5F5IA

Crystal structure of human jmjd2a complexed with kdooa011340
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
b'ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
total genus 112
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f5iA01
4CUGA 3KV6A 5FXXA 5A1LA 5IVVA 4IGQA 5FV3A 5FZKA 5A3WA 3PUAA 2YBPA 3KV5A 5FWEA 2YBSA 4CCKA 5A3TA 3AL6A 3RVHA 5FZBA 3DXUA 2OQ7A 4QXCA 5FYIA 5A3PA 5F5AA 5FZOA 5FZCA 4CCLA 3PU3A 5F32A 5F39A 4EYUA 3KV4A 4GAZA 4Y3OA 3N9QA 5FUNA 4DIQA 5FWJA 5K4LA 2GP5A 4GJZA 5FZFA 5FZ9A 1VRBA 5A7PA 4QWNA 5FZEA 5A80A 5FZ1A 5FYTA 5FZ6A 5FYHA 5FYUA 5FXVA 5FY4A 2YU1A 5IVYA 5ANQA 3PUSA 5IW0A 4UF0B 3LD8A 4QX8A 4CCOA 2GP3A 5FZLA 5FJKA 4AAPA 2OT7A 5FXZA 5FZGA 5F5CA 4E4HA 2XUEA 3K3OA 3OPWA 5F2WA 2OQ6A 3PUQA 3N9MA 2YPDA 5FP7A 4V2WA 5FYYA 5IVBA 5F37A 5A7WB 4QXBA 5FZ7A 5FP9A 5FPAA 3K3NA 3ZLIA 2XMLA 4C8DA 5FZDA 4LITA 5A7OA 5IVCA 4CSWA 2P5BA 5IVFA 4Y33A 4TN7A 4XDPA 4URAA 5IVJA 5FZ4A 5FP4A 5FPLA 5FPBA 4ASKA 4BISA 5FZIA 5LWBA 5LY1A 3PDQA 5E6HA 2XDVA 5A7SA 3KVBA 3KVAA 5FZMA 4D6QA 5FY9A 4UF0A 5ISLA 4CCJA 4Y4RA 4V2VA 5FY8A 2WWJA 5FZ3A 5FY7A 4LIVA 4BU2A 5F3IA 5FZ0A 2WWUA 2PXJA 5FZHA 5FP8A 5FYCA 3DXTA 4IGOA 3AVRA 5FZAA 4EZHA 3KV9A 5F3EA 3N9NA 5F3CA 5FYSA 3AVSA 5FXWA 2W2IA 5CEHA 5FZOB 4CCMA 3PTRB 5IVEA 4XDOA 2Q8CA 4GJYA 5FYVA 5F3GA 2OX0A 2Q8EA 4CCNA 4GD4A 3N9PA 4BXFA 5FYMA 3K2OA 3U78A 5FPVA 4IGPA 5FY0A 3AL5A 5FPUA 2XXZA 4LXLA 5FZ8A 5F5IA 5A7WA 4AI9A 4QU1A 4DO0A 2VD7A 3N9OA 3NJYA 5LY2A 5FBJA 5FY5A 5LW9A 5FY1A 5FJHA 5FYBA 2YU2A 3U4SA 3ZPOA 3OPTA 3PU8A 3UYJA 5A3NA 4D6RA 5IWFA 2OS2A 5FUPA 5F2SA 3LDBA 3PURA 5FYZA 4EZ4A 4HOOA 2Q8DA 4QX7A 4D6SA 4QXHA 5A7NA 3N9LA 2YBKA 5A1FA 5KR7A 4NUBA 5A7QA 4LIUA 4HONA 5FP3A
chains in the Genus database with same CATH superfamily
2IXJA 4AVSA 3LQCA 2PHLA 3PVBB 4Q0PA 4Y1ZA 1PIV1 3V64A 3FBMA 2WFPA 4OQ9A 5I8TA 4J25A 3R4UA 3TEZA 3ZPYA 4JAAA 5GJ6A 4LO8A 4GULA 1W3VA 5A3WA 2ZZQA 2XL7A 1GKBA 1TNRA 1ULFA 2WA4A 1QF3A 2YY1A 3OBZA 1S0IA 1ZZ9A 4YW1A 4QXCA 4DXSA 2VXRA 4C1XA 4N43A 3IM0A 4CTEA 5FWJA 1C4RA 4PCRA 5FZFA 4X8PA 1MQTB 2R043 5A80A 2RDRA 4LKSA 4XZPA 1S0DA 4XCAA 1AJOA 2J1AA 3ETQA 4FXKB 3HMYA 2Y0OA 3TRSB 3LFIA 3I2KA 1AF9A 4NMIA 4CP9B 2V5YA 1PNGA 2A6ZA 3NV4A 1YIFA 1GQGA 2GP3A 1RMU1 3HNMA 4WVVA 1XOYA 3VHRA 5BNQA 5FR3A 2VC9A 1CZTA 1G6NA 3AYAA 2VOTA 2PHUA 1QJX2 1YFWA 1LB2A 1OMIA 3GBGA 3GXUA 1CAUA 1VMHA 2BVVA 4XF1A 5FPAA 1OH4A 2BZDA 2VBPA 1IOAA 2WBKA 4B4QA 1UKRA 3POSA 1MS8A 3ZYRA 1ZBA2 1DDLA 3WP4A 4BK4A 4UBHA 2B46X 5A6YA 1URXA 3OUIA 4U2AA 4XF0A 1A8MA 5FPLA 1FOD1 1PZ9A 5FPBA 4BISA 5FZIA 4TZDA 3LSEA 3PDQA 3C2UA 4GALA 3BB6A 4Q1PA 3THPA 3KVAA 5LEKA 1YUDA 4P9LA 3CU7A 3L2HA 2WINB 4L11A 4Y4RA 5FY8A 1Y7BA 4JRAA 1J3QA 3AMHA 3SKJE 1CZSA 4BU2A 4GWJA 5T55A 3W58A 