5M0TA

Alpha-ketoglutarate-dependent non-heme iron oxygenase eash
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
287
Chain Sequence
SKPTLRRIPRSAGDEAIFQVLQEDGVVVIEGFMSADQVRRFNGEIDPHMKQWELGQKSYQESYLAGMRQLSSLPLFSKLFRDELMNDELLHGLCKRLFGPESGDYWLTTSSVLETEPGYHGQELHREHDGIPICTTLGRQSPESMLNFLTALTDFTAENGATRVLPGSHLWEDFSAPPPKADTAIPAVMNPGDAVLFTGKTLHGAGKNNTTDFLRRGFPLIMQSCQFTPVEASVALPRELVETMTPLAQKMVGWRTVSAKGVDIWTYDLKDLATGIDLKSNQVAKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of EasH (Aspergillus japonicus) - an oxidase involved in cycloclavine biosynthesis.
pubmed doi rcsb
source organism Aspergillus japonicus
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent non-heme iron oxygenase EasH
total genus 96
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5m0tA00
2FCVA 3OUIA 5IAVA 5LASA 3W20A 4NHMA 3GZEA 2FCTA 5HV0A 5IATA 4XCAA 3EMRA 4ZPIA 2HBTA 5LBEA 5LB6A 2RDSA 3ITQA 5LATA 5DAXA 3NNJA 3KT4A 4Q5OA 2Y34A 4XCBA 5HV4A 2A1XA 3HQRA 3NNLA 2RDRA 2OPWA 4NMIA 4Y5TA 4XABA 2JIJA 5LBCA 3HQUA 3KT7A 5M0TA 5L9RA 4BQYA 5L9BA 4Y5SA 3W21A 5LBBA 5LA9A 3KT1A 5DAPA 2G19A 5A3UA 5C5UA 4MHUA 4BQWA 2Y33A 2JIGA 4NHXA 4BQXA 5C5TA 4IW3A 4NHYA 4NHLA 3MGUA 3NNMA 4ZONA 2V4AA 4UWDA 2RG4A 3GJAA 4NHKA 5EPAA 3NNFA 5DAVA 5EQUA 4XACA 5DAQA 4NAOA 4JZRA 3OUHA 5LBFA 2G1MA 2FCUA 3PL0A 3OUJA 4J25A 5DAWA 3GJBA 3BVCA 5L9VA 4MHRA 5IAXA 4XAAA 5ERLA 2RDNA 4KBZA 5EP9A 3DKQA 3OBZA 4XC9A 2RDQA 2HBUA
chains in the Genus database with same CATH superfamily
2B5HA 4XFGA 4D94A 5FMCA 1H2MA 1ENQA 1JOJA 3DXUA 2XBO2 4RQPC 5IAVA 3BIEA 2YV8A 2DBIA 4WV8A 5IVEA 2VXRA 3O12A 1DP0A 3AVSA 4AEKA 1W8FA 3POYA 5JPMB 1OH4A 3ZOIA 2VJXA 4NHMA 4P9LA 1ND2A 5FP8A 1KXGA 2PA7A 1XU2A 3AMQA 4IETA 4H7MA 2WT0A 1NCRA 4QXKA 3DV8A 2V4VA 1QOSA 2K9ZA 3K4ZA 4LITA 4D6QA 4LKEA 5EFUA 2WC2A 4ES9A 4HLTA 1S2BA 1UMZA 3U75A 1KD7A 2FDIA 2JKXA 5HV4A 4NVPA 2I74A 4RQPA 3U78A 2WA3A 3CBNA 3ETPA 2V72A 4YW3A 3WF0A 3VDCA 4Q0VA 1SZBA 3AM2A 2YPJA 3WD5A 2YC4A 4ZHNA 2WNUA 3N9LA 1LGBA 3OY8B 1UOFA 5BNOC 5E8AA 4TZDA 1D4M3 3NKTA 4FFIA 4AAPA 4CCJA 1Z78A 2BJSA 2JDYA 2XPJA 4E9KA 3RZGA 2VVEA 4GD4A 4AHZA 1IS5A 4MVTA 4WVWA 1WLDA 1YIPA 2D6MA 1HN1A 4ZXEA 3BUCA 1AL21 4QKNA 1CPNA 4IV3B 4YVWA 4PIYA 4QPIA 3FBMA 3TB0A 1XE0A 1AR91 2P37A 2VNGA 2D40A 4JGZA 4QXCA 3ZXFA 3BIWE 5ABJA 3T0DA 1OF3A 4AFAA 1F35A 2DU0A 3WW4A 1OKOA 4COUA 1H6XA 4AGRA 4ZONA 4QQLA 5T5PA 1W8UA 4Y4YA 5C4WA 1JODA 3WCSA 1W0OA 3V65A 2Y6LA 1FXZA 5AFEA 5T3NA 1CN1A 4QU1A 1UYPA 4RHV2 4UAPA 3ZKYA 2FQPA 3WP3A 1M4WA 1RUE2 2RG4A 4PI0A 4YRDA 3E5QA 4R4ZA 1LECA 3QACA 4PLMA 1ND3A 4NE9A 3V64A 1OVPA 2HWD1 1OOPB 2WN2A 2Y6HA 5IK7A 1JZ6A 1CQ9A 3H3UA 3N7JA 4GKXA 4YW7A 5FYZA 4C0BA 1HQLA 2EXKA 2D98A 2PHFA 4YNIA 1RUE1 3OUHA 1SG3A 1K5MB 1AX0A 2QKDA 3NAPB 1ZNPA 1HIXA 5A6ZA 5A3NA 1W06A 2RMU3 1FNZA 4J25A 1OHFA 2WNEA 2ORZA 2R071 4OUEA 3RSJA 2IXLA 5L9VA 2ZS6B 3OGRA 1BK1A 3CJXA 1YC61 2A3WA 1TMF2 5JMOA 5JXJA 4I2OA 2DVAA 3HVDA 1EPZA 2R061 4CCKA 1Y9GA 4W65A 4XQDA 4XAAA 1K42A 3U10A 1C8M1 1DBNA 3CJIB 3OCPA 3LOBA 2Q0AA 2W2IA 3F2ZA 1KFXL 3AZWA 3SMHA 2QQUA 2HBUA 2IFRA 1BEV2 2WR9A 1TME2 4LO8A 4CRQA 3VBHC 1MZ6A 1TQ5A 4I3PA 1CAWA 3VN4A 3OBAA 1CAUB 3NW4A 1DGLA 4L99A 1ZRCA 1YQ8A 4UI9L 4XCAA 3PUSA 5I0SA 2GP5A 2QNKA 4CDUB 1NQDA 3R6SA 4CP2A 1K5JA 3ACFA 5CEHA 3H1MA 3ALQA 3NNJA 4Q5OA 4XF0A 3ZSMA 1GNZA 1PK6B 2QQIA 4P08A 4XUNA 3S30A 4LBQD 3WF3A 3SH4A 1UY1A 4XHBA 1TVGA 1FI2A 1PZ9A 2RM23 3N9QA 2ARXA 4TXWA 4CE8A 4O9EA 2VUDA 2C6SA 4Y5TA 1V9U3 1CIYA 2ZKNA 3QOPA 2X5IA 4QMAA 4NWVA 5ACA2 1NZIA 2ZAHA 3DYPA 3I59A 4AHYA 5F2SA 5FUIA 5C8CC 3WHUA 2VAUA 1SQ4A 3CF6E 1KRIA 5AFBA 1WA6X 1G9CA 1FNYA 3POJA 4Q0QA 3WW3A 1D2SA 2K2SA 2FZ2A 2XLAA 5FZ9A 3JD72 2R1BA 4Y5Z0 1NXD1 3C7EA 3I8TA 3KCCA 3MUY1 5EWSA 3WV6A 4CCEA 3N9MA 4COVA 1US3A 2DVBA 5CFDC 1XU1A 4FFHA 1YXWA 2Y33A 4LR4A 4Q2FA 3LKJA 2W47A 1SPPA 4QX2A 2XDVA 3S6PA 5FZBA 2W52A 2YU2A 5G04L 1ST8A 3ZYHA 3DEMA 4FP3A 5KWRA 1JOBA 1WW7A 1HRI2 2XHKA 4NRMA 2WO3A 2FDFA 1ULFA 1UWWA 3M2MA 3Q8FA 4META 4W6YA 3MLKA 1B35A 1QHDA 2YY1A 3LA2A 3OPWA 1WW4A 4FT8A 5LK5A 1HXS2 3VBRA 2PELA 4JGZC 1QWRA 2P3JA 5F9TA 2VO5A 4LQRA 5GLTA 1B35C 5I8TA 2EIGA 1H6YA 5DPNA 3VD4A 3LOIA 1VBB1 2R0FA 4MX3A 4Q0PA 4K6BA 4K9SA 3J4UH 2WAAA 3FHAA 3PIJA 4COYA 2DVFA 3BALA 3DUIA 4N8MA 2B46X 2VM9A 3AP9A 4NAOA 2BBAA 5JI9A 1JZ5A 4XQWA 4PJYA 4LULA 3TAYA 4A3ZA 3WCRA 1JYVA 4FOQA 3H3ZA 4LBMA 4N43A 1KDKA 3D4KA 1GZWB 1OSGA 1V6NA 1MZEA 3IN9A 4YSFA 5DMYA 1MQTA 3ST7A 2WSVA 4I01A 4XDQA 1Q8QA 3V0AB 1GV9A 4JGYA 4BE3A 1BQPA 3KHCA 1L3JA 2XJUA 2VBBA 1UZVA 4XDPA 1UIJA 3JUUA 1L7QA 2FMYA 3HD8B 3H9AA 1GOFA 3H7YA 3J7HA 2VZRA 1I5ZA 1UO9A 3AFGA 1FMD1 2B9UA 4QPYA 1XPWA 5FRAA 1UAIA 1POQA 4K3UA 4XJZA 1YIFA 1Y9MA 2WO7A 1UZWA 4CPBA 2AC1A 3L2HA 3X29B 3ZSEA 1JYTA 2FCVA 4LE4A 5JXHA 2HEYF 4EYUA 1VMHA 2ATFA 1GBGA 3SH3A 4K40A 1R082 4LEJA 2DURA 4M0HA 4JAAA 2W68A 1W2OA 2WAOA 3ZSJA 3BI3A 1CAUA 2XWJB 5EJ1B 2YC0A 1FPN3 1Y43B 2JE7A 2MHFA 3LB9A 3LPGA 3POFA 2FHRA 4GQ7A 3GGLA 3CDZB 3KHBA 3PJYA 1DQ5A 1GZ9A 2PN5A 2ERFA 2GH8A 4XQ4A 5FBZA 5JIAA 4LKDA 2Y34A 5AVAA 1AR92 3NRUA 1HX6A 3MF6A 5F5QA 2ZACA 2BERA 3K48A 3C2UA 3HBKA 2CGOA 2JIJA 4XABA 4XOGA 1DCSA 2RE9A 4IQPA 4Y4RA 3LDBA 3B02A 4XZPA 2A7AA 5CVRA 4QX7A 5M0TA 1QJEA 3IDEA 4CDQC 1XNKA 1AYM1 4W4ZA 1T6GC 5A1FA 2YBKA 2VOTA 2J1AA 3JQXA 4CU7A 4KQ7A 1YJLA 1IZ3A 1Z7S1 2Y6JA 4PDWA 3IIIA 5IK4A 1S0GA 1BBT1 4YGBA 4XFIA 4F8AA 3J7MA 5FZAA 4LA2A 2JG8C 4BQ3A 5C3OA 1NY72 5F32A 1B35B 2ZGQA 3MHZA 4AFCA 2BBVA 2ZJCA 2D3RA 4ATFA 3UKTA 2DVDA 2LRPA 5FZ6A 1POV0 2TEPA 2OQ7A 2VC9A 1PNGA 4PDWC 3ZM8A 4CCLA 4Z2WA 2WWJA 4JV4A 1STMA 1NCQC 4MGSA 2ET7A 2ORXA 4XURA 4CDXA 1O3QA 2D3SA 5FZMA 3AYCA 4TYSA 1CZTA 2OW4A 5A3LA 1OQ1A 1V6IA 4LPLA 5ABJB 4PHZA 4YZ1A 4XFFA 4OYUA 3G7DA 3ELNA 5IVYA 1HV0A 4IDZA 2SLIA 4ZU5A 5FY8A 1S0IA 2P3IA 4DS0A 5JOWA 3AP7A 2ZGPA 1S0JA 4BISA 3LGRA 4A4AA 4N90A 5DAVA 4BQ2A 1WD3A 1MPXA 4RYDA 2HWF3 2RV9A 2BU9A 4RGGA 1Z7S3 3GM8A 1SBFA 1RYYA 3HN1A 3FMGA 3IM0A 3FC0A 1W6PA 4SBVA 4YFWA 3D8CA 2GSYA 5FZKA 4H2AA 3VBFC 2VQTA 2XG3A 4BYYA 3V0AA 4RR3B 3EBRA 3DYOA 4PQQA 1OA3A 5FK7A 1SHWB 2PLV2 4GZ9A 4XFAA 4XHXA 4DXSA 3PNAA 4MOAA 2VG9A 2GH2A 2ZA9A 4AWDA 3JXSA 1O4TA 2VMGA 1MZFA 4QKDA 1FMD3 1APNA 1REFA 4RGAA 4MHRA 3MFAA 4P02B 1US2A 2VGDA 2Q1ZB 3GNEA 3KB5A 3KMHA 3OD0A 1PVC3 2R1DA 4IEOA 4WZFA 2J1SA 5KR7A 3SKVA 5FZ3A 5KXCA 4XBQA 3ILNA 5FBJA 3WQ1A 1G7YA 2I07B 2JDZA 3QH6A 3O5SA 1QQP1 1AR63 4XMIA 4COWA 5F6KA 3JBG1 5KC6A 2ZMKA 5DUVA 1YQ6A 3TEYA 1W6PB 2YFUA 1MS9A 4KGQA 2D5FA 4P9XA 2ZEYA 5FWEA 5HCBA 1BK0A 4XFHA 4LUMA 4BJ0A 4JTNA 5A7OA 4YWAA 5HV0A 3CJIA 2ES3A 2BQPA 1C4RA 1CAWB 1LHVA 1V6LA 2EICA 2XB6C 2RS32 2W1UA 2Y8KA 3MIDA 5LBEA 4C90A 5LB6A 1N3QA 2VNVA 3AKQA 3KVAA 4U2AA 1WWYA 3KF5A 2A6XA 1C5IA 5D8AB 1A8DA 5A32A 2PYTA 5FYSA 4JKMA 4HG6B 5F6LB 2EAAA 5CZKA 2OIIA 2ZKLA 1F8VA 2TNFA 2X5IC 3ACGA 1U5ZA 3QD6A 5EYYA 2WYSA 2HWD2 5LBCA 1QH7A 2RS13 3WOGA 4W8JA 5DUWA 4ATEA 4JGZB 2EF6A 4IV3A 5JZGA 5L36A 3AP4A 3I2OA 4JHZA 2OT7A 4RS5B 4P14A 1HB4A 1IG0A 4YZ3A 1U0AA 5ANQA 5K4LA 3ZFFA 2YDEA 4DMIA 2QQWA 1OXCA 1AXYA 3ETQA 1AR61 1CX4A 1WLWA 3I59B 4XEZA 3W21A 4K1ZA 2ZEZA 3MI8A 4AOCA 1NOVA 1GOHA 4PF5A 5FJKA 1RUF1 5CU1A 3WP4A 1W8HA 3J8F2 3THCA 4EE2A 1Y4WA 5FOJB 2BEOA 2J1EA 4JKLA 1IHMA 1EUUA 1O4ZA 3ZFGA 1AYN2 5FP4A 1FAYA 2C0ZA 1QJY3 2ZHLA 4X6RB 2VUAA 4CU6A 4Y1ZA 4F3JA 4Y1VA 2LW8A 4CXXA 2ZPXA 4FCAA 4QX0A 4IV1B 4D6RA 3CHXA 2FZ1A 3KS7A 2E26A 4NPLA 1EV13 3LEGA 1HRV3 3MW4A 3OYWB 4FOWA 4CDXC 5D1IA 1RUG3 5IVCA 3EO6A 2RJKA 2ZGSA 4LHLA 2B45X 2O0OA 3I2FA 4YG0A 4Q4W1 3RYRA 4E4DX 4LBKA 1RL3A 5FXZA 4EN6B 1RMU3 1W2TA 4ISQA 4CYDA 1AYN3 1X8EA 3ABZA 4PT6A 4E2SA 3HIFA 5DZGA 5EPAA 1W99A 1D0HA 2WLPA 4MG2A 2RMU1 1GQGA 4AQSA 1Q3EA 1YJKA 2BWCA 4DINB 2FDGA 1LJ7A 2CTVA 2R042 5JLVA 4YVSA 1QXJA 5FQ0A 4OUMA 5CB7A 2HYXA 2D7FA 3AMPA 3S5QA 4ASMB 4DZGA 2A6YA 3RYPA 4JZRA 1UX7A 1SLLA 3LAGA 4XVHA 1BXHA 1VMJA 2IC1A 2O8QA 5FZ7A 3WDVA 4PLNA 1VBD1 1RUNA 4Z8BA 4YW2A 3GBGA 2RS52 1GFF2 2EIDA 3EQEA 4QU2A 2XBO3 4HETA 1E57A 1WW5A 2YU1A 4GIQA 1YFXA 2R043 3NMBA 1DFQA 4XJWA 2HWB1 3WR0A 3I3EA 4GWIA 1COV2 1YQ5A 2VW2A 3KCYA 5FZ4A 5LCWL 1JHJA 3JZVA 3OBZA 1WKYA 5FY7A 1XE8A 3D0SA 4Y22A 4RGKA 1MZ5A 1HB2A 3ZPOA 2J22A 4YVSB 4BMBA 1ZREA 4E2QA 4CTEA 4FPEA 1DGWA 3INAA 1SCSA 2WNVB 5FMBA 3CMGA 4CDUA 1VLNA 3K77A 3H8UA 1N1YA 2FBEA 2DFBA 4QM9A 4B7KA 4NIHA 3UK9A 3LIGA 2DCZA 1W28A 4KH9A 3Q8CA 4E4HA 1X36A 2AH2A 2GC0A 2Z79A 1WZXA 4QXBA 1WMEA 3GCWA 1D4M2 5A32B 4DY3A 5HI0A 3AYEA 4M3CB 3WHTA 5F1RA 4YVSC 5LRRA 4XFBA 1BLZA 2GDFA 5CKNA 4A7ZA 5J98B 5BNOA 1W9SA 2K0GA 3ON7A 3HQXA 1OFNA 1IKQA 5I93A 2W91A 1W8NA 5BUVA 5CADA 1XNTA 3FUQA 1RUF3 1VB4A 3ZXAC 5KBFA 3OD4A 3H8OA 3WG3A 4YFZA 1HJGA 3NSTA 4FVVA 1UKRA 2NM1A 3ZFFB 2Y0OA 3UYJA 2WRAA 4FFFA 3WP6A 3M4FA 4B3NA 3PU3A 2GC2A 2VQAA 3THPA 3GZTB 