L2NA 1W3XA 1NYWA 3I2HA 5FY9A 3VZNA 4XXAA 1UIJA 5JAXA 1K5MC 2QZ3A 4AYUA 3H8UA 4R52A 2ZAHA 1DYPA 4RR3C 5A1AA 3MV11 4AGVA 1BCXA 3VHNA 4YVWB 1H6YA 5HCFA 1RHI1 4NRMA 3K75B 3RWKX 3OB8A 2WT1A 4BQ2A 2WBKA 5CFDC 4E9KA 1NXMA 1J1LA 1RJ7A 3GZTB 1F35A 1V6IA 4W6YA 1N3QA 2IXLA 4XURA 2XBO3 5EYXA 1B35C 5BXXA 4FTSA 1V0AA 3FE5A 1Z78A 4OI4A 2BRTA 3WQ7A 1GYKA 1RUC2 2VUCA 4AG4A 5FYIA 1TQ5A 4KWLA 4YGEA 3T2PA 4YZ2A 2QQLA 5FYVA 4MVTA 1GOGA 3U14A 1COV3 1XPWA 3POIA 2WNUA 3J8F1 4FOQA 2R7EB 2RDSA 5FY4A 3HN1A 5JXGA 3KV9A 2RG4A 1M4WA 3LFIA 1Q43A 5GZFA 5ACA1 1RUD3 1C5IA 2D97A 2QVSB 4G4FA 1UZ0A 2WZEA 3DYMA 4XTPA 2PLV2 3VBUC 2W5FA 3VBHC 2R043 3FX3A 2VZTA 4AXOA 4EWAA 4Q8KA 4GB33 5LK7B 1FNYA 3I59B 1OH4A 4CP1A 4A4AA 1OKOA 4AZZA 2P34A 1SLBA 1SLIA 4AF9A 4PIZA 5CFCB 1BBT3 4N90A 1ZA7A 2Z5WA 5DAXA 3UV9A 1G6NA 2VZRA 3WEZA 3OYWA 4P9LA 5A3TA 1CX4A 4Q4X2 4R9CA 5D2AA 1PNFA 2YPDA 4COUA 3LPFA 3ZIWA 3KZ4C 2VW2A 1OUSA 1MS3A 1C1FA 1JU4A 3VZKA 3VZLA 4HONA 2HWC2 1QJX3 4CDUC 1LHNA 4BLIA 3U4SA 5FYBA 3WNPA 1E5HA 3KT4A 3IAQA 4UFIA 4S2DA 5A3MA 4PCRA 2J22A 1DP0A 3CDZB 1JYXA 1N3OA 3WDVA 2B45X 2VOXA 3H1WA 3RZHA 3DXTA 5J3UA 1RUC3 3ETQA 5DAQA 4O65A 4QKDA 4WVVA 1ZYBA 2EXIA 2JDNA 2GMEA 1CIWA 1W2TA 3LWCA 1RUF1 3SISA 1OOPB 4HN1A 4JAAA 1W06A 1FV2A 1ODNA 4CEWA 1A6CA 2BZDA 4YFWA 1UMIA 2PLV3 1LU2A 1PM4A 4KWKA 1UY4A 4UXAA 1D2SA 1C1LA 2RS51 5F3EA 3H3LA 1R64A 1Z7S1 1A34A 2PAKA 4Q4V2 5EPAA 3LGRA 1R092 1OMIA 3AP4A 3ECQA 1MVQA 1W6PB 4R9BA 4EN7B 1APNA 1WWYA 4KI5M 4LORA 3ACLA 4COWA 3T0AA 2ZABA 3OUHA 4Q4X3 4AEDC 1DZTA 2Q30A 3AMMA 3C7EA 1PGW1 5K7PA 3VB9A 2W46A 2HWC3 3WP4A 4LE4A 2GNBA 4JRAA 4M3CB 5EJ1B 1YHFA 5C8CA 1NA1A 2DBNA 2IXHA 5LWBA 4GAZA 4LIVA 1GZ9A 4EZ4A 1S0CA 4XBNA 2Y60A 4X8NA 2UYAA 4AFMA 1RMU1 2RM21 4BQ4A 3AP5A 2DUPA 1H6XA 3PUQA 4K8RB 3KS7A 3I3QA 1QJU2 4WM7A 2BBVA 3ZPYA 1CD3G 1Y4WA 3AKRA 2J1SA 2TEPA 3AC0A 4B4QA 2XGXA 2J1UA 4PI0A 1W8FA 4ORFA 3ZPOA 2VBDA 4QQPA 1YIFA 2YBSA 5CZKA 2W3JA 3PL0A 4DINB 2NMOA 3THCA 5M0TA 2JKXA 3ZR5A 1CWPA 3Q8CA 3KVAA 2WO2A 3C2UA 4XDQA 1Q5OA 3NJZA 1SACA 1WMEA 2R16A 4L99A 4MX3A 1WUVA 4Q4V3 1AR92 3RWNA 1R093 3B9CA 2GN3A 3ZVXA 4DY3A 5BNPA 2FDFA 1UPSA 5A7PA 1QF3A 1BK1A 4UWDA 3H8OA 2J1VA 1TMF3 1PGL1 2R072 1AR62 5A33A 4A7YA 2XJPA 2Q8OA 5K0UB 4BU2A 1OT5A 4CCOA 2JX9A 2WO3A 1ZRDA 4XAAA 4EWDA 4QQ2A 1AX2A 1ZBE2 2XVGA 2RMU1 1UU4A 2ZMKA 2EF6A 3HJRA 1URXA 3ZYGA 4D8MA 4ES9A 2UU8A 3HAGA 2P3IA 1MZ5A 1HB1A 4Z82A 1ZVFA 3DKWA 3USSA 3ZSKA 1QJU3 3MF9A 5L7OA 2IFRA 3ZYHA 4AI8A 3U4XA 1C4RA 2WUHA 1JODA 3WF4A 3AM2A 5ANQA 5FYMA 3OTFA 4EWEA 4HXCA 3WNOA 1PHMA 3W58A 1LOFA 2HJIA 2JDAA 3AFGA 1SQ4A 3BVCA 3LA7A 4BWOA 1O3RA 2HWF2 3PJQA 4YM2A 3O0VA 5IAXA 2FMDA 4JC1A 4CUBA 3H8RA 2CAVA 1AR93 2GH8A 2BBAA 3LZZA 1KQRA 4MGQA 4PJYA 5FO8B 1W6OB 3OBTA 4Q26A 1YRZA 1XQNA 1UW8A 2XXZA 4N43B 1KEXA 4Y1XA 2R073 1AR63 2HWD1 2WFF2 3CIHA 4UBGA 3C3VA 4B3NA 1US2A 4A41A 4X6QB 4RHV2 1ND2B 4FFFA 1VBA2 1UL9A 3RI8A 1CESA 1ZBE3 3TRSB 3LPGA 4MGTA 1LHVA 3U10A 4AVSA 2WLPA 1CAXB 2C0ZA 1H2LA 1K42A 2OIIA 1EY2A 1FMD2 1UU5A 2W94A 4HSLA 1R1A1 4Q0QA 5IVJA 1XBFA 3RG0A 2XBO1 2VU9A 4WM8C 3WINE 2GNDA 3PMEA 3L2HA 2XVKA 1T6GC 3H42B 5FYYA 4LBQB 3AX4A 3CLPA 5BNOB 2GH2A 4GQ7A 1COV1 1KXGA 3OY8B 3MIEA 4P9YA 3ON7A 2QKDA 4XTMA 3WG2A 1HN1A 5FZMA 5JSOA 4P5HA 1VBE2 3AL5A 1HB3A 4CDXA 3EBRA 5EQUA 1RUD1 4E8DA 1RVF1 2HWF3 3SMHA 5FPAA 1ULCA 1YIPA 1F31A 4I0BA 4YVWC 4IE5A 4GB31 2XWJB 3BGAA 2X10A 3MIDA 1D4VB 2OYZA 2PHDA 2Q1ZB 4Y1VA 1PK6A 4YM0A 3MF6A 1K5JA 3K3OA 1YI9A 1BBT1 3A7QA 4QPGB 4OHZA 4QDRA 2YXSA 5FJKA 2A71A 1KDMA 2WFF3 4JGYB 3TAYA 1SFYA 3B94A 3POSA 3POYA 4CDQA 4RHV3 3LE0A 1O4TA 1SFNA 1VBA3 2ZEYA 3OEBA 4IEUA 2VMGA 3RSJA 4BOWA 3BI3A 1Y9GA 1XU2A 1SLAA 2VTFA 3SH4A 4OHYA 1FMD3 4CE8A 2G4IA 4DXRA 1JOPA 1YI7A 4PLNA 1WA6X 3LSEA 1YNAA 3LOIA 5LBBA 4DS0A 4JTNA 4XF0A 3CJIA 3WHTA 4D7YA 3HEIA 5F9TA 1QH6A 4QPYA 5LK5A 1ZRCA 1QNWA 3HIFA 5CFCC 1BEV1 5C33A 1OQEA 2P6CA 1N1VA 2PXJA 1UY0A 3IIAA 4FFHA 2IXIA 1VBE3 3HPNA 3J4UH 3LFMA 4QQOA 2E32A 1OSGA 5JOXA 1YFXA 4BYYA 1IZ3A 2ETEA 1AYM2 4JQTA 4RYDA 4CEYA 5L19A 5A6YA 3ZYBA 1FT9A 4W50A 3U07A 3N7MA 4CXYA 2E7QA 3IDCB 1PX4A 5F2SA 4D6SA 3T0DA 1VMHA 3W5MA 1F2NA 2V5YA 4LKEA 5F6KA 4QX3A 2QQKA 2ZEWA 2H6BA 1GBGA 4BJ0A 1PZ8A 1V6NA 4GMP3 3HMYA 4Q4W1 3WCRA 5FZDA 2BWCA 4FFIA 4C1XA 4XZPA 3ALQA 1E5SA 4Q4X1 3NJYA 5L73A 4ONUA 3WVJA 2VQAA 3ZKYA 3AKTA 1PX3A 1VBD2 2R1BA 5DAVA 5FYHA 2PHRA 4YVSA 5EYYA 3UK9A 2JE8A 5I91A 3IAPA 1LRHA 2ZXQA 1OQDA 1UOGA 5LY1A 4AFAA 2WKKA 4QXKA 3BU7A 2VZPA 3JQWA 2FCTA 1DIWA 3WDTA 4JV4A 2WNUB 1HV0A 2VQTA 3JBG1 3DUIA 3N9LA 2D3SA 2PQSA 4LHKA 1T6BX 4OULA 4AL9A 3KHCA 4ISRA 2PYTA 4XVHA 2XPJA 1V6LA 3D3AA 2B39A 4HSJA 2JD9A 1QJY1 3K4ZA 4JTOA 1AYM3 1TEIA 3PUHA 2XJVA 2B46X 2XHKA 5LBFA 3SEEA 4B4RA 3I97A 5JDBA 1YQ6A 3AK0A 3LA2A 2OKXA 3I4IA 3U11A 4FAHA 4RL7A 1UZYA 2RVAA 5A3PA 1SZBA 1IS5A 1BQPA 3MUY1 3N35A 3V0AA 4Q4V1 3AKQA 5F3CA 1UYYA 1VPHA 1R091 3OYWB 4MXWA 4YG3A 3Q9OA 4KGQA 3U75A 5JMOA 3N9NA 3GZUC 3ZFGA 4MG2A 3GBFA 4XJZA 3TN92 2P5BA 3X29B 4Q5OA 2W68A 1ZRRA 2G19A 1VBB2 1RITA 4NMIA 5DAWA 2VNGA 1UIKA 2JENA 4MSVA 4MH0E 1YJKA 5DUVA 4L0PA 4PF5A 3SQOA 5D8AA 3KB5A 1W8TA 4AW7A 3ZFFA 3LDBA 4YW6A 1JZ3A 1UYZA 4GZ9A 3VBRA 3MO4A 2GC3A 3T30A 5DG2A 4YGBA 1UN1A 1WMDA 5E89A 1JN2P 4AVVA 4XACA 4META 2WAAA 4U36A 1OF4A 2WJSA 5GLUA 4LBJA 3MIGA 1HQNA 5LB6A 3ZXFA 4CEWB 5A6ZA 4YRDA 4FOWA 4D94A 4O61A 3U37A 1WW4A 2Y6KA 1S0EA 3ZXKA 4AAPA 3M3IA 3JD73 5C4WA 3MV01 4JKKA 5K0UC 1JZ8A 3QBQA 3MFCA 1BHGA 1GANA 1QXPA 4BH9A 1W0OA 1OA4A 3KCYA 3DYPA 3NV1A 1HB4A 2VCMA 5IVVA 1AR91 4NHYA 5GLVA 1GQHA 2DWRA 4R9DA 2QQJA 4NIAA 3WCSA 3EB7A 5FMBA 4FPKA 5A7NA 2J42A 3UKNA 4AI9A 3FBYA 1PO11 1GNYA 3TN93 2FQPA 2YB7A 2JJ6A 5IYYA 1AR61 2WSVA 3M1HA 1VBB3 1W0NA 2O8OA 5FZ3A 4ATFA 4YZ5A 5C8CB 1C8NA 3I2OA 4XCBA 1NA1B 4C91A 3NNMA 2EIGA 5J1XA 1W39A 4LO4B 1JUHA 2JDZA 5DDJ1 1Y7BA 3W5NA 4ISQA 1PMIA 2PAEA 5AFEA 1H2NA 1NX9A 4EQVA 4WM7B 2R49A 3PU3A 1WLCA 2IWGB 2MNGA 2IXKA 2CAUA 1RUE2 1PVXA 1HJGA 4LPLA 2VBBA 4QKFA 3VHOA 4MHRA 4RGKA 4JKLA 1UOFA 1SDWA 2EXJA 4ZONA 2ET1A 3S5AA 2WQZC 4D6QA 1RYYA 2R0FA 2XVLA 3SCHA 5JI7A 5FMCA 4M4RA 4K1ZA 1HRV2 1XNBA 2XLFA 4NR1A 1S0BA 2V4AA 3ZO0B 4TTGA 2D5HA 2ZMLA 4HT1T 4YZ4A 3VD3A 3KVBA 2OVUA 3T09A 4UBHA 2X29A 1JYTA 2HWF1 1XYNA 2X53S 2YGMA 5BNNA 1UY2A 1ND2C 2V5DA 5CVRA 5CA6A 1CZVA 4L92A 1HQWA 1XC6A 2OW4A 2UURA 1I1EA 1V9U2 1ZZ9A 5BNQA 3FLRA 1ZREA 1EPWA 1UYXA 1K3IA 5A33B 4BXSV 5IVCA 1W2AX 3GCXA 1J3PA 2YBPA 3N9PA 3VD7A 3EMRA 2WFF1 1PMJX 4N9HA 3AVRA 5FZ1A 1OHFA 2XL7A 1J83A 2LTNA 4QM9A 5CKMA 5BNOC 4Q0PA 2DVAA 1DLLA 3O1RA 3ZXJA 2VCAA 5BYNA 2ARXA 3NJXA 5E16A 1QQP2 