3RZHA 3AJZA 1QJY2 4DY3A 2LRPA 3C8XA 2YROA 1W2NA 3E6BA 2WNVA 3KQRA 1ENQA 5FYCA 3NAPA 5GLZA 1R1A1 3ZSMA 3A0KA 4NHYA 2JKBA 4AFCA 2FDGA 4AFBA 1LODA 3AVSA 2WKKA 2VBBA 2TEPA 4IE5A 1S2EA 1CONA 1RL3A 1JHJA 2LALA 2X5IC 2IUWA 5BUVA 1OF3A 4FT8A 2VULA 5EJZB 5DQ0A 3A21A 2R062 3LGRA 1AR92 1TME1 4A42A 3N4MA 3JBG1 2ATFA 3CQOA 5J3UA 4CU7A 3QH6A 4OHYA 3IPVB 1U5YA 2ZA9A 5BY5A 1VALA 1RGSA 2QQJA 2QQKA 2WS91 2A70A 1IPSA 3UGGA 1PGL2 2HEVF 5F5IA 3A4UA 1VRH3 5LB6A 2RS13 4N9HA 2CHHA 1K42A 5CFDB 1OI6A 2PLV3 3MO4A 3OYWA 4D3WA 3AZXA 1IS4A 3AMNA 1XB9A 1W6MA 2ZGLA 3VD7A 2WQ4A 4CUBA 3WUDA 1W9WA 3AMPA 2ZGQA 3CJIB 4FOVA 1ND3A 1RTVA 1NCRA 1SACA 2E7AA 4QHBA 4QT6A 5I0SA 5KC6A 1LR5A 2W39A 5CFCC 1EPWA 1KJLA 1UZ0A 2D44A 3SHRA 1DGRN 1NLSA 3R0RA 2GMEA 2JE9A 2Y64A 4OZXA 5C8WA 3POFA 2ZEZA 2CTVA 2BPA2 5A32B 4YYOA 3J8F3 2Q1ZB 5FBZA 3X29B 2ZPXA 4A2UA 1UOJA 1MS3A 4LEJA 4XILA 1H2NA 4CDQA 3OTFA 3LWCA 1PO21 1DCSA 1ND2B 2HWD2 4NHXA 3H8UA 3N3HA 4LHSA 1OURA 4UW3A 4Y20A 1VBD2 4Y3OA 2F4LA 2PHDA 3PLQA 1IZ3A 5FMOL 4MGSA 1NA1C 3DCQA 4HBNA 5B2GB 5FZ1A 5D1IA 1KITA 4YW7A 5F5QA 2EAKA 5F6KA 1RUF3 4LHNA 1HJFA 1VBE3 2IXKA 4CEWB 1O91A 2KA3A 4XFHA 1XNTA 2ZGTA 4OHWA 1TG7A 1BHGA 1KS4A 4RGKA 3T2OA 2DCJA 3ZFEA 5C4WC 5JXHA 2R7EB 1OQDA 5JXIA 1D4M1 2XPJA 1XYPA 5BNOA 1NUKA 1Y43B 3C3VA 4LBLA 3WHTA 3B9IA 4IEQA 1IPKA 1HV0A 2XLFA 4M4PA 4Y33A 4YVWC 3UETA 5BNNA 1LEDA 3HT2A 4NRQA 3B94A 1MZ5A 4D69A 1V6OA 5T5PA 5I8SA 2EIEA 2ORXA 4JX0A 1RUE3 1W6PA 4LO6B 4FPGA 1VMFA 2E33A 4D6QA 4COYA 3BN6A 4GMP1 5LEJA 1RVF3 3GZTB 2PAEA 1JZ5A 5JZGA 2HWE3 1VBA1 4AW7A 3T0BA 4OI0A 1VMJA 2QNKA 2XLGA 4AFDA 2IXCA 4IW3A 4CUAA 3BODA 2VVDA 2OUJA 3T09A 1C1LA 3UK9A 3JXSA 1RUG3 1DQ0A 3AC0A 5FOJB 3VD9A 2WS92 4ZU4A 1YQ5A 3FX3A 5FAXA 1YQ6A 5FYSA 1PGL1 4LKEA 4NIGA 3ROUA 1MS5A 3ACGA 3H42B 5H9QA 3AFGA 2DCTA 2VNRA 3LEMA 3PVEA 4IE4A 3FLPA 4HZFA 1QMJA 4PIXA 4ARYA 4GJYA 1HB3A 5FPXA 2IXIA 1IGOA 4UW5A 3URFA 1RUNA 3MIEA 4GD4A 3PVOA 4JHTA 1CAXA 1NY71 4I2OA 2DBNA 3IN9A 2V4VA 3AL5A 2YC4A 2Q4SA 2YFZA 3BGAA 3H9AA 4XJWA 4PQQA 3N9OA 1QJU1 3RPQA 3WOGA 2MEV2 1D2SA 3EXUA 5CU1A 3VBRC 1O5UA 4XUNA 5A6ZA 2XHNA 2C9KA 4KWLA 1ENRA 3RZMA 4JKLA 4JZRA 2OZ6A 4QB1A 4BM8A 1QOTA 3I54A 4Z1VA 2B39A 1OLMA 5FFOC 5FUPA 1WCSA 1IHMA 3K77A 1B35B 2AACA 3VD5A 1UX7A 1W28A 2WFF2 4E4SA 1RYYA 1STMA 1DGWX 2Z2SB 1UNBA 5H9SA 3EMRA 4BE3A 1NE4A 3BU7A 1W90A 4OI4A 1H8TA 3CBNA 1LOEA 3R4SA 4I0BA 4O65A 4NHMA 4BLJA 4XBLA 3TN92 1LHUA 4N43C 5IVVA 2JECA 1YC61 2Y6GA 5L7OA 3FWEA 2IFWA 1WMDA 1G9CA 2J42A 2FZ1A 3CO2A 1FAYA 5KXCA 4H7LA 2FMDA 4Q4Y3 5F32A 4W4ZA 2W3JA 1PMHX 2D6KA 1JOJA 4WV8A 3BPSA 1I5PA 2WQ8A 4ZXEA 3E97A 2QQNA 4QWNA 3M4FA 4A7ZA 1COV2 1HDKA 4GKYA 1JZ3A 2NN8A 4XJZA 4IV3C 5JUVA 1KGYA 3VKMA 2R49A 5FY4A 3NKGA 4I01A 3WLUA 3ZM8A 4EWEA 1S0BA 1RUOA 