5M0TA

Alpha-ketoglutarate-dependent non-heme iron oxygenase eash
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
287
Chain Sequence
SKPTLRRIPRSAGDEAIFQVLQEDGVVVIEGFMSADQVRRFNGEIDPHMKQWELGQKSYQESYLAGMRQLSSLPLFSKLFRDELMNDELLHGLCKRLFGPESGDYWLTTSSVLETEPGYHGQELHREHDGIPICTTLGRQSPESMLNFLTALTDFTAENGATRVLPGSHLWEDFSAPPPKADTAIPAVMNPGDAVLFTGKTLHGAGKNNTTDFLRRGFPLIMQSCQFTPVEASVALPRELVETMTPLAQKMVGWRTVSAKGVDIWTYDLKDLATGIDLKSNQVAKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent non-heme iron oxygenase EasH
publication title Structural characterization of EasH (Aspergillus japonicus) - an oxidase involved in cycloclavine biosynthesis.
pubmed doi rcsb
source organism Aspergillus japonicus
total genus 96
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5m0tA00
5DAPA 5ERLA 4BQYA 5LATA 3KT7A 4BQWA 4XACA 2Y34A 3OBZA 5EQUA 4KBZA 5LA9A 5L9VA 5A3UA 3W21A 2OPWA 5DAWA 3OUIA 2FCUA 5C5TA 5L9RA 4ZPIA 4Q5OA 5LBCA 5DAXA 3HQRA 3NNLA 4NHYA 5DAQA 3OUHA 4MHRA 3OUJA 3NNMA 5IATA 2JIJA 4IW3A 3BVCA 3ITQA 5LASA 2G1MA 3W20A 4NMIA 5HV4A 2FCTA 2RDQA 3HQUA 4XABA 5EP9A 3NNJA 2Y33A 3EMRA 2G19A 2V4AA 4BQXA 4NHKA 3KT1A 5LBEA 5IAVA 5IAXA 2RDSA 2FCVA 4Y5SA 4JZRA 5L9BA 2JIGA 4XCBA 4UWDA 4Y5TA 4ZONA 3GZEA 5HV0A 5EPAA 4NHXA 5LB6A 2A1XA 5C5UA 4XAAA 3PL0A 3GJBA 2HBTA 5LBFA 2RDNA 4J25A 3DKQA 5LBBA 4NHLA 2RDRA 3MGUA 4MHUA 5M0TA 4XCAA 4XC9A 5DAVA 3NNFA 2HBUA 2RG4A 4NAOA 4NHMA 3GJAA 3KT4A
chains in the Genus database with same CATH superfamily
5F5QA 3SCHA 2CL2A 2UU8A 2ZTNA 4GH4A 2CNAA 4L99A 4FPEA 1LTEA 5C9AB 1ZRDA 4LBJA 1YWKA 3K75B 1KS5A 3NAPA 4XQ4A 2YPJA 1OD3A 3NO8A 2OQ7A 3K3NA 2RS53 4XFAA 3IIIA 4EN8B 2EIDA 4IV1C 4JV4A 4OFGA 2CYFA 4M3CE 5FY9A 4Q1RA 3T09A 3W21A 1SBDA 4N8MA 2KR2A 3KGLA 4E4HA 4NIHA 5F3EA 1QQP3 1RUG1 2SLIA 3UESA 5DUXA 5F7UA 2CGPA 2QDRA 4LHNA 1F5FA 2OXBA 5LBCA 2BDRA 2WS93 1EAH1 1ENSA 2LW8A 2ZKNA 4Q4W1 2FBEA 3ABZA 3S5QA 4CCJA 4F83A 4NIGA 5DN2A 4UFLA 2PAEA 5FZKA 3RZZA 3K4DA 3VZKA 4Q0VA 1AXYA 1NQJA 4OUEA 1IQDC 4D7SA 2DTYA 2XJUA 2W2IA 2A3YA 3NJYA 2ZX1A 4NR1A 5JPNB 3A4UA 3OD0A 4YW6A 4N90A 3P3PA 4GWJA 3VBFA 3VN4A 1OLMA 4YRDA 4BIFA 2R6QA 3A0KA 2A75A 5GZCA 1W6OB 4XJ9A 1CAXA 3VBSA 4FTSA 4E2QA 1UWWA 1BKZA 3ZXJA 4JHZA 3G6JB 2NP0A 4AQTA 3SCGA 5J96B 4AI2A 3WQ1A 2NM1A 2YBKA 3KQRA 2WFF2 3LE0A 1QJU2 2IXJA 4DNYA 4FFIA 3W5MA 3JD73 2JG8C 4AHZA 1RUF1 3RPQA 1W8OA 5FAXA 1IPJA 2VAUA 5C3OA 4D69A 1K5MB 3NV4A 4Q0SA 1BYHA 4BJ0A 3WF0A 3PJYA 3K46A 4FT8A 5FZ3A 5FZOB 1EV11 4HVQA 3AJZA 2WT1A 1W39A 1O7FA 2ZGQA 2LROA 2R16A 2JKXA 2A73B 3H0OA 3FLRA 3RS6A 1KFUL 4KU8A 1BQPA 5FYZA 3VZJA 4DUWA 4FAGA 3LEMA 5BNPA 2XPJA 3QH6A 1LHUA 4QM8A 2QQOA 4GMP0 1DGWX 3FLPA 4FP3A 4RQPA 1W28A 1QGLA 4YVWA 1UL9A 1GP5A 2A1XA 2ZX4A 1JYCA 3NMBA 1OQDA 2VCAA 2WZR2 2XQRA 4A7KA 1JN2P 3GJBA 1WUVA 5J7MA 3J8F1 4Y4RA 4ATEA 3M3QA 1J58A 4B3NA 4BM8A 3O1UA 3IKWA 3HWJA 5M0TA 2G4IA 3AXDA 2D5FA 5IVFA 1ULEA 3HEIA 3MLKA 3SNMA 4A3XA 4XIOA 4RGAA 1ASJ1 2DUQA 2RS12 4NO4A 1EY2A 2HBUA 1AF9A 3USUA 3M3CA 3RZKA 4H7LA 3HQXA 1DQ5A 3UGGA 3VDDC 1OOPA 1WMXA 4RN5A 4MH0E 4HZFA 3CBNA 1UY4A 2H6BA 4I02A 1ZBE1 2XBO1 3T2OA 3ATGA 4BQYA 3WW1A 4BCUA 1W90A 3JZVA 4WZFA 4AI9A 4OYUA 3HVDA 4IE5A 4BU2A 3MICA 1BEV2 5FZHA 1SPPA 2WABA 3MO4A 5ABJA 1Q8PA 4OZOA 1F31A 1KITA 3H7YA 4PIZA 5F9TA 2Y6HA 4DXRA 3K2OA 1AXKA 5A1LA 5F6KA 2FDFA 4K8RB 2WQZC 4Q5OA 1DZTA 2E9QA 4XAEA 5FY0A 1GP4A 1MZ5A 4XEZA 3VHRA 2X5IC 4XF4A 1POV0 1G9BA 3W59A 5E8AA 4Z92B 4P00B 2PHRA 2ZEYA 5C4WB 5F8PA 2RMU3 1H8TC 1COV3 4LORA 3NNMA 1L3JA 4XXAA 4QXBA 4YW5A 5TSWA 3ZLIA 1LJ7A 4QQ2A 2CWMA 1R092 2PELA 1AR61 3I2KA 1HB4A 2A6WA 2C1FA 2VULA 4W65A 2HEYF 1CWPA 3V64A 1UNBA 1H6YA 1OD5A 4OZXA 4Q0PA 4LLOA 4Y24A 1PO23 3W5NA 2FDJA 2ZMLA 3BOWA 4AXOA 1PIV3 2YU2A 5KXDA 4D8MA 2VOTA 3DYMA 3PNAA 5C9AA 3I2DA 1QJY2 2XJTA 2BNOA 1UPIA 5IVJA 3T4VA 4XABA 2Q30A 2RVAA 2YYOA 4M3CB 1G9DA 2WAAA 1CD3G 4MADA 2KD7A 3NNJA 2GMMA 2VE1A 3E5XA 1RVF1 5A3OA 1OBNA 2G19A 4AFCA 1V00A 2XQXA 1W6PA 2YBPA 5FJHA 2BJSA 4HVOA 2ZGPA 3R05A 5FYMA 4CEWB 1ONAA 1TEIA 4YW7A 3E5UA 1ENRA 2JD4A 4JRAA 3FFQA 1W8ZA 4NHKA 5LY2A 2RV9A 4OHZA 5T5PA 2W1WA 2CDOA 4JHTA 1GBGA 4AQ6A 5A6QA 4HPKB 4OHXA 3WZ1A 4UWDA 1FATA 2BYVE 4EZ4A 3AMMA 1VBE1 1OI6A 4XHXA 2VZTA 3Q8EA 1QJX1 1LENA 2AENA 2ZOEB 5C5UA 1FOD2 1F4HA 2R071 2RMU1 3WP5A 2JDHA 2VW1A 1V6IA 4QQHA 3LEIA 4HL0A 2R061 5H9QA 4EJRA 4QDQA 3R4SA 5JSRA 1RINA 2P17A 1LOCA 2ZEZA 2IXHA 3WCRA 1GR3A 1UN1A 2E7AA 3NRUA 4IEVA 4XUPA 2E7QA 4A7YA 2WO3A 1YQ6A 5FV3A 5AVAA 3D5OA 4UI9L 4YG0A 3ZN6A 4J1XA 5FZ6A 2WNVC 2XLGA 3VBOB 1C57A 3B00A 3WP4A 4OI1A 5FZBA 2VW0A 1SACA 5D21A 2K2SA 4AFAA 1K5MA 5FOBB 4NAOA 2VZOA 3KHBA 4UW4A 5FZOA 1H1IA 4HSJA 2YHJA 4M00A 2R32A 3WV6A 3AP6A 5CEHA 5A33B 1JZ3A 2WYFA 4CDQC 3M3OA 3TWIA 1LR5A 5LK5A 4CYDA 1EUUA 5FMBA 5T5JA 1W9FA 2VNVA 4XUOA 4HN0A 3I3EA 1WA4A 4XW3A 1QY4A 4L11A 5IW0A 1BZWA 1Q8OA 5E89A 4TN7A 3I3QA 1YI9A 5EQUA 2WNOA 3IN9A 5FYUA 5DAWA 4CUBA 1MS9A 1JBCA 2IWGB 4DS0A 3BYWA 1RMU1 2WFF3 4Z8BA 5FR3A 4QPGB 4A6OA 2GNTA 4WM8B 2WLPA 2QZ3A 3NNGA 4FVVA 4PCRA 4HOOA 3ENRA 3N7JA 1W2NA 2VXRA 4HN1A 4ZXEA 5FMCA 2HWD1 3FN9A 1UU4A 4MHRA 2YY1A 4RHV1 1SLTA 1X7NA 4QPIC 5K9YA 4NN0A 5J36A 1YC61 4AEDB 5CFCB 1ND2C 4Q4Y2 5FUPA 4CCKA 4QXCA 5IATA 2W94A 2ZX2A 4JDNA 3FUOA 2I2SA 2QDNA 4C8DA 1U5XA 4I0WB 1ULCA 4XE9A 2RS32 3ZN4A 1LAJA 1W9TA 2CGNA 1WLDA 5C8CB 3TEZA 1AR71 2CGOA 1QWRA 3LZZA 3AXEA 4F3JA 4V2WA 3LB9A 5HXVA 5FZAA 3U14A 3L9JT 1MS0A 1QDCA 2YMZA 3I49A 1CJPA 3J4UH 4KU7A 3W20A 3NSTA 1TMF1 2FCTA 2WZR3 2AH2A 1S0BA 1DGRA 3B02A 3J7LA 1OF4A 3R4DB 4GB31 3E97A 5C3PA 3CIHA 2LM3A 3S7IA 2D6NA 5FYHA 3U4XA 2A7AA 1DLCA 2NMOA 3OYWB 1MEC3 4LKFA 2WNUA 4B7EA 2EALA 3MUZ1 1AHSA 3F2ZA 3WX5A 2D3RA 3ZFEB 1JZ2A 4W6YA 3AKTA 5K0UB 1T6GC 3AKSA 2K0GA 4X8NA 1QEXA 1RUD1 2NQYA 1REDA 1VRH1 1OH3A 4A2UA 4AE2A 1V70A 1RUI2 2QKDA 2EXHA 2RS13 5DG2A 1BK0A 2YUEA 4URAA 1F15A 4BK4A 2FZ2A 3SCFA 1D4VB 1PGSA 2Q1FA 1K12A 2RDSA 1QJEA 4P14A 1IS3A 3WOGA 5C4WA 2J1UA 5FDBA 3N9MA 4DXZA 1FNZA 2VUCA 4YLZA 4UT5A 4GWIA 4AGVA 2F4PA 5K7PA 5D8AB 1G86A 1E57A 3LSDA 3MIDA 2VU9A 5E88A 1TG7A 2L9LA 2PQQA 3I4IA 1NUKA 1ZZ9A 1LHWA 1KS4A 1R1A1 2OUJA 5CAZA 1BEV3 3DEMA 3EYPA 2HBTA 5FY7A 5F3IA 3U0ZA 1FPN1 2VZSA 5LBFA 4RD7A 1PVC2 4CEYB 2RDNA 1S0JA 2J1TA 1H2KA 1XC6A 3CJIB 1AVBA 3O5SA 2Y38A 3ZMNA 5L7OC 1H9WA 2IUWA 2C6SA 4M0NA 1HJGA 1QJZA 4H7MA 5G05L 3WNXA 2QUOA 4B4RA 4O65A 2GC3A 4HLTA 1V9U3 3O1PA 1IS5A 4BYYA 3SKVA 4C91A 5JXIA 1KEXA 1LOEA 2EA7A 1NY72 4N53B 4EN0A 4CEWA 2Q5TA 5HPOA 4GMP1 4R9DA 1X33A 2ZHLA 1F35A 1Q43A 1R093 3KVBA 5AC91 4BQWA 1XSRA 5A7PA 2BNMA 1SCSA 4HPKA 5FPXA 3IDCB 5I93A 2JECA 1GNHA 3ZFGB 5A3UA 4UOJA 3I3MA 3RWNA 3WNMA 4M4RA 3PUAA 5BNNB 3NW4A 2XL9A 4L0PA 3K51A 1QJY3 2XB6C 2VOXA 2P3KA 3WINE 2GN3A 1WW4A 1UQXA 4R9CA 5LCWL 5F2WA 3ZYHA 5EJZB 2ZMKA 3P3NA 1O3QA 3U4SA 1XNCA 3LEKA 5LRSA 1FT9A 3OUJA 2J7MA 3DPRC 1MZFA 1ULGA 3E5QA 4RR3A 2H6CA 2P37A 4Q4W2 1IKQA 2GSYA 2VQAA 3C8XA 3QLQA 2WWSA 3AM2A 3VBOA 1UAIA 3WCSA 3ZX7A 3GGLA 4DRRA 1VAMA 4YYOA 3GZTB 1YQCA 2JXAA 1PZ7A 4S2GA 2D3SA 1W8NA 1NCRB 1OFSA 2Q4SA 2WC2A 5GM0A 1V9U1 5E16A 3ZR5A 4W6WA 1C8M3 3O0XA 4GJZA 3GF6A 5A3TA 5JR2A 3L2HA 1ND3A 2HLEA 1UXXX 1NG0A 2JWPA 2XJQA 3HBKA 5L73A 5FPUA 4L97A 5FRAA 1FOD3 3RMYA 2G9FA 3ZO0B 1WZXA 4JQTA 2ADDA 4QGLA 1MR5A 4MGYE 4I0BA 3ZSKA 1AR91 3FE5A 2B8MA 5DPNA 3BUCA 1POV1 3LKJA 3W58A 4IL7A 4KH9A 5C7GA 1L7LA 4LXLA 1RUF2 5HBAA 1WCQA 1AJOA 4FOQA 2FQPA 2IC1A 4IDZA 3ZSLA 4NVPA 2BV4A 3CEWA 1OHFA 4WM8A 5FP9A 5FPLA 1HDKA 4JTNA 2OW4A 3VBSC 3PMEA 1EV12 4FO9A 4XMIA 3VL9A 2QCSB 3E1F1 5DABA 1KXGA 2VQUA 1C4RA 2CAVA 3ZR6A 4AEDA 2EAKA 1D0GA 2HWB1 4CSWA 3VHNA 2XOMA 1DZRA 3MF6A 2JDAA 3OB8A 1LHNA 1UMZA 2B46X 2EIBA 2Y60A 3AKRA 1QXPA 3OPWA 1L7QA 4WVZA 1DHKB 2B7YA 4RGGA 1RUJ3 1HJFA 2DV9A 4P02B 1JH5A 3N9OA 5C3QA 2QQNA 3J8F2 1LOGA 5KXCA 1W3VA 5FY5A 4GH4B 4DEVA 2XJPA 4AVTA 4NROA 1Z78A 4GJYA 3NAPB 2ZGRA 3OYWA 1PK6A 3TBDA 3KZ4C 4UFIA 1QOTA 1H2NA 1OT5A 4IEZA 3ZFEA 4PT6A 2R0FA 5ANQA 1ASJ2 3ACGA 4K8FA 5A3PA 2Y0IA 5JIUA 4WVVA 5ERLA 1DQ0A 1UY1A 3OGGA 3SQOA 2R041 1E5SA 4YW3A 4W6XA 1H1AA 4GIQA 1W8FA 1RUNA 4HKOA 3RVHA 1ZBE2 2XBO2 3M8LA 1J84A 4B29A 5BNOA 5CG8A 3O12A 2RS33 1YIFA 3HNYM 3KSCA 3KV5A 4LO6B 1CESA 5F3GA 4IGPA 1UIJA 5D8AA 1WD4A 1U5YA 3OEAA 3U78A 2Y8KA 3GBFA 4QWNA 4PF5A 4XFFA 4ITCA 1XJAA 2WBKA 4IESA 1ZREA 2BVBA 4Q4V3 4XFHA 3ZXLA 1O6UA 4CZSA 3T4HB 5H9RA 1UD1A 2AZ5A 5DAXA 3NWKA 4OHYA 1R64A 4OCTA 4C0BA 2V4VA 3N7LA 3SITA 3JBG3 3WG3A 1PHMA 5A70A 5FMDA 5FUIA 4GKXA 3CJIA 4OUMA 4META 3VB9A 4E8CA 2VUAA 4UFKA 1OH4A 2XL7A 5KXBA 1H9PA 1VB2A 3J26N 5G04L 3WP6A 1KGYA 1EYBA 1QF3A 4JAAA 4Z82A 1UF2C 2JD9A 5JMCA 5ABJC 1UMHA 1RUJ1 5K4LA 4NIAA 1RUI3 4IE6A 5CIRA 1OVPA 2NPIA 4YG6A 3WNLA 1GUIA 3CMGA 3MI8A 1VMJA 2OX0A 4N53A 3WW2A 1DQ1A 2WJSA 4U36A 2J42A 3H1WA 4FXKB 1S0EA 4S2FA 