4L11A 2XOMA 4FTEA 1J83A 3VBSB 3RVHA 2XKPA 4BQYA 4E4SA 1UZYA 2JE8A 4LK6A 3BPSA 1QJFA 4BH9A 1DYOA 2UWCA 3K3NA 1DQ2A 1H4HA 5FY4A 1COV1 1EP0A 4V2VA 4GWMA 2WQ8A 5BXXA 3CJIC 3GBFA 1RUF2 4KWLA 1MEC3 3LEMA 1QOTA 3VBUB 4AVTA 1CZSA 5C5UA 3IMNA 4GH4B 1CD3G 2GNDA 1A6CA 5I8YA 1YFYA 3LPFA 4H14A 1KEXA 1CJPA 4XF9A 3W5NA 2CL2A 3CO2A 3AX4A 1WW6A 3AZVA 2BVVA 3AJZA 5IVJA 4FTSA 1WUVA 3VKOA 3HT1A 5DABA 5FWJA 1SLTA 4MXWB 1D2QA 1RXGA 4NHLA 4AEDB 5BV6A 1K5MC 4YM0A 5JSPA 3RZMA 4O9GA 4CDWA 4CEYA 1L7RA 5FO7B 4IEVA 2NMNA 2WN3A 4Y33A 4OLLA 4XF1A 1UX6A 4GWJA 3SITA 4QDSA 2B7YA 3DYMA 4OUSA 2WZR1 4CDWC 4DXTA 5CG9A 2R49A 1K45A 2VVDA 4X8NA 1T2XA 1ULGA 1YQCA 5EQUA 5FLIA 1CVNA 1PMJX 3SC7X 4LOTA 2ZEWA 3RNSA 5EZWA 1RHI2 4I0BA 2ARAA 3ZYFA 2ZX3A 3OB8A 3O14A 1XYNA 4LHNA 3FJSA 4AFDA 4IEQA 3R05A 4AW7A 1G9DA 3KGLA 2W9XA 4WBBA 3W5MA 1O8PA 1BKZA 1V6JA 1V6OA 2C24A 3PUAA 4AF9A 1S55A 3WNXA 1GP6A 4RHV3 3IAQA 4UBHA 1ZZBA 5AC91 4LO4B 3A22A 1U12A 2WKKA 3MIHA 1PO23 1V00A 3VZLA 4MZUA 4FI9A 2GMMA 4CCNA 3D0JA 4AHWA 3E5XA 1DU3D 3MV11 2ILMA 5ERLA 3VZMA 2YGMA 5IFPA 4Z2AA 2BTVC 4KBZA 2WT2A 5C9AA 1AUYA 3T2TA 5BPXA 2BNMA 5FDBA 2ZABA 4KWJA 1QJU2 3OBTA 5ISLA 1GWMA 2WNUB 1D0GA 2QTWB 3KQ4B 5F3CA 1O6UA 4QQHA 4ZY9A 4V1PA 1JZ7A 3P1IA 5CFDA 2CDPA 5FPVA 5A3WA 1JYWA 3UETA 1NA1A 2WBKA 2IXJA 3VBFA 5BNPA 2D6NA 2OUHA 3EMRA 4DXZA 4GMP1 4OQ9A 4ZPIA 1GZTA 5IHRA 5BNNC 4YPJA 2MPFA 1OMIA 3D82A 3WNKA 4N7IA 1SLCA 1ONAA 1LOFA 5GKAC 2AEZA 2P2KA 4DY5A 2VUJA 2BFUS 2WT1A 1PZ8A 2QCSB 1FV2A 1QJU3 3DPRA 2QQOA 5C70A 2HH9A 2ZBJA 3CKHA 2V5YA 4DPNA 1CWPA 5GZFA 4C1WA 5J36A 3M70A 5C3PA 1H2NA 2Y38A 3DPRC 4HVOA 3BCWA 4JRLA 4GMP0 1H8TC 1F9KA 2GNBA 3LIHA 4RQPB 4XW3A 3GYDA 2WL1A 5L9BA 1VAVA 3DN7A 2ZGMA 3ILRA 4MV2A 1QOOA 1UOJA 5HXMA 1E5SA 2XQRA 2ZCWA 5L7OC 2BPA2 4IE5A 3RPQA 3T2OA 1HXS3 3AP6A 5DAPA 4UBGA 3N9NA 1WMXA 1C1LA 4OMDA 3RWKX 3BN6A 4CDWB 1OLQA 4PI2A 2VL4A 2CDOA 1FPN1 1R092 4N7UA 4WVZA 3AMNA 2GN7A 3EB7A 3MW3A 5C5TA 4IW3A 1OC1A 2XJPA 3P3PA 1LHNA 4QGLA 5L73A 1LKNA 1R1A1 5C3RA 1UCXA 2LM3A 4U36A 1AX1A 3O0XA 1XQNA 2WZR3 1UY0A 1ZA7A 4AQ6A 1KS4A 4LUKA 2PHDA 5HCFA 2VQ0A 3U1XA 1NXMA 1OQDA 4IXLA 3ORJA 2ARCA 2OX0A 4AFBA 5KHIA 1R64A 2J1RA 2LALA 3MIEA 4NIAA 3TNQA 3VBSC 2Q5TA 1AR73 5AC93 2VMEA 3KV4A 3WG1A 1O4YA 2HWE2 4O61A 5DDJ2 5FKCA 3HR9A 4BA6A 4G3YC 2K46A 2VOKA 4B8EA 3FE5A 3I2DA 3N7LA 4Q26A 2V5DA 1UXZA 1K3IA 3I4IA 3ECQA 1U5IA 2ID4A 3VBRB 1UZZA 4QHBA 3SCFA 4K21A 3WF1A 4QDRA 5LA1A 3ME2A 2WABA 1RINA 5ACA1 1D7PM 4AVVA 3HNBM 1W8TA 2WZ8A 3U4SA 4DOUA 1W6OA 2D5HA 4NAMA 4W6WA 3DL3A 3T4VA 1JU3A 3M3QA 4QPWA 3MEPA 4Q4Y1 1GP4A 1UOGA 3W9AA 4ES8A 1GZWA 5AC92 1RJ8A 1YUDA 1UY2A 3WDTA 2EVXA 1NLSA 4FTBA 2JECA 1VB2A 2VZPA 3FHQA 1JS9A 2NYYA 3A21A 5FYIA 5E88A 3VLBB 4KU8A 1FPN2 1K5MA 3AZZA 4D69A 1IS4A 3AFKA 3O1VA 4BDVB 3A0KA 3B9CA 3BTXA 4GAZA 1H9PA 3URFA 2WNVC 5JOXA 1NCRB 1MQTC 1OLME 1S1AA 1TME1 3KM5A 2W08A 3UKVA 2BP6A 2XONA 3USUB 4GA9A 3I2HA 5FK8A 4ASKA 1Q8PA 2HEVF 1G9BA 2YZ4A 3LCPA 3JB8A 2RS51 5BNPB 2WNVA 2QE3A 5FPXA 4NPRA 2D97A 2QQLA 5LATA 4HANA 3M1HA 4I0AA 1CAVB 4FO9A 2KR2A 4JDNA 5DAXA 2VZQA 2RJLA 5A3TA 5JR2A 3AZYA 1VBE2 1GOGA 1JTZX 2JEMA 2QJVA 1QY4A 3APBA 3FBYA 3USUA 4YW4A 2G9FA 3N7KA 1R083 4WVMB 3F95A 2Z42A 1UYZA 2VY0A 1IPKA 3GDBA 5A70A 1ENRA 1UYYA 4BXSV 5T5LA 2JB4A 3T0BA 5FPZA 4XETA 2J7MA 5GZEA 3VDDA 2VVFA 2E51A 1I3HA 1VBD2 1IS3A 2HWE1 3H1YA 3NJYA 4SLIA 4OVEA 2PAMA 4LHSA 4V2WA 2E31A 4YW5A 1BHGA 2LS6A 1LGNA 5J37A 2JDMA 2BZDA 3ASIA 2E33A 3AYAA 2O8OA 1C1FA 3C7FA 5A3UA 4QGMA 2FD8A 4O7XA 2QZ2A 1UKGA 2IUWA 4LBJA 4LO5B 5I0UA 5A3PA 1UXXX 5T5OA 2Q1FA 1W9FA 2VZUA 3AKRA 1H1AA 3LFMA 4BQXA 4BHPA 3WP5A 2ZGOA 1H0BA 2XL7A 5FY5A 4CEYC 5CBLA 2RR13 3CL1A 1QMJA 2KXLA 2WDBA 3MIBA 4HKWA 1LEMA 1MS5A 3NKGA 3T1MA 2JD4A 2JG9B 2HWB3 4ZZ8A 3O1OA 5LW9A 1VR3A 4AGGA 4B4QA 2Y6FA 2FDHA 1ZBE2 4GMP3 1OQEA 1YHFA 3BPZA 3GCXA 3MYXA 1ZYBA 3I2IA 5IYYA 1QEXA 4QB1A 5FYUA 1S0EA 1ZM1A 1V6KA 4FPCA 4P9YA 4GXLA 1OPMA 1VALA 4RFT0 2WIIB 4COZA 3AZXA 2W0XA 3HOBA 5GLZA 5CAZA 5I91A 1O3SA 2W3JA 2G4IA 2JG9C 4W6XA 4YM2A 4FPYA 2JDNA 2L9LA 4Z92B 2HWB2 1MR5A 4YLZA 1WLTA 1SLIA 5FXVA 3THTA 1V6MA 3GBWA 1AR62 2VOXA 4QPGA 4D8MA 3TRSB 3AKSA 2VMCA 1F2NA 1H2KA 4Q4Y2 4NRQA 2MEV2 5CFCC 4ARXA 2NN8A 2JXAA 3TNPB 5I8SA 4D7TA 4Q4W3 4MH0E 1GNHA 1PO21 4XUTA 5ANNA 3JBG2 3QCWA 4PIXA 4HPKB 4RHV1 4X8PA 5IK8A 2RDNA 1HRV1 2D93A 1HXS1 4Y26A 5EP9A 1F4HA 5FV3A 4XC9A 1URXA 4NIGA 1VBA2 4E8DA 4Y24A 1DGRA 5FO9B 2VZTA 3TEZA 1O3RA 4TSVA 3ZFEA 5LA0A 4AAXA 4RN5A 1DDLA 1SBEA 2PLV3 1LNSA 4AEMA 3T0AA 1G86A 2GALA 1LOBA 2PAKA 2HWD3 4UW4A 2YB7A 3ILFA 4XTMA 5F5AA 3ZO0B 3ZLIA 4Q4W2 4HSJA 3TWIA 1RUC2 2Z5WA 1PK6A 3NV4A 3JCIA 3VBHA 5IATA 1RC6A 1UW8A 2UYAA 2VCBA 4S2DA 4IE7A 4UFKA 1ZZCA 2JDAA 3ZN5A 1JZ3A 4KWKA 4OULA 5BNNA 2HWC3 1SCRA 2A3YA 2RVAA 1W6NA 3MF9A 4CSWA 3UNPA 1DYKA 1XNBA 4XPVA 5FYVA 2C4XA 2Y26A 1EPWA 4JC1A 5GLWA 3PUIA 3VBFB 1BMV2 3O1PA 3D5OA 3B3QE 3RZJA 3KVBA 2A1XA 3RDIA 1AVBA 2RS11 2ZHNA 3NAPC 1O8SA 1SMVA 2XHNA 4CP9A 2PFWA 3Q8EA 2XBO1 1TE1B 3OY8A 5FPLA 3IDAA 3KSCA 3L9JT 1ULOA 1RHI1 2RS31 4D7YA 4NUBA 1F5JA 2D6OX 5FY0A 2PHTA 4Y5SA 4K20A 4YVWB 1HRV2 5C3QA 4BOWA 1O91A 1RUG2 2JG8B 5LBBA 2Q8DA 1M06G 1JUIA 4R9CA 3UKNA 1EUTA 2PHRA 4C91A 3NV2A 5F7UA 1HB3A 4E8CA 4GALA 4DB5A 4PDWB 2ZX0A 1MVQA 4Z82A 1JMUB 5JMCA 1PGL2 2GNTA 4C1XA 1X50A 1E5RA 1NAEA 2I2SA 4Q1RA 5FYYA 3S5AA 4JDOA 3OGSA 4N53B 4XJUA 1LAJA 5FZOA 1QJX3 2VOVA 4FQ4A 4M00A 1JUHA 5EJ3A 5CISA 1XOYA 1MS3A 4HKLA 4LLFA 4Y1XA 3W58A 5H9SA 1LESA 3A23A 1YQ2A 3EJKA 1GP5A 1W0PA 1FOD1 5D21A 3TN91 1BMV1 1EAH2 2RS53 4QQ2A 3LWCA 5GALA 4BMEA 2WFF2 4OHWA 1QJY2 2JX9A 4NIIA 1CIWA 1BEV1 1J1LA 1QGLA 3N36A 3POIA 3WNPA 5A33A 1OI6A 2VXJA 3AC0A 2CYFA 1S0FA 2ENRA 4XJ8A 1HW5A 4IE0A 4LOSA 4LKSA 4P9JA 4YW6A 3I3DA 1QDCA 5I0RA 3U4XA 2QQMA 3GZAA 2QVSB 2E63A 3E1F1 5F5CA 4IEWA 5K0UA 3R0RA 4IESA 4PBPA 5LWBA 4DXRA 5CNAA 5E16A 1ASJ1 2G1MA 5A7NA 3KCXA 3MZHA 1ZRRA 1RMU2 3WY6A 1OF4A 3T2QA 3USSA 1R1ZA 1RUJ3 2VZOA 2WFF3 2Y0IA 3T1LA 3A0NA 5C8WA 3VL8A 2YROA 5FO8B 1MS4A 3IAPA 1F15A 4CEWC 2CU5A 1POV1 1J3PA 1QIQA 3B93A 3TEWA 4UW3A 4WVVA 1W2NA 2Q30A 4BQ5A 5FP9A 1HLCA 3I2GA 4AI2A 3FFQA 1NCRC 3ZIWA 5FXWA 4A7YA 1WCKA 1IKPA 5FPBA 3PUHA 3T08A 4KL1A 1DQ0A 4N9HA 5A7WA 1VRBA 2HKXA 2NZ9A 3LSDA 5CFCA 3FLTA 5JZGB 3OUIA 2VECA 1LR5A 2DTYA 5FR3A 5T52A 3W20A 2JDKA 4TLFA 4MGYE 1H1IA 1R091 1PX4A 1QNYA 2W46A 3N9OA 1C57A 4B7EA 2EXHA 1LOGA 4RSUA 2R063 3RI9A 4FPFA 4CCDA 1E5HA 5JOYA 1RUD1 1WCDJ 4QB2A 2XJTA 3IMMA 5KHHA 3CIHA 2VNRA 3J7NA 5FPAA 5KXEA 2VZ3A 3ATGA 4QWNA 1YEWA 2GP3A 2WZPP 1AYM3 4FPOB 5CFCB 2WSUA 4AGVA 3K3OA 3T30A 4BLJA 1RUD2 4CDUC 3NNLA 3EXUA 4FQZA 4MGQA 3WG2A 5CG8A 4NO4A 1KFUL 4CVUA 3VKFC 4BK4A 2ZX1A 4LO6B 1ZBA2 2ZGKA 5EXOA 3B00A 3V56A 3ZN6A 5KXDA 1WMDA 3UL2A 4EN0A 3U0ZA 3HNMA 3E6DA 4HN0A 1Q8VA 4LTAA 1HJFA 4FOVA 1OUXA 5HCHA 1RUH2 2AACA 3PIGA 5J3UA 1IPJA 1HB1A 1V9U1 2B4KA 3SH5A 2E9QA 4K8RB 1RUD3 2ZGTA 1I9RA 3LQCA 2IVJA 3KT1A 4HMZA 2PHUA 3K2OA 2VCCA 1CZVA 4G9SB 4M3CF 4AQTA 2JG8A 4GB31 4HXCA 2W5FA 2E53A 2H6CA 2J42A 4KBBA 4NPMA 4PCRA 1N3OA 1VRH1 1ZBA3 3J26N 3N4MA 1RUI3 1I1EA 2CAUA 1ND3B 2R041 1UD1A 3V0BB 2ZGNA 1DGRN 4TLGA 2VBPA 2JE9A 4AEDA 3D6EA 4YYOA 1RIRA 1SPPB 3VHRA 5FY1A 3VZNA 3IIAA 3WG4A 1NCQA 3WEZA 2D6KA 2WUHA 3AXEA 1MEC2 1WCUA 1YI7A 4KI5M 5FY9A 1NE6A 3H0OA 4UWDA 3UESA 2X10A 1AJKA 4DUVA 3PTYA 5E89A 3SEPA 1NKGA 1PO22 2EIEA 4BIFA 2RJ2A 2WFF1 1EYBA 4R9AA 3CQOA 4PF1A 3MLJA 1LOFC 1CGPA 1PNFA 3OYWA 2W1WA 1AL23 4RR3A 2AUYA 2NPIA 1XSRA 1WA4A 5LEJA 1GMMA 2B9VA 2YMZA 3VHNA 1S0DA 3POEA 5A7PA 5H9QA 3PVEA 1A3KA 2WNUC 2UY8A 3OEBA 1TME3 2Q8EA 3WVJA 1Y7BA 3VD5A 1ULDA 3H1WA 4UFIA 2JDHA 2Q8CA 3TBDA 4CP9B 4JQRA 5LK7B 5BNOB 4XZUG 3AYDA 1CPMA 1AL22 3Q8BA 5EHDA 4EN7B 2ET1A 3U11A 1IOAA 1O5LA 1RHI3 4LE3A 1RVF1 1PGL1 3GHNA 3VKMA 3WDUA 4AEDC 4E2GA 4UFJA 3P5BA 2UWBA 3S0MA 3WLUA 2RDQA 2WNOA 1MS0A 1KJLA 2RMU2 5F5IA 2QQJA 2RM22 3CZUA 3BOWA 4TTGA 3WDXA 5LASA 2VMHA 1FOD2 2DBNA 3B69A 3NNGA 1V9U2 3TN92 5JCTA 1SFNA 1TMF3 5JWPA 4W50A 2FCTA 4MUVA 5C9AB 1YNAA 5K0UC 2JJ6A 2YYOA 4Y3OA 4HK8A 4Y1YA 5ACA3 1W6QA 2HBTA 4R9DA 3MFCA 3ZXKA 1A8MA 3RMXA 4A42A 4QHOA 1HQNA 4HL0A 1C28A 1N1TA 2CWSA 4P9WA 5F39A 2D6PA 4YGCA 2W39A 4LBLA 1ND2C 2BDRA 2WO2A 3KT4A 1TEIA 4KMQA 1PGSA 1BEV3 3ZDVA 1BJQA 1W2UA 3HQRA 3MW2A 1JYNA 4QAWA 2WO1A 4Q4X1 4NMIA 4BCUA 1FOD3 3TN93 2OPKA 4R52A 2ZZJA 4XILA 1OOPC 4YZ4A 4MGIE 1VMFA 2GNMA 1KQRA 4B1MA 2W87A 1LU2A 2D6LX 2GZWA 2QQNA 1ZVFA 1QJZA 5J48A 2VMIA 3AKPA 4ET7A 2PHLA 1RUOA 3VHPA 3A7QA 3O1TA 1ALYA 5A6YA 3PJQA 1REDA 3IDCB 3UT0A 2UU8A 3WXPA 4MLOA 5LA9A 1OURA 5FZCA 5KHKA 3PU8A 3T2PA 3ZIXA 2LROA 1RJ7A 3VBSA 5TSWA 3I3MA 2JIGA 1LU1A 4XAEA 3PUQA 1IQAA 5IVFA 4AXOA 3VBRC 1PVXA 4N43B 4WM8A 3IPVB 1EY2A 5GZCA 1ZA4A 4A41A 4GJYA 4FPLA 1NT0A 1ODMA 5KHJA 2ZAAA 3OBRA 3E6BA 2R16A 