2Y6GA 2CV6A 1FMD1 2D5FA 3CQOA 4TN7A 5DABA 1AUYA 1VP6A 1UKGA 2ENRA 1RUE3 1W8OA 2JXAA 5A7OA 5L7OB 1JHNA 4CUAA 2R0HA 4L9BA 4NAOA 3NKGA 2LW8A 1DFQA 2ZGMA 4AE2A 2UWBA 2W95A 2ZX4A 2VZ3A 5I0DA 4FXGB 5T5OA 4YFZA 4IE4A 4L8QA 4QPGC 1HRV3 5E1RA 1GZWA 1IPJA 4M0NA 4JGYC 2E31A 1VBE1 2DCJA 5A7WA 5H9PA 3FFQA 4RN5A 4XUQA 1AXZA 3UKTA 1GICA 1MZEA 4TLGA 4E4ZA 3CZUA 5ISLA 3C7GA 4LA2A 3ES4A 4ZU5A 2D93A 4IEOA 2ZGKA 4P5YA 5FYZA 1V9U3 4XMAA 1MS4A 4YYOA 3THTA 2A7AA 2IVJA 3PVOA 3VBSA 5LY2A 5C9AC 2A3YA 2HWB2 2OZJA 4EN9B 3WDWA 1MS0A 3C8XA 3S5QA 4J6GA 3ZSEA 1ENRA 3V0BA 1H8TA 5KR7A 5FZLA 1ASJ2 3DKQA 3ACFA 4P9JA 1F8VA 3ILRA 4AVBA 5C3QA 4MGYE 1LOBA 3NO8A 1X8EA 1QQP3 3HBZA 2L9LA 2WZR2 1UF2C 3H1MA 5DZGA 1NXD1 3ZM8A 1O91A 2FDKA 4HPKA 1JI6A 3WV6A 1ZRFA 3E5XA 1AYN3 2VC9A 5FLJA 4A7ZA 2PELA 1WCUA 3KV4A 5IATA 3A4UA 3OD4A 2ZAAA 1VAMA 2H0VA 2BU9A 4JCKA 3AKSA 3E97A 5A3OA 1C3HA 1FV3A 3MFAA 4LHLA 3KT1A 2HEVF 4CDXB 4OI0A 4GKXA 4WBBA 2QQNA 1TNRA 2VCCA 2CWMA 4DB5A 4OQ9A 1IPSA 3ZN4A 1AYM1 1AR82 1W8NA 3NWKA 5FZIA 1ZRIA 5EHDA 2VOTA 4BISA 1JZ4A 1PK6B 1J3RA 3FLTA 4F3JA 3J7LA 1XNKA 1VRH2 1RXGA 2E6VA 4XFGA 3JQXA 1H4GA 3BU0A 2D7FA 4XUNA 4KU8A 1AL21 4XETA 4CDQB 1ULDA 3V65A 2HWE2 2GNMA 2HWB3 3MI8A 2GDFA 2K0GA 2WNUC 3JZVA 3H0OA 3FUOA 4RGGA 5EZWA 4LHSA 3USUA 5EFUA 5I93A 5CG8A 1ASJ3 4CU8A 1O5LA 1VBD1 2BTVC 2ZS6B 2VOVA 3PTYA 1SPPB 1VAKA 4BDVB 1W6MA 4XJUA 4O7XA 1ZBA1 4XJAA 3NV2A 2ZX2A 2BQPA 2WZR3 4GD4A 4N7IA 3L2YA 4LO5B 3PUIA 3H1YA 4K20A 5JIUA 4MGIE 3OBZA 3A0NA 3CJIB 1RUJ2 4P9GA 4IEVA 1FPN2 2D40A 3BOWA 4P9XA 1AL0G 3ZYIB 4IE6A 3T4HB 2G9GA 3QOPA 3PIJA 4JX0A 2HBUA 3OGVA 4NIIA 3H7YA 4HETA 2VMFA 1KJRA 3IMMA 1PMHX 4QHZA 1YQCA 4GH4A 2R042 5DUWA 2ADEA 3ZSMA 1PO22 4NIHA 4CEYB 4EN6B 4TWTA 2WO7A 3GJAA 2QZ2A 4TSVA 1KITA 1AR83 2WO1A 2OZ6A 3M4FA 1JZ5A 2Y34A 1SCRA 4N9IA 3P1IA 5FK7A 2YHJA 3WLUA 4B8EA 5CAZA 1RL3A 1VRH3 3RZMA 2WABA 4HVQA 4PDWA 5FOBB 4YW5A 3R05A 1X9PA 5A6QA 5IUQA 1REEA 1KFUL 2HWE3 2Z2SB 1JYCA 4V2VA 3TN91 5JSRA 1QJX2 4CXXA 1UXXX 4Q2FA 3AP6A 1GZCA 1VBB1 3ZYJB 2VXJA 4YVSB 4CEWC 1OH3A 4FPOB 3V64A 4NPMA 4JDNA 1IS6A 1OQ1A 1DGRA 2P2KA 4NHMA 1N47A 2WA4A 3UYJA 1VRBA 2D6LX 2JG9A 2VZOA 1C8M2 1VB4A 1WD3A 4MADA 1EAH1 3VV1A 1RUJ3 4JHZA 4TLFA 4MYEA 1FPN3 1KJLA 2PHUA 1W6QA 2IC1A 4QX1A 5IT6A 4W6XA 5FYUA 2VNRA 2Y33A 3D0SA 3FHAA 1SEFA 3R4DB 4LO7A 2ZJCA 2O14A 2XKPA 5CB7A 1ACCA 2ID4A 2Q1FA 4YG0A 3PLQA 4QT6A 5F5QA 2ZGTA 4LK7A 3UL2A 5FXWA 3WP6A 4LR4A 1PO23 1PZ9A 3QCWA 1BKZA 1LOAA 1U12A 2AYHA 5DMYA 1CJPA 5C8CC 2A3XA 1NZIA 1NA1C 1LHUA 1KGYA 3SKJE 2E53A 5FP8A 5GZCA 2VZ1A 3V0AB 2WNVA 2PFWA 4MXWB 5IFTA 3O0XA 2HEWF 3ACHA 3BOPA 4XFAA 1OFNA 4AHWA 2ZGOA 1X8MA 2BW8A 1S0IA 1FATA 3I3DA 4M00A 3ZFGB 1VJ2A 2F6BA 4NHLA 4WM7C 4YW4A 4C8DA 4QGMA 4CPBA 2YC2A 3LF7A 5JIAA 3OGJA 2K2SA 5FZKA 2BGOA 1BXHA 2QFEA 3HVDA 3HQUA 2VQ0A 5D8AB 1GUIA 1UMHA 3ZFFB 3UJQA 4XJ8A 3Q8EA 1ODMA 2D3RA 4LO8A 1S2KA 4EZHA 4QM8A 3HWJA 2GC2A 2RR11 4FVVA 4LKFA 3VBRB 1C8M3 4QQLA 4IEWA 4J1XA 1LEMA 5FXXA 3ZFEA 1EUTA 2P4EA 3WP3A 4ASMB 4IW3A 2V73A 4SBVA 3O14A 4R9AA 3ZSLA 1RUE1 4FPEA 1DLCA 3OPTA 4QX7A 4XMIA 1OLME 4B4PA 3VZJA 2BGPA 1HJFA 2UYBA 5KHIA 5I0UA 3SCFA 2DCTA 4RS5A 3WQBA 3KD4A 1ALYA 3OGRA 1ZZBA 1XOYA 1S4CA 5C4WB 1HRV1 3RGBA 2NP0A 3AKPA 4WVMA 4AVCA 2IXJA 4XFFA 2DCZA 5HI0A 2PN5A 4EN0A 4OVEA 2YDEA 2P3JA 2VZSA 4CTEA 5B4XA 1DQ2A 3PTRB 2P3YA 4FP3A 1CPNA 3FMGA 5FY7A 2V09A 1JYIA 1MS1A 2Y64A 3NNJA 1TMF2 4AQTA 5CKQA 3O1TA 1V9U1 3UETA 4LOTA 2AGSA 3MHZA 1REFA 1XNAA 1KS5A 5L7OC 4K1YA 3NW4A 1F4AA 4HLTA 5FZ4A 3UT0A 1PGSA 1WW5A 4X6RB 1K12A 3DN7A 2WFPA 3M7AA 5FZOA 1LOFC 3NMBA 1XRUA 2AENA 2QDRA 2BPA2 1L7QA 1QQP1 4XOGA 5J48A 3J7MA 1HQLA 3W21A 4BMBA 2HBTA 5T5PA 3MIBA 4H2AA 2W87A 2B7YA 3KQ4B 3H50A 2ZX0A 3DPRA 4E4DX 4UI9L 2E33A 2JE9A 2W47A 5FY8A 5BPXA 2EAAA
chains in the Genus database with same CATH topology
4Y5TA 5L9RA 5LBCA 4NHYA 5EP9A 3DKQA 2JIJA 2Y33A 3KT4A 5HV4A 2RDRA 3W20A 5ERLA 4BQYA 4XCBA 3NNFA 3NNMA 2FCVA 3BVCA 3GJBA 5DAQA 5IATA 5LBEA 5IAXA 3OUJA 3KT1A 5DAVA 5L9VA 2FCUA 4NHLA 4MHRA 4MHUA 4ZONA 4XCAA 4XC9A 2JIGA 2V4AA 3HQRA 3HQUA 5C5UA 5HV0A 2FCTA 5EPAA 5DAPA 5LATA 3OUHA 4Y5SA 4IW3A 4ZPIA 5C5TA 2G1MA 5LBFA 3KT7A 2RDQA 3EMRA 3OBZA 5IAVA 5L9BA 5EQUA 2HBUA 3MGUA 2OPWA 4Q5OA 2RDNA 5LA9A 2G19A 4NMIA 3NNJA 5DAWA 3PL0A 4KBZA 5A3UA 3OUIA 3NNLA 4NAOA 3GJAA 5M0TA 4XABA 2Y34A 4JZRA 3GZEA 4BQWA 2A1XA 2RDSA 4NHXA 2RG4A 4XACA 4NHKA 4J25A 4UWDA 5LB6A 3W21A 2HBTA 5LBBA 4XAAA 5DAXA 4BQXA 4NHMA 3ITQA 5LASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5T A;  5L9R A;  5LBC A;  4NHY A;  5EP9 A;  3DKQ A;  2JIJ A;  2Y33 A;  3KT4 A;  5HV4 A;  2RDR A;  3W20 A;  5ERL A;  4BQY A;  4XCB A;  3NNF A;  3NNM A;  2FCV A;  3BVC A;  3GJB A;  5DAQ A;  5IAT A;  5LBE A;  5IAX A;  3OUJ A;  3KT1 A;  5DAV A;  5L9V A;  2FCU A;  4NHL A;  4MHR A;  4MHU A;  4ZON A;  4XCA A;  4XC9 A;  2JIG A;  2V4A A;  3HQR A;  3HQU A;  5C5U A;  5HV0 A;  2FCT A;  5EPA A;  5DAP A;  5LAT A;  3OUH A;  4Y5S A;  4IW3 A;  4ZPI A;  5C5T A;  2G1M A;  5LBF A;  3KT7 A;  2RDQ A;  3EMR A;  3OBZ A;  5IAV A;  5L9B A;  5EQU A;  2HBU A;  3MGU A;  2OPW A;  4Q5O A;  2RDN A;  5LA9 A;  2G19 A;  4NMI A;  3NNJ A;  5DAW A;  3PL0 A;  4KBZ A;  5A3U A;  3OUI A;  3NNL A;  4NAO A;  3GJA A;  5M0T A;  4XAB A;  2Y34 A;  4JZR A;  3GZE A;  4BQW A;  2A1X A;  2RDS A;  4NHX A;  2RG4 A;  4XAC A;  4NHK A;  4J25 A;  4UWD A;  5LB6 A;  3W21 A;  2HBT A;  5LBB A;  4XAA A;  5DAX A;  4BQX A;  4NHM A;  3ITQ A;  5LAS A; 
#chains in the Genus database with same CATH topology
 3DV8 A;  2GAU A;  3P3N A;  3S57 A;  2ZA9 A;  4YNI A;  3O12 A;  1NCQ A;  5KC6 A;  4LO6 B;  4QMA A;  1XE0 A;  1OA3 A;  2VQU A;  4HKO A;  5BNN B;  2JIJ A;  3OBA A;  2CTV A;  4CUC A;  5JOY A;  2J1R A;  3MLK A;  4A45 A;  2FZ2 A;  4QWN A;  4ITC A;  1EYB A;  1MR5 A;  2QE3 A;  3WNX A;  3LEK A;  4KQ7 A;  2ZZJ A;  4LUK A;  4UFL A;  5C71 A;  4LBK A;  1S0G A;  2P3K A;  2PQQ A;  2RS1 1;  4NWV A;  1QY4 A;  3VGI A;  4Y4R A;  1W8Z A;  1YO8 A;  4S2H A;  2WDB A;  4CCC A;  3IPV A;  4QU2 A;  1OBN A;  5FMO L;  4IEY A;  2HWB 1;  4CXW A;  4MGK E;  1SG3 A;  2R06 2;  4O9E A;  2LAL A;  4XFB A;  1EP0 A;  4CDX C;  5GJ6 A;  1GP6 A;  1SLC A;  1DHK B;  1UX6 A;  1DZQ A;  4R4Z A;  4XYX A;  5HPO A;  3A0K A;  1O7F A;  3AYE A;  1ZZ6 A;  2WZR 1;  4UAP A;  5FUN A;  4WZF A;  2VY0 A;  2VNV A;  4Y3O A;  5I8T A;  4K9S A;  1DGL A;  5C7G A;  5HV0 A;  4MZU A;  1PK6 C;  5A32 A;  4N53 A;  2JDM A;  3O1U A;  1OF3 A;  1GZW B;  2H6C A;  4BME A;  3LEM A;  1LJ7 A;  4DY5 A;  5IVF A;  1AXY A;  3AB0 A;  1QOS A;  2C9A A;  