4XJ8A 4COWA 5A1AA 1BCXA 1AR62 3ZFFA 3UV9A 5EXOA 4LBNA 1GZ9A 1XE7A 5B4XA 1XYNA 1VAVA 5DZEA 3VD5A 4P08A 3AZWA 5ACA1 4L2NA 4YM3A 2TNFA 4JGZC 3ZYRA 2WQ8A 1NA1B 4EE2A 2P6HA 1OXCA 5EP9A 3BPZA 4YM0A 1PVC3 3K48A 4OUSA 3ZFGA 4NJ4A 5BNPB 4JTOA 5IK8A 5BNNA 4BH9A 1X50A 1KJLA 3POWA 4BOWA 3RZJA 5F37A 3UK9A 4DXSA 1WMFA 4Q1PA 3LWCA 2XKPA 1MACA 1GNZA 1PO11 1RVF2 2BP6A 1RUC1 1HQWA 1NZIA 4LHKA 1LB2A 1F2NA 1GOFA 3CF6E 3PVBB 4UFJA 1DGRN 2KM2A 3WQ7A 3J7HA 5KC6A 1C8NA 3AC0A 5F3CA 1NLRA 1PMIA 3UKTA 1MQTA 1RHI1 4EYUA 2JIGA 2GAUA 5I8YA 1HV0A 1PNGA 2Y6FA 4OLLA 3RZLA 1AZDA 5FP7A 1UPSA 1AX1A 5KHJA 4NAMA 3TN93 3C2UA 3VBRA 4XAAA 2QQMA 2RM21 1WCUA 2R7EB 4MLOA 4IE7A 4ZS3A 5IYYA 2WNEA 3SC7X 3WR0A 5DG1A 1S0IA 1VBE2 2OYZA 3DF0A 1QJX2 1T6BX 4HBNA 4XTPA 1ZZCA 2R072 2RMU2 1ZZ7A 4OQ8A 3H1YA 2R062 2VMDA 4MXVA 4KWUA 5A7QA 5JXGA 3RZGA 1IKPA 2HWC1 2LALA 3U75A 1KDMA 3ZXDA 3PTRB 4YGCA 2VCBA 1H2LA 5CZKA 2OZJA 1SPPB 4COUA 4RGKA 1RUG3 5JSPA 3MW3A 2QQJA 4HVRA 4CU7A 4CTEA 4D6RA 1RUH3 5FTTC 1PVXA 1EAH3 1Y9QA 2AUYA 2P4EA 2VNOA 5A6ZA 5EFUA 5JI9A 1OLRA 1S2BA 3LFIA 5T5OA 3OPZA 2JDKA 3PJQA 1T2XA 5IK4A 2IVIB 2W95A 1V6JA 3LAGA 4PDWB 4FTEA 1W2TA 4U2AA 1YEWA 2VY0A 2ZGTA 3N35A 3HN1A 4K6BA 4ZY9A 4YZ1A 2C24A 1YXWA 2VZ1A 4LKDA 1AL21 1J1TA 3MBWA 2ZGNA 4O9GA 5LZ6A 3LOBA 5L9RA 4XBQA 4LE4A 1K5MC 1W2OA 3EB7A 1EUTA 3TN91 2YB7A 3OUHA 4UYBA 1UW8A 1J3RA 4LA2A 1WD3A 4MXWA 1RMU2 1W06A 2W0XA 2BU9A 1RUF3 4AEMA 1J3PA 2HWD2 5A3LA 1Q5OA 3N4MA 1HV1A 1J3QA 2WSVA 2EVXA 4IV3A 2B5HA 1SFNA 4LITA 1XNAA 4RHV2 5JCTA 3O14A 1EV13 1I3HA 4R52A 2ZX0A 1WW5A 3BCWA 3ZYPA 1R1ZA 2VG9A 3ZXFA 1ULDA 4BPZA 2ATFA 2VZUA 4E4SA 1W6PB 5EJ3A 4P5YA 4PF1A 4Q4V2 5LASA 2PMWB 2VUJA 1G9CA 1O91A 5J37A 1RUH1 4NMIA 1GZWB 3AZXA 1AR72 2ARCA 3OJBA 3WW4A 3ZYFA 2P6CA 2BFUS 5GKAC 1FMD1 1V6NA 4Q26A 5A7WB 2XHKA 1SBFA 5EHDA 4P9YA 2GU9A 3EXUA 1TMF2 4GB32 3WD5A 3WEZA 4F7ZA 1WW6A 3J8F3 3VZMA 1VBA1 3P5BA 2GC1A 2O8QA 1VMHA 5CBLA 4L92A 2PHWA 3RJRA 2EF6A 5T50A 4JC1A 2F17A 5DMYA 2YC4A 5SV8A 3ZXKA 5IAVA 4XOGA 4DUVA 1KDKA 2QZ2A 3ST7A 1NE6A 1QHDA 5JOYA 2AR6A 2X05A 1RUD2 2WQ4A 1VRH2 2YGMA 1ASJ3 2DVGA 5GLZA 3JUUA 3UYJA 3JCIA 3WNPA 5A80A 1UZZA 3H50A 4EWAA 4QU2A 5HV0A 2HWF1 2P3IA 2D6KA 4LOSA 1O8PA 5F2SA 4H55A 5FYBA 3ZN6B 3A21A 2PHXA 1ZBE3 3D3AA 1WLWA 2XBO3 2ZEXA 4AHXA 2HJIA 1LOFC 2QFEA 2OUHA 2QNKA 2VZRA 4MGIE 4N9HA 1UY0A 1UX6A 1R1A2 4H2AA 3IB3A 3WY6A 4Q2FA 5I0DA 1MS5A 4NUBA 4K1YA 3VHOA 3AYEA 5LBBA 3WDUA 2XVLA 1FPN2 1GOHA 4YW4A 5A3WA 3VBHA 3ZYGA 2ORZA 1WBFA 4IEYA 3JXSA 3MLJA 2ILMA 4FQZA 1NA1A 3OBRA 4IEUA 3AP5A 3ORJA 2ZKLA 1YUDA 1NXMA 4F8AA 2B39A 3M7AA 4QX1A 3O1MA 3KT4A 4LKSA 5C3RA 5FBZA 3AYAA 3SHRA 4UW5A 2JDNA 2X53S 5I0RA 1R083 4AVVA 2A3WA 4ASKA 4AI3A 4LK7A 3USSA 3POEA 4WM7A 2W87A 1FNYA 1TME1 5H9SA 1MEC2 2WAOA 1BMV1 1QJFA 4JKMA 1AR63 4TXWA 5AC92 5T3NA 3WXPA 3T1LA 2A6ZA 5JR7B 4TLFA 1GANA 4QX0A 3BTAA 3N9NA 5CYYA 4IV1B 4YZ2A 1RIRA 2VZ3A 4CEWC 2QJVA 4X6RB 2BBVA 1VALA 2D6MA 3GALA 1AUYA 3MPPG 1W6NB 5CFDA 1PZ8A 1O5LA 3MIFA 5GLUA 4DQAA 2CAUA 1CQ9A 2PA7A 1WBLA 3BB6A 4YG3A 1ZZBA 5A3MA 2HYXA 5JIAA 3GBWA 4LMFA 3WDYA 1RVF3 4CUCA 2GNMA 5IWFA 3AYDA 4AVAA 3DL3A 3T0BA 4IEPA 4QHBA 1QH6A 1W9WA 3PU8A 4HK9A 1DQ2A 1MS4A 1D7PM 1RJ7A 4M4PA 1N3PA 4JGYB 3ZPYA 2WNUB 1FYUA 4CCNA 1APNA 5BNQA 1SDWA 1UZWA 2MPFA 2YV8A 2ZACA 2R1BA 4XDPA 5FP3A 4AGRA 1V9U2 4KWLA 4PDWA 1YI7A 2XGXA 3Q9OA 3WNKA 3A22A 1B35C 3DXTA 4K20A 5FZ7A 4NWWA 4CDWB 3LGRA 3MLLA 1V6MA 1CZSA 1R081 1VBE3 2IZWA 4IERA 5EV7A 2XWBB 1HB3A 1QJX3 1MZEA 1YNAA 2I74A 3HMYA 5A7OA 4AFMA 1HRI1 2R073 2VD7A 3H8RA 5APAA 4YVSC 1PGW1 2GZWA 2R063 4YGBA 2PQSA 1HRV1 2RJKA 1SCRA 1AR92 3VKOA 4A44A 2EAAA 2EIEA 2J1VA 3M4FA 3ZDVA 2Q8CA 4QQPA 4GXLA 1YCIA 4Z07A 3EHKA 4HSLA 4TLGA 5F1RA 3PUIA 3WHTA 2YPDA 1X9PA 2XVKA 2BRTA 2PN5A 4YFZA 1UZ0A 2QQLA 2VECA 4Q0UA 4Q0QA 2D6PA 1O4ZA 3T2QA 1XXNA 3I7DA 2V5DA 4Y3OA 3RGBA 1JU3A 1OA3A 5K8SA 4LIVA 1A8MA 2HWB2 1YIPA 3B69A 1D4M3 2ZABA 3WQBA 1OLQA 1NYWA 1UIKA 4INDA 4Z2AA 2DUOA 5FXZA 3F95A 4N43C 4QPGC 4AHYA 4W50A 2QQPA 3BOPA 3NV2A 1CIYA 3DYOA 1GZWA 3ACFA 4JDMA 4XPVA 4XCAA 1UOJA 4LNVA 3ETQA 4BISA 4MV2A 1VBC1 2EXJA 5C33A 3O0VA 5A7WA 1US3A 1URXA 3POBA 2RE9A 3AB0A 4IE4A 5CFCC 5CKNA 5DZGA 3ZOIA 5FKCA 3SH5A 4DIQA 5J1XA 4C0HA 1C8M2 1RMU3 4K21A 3BIEA 3POIA 4ZU7A 1OUXA 4K7JA 4XDQA 3LIGA 3FUQA 5FWEA 2ARXA 1CVNA 1AR81 4J1WA 2HWD3 2Q8OA 1S0FA 4GALA 2XJSA 1U5IA 2BERA 4RHV3 5C8CC 2YFZA 2ZGUA 1N1YA 3UKNA 2XLFA 4WBBA 2XKOA 5EYYA 1IS4A 3UGFA 2R042 1GFF2 3POGA 1BBT1 2GH8A 1CAVA 1GV9A 1CZTA 1CJDA 2VBPA 3X29B 4BQ2A 4RR3B 1JW6A 1EPZA 2P1BA 3BALA 3OF1A 2OKXA 3RG0A 4AHWA 3FWEA 4ET7A 3TNPB 4JDOA 2RR13 3N36A 1RTVA 5C6CA 1AR73 2XDVA 3U37A 2E53A 4MO3M 2WZEA 2BWCA 3AK0A 5K0UC 2JKBA 1LGBA 2E63A 1CPMA 3KLSA 4AWDA 4EV0A 1TMF3 1W6MA 4GB33 1VMFA 1YFUA 3R0RA 3JU9A 1D4M1 5JSOA 2GN7A 1I1EA 1YQ2A 1ND3B 4P5HA 4YM1A 3HOBA 2W68A 5A7NA 1DQ4A 3SLIA 2JIJA 4BXSV 3VZOA 4NPLA 3D0SA 1I5ZA 4QX8A 5FZ1A 5JDBA 1RUD3 1PZ9A 2J22A 2ZAHA 3HT1A 1VRH3 1H8TB 4YFWA 1RUJ2 5FZGA 2VBBA 4HANA 4OI0A 4DB5A 4CCMA 1ACCA 4P9LA 2IXKA 2OIIA 5A6XA 1OF3A 1OSGA 4YZ3A 4CEYC 1PX3A 1DZQA 1H6XA 2JB8A 5JPMB 3M3EA 3T2PA 3GHMA 4FFGA 1O3SA 3PUHA 5KHGA 2O14A 4WV8A 5BYNA 1R1A3 2P34A 5A3NA 5ACA2 3J7MA 1C28A 1GQPA 2EXIA 4FPFA 5GLTA 1WCDJ 1FPN3 3ZYBA 2VL4A 2XMLA 4V2VA 1AYN3 5FYYA 2ZPXA 4LPLA 4N53C 4IV1A 3GXUA 4QKFA 1DP0A 4IEQA 2VQTA 1TVGA 2RR11 1W6NA 4BXFA 1WKYA 1HXS1 1PO12 1UCXA 1XU1A 3O7OA 5FLJA 5L9BA 3SXWA 1M06G 4IGQA 1W8TA 3B5LB 4RS5B 1C5IA 4CU6A 3T0DA 1TE1B 4QU1A 1RHI2 1YLLA 4PHZA 4XYXA 4PBPA 3ZFGC 2OZ6A 4A4AA 3UJOA 3ES1A 3KCCA 5JOZA 3LOIA 3THPA 3JBG2 4GMP3 1LHOA 1PK6B 2Z2SB 4JGYA 5FMOL 2Z5WA 3PDQA 3JQWA 5AC93 2K9ZA 2RM22 2C9KA 3Q8BA 1CAUB 2WZPP 4DRVA 4QKBA 3MGUA 2YGLA 4CDWA 4QAWA 4CCCA 5JXHA 5LA0A 3ZVXA 1GU3A 3TEYA 1HW5A 3RYKA 4AI0A 1DF0A 2GC2A 5BNOB 2HWC2 2W5FA 1ULPA 4LBQA 4ZHNA 1SG3A 3KF5A 3AL5A 4LUKA 4WVMB 5EZWA 1NCRC 4CP1A 2JG8A 2WNVB 1GZTA 4GWMA 1W0OA 3K4AA 3MV01 4PQ9A 3NQHA 4Q8KA 1ZRIA 1OC1A 3QD6A 4HONA 5LATA 3CZUA 3KT7A 1RUE1 1JOBA 1WCKA 4AOCA 1X36A 2FDKA 4FAHA 3WNNA 2VMHA 3ECQA 1LOAA 1NAEA 1GSLA 2G9GA 1AYN1 1NLQA 3LPFA 4AFDA 2C0ZA 4YW1A 3AZZA 3UNPA 1OLME 2BNNA 1GNYA 2C9AA 3Q8CA 3IM0A 5B2GB 2BFUL 2DFBA 3HAGA 3IBMA 3MW4A 3THCA 1A78A 4D7YA 2R1DA 3VD4A 3C7OA 2I45A 4ZZ5A 4PQQA 1UYXA 1AL22 1BHGA 2A5ZA 2AACA 3C7EA 3GM8A 1N1TA 2ZMNA 1JHJA 1OQ1A 5FY4A 4Y4YA 2VNRA 3CO2A 4P9WA 3ZFFB 4CDUC 4OI2A 5GALA 1W2UA 3KVAA 3OEBA 3TN92 2W92A 4M3CF 4TYSA 1AR93 2DTWA 4AI1A 2PTMA 2Q1ZB 2XWJB 3SEEA 1POV3 5KR7A 1X8MA 3O1SA 1CR7A 1FV2A 3H3UA 2O8OA 3O1RA 2EXKA 2ZX3A 4I0AA 2VH9A 1UO9A 2V72A 3ITQA 4G9SB 3O1VA 2IXCA 5JMOA 4UBHA 2D97A 2XR4A 3JB8A 5FUNA 1W99A 1V6KA 3WG2A 2JG9B 2G1MA 1HQNA 1SBEA 4LUMA 1HIXA 1VIWB 1J83A 4BIOA 3VDDA 1AX0A 5E6HA 4MSVA 2VW2A 3VV1A 2HWB3 4C1XA 1RUG2 2B4KA 4GH4C 4SLIA 1SEFA 1W04A 2V5YA 4ISQA 1OMIA 1RUH2 4COVA 4MUVA 1MQTB 1JYWA 1EAH2 3BIWE 2GMPA 4EN7B 3NAPC 3RDIA 4QX5A 5JOXA 1MVEA 2UURA 1FMD2 3KWVA 5IHRA 4AAPA 3UT0A 4AFBA 1XYOA 1H8VA 3FZ3A 1RYYA 3VBRB 1XOYA 1UY3A 1YHFA 4FPHA 2GP5A 1UX7A 3V65A 2IFRA 3G7DA 2GP3A 3UETA 2Q1MA 2VVDA 2PHTA 4AZZA 4DEQA 3RZHA 3LDRA 3RI9A 2WO7A 2ZJCA 2YXSA 3WVJA 3PU3A 5D2AA 2AEZA 1RJ8A 1MZ6A 3T1MA 1ZRCA 3NJZA 4ZU5A 1TZOA 4QD2A 3N7KA 2E33A 4FP2A 4P9JA 4TWTA 4Q27A 1H8TA 4EZHA 1N1SA 2HWF2 3WUCA 4L8QA 1HQLA 1I6XA 2R043 4ZXKA 4DO0A 2JE7A 3V0AB 1MS8A 4LO5B 3MF9A 3VBFC 2LS6A 3ZSMA 3AP4A 4A41A 2DVBA 1JS9A 4GKYA 2DURA 1OFNA 2WWJA 3HIFA 4UBGA 4N9IA 1C1FA 3NNFA 2MNGA 3HN3A 1Q56A 4XBNA 1ULOA 2ET1A 2GH2A 2XG3A 1TQ5A 5DDJ1 4CPBD 4QXKA 2DCYA 2WZ8A 3FC0A 5HXMA 5FPZA 2Y6KA 3RMXA 1JOPA 5FLIA 5L7OB 4W8JA 4AQ2A 1XNKA 4G3YC 4FOVA 2K46A 4BQ4A 5I0SA 3A0NA 4HKWA 3PVEA 1BXHA 2QBXA 3GBGA 4I01A 4LBKA 5HCBA 1NCQB 2J1SA 2ZAAA 1M4WA 4GULA 4FPGA 1LGNA 1SDDB 4QGMA 2FDGA 1HLCA 1YFYA 2VZQA 1DLLA 1F9KA 2BWAA 3HBZA 1V6LA 3FX3A 3OGRA 3VD3A 3VL8A 4KBZA 1MS1A 4RS5A 4MXWB 4QPYA 4BK5A 3VDAA 1NA1C 1GICA 2OPWA 3ZSJA 5IVEA 5BNPC 1TME2 3OUIA 3WP3A 4UXAA 4XURA 3WF1A 1BMV2 5FWJA 4M01A 5CKMA 5F32A 3M3IA 2ZHMA 1A3KA 3ZM8A 4IV3B 2ID4A 5DQ0A 3EQEA 5KXEA 1G6NA 1OKOA 4RQPC 1QNYA 4YVWC 5I0UA 2IXIA 2JICA 3I59A 4QQOA 4I30A 5ACA3 3MIBA 2A71A 1CAUA 1POQA 4DMIA 1JZ7A 3KF3A 3NJVA 4O61A 3C7HA 1UKGA 3TAYA 5GJ6A 1STMA 4K1ZA 4O9EA 4AK3A 3EO6A 4B4QA 2JDMA 1RXFA 2DVFA 4GA9A 1JU4A 3B94A 2DBNA 1CN1A 1US2A 4XFBA 4CXXA 2J1RA 1YQ5A 2J1EA 1PO13 4WVMA 1RUC3 2NZ9A 1W9SA 4NRQA 4Y20B 1XSQA 3IPVB 2WNVA 4CA9A 4NWVA 2QQKA 3T08A 3THDA 2JDYA 5A6YA 3FLTA 3KCYA 3P6BA 3OBAA 3HJRA 1RHI3 4IUGA 1OOPC 4LQRA 5BUVA 4CXYA 1IQAA 3OTFA 1LNSA 2WN2A 1XRUA 1UOGA 4PIXA 4URTA 4I3PA 5JWPA 3EMRA 1GWKA 3PLQA 5A32B 2RM23 3U11A 2QE3A 5LA1A 5T52A 5CB7A 2VTXA 4O7XA 1O3TA 1R082 1SLIA 2D6OX 4Q8LA 1LEMA 1HRI2 2UWCA 4XZUG 1REEA 3OSDA 2VGDA 3D8CA 5FFOC 3Q8AA 4CDXB 1JHNA 1PGW2 