3PIGA 3ZMOA 1YQCA 4Q4W3 4E4HA 4YG6A 2K2SA 4K1ZA 3OPWA 5F2WA 4AQ6A 4QXKA 4XC9A 4M3CF 3WHUA 1FPN3 2FQPA 5IK5A 3H8RA 1RMU3 4HETA 4CCDA 3RFRA 2VOVA 4UFMA 3KCCA 3VKFC 4NO4A 3BIWE 4QB2A 1JTZX 2XJTA 3ZIWA 4QPIC 4ZU5A 2X09A 5HCFA 2A75A 3ZYGA 4AI2A 4GB31 2E7TA 4WM7C 4ASKA 3VGIA 5IFPA 5LWBA 1VBB2 1RUH1 3AP4A 1GR3A 4HVOA 5C9AC 1QQP3 3ST7A 2XJPA 2Y26A 4NPRA 1CAVB 1ENSA 4MGQA 3N7KA 4WM8A 5FY7A 1RUC3 1ENXA 2VQAA 4MO3M 1VB4A 1BCXA 1HXS1 3DPRB 2WNUA 3WQBA 3CDZB 3FE5A 1XJAA 4UYBA 4RQPC 1VP6A 1FX5A 3AZYA 2E9QA 2W94A 2HYKA 1Y3TA 1X33A 3ALQA 1LHVA 1UD1A 4QKNA 4YG0A 5DDJ1 1WLDA 5GZFA 4AEJA 4PLNA 4NJ4A 3KGLA 1ST8A 1DBNA 3BUCA 3MFCA 1W6NA 3KWVA 1UO9A 5IUQA 3U37A 4FO9A 4XURA 2OVUA 4FTBA 2NMNA 3USUA 3K4AA 3H50A 5LATA 5J48A 3GDBA 5CFCA 4W6WA 4GXLA 2ARCA 4Y1XA 3IMMA 2YU2A 1K5MC 1PM4A 5KXDA 3VBUA 3TN91 1YLLA 5LRRA 1ALYA 4D6RA 4EN9B 2WDBA 2WYFA 3E5XA 2AUYA 2RS51 2X53S 1OLRA 3VKOA 3AK0A 2O8QA 3SMHA 3ZYJB 3DL3A 4XMIA 5L19A 3WF0A 3ACIA 4S2GA 2WZ8A 2DCYA 5T5LA 4QX5A 5C33A 4QDSA 4XHXA 2Y6LA 1DGLA 1LOFC 4LULA 2HBUA 3WNMA 3VDAA 1G7YA 4NAOA 2WYSA 4DRRA 1QWRA 2DFCA 4PHZA 5BXXA 3KLSA 4G4FA 2EICA 4PBOA 1UIKA 3NNFA 1EV11 4I02A 4HXCA 4MHUA 4EYUA 2F6BA 4QX3A 5CB7A 3ME2A 3OG2A 1PO13 2O14A 4XJ9A 1R081 1GZWA 3F2ZA 4Q4X2 2BERA 1M06G 3U4XA 2VQTA 5FZEA 5C4WA 1BBT1 1F2NA 2BWAA 1N1YA 4Z2WA 4EWDA 2ET7A 3HNYM 2W08A 3UV9A 3WV6A 1ASJ1 1O3TA 3AB0A 2LS6A 3PUSA 1N1SA 2GNMA 2Q5TA 2QQIA 5FPZA 4BMEA 5BNPC 4CCOA 4UT5A 1FOD3 4QX2A 1LOAA 2OUHA 2VJXA 4RN5A 4UW4A 3ZSJA 2RE9A 3WNKA 4V1PA 3HD8B 1CESA 2XQXA 3S6PA 2IXLA 2ZGUA 4NN0A 3PHMA 4XFAA 5DZGA 1LEMA 1H1AA 2WO2A 4LQRA 1X36A 3JD71 2VE1A 2R073 4GH4C 4RD7A 5CZKA 3ZLIA 1JYXA 1GLHA 1V6JA 5JIAA 2D7FA 2WC2A 3MBWA 1IS3A 1N1TA 3BPZA 3CEWA 5BNOB 1JHNA 5JZGC 4HLTA 5ABJB 4I09A 1NCQA 2XB6C 5J98B 2RS32 1H2MA 2IVIB 4QPGC 1PZ7A 2LW8A 1OUXA 4LR4A 1EUTA 3DPRC 3OBAA 3GGLA 3KVBA 1AX2A 1ZZ8A 3ACHA 3OGVA 3ZXKA 3FZ3A 3KT1A 4ZKTB 3WG3A 3PVNA 1PGSA 3UKVA 5K9YA 1RUE1 2FDJA 4MV2A 5F3IA 2W0XA 4LO7A 5LBEA 5C9AB 1HV1A 1RITA 2QQOA 4RS5A 2H6BA 3AYDA 4OULA 2CSGA 2JIGA 3DYMA 4BHPA 2XKOA 4WM7B 2QQMA 4IGOA 4UFIA 4E8DA 1PHMA 4F7ZA 3VKLA 1G9FA 1BQPA 1QOSA 4H7MA 3AXDA 3VZKA 5CNAA 5T54A 4FAHA 1IQDC 2E6VA 2FD8A 4KH9A 4IV1B 2VGDA 1W6QA 1UOFA 1Z7S2 2I07B 1VB2A 1POV3 5EFUA 1R1ZA 2A73B 3HJRA 3OPZA 3VL8A 2VQ0A 1AR72 3ZDVA 1IG0A 3I59B 4CDXA 4JC1A 1REDA 2R0HA 3MV11 5CG9A 3BTYA 3AP6A 5J96B 4FPEA 1B35A 2ZCWA 3QH7A 4Y4YA 4CP1A 3RZGA 2Y6JA 1U5IA 2RVAA 4AGGA 2HLEA 1D7PM 1J83A 2E53A 1VLNA 3I3EA 3PNAA 3CJIA 5JOZA 2DWRA 1H8TC 2Q30A 4URTA 4LMFA 4E2GA 1YFXA 1O3RA 2OS2A 1E57A 3BYWA 1FNYA 2A3YA 1JYIA 1ZX5A 3O1UA 4AVCA 3ES1A 3DKWA 2WZPP 1DQ1A 2ARBA 5A7NA 3S0MA 1J1TA 5KR7A 4HT1T 5A7QA 1GQPA 4AL9A 4AE2A 1Z78A 1AX0A 2VUCA 1DZQA 3ETPA 4ZS2A 