4KNCA 4QX3A 2PHWA 4GH4A 1WLCA 5C6CA 1UNBA 3M8LA 3VKNA 4URAA 1NCQB 2E32A 3WZ1A 4XIOA 1LRHA 2DU1A 3KZ4C 4Y20B 3PMEA 1BBT2 1F31A 1FYUA 5FUPA 4L0PA 4HSLA 4JGYB 3B94A 3NNFA 1R093 1CAXB 2XVKA 4D7SA 4EQVA 1Q56A 4EN9B 4CDQB 3VBUC 4WM8C 1HRI3 3POWA 3IB3A 5SV5A 1I5PA 4XE9A 4C0HA 1G6NA 4FSJA 1XBFA 4OQ8A 2BOIA 1DG6A 1QJU1 1JZ4A 2FCUA 2XWBB 1GLHA 1BVP1 3GF6A 1ND3C 1GZCA 3CU7A 4Q4V1 4QPIC 1SLBA 3WX5A 1VIWB 2V09A 2ZGUA 3BVCA 5ABJC 3RZHA 4I3GA 3VZKA 1SDDB 2OQ6A 4F83A 2HWE3 1XSQA 1WCQA 1DZRA 3SQOA 3FN9A 3WQ7A 2DCYA 2R0HA 4PBOA 5T50A 1G9FA 3T4HB 3WNLA 2XJQA 4XUQA 3SHRA 4A6OA 2R30A 1SACA 4DNYA 1F4AA 1OLRA 3LA3A 1QH6A 3ZSLA 1ENXA 2OVUA 4HONA 3ZXEA 4P00B 3BGAA 4NOTA 1PO12 2OZ6A 4ZS3A 4MGTA 1VBE3 3WUDA 2CAVA 2QQPA 5J09A 1N3PA 3PLQA 4KG8A 1QDOA 3C7GA 4JHTA 1RUH1 4B4RA 2YC2A 5LZ6A 1UU5A 3DECA 4UW6A 1AYN1 4AK3A 5DDJ1 1RMU1 4YZ2A 2FDKA 2NQYA 5F3IA 4URTA 3WQBA 1LODA 4NIDA 3ITQA 5FYTA 2DDUA 5JOZA 2EALA 3CEWA 1GANA 2C1FA 1NA1C 4AZZA 2A5ZA 3ZFFC 1ZRDA 3IWZA 5APAA 1PO13 3BTYA 1MVEA 4XYXA 3NJXA 1QNWA 3OGGA 2RDRA 4NN0A 3BTAA 3PHMA 4QM8A 5C8CB 4FPJA 2BGPA 1IQDC 3MBWA 1KGYA 2VH9A 2YUEA 3NV3A 3BKZA 1W8WA 3MV01 2DV9A 2WS93 2PQSA 2E7QA 4GKYA 3ROUA 2F4LA 4XF3A 4N43C 1DF0A 2X5IB 1E5IA 3VHOA 4OFGA 2J1UA 4HN1A 4CCMA 2MEV1 3FFZA 2AYHA 4UF0B 1QKQA 1OKQA 2LTNA 2ZMLA 1AXKA 1SBDA 1ASJ2 2ZX2A 4UYBA 5CKQA 4YG3A 3SCGA 3CLPA 4LBNA 5BNNB 4OI2A 5T55A 2IFWA 1A34A 2D44A 2DUOA 4L97A 1DLCA 5FZIA 3H7JA 3ZN6B 3ZR5A 1W9YA 1ZBE3 2QQKA 3M3IA 4AFMA 5I0DA 4DUWA 3ZYBA 1JHNA 2WS92 1RGSA 3GXUA 1VBB2 3NV1A 1SEFA 4NHXA 3MPPG 1AZDA 5A33B 3H8RA 1IGOA 1ZZ9A 1RUI1 4A45A 2Y64A 3WF4A 2ARBA 1TMF1 1ASJ3 1S2EA 1LHWA 1Z7S2 4UW5A 2WS91 4LKFA 1W8ZA 2V4AA 1YFUA 2WZEA 4QT6A 4IV1C 1PGW2 4A2UA 1LOAA 3I3QA 1B09A 4ORFA 4L8QA 4J1WA 2CWMA 2W95A 4QB6A 2O14A 2VW1A 3J8F1 3JB4C 4NRPA 1QU0A 2A71A 4XTPA 5L19A 2MEV3 1VBB3 2BRTA 2A6VA 3R4SA 3RS6A 1AR83 1PVC1 2A3XA 3N9PA 3PMSA 5FYCA 1OT5A 1R1A3 4OHVA 1G9AA 3RJRA 1W05A 5A3MA 2P6CA 3JBG3 4JQTA 1RXFA 4NWWA 5JR7B 4AI0A 4PIZA 1YLLA 2HEWF 1ZZ8A 3B5LB 2W92A 2GC3A 3NO8A 3TOJA 1VBA3 2DCKA 4H7LA 4YM1A 4QKBA 1GU3A 4XJ9A 5DAWA 2X53S 2JDPA 2Q1MA 2P4EA 3GJBA 3BB6A 3H42B 1UMHA 3ZFEC 3BYWA 1KS5A 3LFIA 3FX3A 1R1A2 5A6XA 2XLFA 4BK5A 2R073 4GH4C 1FV3A 1S0BA 2XJRA 4ONUA 1Y3TA 2CGNA 1H8TA 2BNOA 4RA0A 3PVBB 3ZYPA 3OJBA 3LDRA 2HLEA 1W90A 1VP6A 1VBE1 3VDDB 4HFSA 3WNMA 1Y9QA 5HCAA 3B9IA 5CFDB 3ZR6A 1X7NA 1DIWA 4GB32 3AVRA 4JVAA 3FHIB 2N7GA 4XBNA 4ZXKA 4FAHA 2GC1A 3O1RA 4FP2A 4S2HA 3ENRA 2VZSA 1PMIA 4EWEA 5HXVA 4AI3A 4EWAA 3GZEA 1FMD2 3FWEA 3KQRA 1PX3A 2R072 5F2WA 2AREA 3MLLA 3AK0A 1XNAA 4ARYA 1PVC2 3VBHB 4CUAA 4AI9A 3E97A 1TZOA 2RDSA 5EJZB 3DGTA 1QXPA 4IGQA 4IE4A 1VRH3 1ZBA1 3ZSKA 3RJ2X 5IUQA 4AHXA 3S7EA 1RUJ1 3AP5A 4QHZA 4ZU7A 3O1MA 1XNCA 2YPDA 4GB33 4AVSA 4AVAA 1XYPA 4EROA 1HV1A 1VAKA 4XCBA 5FZ1A 3U37A 3MDPA 1J1TA 1TNRA 2C9KA 1JBCA 2Y6GA 2UWAA 2KM2A 2SBAA 3HT2A 5IWFA 4AVCA 1JZ8A 5JDBA 1RUG1 4QPGC 3THDA 3NQHA 1VE0A 4FBFA 1EV11 2CGPA 1O5UA 3NJZA 5DXDA 1DQ4A 1RTVA 2BGCA 3UGHA 1QJX2 4CEWB 2Z4FA 3BODA 4WM7A 2ETEA 2B42B 1CESA 3P6BA 3VD3A 1LENA 1OA4A 3VBUA 3VD7A 4AR2A 5J96B 2W1SA 3VGIA 2P3YA 1GYKA 4DEVA 5DG2A 2C5DA 5BNPC 4DFSA 3I3BA 4LK7A 3ACHA 1EAH3 4BQWA 3VUOA 2RS12 1S4CA 4QPGB 5B4XA 1NUKA 1ND2B 2YGLA 1QJX1 1OPOA 1NLQA 1KITA 2W1QA 2TUNA 3AMHA 5AVPA 2EXIA 5F8PA 1PIV2 3O0WA 3M7AA 1XXNA 3ZVXA 5C4WC 5DZEA 3B01A 2WQZC 1AR81 2XJSA 3I97A 3QLQA 4Q4X2 1VAMA 2XR4A 2WINB 2CSGA 1OOPA 5JPNB 3J8F3 4BIOA 4EV0A 1YO8A 4CA9A 3HMYA 4IGPA 3T3YA 3IPVA 4IUGA 2OKXA 1RUJ2 4D3WA 2Z2SB 1L7LA 1BCXA 4INDA 3H3LA 2YBSA 3N35A 4WM8B 2DWRA 2JENA 3WF2A 3CNAA 2QFEA 3I2JA 5A1LA 1VBA1 4IEPA 4N9IA 1EV12 4IL7A 4A44A 1UPIA 3ZYIB 4C8DA 2R7EB 3VDDC 4QQPA 4B1LA 2PAEA 3O0VA 5FAXA 5FZLA 1G8WA 4DQAA 1BZWA 1QQP2 4A3XA 4CUGA 5JZGC 3R4UA 3PL0A 4DUXA 1D4VB 5FPUA 3DF0A 1RUC1 2DYCA 2VULA 3RZZA 2HWC1 5DN2A 3K75B 5JUVA 2A73B 2Y6KA 4DRVA 2J1VA 2CV6A 2R062 4LMFA 1ZX5A 5FJHA 2BGOA 1K12A 1J59A 3TEXA 1CR7A 5I0TA 1MQTB 2DUPA 4LXLA 5CA6A 4MGKE 1JW6A 1JN2P 1UPSA 2EA7A 2IXKA 2WLQA 2BOJA 2DF7A 1QQP3 3R4DB 3KV5A 3JQWA 4P5HA 4YG6A 4YW1A 5FTTC 1AYM2 1ZRIA 3NL1A 4ZKTB 1KJRA 3ACIA 2P6HA 2OUJA 4LO7A 3E5UA 4H3WA 1ZZ7A 4XFCA 2JWPA 5FOBB 2B39A 4CXWA 5BYNA 5KXBA 1COV3 2GMPA 1DZTA 4DO0A 2IXHA 5C71A 1NA1B 4WM7C 4G4FA 3O1SA 2VD7A 1RUH3 3NJVA 3AXDA 2UYBA 3A4UA 1UOBA 4AL9A 4RD7A 4CPBD 3S7IA 1NG0A 4XIKA 3C3VA 4QQOA 4P9IA 3VD9A 4BXFA 2OPWA 5JSOA 3FZ3A 2ZGLA 1AJOA 2XGXA 5FYMA 2VQUA 3KT7A 3SCHA 1RUI2 4XXAA 3SXWA 4FPGA 3EHKA 2O1QA 1NX9A 4WM7B 1PO11 2DCTA 3G6JB 1V0AA 2IWGB 4JRAA 5A3OA 2XVLA 4LLOA 5FYHA 1OBNA 1PMHX 3MPBA 4LHKA 4M3CE 4CCOA 1OD5A 3OSDA 2UY9A 4J6GA 2Z69A 4I30A 2IXCA 4KWUA 3ZFGB 2MNGA 3RZLA 1XNDA 1GWKA 4CXYA 3DCQA 4UT5A 2TBVA 3RWNA 3ZXDA 4MHUA 1O7FA 4CU9A 5IVVA 1C5HA 3UV9A 3ZMOA 1Q43A 1H9WA 3ES1A 4N53C 2JG9A 2YFZA 3K46A 3M3OA 4XUOA 1CAXA 2JICA 4ZU4A 1IPSA 2ADDA 4AG4A 4BQ4A 5JAXA 1HRI1 1U5XA 2A75A 4Q4V3 1PHMA 3LE0A 4M4RA 5KHGA 2AEYA 4XJAA 1NZCA 3MGUA 5IW0A 3WT3A 4CDQA 4YM3A 5FREA 2X29A 2VBDA 4EZ4A 3C7HA 3POGA 1QF3A 3EYPA 4ITCA 4QXHA 3BOPA 4MSVA 1LULA 4N53A 5DG1A 4AI8A 2KD7A 3UGGA 5FKBA 3JD71 3PTRB 3GJAA 2D3PA 5GZGA 2HJIA 3I2KA 2IXIA 4OI0A 2VMFA 2PXJA 2WA4A 3HEIA 4Q4V2 1JOPA 4IEYA 1GNYA 1H8VA 4EN8B 1PK6C 4J1XA 1GUIA 1UY3A 5EYXA 2ZTNA 5LBFA 5C7GA 2XUEA 3OUJA 5B4NA 4E27A 1RUE3 2FMDA 1H30A 3IT8A 1OLMA 4TWTA 4XBLA 5FFOC 3K4AA 1ZRFA 3KF3A 5K0UB 1J58A 2QDRA 3B7MA 4KG0A 2OS2A 1DGWX 2H6BA 4P9GA 5CYYA 4PQ9A 3FLPA 4MO3M 3O1UA 5H9PA 1GQPA 5DZFA 4Q8KA 4LBQB 1PGW1 4XUPA 1HDKA 2CNAA 3WDYA 1ULCA 5FMOS 2DCJA 1IG3A 4JTOA 3ZDSA 5CIRA 4XF4A 1W6NB 2JD9A 2DFCA 3RYKA 2D43A 4BZ4A 1XYOA 3OPZA 1NLRA 5JIUA 3OPTA 3VDBA 1UF2C 1UY4A 4RFRB 4QX1A 2EIBA 5FZ8A 3DKWA 3MUZ1 5SV8A 3OEAA 4YGDA 1W6QB 4BU2A 2OYZA 4UOJA 1POV3 2P34A 5A7QA 3M3CA 2VU9A 1GSLA 3JU9A 3GALA 1ULPA 2XMLA 4K7JA 5FUNA 4M3CA 3WQ0A 5JXGA 3POBA 5C4WB 2P3KA 2G9ZA 1AF9A 4I0WB 1X33A 1YCIA 3K51A 5A80A 4QD2A 5GM0A 2YXSA 2ZOEB 3AL6A 2F6BA 2YHJA 1WCSA 2BWAA 4CP0A 2ZMNA 5B2GB 1UMIA 4MXVA 2ZEXA 3I7DA 1UN1A 2BVBA 2XL9A 1RVF2 2VOWA 3ZPYA 3POSA 2YBPA 5T5JA 4JCKA 5GZDA 2E7AA 2ZZQA 1U5YA 5FZHA 2H0BA 3MIFA 5EIYB 1PM4A 5G05L 1CONA 1F5FA 2I45A 4Z07A 3VBOA 2QQVA 1AR72 1AHSA 4BB3A 3UJQA 1SDWA 5DDJ3 1W6MA 2FDJA 4GJZA 4RR3C 2W94A 4NR1A 2HWF1 5FZGA 2LUWA 4NHYA 2UURA 1UIKA 5JXIA 2BNNA 5K9YA 2VE1A 3KV6A 4O65A 3DXTA 1RVF3 1J3RA 1S2KA 4IV3C 2QUOA 2XKOA 4LBOA 3QBQA 3JD73 2B8MA 3MICA 2XQXA 1MS1A 3ZMNA 4CEYB 1Q5OA 3OGJA 5FMDA 3V0BA 4OZOA 4Y20A 3RG0A 1W39A 1W6MB 1ULEA 4KU7A 3OGVA 4I09A 2VZVA 4FPHA 2G9GA 1YWKA 4B4PA 3UGFA 1LEDA 2BW8A 3ZXJA 2WZR2 2RM21 1WBFA 3RQ0A 5LRSA 2RHPA 2IVIB 1W9WA 5FQ0B 4HVQA 5HPOA 5A7WB 1UU6A 1BBT3 4DEQA 3NAPA 3RFRA 1KDMA 4QGNA 2E7TA 4Q8LA 1TG7A 5D2AA 5A6QA 2VCMA 1OD3A 1PZ7A 1W3XA 2R32A 1LOCA 3OG2A 3J7LA 4BQ1A 3FUOA 3N7MA 3RZKA 1MEC1 3LEIA 1AR71 1NYWA 2BUKA 4FPKA 1CAVA 5JVVA 4YGEA 3AJYA 5FLJA 4HOOA 3H50A 4JX0A 4LNVA 5GLUA 3T09A 4YZ5A 4RS5C 5D8AA 4P5YA 2J1TA 1NE4A 2H0VA 3OTFA 3RMYA 5BY5A 4AI1A 3NWKA 3WW1A 3HPNA 3J9SA 3KLSA 4FXKB 4UXAA 5DQ0A 3SEEA 3IDBB 2CY6A 3ZXGA 2A70A 3NVCA 1YI9A 4OMCA 1CJDA 4GULA 4QKFA 3W59A 3ZXLA 1OA2A 5H9RA 4IEUA 4WZCA 4OZXA 3SISA 2PTMA 4IEXA 3KGZA 2XLGA 1LGCA 4A7KA 3D3AA 4RS5A 1H8TB 5D8AC 4LT5A 3VB9A 4Q1PA 3QH7A 4R9BA 5F3GA 4JDMA 5F3EA 4MYEA 5JI7A 3U14A 4AYUA 4XDOA 5FP7A 4HVRA 5CKMA 1T6BX 4BWOA 4R8HA 5L9RA 3KD4A 3PVOA 4M4PA 1N1VA 2P5BA 2RR11 4EWDA 2WJSA 2EXJA 4OHZA 4ASLA 1H1MA 4EJRA 3PURA 1V70A 4LIVA 4NROA 3ZKUA 2XJVA 4XMAA 4CU8A 1A78A 4UFHA 1YFWA 1ODNA 2R6QA 1DHKB 1DQ6A 2ZXQA 1Q8SA 1AR93 2VW0A 4IGOA 3H8XA 4GWNA 3ES4A 1OFSA 4CUCA 1C8NA 2G19A 3KV9A 3PVNA 1SFYA 4YVWC 3AMMA 3M3EA 1DQ1A 2P17A 4K1YA 3U07A 2JKBA 4L9BA 3LEKA 1XRUA 3UJOA 1C3HA 4NJ4A 4M01A 2ZHKA 4Q0UA 2HWF2 2QDNA 1N47A 1UZ0A 2YG0A 1MS8A 1VBD3 1VJ2A 2BFUL 5FZDA 2WWSA 2CHHA 2OZJA 1ENSA 3AL5A 4OCTA 5F37A 1VPHA 4CZSA 3HNYM 4D0QA 1R081 3BU0A 1GR3A 4MXWA 5LEKA 4H55A 2PQQA 4JGYC 3I54A 1X8MA 2EAKA 5FLHA 2Q4SA 1LOEA 4NHKA 1P8JA 5FZOB 4Q4Y3 3VZOA 5IVBA 3ZFGC 3HWJA 3HAGA 4OHXA 1MACA 1O3TA 1AXZA 4HZFA 2VR4A 3KWVA 1JXNA 4IEZA 3VV1A 1UU4A 1NQJA 4ZZ5A 1JYXA 4A6SA 1WMFA 4BM8A 4IERA 5J1XA 3LSEA 5DAQA 2RR12 4LORA 2DTWA 5DUXA 1JZ2A 5T54A 4FAGA 3LA7A 5FP3A 4QPIB 5FIXA 3I49A 2AZ5A 3ZX7A 3Q9OA 1LB2A 4UFMA 1JYIA 1JU4A 3DPRB 3TYJA 1QXRA 3FL7A 5C33A 2F4PA 3BTZA 1LCLA 1X9PA 2VCAA 1Z0HA 3LF7A 4FFGA 5E6HA 1AR82 1BVVA 2QBXA 2VUCA 3BU7A 2AGSA 3RGBA 5JSRA 1ACCA 4TN7A 1CX1A 3LZZA 1QJY1 2VMDA 2VNOA 1H4GA 1ZZ6A 2WYFA 4B29A 5J7MA 1W9TA 1S0CA 5L7OB 2RS33 4L2NA 4L92A 4HKOA 5C8CA 2AENA 3WNNA 1YYNA 5HBAA 1AX2A 1SFPA 1NY71 2GN3A 2NLRA 3GHMA 3P3NA 4KGGA 2ADEA 5FXXA 1JYCA 2A6WA 4LJHA 2E6VA 4AQ2A 5IFTA 3IZOA 4CUBA 1UYXA 2JDUA 3ZYJB 5FZFA 4BLIA 4MGZE 2F17A 3WINE 3S57A 4FOYA 4Q29A 5KC5A 4QDQA 5FCCA 