2FMYA 3N3HA 4LO8A 1HRV2 2HWC3 2DCJA 3IAQA 4LJHA 1LODA 3AVSA 4QX7A 4E27A 4Z1VA 2Z4FA 3U1XA 3IWZA 2C5DA 2QTWB 4Y5TA 1ZZ8A 5I8SA 2WWUA 1IOAA 3VBHB 5CADA 3B01A 1IPKA 1ZBA3 2YC0A 3OGSA 3TEWA 2RJLA 3IDAA 4EN6B 5CG9A 4QX3A 2BVVA 1I5PA 2F4LA 2CSGA 2VVFA 3KS7A 3PL0A 3N9QA 2NLRA 3IMMA 3N7MA 1WLCA 3PHMA 4IXLA 3ETPA 4AF9A 1ND2A 3MZHA 1DBNA 2PLV1 4P9GA 1ZRFA 2JE9A 3OGVA 1A6CA 1BVVA 4IETA 4YW2A 2ERFA 5FZLA 4ASLA 5C8WA 3AZVA 3HNMA 2JG9A 1OPMA 1GP6A 2HEWF 1JYIA 2Y0OA 3SKJE 5L36A 1D2SA 2VMCA 3DN7A 2PAMA 5GZGA 3D0JA 2IFWA 4OMCA 4WM7B 3GNEA 5CU1A 1AL23 2ZGSA 3OD4A 1Z7S3 1ZZ6A 1Y3TA 5C9AC 2FDIA 5HCHA 1B09A 2X8KA 2Q0AA 1RL3A 3ZXEA 1SFYA 1VBC2 1HN0A 4PLNA 4HT1T 4Q4Y1 3VD9A 5JI7A 2ZGOA 2ZS6B 3KMHA 1QMJA 1O8SA 1WGPA 2D93A 3MFCA 4XF0A 1JI6A 1RGSA 2PHLA 5DAPA 3RRDA 4BQ1A 3S57A 2W52A 2FD8A 4DY5A 2PHUA 1GOGA 1BVP1 3PVOA 1KJRA 2CU5A 2VXJA 4PI0A 1EP0A 4JCKA 4A3ZA 4DY3A 4FPYA 2W46A 3MDPA 2BGCA 2XLAA 2Y34A 4NIDA 1AR82 4C90A 1GLHA 1G9AA 2DYCA 2YC2A 4LHSA 2PYTA 3OBZA 4CE8A 3AL6A 4FPLA 5LA9A 2QVSB 5L9VA 3POYA 1QIQA 5FXXA 3VKFC 3JQXA 2Y6GA 3KQ4B 5CFDB 1LCLA 4KGQA 1N3QA 3VBUB 1ST8A 3GCWA 2NMNA 2WO2A 1RITA 1RXGA 1PMJX 2MEV3 4ZPIA 4ZKTB 1N3OA 1ZA7A 3E6BA 4RSUA 3IT8A 2X29A 1VBD3 3VZLA 3O1OA 5FP4A 3INAA 4CP0A 2VOVA 1ZBA1 4XJAA 2PAKA 1E5IA 4I09A 3V0AA 1AYM3 1JZ6A 4LBLA 4NRMA 2VR4A 5F39A 1H4HA 4CPBA 4ARXA 4D6SA 2DCTA 5AFBA 4I3GA 3A7QA 1FMD3 4A45A 1SLLA 1CAWA 2BZDA 4AVBA 4KG8A 2WN3A 5BXXA 4JQRA 4A42A 2ENRA 1JUHA 3CLPA 1D4M2 1VBA3 1H0BA 5CKQA 1KD7A 4IGOA 5L7OA 3WF4A 2VCMA 1Z7S1 2VO5A 1NCQA 2E7TA 5FMOS 3TOJA 2DU0A 4D3WA 1PGL1 1PNFA 3ZDSA 3WDVA 3I2IA 5FZ8A 2WYSA 1S4CA 3CQOA 3SH4A 2HWF3 4LOTA 2W3JA 4LLFA 1HB2A 3BPSA 1VJ2A 5FREA 3VGIA 2VJXA 3WW3A 2PXJA 4LKEA 3RNSA 1XB9A 4JGZB 4MVTA 1QNWA 4CXWA 4G4FA 4B4PA 4MZUA 4QX2A 1NY71 5LBEA 3I3BA 4UF0A 2A70A 2MEV1 4S2DA 4E9KA 2YROA 3ZMOA 2VMGA 1VBD1 5FIXA 3AP7A 3KD4A 1UOFA 3RYPA 5JZGB 2X10A 2G9ZA 1AYM1 2D98A 4JX0A 2RR12 4YGEA 3ES4A 4B7KA 2HWE1 1HXS2 1X82A 4QT6A 3ZIXA 1NLSA 3UJQA 4ARYA 3PIJA 3DPRA 1JYTA 4CP2A 1VBB1 1AJKA 2FDHA 5IUQA 3LA7A 2WA3A 4Y20A 2SBAA 3CZJA 3IPVA 2A3XA 3TNQA 5FZIA 5IVVA 3E6CC 3AJYA 1DIWA 4J25A 5ANNA 4AQSA 3RSJA 4L9BA 4J6GA 1TME3 4R4XA 1S2EA 4XC9A 3ZYJB 4YNIA 5JAXA 1ALYA 5FYTA 3WDXA 5HI0A 3GCXA 4BDVB 1XYPA 5A32A 2YZ4A 4E2GA 1CGPA 4X8PA 1TNFA 2JDUA 1ULFA 2WRAA 5FYCA 4NPRA 5HCAA 1CAVB 5LEJA 1A8DA 2B45X 1UMIA 5FPAA 5B4NA 5J09A 3OY8B 4AEJA 4JGYC 2FZ1A 4CDXA 2WNUC 4CVUA 2PFWA 1A34A 3LA3A 4LBOA 1NXD1 1GMMA 3I97A 4Q4X3 4BLIA 1JYNA 2CTVA 3K4ZA 2O0OA 1W9YA 4UAPA 3BTZA 2GNDA 4K3UA 5FY8A 5LRRA 1RUE2 1W6MB 4CDWC 4CCOA 4E4DX 5I8TA 1ODNA 3C7GA 1FI2A 2VM9A 2V73A 1WCSA 2E51A 3UL2A 1ZX5A 3B9IA 1W05A 1AYN2 4EWDA 2ZGLA 4CP9B 4NOTA 1ENXA 4EN9B 1KQRA 5C4WC 2ZHKA 2BQPA 2XONA 1ODMA 3DKWA 3PUSA 1I9RA 4K9SA 3THTA 5J3UA 1C3HA 4IQPA 1S0GA 4NHYA 4RL7A 1TNRA 4E8DA 4H14A 3CNAA 4XTMA 3B9CA 4LA3A 1IG3A 5F5AA 4OHVA 1W6QB 2YBSA 4P9IA 3ZKUA 4V1PA 2RS51 2CWSA 1HRI3 2AYHA 4OHWA 1Q8VA 2UYAA 3WNOA 1DYPA 5AVPA 4PBOA 1HRV3 4OULA 3S30A 3QH7A 5FXVA 1QQP1 3HPNA 1YJKA 2JB4A 3I2FA 1WMDA 4LULA 4WVWA 4R9BA 5C70A 4MOAA 2F6BA 1Y9MA 2WS91 4PLOA 4IE0A 4HKLA 3WF2A 3KV4A 3RWKX 3KB5A 5HV4A 3VDCA 1LOBA 3POFA 5J48A 4FPKA 4ASMB 1REFA 1RC6A 3ALQA 4Y22B 2Y33A 3URFA 3KGZA 4OMDA 4B1LA 3VDBA 3M1HA 5DUUA 4CUAA 2V4AA 2OS2A 4QB2A 3ZN5A 3VBUA 4QGNA 5LA2A 4Q4X1 4YPJA 1J1LA 4HK8A 4BQXA 2R30A 4KBBA 4FTBA 4AVCA 4LTAA 3S6PA 4YM2A 1NOVA 2B9VA 3ZIWA 2YFUA 3NV3A 4XUNA 3AKPA 1DGLA 3KCXA 5LK7B 4QHZA 5JZGC 1IHMA 2ZBJA 1MVQA 1S55A 1VBC3 1XE8A 5FZMA 1DFQA 4D7TA 3AMQA 3JD71 5FPBA 2CV6A 1FAYA 3VLBB 3VKNA 4COZA 1JUIA 2JENA 1QU0A 4RR3C 4R4ZA 2VQ0A 4Y26A 1AR83 2LRPA 3CU7A 2C4XA 3IAPA 4TSVA 3VBOC 3LCPA 4LBQB 4Z2WA 2IVJA 3O0WA 3RZMA 3WSOA 1H4GA 2EICA 3N9PA 4BMEA 4FPOB 5F5CA 2JG8B 1EPWA 4MHUA 4XDOA 4FPJA 3WG1A 1BBT3 1CX1A 2EIGA 3P1IA 4LBQD 4KWKA 1DYOA 3O1TA 3POJA 2D7FA 1ND3C 5T54A 4IEOA 1F5JA 3APBA 1OVSA 1DCSA 3GJAA 1LU2A 5IJRA 5BY5A 1S1AA 1NQDA 1PX4A 2P3JA 4JGZA 3KV9A 5DDJ2 2LUWA 2ETEA 2JDZA 3PUQA 2Q8DA 3ILFA 1LULA 2W1UA 2W39A 3RQ0A 2ZCWA 2D6LX 4KI5M 1CZVA 3ACHA 1ZVFA 5EJ1B 5JZGA 1LEDA 3IDBB 4WM8C 2ZZJA 3H8XA 1UZVA 2VVEA 4NPMA 2BTVC 1C1LA 3HNBM 3LPGA 1E5RA 1OA2A 4AW7A 5LW9A 4B1MA 4DFSA 1NX9A 2HH9A 3R4UA 4AEDC 1FV3A 2H0BA 3T30A 2R49A 2ORXA 1L7RA 5AFEA 2P2KA 4AAXA 2QQWA 1VRBA 2JEMA 3AYCA 1CIWA 4N7UA 4JKLA 4QKDA 4BQ5A 5GLWA 1Y7BA 3N9LA 3OBTA 4QPWA 3WT3A 3S5AA 2ZGKA 2ZEWA 3H1MA 1Y9GA 3VDDB 3LSEA 2VOKA 2MHFA 1QOSA 4RS5C 3C7FA 4JKKA 1K5JA 3BVCA 1UY2A 3TB0A 3S0MA 3GZUC 4ES8A 4AL9A 4KQ7A 5FO9B 1HN1A 2P3YA 2XXZA 1LGCA 3D82A 3OY8A 2Y6LA 1PK6C 4UFHA 1HXS3 3CHXA 4XFCA 3ZFEC 4AVSA 2RDQA 3CJXA 3I3DA 4DXTA 4JVAA 3NVCA 3VUOA 1AL0G 4AEKA 1K3IA 1COV1 3MYXA 3TYJA 4Y5Z0 1VAKA 1W6OA 1S0DA 3AVRA 1HKDA 5FKBA 5GLVA 2Y64A 3U10A 1G9FA 1SZBA 1YQ8A 2Z69A 3NKTA 2DUPA 2O1QA 4QKNA 4QB1A 2XH6A 4B8EA 4CP9A 5C71A 5BNOC 1B35B 3BTYA 2X5IB 2VNGA 3V56A 2DU1A 5JVVA 3LIHA 5D8AC 1PO21 4R8HA 3B3QE 4QDSA 4DZGA 1PIV1 4MGZE 4Y1UA 4YVSB 2UY8A 4FFHA 1UU6A 3SISA 3I2JA 2ARBA 4GZ9A 3FL7A 1W6QA 1Q3EA 2ZGMA 3QBQA 2CY6A 2GMEA 2ET7A 1GKBA 1W03A 3QOPA 4CRQA 5E1RA 1JODA 1SLAA 1SLCA 2A6YA 3MIGA 3CJIC 5FYSA 5IT6A 3BGAA 4LR4A 4XXPA 3NV1A 3AFKA 2WINB 3BU0A 2JX9A 1W8UA 2D3PA 2NYYA 4PLMA 2OPKA 1RUE3 3AFGA 4YGDA 1OPOA 2VBDA 4QXHA 2Z79A 2W91A 1DQ6A 2PLV2 4FSJA 4K40A 1SMVA 1BK1A 3OPTA 2WUHA 1HB1A 3ZFFC 3H3ZA 2VOWA 1O5UA 4Y22A 4N43B 1C5HA 1GQGA 1QDOA 1QJU3 3C3VA 2XJVA 3FHIB 3J7NA 2DF7A 3J9SA 5IVYA 3T0AA 1RUC2 2B42B 4BLJA 5L19A 4ISRA 4YZ5A 2CDPA 4ATFA 5FZEA 4AYUA 3HT2A 4E2SA 3AZYA 3GHNA 3GYDA 3H3LA 4EWEA 3FHAA 4KGGA 5BNNC 1JZ4A 4GD4A 3E6DA 5D1IA 1SLBA 3RI8A 2JG9C 4QDRA 1OA4A 5IFPA 5IFTA 3I59B 1WMEA 2E26A 3D4KA 1JZ8A 2BGOA 2OVUA 3POSA 4C1WA 1OURA 1Z0HA 2WFPA 2P5BA 4GAZA 2W08A 3LFMA 5I91A 5LY1A 3I8TA 4BZ4A 3B7MA 3DYPA 2XHNA 1MQTC 5GZFA 4XF3A 2UWBA 5FZCA 5F5IA 2FMDA 1VR3A 4ZS2A 1YRZA 4IEWA 5DAQA 3VBRC 4XILA 4MGTA 3LDKA 4R9AA 5FYVA 2LTNA 4Y1VA 1ZBA2 3BN6A 1LOFA 4UW6A 2NN8A 4BE3A 1D2QA 4HFSA 1YJLA 1LESA 1ZM1A 4Y1ZA 4ONUA 1D0HA 5FLHA 1JZ5A 1VB4A 2TUNA 1OKQA 4DPNA 4LEJA 2J1AA 4CDQB 5FP8A 4CCDA 5KC5A 1G7YA 4RFRB 5JUVA 3LA2A 3OGJA 2WFF1 4KMQA 1QJU1 1U0AA 2UWAA 4X6QB 5EIYB 1X8EA 4XHBA 3I2GA 3KM5A 4LK6A 4CU8A 5FBJA 4CCLA 5IK7A 3HQUA 2ADEA 4FXGB 1Z7S2 1CX4A 4KNCA 5FZDA 3DECA 2WA4A 3H8UA 1PGL2 1H1MA 2WR9A 3MPBA 3ZXAC 1W2AX 3LD8A 2BGPA 1AX2A 1IGOA 4TZDA 4DUXA 2VPVA 5FZ9A 2ES3A 5KBFA 2AEYA 2UY9A 4NE9A 3TRSB 4XFIA 5ISLA 4XMAA 4DOUA 3PTYA 1YO8A 4FPCA 3OG2A 3FFZA 1P8JA 5KWRA 3OCPA 3WF3A 4M3CA 3BTXA 1VLNA 1NE4A 4QM9A 4QPIB 5CISA 1ND2B 2XUEA 1NCQC 3DUIA 5CVRA 2FCVA 5IVBA 5EYXA 4CU9A 2WZR1 1VE0A 4ZONA 1G8WA 4A6SA 5DDJ3 3MEPA 1YFXA 3PIGA 4GQ7A 2MEV2 2CHHA 2FHRA 1W8WA 4HMZA 3ZSEA 2W9XA 1Y43B 1VBD2 1V0AA 1MEC1 3LDBA 2VTFA 4LE3A 2WT2A 5FQ0B 4HG6B 1AYM2 5IVCA 1JXNA 4XBLA 1VPHA 2VZVA 2GALA 2HWE2 3R6SA 5FO8B 2D43A 2BEOA 2VMIA 4IV3C 1QH7A 1VBB2 4UW3A 1O3RA 2HYKA 2RS11 4KG0A 4NHLA 1XBFA 3CKHA 5LEKA 1VBA2 3KV6A 2VCCA 3WG4A 2JE8A 3MIEA 4FI9A 3HR9A 1SQ4A 2HEVF 1Q8SA 3CDZB 3DV8A 3RJ2X 2OQ6A 4P9XA 5KHKA 2XJRA 1B35A 3HD8B 1BEV1 1VP6A 2JJ6A 2X5IA 3SMHA 3VKMA 3WUDA 4CUGA 1KFXL 1PM4A 1W0PA 1ZRRA 5A7SA 4S2HA 3WDWA 5CA6A 4FQ4A 4Y1XA 3H9AA 4YARA 4XACA 4YVSA 1H30A 5FZ4A 2DFCA 1V6OA 4XVHA 2BOJA 3WHUA 4AG4A 5FOJB 1K42A 1ENQA 2V09A 4XQWA 5DZFA 1JYXA 5A33A 1DG6A 1CAWB 2XVGA 2ARAA 2FCUA 1U12A 4XQDA 4ZU4A 4TTGA 4XUQA 4PJYA 1KRIA 1GWMA 2VMEA 1O4YA 2D44A 1J59A 3D6EA 3FHQA 2IXLA 2VZPA 3CL1A 3PMSA 4BA6A 5C3SA 4LIUA 1MS3A 5FCCA 4XETA 3WLUA 4AI8A 1R091 4CDXC 1QXRA 3V0BB 4KL1A 2DBIA 3H42B 1DGWA 2QQIA 1Y4WA 1FXZA 3K77A 3TEXA 5J98B 4N43A 1JYVA 4QPGA 2N7GA 2E6VA 3L2YA 3U07A 1RB8G 3LQCA 4YSFA 3VBHC 2C26A 2DDUA 4NRPA 1QJY1 4CDUB 2YDEA 4A7ZA 2UYBA 3I2OA 2RS52 5CNAA 2GC0A 2AGSA 2VUDA 1O4TA 2OT7A 4COYA 3QACA 4XJWA 5CFCA 3H7JA 1WLTA 5FZ0A 1QQP2 1O59A 4LBMA 5A1FA 4RFT0 3IDEA 4MX3A 5T55A 1PMHX 1NZCA 2WS92 2Y26A 4AGGA 4UF0B 5FK7A 1OUSA 4XF9A 4Y1YA 4D94A 2PHFA 2R0HA 4PI2A 3VKLA 2ZA9A 5C8CA 1GZCA 4HXCA 4WM7C 2DWRA 5FY1A 1DDLA 2DCKA 3ZKYA 3M70A 3MV11 1JMUB 2PLV3 4Y33A 2BPA2 3QCWA 5GZEA 1UOBA 3T2TA 3KT1A 4XF1A 3DPRB 1IPSA 4OVEA 2RHPA 1C8M1 4Q4X2 2QQVA 5H9PA 4MGKE 3AMHA 3Q8FA 1GWLA 1FOD1 1XQNA 1LU1A 3EJKA 2E31A 1UZYA 5K0UA 4FCAA 4NHXA 4OI4A 5LB6A 1WA6X 4Q4Y3 1F8VA 2PHDA 3A23A 1GQHA 3BODA 4FOWA 5CFDC 2D40A 3MUY1 3ME2A 4CDQA 3B93A 1HX6A 1YYNA 3JD72 3VBUC 2KXLA 3BKZA 2E32A 3KHCA 3VZNA 4SBVA 3EBRA 2A6VA 2VC9A 4MYEA 4XZPA 2W1QA 3AMNA 3PURA 2Q8EA 1SFPA 3BU7A 2GDFA 4GWNA 2RDRA 3I2HA 2DCZA 2WDBA 5DAVA 1F4AA 1W8HA 2BOIA 4XUTA 4D6QA 3FMGA 1PM7A 3WDTA 1ZYBA 3AP9A 5IK5A 4KWJA 2W47A 1FX5A 4ZZ8A 2GNBA 3VBFB 2B9UA 4LT5A 4NIIA 4CEYA 4PDWC 4NHMA 1BJQA 5SV5A 4RYDA 3S7EA 1NKGA 2BUKA 1S2KA 1CAXB 3VBSB 4RA0A 1X9TA 5EWSA 4QPIA 1YFWA 1XE0A 