4FXK B;  1H2M A;  4AGR A;  2W0X A;  4I3G A;  4D7T A;  4CDQ C;  1VAV A;  5A7W B;  1ZZ8 A;  3F2Z A;  3JUU A;  1CZS A;  2W1W A;  4IEQ A;  2RS3 2;  4N8M A;  4AWD A;  3BAL A;  3R0R A;  1XU1 A;  4OMD A;  2ARA A;  1UWW A;  1XNT A;  4QPI A;  2XDV A;  4QKN A;  4U2A A;  1PVC 2;  2DCK A;  4FQ4 A;  2WL1 A;  4YGD A;  3I3E A;  2QQV A;  1W8W A;  3FZ3 A;  4M3C F;  3ZMO A;  5CNA A;  3N7L A;  3VBS B;  2ARE A;  5FQ0 A;  3CJI C;  2PHX A;  4OZO A;  1ZZC A;  2BOJ A;  3TEW A;  3V0B B;  1H8T B;  3T08 A;  4YW3 A;  2ORX A;  1W9F A;  2XQX A;  2MEV 2;  2R06 3;  4IGP A;  2VW0 A;  1NLQ A;  3N7J A;  1H1M A;  4BXF A;  3OUI A;  1YXW A;  3MIC A;  2OXB A;  2W1S A;  1JH5 A;  4HPK B;  1Y43 B;  3MIF A;  3GXU A;  3MW4 A;  3PVB B;  2ZX3 A;  3IKW A;  1W3V A;  1XB9 A;  1I6X A;  2CGN A;  2VVF A;  1RUJ 1;  1FPN 1;  4Y20 A;  5D21 A;  5I0T A;  2WLQ A;  2ZGU A;  4QAW A;  1W2N A;  2W08 A;  4BIF A;  4CU6 A;  5A1L A;  1LTE A;  1DZR A;  4RQP A;  2XH6 A;  4CVU A;  2Z4F A;  4B7K A;  2R32 A;  1OLM A;  4WVZ A;  4HMZ A;  1ND3 A;  4H7L A;  2R04 1;  3ABZ A;  5FZE A;  4F83 A;  1SBD A;  3LQC A;  5T52 A;  2RS3 3;  4F7Z A;  4GWI A;  5HCH A;  4HVR A;  1TG7 A;  1HW5 A;  5SV8 A;  4BQX A;  4YVS C;  5AC9 2;  3MZH A;  2I74 A;  1F5F A;  1PVC 3;  1YEW A;  2BDR A;  3RDI A;  5JSP A;  1AXK A;  3DGT A;  3TWI A;  3IDB B;  4DQA A;  5LZ6 A;  5EWS A;  1JS9 A;  4I3P A;  3RMY A;  1HDK A;  4BE3 A;  1RB8 G;  4FPC A;  5LEJ A;  3NQH A;  5EP9 A;  3VL9 A;  1ULE A;  3ZKU A;  1R08 2;  4XF9 A;  3O1P A;  5ANN A;  2YYO A;  1H9P A;  5EV7 A;  4NRQ A;  3ZN5 A;  3MW2 A;  3USU B;  2EIB A;  5HV4 A;  1QJX 1;  1CGP A;  4UFJ A;  1ZM1 A;  2MEV 3;  2YC0 A;  5FZA A;  4BQY A;  1L7L A;  1SPP A;  1W6M B;  2AUY A;  2GNT A;  3UJO A;  2CGP A;  1BMV 2;  3TEX A;  2DVB A;  5E6H A;  1F4H A;  1SLL A;  2QQM A;  4XIO A;  1GQG A;  1RUC 1;  1LOC A;  2A6X A;  2LRP A;  1C8M 1;  1LKN A;  5T50 A;  4M3C E;  3RS6 A;  5T5J A;  4RD7 A;  5JR7 B;  4AOC A;  5A3W A;  3T2T A;  3M2M A;  2WRA A;  4LBL A;  2YU1 A;  2ZZQ A;  5FLH A;  5JVV A;  5FBJ A;  1SCS A;  4DNY A;  1S0D A;  3FBM A;  5GLT A;  3ZXG A;  3VD4 A;  4YZ1 A;  5J37 A;  2YC4 A;  4D69 A;  3RZL A;  4LHN A;  3WNM A;  3ZFG C;  1GV9 A;  4GH4 B;  4ZHN A;  4B1M A;  2NN8 A;  1MEC 2;  2JDK A;  1E5I A;  2PLV 1;  4HL0 A;  4K6B A;  1I5P A;  5C5U A;  3PIG A;  2TBV A;  2VE1 A;  5CEH A;  1RJ8 A;  1VB2 A;  3E6B A;  1WLT A;  2DU0 A;  2JEC A;  1Z0H A;  5AC9 3;  2PHF A;  2D6N A;  3H3U A;  1GFF 2;  4FP2 A;  4Y1U A;  5D8A C;  3ZFF C;  4DFS A;  5CG9 A;  3NAP A;  2X05 A;  2VNO A;  4PDW B;  3O0W A;  3VBR C;  3IBM A;  2IVI B;  3AP9 A;  3LA3 A;  5EIY B;  1X82 A;  1R08 3;  2OPK A;  1BK0 A;  2A6V A;  4DOU A;  5F39 A;  3VZM A;  4BB3 A;  1IOA A;  1CQ9 A;  2WT0 A;  1UX7 A;  2VVD A;  2WII B;  1MZF A;  1OOP C;  2HWC 1;  2WQ8 A;  3OBR A;  4W4Z A;  1NG0 A;  3UGG A;  1LEC A;  4CZS A;  5T5L A;  2EA7 A;  4ASL A;  4LKS A;  1POV 3;  5FCC A;  4AVA A;  1A8M A;  1I9R A;  1LES A;  3NV4 A;  3R4U A;  2B9V A;  3ZXL A;  5C4W C;  2ZBJ A;  1HXS 3;  1QXR A;  2JG9 B;  3A22 A;  1QDO A;  4HBN A;  4GWN A;  4FTB A;  2I45 A;  1BJQ A;  1D2Q A;  3ZOI A;  2XUE A;  3P6B A;  3K3N A;  1W6Q B;  4FOV A;  3NVC A;  4UFH A;  1QKQ A;  3RZJ A;  2HYX A;  4YWA A;  1G9B A;  3BOD A;  4M01 A;  1H8V A;  3JD7 2;  1IHM A;  1MEC 3;  2WZP P;  3VZO A;  2NYY A;  5D1I A;  5LRR A;  2YGL A;  1OKQ A;  4W6W A;  4Q8L A;  5FZ6 A;  1W9S A;  3JB4 C;  4B7E A;  2ADD A;  2CWS A;  3RYK A;  1D0H A;  1XYO A;  2E7A A;  4H7M A;  4XPV A;  4DRR A;  2KR2 A;  2WNV B;  3RZK A;  3QLQ A;  4URT A;  3KHB A;  4B1L A;  5FPV A;  1SFP A;  1DQ0 A;  4IV3 A;  5T55 A;  3WUD A;  3WG4 A;  1X36 A;  4BZ4 A;  3WG3 A;  1CAV A;  1TMF 1;  3OG2 A;  2DUO A;  3V56 A;  3VD9 A;  2IZW A;  2C24 A;  3K4D A;  1WCQ A;  4GJY A;  5FUI A;  5LAS A;  2MPF A;  3D0J A;  4XAE A;  2SBA A;  2WA3 A;  3GM8 A;  1NE6 A;  2IXC A;  5L9R A;  1NQJ A;  2QQO A;  1LAJ A;  2YUE A;  1WLW A;  3G7D A;  1OUR A;  3POW A;  4UW3 A;  2DVF A;  4JGZ A;  3CBN A;  2VUD A;  1VMJ A;  1YFY A;  4QX8 A;  3UGH A;  2VH9 A;  1I5Z A;  3ZFE B;  2YRO A;  1K45 A;  5ABJ A;  4ES8 A;  2BNO A;  4D7S A;  5I8Y A;  3AZW A;  3DXU A;  4IV1 A;  1QJU 1;  1QMJ A;  5FZB A;  3PJY A;  2EID A;  3ZMN A;  3SNM A;  3WHU A;  1UMZ A;  2ZTN A;  1W9Y A;  2EIC A;  1P8J A;  1SMV A;  3NNF A;  4XBL A;  4RS5 B;  2GC1 A;  5KHK A;  1AR7 2;  1D4M 2;  2JDU A;  4GA9 A;  1OC1 A;  3KSC A;  4LUM A;  5IW0 A;  4LA3 A;  4QX2 A;  4WVM B;  3W9A A;  1O6U A;  1GR3 A;  2BP6 A;  3S7I A;  3ZX7 A;  2ZGP A;  5FBZ A;  2KD7 A;  2UY8 A;  2ZAC A;  4UW4 A;  2G9Z A;  4QQH A;  3TEZ A;  4P00 B;  2Y38 A;  5JUV A;  5GLZ A;  5FO9 B;  2ZHM A;  3FHI B;  4P08 A;  1CAU A;  2F17 A;  5FYS A;  5FFO C;  1AHS A;  1E57 A;  4XIL A;  2WNO A;  2XJR A;  1FYU A;  2R07 1;  2OT7 A;  2WYS A;  3GGL A;  4HZF A;  5F6L B;  2LRO A;  3S30 A;  2DCY A;  4OZX A;  5FJH A;  3WZ1 A;  2YV8 A;  3C7O A;  2BVV A;  2A70 A;  4FCA A;  2VG9 A;  5F37 A;  1OXC A;  4FOY A;  5FZO B;  1ZBE 1;  1MPX A;  1WLD A;  2ZCW A;  2FDJ A;  2R06 1;  4KU7 A;  4AQ2 A;  2DFC A;  2NLR A;  3D4K A;  3M3Q A;  1ST8 A;  3WW3 A;  3N7K A;  4E4H A;  1A3K A;  1S2B A;  2ARB A;  1O3T A;  4CU7 A;  1MQT A;  2BJS A;  1JZ6 A;  4LLF A;  1QOT A;  3KCX A;  4NAM A;  3ROU A;  3DPR B;  5FTT C;  5C70 A;  4BPZ A;  5FZC A;  3BTY A;  1GWK A;  2VZV A;  2WS9 2;  1BYH A;  2Y8K A;  3IZO A;  2Q8C A;  4N43 C;  4Z1V A;  3HBK A;  4R8H A;  1AR7 3;  1D4M 3;  1N1Y A;  1ULO A;  5FPB A;  4QHO A;  1NCQ B;  1GLH A;  3MW3 A;  3VBS C;  3LDR A;  4Y4Y A;  2QQP A;  1LGB A;  2OPW A;  5A7Q A;  1PNG A;  4EE2 A;  3BTZ A;  1H8T C;  5FXV A;  2W9X A;  4ZU7 A;  2RS3 1;  2B9U A;  4IDZ A;  2E26 A;  1YQ8 A;  3NNL A;  4HG6 B;  4CUG A;  3ILN A;  4Y1Z A;  3DF0 A;  2NQY A;  4AI1 A;  3O1M A;  1XE8 A;  1LU1 A;  2DUQ A;  1QNY A;  3GZE A;  1KDK A;  3K46 A;  3U1X A;  3DCQ A;  3GHM A;  4NPL A;  4YW1 A;  5DZE A;  3CF6 E;  1O8S A;  3LCP A;  2ZEX A;  1YLL A;  1MS8 A;  3IPV B;  2XOM A;  4NHK A;  4J25 A;  4RHV 1;  1RIN A;  1Z7S 2;  4D0Q A;  3T3Y A;  1VBA 1;  1V6J A;  4OHW A;  3VKL A;  3OGS A;  2K46 A;  2MEV 1;  4HOO A;  1ZZ7 A;  3APB A;  1QEX A;  4FAG A;  1LOE A;  3ASI A;  2CHH A;  1T2X A;  3ME2 A;  1AYN 2;  2JDP A;  5KXB A;  2XG3 A;  4FFG A;  5IWF A;  4ZS2 A;  2FHR A;  2PTM A;  3PMS A;  2JG8 A;  4GMP 0;  4XEZ A;  4N53 B;  5A32 B;  3T1L A;  3WW1 A;  2WS9 3;  4C0B A;  2FDI A;  2XON A;  4Q0U A;  4XQW A;  3PHM A;  2CL2 A;  3UNP A;  4P9W A;  4A6S A;  4HK8 A;  1MAC A;  1RMU 2;  1Y9M A;  5JXH A;  2XUM A;  2VUL A;  3AZY A;  4RGA