3VL9A 2C26A 2P1BA 1W2AX 3SLIA 3RI8A 5K7PA 1OUSA 3IKWA 5L7OA 1SLAA 1UL9A 3PDQA 2HYKA 1PM7A 2Q8OA 4CDXB 4UFLA 1ZBE1 2GMEA 1HKDA 1J3QA 1REEA 2X8KA 1VBC2 3L2YA 4F7ZA 3GZUC 3FLRA 1GWLA 4M0NA 4YARA 4BPZA 2WFPA 1JH5A 4MADA 1FX5A 2ZGRA 4IE6A 1O59A 3E6CC 3HQUA 4AE2A 5LY1A 1RUC3 3C7OA 1AL0G 2BYVE 5E1RA 2AR6A 3OOXA 4S2FA 4ZS2A 3ZFEB 4D6SA 4Z1VA 1PIV3 1X82A 4HT1T 3K4DA 1C8M3 3MIGA 4LA3A 2IZWA 3CZJA 2HWC2 3IBMA 1VRH2 2PLV1 5A7SA 3AKTA 1RITA 1VBC3 3MO4A 4CP1A 4I02A 4EZHA 2C9AA 5BNQA 1XB9A 1BYHA 4Y1UA 4DRRA 2A6ZA 2PHXA 5K8SA 1XE7A 4PLOA 1W6OB 4XXPA 3ZYGA 1EAH1 2DUQA 1LHOA 2ZHMA 4OI4A 4QX5A 4UF0A 2QZ3A 1GICA 1GKBA 1J84A 4K8FA 4OHYA 1DLLA 3WUCA 3VZJA 5GLVA 1C8M2 1OVSA 4AEJA 3O7OA 3OF1A 5FMOL 4AVBA 3RRDA 3ZN4A 3WW2A 2VZ1A 1TNFA 5A1AA 1XJAA 2Y60A 3SNMA 2OXBA 3ZYRA 5C9AC 1DZQA 1UQXA 1N1SA 3NNMA 2VTXA 3WNOA 3HN3A 5IK5A 3N3HA 4JKKA 2XXZA 4HK9A 1LTEA 5EV7A 3AB0A 2NMOA 2BV4A 3VBOB 1VBC1 1RB8G 3HBZA 5IJRA 4IV1A 1HN0A 1Q8OA 3WDWA 1LHUA 4CCCA 1W8OA 1FT9A 4RL7A 3WSOA 5IT6A 1YRZA 1W0NA 1WD4A 2VTFA 1PIV1 4R4XA 2PMWB 2XH6A 4S2GA 4XACA 1HQWA 2NP0A 2DVGA 3HJRA 1I6XA 5FYBA 1WBLA 2X09A 2XUMA 5DUUA 3ACLA 3LDKA 4Q0SA 4Q4X3 2XVGA 3VKLA 1W3VA 2X05A 1W04A 4LBQA 3VBOC 4HPKA 3C8XA 2KA3A 2OA2A 4ISRA 4HBNA 4FXGB 5LY2A 2ZX4A 1JI6A 5C3SA 1DYPA 4Q27A 2VTXJ 3SKJE 3VDAA 1IS6A 5LA2A 4Y22B 4OI1A 3LD8A 1X9TA 5GJ6A 2VPVA 2V73A 5FZ0A 2JB8A 1GQHA 1H2LA 4WVMA 2WWUA 1W03A 2GU9A 2WQ4A 4DIQA 4X6QB 1XC6A 2GAUA 5IAXA 1WGPA 4LIUA 1D4M1 4E4ZA 3DKQA 4QX8A 5FZEA 1FATA 4CEWA 1OH3A 3Q8AA
chains in the Genus database with same CATH topology
2FCVA 3OUIA 5IAVA 5LASA 3W20A 4NHMA 3GZEA 2FCTA 5HV0A 5IATA 4XCAA 3EMRA 4ZPIA 2HBTA 5LBEA 5LB6A 2RDSA 3ITQA 5LATA 5DAXA 3NNJA 3KT4A 4Q5OA 2Y34A 4XCBA 5HV4A 2A1XA 3HQRA 3NNLA 2RDRA 2OPWA 4NMIA 4Y5TA 4XABA 2JIJA 5LBCA 3HQUA 3KT7A 5M0TA 5L9RA 4BQYA 5L9BA 4Y5SA 3W21A 5LBBA 5LA9A 3KT1A 5DAPA 2G19A 5A3UA 5C5UA 4MHUA 4BQWA 2Y33A 2JIGA 4NHXA 4BQXA 5C5TA 4IW3A 4NHYA 4NHLA 3MGUA 3NNMA 4ZONA 2V4AA 4UWDA 2RG4A 3GJAA 4NHKA 5EPAA 3NNFA 5DAVA 5EQUA 4XACA 5DAQA 4NAOA 4JZRA 3OUHA 5LBFA 2G1MA 2FCUA 3PL0A 3OUJA 4J25A 5DAWA 3GJBA 3BVCA 5L9VA 4MHRA 5IAXA 4XAAA 5ERLA 2RDNA 4KBZA 5EP9A 3DKQA 3OBZA 4XC9A 2RDQA 2HBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCV A;  3OUI A;  5IAV A;  5LAS A;  3W20 A;  4NHM A;  3GZE A;  2FCT A;  5HV0 A;  5IAT A;  4XCA A;  3EMR A;  4ZPI A;  2HBT A;  5LBE A;  5LB6 A;  2RDS A;  3ITQ A;  5LAT A;  5DAX A;  3NNJ A;  3KT4 A;  4Q5O A;  2Y34 A;  4XCB A;  5HV4 A;  2A1X A;  3HQR A;  3NNL A;  2RDR A;  2OPW A;  4NMI A;  4Y5T A;  4XAB A;  2JIJ A;  5LBC A;  3HQU A;  3KT7 A;  5M0T A;  5L9R A;  4BQY A;  5L9B A;  4Y5S A;  3W21 A;  5LBB A;  5LA9 A;  3KT1 A;  5DAP A;  2G19 A;  5A3U A;  5C5U A;  4MHU A;  4BQW A;  2Y33 A;  2JIG A;  4NHX A;  4BQX A;  5C5T A;  4IW3 A;  4NHY A;  4NHL A;  3MGU A;  3NNM A;  4ZON A;  2V4A A;  4UWD A;  2RG4 A;  3GJA A;  4NHK A;  5EPA A;  3NNF A;  5DAV A;  5EQU A;  4XAC A;  5DAQ A;  4NAO A;  4JZR A;  3OUH A;  5LBF A;  2G1M A;  2FCU A;  3PL0 A;  3OUJ A;  4J25 A;  5DAW A;  3GJB A;  3BVC A;  5L9V A;  4MHR A;  5IAX A;  4XAA A;  5ERL A;  2RDN A;  4KBZ A;  5EP9 A;  3DKQ A;  3OBZ A;  4XC9 A;  2RDQ A;  2HBU A; 
#chains in the Genus database with same CATH topology
 2B5H A;  4XFG A;  4D94 A;  5FMC A;  1H2M A;  1ENQ A;  1JOJ A;  3DXU A;  2XBO 2;  4RQP C;  5IAV A;  3BIE A;  2YV8 A;  2DBI A;  4WV8 A;  5IVE A;  2VXR A;  3O12 A;  1DP0 A;  3AVS A;  4AEK A;  1W8F A;  3POY A;  5JPM B;  1OH4 A;  3ZOI A;  2VJX A;  4NHM A;  4P9L A;  1ND2 A;  5FP8 A;  1KXG A;  2PA7 A;  1XU2 A;  3AMQ A;  4IET A;  4H7M A;  2WT0 A;  1NCR A;  4QXK A;  3DV8 A;  2V4V A;  1QOS A;  2K9Z A;  3K4Z A;  4LIT A;  4D6Q A;  4LKE A;  5EFU A;  2WC2 A;  4ES9 A;  4HLT A;  1S2B A;  1UMZ A;  3U75 A;  1KD7 A;  2FDI A;  2JKX A;  5HV4 A;  4NVP A;  2I74 A;  4RQP A;  3U78 A;  2WA3 A;  3CBN A;  3ETP A;  2V72 A;  4YW3 A;  3WF0 A;  3VDC A;  4Q0V A;  1SZB A;  3AM2 A;  2YPJ A;  3WD5 A;  2YC4 A;  4ZHN A;  2WNU A;  3N9L A;  1LGB A;  3OY8 B;  1UOF A;  5BNO C;  5E8A A;  4TZD A;  1D4M 3;  3NKT A;  4FFI A;  4AAP A;  4CCJ A;  1Z78 A;  2BJS A;  2JDY A;  2XPJ A;  4E9K A;  3RZG A;  2VVE A;  4GD4 A;  4AHZ A;  1IS5 A;  4MVT A;  4WVW A;  1WLD A;  1YIP A;  2D6M A;  1HN1 A;  4ZXE A;  3BUC A;  1AL2 1;  4QKN A;  1CPN A;  4IV3 B;  4YVW A;  4PIY A;  4QPI A;  3FBM A;  3TB0 A;  1XE0 A;  1AR9 1;  2P37 A;  2VNG A;  2D40 A;  4JGZ A;  4QXC A;  3ZXF A;  3BIW E;  5ABJ A;  3T0D A;  1OF3 A;  4AFA A;  1F35 A;  2DU0 A;  3WW4 A;  1OKO A;  4COU A;  1H6X A;  4AGR A;  4ZON A;  4QQL A;  5T5P A;  1W8U A;  4Y4Y A;  5C4W A;  1JOD A;  3WCS A;  1W0O A;  3V65 A;  2Y6L A;  1FXZ A;  5AFE A;  5T3N A;  1CN1 A;  4QU1 A;  1UYP A;  4RHV 2;  4UAP A;  3ZKY A;  2FQP A;  3WP3 A;  1M4W A;  1RUE 2;  2RG4 A;  4PI0 A;  4YRD A;  3E5Q A;  4R4Z A;  1LEC A;  3QAC A;  4PLM A;  1ND3 A;  4NE9 A;  3V64 A;  1OVP A;  2HWD 1;  1OOP B;  2WN2 A;  2Y6H A;  5IK7 A;  1JZ6 A;  1CQ9 A;  3H3U A;  3N7J A;  4GKX A;  4YW7 A;  5FYZ A;  4C0B A;  1HQL A;  2EXK A;  2D98 A;  2PHF A;  4YNI A;  1RUE 1;  3OUH A;  1SG3 A;  1K5M B;  1AX0 A;  2QKD A;  3NAP B;  1ZNP A;  1HIX A;  5A6Z A;  5A3N A;  1W06 A;  2RMU 3;  1FNZ A;  4J25 A;  1OHF A;  2WNE A;  2ORZ A;  2R07 1;  4OUE A;  3RSJ A;  2IXL A;  5L9V A;  2ZS6 B;  3OGR A;  1BK1 A;  3CJX A;  1YC6 1;  2A3W A;  1TMF 2;  5JMO A;  5JXJ A;  4I2O A;  2DVA A;  3HVD A;  1EPZ A;  2R06 1;  4CCK A;  1Y9G A;  4W65 A;  4XQD A;  4XAA A;  1K42 A;  3U10 A;  1C8M 1;  1DBN A;  3CJI B;  3OCP A;  3LOB A;  2Q0A A;  2W2I A;  3F2Z A;  1KFX L;  3AZW A;  3SMH A;  2QQU A;  2HBU A;  2IFR A;  1BEV 2;  2WR9 A;  1TME 2;  4LO8 A;  4CRQ A;  3VBH C;  1MZ6 A;  1TQ5 A;  4I3P A;  1CAW A;  3VN4 A;  3OBA A;  1CAU B;  3NW4 A;  1DGL A;  4L99 A;  1ZRC A;  1YQ8 A;  4UI9 L;  4XCA A;  3PUS A;  5I0S A;  2GP5 A;  2QNK A;  4CDU B;  1NQD A;  3R6S A;  4CP2 A;  1K5J A;  3ACF A;  5CEH A;  3H1M A;  3ALQ A;  3NNJ A;  4Q5O A;  4XF0 A;  3ZSM A;  1GNZ A;  1PK6 B;  2QQI A;  4P08 A;  4XUN A;  3S30 A;  4LBQ D;  3WF3 A;  3SH4 A;  1UY1 A;  4XHB A;  1TVG A;  1FI2 A;  1PZ9 A;  2RM2 3;  3N9Q A;  2ARX A;  4TXW A;  4CE8 A;  4O9E A;  2VUD A;  2C6S A;  4Y5T A;  1V9U 3;  1CIY A;  2ZKN A;  3QOP A;  2X5I A;  4QMA A;  4NWV A;  5ACA 2;  1NZI A;  2ZAH A;  3DYP A;  3I59 A;  4AHY A;  5F2S A;  5FUI A;  5C8C C;  3WHU A;  2VAU A;  1SQ4 A;  3CF6 E;  1KRI A;  5AFB A;  1WA6 X;  1G9C A;  1FNY A;  3POJ A;  4Q0Q A;  3WW3 A;  1D2S A;  2K2S A;  2FZ2 A;  2XLA A;  5FZ9 A;  3JD7 2;  2R1B A;  4Y5Z 0;  1NXD 1;  3C7E A;  3I8T A;  3KCC A;  3MUY 1;  5EWS A;  3WV6 A;  4CCE A;  3N9M A;  4COV A;  1US3 A;  2DVB A;  5CFD C;  1XU1 A;  4FFH A;  1YXW A;  2Y33 A;  4LR4 A;  4Q2F A;  3LKJ A;  2W47 A;  1SPP A;  4QX2 A;  2XDV A;  3S6P A;  5FZB A;  2W52 A;  2YU2 A;  5G04 L;  1ST8 A;  3ZYH A;  3DEM A;  4FP3 A;  5KWR A;  1JOB A;  1WW7 A;  1HRI 2;  2XHK A;  4NRM A;  2WO3 A;  2FDF A;  1ULF A;  1UWW A;  3M2M A;  3Q8F A;  4MET A;  4W6Y A;  3MLK A;  1B35 A;  1QHD A;  2YY1 A;  3LA2 A;  3OPW A;  1WW4 A;  4FT8 A;  5LK5 A;  1HXS 2;  3VBR A;  2PEL A;  4JGZ C;  1QWR A;  2P3J A;  5F9T A;  2VO5 A;  4LQR A;  5GLT A;  1B35 C;  5I8T A;  2EIG A;  1H6Y A;  5DPN A;  3VD4 A;  3LOI A;  1VBB 1;  2R0F A;  4MX3 A;  4Q0P A;  4K6B A;  4K9S A;  3J4U H;  2WAA A;  3FHA A;  3PIJ A;  4COY A;  2DVF A;  3BAL A;  3DUI A;  4N8M A;  2B46 X;  2VM9 A;  3AP9 A;  4NAO A;  2BBA A;  5JI9 A;  1JZ5 A;  4XQW A;  4PJY A;  4LUL A;  3TAY A;  4A3Z A;  3WCR A;  1JYV A;  4FOQ A;  3H3Z A;  4LBM A;  4N43 A;  1KDK A;  3D4K A;  1GZW B;  1OSG A;  1V6N A;  1MZE A;  3IN9 A;  4YSF A;  5DMY A;  1MQT A;  3ST7 A;  2WSV A;  4I01 A;  4XDQ A;  1Q8Q A;  3V0A B;  1GV9 A;  4JGY A;  4BE3 A;  1BQP A;  3KHC A;  1L3J A;  2XJU A;  2VBB A;  1UZV A;  4XDP A;  1UIJ A;  3JUU A;  1L7Q A;  2FMY A;  3HD8 B;  3H9A A;  1GOF A;  3H7Y A;  3J7H A;  2VZR A;  1I5Z A;  1UO9 A;  3AFG A;  1FMD 1;  2B9U A;  4QPY A;  1XPW A;  5FRA A;  1UAI A;  1POQ A;  4K3U A;  4XJZ A;  1YIF A;  1Y9M A;  2WO7 A;  1UZW A;  4CPB A;  2AC1 A;  3L2H A;  3X29 B;  3ZSE A;  1JYT A;  2FCV A;  4LE4 A;  5JXH A;  2HEY F;  4EYU A;  1VMH A;  2ATF A;  1GBG A;  3SH3 A;  4K40 A;  1R08 2;  4LEJ A;  2DUR A;  4M0H A;  4JAA A;  2W68 A;  1W2O A;  2WAO A;  3ZSJ A;  3BI3 A;  1CAU A;  2XWJ B;  5EJ1 B;  2YC0 A;  1FPN 3;  1Y43 B;  2JE7 A;  2MHF A;  3LB9 A;  3LPG A;  3POF A;  2FHR A;  4GQ7 A;  3GGL A;  3CDZ B;  3KHB A;  3PJY A;  1DQ5 A;  1GZ9 A;  2PN5 A;  2ERF A;  2GH8 A;  4XQ4 A;  5FBZ A;  5JIA A;  4LKD A;  2Y34 A;  5AVA A;  1AR9 2;  3NRU A;  1HX6 A;  3MF6 A;  5F5Q A;  2ZAC A;  2BER A;  3K48 A;  3C2U A;  3HBK A;  2CGO A;  2JIJ A;  4XAB A;  4XOG A;  1DCS A;  2RE9 A;  4IQP