4YZ4A 4EQVA 2WKKA 5HCFA 3UGHA 1XU2A 2DVDA 2AREA 2WLQA 1QXJA 3SEPA 2Z42A 2HKXA 2JDPA 2BBAA 3VD7A 1K45A 2I07B 1DYKA 5LWBA 4LO4B 5DXDA 2XUMA 5FQ0A 1GYKA 5C5TA 1IZ3A 2W1SA 4Q29A 3IIAA 3ROUA 1NT0A 2X09A 4FBFA 3JB4C 1LHVA 5FO7B 3HQRA 3NNLA 3IZOA 3VHPA 2BW8A 2ZZQA 5JLVA 3FBYA 1QOOA 2QQUA 1CPNA 4XJUA 1SHWB 1BLZA 4BQ3A 4XJZA 3T3YA 3UKVA 1Q8QA 1JOJA 2WO1A 2DVAA 2WSUA 3DCQA 4QB6A 2RS31 4RQPB 1W0NA 4YVWB 4H3WA 4XFGA 3NKGA 5FZFA 4BHPA 5BPXA 4IW3A 3I54A 1ZA4A 1XPWA 3LF7A 4MGQA 4QMAA 1N1VA 1RUOA 3ZPOA 4D0QA 4Q4V1 3FJSA 2KA3A 2WIIB 2Y6JA 4CCEA 4QQLA 1UKRA 1BBT2 3JBG1 4WZCA 3ZYIB 2WT0A 4ORFA 2TEPA 3MFAA 3PVNA 1E5HA 3DGTA 3MW2A 5GZDA 1NCRA 1UYPA 3M2MA 4XIKA 4JRLA 5FK8A 3FBMA 2HWE3 5DUWA 5FPVA 1UYYA 4LO7A 4ES9A 1N47A 1QKQA 1AXZA 2VMFA 1DU3D 3USUB 5FXWA 1VBB3 3MIHA 1RUI1 1UU5A 4OQ9A 3RFRA 3ZXGA 2TBVA 1OOPB 1COV2 5FYIA 3NL1A 1XNDA 3ILNA 5F6LB 3MHZA 1WW7A 5T5LA 1LECA 1CONA 4QHOA 2RJ2A 4FOYA 5IAXA 5JOWA 5ABJB 2YU1A 4Y5SA 3OOXA 4JZRA 1LRHA 3V0BA 1PO22 4XCBA 1IS6A 3AKQA 3IMNA 1PIV2 3H8OA 2YG0A 3GZEA 3ON7A 5EPAA 1UXZA 4I2OA 2ZHNA 4EROA 1PVC1 4HETA 4AR2A 1WWYA 4Q4W3 4BB3A 2A6XA 3K3OA 1IG0A 1OQEA 4W4ZA 4E4ZA 4CDUA 1S0CA 3GDBA 4N7IA 3SH3A 1XNBA 2WL1A 4BMBA 5BV6A 3ACLA 2ZXQA 1XNTA 3ELNA 3ILRA 3DXUA 4M0HA 3AMPA 5I0TA 5JXJA 3ASIA 5DUVA 4MG2A 3DKQA 2H0VA 2VTXJ 3WQ0A 1H2MA 3ACIA 1U5ZA 4FFFA 2AC1A 4LHLA 4PIYA 1MPXA 3NJXA 3RYRA 1JTZX 5KHHA 4IEXA 4YWAA 3AX4A 3W9AA 3GZAA 5FJKA 2OA2A 2RG4A 4BWOA 4DINB 1LKNA 2D5HA 4MGSA 4UFMA 3LEGA 1UYZA 1ZNPA 3BI3A 1W3XA 5KHIA
chains in the Genus database with same CATH topology
5DAPA 5ERLA 4BQYA 5LATA 3KT7A 4BQWA 4XACA 2Y34A 3OBZA 5EQUA 4KBZA 5LA9A 5L9VA 5A3UA 3W21A 2OPWA 5DAWA 3OUIA 2FCUA 5C5TA 5L9RA 4ZPIA 4Q5OA 5LBCA 5DAXA 3HQRA 3NNLA 4NHYA 5DAQA 3OUHA 4MHRA 3OUJA 3NNMA 5IATA 2JIJA 4IW3A 3BVCA 3ITQA 5LASA 2G1MA 3W20A 4NMIA 5HV4A 2FCTA 2RDQA 3HQUA 4XABA 5EP9A 3NNJA 2Y33A 3EMRA 2G19A 2V4AA 4BQXA 4NHKA 3KT1A 5LBEA 5IAVA 5IAXA 2RDSA 2FCVA 4Y5SA 4JZRA 5L9BA 2JIGA 4XCBA 4UWDA 4Y5TA 4ZONA 3GZEA 5HV0A 5EPAA 4NHXA 5LB6A 2A1XA 5C5UA 4XAAA 3PL0A 3GJBA 2HBTA 5LBFA 2RDNA 4J25A 3DKQA 5LBBA 4NHLA 2RDRA 3MGUA 4MHUA 5M0TA 4XCAA 4XC9A 5DAVA 3NNFA 2HBUA 2RG4A 4NAOA 4NHMA 3GJAA 3KT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAP A;  5ERL A;  4BQY A;  5LAT A;  3KT7 A;  4BQW A;  4XAC A;  2Y34 A;  3OBZ A;  5EQU A;  4KBZ A;  5LA9 A;  5L9V A;  5A3U A;  3W21 A;  2OPW A;  5DAW A;  3OUI A;  2FCU A;  5C5T A;  5L9R A;  4ZPI A;  4Q5O A;  5LBC A;  5DAX A;  3HQR A;  3NNL A;  4NHY A;  5DAQ A;  3OUH A;  4MHR A;  3OUJ A;  3NNM A;  5IAT A;  2JIJ A;  4IW3 A;  3BVC A;  3ITQ A;  5LAS A;  2G1M A;  3W20 A;  4NMI A;  5HV4 A;  2FCT A;  2RDQ A;  3HQU A;  4XAB A;  5EP9 A;  3NNJ A;  2Y33 A;  3EMR A;  2G19 A;  2V4A A;  4BQX A;  4NHK A;  3KT1 A;  5LBE A;  5IAV A;  5IAX A;  2RDS A;  2FCV A;  4Y5S A;  4JZR A;  5L9B A;  2JIG A;  4XCB A;  4UWD A;  4Y5T A;  4ZON A;  3GZE A;  5HV0 A;  5EPA A;  4NHX A;  5LB6 A;  2A1X A;  5C5U A;  4XAA A;  3PL0 A;  3GJB A;  2HBT A;  5LBF A;  2RDN A;  4J25 A;  3DKQ A;  5LBB A;  4NHL A;  2RDR A;  3MGU A;  4MHU A;  5M0T A;  4XCA A;  4XC9 A;  5DAV A;  3NNF A;  2HBU A;  2RG4 A;  4NAO A;  4NHM A;  3GJA A;  3KT4 A; 
#chains in the Genus database with same CATH topology
 5F5Q A;  3SCH A;  2CL2 A;  2UU8 A;  2ZTN A;  4GH4 A;  2CNA A;  4L99 A;  4FPE A;  1LTE A;  5C9A B;  1ZRD A;  4LBJ A;  1YWK A;  3K75 B;  1KS5 A;  3NAP A;  4XQ4 A;  2YPJ A;  1OD3 A;  3NO8 A;  2OQ7 A;  3K3N A;  2RS5 3;  4XFA A;  3III A;  4EN8 B;  2EID A;  4IV1 C;  4JV4 A;  4OFG A;  2CYF A;  4M3C E;  5FY9 A;  4Q1R A;  3T09 A;  3W21 A;  1SBD A;  4N8M A;  2KR2 A;  3KGL A;  4E4H A;  4NIH A;  5F3E A;  1QQP 3;  1RUG 1;  2SLI A;  3UES A;  5DUX A;  5F7U A;  2CGP A;  2QDR A;  4LHN A;  1F5F A;  2OXB A;  5LBC A;  2BDR A;  2WS9 3;  1EAH 1;  1ENS A;  2LW8 A;  2ZKN A;  4Q4W 1;  2FBE A;  3ABZ A;  3S5Q A;  4CCJ A;  4F83 A;  4NIG A;  5DN2 A;  4UFL A;  2PAE A;  5FZK A;  3RZZ A;  3K4D A;  3VZK A;  4Q0V A;  1AXY A;  1NQJ A;  4OUE A;  1IQD C;  4D7S A;  2DTY A;  2XJU A;  2W2I A;  2A3Y A;  3NJY A;  2ZX1 A;  4NR1 A;  5JPN B;  3A4U A;  3OD0 A;  4YW6 A;  4N90 A;  3P3P A;  4GWJ A;  3VBF A;  3VN4 A;  1OLM A;  4YRD A;  4BIF A;  2R6Q A;  3A0K A;  2A75 A;  5GZC A;  1W6O B;  4XJ9 A;  1CAX A;  3VBS A;  4FTS A;  4E2Q A;  1UWW A;  1BKZ A;  3ZXJ A;  4JHZ A;  3G6J B;  2NP0 A;  4AQT A;  3SCG A;  5J96 B;  4AI2 A;  3WQ1 A;  2NM1 A;  2YBK A;  3KQR A;  2WFF 2;  3LE0 A;  1QJU 2;  2IXJ A;  4DNY A;  4FFI A;  3W5M A;  3JD7 3;  2JG8 C;  4AHZ A;  1RUF 1;  3RPQ A;  1W8O A;  5FAX A;  1IPJ A;  2VAU A;  5C3O A;  4D69 A;  1K5M B;  3NV4 A;  4Q0S A;  1BYH A;  4BJ0 A;  3WF0 A;  3PJY A;  3K46 A;  4FT8 A;  5FZ3 A;  5FZO B;  1EV1 1;  4HVQ A;  3AJZ A;  2WT1 A;  1W39 A;  1O7F A;  2ZGQ A;  2LRO A;  2R16 A;  2JKX A;  2A73 B;  3H0O A;  3FLR A;  3RS6 A;  1KFU L;  4KU8 A;  1BQP A;  5FYZ A;  3VZJ A;  4DUW A;  4FAG A;  3LEM A;  5BNP A;  2XPJ A;  3QH6 A;  1LHU A;  4QM8 A;  2QQO A;  4GMP 0;  1DGW X;  3FLP A;  4FP3 A;  4RQP A;  1W28 A;  1QGL A;  4YVW A;  1UL9 A;  1GP5 A;  2A1X A;  2ZX4 A;  1JYC A;  3NMB A;  1OQD A;  2VCA A;  2WZR 2;  2XQR A;  4A7K A;  1JN2 P;  3GJB A;  1WUV A;  5J7M A;  3J8F 1;  4Y4R A;  4ATE A;  3M3Q A;  1J58 A;  4B3N A;  4BM8 A;  3O1U A;  3IKW A;  3HWJ A;  5M0T A;  2G4I A;  3AXD A;  2D5F A;  5IVF A;  1ULE A;  3HEI A;  3MLK A;  3SNM A;  4A3X A;  4XIO A;  4RGA A;  1ASJ 1;  2DUQ A;  2RS1 2;  4NO4 A;  1EY2 A;  2HBU A;  1AF9 A;  3USU A;  3M3C A;  3RZK A;  4H7L A;  3HQX A;  1DQ5 A;  3UGG A;  3VDD C;  1OOP A;  1WMX A;  4RN5 A;  4MH0 E;  4HZF A;  3CBN A;  1UY4 A;  2H6B A;  4I02 A;  1ZBE 1;  2XBO 1;  3T2O A;  3ATG A;  4BQY A;  3WW1 A;  4BCU A;  1W90 A;  3JZV A;  4WZF A;  4AI9 A;  4OYU A;  3HVD A;  4IE5 A;  4BU2 A;  3MIC A;  1BEV 2;  5FZH A;  1SPP A;  2WAB A;  3MO4 A;  5ABJ A;  1Q8P A;  4OZO A;  1F31 A;  1KIT A;  3H7Y A;  4PIZ A;  5F9T A;  2Y6H A;  4DXR A;  3K2O A;  1AXK A;  5A1L A;  5F6K A;  2FDF A;  4K8R B;  2WQZ C;  4Q5O A;  1DZT A;  2E9Q A;  4XAE A;  5FY0 A;  1GP4 A;  1MZ5 A;  4XEZ A;  3VHR A;  2X5I C;  4XF4 A;  1POV 0;  1G9B A;  3W59 A;  5E8A A;  4Z92 B;  4P00 B;  2PHR A;  2ZEY A;  5C4W B;  5F8P A;  2RMU 3;  1H8T C;  1COV 3;  4LOR A;  3NNM A;  1L3J A;  4XXA A;  4QXB A;  4YW5 A;  5TSW A;  3ZLI A;  1LJ7 A;  4QQ2 A;  2CWM A;  1R09 2;  2PEL A;  1AR6 1;  3I2K A;  1HB4 A;  2A6W A;  2C1F A;  2VUL A;  4W65 A;  2HEY F;  1CWP A;  3V64 A;  1UNB A;  1H6Y A;  1OD5 A;  4OZX A;  4Q0P A;  4LLO A;  4Y24 A;  1PO2 3;  3W5N A;  2FDJ A;  2ZML A;  3BOW A;  4AXO A;  1PIV 3;  2YU2 A;  5KXD A;  4D8M A;  2VOT A;  3DYM A;  3PNA A;  5C9A A;  3I2D A;  1QJY 2;  2XJT A;  2BNO A;  1UPI A;  5IVJ A;  3T4V A;  4XAB A;  2Q30 A;  2RVA A;  2YYO A;  4M3C B;  1G9D A;  2WAA A;  1CD3 G;  4MAD A;  2KD7 A;  3NNJ A;  2GMM A;  2VE1 A;  3E5X A;  1RVF 1;  5A3O A;  1OBN A;  2G19 A;  4AFC A;  1V00 A;  2XQX A;  1W6P A;  2YBP A;  5FJH A;  2BJS A;  4HVO A;  2ZGP A;  3R05 A;  5FYM A;  4CEW B;  1ONA A;  1TEI A;  4YW7 A;  3E5U A;  1ENR A;  2JD4 A;  4JRA A;  3FFQ A;  1W8Z A;  4NHK A;  5LY2 A;  2RV9 A;  4OHZ A;  5T5P A;  2W1W A;  2CDO A;  4JHT A;  1GBG A;  4AQ6 A;  5A6Q A;  4HPK B;  4OHX A;  3WZ1 A;  4UWD A;  1FAT A;  2BYV E;  4EZ4 A;  3AMM A;  1VBE 1;  1OI6 A;  4XHX A;  2VZT A;  3Q8E A;  1QJX 1;  1LEN A;  2AEN A;  2ZOE B;  5C5U A;  1FOD 2;  1F4H A;  2R07 1;  2RMU 1;  3WP5 A;  2JDH A;  2VW1 A;  1V6I A;  4QQH A;  3LEI A;  4HL0 A;  2R06 1;  5H9Q A;  4EJR A;  4QDQ A;  3R4S A;  5JSR A;  1RIN A;  2P17 A;  1LOC A;  2ZEZ A;  2IXH A;  3WCR A;  1GR3 A;  1UN1 A;  2E7A A;  3NRU A;  4IEV A;  4XUP A;  2E7Q A;  4A7Y A;  2WO3 A;  1YQ6 A;  5FV3 A;  5AVA A;  3D5O A;  4UI9 L;  4YG0 A;  3ZN6 A;  4J1X A;  5FZ6 A;  2WNV C;  2XLG A;  3VBO B;  1C57 A;  3B00 A;  3WP4 A;  4OI1 A;  5FZB A;  2VW0 A;  1SAC A;  5D21 A;  2K2S A;  4AFA A;  1K5M A;  5FOB B;  4NAO A;  2VZO A;  3KHB A;  4UW4 A;  5FZO A;  1H1I A;  4HSJ A;  2YHJ A;  4M00 A;  2R32 A;  3WV6 A;  3AP6 A;  5CEH A;  5A33 B;  1JZ3 A;  2WYF A;  4CDQ C;  3M3O A;  3TWI A;  1LR5 A;  5LK5 A;  4CYD A;  1EUU A;  5FMB A;  5T5J A;  1W9F A;  2VNV A;  4XUO A;  4HN0 A;  3I3E A;  1WA4 A;  4XW3 A;  1QY4 A;  4L11 A;  5IW0 A;  1BZW A;  1Q8O A;  5E89 A;  4TN7 A;  3I3Q A;  1YI9 A;  5EQU A;  2WNO A;  3IN9 A;  5FYU A;  5DAW A;  4CUB A;  1MS9 A;  1JBC A;  2IWG B;  4DS0 A;  3BYW A;  1RMU 1;  2WFF 3;  4Z8B A;  5FR3 A;  4QPG B;  4A6O A;  2GNT A;  4WM8 B;  2WLP A;  2QZ3 A;  3NNG A;  4FVV A;  4PCR A;  4HOO A;  3ENR A;  3N7J A;  1W2N A;  2VXR A;  4HN1 A;  4ZXE A;  5FMC A;  2HWD 1;  3FN9 A;  1UU4 A;  4MHR A;  2YY1 A;  4RHV 1;  1SLT A;  1X7N A;  4QPI C;  5K9Y A;  4NN0 A;  5J36 A;  1YC6 