A;  4AFD A;  4DUW A;  1KD7 A;  5DZF A;  4BM8 A;  5JMC A;  4HN0 A;  4B29 A;  1QJZ A;  5AVP A;  4QPI B;  2AZ5 A;  2GZW A;  2P1B A;  2AAC A;  1PZ7 A;  3AZV A;  1BVV A;  4ZXE A;  2XKO A;  4NID A;  3ZN6 A;  5AC9 1;  1H0B A;  4OUE A;  1WBF A;  4DXT A;  4IGQ A;  3B01 A;  4LBQ D;  4LKD A;  5FQ0 B;  5H9Q A;  4GMP 1;  4AFC A;  1WKY A;  2FCU A;  3AP7 A;  3GF6 A;  4XQD A;  2AR6 A;  4HVO A;  3ZXD A;  1YWK A;  1Z7S 3;  3NKT A;  4K40 A;  3WX5 A;  4E8C A;  2ZHK A;  3CZJ A;  1LEN A;  3DEC A;  4XCA A;  2JIG A;  2X5I A;  2A6Z A;  4GH4 C;  4I09 A;  4GWM A;  4A44 A;  3LIH A;  2XQR A;  4LBM A;  4QHB A;  1BMV 1;  4QU1 A;  5JZG A;  4OHX A;  4AI3 A;  5FAX A;  5EXO A;  1WMF A;  4Y20 B;  2YY1 A;  3B02 A;  2BOI A;  4Y5S A;  3TYJ A;  4LT5 A;  3M3O A;  4RQP B;  3T2O A;  2QQW A;  2QQI A;  4PDW C;  3B3Q E;  3OCP A;  1KFX L;  1ND3 B;  1W2O A;  3DEM A;  1RMU 3;  3PDQ A;  4H3W A;  2E63 A;  1XSQ A;  1MVE A;  5DUX A;  1IPK A;  1MEC 1;  2A73 B;  5FPZ A;  5HCB A;  2XB6 C;  4XFC A;  4FQZ A;  4EYU A;  4OCT A;  5HXM A;  4DEV A;  2BNM A;  2JDY A;  1J1T A;  1HX6 A;  2CSG A;  2D43 A;  2VO5 A;  2XJS A;  1WBL A;  3MGU A;  4UYB A;  4P02 B;  4K21 A;  4KNC A;  2RDN A;  4IXL A;  3WF0 A;  2YFU A;  1FNZ A;  1W90 A;  2ATF A;  5CU1 A;  2BGC A;  4KBZ A;  5A3U A;  4I2O A;  5BV6 A;  1RXF A;  1B09 A;  4LUL A;  1IKP A;  3ZXA C;  3TEY A;  2VZQ A;  4JZR A;  1UKR A;  1NE4 A;  3POG A;  4Y33 A;  4CDW A;  1EV1 2;  2VMD A;  4CP9 A;  3U78 A;  3VBF A;  1HRI 2;  4Z2W A;  1DQ4 A;  1LHO A;  2ZX1 A;  4LEJ A;  4MUV A;  2D6P A;  4FPG A;  4CYD A;  2KXL A;  2RJL A;  4DO0 A;  4TYS A;  3POE A;  4LNV A;  3WF2 A;  3LD8 A;  2VZU A;  3QD6 A;  3HT2 A;  3ZSJ A;  2WNV C;  5LW9 A;  1IGO A;  2AC1 A;  4GKY A;  1UCX A;  4HKW A;  3WXP A;  3EHK A;  1GSL A;  1IG0 A;  1UOB A;  3PUR A;  4OYU A;  4R4X A;  1RUO A;  5LCW L;  3VDD A;  4AQS A;  1JOB A;  1Q56 A;  5A1F A;  1R1A 2;  3IM0 A;  3SIT A;  1G9A A;  3JD7 1;  5F3G A;  3RRD A;  1UNB A;  3O1O A;  1D7P M;  3CMG A;  4DXZ A;  4MLO A;  3J26 N;  2EAK A;  5EJZ B;  5I0R A;  2WWS A;  3NAP B;  2NPI A;  3JCI A;  3N9O A;  1CR7 A;  1Q3E A;  2ARC A;  4MGS A;  3U0Z A;  3ZFE C;  3I2F A;  1JZ7 A;  5ERL A;  1CAW A;  1NOV A;  2EXH A;  1RVF 2;  1ZNP A;  3MDP A;  2I2S A;  4IGO A;  4KH9 A;  4NRO A;  2X8K A;  1A78 A;  1CZT A;  4AQ6 A;  3UGF A;  3UES A;  3CNA A;  1V6K A;  2ORZ A;  3D82 A;  4KGG A;  3KCC A;  3VKF C;  4QDQ A;  1VIW B;  4RS5 C;  3IT8 A;  1EV1 3;  3HT1 A;  3KGZ A;  4AR2 A;  1HRI 3;  2JE7 A;  4XDP A;  1NUK A;  4AHZ A;  4GJZ A;  2RE9 A;  3WSO A;  2XJU A;  3WG1 A;  2JKB A;  4BIO A;  5KWR A;  3Q8A A;  2VR4 A;  4IND A;  4DXS A;  2HH9 A;  5A3L A;  5JLV A;  4E2G A;  1BLZ A;  3FC0 A;  3N9Q A;  3I2I A;  3DYO A;  3RFR A;  2GMP A;  4DIQ A;  3MEP A;  4XJ9 A;  2A6W A;  4IUG A;  1NAE A;  2A75 A;  2GU9 A;  1RTV A;  4CPB D;  3KLS A;  4FPJ A;  2BEO A;  5JXJ A;  1JMU B;  1AR7 1;  1J84 A;  1R1A 3;  2ERF A;  1D4M 1;  4MO3 M;  3T0B A;  2RJK A;  2QBX A;  3BB6 A;  1DGW A;  4PLO A;  1C28 A;  2YFZ A;  5FZ9 A;  3D8C A;  2DTY A;  5FMO S;  5CIS A;  2R6Q A;  1BEV 2;  4ZPI A;  3GZA A;  5J7M A;  4KWU A;  2VOK A;  2W2I A;  4IV3 B;  5FWE A;  2G1M A;  1ENX A;  1TZO A;  3FJS A;  1DU3 D;  4CCK A;  3AJY A;  1CAV B;  4O9G A;  3PUA A;  1RVF 3;  1ULP A;  4CCD A;  4G3Y C;  3BIE A;  3AL6 A;  4OLL A;  1YFW A;  4NE9 A;  4ARY A;  5FO7 B;  5L9B A;  1RGS A;  3O1S A;  3KF5 A;  3DPR C;  5BY5 A;  3I3B A;  5LA1 A;  4DEQ A;  4JGZ B;  2TNF A;  1NCQ C;  4FBF A;  3K77 A;  3E5U A;  4HFS A;  4W8J A;  5IVY A;  4FT8 A;  2H0B A;  2HEY F;  5SV5 A;  4UW5 A;  2E9Q A;  3KWV A;  4BCU A;  4Q4W 2;  5C3O A;  5ABJ B;  4AFB A;  4COZ A;  3A21 A;  1W99 A;  5JR2 A;  4IV1 B;  5GAL A;  1UAI A;  4XFI A;  2VOW A;  1NCR A;  3VBO A;  2GC0 A;  3WW4 A;  2WWJ A;  1QDC A;  4P9I A;  4ZKT B;  4BLJ A;  2QCS B;  4Y22 A;  3VUO A;  5KHH A;  1G7Y A;  2CDP A;  3O7O A;  4YM1 A;  4TZD A;  4GWJ A;  3ZYF A;  1FXZ A;  4A3Z A;  2WS9 1;  5FZF A;  1GKB A;  5CIR A;  5A80 A;  3IDE A;  1AJK A;  2BUK A;  2FZ1 A;  4LIT A;  4XF3 A;  3AMH A;  2YZ4 A;  2BFU L;  3CEW A;  1K5M A;  1XE7 A;  5EJ3 A;  2TUN A;  3JBG 2;  4RR3 A;  1BEV 3;  1RUI 2;  3LIG A;  1KS4 A;  3CO2 A;  4XE9 A;  2ZEZ A;  5IVB A;  3BCW A;  4IL7 A;  5AFB A;  3ELN A;  1CAU B;  2Y6J A;  4LLO A;  3WT3 A;  4AEJ A;  2A3W A;  1YC6 1;  3LDK A;  5CFD A;  5FKB A;  3QAC A;  4LTA A;  2PHL A;  1QJY 2;  1GOH A;  3RQ0 A;  1B35 A;  2VGD A;  4N53 C;  3C7F A;  5FZ7 A;  5F3I A;  4BQ5 A;  4MGZ E;  3VHR A;  4F8A A;  2RDR A;  2VUA A;  2XWB B;  3IN9 A;  4QB6 A;  1DG6 A;  3LKJ A;  4CCM A;  3E6C C;  1NY7 2;  4QKB A;  3GBW A;  5I8S A;  4A7K A;  1MQT B;  4Q4W 3;  4X8P A;  1DQ6 A;  3AMP A;  3GJB A;  3VBH A;  5LA0 A;  4XJW A;  1H1A A;  3PVN A;  1AYN 1;  4QPI C;  3VBU A;  3VKN A;  4CA9 A;  4QB2 A;  4OUS A;  3B93 A;  5LBE A;  4TXW A;  3OJB A;  3RYP A;  5IK5 A;  3VKO A;  2QJV A;  3B69 A;  1SHW B;  1XNC A;  4W65 A;  3N4M A;  3HR9 A;  5L9V A;  5CYY A;  4NVP A;  1ZA4 A;  4UOJ A;  1J3Q A;  3WDX A;  2P6H A;  1D0G A;  1GQP A;  3I54 A;  4YW7 A;  4BA6 A;  2EIE A;  1LR5 A;  1WW6 A;  3IDA A;  2OS2 A;  3OPZ A;  5GZE A;  5JXI A;  2WSU A;  1JXN A;  1UZV A;  4Y1Y A;  3TNQ A;  1FX5 A;  3RI9 A;  1QOO A;  4AEK A;  1LB2 A;  3HQR A;  2P37 A;  3JBG 3;  1HIX A;  1RUI 3;  1W2U A;  2RHP A;  3ZIX A;  4JDM A;  3TB0 A;  2W39 A;  4Y26 A;  1MS9 A;  2JB8 A;  4ASK A;  4CDU A;  2C26 A;  4KBB A;  1TVG A;  4JDO A;  3RJR A;  2CYF A;  2XML A;  1OFS A;  3CKH A;  4Y24 A;  2AH2 A;  5DAP A;  5I0S A;  5J96 B;  3NST A;  2O1Q A;  1WW7 A;  2XJT A;  1G9F A;  1QJY 3;  3E6D A;  4Q1R A;  3ZYP A;  4BK4 A;  2W91 A;  5FWJ A;  3VDB A;  5KHJ A;  3CJX A;  1VBC 2;  1VMF A;  5GKA C;  1UQX A;  1WCD J;  2Z42 A;  3SHR A;  4FPY A;  2OUH A;  4CRQ A;  1JOJ A;  3D6E A;  4RQP C;  1IS3 A;  1ASJ 1;  1UOJ A;  3RZZ A;  3WR0 A;  1MS5 A;  3GCW A;  3KT7 A;  3AVS A;  4RFR B;  5IHR A;  1ND3 C;  5C3S A;  1F15 A;  2BER A;  5F7U A;  3GHN A;  2J1T A;  1W28 A;  3RPQ A;  1PO1 2;  3JU9 A;  2V72 A;  5IAV A;  4AHY A;  5F8P A;  2WAO A;  2JG8 B;  3AMN A;  4IE0 A;  1NKG A;  3BKZ A;  1WA4 A;  2VAU A;  5LA9 A;  4IEX A;  2DDU A;  2SLI A;  2WZ8 A;  4XW3 A;  3BN6 A;  3NJV A;  5DDJ 2;  1LUL A;  5JI9 A;  5JCT A;  2VVE A;  4LXL A;  2WN2 A;  4A6O A;  2VCB A;  4XAB A;  4YAR A;  5IK8 A;  2D44 A;  3LSD A;  4HK9 A;  2B5H A;  3SH3 A;  5DG1 A;  1TME 2;  3ST7 A;  3T1M A;  5F5A A;  4I02 A;  4AED A;  1AR8 1;  2A1X A;  3CU7 A;  4YGC A;  3QH6 A;  4XUP A;  4NHX A;  2P17 A;  4GIQ A;  3ZN6 B;  2WNE A;  1X7N A;  1FOD 2;  1X33 