A;  4Y4R A;  3LDB A;  3B02 A;  4XZP A;  2A7A A;  5CVR A;  4QX7 A;  5M0T A;  1QJE A;  3IDE A;  4CDQ C;  1XNK A;  1AYM 1;  4W4Z A;  1T6G C;  5A1F A;  2YBK A;  2VOT A;  2J1A A;  3JQX A;  4CU7 A;  4KQ7 A;  1YJL A;  1IZ3 A;  1Z7S 1;  2Y6J A;  4PDW A;  3III A;  5IK4 A;  1S0G A;  1BBT 1;  4YGB A;  4XFI A;  4F8A A;  3J7M A;  5FZA A;  4LA2 A;  2JG8 C;  4BQ3 A;  5C3O A;  1NY7 2;  5F32 A;  1B35 B;  2ZGQ A;  3MHZ A;  4AFC A;  2BBV A;  2ZJC A;  2D3R A;  4ATF A;  3UKT A;  2DVD A;  2LRP A;  5FZ6 A;  1POV 0;  2TEP A;  2OQ7 A;  2VC9 A;  1PNG A;  4PDW C;  3ZM8 A;  4CCL A;  4Z2W A;  2WWJ A;  4JV4 A;  1STM A;  1NCQ C;  4MGS A;  2ET7 A;  2ORX A;  4XUR A;  4CDX A;  1O3Q A;  2D3S A;  5FZM A;  3AYC A;  4TYS A;  1CZT A;  2OW4 A;  5A3L A;  1OQ1 A;  1V6I A;  4LPL A;  5ABJ B;  4PHZ A;  4YZ1 A;  4XFF A;  4OYU A;  3G7D A;  3ELN A;  5IVY A;  1HV0 A;  4IDZ A;  2SLI A;  4ZU5 A;  5FY8 A;  1S0I A;  2P3I A;  4DS0 A;  5JOW A;  3AP7 A;  2ZGP A;  1S0J A;  4BIS A;  3LGR A;  4A4A A;  4N90 A;  5DAV A;  4BQ2 A;  1WD3 A;  1MPX A;  4RYD A;  2HWF 3;  2RV9 A;  2BU9 A;  4RGG A;  1Z7S 3;  3GM8 A;  1SBF A;  1RYY A;  3HN1 A;  3FMG A;  3IM0 A;  3FC0 A;  1W6P A;  4SBV A;  4YFW A;  3D8C A;  2GSY A;  5FZK A;  4H2A A;  3VBF C;  2VQT A;  2XG3 A;  4BYY A;  3V0A A;  4RR3 B;  3EBR A;  3DYO A;  4PQQ A;  1OA3 A;  5FK7 A;  1SHW B;  2PLV 2;  4GZ9 A;  4XFA A;  4XHX A;  4DXS A;  3PNA A;  4MOA A;  2VG9 A;  2GH2 A;  2ZA9 A;  4AWD A;  3JXS A;  1O4T A;  2VMG A;  1MZF A;  4QKD A;  1FMD 3;  1APN A;  1REF A;  4RGA A;  4MHR A;  3MFA A;  4P02 B;  1US2 A;  2VGD A;  2Q1Z B;  3GNE A;  3KB5 A;  3KMH A;  3OD0 A;  1PVC 3;  2R1D A;  4IEO A;  4WZF A;  2J1S A;  5KR7 A;  3SKV A;  5FZ3 A;  5KXC A;  4XBQ A;  3ILN A;  5FBJ A;  3WQ1 A;  1G7Y A;  2I07 B;  2JDZ A;  3QH6 A;  3O5S A;  1QQP 1;  1AR6 3;  4XMI A;  4COW A;  5F6K A;  3JBG 1;  5KC6 A;  2ZMK A;  5DUV A;  1YQ6 A;  3TEY A;  1W6P B;  2YFU A;  1MS9 A;  4KGQ A;  2D5F A;  4P9X A;  2ZEY A;  5FWE A;  5HCB A;  1BK0 A;  4XFH A;  4LUM A;  4BJ0 A;  4JTN A;  5A7O A;  4YWA A;  5HV0 A;  3CJI A;  2ES3 A;  2BQP A;  1C4R A;  1CAW B;  1LHV A;  1V6L A;  2EIC A;  2XB6 C;  2RS3 2;  2W1U A;  2Y8K A;  3MID A;  5LBE A;  4C90 A;  5LB6 A;  1N3Q A;  2VNV A;  3AKQ A;  3KVA A;  4U2A A;  1WWY A;  3KF5 A;  2A6X A;  1C5I A;  5D8A B;  1A8D A;  5A32 A;  2PYT A;  5FYS A;  4JKM A;  4HG6 B;  5F6L B;  2EAA A;  5CZK A;  2OII A;  2ZKL A;  1F8V A;  2TNF A;  2X5I C;  3ACG A;  1U5Z A;  3QD6 A;  5EYY A;  2WYS A;  2HWD 2;  5LBC A;  1QH7 A;  2RS1 3;  3WOG A;  4W8J A;  5DUW A;  4ATE A;  4JGZ B;  2EF6 A;  4IV3 A;  5JZG A;  5L36 A;  3AP4 A;  3I2O A;  4JHZ A;  2OT7 A;  4RS5 B;  4P14 A;  1HB4 A;  1IG0 A;  4YZ3 A;  1U0A A;  5ANQ A;  5K4L A;  3ZFF A;  2YDE A;  4DMI A;  2QQW A;  1OXC A;  1AXY A;  3ETQ A;  1AR6 1;  1CX4 A;  1WLW A;  3I59 B;  4XEZ A;  3W21 A;  4K1Z A;  2ZEZ A;  3MI8 A;  4AOC A;  1NOV A;  1GOH A;  4PF5 A;  5FJK A;  1RUF 1;  5CU1 A;  3WP4 A;  1W8H A;  3J8F 2;  3THC A;  4EE2 A;  1Y4W A;  5FOJ B;  2BEO A;  2J1E A;  4JKL A;  1IHM A;  1EUU A;  1O4Z A;  3ZFG A;  1AYN 2;  5FP4 A;  1FAY A;  2C0Z A;  1QJY 3;  2ZHL A;  4X6R B;  2VUA A;  4CU6 A;  4Y1Z A;  4F3J A;  4Y1V A;  2LW8 A;  4CXX A;  2ZPX A;  4FCA A;  4QX0 A;  4IV1 B;  4D6R A;  3CHX A;  2FZ1 A;  3KS7 A;  2E26 A;  4NPL A;  1EV1 3;  3LEG A;  1HRV 3;  3MW4 A;  3OYW B;  4FOW A;  4CDX C;  5D1I A;  1RUG 3;  5IVC A;  3EO6 A;  2RJK A;  2ZGS A;  4LHL A;  2B45 X;  2O0O A;  3I2F A;  4YG0 A;  4Q4W 1;  3RYR A;  4E4D X;  4LBK A;  1RL3 A;  5FXZ A;  4EN6 B;  1RMU 3;  1W2T A;  4ISQ A;  4CYD A;  1AYN 3;  1X8E A;  3ABZ A;  4PT6 A;  4E2S A;  3HIF A;  5DZG A;  5EPA A;  1W99 A;  1D0H A;  2WLP A;  4MG2 A;  2RMU 1;  1GQG A;  4AQS A;  1Q3E A;  1YJK A;  2BWC A;  4DIN B;  2FDG A;  1LJ7 A;  2CTV A;  2R04 2;  5JLV A;  4YVS A;  1QXJ A;  5FQ0 A;  4OUM A;  5CB7 A;  2HYX A;  2D7F A;  3AMP A;  3S5Q A;  4ASM B;  4DZG A;  2A6Y A;  3RYP A;  4JZR A;  1UX7 A;  1SLL A;  3LAG A;  4XVH A;  1BXH A;  1VMJ A;  2IC1 A;  2O8Q A;  5FZ7 A;  3WDV A;  4PLN A;  1VBD 1;  1RUN A;  4Z8B A;  4YW2 A;  3GBG A;  2RS5 2;  1GFF 2;  2EID A;  3EQE A;  4QU2 A;  2XBO 3;  4HET A;  1E57 A;  1WW5 A;  2YU1 A;  4GIQ A;  1YFX A;  2R04 3;  3NMB A;  1DFQ A;  4XJW A;  2HWB 1;  3WR0 A;  3I3E A;  4GWI A;  1COV 2;  1YQ5 A;  2VW2 A;  3KCY A;  5FZ4 A;  5LCW L;  1JHJ A;  3JZV A;  3OBZ A;  1WKY A;  5FY7 A;  1XE8 A;  3D0S A;  4Y22 A;  4RGK A;  1MZ5 A;  1HB2 A;  3ZPO A;  2J22 A;  4YVS B;  4BMB A;  1ZRE A;  4E2Q A;  4CTE A;  4FPE A;  1DGW A;  3INA A;  1SCS A;  2WNV B;  5FMB A;  3CMG A;  4CDU A;  1VLN A;  3K77 A;  3H8U A;  1N1Y A;  2FBE A;  2DFB A;  4QM9 A;  4B7K A;  4NIH A;  3UK9 A;  3LIG A;  2DCZ A;  1W28 A;  4KH9 A;  3Q8C A;  4E4H A;  1X36 A;  2AH2 A;  2GC0 A;  2Z79 A;  1WZX A;  4QXB A;  1WME A;  3GCW A;  1D4M 2;  5A32 B;  4DY3 A;  5HI0 A;  3AYE A;  4M3C B;  3WHT A;  5F1R A;  4YVS C;  5LRR A;  4XFB A;  1BLZ A;  2GDF A;  5CKN A;  4A7Z A;  5J98 B;  5BNO A;  1W9S A;  2K0G A;  3ON7 A;  3HQX A;  1OFN A;  1IKQ A;  5I93 A;  2W91 A;  1W8N A;  5BUV A;  5CAD A;  1XNT A;  3FUQ A;  1RUF 3;  1VB4 A;  3ZXA C;  5KBF A;  3OD4 A;  3H8O A;  3WG3 A;  4YFZ A;  1HJG A;  3NST A;  4FVV A;  1UKR A;  2NM1 A;  3ZFF B;  2Y0O A;  3UYJ A;  2WRA A;  4FFF A;  3WP6 A;  3M4F A;  4B3N A;  3PU3 A;  2GC2 A;  2VQA A;  3THP A;  3GZT B;  4L11 A;  2XOM A;  4FTE A;  1J83 A;  3VBS B;  3RVH A;  2XKP A;  4BQY A;  4E4S A;  1UZY A;  2JE8 A;  4LK6 A;  3BPS A;  1QJF A;  4BH9 A;  1DYO A;  2UWC A;  3K3N A;  1DQ2 A;  1H4H A;  5FY4 A;  1COV 1;  1EP0 A;  4V2V A;  4GWM A;  2WQ8 A;  5BXX A;  3CJI C;  3GBF A;  1RUF 2;  4KWL A;  1MEC 3;  3LEM A;  1QOT A;  3VBU B;  4AVT A;  1CZS A;  5C5U A;  3IMN A;  4GH4 B;  1CD3 G;  2GND A;  1A6C A;  5I8Y A;  1YFY A;  3LPF A;  4H14 A;  1KEX A;  1CJP A;  4XF9 A;  3W5N A;  2CL2 A;  3CO2 A;  3AX4 A;  1WW6 A;  3AZV A;  2BVV A;  3AJZ A;  5IVJ A;  4FTS A;  1WUV A;  3VKO A;  3HT1 A;  5DAB A;  5FWJ A;  1SLT A;  4MXW B;  1D2Q A;  1RXG A;  4NHL A;  4AED B;  5BV6 A;  1K5M C;  4YM0 A;  5JSP A;  3RZM A;  4O9G A;  4CDW A;  4CEY A;  1L7R A;  5FO7 B;  4IEV A;  2NMN A;  2WN3 A;  4Y33 A;  4OLL A;  4XF1 A;  1UX6 A;  4GWJ A;  3SIT A;  4QDS A;  2B7Y A;  3DYM A;  4OUS A;  2WZR 1;  4CDW C;  4DXT A;  5CG9 A;  2R49 A;  1K45 A;  2VVD A;  4X8N A;  1T2X A;  1ULG A;  1YQC A;  5EQU A;  5FLI A;  1CVN A;  1PMJ X;  3SC7 X;  4LOT A;  2ZEW A;  3RNS A;  5EZW A;  1RHI 2;  4I0B A;  2ARA A;  3ZYF A;  2ZX3 A;  3OB8 A;  3O14 A;  1XYN A;  4LHN A;  3FJS A;  4AFD A;  4IEQ A;  3R05 A;  4AW7 A;  1G9D A;  3KGL A;  2W9X A;  4WBB A;  3W5M A;  1O8P A;  1BKZ A;  1V6J A;  1V6O A;  2C24 A;  3PUA A;  4AF9 A;  1S55 A;  3WNX A;  1GP6 A;  4RHV 3;  3IAQ A;  4UBH A;  1ZZB A;  5AC9 1;  4LO4 B;  3A22 A;  1U12 A;  2WKK A;  3MIH A;  1PO2 3;  1V00 A;  3VZL A;  4MZU A;  4FI9 A;  2GMM A;  4CCN A;  3D0J A;  4AHW A;  3E5X A;  1DU3 D;  3MV1 1;  2ILM A;  5ERL A;  3VZM A;  2YGM A;  5IFP A;  4Z2A A;  2BTV C;  4KBZ A;  2WT2 A;  5C9A A;  1AUY A;  3T2T A;  5BPX A;  2BNM A;  5FDB A;  2ZAB A;  4KWJ A;  1QJU 2;  3OBT A;  5ISL A;  1GWM A;  2WNU B;  1D0G A;  2QTW B;  3KQ4 B;  5F3C A;  1O6U A;  4QQH A;  4ZY9 A;  4V1P A;  1JZ7 A;  3P1I A;  5CFD A;  2CDP A;  5FPV A;  5A3W A;  1JYW A;  3UET A;  1NA1 A;  2WBK A;  2IXJ A;  3VBF A;  5BNP A;  2D6N A;  2OUH A;  3EMR A;  4DXZ A;  4GMP 1;  4OQ9 A;  4ZPI A;  1GZT A;  5IHR A;  5BNN C;  4YPJ A;  2MPF A;  1OMI A;  3D82 A;  3WNK A;  4N7I A;  1SLC A;  1ONA A;  1LOF A;  5GKA C;  2AEZ A;  2P2K A;  4DY5 A;  2VUJ A;  2BFU S;  2WT1 A;  1PZ8 A;  2QCS B;  1FV2 A;  1QJU 3;  3DPR A;  2QQO A;  5C70 A;  2HH9 A;  2ZBJ A;  3CKH A;  2V5Y A;  4DPN A;  1CWP A;  5GZF A;  4C1W A;  5J36 A;  3M70 A;  5C3P A;  1H2N A;  2Y38 A;  3DPR C;  4HVO A;  3BCW A;  4JRL A;  4GMP 0;  1H8T C;  1F9K A;  2GNB A;  3LIH A;  4RQP B;  4XW3 A;  3GYD A;  2WL1 A;  5L9B A;  1VAV A;  3DN7 A;  2ZGM A;  3ILR A;  4MV2 A;  1QOO A;  1UOJ A;  5HXM A;  1E5S A;  2XQR A;  2ZCW A;  5L7O C;  2BPA 2;  4IE5 A;  3RPQ A;  3T2O A;  1HXS 3;  3AP6 A;  5DAP A;  4UBG A;  3N9N A;  1WMX A;  1C1L A;  4OMD A;  3RWK X;  3BN6 A;  4CDW B;  1OLQ A;  4PI2 A;  2VL4 A;  2CDO A;  1FPN 1;  1R09 2;  4N7U A;  4WVZ A;  3AMN A;  2GN7 A;  3EB7 A;  3MW3 A;  5C5T A;  4IW3 A;  1OC1 A;  2XJP A;  3P3P A;  1LHN A;  4QGL A;  5L73 A;  1LKN A;  1R1A 1;  5C3R A;  1UCX A;  2LM3 A;  4U36 A;  1AX1 A;  3O0X A;  1XQN A;  2WZR 3;  1UY0 A;  1ZA7 A;  4AQ6 A;  1KS4 A;  4LUK A;  2PHD A;  5HCF A;  2VQ0 A;  3U1X A;  1NXM A;  1OQD A;  4IXL A;  3ORJ A;  2ARC A;  2OX0 A;  4AFB A;  5KHI A;  1R64 A;  2J1R A;  2LAL A;  3MIE A;  4NIA A;  3TNQ A;  3VBS C;  2Q5T A;  1AR7 3;  5AC9 3;  2VME