1;  4AED B;  5CFC B;  1ND2 C;  4Q4Y 2;  5FUP A;  4CCK A;  4QXC A;  5IAT A;  2W94 A;  2ZX2 A;  4JDN A;  3FUO A;  2I2S A;  2QDN A;  4C8D A;  1U5X A;  4I0W B;  1ULC A;  4XE9 A;  2RS3 2;  3ZN4 A;  1LAJ A;  1W9T A;  2CGN A;  1WLD A;  5C8C B;  3TEZ A;  1AR7 1;  2CGO A;  1QWR A;  3LZZ A;  3AXE A;  4F3J A;  4V2W A;  3LB9 A;  5HXV A;  5FZA A;  3U14 A;  3L9J T;  1MS0 A;  1QDC A;  2YMZ A;  3I49 A;  1CJP A;  3J4U H;  4KU7 A;  3W20 A;  3NST A;  1TMF 1;  2FCT A;  2WZR 3;  2AH2 A;  1S0B A;  1DGR A;  3B02 A;  3J7L A;  1OF4 A;  3R4D B;  4GB3 1;  3E97 A;  5C3P A;  3CIH A;  2LM3 A;  3S7I A;  2D6N A;  5FYH A;  3U4X A;  2A7A A;  1DLC A;  2NMO A;  3OYW B;  1MEC 3;  4LKF A;  2WNU A;  4B7E A;  2EAL A;  3MUZ 1;  1AHS A;  3F2Z A;  3WX5 A;  2D3R A;  3ZFE B;  1JZ2 A;  4W6Y A;  3AKT A;  5K0U B;  1T6G C;  3AKS A;  2K0G A;  4X8N A;  1QEX A;  1RUD 1;  2NQY A;  1RED A;  1VRH 1;  1OH3 A;  4A2U A;  4AE2 A;  1V70 A;  1RUI 2;  2QKD A;  2EXH A;  2RS1 3;  5DG2 A;  1BK0 A;  2YUE A;  4URA A;  1F15 A;  4BK4 A;  2FZ2 A;  3SCF A;  1D4V B;  1PGS A;  2Q1F A;  1K12 A;  2RDS A;  1QJE A;  4P14 A;  1IS3 A;  3WOG A;  5C4W A;  2J1U A;  5FDB A;  3N9M A;  4DXZ A;  1FNZ A;  2VUC A;  4YLZ A;  4UT5 A;  4GWI A;  4AGV A;  2F4P A;  5K7P A;  5D8A B;  1G86 A;  1E57 A;  3LSD A;  3MID A;  2VU9 A;  5E88 A;  1TG7 A;  2L9L A;  2PQQ A;  3I4I A;  1NUK A;  1ZZ9 A;  1LHW A;  1KS4 A;  1R1A 1;  2OUJ A;  5CAZ A;  1BEV 3;  3DEM A;  3EYP A;  2HBT A;  5FY7 A;  5F3I A;  3U0Z A;  1FPN 1;  2VZS A;  5LBF A;  4RD7 A;  1PVC 2;  4CEY B;  2RDN A;  1S0J A;  2J1T A;  1H2K A;  1XC6 A;  3CJI B;  1AVB A;  3O5S A;  2Y38 A;  3ZMN A;  5L7O C;  1H9W A;  2IUW A;  2C6S A;  4M0N A;  1HJG A;  1QJZ A;  4H7M A;  5G05 L;  3WNX A;  2QUO A;  4B4R A;  4O65 A;  2GC3 A;  4HLT A;  1V9U 3;  3O1P A;  1IS5 A;  4BYY A;  3SKV A;  4C91 A;  5JXI A;  1KEX A;  1LOE A;  2EA7 A;  1NY7 2;  4N53 B;  4EN0 A;  4CEW A;  2Q5T A;  5HPO A;  4GMP 1;  4R9D A;  1X33 A;  2ZHL A;  1F35 A;  1Q43 A;  1R09 3;  3KVB A;  5AC9 1;  4BQW A;  1XSR A;  5A7P A;  2BNM A;  1SCS A;  4HPK A;  5FPX A;  3IDC B;  5I93 A;  2JEC A;  1GNH A;  3ZFG B;  5A3U A;  4UOJ A;  3I3M A;  3RWN A;  3WNM A;  4M4R A;  3PUA A;  5BNN B;  3NW4 A;  2XL9 A;  4L0P A;  3K51 A;  1QJY 3;  2XB6 C;  2VOX A;  2P3K A;  3WIN E;  2GN3 A;  1WW4 A;  1UQX A;  4R9C A;  5LCW L;  5F2W A;  3ZYH A;  5EJZ B;  2ZMK A;  3P3N A;  1O3Q A;  3U4S A;  1XNC A;  3LEK A;  5LRS A;  1FT9 A;  3OUJ A;  2J7M A;  3DPR C;  1MZF A;  1ULG A;  3E5Q A;  4RR3 A;  2H6C A;  2P37 A;  4Q4W 2;  1IKQ A;  2GSY A;  2VQA A;  3C8X A;  3QLQ A;  2WWS A;  3AM2 A;  3VBO A;  1UAI A;  3WCS A;  3ZX7 A;  3GGL A;  4DRR A;  1VAM A;  4YYO A;  3GZT B;  1YQC A;  2JXA A;  1PZ7 A;  4S2G A;  2D3S A;  1W8N A;  1NCR B;  1OFS A;  2Q4S A;  2WC2 A;  5GM0 A;  1V9U 1;  5E16 A;  3ZR5 A;  4W6W A;  1C8M 3;  3O0X A;  4GJZ A;  3GF6 A;  5A3T A;  5JR2 A;  3L2H A;  1ND3 A;  2HLE A;  1UXX X;  1NG0 A;  2JWP A;  2XJQ A;  3HBK A;  5L73 A;  5FPU A;  4L97 A;  5FRA A;  1FOD 3;  3RMY A;  2G9F A;  3ZO0 B;  1WZX A;  4JQT A;  2ADD A;  4QGL A;  1MR5 A;  4MGY E;  4I0B A;  3ZSK A;  1AR9 1;  3FE5 A;  2B8M A;  5DPN A;  3BUC A;  1POV 1;  3LKJ A;  3W58 A;  4IL7 A;  4KH9 A;  5C7G A;  1L7L A;  4LXL A;  1RUF 2;  5HBA A;  1WCQ A;  1AJO A;  4FOQ A;  2FQP A;  2IC1 A;  4IDZ A;  3ZSL A;  4NVP A;  2BV4 A;  3CEW A;  1OHF A;  4WM8 A;  5FP9 A;  5FPL A;  1HDK A;  4JTN A;  2OW4 A;  3VBS C;  3PME A;  1EV1 2;  4FO9 A;  4XMI A;  3VL9 A;  2QCS B;  3E1F 1;  5DAB A;  1KXG A;  2VQU A;  1C4R A;  2CAV A;  3ZR6 A;  4AED A;  2EAK A;  1D0G A;  2HWB 1;  4CSW A;  3VHN A;  2XOM A;  1DZR A;  3MF6 A;  2JDA A;  3OB8 A;  1LHN A;  1UMZ A;  2B46 X;  2EIB A;  2Y60 A;  3AKR A;  1QXP A;  3OPW A;  1L7Q A;  4WVZ A;  1DHK B;  2B7Y A;  4RGG A;  1RUJ 3;  1HJF A;  2DV9 A;  4P02 B;  1JH5 A;  3N9O A;  5C3Q A;  2QQN A;  3J8F 2;  1LOG A;  5KXC A;  1W3V A;  5FY5 A;  4GH4 B;  4DEV A;  2XJP A;  4AVT A;  4NRO A;  1Z78 A;  4GJY A;  3NAP B;  2ZGR A;  3OYW A;  1PK6 A;  3TBD A;  3KZ4 C;  4UFI A;  1QOT A;  1H2N A;  1OT5 A;  4IEZ A;  3ZFE A;  4PT6 A;  2R0F A;  5ANQ A;  1ASJ 2;  3ACG A;  4K8F A;  5A3P A;  2Y0I A;  5JIU A;  4WVV A;  5ERL A;  1DQ0 A;  1UY1 A;  3OGG A;  3SQO A;  2R04 1;  1E5S A;  4YW3 A;  4W6X A;  1H1A A;  4GIQ A;  1W8F A;  1RUN A;  4HKO A;  3RVH A;  1ZBE 2;  2XBO 2;  3M8L A;  1J84 A;  4B29 A;  5BNO A;  5CG8 A;  3O12 A;  2RS3 3;  1YIF A;  3HNY M;  3KSC A;  3KV5 A;  4LO6 B;  1CES A;  5F3G A;  4IGP A;  1UIJ A;  5D8A A;  1WD4 A;  1U5Y A;  3OEA A;  3U78 A;  2Y8K A;  3GBF A;  4QWN A;  4PF5 A;  4XFF A;  4ITC A;  1XJA A;  2WBK A;  4IES A;  1ZRE A;  2BVB A;  4Q4V 3;  4XFH A;  3ZXL A;  1O6U A;  4CZS A;  3T4H B;  5H9R A;  1UD1 A;  2AZ5 A;  5DAX A;  3NWK A;  4OHY A;  1R64 A;  4OCT A;  4C0B A;  2V4V A;  3N7L A;  3SIT A;  3JBG 3;  3WG3 A;  1PHM A;  5A70 A;  5FMD A;  5FUI A;  4GKX A;  3CJI A;  4OUM A;  4MET A;  3VB9 A;  4E8C A;  2VUA A;  4UFK A;  1OH4 A;  2XL7 A;  5KXB A;  1H9P A;  1VB2 A;  3J26 N;  5G04 L;  3WP6 A;  1KGY A;  1EYB A;  1QF3 A;  4JAA A;  4Z82 A;  1UF2 C;  2JD9 A;  5JMC A;  5ABJ C;  1UMH A;  1RUJ 1;  5K4L A;  4NIA A;  1RUI 3;  4IE6 A;  5CIR A;  1OVP A;  2NPI A;  4YG6 A;  3WNL A;  1GUI A;  3CMG A;  3MI8 A;  1VMJ A;  2OX0 A;  4N53 A;  3WW2 A;  1DQ1 A;  2WJS A;  4U36 A;  2J42 A;  3H1W A;  4FXK B;  1S0E A;  4S2F A;  4XJ8 A;  4COW A;  5A1A A;  1BCX A;  1AR6 2;  3ZFF A;  3UV9 A;  5EXO A;  4LBN A;  1GZ9 A;  1XE7 A;  5B4X A;  1XYN A;  1VAV A;  5DZE A;  3VD5 A;  4P08 A;  3AZW A;  5ACA 1;  4L2N A;  4YM3 A;  2TNF A;  4JGZ C;  3ZYR A;  2WQ8 A;  1NA1 B;  4EE2 A;  2P6H A;  1OXC A;  5EP9 A;  3BPZ A;  4YM0 A;  1PVC 3;  3K48 A;  4OUS A;  3ZFG A;  4NJ4 A;  5BNP B;  4JTO A;  5IK8 A;  5BNN A;  4BH9 A;  1X50 A;  1KJL A;  3POW A;  4BOW A;  3RZJ A;  5F37 A;  3UK9 A;  4DXS A;  1WMF A;  4Q1P A;  3LWC A;  2XKP A;  1MAC A;  1GNZ A;  1PO1 1;  1RVF 2;  2BP6 A;  1RUC 1;  1HQW A;  1NZI A;  4LHK A;  1LB2 A;  1F2N A;  1GOF A;  3CF6 E;  3PVB B;  4UFJ A;  1DGR N;  2KM2 A;  3WQ7 A;  3J7H A;  5KC6 A;  1C8N A;  3AC0 A;  5F3C A;  1NLR A;  1PMI A;  3UKT A;  1MQT A;  1RHI 1;  4EYU A;  2JIG A;  2GAU A;  5I8Y A;  1HV0 A;  1PNG A;  2Y6F A;  4OLL A;  3RZL A;  1AZD A;  5FP7 A;  1UPS A;  1AX1 A;  5KHJ A;  4NAM A;  3TN9 3;  3C2U A;  3VBR A;  4XAA A;  2QQM A;  2RM2 1;  1WCU A;  2R7E B;  4MLO A;  4IE7 A;  4ZS3 A;  5IYY A;  2WNE A;  3SC7 X;  3WR0 A;  5DG1 A;  1S0I A;  1VBE 2;  2OYZ A;  3DF0 A;  1QJX 2;  1T6B X;  4HBN A;  4XTP A;  1ZZC A;  2R07 2;  2RMU 2;  1ZZ7 A;  4OQ8 A;  3H1Y A;  2R06 2;  2VMD A;  4MXV A;  4KWU A;  5A7Q A;  5JXG A;  3RZG A;  1IKP A;  2HWC 1;  2LAL A;  3U75 A;  1KDM A;  3ZXD A;  3PTR B;  4YGC A;  2VCB A;  1H2L A;  5CZK A;  2OZJ A;  1SPP B;  4COU A;  4RGK A;  1RUG 3;  5JSP A;  3MW3 A;  2QQJ A;  4HVR A;  4CU7 A;  4CTE A;  4D6R A;  1RUH 3;  5FTT C;  1PVX A;  1EAH 3;  1Y9Q A;  2AUY A;  2P4E A;  2VNO A;  5A6Z A;  5EFU A;  5JI9 A;  1OLR A;  1S2B A;  3LFI A;  5T5O A;  3OPZ A;  2JDK A;  3PJQ A;  1T2X A;  5IK4 A;  2IVI B;  2W95 A;  1V6J A;  3LAG A;  4PDW B;  4FTE A;  1W2T A;  4U2A A;  1YEW A;  2VY0 A;  2ZGT A;  3N35 A;  3HN1 A;  4K6B A;  4ZY9 A;  4YZ1 A;  2C24 A;  1YXW A;  2VZ1 A;  4LKD A;  1AL2 1;  1J1T A;  3MBW A;  2ZGN A;  4O9G A;  5LZ6 A;  3LOB A;  5L9R A;  4XBQ A;  4LE4 A;  1K5M C;  1W2O A;  3EB7 A;  1EUT A;  3TN9 1;  2YB7 A;  3OUH A;  4UYB A;  1UW8 A;  1J3R A;  4LA2 A;  1WD3 A;  4MXW A;  1RMU 2;  1W06 A;  2W0X A;  2BU9 A;  1RUF 3;  4AEM A;  1J3P A;  2HWD 2;  5A3L A;  1Q5O A;  3N4M A;  1HV1 A;  1J3Q A;  2WSV A;  2EVX A;  4IV3 A;  2B5H A;  1SFN A;  4LIT A;  1XNA A;  4RHV 2;  5JCT A;  3O14 A;  1EV1 3;  1I3H A;  4R52 A;  2ZX0 A;  1WW5 A;  3BCW A;  3ZYP A;  1R1Z A;  2VG9 A;  3ZXF A;  1ULD A;  4BPZ A;  2ATF A;  2VZU A;  4E4S A;  1W6P B;  5EJ3 A;  4P5Y A;  4PF1 A;  4Q4V 2;  5LAS A;  2PMW B;  2VUJ A;  1G9C A;  1O91 A;  5J37 A;  1RUH 1;  4NMI A;  1GZW B;  3AZX A;  1AR7 2;  2ARC A;  3OJB A;  3WW4 A;  3ZYF A;  2P6C A;  2BFU S;  5GKA C;  1FMD 1;  1V6N A;  4Q26 A;  5A7W B;  2XHK A;  1SBF A;  5EHD A;  4P9Y A;  2GU9 A;  3EXU A;  1TMF 2;  4GB3 2;  3WD5 A;  3WEZ A;  4F7Z A;  1WW6 A;  3J8F 3;  3VZM A;  1VBA 1;  3P5B A;  2GC1 A;  2O8Q A;  1VMH A;  5CBL A;  4L92 A;  2PHW A;  3RJR A;  2EF6 A;  5T50 A;  4JC1 A;  2F17 A;  5DMY A;  2YC4 A;  5SV8 A;  3ZXK A;  5IAV A;  4XOG A;  4DUV A;  1KDK A;  2QZ2 A;  3ST7 A;  1NE6 A;  1QHD A;  5JOY A;  2AR6 A;  2X05 A;  1RUD 2;  2WQ4 A;  1VRH 2;  2YGM A;  1ASJ 3;  2DVG A;  5GLZ A;  3JUU A;  3UYJ A;  3JCI A;  3WNP A;  5A80 A;  1UZZ A;  3H50 A;  4EWA A;  4QU2 A;  5HV0 A;  2HWF 1;  2P3I A;  2D6K A;  4LOS A;  1O8P A;  5F2S A;  4H55 A;  5FYB A;  