A;  2VW1 A;  4H14 A;  5FXZ A;  1VRH 1;  2N7G A;  1Q8S A;  4Q4Y 2;  5F2W A;  5A6X A;  5KXD A;  3BUC A;  3RJ2 X;  4JQR A;  1X9T A;  2Q4S A;  2A5Z A;  1VLN A;  2VD7 A;  3N9M A;  3P5B A;  4DZG A;  2HWE 1;  1VBC 3;  1F5J A;  1OI6 A;  4NN0 A;  2PHT A;  1O3Q A;  1HLC A;  4QGL A;  3SH5 A;  4CU9 A;  1OD3 A;  3R6S A;  3I3M A;  4XXP A;  4IER A;  4KWJ A;  1LED A;  1XND A;  2EAL A;  5LA2 A;  1W8H A;  4BK5 A;  2X5I B;  4COY A;  3OEA A;  2O0O A;  4J1W A;  2MHF A;  4COV A;  2C4X A;  5GLW A;  4XF4 A;  5C6C A;  1EV1 1;  4CEY C;  3S0M A;  1HRI 1;  1GP5 A;  1YJL A;  4FO9 A;  1PO1 3;  1C5H A;  3TBD A;  1AZD A;  5JZG B;  3E5Q A;  3GAL A;  3I2D A;  3MYX A;  2CY6 A;  5FRE A;  3RMX A;  2VEC A;  4E2S A;  1JW6 A;  3NAP C;  1H2K A;  5A7S A;  2IUW A;  2QTW B;  3WW2 A;  1IQA A;  2DV9 A;  4XZU G;  4Z2A A;  1H1I A;  4FPF A;  5DDJ 3;  4YW2 A;  2PHW A;  1W04 A;  4RFT 0;  1Q8V A;  3RZG A;  2D3P A;  1GNH A;  5FOJ B;  4EN8 B;  2VPV A;  4YM3 A;  1PO2 1;  5T54 A;  4Q29 A;  1POQ A;  3MLJ A;  3WQ0 A;  1TME 3;  3JXS A;  4AAX A;  5DN2 A;  3CL1 A;  4AEM A;  4BQ1 A;  1TE1 B;  5LRS A;  2WYF A;  5TSW A;  2R1D A;  3WF1 A;  5CBL A;  1FOD 3;  4DPN A;  1G9C A;  3O5S A;  4P14 A;  3T4V A;  1V6O A;  2QDN A;  4QXH A;  4PIY A;  2DU1 A;  2DVG A;  4Q4Y 3;  5E88 A;  2ZGL A;  1DQ5 A;  3LOB A;  2CGO A;  3B7M A;  4XC9 A;  4CCL A;  2W92 A;  1H4H A;  1WGP A;  3POF A;  4SLI A;  3POB A;  4URA A;  3T2Q A;  1J59 A;  3ZXE A;  1OPM A;  4I01 A;  3HD8 B;  3NRU A;  4Y5Z 0;  3HNB M;  3FN9 A;  4UF0 A;  4CDW B;  4CP9 B;  3VBF B;  1S55 A;  3FHQ A;  4H55 A;  3FLP A;  5LAT A;  4G9S B;  1HXS 2;  3I2G A;  4OQ8 A;  3K51 A;  1AF9 A;  1GP4 A;  2JD4 A;  1SDD B;  4ERO A;  2Z69 A;  1OD5 A;  2LUW A;  4Q0V A;  1NLR A;  1U5Y A;  4PIX A;  4MXV A;  5FPX A;  3PU8 A;  2OQ6 A;  1KRI A;  1OLQ A;  2AEY A;  5IK4 A;  5C5T A;  1CJD A;  2ZGR A;  1EUU A;  1QGL A;  4V2W A;  5FZH A;  4IV3 C;  4UFM A;  1RUG 2;  1R1Z A;  1O4Y A;  1MZ6 A;  4Z07 A;  3VDD B;  1AJO A;  3WNL A;  3THD A;  5A70 A;  3NL1 A;  4YG6 A;  3BIW E;  4AVT A;  4YLZ A;  2E7T A;  3S7E A;  1QWR A;  5B4N A;  2EXK A;  3L9J T;  1W9W A;  2UY9 A;  3GNE A;  2C9K A;  5FIX A;  3VL8 A;  4Z92 B;  4IET A;  5FK8 A;  4C90 A;  4QB1 A;  5A3N A;  1STM A;  1U5X A;  2XHN A;  5F32 A;  1BZW A;  3ACI A;  4A42 A;  2ZKN A;  5FRA A;  1W6N A;  5C9A B;  4Q0S A;  4XBQ A;  1RC6 A;  2QNK A;  1LNS A;  1N3P A;  2KM2 A;  3BTA A;  3MPP G;  4JGZ C;  3SEP A;  3VN4 A;  5J36 A;  1PIV 2;  3AXE A;  4D3W A;  5ABJ C;  3AXD A;  2DVD A;  3J7H A;  3LEI A;  3DL3 A;  1CAW B;  2CDO A;  5BNP B;  3KF3 A;  1S2E A;  4ZXK A;  4IV1 C;  3EXU A;  1RUH 2;  1QXJ A;  3I2J A;  4WM8 A;  3WP5 A;  1QH7 A;  2XJQ A;  4IQP A;  5F5C A;  5HBA A;  3AFK A;  3ZDV A;  3B5L B;  2DF7 A;  1UU6 A;  3EJK A;  2HLE A;  5FYC A;  3ENR A;  3HN3 A;  2WQ4 A;  1G8W A;  3AYA A;  3PUS A;  4AK3 A;  2BV4 A;  1N1S A;  1VR3 A;  5KXE A;  5IK7 A;  1RUN A;  4OFG A;  1AL2 2;  1AX0 A;  2CU5 A;  3MBW A;  2VM9 A;  2Y0I A;  3MIH A;  5JPM B;  4V1P A;  1FI2 A;  4L97 A;  4L11 A;  3I2K A;  3LEG A;  4YVW A;  2ZHL A;  1RUG 3;  3K2O A;  1OLR A;  1O5U A;  1ENS A;  1JYN A;  3KV5 A;  4CP0 A;  1LGN A;  1YCI A;  1ZBA 2;  4IEP A;  4UW6 A;  1PM7 A;  5GM0 A;  2ZOE B;  5G04 L;  2VJX A;  1Q8Q A;  5B2G B;  3TNP B;  3H7J A;  5K4L A;  3B9I A;  1CPM A;  3LAG A;  1GU3 A;  2E51 A;  2PAM A;  2R30 A;  1WZX A;  2WC2 A;  3OF1 A;  4I0W B;  4ZY9 A;  5DXD A;  1RUI 1;  3I7D A;  1XJA A;  1C57 A;  1PIV 3;  1CIY A;  5FMD A;  1GZT A;  5APA A;  1MQT C;  2I07 B;  3ZR6 A;  2QQU A;  4KMQ A;  2J7M A;  4AI2 A;  4HKL A;  4QXC A;  2Q8E A;  4XFH A;  1VAL A;  3WF3 A;  1RUH 3;  3AMQ A;  4QX0 A;  1SLT A;  1DYK A;  2Q5T A;  4XHB A;  3AYD A;  4UFK A;  3I59 A;  4M4P A;  5HXV A;  5JOW A;  2B42 B;  1L7R A;  2ILM A;  3FWE A;  3NNG A;  4FPL A;  5KC5 A;  5FZ0 A;  3OD0 A;  5FDB A;  4XQ4 A;  5J98 B;  5CFC A;  5K8S A;  1I3H A;  3D5O A;  4IEZ A;  5G05 L;  1O4Z A;  5BNN C;  1Q8P A;  2ZGS A;  1DDL A;  5IFP A;  1AL2 3;  1V6M A;  1DGR N;  1NY7 1;  2W1Q A;  4Q27 A;  4S2G A;  1NCR B;  3VBO B;  1V70 A;  4HAN A;  2D98 A;  4FI9 A;  3I49 A;  1FAY A;  1RHI 2;  4PLM A;  4Y22 B;  4PBO A;  2GAL A;  2D6M A;  1L3J A;  4YZ3 A;  1CX1 A;  4AHX A;  2DBI A;  1VBD 3;  5FZG A;  4A2U A;  3S6P A;  3VDC A;  3GYD A;  2ZGN A;  3A23 A;  1Q8O A;  4XF1 A;  2O8Q A;  1ZBA 3;  3OOX A;  3O1V A;  4KG8 A;  3CHX A;  3JB8 A;  3SXW A;  5GZG A;  2RJ2 A;  2Y6F A;  4LJH A;  1JYW A;  4KG0 A;  1EPZ A;  4JRL A;  1Y3T A;  1EAH 2;  1NT0 A;  4A3X A;  5J09 A;  1K5M B;  1BVP 1;  1IG3 A;  2RDQ A;  1ONA A;  3E1F 1;  3III A;  3J8F 2;  4RR3 B;  4EV0 A;  4MOA A;  3QH7 A;  1JU3 A;  4IES A;  2LM3 A;  4E27 A;  1U0A A;  5FYT A;  1UY3 A;  1S0F A;  1OOP A;  4QDS A;  3W59 A;  5ACA 2;  5KXC A;  5CFD B;  5JWP A;  4DUX A;  2GMM A;  3VKM A;  1QJE A;  2W52 A;  5IVE A;  1W9T A;  2VMC A;  3POJ A;  1B35 B;  2NMN A;  2WWU A;  3AYC A;  4N7U A;  1OPO A;  2D6K A;  2JG8 C;  3Q8F A;  4BQ3 A;  3MPB A;  4JKM A;  1XSR A;  3H8X A;  2WR9 A;  1VBC 1;  4C0H A;  2JIC A;  2ZKL A;  2XLG A;  1QHD A;  3PNA A;  3KGL A;  1QU0 A;  3F95 A;  4XDO A;  1W6P A;  3KV6 A;  3IMN A;  2VUJ A;  4BQW A;  2FBE A;  3IWZ A;  1UYP A;  5E8A A;  4LBN A;  2CNA A;  3VBH B;  4GXL A;  3VBU B;  1GWL A;  5KHG A;  4WZC A;  3HNY M;  1RHI 3;  5FP7 A;  5DUU A;  1RIR A;  3SLI A;  1S0J A;  4OMC A;  4D6R A;  2F4L A;  2VME A;  3MLL A;  4M3C A;  4LE3 A;  2ES3 A;  1GNZ A;  2BYV E;  1UD1 A;  3M3E A;  1AVB A;  2OX0 A;  1W03 A;  4MV2 A;  2RR1 2;  4UT5 A;  2PA7 A;  3HNM A;  2ET7 A;  4XIK A;  4ZZ8 A;  2Y0O A;  4CCE A;  1EAH 3;  1YQ5 A;  4K8F A;  2VTX J;  3RYR A;  4ATE A;  5IJR A;  2QUO A;  4PI2 A;  4E4S A;  2C6S A;  2OA2 A;  2VTX A;  3J8F 3;  1TME 1;  3ORJ A;  5HCA A;  1RUF 2;  3WY6 A;  2X5I C;  4CDU B;  1HKD A;  3C7H A;  4QGN A;  3WDU A;  1JUI A;  1N1T A;  1PVC 1;  1UO9 A;  5ACA 3;  2OUJ A;  5FV3 A;  4EJR A;  1YUD A;  3NV3 A;  1FOD 1;  2FDH A;  3VLB B;  2GSY A;  2ZPX A;  5FUP A;  5FY0 A;  5C3P A;  5JZG C;  3OPW A;  2C5D A;  4Q4Y 1;  3ETP A;  2EVX A;  1TNF A;  3W20 A;  4RA0 A;  2RS5 2;  1HB2 A;  4BHP A;  2DTW A;  1O3S A;  2J1A A;  3WQ1 A;  5FP3 A;  4LBO A;  4LIU A;  2ZHN A;  1CVN A;  2WIN B;  4LOS A;  4QX5 A;  1WCK A;  4Z8B A;  5F5I A;  1V00 A;  1CON A;  1UZW A;  2RV9 A;  3Q8B A;  4QD2 A;  5F1R A;  1X50 A;  3OGG A;  3OUJ A;  5GZD A;  2J1E A;  1PGW 2;  3J9S A;  3SKV A;  3VDA A;  4JVA A;  4LQR A;  4PBP A;  5K0U A;  1GOF A;  1JTZ X;  1W05 A;  2OQ7 A;  3AJZ A;  2YG0 A;  4XUT A;  3LB9 A;  3J7N A;  4MHU A;  2FDG A;  