3TNQA 3ZR6A 5JOYA 2AEZA 1J3RA 1R082 4B7EA 3MYXA 2A71A 5DAVA 1VE0A 1SBDA 3IT8A 1XNCA 2ZKNA 3ZDSA 4CDQB 5EP9A 3B02A 4IV3A 2VVEA 4J1XA 4YGBA 3SH4A 5KHIA 1QXPA 1CWPA 5IYYA 3LA3A 4INDA 2ZEWA 1LU2A 5GM0A 2JG8A 4M00A 2XJRA 2RM23 3M3QA 2NPIA 2VMIA 4GJZA 4XACA 1VRBA 5A7PA 3VZNA 4BIOA 4EN6B 4NIHA 3WQ7A 2NYYA 3M3OA 1B09A 2Y60A 3IMNA 3W59A 3NVCA 1OT5A 3RI9A 2DTYA 2DUOA 3U07A 2VNOA 3SH5A 3IWZA 4FTEA 3J26N 1W6MB 3K75B 3CLPA 1GNYA 5GZGA 1VBC2 4RYDA 5FMDA 4B7KA 3ZFFB 1UZYA 2J1RA 2P4EA 4LLOA 4M0HA 1JZ2A 3PUQA 3OYWB 3D6EA 1RVF1 2JDMA 3M3IA 3LPFA 3R05A 4LBMA 5FO7B 5BNNB 1LKNA 2WZR3 1ZBE2 3GJBA 4XQ4A 1CIWA 2QZ2A 2DCZA 2OXBA 4I3GA 1GP4A 1WCDJ 1AYM3 1W6OB 4ET7A 4RR3A 4IDZA 3ABZA 2P34A 5E89A 1YIPA 1SFYA 1R092 2BDRA 4RQPA 4ZU7A 1DGRA 1WBFA 1UY1A 4YZ5A 5FZ3A 3AMMA 2JX9A 3NAPB 5KXBA 1RUH3 5FZHA 1I6XA 4DZGA 2AENA 4AQSA 4BA6A 4DEQA 5BPXA 2VZQA 5D8AC 5FZAA 1N1VA 4CXWA 4FFGA 1TE1B 3D8CA 4YVWB 1VAKA 2ZHNA 1H9PA 1MS4A 4FQ4A 3JB8A 4HKWA 1UMZA 1UAIA 2BNNA 5E8AA 1RUJ2 1NQDA 3KCYA 3DV8A 5AC92 3T08A 1C8M2 2VZSA 4PIYA 1POV0 3USSA 4L92A 4AQTA 1DQ6A 1E5RA 3ZR5A 2W47A 1VAMA 4UFKA 3BI3A 1PGW2 1YFUA 3NRUA 5C3OA 2JE8A 1ZZCA 4MZUA 5D21A 5KC5A 2VD7A 5CADA 3OB8A 4AYUA 5LZ6A 1NZIA 1O8SA 1NA1B 2NLRA 4FSJA 3Q8FA 2VPVA 2WQZC 4QPWA 3VBOA 1ZRFA 3H3ZA 1PX4A 3VBOB 2QBXA 1CVNA 1HW5A 1UL9A 1CJPA 2ZKLA 4JV4A 1AXZA 1AYN3 3E5UA 3HBZA 4AEKA 2GC0A 4M3CE 5LA2A 2BOJA 1ZVFA 1DIWA 4RR3B 2CNAA 4Q4Y1 4COUA 3RZLA 2ZOEB 1A78A 1XSRA 3RZJA 3OSDA 1ZRIA 1OOPA 1RB8G 4GWNA 4ATEA 3SCHA 4UFJA 1XBFA 2A1XA 3I59A 4XZUG 1GU3A 3WG1A 4AF9A 1GSLA 3ZYBA 2ZGKA 1YEWA 2GSYA 1HIXA 5JMCA 4A6OA 4LNVA 1Y9GA 2YBPA 5LBCA 3GNEA 5IT6A 2SLIA 5FZBA 5AVAA 1WD4A 3HPNA 1ULPA 4YVSA 4ARXA 4Q4W1 2CAUA 5JR2A 3USUB 4NIAA 3F95A 5DUXA 5FUNA 4ZONA 1U12A 3KMHA 4LBQB 4CVUA 1UWWA 2IZWA 2WLPA 1GP5A 4WVMB 1EV13 2VW2A 3WNNA 1SMVA 2ZACA 5CFDC 1A3KA 3H7YA 2WFF1 3AKRA 3PJQA 4NOTA 4DOUA 2WZEA 4KWKA 1BBT3 3WQ1A 5JVVA 2W9XA 2O8OA 1AR63 3MDPA 4FOYA 3WDXA 4WZFA 5JSOA 1UOGA 4GZ9A 4DNYA 2HWC3 3NV2A 4LKDA 4QPGA 3RG0A 3HQRA 1OQ1A 4BYYA 2JG9C 4A3ZA 1AZDA 5A7WB 3O0VA 4QPYA 3I2FA 1M4WA 2VH9A 3SKVA 1LTEA 5ABJA 3S7EA 2P5BA 2R6QA 1UF2C 5ACA3 1CAVA 1HRV2 3EYPA 3BOPA 1SHWB 1YJKA 3U1XA 2I2SA 1BXHA 1NLQA 4K40A 5K7PA 4PI2A 3W5MA 1H1IA 1GP6A 1Q8OA 4F8AA 4JKKA 2JEMA 1VBA2 1Y9MA 4QDRA 2D6LX 2CL2A 4XFBA 1S0FA 3MGUA 3R4DB 3I2IA 4N53C 3ZOIA 5ISLA 1HKDA 2LUWA 3KHBA 3FUQA 4ZHNA 2BBAA 1LRHA 1MZ6A 4Z92B 1SLCA 2D6NA 2RJKA 1HN0A 4MOAA 4PBPA 5A33A 5FLJA 4U36A 1CPMA 1PGW1 3ZX7A 5C7GA 5JWPA 1A8DA 1CAWB 3KD4A 1RUI1 5FXWA 3KF5A 2JDHA 3ZYIB 1O5LA 4IE6A 5IJRA 1JUHA 5JAXA 2IC1A 4QGNA 4B4PA 4DPNA 5A3LA 5HV0A 3LIGA 1KFUL 2DV9A 1U0AA 2VCAA 1CJDA 2RS53 4YM1A 1ULOA 4YZ4A 4AG4A 3U78A 1PK6C 3ZYPA 4Q4V3 2FZ2A 1RJ8A 2B42B 2MEV1 1R1A3 