3ZN6 B;  3A21 A;  2PHX A;  1ZBE 3;  3D3A A;  1WLW A;  2XBO 3;  2ZEX A;  4AHX A;  2HJI A;  1LOF C;  2QFE A;  2OUH A;  2QNK A;  2VZR A;  4MGI E;  4N9H A;  1UY0 A;  1UX6 A;  1R1A 2;  4H2A A;  3IB3 A;  3WY6 A;  4Q2F A;  5I0D A;  1MS5 A;  4NUB A;  4K1Y A;  3VHO A;  3AYE A;  5LBB A;  3WDU A;  2XVL A;  1FPN 2;  1GOH A;  4YW4 A;  5A3W A;  3VBH A;  3ZYG A;  2ORZ A;  1WBF A;  4IEY A;  3JXS A;  3MLJ A;  2ILM A;  4FQZ A;  1NA1 A;  3OBR A;  4IEU A;  3AP5 A;  3ORJ A;  2ZKL A;  1YUD A;  1NXM A;  4F8A A;  2B39 A;  3M7A A;  4QX1 A;  3O1M A;  3KT4 A;  4LKS A;  5C3R A;  5FBZ A;  3AYA A;  3SHR A;  4UW5 A;  2JDN A;  2X53 S;  5I0R A;  1R08 3;  4AVV A;  2A3W A;  4ASK A;  4AI3 A;  4LK7 A;  3USS A;  3POE A;  4WM7 A;  2W87 A;  1FNY A;  1TME 1;  5H9S A;  1MEC 2;  2WAO A;  1BMV 1;  1QJF A;  4JKM A;  1AR6 3;  4TXW A;  5AC9 2;  5T3N A;  3WXP A;  3T1L A;  2A6Z A;  5JR7 B;  4TLF A;  1GAN A;  4QX0 A;  3BTA A;  3N9N A;  5CYY A;  4IV1 B;  4YZ2 A;  1RIR A;  2VZ3 A;  4CEW C;  2QJV A;  4X6R B;  2BBV A;  1VAL A;  2D6M A;  3GAL A;  1AUY A;  3MPP G;  1W6N B;  5CFD A;  1PZ8 A;  1O5L A;  3MIF A;  5GLU A;  4DQA A;  2CAU A;  1CQ9 A;  2PA7 A;  1WBL A;  3BB6 A;  4YG3 A;  1ZZB A;  5A3M A;  2HYX A;  5JIA A;  3GBW A;  4LMF A;  3WDY A;  1RVF 3;  4CUC A;  2GNM A;  5IWF A;  3AYD A;  4AVA A;  3DL3 A;  3T0B A;  4IEP A;  4QHB A;  1QH6 A;  1W9W A;  3PU8 A;  4HK9 A;  1DQ2 A;  1MS4 A;  1D7P M;  1RJ7 A;  4M4P A;  1N3P A;  4JGY B;  3ZPY A;  2WNU B;  1FYU A;  4CCN A;  1APN A;  5BNQ A;  1SDW A;  1UZW A;  2MPF A;  2YV8 A;  2ZAC A;  2R1B A;  4XDP A;  5FP3 A;  4AGR A;  1V9U 2;  4KWL A;  4PDW A;  1YI7 A;  2XGX A;  3Q9O A;  3WNK A;  3A22 A;  1B35 C;  3DXT A;  4K20 A;  5FZ7 A;  4NWW A;  4CDW B;  3LGR A;  3MLL A;  1V6M A;  1CZS A;  1R08 1;  1VBE 3;  2IZW A;  4IER A;  5EV7 A;  2XWB B;  1HB3 A;  1QJX 3;  1MZE A;  1YNA A;  2I74 A;  3HMY A;  5A7O A;  4AFM A;  1HRI 1;  2R07 3;  2VD7 A;  3H8R A;  5APA A;  4YVS C;  1PGW 1;  2GZW A;  2R06 3;  4YGB A;  2PQS A;  1HRV 1;  2RJK A;  1SCR A;  1AR9 2;  3VKO A;  4A44 A;  2EAA A;  2EIE A;  2J1V A;  3M4F A;  3ZDV A;  2Q8C A;  4QQP A;  4GXL A;  1YCI A;  4Z07 A;  3EHK A;  4HSL A;  4TLG A;  5F1R A;  3PUI A;  3WHT A;  2YPD A;  1X9P A;  2XVK A;  2BRT A;  2PN5 A;  4YFZ A;  1UZ0 A;  2QQL A;  2VEC A;  4Q0U A;  4Q0Q A;  2D6P A;  1O4Z A;  3T2Q A;  1XXN A;  3I7D A;  2V5D A;  4Y3O A;  3RGB A;  1JU3 A;  1OA3 A;  5K8S A;  4LIV A;  1A8M A;  2HWB 2;  1YIP A;  3B69 A;  1D4M 3;  2ZAB A;  3WQB A;  1OLQ A;  1NYW A;  1UIK A;  4IND A;  4Z2A A;  2DUO A;  5FXZ A;  3F95 A;  4N43 C;  4QPG C;  4AHY A;  4W50 A;  2QQP A;  3BOP A;  3NV2 A;  1CIY A;  3DYO A;  1GZW A;  3ACF A;  4JDM A;  4XPV A;  4XCA A;  1UOJ A;  4LNV A;  3ETQ A;  4BIS A;  4MV2 A;  1VBC 1;  2EXJ A;  5C33 A;  3O0V A;  5A7W A;  1US3 A;  1URX A;  3POB A;  2RE9 A;  3AB0 A;  4IE4 A;  5CFC C;  5CKN A;  5DZG A;  3ZOI A;  5FKC A;  3SH5 A;  4DIQ A;  5J1X A;  4C0H A;  1C8M 2;  1RMU 3;  4K21 A;  3BIE A;  3POI A;  4ZU7 A;  1OUX A;  4K7J A;  4XDQ A;  3LIG A;  3FUQ A;  5FWE A;  2ARX A;  1CVN A;  1AR8 1;  4J1W A;  2HWD 3;  2Q8O A;  1S0F A;  4GAL A;  2XJS A;  1U5I A;  2BER A;  4RHV 3;  5C8C C;  2YFZ A;  2ZGU A;  1N1Y A;  3UKN A;  2XLF A;  4WBB A;  2XKO A;  5EYY A;  1IS4 A;  3UGF A;  2R04 2;  1GFF 2;  3POG A;  1BBT 1;  2GH8 A;  1CAV A;  1GV9 A;  1CZT A;  1CJD A;  2VBP A;  3X29 B;  4BQ2 A;  4RR3 B;  1JW6 A;  1EPZ A;  2P1B A;  3BAL A;  3OF1 A;  2OKX A;  3RG0 A;  4AHW A;  3FWE A;  4ET7 A;  3TNP B;  4JDO A;  2RR1 3;  3N36 A;  1RTV A;  5C6C A;  1AR7 3;  2XDV A;  3U37 A;  2E53 A;  4MO3 M;  2WZE A;  2BWC A;  3AK0 A;  5K0U C;  2JKB A;  1LGB A;  2E63 A;  1CPM A;  3KLS A;  4AWD A;  4EV0 A;  1TMF 3;  1W6M A;  4GB3 3;  1VMF A;  1YFU A;  3R0R A;  3JU9 A;  1D4M 1;  5JSO A;  2GN7 A;  1I1E A;  1YQ2 A;  1ND3 B;  4P5H A;  4YM1 A;  3HOB A;  2W68 A;  5A7N A;  1DQ4 A;  3SLI A;  2JIJ A;  4BXS V;  3VZO A;  4NPL A;  3D0S A;  1I5Z A;  4QX8 A;  5FZ1 A;  5JDB A;  1RUD 3;  1PZ9 A;  2J22 A;  2ZAH A;  3HT1 A;  1VRH 3;  1H8T B;  4YFW A;  1RUJ 2;  5FZG A;  2VBB A;  4HAN A;  4OI0 A;  4DB5 A;  4CCM A;  1ACC A;  4P9L A;  2IXK A;  2OII A;  5A6X A;  1OF3 A;  1OSG A;  4YZ3 A;  4CEY C;  1PX3 A;  1DZQ A;  1H6X A;  2JB8 A;  5JPM B;  3M3E A;  3T2P A;  3GHM A;  4FFG A;  1O3S A;  3PUH A;  5KHG A;  2O14 A;  4WV8 A;  5BYN A;  1R1A 3;  2P34 A;  5A3N A;  5ACA 2;  3J7M A;  1C28 A;  1GQP A;  2EXI A;  4FPF A;  5GLT A;  1WCD J;  1FPN 3;  3ZYB A;  2VL4 A;  2XML A;  4V2V A;  1AYN 3;  5FYY A;  2ZPX A;  4LPL A;  4N53 C;  4IV1 A;  3GXU A;  4QKF A;  1DP0 A;  4IEQ A;  2VQT A;  1TVG A;  2RR1 1;  1W6N A;  4BXF A;  1WKY A;  1HXS 1;  1PO1 2;  1UCX A;  1XU1 A;  3O7O A;  5FLJ A;  5L9B A;  3SXW A;  1M06 G;  4IGQ A;  1W8T A;  3B5L B;  4RS5 B;  1C5I A;  4CU6 A;  3T0D A;  1TE1 B;  4QU1 A;  1RHI 2;  1YLL A;  4PHZ A;  4XYX A;  4PBP A;  3ZFG C;  2OZ6 A;  4A4A A;  3UJO A;  3ES1 A;  3KCC A;  5JOZ A;  3LOI A;  3THP A;  3JBG 2;  4GMP 3;  1LHO A;  1PK6 B;  2Z2S B;  4JGY A;  5FMO L;  2Z5W A;  3PDQ A;  3JQW A;  5AC9 3;  2K9Z A;  2RM2 2;  2C9K A;  3Q8B A;  1CAU B;  2WZP P;  4DRV A;  4QKB A;  3MGU A;  2YGL A;  4CDW A;  4QAW A;  4CCC A;  5JXH A;  5LA0 A;  3ZVX A;  1GU3 A;  3TEY A;  1HW5 A;  3RYK A;  4AI0 A;  1DF0 A;  2GC2 A;  5BNO B;  2HWC 2;  2W5F A;  1ULP A;  4LBQ A;  4ZHN A;  1SG3 A;  3KF5 A;  3AL5 A;  4LUK A;  4WVM B;  5EZW A;  1NCR C;  4CP1 A;  2JG8 A;  2WNV B;  1GZT A;  4GWM A;  1W0O A;  3K4A A;  3MV0 1;  4PQ9 A;  3NQH A;  4Q8K A;  1ZRI A;  1OC1 A;  3QD6 A;  4HON A;  5LAT A;  3CZU A;  3KT7 A;  1RUE 1;  1JOB A;  1WCK A;  4AOC A;  1X36 A;  2FDK A;  4FAH A;  3WNN A;  2VMH A;  3ECQ A;  1LOA A;  1NAE A;  1GSL A;  2G9G A;  1AYN 1;  1NLQ A;  3LPF A;  4AFD A;  2C0Z A;  4YW1 A;  3AZZ A;  3UNP A;  1OLM E;  2BNN A;  1GNY A;  2C9A A;  3Q8C A;  3IM0 A;  5B2G B;  2BFU L;  2DFB A;  3HAG A;  3IBM A;  3MW4 A;  3THC A;  1A78 A;  4D7Y A;  2R1D A;  3VD4 A;  3C7O A;  2I45 A;  4ZZ5 A;  4PQQ A;  1UYX A;  1AL2 2;  1BHG A;  2A5Z A;  2AAC A;  3C7E A;  3GM8 A;  1N1T A;  2ZMN A;  1JHJ A;  1OQ1 A;  5FY4 A;  4Y4Y A;  2VNR A;  3CO2 A;  4P9W A;  3ZFF B;  4CDU C;  4OI2 A;  5GAL A;  1W2U A;  3KVA A;  3OEB A;  3TN9 2;  2W92 A;  4M3C F;  4TYS A;  1AR9 3;  2DTW A;  4AI1 A;  2PTM A;  2Q1Z B;  2XWJ B;  3SEE A;  1POV 3;  5KR7 A;  1X8M A;  3O1S A;  1CR7 A;  1FV2 A;  3H3U A;  2O8O A;  3O1R A;  2EXK A;  2ZX3 A;  4I0A A;  2VH9 A;  1UO9 A;  2V72 A;  3ITQ A;  4G9S B;  3O1V A;  2IXC A;  5JMO A;  4UBH A;  2D97 A;  2XR4 A;  3JB8 A;  5FUN A;  1W99 A;  1V6K A;  3WG2 A;  2JG9 B;  2G1M A;  1HQN A;  1SBE A;  4LUM A;  1HIX A;  1VIW B;  1J83 A;  4BIO A;  3VDD A;  1AX0 A;  5E6H A;  4MSV A;  2VW2 A;  3VV1 A;  2HWB 3;  4C1X A;  1RUG 2;  2B4K A;  4GH4 C;  4SLI A;  1SEF A;  1W04 A;  2V5Y A;  4ISQ A;  1OMI A;  1RUH 2;  4COV A;  4MUV A;  1MQT B;  1JYW A;  1EAH 2;  3BIW E;  2GMP A;  4EN7 B;  3NAP C;  3RDI A;  4QX5 A;  5JOX A;  1MVE A;  2UUR A;  1FMD 2;  3KWV A;  5IHR A;  4AAP A;  3UT0 A;  4AFB A;  1XYO A;  1H8V A;  3FZ3 A;  1RYY A;  3VBR B;  1XOY A;  1UY3 A;  1YHF A;  4FPH A;  2GP5 A;  1UX7 A;  3V65 A;  2IFR A;  3G7D A;  2GP3 A;  3UET A;  2Q1M A;  2VVD A;  2PHT A;  4AZZ A;  4DEQ A;  3RZH A;  3LDR A;  3RI9 A;  2WO7 A;  2ZJC A;  2YXS A;  3WVJ A;  3PU3 A;  5D2A A;  2AEZ A;  1RJ8 A;  1MZ6 A;  3T1M A;  1ZRC A;  3NJZ A;  4ZU5 A;  1TZO A;  4QD2 A;  3N7K A;  2E33 A;  4FP2 A;  4P9J A;  4TWT A;  4Q27 A;  1H8T A;  4EZH A;  1N1S A;  2HWF 2;  3WUC A;  4L8Q A;  1HQL A;  1I6X A;  2R04 3;  4ZXK A;  4DO0 A;  2JE7 A;  3V0A B;  1MS8 A;  4LO5 B;  3MF9 A;  3VBF C;  2LS6 A;  3ZSM A;  3AP4 A;  4A41 A;  2DVB A;  1JS9 A;  4GKY A;  2DUR A;  1OFN A;  2WWJ A;  3HIF A;  4UBG A;  4N9I A;  1C1F A;  3NNF A;  2MNG A;  3HN3 A;  1Q56 A;  4XBN A;  1ULO A;  2ET1 A;  2GH2 A;  2XG3 A;  1TQ5 A;  5DDJ 1;  4CPB D;  4QXK A;  2DCY A;  2WZ8 A;  3FC0 A;  5HXM A;  5FPZ A;  2Y6K A;  3RMX A;  1JOP A;  5FLI A;  5L7O B;  4W8J A;  4AQ2 A;  1XNK A;  4G3Y C;  4FOV A;  2K46 A;  4BQ4 A;  5I0S A;  3A0N A;  4HKW A;  3PVE A;  1BXH A;  2QBX A;  3GBG A;  4I01 A;  4LBK A;  5HCB A;  1NCQ B;  2J1S A;  2ZAA A;  1M4W A;  4GUL A;  4FPG A;  1LGN A;  1SDD B;  4QGM A;  2FDG A;  1HLC A;  1YFY A;  2VZQ A;  1DLL A;  1F9K A;  2BWA A;  3HBZ A;  1V6L A;  3FX3 A;  3OGR A;  3VD3 A;  3VL8 A;  4KBZ A;  1MS1 A;  4RS5 A;  4MXW B;  4QPY A;  4BK5 A;  3VDA A;  1NA1 C;  1GIC A;  2OPW A;  3ZSJ A;  5IVE A;  5BNP C;  1TME 2;  3OUI A;  3WP3 A;  4UXA A;  4XUR A;  3WF1 A;  1BMV 2;  5FWJ A;  4M01 A;  5CKM A;  5F32 A;  3M3I A;  2ZHM A;  1A3K A;  3ZM8 A;  4IV3 B;  2ID4 A;  5DQ0 A;  3EQE A;  5KXE A;  1G6N A;  1OKO A;  4RQP C;  1QNY A;  4YVW C;  5I0U A;  