3HQX A;  2UWC A;  3EYP A;  3TOJ A;  4K3U A;  4M0H A;  3WD5 A;  4LMF A;  5K9Y A;  1CN1 A;  2VBP A;  2RM2 2;  2RR1 3;  2JDH A;  1WCS A;  3BTX A;  1F9K A;  2XLA A;  4NOT A;  5FP4 A;  3K48 A;  3PVE A;  1POV 0;  2C1F A;  1OUX A;  4AED B;  4NRP A;  5FPU A;  2HYK A;  3FL7 A;  4GAL A;  2D6O X;  1RED A;  1RUF 3;  4CDW C;  1UXZ A;  3VBF C;  2YMZ A;  3RNS A;  1ULG A;  2JB4 A;  1WMX A;  5KBF A;  1LGC A;  2B4K A;  2Q0A A;  4NIG A;  5FY1 A;  1U5I A;  1VE0 A;  2Q8D A;  3EO6 A;  1R08 1;  4RSU A;  3WNN A;  2RS5 3;  5H9S A;  1JBC A;  1JHJ A;  3P3P A;  3R4S A;  4PT6 A;  3N36 A;  1QJF A;  2KA3 A;  2B8M A;  4NPR A;  5FLI A;  1HV1 A;  5DQ0 A;  4PQ9 A;  3MUZ 1;  3WNK A;  3WDY A;  3VDD C;  4NJ4 A;  2W1U A;  5CKN A;  3ZDS A;  1POV 1;  4CCN A;  2VL4 A;  2NZ9 A;  2Z79 A;  1W6O A;  3B00 A;  1S1A A;  3FUQ A;  4XUO A;  5FY5 A;  1PGL 2;  1HXS 1;  2A6Y A;  2DYC A;  3N3H A;  1IS4 A;  3BPZ A;  2RS1 2;  4N43 A;  4C1W A;  1G9D A;  1UZZ A;  1NZC A;  4I0A A;  3WUC A;  3BYW A;  1NLS A;  2BNN A;  2AEZ A;  3HOB A;  3UKV A;  4LK6 A;  4WV8 A;  3ZLI A;  1YQ2 A;  4WVW A;  1WD4 A;  2K9Z A;  2RMU 2;  1ND2 A;  1LCL A;  5L36 A;  1M06 G;  1RUG 1;  2ZMN A;  1H9W A;  4PF1 A;  1XXN A;  2RM2 3;  5FKC A;  5BNP C;  1CAX A;  2UWA A;  1DCS A;  4XHX A;  1O59 A;  5DPN A;  5FR3 A;  4OI2 A;  4QXB A;  3ILF A;  1W0P A;  4FPH A;  5FZ8 A;  3SC7 X;  4ZZ5 A;  1ENQ A;  3M8L A;  4E2Q A;  1SBE A;  5LEK A;  4DMI A;  1OVS A;  2VMI A;  1YFU A;  2VXR A;  3INA A;  1DGW X;  2F4P A;  4NO4 A;  4YSF A;  2GN7 A;  4LBQ A;  2VMH A;  5C3R A;  5BNO A;  1YYN A;  2JG9 C;  4AGG A;  4CCJ A;  3OY8 A;  1A8D A;  3AZZ A;  3OSD A;  1J58 A;  1E5R A;  1JYV A;  1PIV 1;  3K4A A;  3ITQ A;  3IB3 A;  5FPL A;  2Y6H A;  4Y5T A;  2FMY A;  3THP A;  5T3N A;  1RUH 1;  5LBC A;  3ZYR A;  5JOZ A;  2HKX A;  2G9F A;  4UF0 B;  1DYO A;  3WOG A;  2WT2 A;  4NUB A;  2GP3 A;  1JZ2 A;  4CSW A;  1QIQ A;  2HWD 2;  2NM1 A;  1Y9Q A;  4PHZ A;  4QPG A;  4GUL A;  4FSJ A;  2RS1 3;  1UPI A;  3GBG A;  4NWW A;  4IE7 A;  2DFB A;  4S2F A;  1O8P A;  4JGY A;  3SCG A;  3VD5 A;  5FP9 A;  2FD8 A;  3I8T A;  2BFU S;  2FCV A;  3M3C A;  2RMU 3;  2YU2 A;  3ACG A;  2PMW B;  4DRV A;  3URF A;  3VHP A;  1IKQ A;  3FFZ A;  3KM5 A;  1IQD C;  3BPS A;  2X09 A;  4DUV A;  1DQ1 A;  2Y26 A;  1LHW A;  1OVP A;  2XBO 2;  4CP2 A;  2YBK A;  2YPJ A;  1G86 A;  1LOD A;  3H9A A;  1GWM A;  3G6J B;  4JHT A;  4ZU4 A;  1U5Z A;  2XR4 A;  3GDB A;  4AI0 A;  1XYP A;  4ET7 A;  3RVH A;  1SBF A;  1W6N B;  3AZX A;  2IFW A;  3KQR A;  4I30 A;  1COV 2;  4OUM A;  4ZS3 A;  4ARX A;  5CAD A;  5C9A A;  1AX1 A;  1H30 A;  2Q1M A;  5JPN B;  2XL9 A;  5BUV A;  2V4V A;  5C8W A;  2BWA A;  4KL1 A;  1US3 A;  1RUD 2;  1NQD A;  2Y6L A;  3KMH A;  3ES1 A;  3ATG A;  4OHV A;  1ULF A;  1NCR C;  3VBO C;  2DUR A;  3EQE A;  2BVB A;  1DF0 A;  4WM8 B;  4GB3 2;  5AVA A;  4FTE A;  3H3Z A;  4QPW A;  1LOG A;  1ZX5 A;  2ZGQ A;  1GMM A;  4Q1P A;  2WN3 A;  2LS6 A;  1W8U A;  2GP5 A;  4K7J A;  4OI1 A;  1BBT 2;  1DBN A;  4YPJ A;  4PQQ A;  3M70 A;  5H9R A;  2JWP A;  1OA2 A;  1UY1 A;  1HN0 A;  2HWD 3;  2JEM A;  4L2N A;  1W3X A;  1NYW A;  3I2H A;  5FY9 A;  3VZN A;  4XXA A;  1UIJ A;  5JAX A;  1K5M C;  2QZ3 A;  4AYU A;  3H8U A;  4R52 A;  2ZAH A;  1DYP A;  4RR3 C;  5A1A A;  3MV1 1;  4AGV A;  1BCX A;  3VHN A;  4YVW B;  1H6Y A;  5HCF A;  1RHI 1;  4NRM A;  3K75 B;  3RWK X;  3OB8 A;  2WT1 A;  4BQ2 A;  2WBK A;  5CFD C;  4E9K A;  1NXM A;  1J1L A;  1RJ7 A;  3GZT B;  1F35 A;  1V6I A;  4W6Y A;  1N3Q A;  2IXL A;  4XUR A;  2XBO 3;  5EYX A;  1B35 C;  5BXX A;  4FTS A;  1V0A A;  3FE5 A;  1Z78 A;  4OI4 A;  2BRT A;  3WQ7 A;  1GYK A;  1RUC 2;  2VUC A;  4AG4 A;  5FYI A;  1TQ5 A;  4KWL A;  4YGE A;  3T2P A;  4YZ2 A;  2QQL A;  5FYV A;  4MVT A;  1GOG A;  3U14 A;  1COV 3;  1XPW A;  3POI A;  2WNU A;  3J8F 1;  4FOQ A;  2R7E B;  2RDS A;  5FY4 A;  3HN1 A;  5JXG A;  3KV9 A;  2RG4 A;  1M4W A;  3LFI A;  1Q43 A;  5GZF A;  5ACA 1;  1RUD 3;  1C5I A;  2D97 A;  2QVS B;  4G4F A;  1UZ0 A;  2WZE A;  3DYM A;  4XTP A;  2PLV 2;  3VBU C;  2W5F A;  3VBH C;  2R04 3;  3FX3 A;  2VZT A;  4AXO A;  4EWA A;  4Q8K A;  4GB3 3;  5LK7 B;  1FNY A;  3I59 B;  1OH4 A;  4CP1 A;  4A4A A;  1OKO A;  4AZZ A;  2P34 A;  1SLB A;  1SLI A;  4AF9 A;  4PIZ A;  5CFC B;  1BBT 3;  4N90 A;  1ZA7 A;  2Z5W A;  5DAX A;  3UV9 A;  1G6N A;  2VZR A;  3WEZ A;  3OYW A;  4P9L A;  5A3T A;  1CX4 A;  4Q4X 2;  4R9C A;  5D2A A;  1PNF A;  2YPD A;  4COU A;  3LPF A;  3ZIW A;  3KZ4 C;  2VW2 A;  1OUS A;  1MS3 A;  1C1F A;  1JU4 A;  3VZK A;  3VZL A;  4HON A;  2HWC 2;  1QJX 3;  4CDU C;  1LHN A;  4BLI A;  3U4S A;  5FYB A;  3WNP A;  1E5H A;  3KT4 A;  3IAQ A;  4UFI A;  4S2D A;  5A3M A;  4PCR A;  2J22 A;  1DP0 A;  3CDZ B;  1JYX A;  1N3O A;  3WDV A;  2B45 X;  2VOX A;  3H1W A;  3RZH A;  3DXT A;  5J3U A;  1RUC 3;  3ETQ A;  5DAQ A;  4O65 A;  4QKD A;  4WVV A;  1ZYB A;  2EXI A;  2JDN A;  2GME A;  1CIW A;  1W2T A;  3LWC A;  1RUF 1;  3SIS A;  1OOP B;  4HN1 A;  4JAA A;  1W06 A;  1FV2 A;  1ODN A;  4CEW A;  1A6C A;  2BZD A;  4YFW A;  1UMI A;  2PLV 3;  1LU2 A;  1PM4 A;  4KWK A;  1UY4 A;  4UXA A;  1D2S A;  1C1L A;  2RS5 1;  5F3E A;  3H3L A;  1R64 A;  1Z7S 1;  1A34 A;  2PAK A;  4Q4V 2;  5EPA A;  3LGR A;  1R09 2;  1OMI A;  3AP4 A;  3ECQ A;  1MVQ A;  1W6P B;  4R9B A;  4EN7 B;  1APN A;  1WWY A;  4KI5 M;  4LOR A;  3ACL A;  4COW A;  3T0A A;  2ZAB A;  3OUH A;  4Q4X 3;  4AED C;  1DZT A;  2Q30 A;  3AMM A;  3C7E A;  1PGW 1;  5K7P A;  3VB9 A;  2W46 A;  2HWC 3;  3WP4 A;  4LE4 A;  2GNB A;  4JRA A;  4M3C B;  5EJ1 B;  1YHF A;  5C8C A;  1NA1 A;  2DBN A;  2IXH A;  5LWB A;  4GAZ A;  4LIV A;  1GZ9 A;  4EZ4 A;  1S0C A;  4XBN A;  2Y60 A;  4X8N A;  2UYA A;  4AFM A;  1RMU 1;  2RM2 1;  4BQ4 A;  3AP5 A;  2DUP A;  1H6X A;  3PUQ A;  4K8R B;  3KS7 A;  3I3Q A;  1QJU 2;  4WM7 A;  2BBV A;  3ZPY A;  1CD3 G;  1Y4W A;  3AKR A;  2J1S A;  2TEP A;  3AC0 A;  4B4Q A;  2XGX A;  2J1U A;  4PI0 A;  1W8F A;  4ORF A;  3ZPO A;  2VBD A;  4QQP A;  1YIF A;  2YBS A;  5CZK A;  2W3J A;  3PL0 A;  4DIN B;  2NMO A;  3THC A;  5M0T A;  2JKX A;  3ZR5 A;  1CWP A;  3Q8C A;  3KVA A;  2WO2 A;  3C2U A;  4XDQ A;  1Q5O A;  3NJZ A;  1SAC A;  1WME A;  2R16 A;  4L99 A;  4MX3 A;  1WUV A;  4Q4V 3;  1AR9 2;  3RWN A;  1R09 3;  3B9C A;  2GN3 A;  3ZVX A;  4DY3 A;  5BNP A;  2FDF A;  1UPS A;  5A7P A;  1QF3 A;  1BK1 A;  4UWD A;  3H8O A;  2J1V A;  1TMF 3;  1PGL 1;  2R07 2;  1AR6 2;  5A33 A;  4A7Y A;  2XJP A;  2Q8O A;  5K0U B;  4BU2 A;  1OT5 A;  4CCO A;  2JX9 A;  2WO3 A;  1ZRD A;  4XAA A;  4EWD