4GA9A 3PIJA 1X50A 4YM0A 3AM2A 3FFQA 4AK3A 2XVKA 4XJAA 3M7AA 5LY2A 4RS5B 3WW2A 5G04L 4EQVA 5FY1A 4CZSA 1YI7A 1VBD1 3CNAA 3OEAA 4D7TA 4XUOA 1X82A 5FMOS 2OIIA 3CJXA 3H1MA 4HL0A 2V4AA 4LJHA 3PU8A 2YG0A 1D0GA 1AVBA 1TME3 3JBG3 4QB6A 4TYSA 4Y1UA 3MHZA 5FQ0B 2NQYA 3PURA 2W1SA 3OOXA 3QACA 3O1SA 2D93A 4QX7A 3JB4C 5DDJ2 4QXHA 4E4DX 1LOCA 2YBKA 1NCQB 1YNAA 1MS0A 1S0EA 2VTFA 3B00A 5JXJA 4HONA 5FOBB 3U0ZA 1PO11 1ULDA 1WMFA 3ILNA 3VDCA 5HCAA 3GBFA 4LBJA 4E8CA 5FQ0A 2W5FA 4K7JA 3VBSC 1AL23 3W21A 1D4M2 4CYDA 4JGYB 4X6QB 1QU0A 4IV1A 3LEKA 1GOHA 3K51A 1RJ7A 2JDUA 2XR4A 4H14A 4L0PA 4A7KA 3V0BA 1O3QA 1W05A 4ASMB 2X10A 4E2SA 3ES4A 2GMPA 4Y1YA 1UIJA 4XFCA 1KD7A 1Q3EA 2D6PA 2ZGRA 1V6KA 4Q26A 2VZ1A 5F39A 1EAH2 1AR83 3P5BA 4FP3A 4W8JA 3N7LA 3T2PA 1XE0A 3NL1A 1YWKA 3JD73 1G8WA 5FZ9A 1KS5A 4NRPA 3WCRA 2BNMA 1CR7A 3AXEA 2VMCA 4UWDA 1EUUA 5FXVA 1V9U2 1ZNPA 1C57A 2ERFA 4JGZB 4WM8B 1N47A 3BTXA 4YGEA 1XXNA 3V0AB 2I74A 4LUKA 3P1IA 3I7DA 3ZFGB 2B9VA 5DAPA 5AC91 4XTPA 2E51A 2E7QA 1I3HA 2L9LA 2WIIB 5FP7A 4BQ4A 4E9KA 5CKNA 2NP0A 1O59A 5FYYA 3UJQA 3FN9A 1BKZA 4P9YA 4YARA 2CY6A 2VOKA 3LE0A 5FZDA 4CEYC 3HVDA 2WNEA 3S30A 4BMBA 5H9RA 1ND3C 2Z4FA 3VD3A 3VDBA 3HOBA 4KBZA 1W2OA 2C9AA 4WVZA 1NY72 3MPBA 2IXHA 3VBHC 1W0PA 3U10A 1V6IA 5FZMA 5FY9A 1GQHA 1AYM1 4N7UA 4WVWA 1TMF2 2QQVA 2YGMA 4H55A 3VBUB 5TSWA 1F4HA 2PHFA 4B1MA 4CU8A 1ASJ2 4K20A 1XNKA 2ZMNA 1MS9A 2WWUA 3L9JT 1BMV2 4XAEA 4P9JA 1NLRA 2QDNA 3T0DA 4LBOA 3LOBA 5JI9A 3VBFA 1K3IA 2C0ZA 2C5DA 3A0NA 5C71A 3AVRA 1AX1A 4I0WB 4O9GA 2VMDA 3V56A 5EYYA 5FLHA 4SLIA 4N7IA 4JDOA 5FCCA 5AFEA 3RQ0A 1ZZ7A 2HWE1 2MNGA 4A44A 3Q8AA 5C70A 5F3GA 2ZTNA 1ULGA 1WCQA 5KHHA 1GZCA 3FFZA 3UGFA 2Q8EA 3MIBA 2CU5A 5T52A 4P9IA 3MLJA 3TYJA 1OBNA 1LCLA 5LA1A 1WD3A 1XYNA 2WWSA 3J7LA 1SLTA 4CDUB 1WW4A 5FZ8A 1NCRC 1ZBA1 4UW6A 2DURA 4R9BA 1DYOA 1SZBA 2GZWA 2PQQA 3MIFA 1UZVA 4XJ8A 3VL9A 2K0GA 2YHJA 2VMHA 4L99A 3C7GA 1ZM1A 2YMZA 2G9ZA 1ZA4A 3DUIA 2B4KA 4BLIA 3DF0A 2YUEA 4YWAA 1Z0HA 4R9DA 3UYJA 4Q8KA 5A3NA 5C5TA 2AYHA 1CAWA 1NE6A 4W6YA 3WF2A 3A7QA 1V6LA 2NZ9A 1JUIA 5FYZA 3ZO0B 3ZVXA 5CISA 3LA7A 3MIDA 4YRDA 1LHNA 2NM1A 3B69A 2Q8DA 4FCAA 4D6SA 3GBWA 1RHI3 3MPPG 4HFSA 5A1FA 2R042 1Y9QA 3JQWA 2X29A 3RNSA 1QJU3 2RM21 3DEMA 3SNMA 1UQXA 2J1SA 3HAGA 1PO23 1WZXA 3CZUA 1UU5A 4KNCA 4JDMA 4QM8A 3H8XA 2C4XA 4S2HA 4LHLA 4P02B 1Q8QA 2WNVC 2D43A 4XAAA 1V9U1 5C3QA 3VDDB 4ZZ5A 3O1OA 1QKQA 1BLZA 3UESA 2WT1A 4O9EA 4Q4X1 2FDHA 3RJRA 3GHNA 4ISRA 4AWDA 1VBB1 4UXAA 3OBTA 3B7MA 3KGZA 3P3NA 1W9TA 1PIV2 4MX3A 4AHWA 1H0BA 4FP2A 2W1WA 2WNUB 2Y33A 4JTNA 5BYNA 4YGCA 1OA3A 4NPMA 3ZFEC 1UPSA 4BQ5A 1AHSA 2J1TA 1OD3A 5FYHA 2XVLA 1MPXA 5IVYA 4COWA 2GH2A 3POEA 5IW0A 3LD8A 1C3HA 2X8KA 2CGOA 1SCSA 3GALA 4MGYE 1RUD2 2FDIA 3JZVA 3O1MA 