2IXI A;  2JIC A;  3I59 A;  4QQO A;  4I30 A;  5ACA 3;  3MIB A;  2A71 A;  1CAU A;  1POQ A;  4DMI A;  1JZ7 A;  3KF3 A;  3NJV A;  4O61 A;  3C7H A;  1UKG A;  3TAY A;  5GJ6 A;  1STM A;  4K1Z A;  4O9E A;  4AK3 A;  3EO6 A;  4B4Q A;  2JDM A;  1RXF A;  2DVF A;  4GA9 A;  1JU4 A;  3B94 A;  2DBN A;  1CN1 A;  1US2 A;  4XFB A;  4CXX A;  2J1R A;  1YQ5 A;  2J1E A;  1PO1 3;  4WVM A;  1RUC 3;  2NZ9 A;  1W9S A;  4NRQ A;  4Y20 B;  1XSQ A;  3IPV B;  2WNV A;  4CA9 A;  4NWV A;  2QQK A;  3T08 A;  3THD A;  2JDY A;  5A6Y A;  3FLT A;  3KCY A;  3P6B A;  3OBA A;  3HJR A;  1RHI 3;  4IUG A;  1OOP C;  4LQR A;  5BUV A;  4CXY A;  1IQA A;  3OTF A;  1LNS A;  2WN2 A;  1XRU A;  1UOG A;  4PIX A;  4URT A;  4I3P A;  5JWP A;  3EMR A;  1GWK A;  3PLQ A;  5A32 B;  2RM2 3;  3U11 A;  2QE3 A;  5LA1 A;  5T52 A;  5CB7 A;  2VTX A;  4O7X A;  1O3T A;  1R08 2;  1SLI A;  2D6O X;  4Q8L A;  1LEM A;  1HRI 2;  2UWC A;  4XZU G;  1REE A;  3OSD A;  2VGD A;  3D8C A;  5FFO C;  3Q8A A;  4CDX B;  1JHN A;  1PGW 2;  2FMY A;  3N3H A;  4LO8 A;  1HRV 2;  2HWC 3;  2DCJ A;  3IAQ A;  4LJH A;  1LOD A;  3AVS A;  4QX7 A;  4E27 A;  4Z1V A;  2Z4F A;  3U1X A;  3IWZ A;  2C5D A;  2QTW B;  4Y5T A;  1ZZ8 A;  5I8S A;  2WWU A;  1IOA A;  3VBH B;  5CAD A;  3B01 A;  1IPK A;  1ZBA 3;  2YC0 A;  3OGS A;  3TEW A;  2RJL A;  3IDA A;  4EN6 B;  5CG9 A;  4QX3 A;  2BVV A;  1I5P A;  2F4L A;  2CSG A;  2VVF A;  3KS7 A;  3PL0 A;  3N9Q A;  2NLR A;  3IMM A;  3N7M A;  1WLC A;  3PHM A;  4IXL A;  3ETP A;  4AF9 A;  1ND2 A;  3MZH A;  1DBN A;  2PLV 1;  4P9G A;  1ZRF A;  2JE9 A;  3OGV A;  1A6C A;  1BVV A;  4IET A;  4YW2 A;  2ERF A;  5FZL A;  4ASL A;  5C8W A;  3AZV A;  3HNM A;  2JG9 A;  1OPM A;  1GP6 A;  2HEW F;  1JYI A;  2Y0O A;  3SKJ E;  5L36 A;  1D2S A;  2VMC A;  3DN7 A;  2PAM A;  5GZG A;  3D0J A;  2IFW A;  4OMC A;  4WM7 B;  3GNE A;  5CU1 A;  1AL2 3;  2ZGS A;  3OD4 A;  1Z7S 3;  1ZZ6 A;  1Y3T A;  5C9A C;  2FDI A;  5HCH A;  1B09 A;  2X8K A;  2Q0A A;  1RL3 A;  3ZXE A;  1SFY A;  1VBC 2;  1HN0 A;  4PLN A;  4HT1 T;  4Q4Y 1;  3VD9 A;  5JI7 A;  2ZGO A;  2ZS6 B;  3KMH A;  1QMJ A;  1O8S A;  1WGP A;  2D93 A;  3MFC A;  4XF0 A;  1JI6 A;  1RGS A;  2PHL A;  5DAP A;  3RRD A;  4BQ1 A;  3S57 A;  2W52 A;  2FD8 A;  4DY5 A;  2PHU A;  1GOG A;  1BVP 1;  3PVO A;  1KJR A;  2CU5 A;  2VXJ A;  4PI0 A;  1EP0 A;  4JCK A;  4A3Z A;  4DY3 A;  4FPY A;  2W46 A;  3MDP A;  2BGC A;  2XLA A;  2Y34 A;  4NID A;  1AR8 2;  4C90 A;  1GLH A;  1G9A A;  2DYC A;  2YC2 A;  4LHS A;  2PYT A;  3OBZ A;  4CE8 A;  3AL6 A;  4FPL A;  5LA9 A;  2QVS B;  5L9V A;  3POY A;  1QIQ A;  5FXX A;  3VKF C;  3JQX A;  2Y6G A;  3KQ4 B;  5CFD B;  1LCL A;  4KGQ A;  1N3Q A;  3VBU B;  1ST8 A;  3GCW A;  2NMN A;  2WO2 A;  1RIT A;  1RXG A;  1PMJ X;  2MEV 3;  4ZPI A;  4ZKT B;  1N3O A;  1ZA7 A;  3E6B A;  4RSU A;  3IT8 A;  2X29 A;  1VBD 3;  3VZL A;  3O1O A;  5FP4 A;  3INA A;  4CP0 A;  2VOV A;  1ZBA 1;  4XJA A;  2PAK A;  1E5I A;  4I09 A;  3V0A A;  1AYM 3;  1JZ6 A;  4LBL A;  4NRM A;  2VR4 A;  5F39 A;  1H4H A;  4CPB A;  4ARX A;  4D6S A;  2DCT A;  5AFB A;  4I3G A;  3A7Q A;  1FMD 3;  4A45 A;  1SLL A;  1CAW A;  2BZD A;  4AVB A;  4KG8 A;  2WN3 A;  5BXX A;  4JQR A;  4A42 A;  2ENR A;  1JUH A;  3CLP A;  1D4M 2;  1VBA 3;  1H0B A;  5CKQ A;  1KD7 A;  4IGO A;  5L7O A;  3WF4 A;  2VCM A;  1Z7S 1;  2VO5 A;  1NCQ A;  2E7T A;  5FMO S;  3TOJ A;  2DU0 A;  4D3W A;  1PGL 1;  1PNF A;  3ZDS A;  3WDV A;  3I2I A;  5FZ8 A;  2WYS A;  1S4C A;  3CQO A;  3SH4 A;  2HWF 3;  4LOT A;  2W3J A;  4LLF A;  1HB2 A;  3BPS A;  1VJ2 A;  5FRE A;  3VGI A;  2VJX A;  3WW3 A;  2PXJ A;  4LKE A;  3RNS A;  1XB9 A;  4JGZ B;  4MVT A;  1QNW A;  4CXW A;  4G4F A;  4B4P A;  4MZU A;  4QX2 A;  1NY7 1;  5LBE A;  3I3B A;  4UF0 A;  2A70 A;  2MEV 1;  4S2D A;  4E9K A;  2YRO A;  3ZMO A;  2VMG A;  1VBD 1;  5FIX A;  3AP7 A;  3KD4 A;  1UOF A;  3RYP A;  5JZG B;  2X10 A;  2G9Z A;  1AYM 1;  2D98 A;  4JX0 A;  2RR1 2;  4YGE A;  3ES4 A;  4B7K A;  2HWE 1;  1HXS 2;  1X82 A;  4QT6 A;  3ZIX A;  1NLS A;  3UJQ A;  4ARY A;  3PIJ A;  3DPR A;  1JYT A;  4CP2 A;  1VBB 1;  1AJK A;  2FDH A;  5IUQ A;  3LA7 A;  2WA3 A;  4Y20 A;  2SBA A;  3CZJ A;  3IPV A;  2A3X A;  3TNQ A;  5FZI A;  5IVV A;  3E6C C;  3AJY A;  1DIW A;  4J25 A;  5ANN A;  4AQS A;  3RSJ A;  4L9B A;  4J6G A;  1TME 3;  4R4X A;  1S2E A;  4XC9 A;  3ZYJ B;  4YNI A;  5JAX A;  1ALY A;  5FYT A;  3WDX A;  5HI0 A;  3GCX A;  4BDV B;  1XYP A;  5A32 A;  2YZ4 A;  4E2G A;  1CGP A;  4X8P A;  1TNF A;  2JDU A;  1ULF A;  2WRA A;  5FYC A;  4NPR A;  5HCA A;  1CAV B;  5LEJ A;  1A8D A;  2B45 X;  1UMI A;  5FPA A;  5B4N A;  5J09 A;  3OY8 B;  4AEJ A;  4JGY C;  2FZ1 A;  4CDX A;  2WNU C;  4CVU A;  2PFW A;  1A34 A;  3LA3 A;  4LBO A;  1NXD 1;  1GMM A;  3I97 A;  4Q4X 3;  4BLI A;  1JYN A;  2CTV A;  3K4Z A;  2O0O A;  1W9Y A;  4UAP A;  3BTZ A;  2GND A;  4K3U A;  5FY8 A;  5LRR A;  1RUE 2;  1W6M B;  4CDW C;  4CCO A;  4E4D X;  5I8T A;  1ODN A;  3C7G A;  1FI2 A;  2VM9 A;  2V73 A;  1WCS A;  2E51 A;  3UL2 A;  1ZX5 A;  3B9I A;  1W05 A;  1AYN 2;  4EWD A;  2ZGL A;  4CP9 B;  4NOT A;  1ENX A;  4EN9 B;  1KQR A;  5C4W C;  2ZHK A;  2BQP A;  2XON A;  1ODM A;  3DKW A;  3PUS A;  1I9R A;  4K9S A;  3THT A;  5J3U A;  1C3H A;  4IQP A;  1S0G A;  4NHY A;  4RL7 A;  1TNR A;  4E8D A;  4H14 A;  3CNA A;  4XTM A;  3B9C A;  4LA3 A;  1IG3 A;  5F5A A;  4OHV A;  1W6Q B;  2YBS A;  4P9I A;  3ZKU A;  4V1P A;  2RS5 1;  2CWS A;  1HRI 3;  2AYH A;  4OHW A;  1Q8V A;  2UYA A;  3WNO A;  1DYP A;  5AVP A;  4PBO A;  1HRV 3;  4OUL A;  3S30 A;  3QH7 A;  5FXV A;  1QQP 1;  3HPN A;  1YJK A;  2JB4 A;  3I2F A;  1WMD A;  4LUL A;  4WVW A;  4R9B A;  5C70 A;  4MOA A;  2F6B A;  1Y9M A;  2WS9 1;  4PLO A;  4IE0 A;  4HKL A;  3WF2 A;  3KV4 A;  3RWK X;  3KB5 A;  5HV4 A;  3VDC A;  1LOB A;  3POF A;  5J48 A;  4FPK A;  4ASM B;  1REF A;  1RC6 A;  3ALQ A;  4Y22 B;  2Y33 A;  3URF A;  3KGZ A;  4OMD A;  4B1L A;  3VDB A;  3M1H A;  5DUU A;  4CUA A;  2V4A A;  2OS2 A;  4QB2 A;  3ZN5 A;  3VBU A;  4QGN A;  5LA2 A;  4Q4X 1;  4YPJ A;  1J1L A;  4HK8 A;  4BQX A;  2R30 A;  4KBB A;  4FTB A;  4AVC A;  4LTA A;  3S6P A;  4YM2 A;  1NOV A;  2B9V A;  3ZIW A;  2YFU A;  3NV3 A;  4XUN A;  3AKP A;  1DGL A;  3KCX A;  5LK7 B;  4QHZ A;  5JZG C;  1IHM A;  2ZBJ A;  1MVQ A;  1S55 A;  1VBC 3;  1XE8 A;  5FZM A;  1DFQ A;  4D7T A;  3AMQ A;  3JD7 1;  5FPB A;  2CV6 A;  1FAY A;  3VLB B;  3VKN A;  4COZ A;  1JUI A;  2JEN A;  1QU0 A;  4RR3 C;  4R4Z A;  2VQ0 A;  4Y26 A;  1AR8 3;  2LRP A;  3CU7 A;  2C4X A;  3IAP A;  4TSV A;  3VBO C;  3LCP A;  4LBQ B;  4Z2W A;  2IVJ A;  3O0W A;  3RZM A;  3WSO A;  1H4G A;  2EIC A;  3N9P A;  4BME A;  4FPO B;  5F5C A;  2JG8 B;  1EPW A;  4MHU A;  4XDO A;  4FPJ A;  3WG1 A;  1BBT 3;  1CX1 A;  2EIG A;  3P1I A;  4LBQ D;  4KWK A;  1DYO A;  3O1T A;  3POJ A;  2D7F A;  1ND3 C;  5T54 A;  4IEO A;  1F5J A;  3APB A;  1OVS A;  1DCS A;  3GJA A;  1LU2 A;  5IJR A;  5BY5 A;  1S1A A;  1NQD A;  1PX4 A;  2P3J A;  4JGZ A;  3KV9 A;  5DDJ 2;  2LUW A;  2ETE A;  2JDZ A;  3PUQ A;  2Q8D A;  3ILF A;  1LUL A;  2W1U A;  2W39 A;  3RQ0 A;  2ZCW A;  2D6L X;  4KI5 M;  1CZV A;  3ACH A;  1ZVF A;  5EJ1 B;  5JZG A;  1LED A;  3IDB B;  4WM8 C;  2ZZJ A;  3H8X A;  1UZV A;  2VVE A;  4NPM A;  2BTV C;  1C1L A;  3HNB M;  3LPG A;  1E5R A;  1OA2 A;  4AW7 A;  5LW9 A;  4B1M A;  4DFS A;  1NX9 A;  2HH9 A;  3R4U A;  4AED C;  1FV3 A;  2H0B A;  3T30 A;  2R49 A;  2ORX A;  1L7R A;  5AFE A;  2P2K A;  4AAX A;  2QQW A;  1VRB A;  2JEM A;  3AYC A;  1CIW A;  4N7U A;  4JKL A;  4QKD A;  4BQ5 A;  5GLW A;  1Y7B A;  3N9L A;  3OBT A;  4QPW A;  3WT3 A;  3S5A A;  2ZGK A;  2ZEW A;  3H1M A;  1Y9G A;  3VDD B;  3LSE A;  2VOK A;  2MHF A;  1QOS A;  4RS5 C;  3C7F A;  4JKK A;  1K5J A;  3BVC A;  1UY2 A;  3TB0 A;  3S0M A;  3GZU C;  4ES8 A;  4AL9 A;  4KQ7 A;  5FO9 B;  1HN1 A;  2P3Y A;  2XXZ A;  1LGC A;  3D82 A;  3OY8 A;  2Y6L A;  1PK6 C;  4UFH A;  1HXS 3;  3CHX A;  4XFC A;  3ZFE C;  4AVS A;  2RDQ A;  3CJX A;  3I3D A;  4DXT A;  4JVA A;  3NVC A;  3VUO A;  1AL0 G;  4AEK A;  1K3I A;  1COV 1;  3MYX A;  3TYJ A;  4Y5Z 0;  1VAK A;  1W6O A;  1S0D A;  3AVR A;  1HKD A;  5FKB A;  5GLV A;  2Y64 A;  3U10 A;  1G9F A;  1SZB A;  1YQ8 A;  2Z69 A;  3NKT A;  2DUP A;  2O1Q A;  4QKN A;  4QB1 A;  2XH6 A;  4B8E A;  4CP9 A;  5C71 A;  5BNO C;  1B35 B;  3BTY A;  2X5I B;  2VNG A;  3V56 A;  2DU1 A;  5JVV A;  3LIH A;  5D8A C;  1PO2 1;  4R8H A;  3B3Q E;  4QDS A;  4DZG A;  1PIV 1;  4MGZ E;  4Y1U A;  4YVS B;  2UY8 A;  4FFH A;  1UU6 A;  3SIS A;  3I2J A;  2ARB A;  4GZ9 A;  3FL7 A;  1W6Q A;  1Q3E A;  2ZGM A;  3QBQ A;  2CY6 A;  2GME A;  2ET7 A;  1GKB A;  1W03 A;  3QOP A;  4CRQ A;  5E1R A;  1JOD A;  1SLA A;  1SLC A;  2A6Y A;  3MIG A;  3CJI C;  5FYS A;  5IT6 