A;  4QQ2 A;  1AX2 A;  1ZBE 2;  2XVG A;  2RMU 1;  1UU4 A;  2ZMK A;  2EF6 A;  3HJR A;  1URX A;  3ZYG A;  4D8M A;  4ES9 A;  2UU8 A;  3HAG A;  2P3I A;  1MZ5 A;  1HB1 A;  4Z82 A;  1ZVF A;  3DKW A;  3USS A;  3ZSK A;  1QJU 3;  3MF9 A;  5L7O A;  2IFR A;  3ZYH A;  4AI8 A;  3U4X A;  1C4R A;  2WUH A;  1JOD A;  3WF4 A;  3AM2 A;  5ANQ A;  5FYM A;  3OTF A;  4EWE A;  4HXC A;  3WNO A;  1PHM A;  3W58 A;  1LOF A;  2HJI A;  2JDA A;  3AFG A;  1SQ4 A;  3BVC A;  3LA7 A;  4BWO A;  1O3R A;  2HWF 2;  3PJQ A;  4YM2 A;  3O0V A;  5IAX A;  2FMD A;  4JC1 A;  4CUB A;  3H8R A;  2CAV A;  1AR9 3;  2GH8 A;  2BBA A;  3LZZ A;  1KQR A;  4MGQ A;  4PJY A;  5FO8 B;  1W6O B;  3OBT A;  4Q26 A;  1YRZ A;  1XQN A;  1UW8 A;  2XXZ A;  4N43 B;  1KEX A;  4Y1X A;  2R07 3;  1AR6 3;  2HWD 1;  2WFF 2;  3CIH A;  4UBG A;  3C3V A;  4B3N A;  1US2 A;  4A41 A;  4X6Q B;  4RHV 2;  1ND2 B;  4FFF A;  1VBA 2;  1UL9 A;  3RI8 A;  1CES A;  1ZBE 3;  3TRS B;  3LPG A;  4MGT A;  1LHV A;  3U10 A;  4AVS A;  2WLP A;  1CAX B;  2C0Z A;  1H2L A;  1K42 A;  2OII A;  1EY2 A;  1FMD 2;  1UU5 A;  2W94 A;  4HSL A;  1R1A 1;  4Q0Q A;  5IVJ A;  1XBF A;  3RG0 A;  2XBO 1;  2VU9 A;  4WM8 C;  3WIN E;  2GND A;  3PME A;  3L2H A;  2XVK A;  1T6G C;  3H42 B;  5FYY A;  4LBQ B;  3AX4 A;  3CLP A;  5BNO B;  2GH2 A;  4GQ7 A;  1COV 1;  1KXG A;  3OY8 B;  3MIE A;  4P9Y A;  3ON7 A;  2QKD A;  4XTM A;  3WG2 A;  1HN1 A;  5FZM A;  5JSO A;  4P5H A;  1VBE 2;  3AL5 A;  1HB3 A;  4CDX A;  3EBR A;  5EQU A;  1RUD 1;  4E8D A;  1RVF 1;  2HWF 3;  3SMH A;  5FPA A;  1ULC A;  1YIP A;  1F31 A;  4I0B A;  4YVW C;  4IE5 A;  4GB3 1;  2XWJ B;  3BGA A;  2X10 A;  3MID A;  1D4V B;  2OYZ A;  2PHD A;  2Q1Z B;  4Y1V A;  1PK6 A;  4YM0 A;  3MF6 A;  1K5J A;  3K3O A;  1YI9 A;  1BBT 1;  3A7Q A;  4QPG B;  4OHZ A;  4QDR A;  2YXS A;  5FJK A;  2A71 A;  1KDM A;  2WFF 3;  4JGY B;  3TAY A;  1SFY A;  3B94 A;  3POS A;  3POY A;  4CDQ A;  4RHV 3;  3LE0 A;  1O4T A;  1SFN A;  1VBA 3;  2ZEY A;  3OEB A;  4IEU A;  2VMG A;  3RSJ A;  4BOW A;  3BI3 A;  1Y9G A;  1XU2 A;  1SLA A;  2VTF A;  3SH4 A;  4OHY A;  1FMD 3;  4CE8 A;  2G4I A;  4DXR A;  1JOP A;  1YI7 A;  4PLN A;  1WA6 X;  3LSE A;  1YNA A;  3LOI A;  5LBB A;  4DS0 A;  4JTN A;  4XF0 A;  3CJI A;  3WHT A;  4D7Y A;  3HEI A;  5F9T A;  1QH6 A;  4QPY A;  5LK5 A;  1ZRC A;  1QNW A;  3HIF A;  5CFC C;  1BEV 1;  5C33 A;  1OQE A;  2P6C A;  1N1V A;  2PXJ A;  1UY0 A;  3IIA A;  4FFH A;  2IXI A;  1VBE 3;  3HPN A;  3J4U H;  3LFM A;  4QQO A;  2E32 A;  1OSG A;  5JOX A;  1YFX A;  4BYY A;  1IZ3 A;  2ETE A;  1AYM 2;  4JQT A;  4RYD A;  4CEY A;  5L19 A;  5A6Y A;  3ZYB A;  1FT9 A;  4W50 A;  3U07 A;  3N7M A;  4CXY A;  2E7Q A;  3IDC B;  1PX4 A;  5F2S A;  4D6S A;  3T0D A;  1VMH A;  3W5M A;  1F2N A;  2V5Y A;  4LKE A;  5F6K A;  4QX3 A;  2QQK A;  2ZEW A;  2H6B A;  1GBG A;  4BJ0 A;  1PZ8 A;  1V6N A;  4GMP 3;  3HMY A;  4Q4W 1;  3WCR A;  5FZD A;  2BWC A;  4FFI A;  4C1X A;  4XZP A;  3ALQ A;  1E5S A;  4Q4X 1;  3NJY A;  5L73 A;  4ONU A;  3WVJ A;  2VQA A;  3ZKY A;  3AKT A;  1PX3 A;  1VBD 2;  2R1B A;  5DAV A;  5FYH A;  2PHR A;  4YVS A;  5EYY A;  3UK9 A;  2JE8 A;  5I91 A;  3IAP A;  1LRH A;  2ZXQ A;  1OQD A;  1UOG A;  5LY1 A;  4AFA A;  2WKK A;  4QXK A;  3BU7 A;  2VZP A;  3JQW A;  2FCT A;  1DIW A;  3WDT A;  4JV4 A;  2WNU B;  1HV0 A;  2VQT A;  3JBG 1;  3DUI A;  3N9L A;  2D3S A;  2PQS A;  4LHK A;  1T6B X;  4OUL A;  4AL9 A;  3KHC A;  4ISR A;  2PYT A;  4XVH A;  2XPJ A;  1V6L A;  3D3A A;  2B39 A;  4HSJ A;  2JD9 A;  1QJY 1;  3K4Z A;  4JTO A;  1AYM 3;  1TEI A;  3PUH A;  2XJV A;  2B46 X;  2XHK A;  5LBF A;  3SEE A;  4B4R A;  3I97 A;  5JDB A;  1YQ6 A;  3AK0 A;  3LA2 A;  2OKX A;  3I4I A;  3U11 A;  4FAH A;  4RL7 A;  1UZY A;  2RVA A;  5A3P A;  1SZB A;  1IS5 A;  1BQP A;  3MUY 1;  3N35 A;  3V0A A;  4Q4V 1;  3AKQ A;  5F3C A;  1UYY A;  1VPH A;  1R09 1;  3OYW B;  4MXW A;  4YG3 A;  3Q9O A;  4KGQ A;  3U75 A;  5JMO A;  3N9N A;  3GZU C;  3ZFG A;  4MG2 A;  3GBF A;  4XJZ A;  3TN9 2;  2P5B A;  3X29 B;  4Q5O A;  2W68 A;  1ZRR A;  2G19 A;  1VBB 2;  1RIT A;  4NMI A;  5DAW A;  2VNG A;  1UIK A;  2JEN A;  4MSV A;  4MH0 E;  1YJK A;  5DUV A;  4L0P A;  4PF5 A;  3SQO A;  5D8A A;  3KB5 A;  1W8T A;  4AW7 A;  3ZFF A;  3LDB A;  4YW6 A;  1JZ3 A;  1UYZ A;  4GZ9 A;  3VBR A;  3MO4 A;  2GC3 A;  3T30 A;  5DG2 A;  4YGB A;  1UN1 A;  1WMD A;  5E89 A;  1JN2 P;  4AVV A;  4XAC A;  4MET A;  2WAA A;  4U36 A;  1OF4 A;  2WJS A;  5GLU A;  4LBJ A;  3MIG A;  1HQN A;  5LB6 A;  3ZXF A;  4CEW B;  5A6Z A;  4YRD A;  4FOW A;  4D94 A;  4O61 A;  3U37 A;  1WW4 A;  2Y6K A;  1S0E A;  3ZXK A;  4AAP A;  3M3I A;  3JD7 3;  5C4W A;  3MV0 1;  4JKK A;  5K0U C;  1JZ8 A;  3QBQ A;  3MFC A;  1BHG A;  1GAN A;  1QXP A;  4BH9 A;  1W0O A;  1OA4 A;  3KCY A;  3DYP A;  3NV1 A;  1HB4 A;  2VCM A;  5IVV A;  1AR9 1;  4NHY A;  5GLV A;  1GQH A;  2DWR A;  4R9D A;  2QQJ A;  4NIA A;  3WCS A;  3EB7 A;  5FMB A;  4FPK A;  5A7N A;  2J42 A;  3UKN A;  4AI9 A;  3FBY A;  1PO1 1;  1GNY A;  3TN9 3;  2FQP A;  2YB7 A;  2JJ6 A;  5IYY A;  1AR6 1;  2WSV A;  3M1H A;  1VBB 3;  1W0N A;  2O8O A;  5FZ3 A;  4ATF A;  4YZ5 A;  5C8C B;  1C8N A;  3I2O A;  4XCB A;  1NA1 B;  4C91 A;  3NNM A;  2EIG A;  5J1X A;  1W39 A;  4LO4 B;  1JUH A;  2JDZ A;  5DDJ 1;  1Y7B A;  3W5N A;  4ISQ A;  1PMI A;  2PAE A;  5AFE A;  1H2N A;  1NX9 A;  4EQV A;  4WM7 B;  2R49 A;  3PU3 A;  1WLC A;  2IWG B;  2MNG A;  2IXK A;  2CAU A;  1RUE 2;  1PVX A;  1HJG A;  4LPL A;  2VBB A;  4QKF A;  3VHO A;  4MHR A;  4RGK A;  4JKL A;  1UOF A;  1SDW A;  2EXJ A;  4ZON A;  2ET1 A;  3S5A A;  2WQZ C;  4D6Q A;  1RYY A;  2R0F A;  2XVL A;  3SCH A;  5JI7 A;  5FMC A;  4M4R A;  4K1Z A;  1HRV 2;  1XNB A;  2XLF A;  4NR1 A;  1S0B A;  2V4A A;  3ZO0 B;  4TTG A;  2D5H A;  2ZML A;  4HT1 T;  4YZ4 A;  3VD3 A;  3KVB A;  2OVU A;  3T09 A;  4UBH A;  2X29 A;  1JYT A;  2HWF 1;  1XYN A;  2X53 S;  2YGM A;  5BNN A;  1UY2 A;  1ND2 C;  2V5D A;  5CVR A;  5CA6 A;  1CZV A;  4L92 A;  1HQW A;  1XC6 A;  2OW4 A;  2UUR A;  1I1E A;  1V9U 2;  1ZZ9 A;  5BNQ A;  3FLR A;  1ZRE A;  1EPW A;  1UYX A;  1K3I A;  5A33 B;  4BXS V;  5IVC A;  1W2A X;  3GCX A;  1J3P A;  2YBP A;  3N9P A;  3VD7 A;  3EMR A;  2WFF 1;  1PMJ X;  4N9H A;  3AVR A;  5FZ1 A;  1OHF A;  2XL7 A;  1J83 A;  2LTN A;  4QM9 A;  5CKM A;  5BNO C;  4Q0P A;  2DVA A;  1DLL A;  3O1R A;  3ZXJ A;  2VCA A;  5BYN A;  2ARX A;  3NJX A;  5E16 A;  1QQP 2;  2Y6G A;  2CV6 A;  1FMD 1;  2D5F A;  3CQO A;  4TN7 A;  5DAB A;  1AUY A;  1VP6 A;  1UKG A;  2ENR A;  1RUE 3;  1W8O A;  2JXA A;  5A7O A;  5L7O B;  