A;  3KV4 A;  3WG1 A;  1O4Y A;  2HWE 2;  4O61 A;  5DDJ 2;  5FKC A;  3HR9 A;  4BA6 A;  4G3Y C;  2K46 A;  2VOK A;  4B8E A;  3FE5 A;  3I2D A;  3N7L A;  4Q26 A;  2V5D A;  1UXZ A;  1K3I A;  3I4I A;  3ECQ A;  1U5I A;  2ID4 A;  3VBR B;  1UZZ A;  4QHB A;  3SCF A;  4K21 A;  3WF1 A;  4QDR A;  5LA1 A;  3ME2 A;  2WAB A;  1RIN A;  5ACA 1;  1D7P M;  4AVV A;  3HNB M;  1W8T A;  2WZ8 A;  3U4S A;  4DOU A;  1W6O A;  2D5H A;  4NAM A;  4W6W A;  3DL3 A;  3T4V A;  1JU3 A;  3M3Q A;  4QPW A;  3MEP A;  4Q4Y 1;  1GP4 A;  1UOG A;  3W9A A;  4ES8 A;  1GZW A;  5AC9 2;  1RJ8 A;  1YUD A;  1UY2 A;  3WDT A;  2EVX A;  1NLS A;  4FTB A;  2JEC A;  1VB2 A;  2VZP A;  3FHQ A;  1JS9 A;  2NYY A;  3A21 A;  5FYI A;  5E88 A;  3VLB B;  4KU8 A;  1FPN 2;  1K5M A;  3AZZ A;  4D69 A;  1IS4 A;  3AFK A;  3O1V A;  4BDV B;  3A0K A;  3B9C A;  3BTX A;  4GAZ A;  1H9P A;  3URF A;  2WNV C;  5JOX A;  1NCR B;  1MQT C;  1OLM E;  1S1A A;  1TME 1;  3KM5 A;  2W08 A;  3UKV A;  2BP6 A;  2XON A;  3USU B;  4GA9 A;  3I2H A;  5FK8 A;  4ASK A;  1Q8P A;  2HEV F;  1G9B A;  2YZ4 A;  3LCP A;  3JB8 A;  2RS5 1;  5BNP B;  2WNV A;  2QE3 A;  5FPX A;  4NPR A;  2D97 A;  2QQL A;  5LAT A;  4HAN A;  3M1H A;  4I0A A;  1CAV B;  4FO9 A;  2KR2 A;  4JDN A;  5DAX A;  2VZQ A;  2RJL A;  5A3T A;  5JR2 A;  3AZY A;  1VBE 2;  1GOG A;  1JTZ X;  2JEM A;  2QJV A;  1QY4 A;  3APB A;  3FBY A;  3USU A;  4YW4 A;  2G9F A;  3N7K A;  1R08 3;  4WVM B;  3F95 A;  2Z42 A;  1UYZ A;  2VY0 A;  1IPK A;  3GDB A;  5A70 A;  1ENR A;  1UYY A;  4BXS V;  5T5L A;  2JB4 A;  3T0B A;  5FPZ A;  4XET A;  2J7M A;  5GZE A;  3VDD A;  2VVF A;  2E51 A;  1I3H A;  1VBD 2;  1IS3 A;  2HWE 1;  3H1Y A;  3NJY A;  4SLI A;  4OVE A;  2PAM A;  4LHS A;  4V2W A;  2E31 A;  4YW5 A;  1BHG A;  2LS6 A;  1LGN A;  5J37 A;  2JDM A;  2BZD A;  3ASI A;  2E33 A;  3AYA A;  2O8O A;  1C1F A;  3C7F A;  5A3U A;  4QGM A;  2FD8 A;  4O7X A;  2QZ2 A;  1UKG A;  2IUW A;  4LBJ A;  4LO5 B;  5I0U A;  5A3P A;  1UXX X;  5T5O A;  2Q1F A;  1W9F A;  2VZU A;  3AKR A;  1H1A A;  3LFM A;  4BQX A;  4BHP A;  3WP5 A;  2ZGO A;  1H0B A;  2XL7 A;  5FY5 A;  4CEY C;  5CBL A;  2RR1 3;  3CL1 A;  1QMJ A;  2KXL A;  2WDB A;  3MIB A;  4HKW A;  1LEM A;  1MS5 A;  3NKG A;  3T1M A;  2JD4 A;  2JG9 B;  2HWB 3;  4ZZ8 A;  3O1O A;  5LW9 A;  1VR3 A;  4AGG A;  4B4Q A;  2Y6F A;  2FDH A;  1ZBE 2;  4GMP 3;  1OQE A;  1YHF A;  3BPZ A;  3GCX A;  3MYX A;  1ZYB A;  3I2I A;  5IYY A;  1QEX A;  4QB1 A;  5FYU A;  1S0E A;  1ZM1 A;  1V6K A;  4FPC A;  4P9Y A;  4GXL A;  1OPM A;  1VAL A;  4RFT 0;  2WII B;  4COZ A;  3AZX A;  2W0X A;  3HOB A;  5GLZ A;  5CAZ A;  5I91 A;  1O3S A;  2W3J A;  2G4I A;  2JG9 C;  4W6X A;  4YM2 A;  4FPY A;  2JDN A;  2L9L A;  4Z92 B;  2HWB 2;  1MR5 A;  4YLZ A;  1WLT A;  1SLI A;  5FXV A;  3THT A;  1V6M A;  3GBW A;  1AR6 2;  2VOX A;  4QPG A;  4D8M A;  3TRS B;  3AKS A;  2VMC A;  1F2N A;  1H2K A;  4Q4Y 2;  4NRQ A;  2MEV 2;  5CFC C;  4ARX A;  2NN8 A;  2JXA A;  3TNP B;  5I8S A;  4D7T A;  4Q4W 3;  4MH0 E;  1GNH A;  1PO2 1;  4XUT A;  5ANN A;  3JBG 2;  3QCW A;  4PIX A;  4HPK B;  4RHV 1;  4X8P A;  5IK8 A;  2RDN A;  1HRV 1;  2D93 A;  1HXS 1;  4Y26 A;  5EP9 A;  1F4H A;  5FV3 A;  4XC9 A;  1URX A;  4NIG A;  1VBA 2;  4E8D A;  4Y24 A;  1DGR A;  5FO9 B;  2VZT A;  3TEZ A;  1O3R A;  4TSV A;  3ZFE A;  5LA0 A;  4AAX A;  4RN5 A;  1DDL A;  1SBE A;  2PLV 3;  1LNS A;  4AEM A;  3T0A A;  1G86 A;  2GAL A;  1LOB A;  2PAK A;  2HWD 3;  4UW4 A;  2YB7 A;  3ILF A;  4XTM A;  5F5A A;  3ZO0 B;  3ZLI A;  4Q4W 2;  4HSJ A;  3TWI A;  1RUC 2;  2Z5W A;  1PK6 A;  3NV4 A;  3JCI A;  3VBH A;  5IAT A;  1RC6 A;  1UW8 A;  2UYA A;  2VCB A;  4S2D A;  4IE7 A;  4UFK A;  1ZZC A;  2JDA A;  3ZN5 A;  1JZ3 A;  4KWK A;  4OUL A;  5BNN A;  2HWC 3;  1SCR A;  2A3Y A;  2RVA A;  1W6N A;  3MF9 A;  4CSW A;  3UNP A;  1DYK A;  1XNB A;  4XPV A;  5FYV A;  2C4X A;  2Y26 A;  1EPW A;  4JC1 A;  5GLW A;  3PUI A;  3VBF B;  1BMV 2;  3O1P A;  3D5O A;  3B3Q E;  3RZJ A;  3KVB A;  2A1X A;  3RDI A;  1AVB A;  2RS1 1;  2ZHN A;  3NAP C;  1O8S A;  1SMV A;  2XHN A;  4CP9 A;  2PFW A;  3Q8E A;  2XBO 1;  1TE1 B;  3OY8 A;  5FPL A;  3IDA A;  3KSC A;  3L9J T;  1ULO A;  1RHI 1;  2RS3 1;  4D7Y A;  4NUB A;  1F5J A;  2D6O X;  5FY0 A;  2PHT A;  4Y5S A;  4K20 A;  4YVW B;  1HRV 2;  5C3Q A;  4BOW A;  1O91 A;  1RUG 2;  2JG8 B;  5LBB A;  2Q8D A;  1M06 G;  1JUI A;  4R9C A;  3UKN A;  1EUT A;  2PHR A;  4C91 A;  3NV2 A;  5F7U A;  1HB3 A;  4E8C A;  4GAL A;  4DB5 A;  4PDW B;  2ZX0 A;  1MVQ A;  4Z82 A;  1JMU B;  5JMC A;  1PGL 2;  2GNT A;  4C1X A;  1X50 A;  1E5R A;  1NAE A;  2I2S A;  4Q1R A;  5FYY A;  3S5A A;  4JDO A;  3OGS A;  4N53 B;  4XJU A;  1LAJ A;  5FZO A;  1QJX 3;  2VOV A;  4FQ4 A;  4M00 A;  1JUH A;  5EJ3 A;  5CIS A;  1XOY A;  1MS3 A;  4HKL A;  4LLF A;  4Y1X A;  3W58 A;  5H9S A;  1LES A;  3A23 A;  1YQ2 A;  3EJK A;  1GP5 A;  1W0P A;  1FOD 1;  5D21 A;  3TN9 1;  1BMV 1;  1EAH 2;  2RS5 3;  4QQ2 A;  3LWC A;  5GAL A;  4BME A;  2WFF 2;  4OHW A;  1QJY 2;  2JX9 A;  4NII A;  1CIW A;  1BEV 1;  1J1L A;  1QGL A;  3N36 A;  3POI A;  3WNP A;  5A33 A;  1OI6 A;  2VXJ A;  3AC0 A;  2CYF A;  1S0F A;  2ENR A;  4XJ8 A;  1HW5 A;  4IE0 A;  4LOS A;  4LKS A;  4P9J A;  4YW6 A;  3I3D A;  1QDC A;  5I0R A;  3U4X A;  2QQM A;  3GZA A;  2QVS B;  2E63 A;  3E1F 1;  5F5C A;  4IEW A;  5K0U A;  3R0R A;  4IES A;  4PBP A;  5LWB A;  4DXR A;  5CNA A;  5E16 A;  1ASJ 1;  2G1M A;  5A7N A;  3KCX A;  3MZH A;  1ZRR A;  1RMU 2;  3WY6 A;  1OF4 A;  3T2Q A;  3USS A;  1R1Z A;  1RUJ 3;  2VZO A;  2WFF 3;  2Y0I A;  3T1L A;  3A0N A;  5C8W A;  3VL8 A;  2YRO A;  5FO8 B;  1MS4 A;  3IAP A;  1F15 A;  4CEW C;  2CU5 A;  1POV 1;  1J3P A;  1QIQ A;  3B93 A;  3TEW A;  4UW3 A;  4WVV A;  1W2N A;  2Q30 A;  4BQ5 A;  5FP9 A;  1HLC A;  3I2G A;  4AI2 A;  3FFQ A;  1NCR C;  3ZIW A;  5FXW A;  4A7Y A;  1WCK A;  1IKP A;  5FPB A;  3PUH A;  3T08 A;  4KL1 A;  1DQ0 A;  4N9H A;  5A7W A;  1VRB A;  2HKX A;  2NZ9 A;  3LSD A;  5CFC A;  3FLT A;  5JZG B;  3OUI A;  2VEC A;  1LR5 A;  2DTY A;  5FR3 A;  5T52 A;  3W20 A;  2JDK A;  4TLF A;  4MGY E;  1H1I A;  1R09 1;  1PX4 A;  1QNY A;  2W46 A;  3N9O A;  1C57 A;  4B7E A;  2EXH A;  1LOG A;  4RSU A;  2R06 3;  3RI9 A;  4FPF A;  4CCD A;  1E5H A;  5JOY A;  1RUD 1;  1WCD J;  4QB2 A;  2XJT A;  3IMM A;  5KHH A;  3CIH A;  2VNR A;  3J7N A;  5FPA A;  5KXE A;  2VZ3 A;  3ATG A;  4QWN A;  1YEW A;  2GP3 A;  2WZP P;  1AYM 3;  4FPO B;  5CFC B;  2WSU A;  4AGV A;  3K3O A;  3T30 A;  4BLJ A;  1RUD 2;  4CDU C;  3NNL A;  3EXU A;  4FQZ A;  4MGQ A;  3WG2 A;  5CG8 A;  4NO4 A;  1KFU L;  4CVU A;  3VKF C;  4BK4 A;  2ZX1 A;  4LO6 B;  1ZBA 2;  2ZGK A;  5EXO A;  3B00 A;  3V56 A;  3ZN6 A;  5KXD A;  1WMD A;  3UL2 A;  4EN0 A;  3U0Z A;  3HNM A;  3E6D A;  4HN0 A;  1Q8V A;  4LTA A;  1HJF A;  4FOV A;  1OUX A;  5HCH A;  1RUH 2;  2AAC A;  3PIG A;  5J3U A;  1IPJ A;  1HB1 A;  1V9U 1;  2B4K A;  3SH5 A;  2E9Q A;  4K8R B;  1RUD 3;  2ZGT A;  1I9R A;  3LQC A;  2IVJ A;  3KT1 A;  4HMZ A;  2PHU A;  3K2O A;  2VCC A;  1CZV A;  4G9S B;  4M3C F;  4AQT A;  2JG8 A;  4GB3 1;  4HXC A;  2W5F A;  2E53 A;  2H6C A;  2J42 A;  4KBB A;  4NPM A;  4PCR A;  1N3O A;  1VRH 1;  1ZBA 3;  3J26 N;  3N4M A;  1RUI 3;  1I1E A;  2CAU A;  1ND3 B;  2R04 1;  1UD1 A;  3V0B B;  2ZGN A;  1DGR N;  4TLG A;  2VBP A;  2JE9 A;  4AED A;  3D6E A;  4YYO A;  1RIR A;  1SPP B;  3VHR A;  5FY1 A;  3VZN A;  3IIA A;  3WG4 A;  1NCQ A;  3WEZ A;  2D6K A;  2WUH A;  3AXE A;  1MEC 2;  1WCU A;  1YI7 A;  4KI5 M;  5FY9 A;  1NE6 A;  3H0O A;  4UWD A;  3UES A;  2X10 A;  1AJK A;  4DUV A;  3PTY A;  5E89 A;  3SEP A;  1NKG A;  1PO2 2;  2EIE A;  4BIF A;  2RJ2 A;  2WFF 1;  1EYB A;  4R9A A;  3CQO A;  4PF1 A;  3MLJ A;  1LOF C;  1CGP A;  1PNF A;  3OYW A;  2W1W A;  1AL2 3;  4RR3 A;  2AUY A;  2NPI A;  1XSR A;  1WA4 A;  5LEJ A;  1GMM A;  2B9V A;  2YMZ A;  3VHN A;  1S0D A;  3POE A;  5A7P A;  5H9Q A;  3PVE A;  1A3K A;  2WNU C;  2UY8 A;  3OEB A;  1TME 3;  2Q8E A;  3WVJ A;  1Y7B A;  3VD5 A;  1ULD A;  3H1W A;  4UFI A;  2JDH A;  2Q8C A;  3TBD A;  4CP9 B;  4JQR A;  5LK7 B;  5BNO B;  4XZU G;  3AYD A;  1CPM A;  1AL2 2;  3Q8B A;  5EHD A;  4EN7 B;  2ET1 A;  3U11 A;  1IOA A;  1O5L A;  1RHI 3;  4LE3 A;  1RVF 1;  1PGL 1;  3GHN A;  3VKM A;  3WDU A;  4AED C;  4E2G A;  4UFJ A;  3P5B A;  2UWB A;  3S0M A;  3WLU A;  2RDQ A;  2WNO A;  1MS0 A;  1KJL A;  2RMU 2;  5F5I A;  2QQJ A;  2RM2 2;  3CZU A;  3BOW A;  4TTG A;  3WDX A;  5LAS A;  2VMH A;  1FOD 2;  2DBN A;  3B69 A;  3NNG A;  1V9U 2;  3TN9 2;  5JCT A;  1SFN A;  1TMF 3;  5JWP A;  4W50 A;  2FCT A;  4MUV A;  5C9A B;  1YNA A;  5K0U C;  2JJ6 A;  2YYO A;  4Y3O A;  4HK8 A;  4Y1Y A;  5ACA 3;  1W6Q A;  2HBT A;  4R9D A;  3MFC A;  3ZXK A;  1A8M A;  3RMX A;  4A42 A;  