A;  3BGA A;  4LR4 A;  4XXP A;  3NV1 A;  3AFK A;  2WIN B;  3BU0 A;  2JX9 A;  1W8U A;  2D3P A;  2NYY A;  4PLM A;  2OPK A;  1RUE 3;  3AFG A;  4YGD A;  1OPO A;  2VBD A;  4QXH A;  2Z79 A;  2W91 A;  1DQ6 A;  2PLV 2;  4FSJ A;  4K40 A;  1SMV A;  1BK1 A;  3OPT A;  2WUH A;  1HB1 A;  3ZFF C;  3H3Z A;  2VOW A;  1O5U A;  4Y22 A;  4N43 B;  1C5H A;  1GQG A;  1QDO A;  1QJU 3;  3C3V A;  2XJV A;  3FHI B;  3J7N A;  2DF7 A;  3J9S A;  5IVY A;  3T0A A;  1RUC 2;  2B42 B;  4BLJ A;  5L19 A;  4ISR A;  4YZ5 A;  2CDP A;  4ATF A;  5FZE A;  4AYU A;  3HT2 A;  4E2S A;  3AZY A;  3GHN A;  3GYD A;  3H3L A;  4EWE A;  3FHA A;  4KGG A;  5BNN C;  1JZ4 A;  4GD4 A;  3E6D A;  5D1I A;  1SLB A;  3RI8 A;  2JG9 C;  4QDR A;  1OA4 A;  5IFP A;  5IFT A;  3I59 B;  1WME A;  2E26 A;  3D4K A;  1JZ8 A;  2BGO A;  2OVU A;  3POS A;  4C1W A;  1OUR A;  1Z0H A;  2WFP A;  2P5B A;  4GAZ A;  2W08 A;  3LFM A;  5I91 A;  5LY1 A;  3I8T A;  4BZ4 A;  3B7M A;  3DYP A;  2XHN A;  1MQT C;  5GZF A;  4XF3 A;  2UWB A;  5FZC A;  5F5I A;  2FMD A;  1VR3 A;  4ZS2 A;  1YRZ A;  4IEW A;  5DAQ A;  3VBR C;  4XIL A;  4MGT A;  3LDK A;  4R9A A;  5FYV A;  2LTN A;  4Y1V A;  1ZBA 2;  3BN6 A;  1LOF A;  4UW6 A;  2NN8 A;  4BE3 A;  1D2Q A;  4HFS A;  1YJL A;  1LES A;  1ZM1 A;  4Y1Z A;  4ONU A;  1D0H A;  5FLH A;  1JZ5 A;  1VB4 A;  2TUN A;  1OKQ A;  4DPN A;  4LEJ A;  2J1A A;  4CDQ B;  5FP8 A;  4CCD A;  5KC5 A;  1G7Y A;  4RFR B;  5JUV A;  3LA2 A;  3OGJ A;  2WFF 1;  4KMQ A;  1QJU 1;  1U0A A;  2UWA A;  4X6Q B;  5EIY B;  1X8E A;  4XHB A;  3I2G A;  3KM5 A;  4LK6 A;  4CU8 A;  5FBJ A;  4CCL A;  5IK7 A;  3HQU A;  2ADE A;  4FXG B;  1Z7S 2;  1CX4 A;  4KNC A;  5FZD A;  3DEC A;  2WA4 A;  3H8U A;  1PGL 2;  1H1M A;  2WR9 A;  3MPB A;  3ZXA C;  1W2A X;  3LD8 A;  2BGP A;  1AX2 A;  1IGO A;  4TZD A;  4DUX A;  2VPV A;  5FZ9 A;  2ES3 A;  5KBF A;  2AEY A;  2UY9 A;  4NE9 A;  3TRS B;  4XFI A;  5ISL A;  4XMA A;  4DOU A;  3PTY A;  1YO8 A;  4FPC A;  3OG2 A;  3FFZ A;  1P8J A;  5KWR A;  3OCP A;  3WF3 A;  4M3C A;  3BTX A;  1VLN A;  1NE4 A;  4QM9 A;  4QPI B;  5CIS A;  1ND2 B;  2XUE A;  1NCQ C;  3DUI A;  5CVR A;  2FCV A;  5IVB A;  5EYX A;  4CU9 A;  2WZR 1;  1VE0 A;  4ZON A;  1G8W A;  4A6S A;  5DDJ 3;  3MEP A;  1YFX A;  3PIG A;  4GQ7 A;  2MEV 2;  2CHH A;  2FHR A;  1W8W A;  4HMZ A;  3ZSE A;  2W9X A;  1Y43 B;  1VBD 2;  1V0A A;  1MEC 1;  3LDB A;  2VTF A;  4LE3 A;  2WT2 A;  5FQ0 B;  4HG6 B;  1AYM 2;  5IVC A;  1JXN A;  4XBL A;  1VPH A;  2VZV A;  2GAL A;  2HWE 2;  3R6S A;  5FO8 B;  2D43 A;  2BEO A;  2VMI A;  4IV3 C;  1QH7 A;  1VBB 2;  4UW3 A;  1O3R A;  2HYK A;  2RS1 1;  4KG0 A;  4NHL A;  1XBF A;  3CKH A;  5LEK A;  1VBA 2;  3KV6 A;  2VCC A;  3WG4 A;  2JE8 A;  3MIE A;  4FI9 A;  3HR9 A;  1SQ4 A;  2HEV F;  1Q8S A;  3CDZ B;  3DV8 A;  3RJ2 X;  2OQ6 A;  4P9X A;  5KHK A;  2XJR A;  1B35 A;  3HD8 B;  1BEV 1;  1VP6 A;  2JJ6 A;  2X5I A;  3SMH A;  3VKM A;  3WUD A;  4CUG A;  1KFX L;  1PM4 A;  1W0P A;  1ZRR A;  5A7S A;  4S2H A;  3WDW A;  5CA6 A;  4FQ4 A;  4Y1X A;  3H9A A;  4YAR A;  4XAC A;  4YVS A;  1H30 A;  5FZ4 A;  2DFC A;  1V6O A;  4XVH A;  2BOJ A;  3WHU A;  4AG4 A;  5FOJ B;  1K42 A;  1ENQ A;  2V09 A;  4XQW A;  5DZF A;  1JYX A;  5A33 A;  1DG6 A;  1CAW B;  2XVG A;  2ARA A;  2FCU A;  1U12 A;  4XQD A;  4ZU4 A;  4TTG A;  4XUQ A;  4PJY A;  1KRI A;  1GWM A;  2VME A;  1O4Y A;  2D44 A;  1J59 A;  3D6E A;  3FHQ A;  2IXL A;  2VZP A;  3CL1 A;  3PMS A;  4BA6 A;  5C3S A;  4LIU A;  1MS3 A;  5FCC A;  4XET A;  3WLU A;  4AI8 A;  1R09 1;  4CDX C;  1QXR A;  3V0B B;  4KL1 A;  2DBI A;  3H42 B;  1DGW A;  2QQI A;  1Y4W A;  1FXZ A;  3K77 A;  3TEX A;  5J98 B;  4N43 A;  1JYV A;  4QPG A;  2N7G A;  2E6V A;  3L2Y A;  3U07 A;  1RB8 G;  3LQC A;  4YSF A;  3VBH C;  2C26 A;  2DDU A;  4NRP A;  1QJY 1;  4CDU B;  2YDE A;  4A7Z A;  2UYB A;  3I2O A;  2RS5 2;  5CNA A;  2GC0 A;  2AGS A;  2VUD A;  1O4T A;  2OT7 A;  4COY A;  3QAC A;  4XJW A;  5CFC A;  3H7J A;  1WLT A;  5FZ0 A;  1QQP 2;  1O59 A;  4LBM A;  5A1F A;  4RFT 0;  3IDE A;  4MX3 A;  5T55 A;  1PMH X;  1NZC A;  2WS9 2;  2Y26 A;  4AGG A;  4UF0 B;  5FK7 A;  1OUS A;  4XF9 A;  4Y1Y A;  4D94 A;  2PHF A;  2R0H A;  4PI2 A;  3VKL A;  2ZA9 A;  5C8C A;  1GZC A;  4HXC A;  4WM7 C;  2DWR A;  5FY1 A;  1DDL A;  2DCK A;  3ZKY A;  3M70 A;  3MV1 1;  1JMU B;  2PLV 3;  4Y33 A;  2BPA 2;  3QCW A;  5GZE A;  1UOB A;  3T2T A;  3KT1 A;  4XF1 A;  3DPR B;  1IPS A;  4OVE A;  2RHP A;  1C8M 1;  4Q4X 2;  2QQV A;  5H9P A;  4MGK E;  3AMH A;  3Q8F A;  1GWL A;  1FOD 1;  1XQN A;  1LU1 A;  3EJK A;  2E31 A;  1UZY A;  5K0U A;  4FCA A;  4NHX A;  4OI4 A;  5LB6 A;  1WA6 X;  4Q4Y 3;  1F8V A;  2PHD A;  3A23 A;  1GQH A;  3BOD A;  4FOW A;  5CFD C;  2D40 A;  3MUY 1;  3ME2 A;  4CDQ A;  3B93 A;  1HX6 A;  1YYN A;  3JD7 2;  3VBU C;  2KXL A;  3BKZ A;  2E32 A;  3KHC A;  3VZN A;  4SBV A;  3EBR A;  2A6V A;  2VC9 A;  4MYE A;  4XZP A;  2W1Q A;  3AMN A;  3PUR A;  2Q8E A;  1SFP A;  3BU7 A;  2GDF A;  4GWN A;  2RDR A;  3I2H A;  2DCZ A;  2WDB A;  5DAV A;  1F4A A;  1W8H A;  2BOI A;  4XUT A;  4D6Q A;  3FMG A;  1PM7 A;  3WDT A;  1ZYB A;  3AP9 A;  5IK5 A;  4KWJ A;  2W47 A;  1FX5 A;  4ZZ8 A;  2GNB A;  3VBF B;  2B9U A;  4LT5 A;  4NII A;  4CEY A;  4PDW C;  4NHM A;  1BJQ A;  5SV5 A;  4RYD A;  3S7E A;  1NKG A;  2BUK A;  1S2K A;  1CAX B;  3VBS B;  4RA0 A;  1X9T A;  5EWS A;  4QPI A;  1YFW A;  1XE0 A;  4YZ4 A;  4EQV A;  2WKK A;  5HCF A;  3UGH A;  1XU2 A;  2DVD A;  2ARE A;  2WLQ A;  1QXJ A;  3SEP A;  2Z42 A;  2HKX A;  2JDP A;  2BBA A;  3VD7 A;  1K45 A;  2I07 B;  1DYK A;  5LWB A;  4LO4 B;  5DXD A;  2XUM A;  5FQ0 A;  1GYK A;  5C5T A;  1IZ3 A;  2W1S A;  4Q29 A;  3IIA A;  3ROU A;  1NT0 A;  2X09 A;  4FBF A;  3JB4 C;  1LHV A;  5FO7 B;  3HQR A;  3NNL A;  3IZO A;  3VHP A;  2BW8 A;  2ZZQ A;  5JLV A;  3FBY A;  1QOO A;  2QQU A;  1CPN A;  4XJU A;  1SHW B;  1BLZ A;  4BQ3 A;  4XJZ A;  3T3Y A;  3UKV A;  1Q8Q A;  1JOJ A;  2WO1 A;  2DVA A;  2WSU A;  3DCQ A;  4QB6 A;  2RS3 1;  4RQP B;  1W0N A;  4YVW B;  4H3W A;  4XFG A;  3NKG A;  5FZF A;  4BHP A;  5BPX A;  4IW3 A;  3I54 A;  1ZA4 A;  1XPW A;  3LF7 A;  4MGQ A;  4QMA A;  1N1V A;  1RUO A;  3ZPO A;  4D0Q A;  4Q4V 1;  3FJS A;  2KA3 A;  2WII B;  2Y6J A;  4CCE A;  4QQL A;  1UKR A;  1BBT 2;  3JBG 1;  4WZC A;  3ZYI B;  2WT0 A;  4ORF A;  2TEP A;  3MFA A;  3PVN A;  1E5H A;  3DGT A;  3MW2 A;  5GZD A;  1NCR A;  1UYP A;  3M2M A;  4XIK A;  4JRL A;  5FK8 A;  3FBM A;  2HWE 3;  5DUW A;  5FPV A;  1UYY A;  4LO7 A;  4ES9 A;  1N47 A;  1QKQ A;  1AXZ A;  2VMF A;  1DU3 D;  3USU B;  5FXW A;  1VBB 3;  3MIH A;  1RUI 1;  1UU5 A;  4OQ9 A;  3RFR A;  3ZXG A;  2TBV A;  1OOP B;  1COV 2;  5FYI A;  3NL1 A;  1XND A;  3ILN A;  5F6L B;  3MHZ A;  1WW7 A;  5T5L A;  1LEC A;  1CON A;  4QHO A;  2RJ2 A;  4FOY A;  5IAX A;  5JOW A;  5ABJ B;  2YU1 A;  4Y5S A;  3OOX A;  4JZR A;  1LRH A;  3V0B A;  1PO2 2;  4XCB A;  1IS6 A;  3AKQ A;  3IMN A;  1PIV 2;  3H8O A;  2YG0 A;  3GZE A;  3ON7 A;  5EPA A;  1UXZ A;  4I2O A;  2ZHN A;  4ERO A;  1PVC 1;  4HET A;  4AR2 A;  1WWY A;  4Q4W 3;  4BB3 A;  2A6X A;  3K3O A;  1IG0 A;  1OQE A;  4W4Z A;  4E4Z A;  4CDU A;  1S0C A;  3GDB A;  4N7I A;  3SH3 A;  1XNB A;  2WL1 A;  4BMB A;  5BV6 A;  3ACL A;  2ZXQ A;  1XNT A;  3ELN A;  3ILR A;  3DXU A;  4M0H A;  3AMP A;  5I0T A;  5JXJ A;  3ASI A;  5DUV A;  4MG2 A;  3DKQ A;  2H0V A;  2VTX J;  3WQ0 A;  1H2M A;  3ACI A;  1U5Z A;  4FFF A;  2AC1 A;  4LHL A;  4PIY A;  1MPX A;  3NJX A;  3RYR A;  1JTZ X;  5KHH A;  4IEX A;  4YWA A;  3AX4 A;  3W9A A;  3GZA A;  5FJK A;  2OA2 A;  2RG4 A;  4BWO A;  4DIN B;  1LKN A;  2D5H A;  4MGS A;  4UFM A;  3LEG A;  1UYZ A;  1ZNP A;  3BI3 A;  1W3X A;  5KHI A; 
#chains in the Genus database with same CATH homology
 5DAP A;  5ERL A;  4BQY A;  5LAT A;  3KT7 A;  4BQW A;  4XAC A;  2Y34 A;  3OBZ A;  5EQU A;  4KBZ A;  5LA9 A;  5L9V A;  5A3U A;  3W21 A;  2OPW A;  5DAW A;  3OUI A;  2FCU A;  5C5T A;  5L9R A;  4ZPI A;  4Q5O A;  5LBC A;  5DAX A;  3HQR A;  3NNL A;  4NHY A;  5DAQ A;  3OUH A;  4MHR A;  3OUJ A;  3NNM A;  5IAT A;  2JIJ A;  4IW3 A;  3BVC A;  3ITQ A;  5LAS A;  2G1M A;  3W20 A;  4NMI A;  5HV4 A;  2FCT A;  2RDQ A;  3HQU A;  4XAB A;  5EP9 A;  3NNJ A;  2Y33 A;  3EMR A;  2G19 A;  2V4A A;  4BQX A;  4NHK A;  3KT1 A;  5LBE A;  5IAV A;  5IAX A;  2RDS A;  2FCV A;  4Y5S A;  4JZR A;  5L9B A;  2JIG A;  4XCB A;  4UWD A;  4Y5T A;  4ZON A;  3GZE A;  5HV0 A;  5EPA A;  4NHX A;  5LB6 A;  2A1X A;  5C5U A;  4XAA A;  3PL0 A;  3GJB A;  2HBT A;  5LBF A;  2RDN A;  4J25 A;  3DKQ A;  5LBB A;  4NHL A;  2RDR A;  3MGU A;  4MHU A;  5M0T A;  4XCA A;  4XC9 A;  5DAV A;  3NNF A;  2HBU A;  2RG4 A;  4NAO A;  4NHM A;  3GJA A;  3KT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...