1JHN A;  4CUA A;  2R0H A;  4L9B A;  4NAO A;  3NKG A;  2LW8 A;  1DFQ A;  2ZGM A;  4AE2 A;  2UWB A;  2W95 A;  2ZX4 A;  2VZ3 A;  5I0D A;  4FXG B;  5T5O A;  4YFZ A;  4IE4 A;  4L8Q A;  4QPG C;  1HRV 3;  5E1R A;  1GZW A;  1IPJ A;  4M0N A;  4JGY C;  2E31 A;  1VBE 1;  2DCJ A;  5A7W A;  5H9P A;  3FFQ A;  4RN5 A;  4XUQ A;  1AXZ A;  3UKT A;  1GIC A;  1MZE A;  4TLG A;  4E4Z A;  3CZU A;  5ISL A;  3C7G A;  4LA2 A;  3ES4 A;  4ZU5 A;  2D93 A;  4IEO A;  2ZGK A;  4P5Y A;  5FYZ A;  1V9U 3;  4XMA A;  1MS4 A;  4YYO A;  3THT A;  2A7A A;  2IVJ A;  3PVO A;  3VBS A;  5LY2 A;  5C9A C;  2A3Y A;  2HWB 2;  2OZJ A;  4EN9 B;  3WDW A;  1MS0 A;  3C8X A;  3S5Q A;  4J6G A;  3ZSE A;  1ENR A;  3V0B A;  1H8T A;  5KR7 A;  5FZL A;  1ASJ 2;  3DKQ A;  3ACF A;  4P9J A;  1F8V A;  3ILR A;  4AVB A;  5C3Q A;  4MGY E;  1LOB A;  3NO8 A;  1X8E A;  1QQP 3;  3HBZ A;  2L9L A;  2WZR 2;  1UF2 C;  3H1M A;  5DZG A;  1NXD 1;  3ZM8 A;  1O91 A;  2FDK A;  4HPK A;  1JI6 A;  3WV6 A;  1ZRF A;  3E5X A;  1AYN 3;  2VC9 A;  5FLJ A;  4A7Z A;  2PEL A;  1WCU A;  3KV4 A;  5IAT A;  3A4U A;  3OD4 A;  2ZAA A;  1VAM A;  2H0V A;  2BU9 A;  4JCK A;  3AKS A;  3E97 A;  5A3O A;  1C3H A;  1FV3 A;  3MFA A;  4LHL A;  3KT1 A;  2HEV F;  4CDX B;  4OI0 A;  4GKX A;  4WBB A;  2QQN A;  1TNR A;  2VCC A;  2CWM A;  4DB5 A;  4OQ9 A;  1IPS A;  3ZN4 A;  1AYM 1;  1AR8 2;  1W8N A;  3NWK A;  5FZI A;  1ZRI A;  5EHD A;  2VOT A;  4BIS A;  1JZ4 A;  1PK6 B;  1J3R A;  3FLT A;  4F3J A;  3J7L A;  1XNK A;  1VRH 2;  1RXG A;  2E6V A;  4XFG A;  3JQX A;  1H4G A;  3BU0 A;  2D7F A;  4XUN A;  4KU8 A;  1AL2 1;  4XET A;  4CDQ B;  1ULD A;  3V65 A;  2HWE 2;  2GNM A;  2HWB 3;  3MI8 A;  2GDF A;  2K0G A;  2WNU C;  3JZV A;  3H0O A;  3FUO A;  4RGG A;  5EZW A;  4LHS A;  3USU A;  5EFU A;  5I93 A;  5CG8 A;  1ASJ 3;  4CU8 A;  1O5L A;  1VBD 1;  2BTV C;  2ZS6 B;  2VOV A;  3PTY A;  1SPP B;  1VAK A;  4BDV B;  1W6M A;  4XJU A;  4O7X A;  1ZBA 1;  4XJA A;  3NV2 A;  2ZX2 A;  2BQP A;  2WZR 3;  4GD4 A;  4N7I A;  3L2Y A;  4LO5 B;  3PUI A;  3H1Y A;  4K20 A;  5JIU A;  4MGI E;  3OBZ A;  3A0N A;  3CJI B;  1RUJ 2;  4P9G A;  4IEV A;  1FPN 2;  2D40 A;  3BOW A;  4P9X A;  1AL0 G;  3ZYI B;  4IE6 A;  3T4H B;  2G9G A;  3QOP A;  3PIJ A;  4JX0 A;  2HBU A;  3OGV A;  4NII A;  3H7Y A;  4HET A;  2VMF A;  1KJR A;  3IMM A;  1PMH X;  4QHZ A;  1YQC A;  4GH4 A;  2R04 2;  5DUW A;  2ADE A;  3ZSM A;  1PO2 2;  4NIH A;  4CEY B;  4EN6 B;  4TWT A;  2WO7 A;  3GJA A;  2QZ2 A;  4TSV A;  1KIT A;  1AR8 3;  2WO1 A;  2OZ6 A;  3M4F A;  1JZ5 A;  2Y34 A;  1SCR A;  4N9I A;  3P1I A;  5FK7 A;  2YHJ A;  3WLU A;  4B8E A;  5CAZ A;  1RL3 A;  1VRH 3;  3RZM A;  2WAB A;  4HVQ A;  4PDW A;  5FOB B;  4YW5 A;  3R05 A;  1X9P A;  5A6Q A;  5IUQ A;  1REE A;  1KFU L;  2HWE 3;  2Z2S B;  1JYC A;  4V2V A;  3TN9 1;  5JSR A;  1QJX 2;  4CXX A;  1UXX X;  4Q2F A;  3AP6 A;  1GZC A;  1VBB 1;  3ZYJ B;  2VXJ A;  4YVS B;  4CEW C;  1OH3 A;  4FPO B;  3V64 A;  4NPM A;  4JDN A;  1IS6 A;  1OQ1 A;  1DGR A;  2P2K A;  4NHM A;  1N47 A;  2WA4 A;  3UYJ A;  1VRB A;  2D6L X;  2JG9 A;  2VZO A;  1C8M 2;  1VB4 A;  1WD3 A;  4MAD A;  1EAH 1;  3VV1 A;  1RUJ 3;  4JHZ A;  4TLF A;  4MYE A;  1FPN 3;  1KJL A;  2PHU A;  1W6Q A;  2IC1 A;  4QX1 A;  5IT6 A;  4W6X A;  5FYU A;  2VNR A;  2Y33 A;  3D0S A;  3FHA A;  1SEF A;  3R4D B;  4LO7 A;  2ZJC A;  2O14 A;  2XKP A;  5CB7 A;  1ACC A;  2ID4 A;  2Q1F A;  4YG0 A;  3PLQ A;  4QT6 A;  5F5Q A;  2ZGT A;  4LK7 A;  3UL2 A;  5FXW A;  3WP6 A;  4LR4 A;  1PO2 3;  1PZ9 A;  3QCW A;  1BKZ A;  1LOA A;  1U12 A;  2AYH A;  5DMY A;  1CJP A;  5C8C C;  2A3X A;  1NZI A;  1NA1 C;  1LHU A;  1KGY A;  3SKJ E;  2E53 A;  5FP8 A;  5GZC A;  2VZ1 A;  3V0A B;  2WNV A;  2PFW A;  4MXW B;  5IFT A;  3O0X A;  2HEW F;  3ACH A;  3BOP A;  4XFA A;  1OFN A;  4AHW A;  2ZGO A;  1X8M A;  2BW8 A;  1S0I A;  1FAT A;  3I3D A;  4M00 A;  3ZFG B;  1VJ2 A;  2F6B A;  4NHL A;  4WM7 C;  4YW4 A;  4C8D A;  4QGM A;  4CPB A;  2YC2 A;  3LF7 A;  5JIA A;  3OGJ A;  2K2S A;  5FZK A;  2BGO A;  1BXH A;  2QFE A;  3HVD A;  3HQU A;  2VQ0 A;  5D8A B;  1GUI A;  1UMH A;  3ZFF B;  3UJQ A;  4XJ8 A;  3Q8E A;  1ODM A;  2D3R A;  4LO8 A;  1S2K A;  4EZH A;  4QM8 A;  3HWJ A;  2GC2 A;  2RR1 1;  4FVV A;  4LKF A;  3VBR B;  1C8M 3;  4QQL A;  4IEW A;  4J1X A;  1LEM A;  5FXX A;  3ZFE A;  1EUT A;  2P4E A;  3WP3 A;  4ASM B;  4IW3 A;  2V73 A;  4SBV A;  3O14 A;  4R9A A;  3ZSL A;  1RUE 1;  4FPE A;  1DLC A;  3OPT A;  4QX7 A;  4XMI A;  1OLM E;  4B4P A;  3VZJ A;  2BGP A;  1HJF A;  2UYB A;  5KHI A;  5I0U A;  3SCF A;  2DCT A;  4RS5 A;  3WQB A;  3KD4 A;  1ALY A;  3OGR A;  1ZZB A;  1XOY A;  1S4C A;  5C4W B;  1HRV 1;  3RGB A;  2NP0 A;  3AKP A;  4WVM A;  4AVC A;  2IXJ A;  4XFF A;  2DCZ A;  5HI0 A;  2PN5 A;  4EN0 A;  4OVE A;  2YDE A;  2P3J A;  2VZS A;  4CTE A;  5B4X A;  1DQ2 A;  3PTR B;  2P3Y A;  4FP3 A;  1CPN A;  3FMG A;  5FY7 A;  2V09 A;  1JYI A;  1MS1 A;  2Y64 A;  3NNJ A;  1TMF 2;  4AQT A;  5CKQ A;  3O1T A;  1V9U 1;  3UET A;  4LOT A;  2AGS A;  3MHZ A;  1REF A;  1XNA A;  1KS5 A;  5L7O C;  4K1Y A;  3NW4 A;  1F4A A;  4HLT A;  5FZ4 A;  3UT0 A;  1PGS A;  1WW5 A;  4X6R B;  1K12 A;  3DN7 A;  2WFP A;  3M7A A;  5FZO A;  1LOF C;  3NMB A;  1XRU A;  2AEN A;  2QDR A;  2BPA 2;  1L7Q A;  1QQP 1;  4XOG A;  5J48 A;  3J7M A;  1HQL A;  3W21 A;  4BMB A;  2HBT A;  5T5P A;  3MIB A;  4H2A A;  2W87 A;  2B7Y A;  3KQ4 B;  3H50 A;  2ZX0 A;  3DPR A;  4E4D X;  4UI9 L;  2E33 A;  2JE9 A;  2W47 A;  5FY8 A;  5BPX A;  2EAA A; 
#chains in the Genus database with same CATH homology
 4Y5T A;  5L9R A;  5LBC A;  4NHY A;  5EP9 A;  3DKQ A;  2JIJ A;  2Y33 A;  3KT4 A;  5HV4 A;  2RDR A;  3W20 A;  5ERL A;  4BQY A;  4XCB A;  3NNF A;  3NNM A;  2FCV A;  3BVC A;  3GJB A;  5DAQ A;  5IAT A;  5LBE A;  5IAX A;  3OUJ A;  3KT1 A;  5DAV A;  5L9V A;  2FCU A;  4NHL A;  4MHR A;  4MHU A;  4ZON A;  4XCA A;  4XC9 A;  2JIG A;  2V4A A;  3HQR A;  3HQU A;  5C5U A;  5HV0 A;  2FCT A;  5EPA A;  5DAP A;  5LAT A;  3OUH A;  4Y5S A;  4IW3 A;  4ZPI A;  5C5T A;  2G1M A;  5LBF A;  3KT7 A;  2RDQ A;  3EMR A;  3OBZ A;  5IAV A;  5L9B A;  5EQU A;  2HBU A;  3MGU A;  2OPW A;  4Q5O A;  2RDN A;  5LA9 A;  2G19 A;  4NMI A;  3NNJ A;  5DAW A;  3PL0 A;  4KBZ A;  5A3U A;  3OUI A;  3NNL A;  4NAO A;  3GJA A;  5M0T A;  4XAB A;  2Y34 A;  4JZR A;  3GZE A;  4BQW A;  2A1X A;  2RDS A;  4NHX A;  2RG4 A;  4XAC A;  4NHK A;  4J25 A;  4UWD A;  5LB6 A;  3W21 A;  2HBT A;  5LBB A;  4XAA A;  5DAX A;  4BQX A;  4NHM A;  3ITQ A;  5LAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...