4QHO A;  1HQN A;  4HL0 A;  1C28 A;  1N1T A;  2CWS A;  4P9W A;  5F39 A;  2D6P A;  4YGC A;  2W39 A;  4LBL A;  1ND2 C;  2BDR A;  2WO2 A;  3KT4 A;  1TEI A;  4KMQ A;  1PGS A;  1BEV 3;  3ZDV A;  1BJQ A;  1W2U A;  3HQR A;  3MW2 A;  1JYN A;  4QAW A;  2WO1 A;  4Q4X 1;  4NMI A;  4BCU A;  1FOD 3;  3TN9 3;  2OPK A;  4R52 A;  2ZZJ A;  4XIL A;  1OOP C;  4YZ4 A;  4MGI E;  1VMF A;  2GNM A;  1KQR A;  4B1M A;  2W87 A;  1LU2 A;  2D6L X;  2GZW A;  2QQN A;  1ZVF A;  1QJZ A;  5J48 A;  2VMI A;  3AKP A;  4ET7 A;  2PHL A;  1RUO A;  3VHP A;  3A7Q A;  3O1T A;  1ALY A;  5A6Y A;  3PJQ A;  1RED A;  3IDC B;  3UT0 A;  2UU8 A;  3WXP A;  4MLO A;  5LA9 A;  1OUR A;  5FZC A;  5KHK A;  3PU8 A;  3T2P A;  3ZIX A;  2LRO A;  1RJ7 A;  3VBS A;  5TSW A;  3I3M A;  2JIG A;  1LU1 A;  4XAE A;  3PUQ A;  1IQA A;  5IVF A;  4AXO A;  3VBR C;  1PVX A;  4N43 B;  4WM8 A;  3IPV B;  1EY2 A;  5GZC A;  1ZA4 A;  4A41 A;  4GJY A;  4FPL A;  1NT0 A;  1ODM A;  5KHJ A;  2ZAA A;  3OBR A;  3E6B A;  2R16 A;  4KNC A;  4QX3 A;  2PHW A;  4GH4 A;  1WLC A;  5C6C A;  1UNB A;  3M8L A;  3VKN A;  4URA A;  1NCQ B;  2E32 A;  3WZ1 A;  4XIO A;  1LRH A;  2DU1 A;  3KZ4 C;  4Y20 B;  3PME A;  1BBT 2;  1F31 A;  1FYU A;  5FUP A;  4L0P A;  4HSL A;  4JGY B;  3B94 A;  3NNF A;  1R09 3;  1CAX B;  2XVK A;  4D7S A;  4EQV A;  1Q56 A;  4EN9 B;  4CDQ B;  3VBU C;  4WM8 C;  1HRI 3;  3POW A;  3IB3 A;  5SV5 A;  1I5P A;  4XE9 A;  4C0H A;  1G6N A;  4FSJ A;  1XBF A;  4OQ8 A;  2BOI A;  1DG6 A;  1QJU 1;  1JZ4 A;  2FCU A;  2XWB B;  1GLH A;  1BVP 1;  3GF6 A;  1ND3 C;  1GZC A;  3CU7 A;  4Q4V 1;  4QPI C;  1SLB A;  3WX5 A;  1VIW B;  2V09 A;  2ZGU A;  3BVC A;  5ABJ C;  3RZH A;  4I3G A;  3VZK A;  1SDD B;  2OQ6 A;  4F83 A;  2HWE 3;  1XSQ A;  1WCQ A;  1DZR A;  3SQO A;  3FN9 A;  3WQ7 A;  2DCY A;  2R0H A;  4PBO A;  5T50 A;  1G9F A;  3T4H B;  3WNL A;  2XJQ A;  4XUQ A;  3SHR A;  4A6O A;  2R30 A;  1SAC A;  4DNY A;  1F4A A;  1OLR A;  3LA3 A;  1QH6 A;  3ZSL A;  1ENX A;  2OVU A;  4HON A;  3ZXE A;  4P00 B;  3BGA A;  4NOT A;  1PO1 2;  2OZ6 A;  4ZS3 A;  4MGT A;  1VBE 3;  3WUD A;  2CAV A;  2QQP A;  5J09 A;  1N3P A;  3PLQ A;  4KG8 A;  1QDO A;  3C7G A;  4JHT A;  1RUH 1;  4B4R A;  2YC2 A;  5LZ6 A;  1UU5 A;  3DEC A;  4UW6 A;  1AYN 1;  4AK3 A;  5DDJ 1;  1RMU 1;  4YZ2 A;  2FDK A;  2NQY A;  5F3I A;  4URT A;  3WQB A;  1LOD A;  4NID A;  3ITQ A;  5FYT A;  2DDU A;  5JOZ A;  2EAL A;  3CEW A;  1GAN A;  2C1F A;  1NA1 C;  4AZZ A;  2A5Z A;  3ZFF C;  1ZRD A;  3IWZ A;  5APA A;  1PO1 3;  3BTY A;  1MVE A;  4XYX A;  3NJX A;  1QNW A;  3OGG A;  2RDR A;  4NN0 A;  3BTA A;  3PHM A;  4QM8 A;  5C8C B;  4FPJ A;  2BGP A;  1IQD C;  3MBW A;  1KGY A;  2VH9 A;  2YUE A;  3NV3 A;  3BKZ A;  1W8W A;  3MV0 1;  2DV9 A;  2WS9 3;  2PQS A;  2E7Q A;  4GKY A;  3ROU A;  2F4L A;  4XF3 A;  4N43 C;  1DF0 A;  2X5I B;  1E5I A;  3VHO A;  4OFG A;  2J1U A;  4HN1 A;  4CCM A;  2MEV 1;  3FFZ A;  2AYH A;  4UF0 B;  1QKQ A;  1OKQ A;  2LTN A;  2ZML A;  1AXK A;  1SBD A;  1ASJ 2;  2ZX2 A;  4UYB A;  5CKQ A;  4YG3 A;  3SCG A;  3CLP A;  4LBN A;  5BNN B;  4OI2 A;  5T55 A;  2IFW A;  1A34 A;  2D44 A;  2DUO A;  4L97 A;  1DLC A;  5FZI A;  3H7J A;  3ZN6 B;  3ZR5 A;  1W9Y A;  1ZBE 3;  2QQK A;  3M3I A;  4AFM A;  5I0D A;  4DUW A;  3ZYB A;  1JHN A;  2WS9 2;  1RGS A;  3GXU A;  1VBB 2;  3NV1 A;  1SEF A;  4NHX A;  3MPP G;  1AZD A;  5A33 B;  3H8R A;  1IGO A;  1ZZ9 A;  1RUI 1;  4A45 A;  2Y64 A;  3WF4 A;  2ARB A;  1TMF 1;  1ASJ 3;  1S2E A;  1LHW A;  1Z7S 2;  4UW5 A;  2WS9 1;  4LKF A;  1W8Z A;  2V4A A;  1YFU A;  2WZE A;  4QT6 A;  4IV1 C;  1PGW 2;  4A2U A;  1LOA A;  3I3Q A;  1B09 A;  4ORF A;  4L8Q A;  4J1W A;  2CWM A;  2W95 A;  4QB6 A;  2O14 A;  2VW1 A;  3J8F 1;  3JB4 C;  4NRP A;  1QU0 A;  2A71 A;  4XTP A;  5L19 A;  2MEV 3;  1VBB 3;  2BRT A;  2A6V A;  3R4S A;  3RS6 A;  1AR8 3;  1PVC 1;  2A3X A;  3N9P A;  3PMS A;  5FYC A;  1OT5 A;  1R1A 3;  4OHV A;  1G9A A;  3RJR A;  1W05 A;  5A3M A;  2P6C A;  3JBG 3;  4JQT A;  1RXF A;  4NWW A;  5JR7 B;  4AI0 A;  4PIZ A;  1YLL A;  2HEW F;  1ZZ8 A;  3B5L B;  2W92 A;  2GC3 A;  3NO8 A;  3TOJ A;  1VBA 3;  2DCK A;  4H7L A;  4YM1 A;  4QKB A;  1GU3 A;  4XJ9 A;  5DAW A;  2X53 S;  2JDP A;  2Q1M A;  2P4E A;  3GJB A;  3BB6 A;  3H42 B;  1UMH A;  3ZFE C;  3BYW A;  1KS5 A;  3LFI A;  3FX3 A;  1R1A 2;  5A6X A;  2XLF A;  4BK5 A;  2R07 3;  4GH4 C;  1FV3 A;  1S0B A;  2XJR A;  4ONU A;  1Y3T A;  2CGN A;  1H8T A;  2BNO A;  4RA0 A;  3PVB B;  3ZYP A;  3OJB A;  3LDR A;  2HLE A;  1W90 A;  1VP6 A;  1VBE 1;  3VDD B;  4HFS A;  3WNM A;  1Y9Q A;  5HCA A;  3B9I A;  5CFD B;  3ZR6 A;  1X7N A;  1DIW A;  4GB3 2;  3AVR A;  4JVA A;  3FHI B;  2N7G A;  4XBN A;  4ZXK A;  4FAH A;  2GC1 A;  3O1R A;  4FP2 A;  4S2H A;  3ENR A;  2VZS A;  1PMI A;  4EWE A;  5HXV A;  4AI3 A;  4EWA A;  3GZE A;  1FMD 2;  3FWE A;  3KQR A;  1PX3 A;  2R07 2;  5F2W A;  2ARE A;  3MLL A;  3AK0 A;  1XNA A;  4ARY A;  1PVC 2;  3VBH B;  4CUA A;  4AI9 A;  3E97 A;  1TZO A;  2RDS A;  5EJZ B;  3DGT A;  1QXP A;  4IGQ A;  4IE4 A;  1VRH 3;  1ZBA 1;  3ZSK A;  3RJ2 X;  5IUQ A;  4AHX A;  3S7E A;  1RUJ 1;  3AP5 A;  4QHZ A;  4ZU7 A;  3O1M A;  1XNC A;  2YPD A;  4GB3 3;  4AVS A;  4AVA A;  1XYP A;  4ERO A;  1HV1 A;  1VAK A;  4XCB A;  5FZ1 A;  3U37 A;  3MDP A;  1J1T A;  1TNR A;  2C9K A;  1JBC A;  2Y6G A;  2UWA A;  2KM2 A;  2SBA A;  3HT2 A;  5IWF A;  4AVC A;  1JZ8 A;  5JDB A;  1RUG 1;  4QPG C;  3THD A;  3NQH A;  1VE0 A;  4FBF A;  1EV1 1;  2CGP A;  1O5U A;  3NJZ A;  5DXD A;  1DQ4 A;  1RTV A;  2BGC A;  3UGH A;  1QJX 2;  4CEW B;  2Z4F A;  3BOD A;  4WM7 A;  2ETE A;  2B42 B;  1CES A;  3P6B A;  3VD3 A;  1LEN A;  1OA4 A;  3VBU A;  3VD7 A;  4AR2 A;  5J96 B;  2W1S A;  3VGI A;  2P3Y A;  1GYK A;  4DEV A;  5DG2 A;  2C5D A;  5BNP C;  4DFS A;  3I3B A;  4LK7 A;  3ACH A;  1EAH 3;  4BQW A;  3VUO A;  2RS1 2;  1S4C A;  4QPG B;  5B4X A;  1NUK A;  1ND2 B;  2YGL A;  1QJX 1;  1OPO A;  1NLQ A;  1KIT A;  2W1Q A;  2TUN A;  3AMH A;  5AVP A;  2EXI A;  5F8P A;  1PIV 2;  3O0W A;  3M7A A;  1XXN A;  3ZVX A;  5C4W C;  5DZE A;  3B01 A;  2WQZ C;  1AR8 1;  2XJS A;  3I97 A;  3QLQ A;  4Q4X 2;  1VAM A;  2XR4 A;  2WIN B;  2CSG A;  1OOP A;  5JPN B;  3J8F 3;  4BIO A;  4EV0 A;  1YO8 A;  4CA9 A;  3HMY A;  4IGP A;  3T3Y A;  3IPV A;  4IUG A;  2OKX A;  1RUJ 2;  4D3W A;  2Z2S B;  1L7L A;  1BCX A;  4IND A;  3H3L A;  2YBS A;  3N35 A;  4WM8 B;  2DWR A;  2JEN A;  3WF2 A;  3CNA A;  2QFE A;  3I2J A;  5A1L A;  1VBA 1;  4IEP A;  4N9I A;  1EV1 2;  4IL7 A;  4A44 A;  1UPI A;  3ZYI B;  4C8D A;  2R7E B;  3VDD C;  4QQP A;  4B1L A;  2PAE A;  3O0V A;  5FAX A;  5FZL A;  1G8W A;  4DQA A;  1BZW A;  1QQP 2;  4A3X A;  4CUG A;  5JZG C;  3R4U A;  3PL0 A;  4DUX A;  1D4V B;  5FPU A;  3DF0 A;  1RUC 1;  2DYC A;  2VUL A;  3RZZ A;  2HWC 1;  5DN2 A;  3K75 B;  5JUV A;  2A73 B;  2Y6K A;  4DRV A;  2J1V A;  2CV6 A;  2R06 2;  4LMF A;  1ZX5 A;  5FJH A;  2BGO A;  1K12 A;  1J59 A;  3TEX A;  1CR7 A;  5I0T A;  1MQT B;  2DUP A;  4LXL A;  5CA6 A;  4MGK E;  1JW6 A;  1JN2 P;  1UPS A;  2EA7 A;  2IXK A;  2WLQ A;  2BOJ A;  2DF7 A;  1QQP 3;  3R4D B;  3KV5 A;  3JQW A;  4P5H A;  4YG6 A;  4YW1 A;  5FTT C;  1AYM 2;  1ZRI A;  3NL1 A;  4ZKT B;  1KJR A;  3ACI A;  2P6H A;  2OUJ A;  4LO7 A;  3E5U A;  4H3W A;  1ZZ7 A;  4XFC A;  2JWP A;  5FOB B;  2B39 A;  4CXW A;  5BYN A;  5KXB A;  1COV 3;  2GMP A;  1DZT A;  4DO0 A;  2IXH A;  5C71 A;  1NA1 B;  4WM7 C;  4G4F A;  3O1S A;  2VD7 A;  1RUH 3;  3NJV A;  3AXD A;  2UYB A;  3A4U A;  1UOB A;  4AL9 A;  4RD7 A;  4CPB D;  3S7I A;  1NG0 A;  4XIK A;  3C3V A;  4QQO A;  4P9I A;  3VD9 A;  4BXF A;  2OPW A;  5JSO A;  3FZ3 A;  2ZGL A;  1AJO A;  2XGX A;  5FYM A;  2VQU A;  3KT7 A;  3SCH A;  1RUI 2;  4XXA A;  3SXW A;  4FPG A;  3EHK A;  2O1Q A;  1NX9 A;  4WM7 B;  1PO1 1;  2DCT A;  3G6J B;  1V0A A;  2IWG B;  4JRA A;  5A3O A;  2XVL A;  4LLO A;  5FYH A;  1OBN A;  1PMH X;  3MPB A;  4LHK A;  4M3C E;  4CCO A;  1OD5 A;  3OSD A;  2UY9 A;  4J6G A;  2Z69 A;  4I30 A;  2IXC A;  4KWU A;  3ZFG B;  2MNG A;  3RZL A;  1XND A;  1GWK A;  4CXY A;  3DCQ A;  4UT5 A;  2TBV A;  3RWN A;  3ZXD A;  4MHU A;  1O7F A;  4CU9 A;  5IVV A;  1C5H A;  3UV9 A;  3ZMO A;  1Q43 A;  1H9W A;  3ES1 A;  4N53 C;  2JG9 A;  2YFZ A;  3K46 A;  3M3O A;  4XUO A;  1CAX A;  2JIC A;  4ZU4 A;  1IPS A;  2ADD A;  4AG4 A;  4BQ4 A;  5JAX A;  1HRI 1;  1U5X A;  2A75 A;  4Q4V 3;  1PHM A;  3LE0 A;  4M4R A;  5KHG A;  2AEY A;  4XJA A;  1NZC A;  3MGU A;  5IW0 A;  3WT3 A;  4CDQ A;  4YM3 A;  5FRE A;  2X29 A;  2VBD A;  4EZ4 A;  3C7H A;  3POG A;  1QF3 A;  3EYP A;  4ITC A;  4QXH A;  3BOP A;  4MSV A;  1LUL A;  4N53 A;  5DG1 A;  4AI8 A;  2KD7 A;  3UGG A;  5FKB A;  3JD7 1;  3PTR B;  3GJA A;  2D3P A;  5GZG A;  2HJI A;  3I2K A;  2IXI