1F8VA 3N9MA 2H0VA 1QJY3 3VBRA 4MGZE 4JGYA 5F37A 1LENA 1SG3A 2KD7A 1G9BA 3LPGA 2A6YA 1AJKA 2RR13 1V0AA 2RS31 4LITA 4OUMA 5IVCA 4CXYA 1UZWA 2WAAA 2GNDA 3CKHA 3WDVA 1LESA 4OMDA 1G9AA 4MGTA 5JLVA 2XQRA 2ZGMA 2GALA 2HBTA 2W1QA 2EXJA 4QQOA 4YFWA 2CGNA 2XDVA 5A7SA 1QHDA 1TVGA 1ULCA 2R063 3HBKA 3BKZA 1N3PA 2DTWA 2HWF3 1H9WA 3O12A 5LK5A 4NRMA 3FHAA 1ODMA 2JDNA 2A6VA 4CEWA 3MUZ1 4CPBD 1W2AX 3NNLA 4B1LA 2UY8A 2RHPA 2XJVA 4M3CB 5KWRA 5JDBA 4CUCA 1UYYA 4BQXA 5L7OC 1CAUB 1OSGA 1K5JA 1DQ5A 1V70A 4GB33 4AXOA 4AR2A 2GU9A 4JTOA 3ZSLA 2PHWA 3MIGA 4FOWA 4CP0A 1F5JA 2GH8A 4CU9A 4MGIE 1JODA 1Q8SA 2LTNA 2RMU3 2KXLA 1O7FA 1QQP1 3MV01 5CIRA 2G9FA 5KBFA 1FMD2 4XDOA 3B3QE 2Q8CA 2DVAA 1DF0A 2BOIA 2OX0A 3D3AA 2UYAA 2HWB2 2WLQA 4UFLA 3CF6E 1AYN1 1EAH1 2WT0A 5EYXA 1QIQA 5A32A 2E32A 4F3JA 3I2HA 4UFHA 1MEC2 2B8MA 4W50A 1JU3A 3T1LA 4YW4A 4CRQA 3AYCA 3J8F2 5F6LB 3EJKA 2YB7A 3IIIA 1H4HA 1JW6A 2AC1A 2DUPA 1AR91 4XCBA 3WP3A 2HWD3 2XG3A 1UZZA 2DUQA 1SFPA 5IWFA 3NW4A 4W6XA 4IE7A 1JS9A 2BVBA 3WR0A 3DN7A 1FI2A 3T4HB 3E6CC 1QXJA 1VBD3 2A6WA 1Q43A 2Q0AA 1X8MA 4JHZA 4WM7A 5HPOA 2VO5A 4NVPA 3TOJA 5FIXA 4HKLA 1H30A 4XOGA 1Y4WA 1OFNA 2ILMA 5DPNA 4EJRA 3MW2A 4EE2A 3OJBA 5CA6A 1VBE2 2KR2A 3FUOA 1UU4A 3RS6A 1DP0A 2WNUC 2JDYA 4C91A 4DUXA 1AL21 2AR6A 3A22A 5AVPA 3QOPA 1DG6A 2HH9A 1OA2A 1X8EA 5L36A 2ARXA 4PLMA 4TLFA 1LULA 4QX1A 5EJ3A 4DIQA 2VCCA 3H8OA 1PVC2 3VDDC 3WNLA 2VMGA 1HRI3 3ELNA 3JQXA 3KHCA 1CX1A 4HANA 1PMIA 3WQ0A 1MZEA 4NWVA 4Z07A 2R30A 4PF5A 5CKMA 2Y8KA 2ZHLA 4MUVA 4XFFA 1SLBA 2FCVA 2AREA 4R9AA 3RYRA 2O1QA 1TQ5A 4C1WA 2OT7A 2BRTA 1RVF2 4FPCA 4XXPA 5A3UA 1EP0A 2GDFA 2JICA 3ZIXA 2DU1A 2HWE2 4XPVA 3K3OA 1VIWB 3R6SA 4AI3A 3IAPA 2OQ6A 2ZGOA 3GZEA 5L73A 2WL1A 3VBHA 3VN4A 5DG2A 5FDBA 1JZ8A 4ITCA 4LBNA 5IATA 1H8VA 5EHDA 2WA3A 2XBO3 4YSFA 2C24A 1OC1A 1S2BA 2W1UA 1YYNA 3JCIA 3Q8CA 4O61A 1J3PA 4OHZA 1QJFA 4D94A 5B4XA 1XNAA 2EA7A 3IKWA 2CDOA 2K9ZA 5M0TA 3WW1A 4RHV3 3K48A 2VCBA 3N36A 1NCRB 1RUI3 3MICA 1RUC1 3POWA 2UY9A 3T2QA 4CDUC 4KU8A 3RZKA 2PMWB 2DF7A 2WWJA 3BU0A 1FMD1 3IZOA 3BOWA 5FZ0A 4XUQA 1REEA 2UWAA 2EAAA 1UYZA 2HWB1 1W8FA 2B7YA 4ZXKA 4TWTA 2MEV3 1FATA 4M3CA 4XJUA 2ZS6B 4AQ2A 3SEEA 2VY0A 5F3EA 3UKTA 4OLLA 1C8NA 1OLME 1E5IA 5K0UC 1F5FA 3IPVA 1UN1A 2JDPA 1TZOA 5FUIA 4PDWC 1V6MA 5GLTA 1XPWA 3T1MA 5KHKA 4CCMA 2BW8A 2BGOA 4MG2A 1BEV3 1XE8A 4DQAA 1U5ZA 4HN0A 4JCKA 1AL0G 4AGRA 4DS0A 3FLTA 3JUUA 3TEWA 4TLGA 3TBDA 3K4DA 3MI8A 2EF6A 1AUYA 3VBUC 4LPLA 4IGPA 4KG8A 3RWKX 5C3SA 2A5ZA 3LA2A 5LA0A 1I9RA 3TN93 3LEIA 1LHOA 1PVXA 1W6QB 2EIGA 4OHXA 2W91A 3SXWA 1KDMA 3ATGA 4QAWA 3C7FA 2VBDA 1S55A 2G9GA 2WSVA 1LOFA 4CEYB 1QH6A 2DVBA 2QCSB 4AEDA 2D40A 4CCCA 4IETA 5I0UA 4NUBA 1HXS2 1COV3 5J1XA 5FP3A 1SDWA 1C5HA 4CUGA 3WF4A 1LGCA 5FXXA 4IEPA 