A;  4OI0 A;  2VMF A;  2PXJ A;  2WA4 A;  3HEI A;  4Q4V 2;  1JOP A;  4IEY A;  1GNY A;  1H8V A;  4EN8 B;  1PK6 C;  4J1X A;  1GUI A;  1UY3 A;  5EYX A;  2ZTN A;  5LBF A;  5C7G A;  2XUE A;  3OUJ A;  5B4N A;  4E27 A;  1RUE 3;  2FMD A;  1H30 A;  3IT8 A;  1OLM A;  4TWT A;  4XBL A;  5FFO C;  3K4A A;  1ZRF A;  3KF3 A;  5K0U B;  1J58 A;  2QDR A;  3B7M A;  4KG0 A;  2OS2 A;  1DGW X;  2H6B A;  4P9G A;  5CYY A;  4PQ9 A;  3FLP A;  4MO3 M;  3O1U A;  5H9P A;  1GQP A;  5DZF A;  4Q8K A;  4LBQ B;  1PGW 1;  4XUP A;  1HDK A;  2CNA A;  3WDY A;  1ULC A;  5FMO S;  2DCJ A;  1IG3 A;  4JTO A;  3ZDS A;  5CIR A;  4XF4 A;  1W6N B;  2JD9 A;  2DFC A;  3RYK A;  2D43 A;  4BZ4 A;  1XYO A;  3OPZ A;  1NLR A;  5JIU A;  3OPT A;  3VDB A;  1UF2 C;  1UY4 A;  4RFR B;  4QX1 A;  2EIB A;  5FZ8 A;  3DKW A;  3MUZ 1;  5SV8 A;  3OEA A;  4YGD A;  1W6Q B;  4BU2 A;  2OYZ A;  4UOJ A;  1POV 3;  2P34 A;  5A7Q A;  3M3C A;  2VU9 A;  1GSL A;  3JU9 A;  3GAL A;  1ULP A;  2XML A;  4K7J A;  5FUN A;  4M3C A;  3WQ0 A;  5JXG A;  3POB A;  5C4W B;  2P3K A;  2G9Z A;  1AF9 A;  4I0W B;  1X33 A;  1YCI A;  3K51 A;  5A80 A;  4QD2 A;  5GM0 A;  2YXS A;  2ZOE B;  3AL6 A;  2F6B A;  2YHJ A;  1WCS A;  2BWA A;  4CP0 A;  2ZMN A;  5B2G B;  1UMI A;  4MXV A;  2ZEX A;  3I7D A;  1UN1 A;  2BVB A;  2XL9 A;  1RVF 2;  2VOW A;  3ZPY A;  3POS A;  2YBP A;  5T5J A;  4JCK A;  5GZD A;  2E7A A;  2ZZQ A;  1U5Y A;  5FZH A;  2H0B A;  3MIF A;  5EIY B;  1PM4 A;  5G05 L;  1CON A;  1F5F A;  2I45 A;  4Z07 A;  3VBO A;  2QQV A;  1AR7 2;  1AHS A;  4BB3 A;  3UJQ A;  1SDW A;  5DDJ 3;  1W6M A;  2FDJ A;  4GJZ A;  4RR3 C;  2W94 A;  4NR1 A;  2HWF 1;  5FZG A;  2LUW A;  4NHY A;  2UUR A;  1UIK A;  5JXI A;  2BNN A;  5K9Y A;  2VE1 A;  3KV6 A;  4O65 A;  3DXT A;  1RVF 3;  1J3R A;  1S2K A;  4IV3 C;  2QUO A;  2XKO A;  4LBO A;  3QBQ A;  3JD7 3;  2B8M A;  3MIC A;  2XQX A;  1MS1 A;  3ZMN A;  4CEY B;  1Q5O A;  3OGJ A;  5FMD A;  3V0B A;  4OZO A;  4Y20 A;  3RG0 A;  1W39 A;  1W6M B;  1ULE A;  4KU7 A;  3OGV A;  4I09 A;  2VZV A;  4FPH A;  2G9G A;  1YWK A;  4B4P A;  3UGF A;  1LED A;  2BW8 A;  3ZXJ A;  2WZR 2;  2RM2 1;  1WBF A;  3RQ0 A;  5LRS A;  2RHP A;  2IVI B;  1W9W A;  5FQ0 B;  4HVQ A;  5HPO A;  5A7W B;  1UU6 A;  1BBT 3;  4DEQ A;  3NAP A;  3RFR A;  1KDM A;  4QGN A;  2E7T A;  4Q8L A;  1TG7 A;  5D2A A;  5A6Q A;  2VCM A;  1OD3 A;  1PZ7 A;  1W3X A;  2R32 A;  1LOC A;  3OG2 A;  3J7L A;  4BQ1 A;  3FUO A;  3N7M A;  3RZK A;  1MEC 1;  3LEI A;  1AR7 1;  1NYW A;  2BUK A;  4FPK A;  1CAV A;  5JVV A;  4YGE A;  3AJY A;  5FLJ A;  4HOO A;  3H50 A;  4JX0 A;  4LNV A;  5GLU A;  3T09 A;  4YZ5 A;  4RS5 C;  5D8A A;  4P5Y A;  2J1T A;  1NE4 A;  2H0V A;  3OTF A;  3RMY A;  5BY5 A;  4AI1 A;  3NWK A;  3WW1 A;  3HPN A;  3J9S A;  3KLS A;  4FXK B;  4UXA A;  5DQ0 A;  3SEE A;  3IDB B;  2CY6 A;  3ZXG A;  2A70 A;  3NVC A;  1YI9 A;  4OMC A;  1CJD A;  4GUL A;  4QKF A;  3W59 A;  3ZXL A;  1OA2 A;  5H9R A;  4IEU A;  4WZC A;  4OZX A;  3SIS A;  2PTM A;  4IEX A;  3KGZ A;  2XLG A;  1LGC A;  4A7K A;  3D3A A;  4RS5 A;  1H8T B;  5D8A C;  4LT5 A;  3VB9 A;  4Q1P A;  3QH7 A;  4R9B A;  5F3G A;  4JDM A;  5F3E A;  4MYE A;  5JI7 A;  3U14 A;  4AYU A;  4XDO A;  5FP7 A;  4HVR A;  5CKM A;  1T6B X;  4BWO A;  4R8H A;  5L9R A;  3KD4 A;  3PVO A;  4M4P A;  1N1V A;  2P5B A;  2RR1 1;  4EWD A;  2WJS A;  2EXJ A;  4OHZ A;  4ASL A;  1H1M A;  4EJR A;  3PUR A;  1V70 A;  4LIV A;  4NRO A;  3ZKU A;  2XJV A;  4XMA A;  4CU8 A;  1A78 A;  4UFH A;  1YFW A;  1ODN A;  2R6Q A;  1DHK B;  1DQ6 A;  2ZXQ A;  1Q8S A;  1AR9 3;  2VW0 A;  4IGO A;  3H8X A;  4GWN A;  3ES4 A;  1OFS A;  4CUC A;  1C8N A;  2G19 A;  3KV9 A;  3PVN A;  1SFY A;  4YVW C;  3AMM A;  3M3E A;  1DQ1 A;  2P17 A;  4K1Y A;  3U07 A;  2JKB A;  4L9B A;  3LEK A;  1XRU A;  3UJO A;  1C3H A;  4NJ4 A;  4M01 A;  2ZHK A;  4Q0U A;  2HWF 2;  2QDN A;  1N47 A;  1UZ0 A;  2YG0 A;  1MS8 A;  1VBD 3;  1VJ2 A;  2BFU L;  5FZD A;  2WWS A;  2CHH A;  2OZJ A;  1ENS A;  3AL5 A;  4OCT A;  5F37 A;  1VPH A;  4CZS A;  3HNY M;  4D0Q A;  1R08 1;  3BU0 A;  1GR3 A;  4MXW A;  5LEK A;  4H55 A;  2PQQ A;  4JGY C;  3I54 A;  1X8M A;  2EAK A;  5FLH A;  2Q4S A;  1LOE A;  4NHK A;  1P8J A;  5FZO B;  4Q4Y 3;  3VZO A;  5IVB A;  3ZFG C;  3HWJ A;  3HAG A;  4OHX A;  1MAC A;  1O3T A;  1AXZ A;  4HZF A;  2VR4 A;  3KWV A;  1JXN A;  4IEZ A;  3VV1 A;  1UU4 A;  1NQJ A;  4ZZ5 A;  1JYX A;  4A6S A;  1WMF A;  4BM8 A;  4IER A;  5J1X A;  3LSE A;  5DAQ A;  2RR1 2;  4LOR A;  2DTW A;  5DUX A;  1JZ2 A;  5T54 A;  4FAG A;  3LA7 A;  5FP3 A;  4QPI B;  5FIX A;  3I49 A;  2AZ5 A;  3ZX7 A;  3Q9O A;  1LB2 A;  4UFM A;  1JYI A;  1JU4 A;  3DPR B;  3TYJ A;  1QXR A;  3FL7 A;  5C33 A;  2F4P A;  3BTZ A;  1LCL A;  1X9P A;  2VCA A;  1Z0H A;  3LF7 A;  4FFG A;  5E6H A;  1AR8 2;  1BVV A;  2QBX A;  2VUC A;  3BU7 A;  2AGS A;  3RGB A;  5JSR A;  1ACC A;  4TN7 A;  1CX1 A;  3LZZ A;  1QJY 1;  2VMD A;  2VNO A;  1H4G A;  1ZZ6 A;  2WYF A;  4B29 A;  5J7M A;  1W9T A;  1S0C A;  5L7O B;  2RS3 3;  4L2N A;  4L92 A;  4HKO A;  5C8C A;  2AEN A;  3WNN A;  1YYN A;  5HBA A;  1AX2 A;  1SFP A;  1NY7 1;  2GN3 A;  2NLR A;  3GHM A;  3P3N A;  4KGG A;  2ADE A;  5FXX A;  1JYC A;  2A6W A;  4LJH A;  2E6V A;  4AQ2 A;  5IFT A;  3IZO A;  4CUB A;  1UYX A;  2JDU A;  3ZYJ B;  5FZF A;  4BLI A;  4MGZ E;  2F17 A;  3WIN E;  3S57 A;  4FOY A;  4Q29 A;  5KC5 A;  4QDQ A;  5FCC A;  3VL9 A;  2C26 A;  2P1B A;  1W2A X;  3SLI A;  3RI8 A;  5K7P A;  1OUS A;  3IKW A;  5L7O A;  1SLA A;  1UL9 A;  3PDQ A;  2HYK A;  1PM7 A;  2Q8O A;  4CDX B;  4UFL A;  1ZBE 1;  2GME A;  1HKD A;  1J3Q A;  1REE A;  2X8K A;  1VBC 2;  3L2Y A;  4F7Z A;  3GZU C;  3FLR A;  1GWL A;  4M0N A;  4YAR A;  4BPZ A;  2WFP A;  1JH5 A;  4MAD A;  1FX5 A;  2ZGR A;  4IE6 A;  1O59 A;  3E6C C;  3HQU A;  4AE2 A;  5LY1 A;  1RUC 3;  3C7O A;  1AL0 G;  2BYV E;  5E1R A;  2AR6 A;  3OOX A;  4S2F A;  4ZS2 A;  3ZFE B;  4D6S A;  4Z1V A;  1PIV 3;  1X82 A;  4HT1 T;  3K4D A;  1C8M 3;  3MIG A;  4LA3 A;  2IZW A;  3CZJ A;  2HWC 2;  3IBM A;  1VRH 2;  2PLV 1;  5A7S A;  3AKT A;  1RIT A;  1VBC 3;  3MO4 A;  4CP1 A;  4I02 A;  4EZH A;  2C9A A;  5BNQ A;  1XB9 A;  1BYH A;  4Y1U A;  4DRR A;  2A6Z A;  2PHX A;  5K8S A;  1XE7 A;  4PLO A;  1W6O B;  4XXP A;  3ZYG A;  1EAH 1;  2DUQ A;  1LHO A;  2ZHM A;  4OI4 A;  4QX5 A;  4UF0 A;  2QZ3 A;  1GIC A;  1GKB A;  1J84 A;  4K8F A;  4OHY A;  1DLL A;  3WUC A;  3VZJ A;  5GLV A;  1C8M 2;  1OVS A;  4AEJ A;  3O7O A;  3OF1 A;  5FMO L;  4AVB A;  3RRD A;  3ZN4 A;  3WW2 A;  2VZ1 A;  1TNF A;  5A1A A;  1XJA A;  2Y60 A;  3SNM A;  2OXB A;  3ZYR A;  5C9A C;  1DZQ A;  1UQX A;  1N1S A;  3NNM A;  2VTX A;  3WNO A;  3HN3 A;  5IK5 A;  3N3H A;  4JKK A;  2XXZ A;  4HK9 A;  1LTE A;  5EV7 A;  3AB0 A;  2NMO A;  2BV4 A;  3VBO B;  1VBC 1;  1RB8 G;  3HBZ A;  5IJR A;  4IV1 A;  1HN0 A;  1Q8O A;  3WDW A;  1LHU A;  4CCC A;  1W8O A;  1FT9 A;  4RL7 A;  3WSO A;  5IT6 A;  1YRZ A;  1W0N A;  1WD4 A;  2VTF A;  1PIV 1;  4R4X A;  2PMW B;  2XH6 A;  4S2G A;  4XAC A;  1HQW A;  2NP0 A;  2DVG A;  3HJR A;  1I6X A;  5FYB A;  1WBL A;  2X09 A;  2XUM A;  5DUU A;  3ACL A;  3LDK A;  4Q0S A;  4Q4X 3;  2XVG A;  3VKL A;  1W3V A;  2X05 A;  1W04 A;  4LBQ A;  3VBO C;  4HPK A;  3C8X A;  2KA3 A;  2OA2 A;  4ISR A;  4HBN A;  4FXG B;  5LY2 A;  2ZX4 A;  1JI6 A;  5C3S A;  1DYP A;  4Q27 A;  2VTX J;  3SKJ E;  3VDA A;  1IS6 A;  5LA2 A;  4Y22 B;  4OI1 A;  3LD8 A;  1X9T A;  5GJ6 A;  2VPV A;  2V73 A;  5FZ0 A;  2JB8 A;  1GQH A;  1H2L A;  4WVM A;  2WWU A;  1W03 A;  2GU9 A;  2WQ4 A;  4DIQ A;  4X6Q B;  1XC6 A;  2GAU A;  5IAX A;  1WGP A;  4LIU A;  1D4M 1;  4E4Z A;  3DKQ A;  4QX8 A;  5FZE A;  1FAT A;  4CEW A;  1OH3 A;  3Q8A A; 
#chains in the Genus database with same CATH homology
 2FCV A;  3OUI A;  5IAV A;  5LAS A;  3W20 A;  4NHM A;  3GZE A;  2FCT A;  5HV0 A;  5IAT A;  4XCA A;  3EMR A;  4ZPI A;  2HBT A;  5LBE A;  5LB6 A;  2RDS A;  3ITQ A;  5LAT A;  5DAX A;  3NNJ A;  3KT4 A;  4Q5O A;  2Y34 A;  4XCB A;  5HV4 A;  2A1X A;  3HQR A;  3NNL A;  2RDR A;  2OPW A;  4NMI A;  4Y5T A;  4XAB A;  2JIJ A;  5LBC A;  3HQU A;  3KT7 A;  5M0T A;  5L9R A;  4BQY A;  5L9B A;  4Y5S A;  3W21 A;  5LBB A;  5LA9 A;  3KT1 A;  5DAP A;  2G19 A;  5A3U A;  5C5U A;  4MHU A;  4BQW A;  2Y33 A;  2JIG A;  4NHX A;  4BQX A;  5C5T A;  4IW3 A;  4NHY A;  4NHL A;  3MGU A;  3NNM A;  4ZON A;  2V4A A;  4UWD A;  2RG4 A;  3GJA A;  4NHK A;  5EPA A;  3NNF A;  5DAV A;  5EQU A;  4XAC A;  5DAQ A;  4NAO A;  4JZR A;  3OUH A;  5LBF A;  2G1M A;  2FCU A;  3PL0 A;  3OUJ A;  4J25 A;  5DAW A;  3GJB A;  3BVC A;  5L9V A;  4MHR A;  5IAX A;  4XAA A;  5ERL A;  2RDN A;  4KBZ A;  5EP9 A;  3DKQ A;  3OBZ A;  4XC9 A;  2RDQ A;  2HBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...