1PVC1 4WM8C 2BU9A 2ZX3A 5I0RA 1G9DA 2XONA 4IGQA 2XJQA 4UI9L 1CX4A 4Q4W2 5FWEA 5I8YA 3SLIA 4AAXA 2EIDA 3RVHA 1GWMA 3ZFFA 2BQPA 2ZX2A 3IIAA 1RMU2 3LDRA 1VJ2A 1UXZA 4FBFA 1ZRDA 2RDNA 2VECA 2VZTA 1LGBA 5HXMA 3GZUC 4R4XA 1US3A 4N9IA 1D0HA 2P6CA 2DVDA 3QD6A 1JXNA 3TEXA 3M70A 4FXGB 1SLAA 2D6OX 4QX0A 2B45X 1APNA 2Y0IA 4LK7A 4JGYC 1VBB3 1F15A 2YU1A 1C1FA 3VBSB 1KEXA 4IQPA 4DB5A 5IK8A 2R071 1PM7A 2DU0A 4CE8A 1WW7A 2PFWA 2XUEA 1NCQC 2QFEA 4LO4B 5DG1A 1NZCA 3O0WA 4KL1A 1RUC2 2DDUA 1JOBA 4V2WA 4MXWB 1ODNA 2XHKA 1HRV1 4RFT0 5FP9A 5FZ7A 2RJ2A 4H2AA 3TWIA 3O0XA 5D2AA 1C8M1 2N7GA 2ZMKA 1H1MA 4TN7A 3VZMA 4D8MA 2ZJCA 4OVEA 4XDPA 5IVJA 4UBGA 3E5QA 4RS5C 4AFAA 4FPHA 2RR11 1GANA 1XC6A 3WP5A 3PUHA 4KMQA 1MVQA 3SQOA 2OPKA 1H2KA 1DLLA 1PK6B 3ZXDA 4E2QA 2D5FA 4CCJA 2VUAA 4R9CA 4V2VA 2H6CA 1IKQA 5HXVA 3H0OA 1QJX3 5A6XA 5EWSA 3BCWA 4YLZA 4JDNA 2P3YA 2VTXA 1LGNA 1BYHA 3FLRA 2UURA 3WDTA 3VBFB 1W2TA 1PZ8A 4FFHA 1KXGA 4ONUA 2VAUA 3B9CA 2Z5WA 4M0NA 3S5AA 2XH6A 1J59A 3SITA 1T2XA 2W46A 1ZBA3 3ASIA 4RGAA 4FTSA 4PF1A 2RG4A 1HB1A 4YPJA 3WZ1A 1POV1 5CEHA 4NIDA 3PL0A 3W20A 3M1HA 2VTXJ 1WCUA 2YFUA 4P9WA 2J22A 4OZOA 2VOXA 1W2UA 1QEXA 4ZS3A 4META 1GWKA 3WX5A 4KGGA 2GC2A 3ZXGA 3KT4A 3M2MA 5A3MA 5BNPA 3FL7A 4N53B 3NJVA 2V5DA 2D97A 4QQHA 4RL7A 3WDYA 3WXPA 1YFYA 2IWGB 5JI7A 3FHQA 1AXYA 1UYXA 4ISQA 4N8MA 4QU1A 4HVQA 4XHBA 1GFF2 3OD4A 4BOWA 3HNBM 1VPHA 4AVVA 2ADEA 3WSOA 4AHZA 1BMV1 2ET1A 2VZ3A 1DHKB 3ZPOA 4KWUA 1DGWA 4CDWB 3ZYHA 1NAEA 3G7DA 4BH9A 4LOTA 3E6DA 1W3XA 3Q8EA 4OI1A 4A41A 2D6MA 2JG9B 1GZ9A 4XXAA 1AR93 1J84A 5IHRA 4Q4X3 1QNYA 1HLCA 3MZHA 5GALA 2OZJA 2PHTA 5A3OA 4LK6A 2PAKA 2P6HA 1JYCA 2D5HA 4KBBA 4DFSA 1POQA 2RDQA 3KCXA 1VRH2 3T4VA 2RS12 1HX6A 4YZ3A 3ZN6B 3D4KA 1FOD2 1WLWA 2PLV2 3VDDA 2B5HA 1KRIA 1JYTA 2ID4A 3MLKA 1DYKA 4Y1VA 1GNHA 3ORJA 3DXUA 1ZYBA 5F5AA 5D8AA 5FZOA 4NIIA 1QDOA 4OUEA 3RYPA 4L8QA 2R072 1KFXL 3LF7A 3CMGA 3GYDA 1UPIA 3PMEA 4IEYA 3KB5A 4BK5A 2EIBA 2JB8A 5JSPA 3IB3A 3WT3A 1LOGA 3S5QA 4AHYA 1MS1A 2RS33 1QNWA 1QGLA 4DUWA 5FYUA 4EN7B 3AZWA 1PX3A 5ANQA 1OF4A 3PUIA 4PT6A 3AKTA 3ZFGA 4DEVA 5CKQA 4UF0B 4CDXC 2R041 2W52A 2YXSA 4A7YA 3AKSA 5JSRA 4JGZA 4FI9A 5T5OA 4W65A 2WZR1 4RR3C 2VOWA 3LIHA 4Y5Z0 4OQ8A 5I93A 2HWF1 2WT2A 4LT5A 4C8DA 4LTAA 4LLFA 4LORA 1YI9A 4CDUA 2BGCA 3VBOC 1JN2P 2QZ3A 4YG3A 2P3JA 4X8NA 2ORZA 1IPJA 3AZZA 4QQPA 3THCA 2PN5A 3EQEA 3ZXJA 5C3RA 2QE3A 5FZ4A 4BWOA 1BZWA 1RUF2 1W8OA 3J7HA 4TSVA 3U14A 5E6HA 1US2A 2RMU1 1CIYA 2DFBA 2HWC1 2WO3A 3HQUA 3H1YA 4FVVA 4HMZA 2C6SA 1OH3A 2QTWB 4RSUA 5DUVA 2CDPA 2VXJA 2ZZJA 4YW3A 3NQHA 4LIVA 4RHV1 5T5JA 1CGPA 3H3LA 2XWJB 3HWJA 5C8CB 4QU2A 2WO1A 2ZABA 5FP8A 5L9BA 1MZFA 4BPZA 5DAQA 1JZ6A 4XF4A 2JB4A 4HKOA 2P3KA 2WN3A 3CIHA 5J37A 1WW5A 2VL4A 1W6NB 1WUVA 2JG8C 3SISA 5D8AB 2CV6A 4FPYA 4KG0A 5FZOB 3KM5A 4Y22A 2MPFA 2W92A 1RUE2 2A3XA 3P3PA 4HVRA 5FREA 4IEWA 3NAPC 3FJSA 1DLCA 5IK7A 2ZEYA 3K2OA 3L2YA 5HV4A 5FPVA 1QXRA 2Z79A 1OKQA 1UMIA 2WNOA 4LBKA 3VLBB 2V73A 1WMXA 1ULEA 5JOXA 5JPMB 1RUG2 4I0AA 2W87A 2WS93 4BDVB 2BYVE 3I2JA 3V0AA 2YPJA 2RS11 5BNNC 4JQTA 3LDBA 3NJXA 2J1UA 3O5SA 2ENRA 5HCBA 2JWPA 2RM22 4IE0A 5GLWA 2XVGA 2I45A 4ZZ8A 1HQLA 4ZPIA 2Y6KA 2GMMA 2EXIA 3N9LA 4LO5B 4WVMA 3ZFFC 4R52A 3LCPA 1CN1A 3POGA 3MF9A 3OGRA 5C3PA 3UNPA 2PHRA 4BQ2A 4AFMA 1NT0A 4K9SA 3O1RA 4K3UA 1JBCA 2XJUA 4AVTA 1IS5A 3PUAA 3POYA 4XYXA 3RYKA 3V0BB 1RUJ1 1RIRA 5FYIA 2OQ7A 2AH2A 4IL7A 1OVSA 3J8F1 5A3PA 1W6OA 4ZY9A 3WUCA 2BV4A 4M4RA 3KV4A 3O14A 4QD2A 1SPPB 1W8UA 1WMEA 3AKPA 4GQ7A 2WFF3 4AGVA 1JYVA 2PQSA 4CDQC 1AYM2 4K8RB 3IBMA 3J4UH 5APAA 2FCTA 5AFBA 2JXAA 4AHXA 1RUD1 4GWMA 1R093 2ETEA 1LAJA 3B01A 4BZ4A 3I2OA 1V00A 3OY8A 1GYKA 2Z42A 4P14A 4YW2A 1VR3A 1W8TA 4LA2A 4D7SA 5F5CA 3H3UA 4BQ3A 2YZ4A 3RGBA 2CAVA 2E31A 2PYTA 3BIEA 1SBFA 3HR9A 5IVBA 4Q4Y2 5A70A 3K3NA 4DINB 4AOCA 1A6CA 4Z2AA 4FPKA 1HB4A 1H6XA 2RJLA 4G3YC 4Y20B 5A7OA 1H8TB 2JG8B 2Z69A 3Q8BA 3ACFA 5IAXA 2VU9A 1OUSA 5E88A 2R16A 3NJZA 5CG8A 3CL1A 1VBC1 5FP4A 1R64A 1UCXA 1W04A 3O7OA 1JZ4A 1WLTA 5AC93 5C8CC 1C8M3 1LNSA 1MVEA 5LA9A 3WF3A 1JMUB 1XQNA 1GMMA 1NX9A 1W9SA 2Q1MA 4KQ7A 1VAVA 2JDZA 2NMOA 5HI0A 2PXJA 5A33B 2F4PA 4IV1C 1GBGA 1FPN2 4YZ1A 5FO9B 3A23A 4QQ2A 3VZJA 5JCTA 2VW1A 3DXTA 1K12A 1NYWA 2G4IA 2OPWA 5FKCA 3I8TA 3KV9A 4QDQA 4Q5OA 3S57A 3FHIB 1DYPA 2FCUA 5DABA 2VVFA 4MH0E 3I4IA 1X9TA 3JU9A 1RUG1 1AYN2 3PTRB 5IVEA 4RGGA 4COZA 1XE7A 1W8WA 4MXVA 4CPBA 1HQNA 3POBA 3AKQA 1F35A 1QQP2 5CFDA 5F9TA 3WG2A 3LOIA 4IEOA 4BXFA 2AGSA 4YM3A 3ZSKA 4CDXB 3NMBA 4LXLA 5GLUA 1JOPA 2YV8A 2QQPA 1COV1 4MXWA 4NPLA 3NKTA 2OKXA 5FY5A 1H6YA 4QPGB 3OF1A 3ZKUA 5LW9A 5LBFA 4BQWA 2VQUA 2WN2A 3AZVA 3LFMA 1DZTA 5ABJC 5BNOC 1UY3A 5JZGB 4A45A 3NSTA 3HT1A 3RJ2X 4CEYA 4H3WA 3TB0A 4CCEA 1D2QA 1T6BX 1FV3A 3EHKA 4GH4B 3I97A 2VUDA 4QKBA 1W6PB 4EZ4A 3WEZA 4HOOA 5CYYA 4FOQA 3T3YA 2ZAAA 1Q56A 2R0FA 3RMYA 4YNIA 2JDKA 1EV12 4CU6A 4Y24A 4NR1A 3NWKA 3P6BA 3OUHA 1FYUA 4HG6B 4XUPA 4B8EA 5A1LA 5BNPB 3FMGA 1XRUA 2P3IA 5LCWL 5DXDA 1AR81 2G1MA 3S7IA 5F7UA 1F9KA 2GAUA 2HWC2 2R1DA 1PMJX 3AL6A 5DUUA 4QHOA 1FV2A 2UWBA 1S0CA 2ARAA 5DUWA 3D0JA 4E4ZA 2CGPA 3GF6A 3HIFA 4PIZA 3C7OA 4CDWC 3WD5A 4DXRA 3U75A 1X7NA 2PAMA 4TTGA 1HRV3 4ATFA 3GM8A 2QQWA 2P2KA 2YYOA 4P5YA 1BVVA 1W03A 3GCXA 4EN0A 5GZDA 1X9PA 4DY5A 5EIYB 4Q0VA 3G6JB 4L9BA 1OQEA 1PK6A 2PHXA 1EPZA 2FMYA 2QJVA 3DGTA 1GUIA 1W0OA 1ND2A 3IDBB 4YW6A 4OFGA 2YC2A 3ACLA 4PLOA 2WSUA 3M3EA 3RRDA 3WW4A 3VB9A 1UMHA 2QUOA 1ZREA 2BFUL 5JMOA 3HN3A 1UOBA 1OKOA 1SBEA 1QJX1 2LROA 4JVAA 4DUVA 1S0JA 4K21A 4CSWA 3VKNA 1LOBA 1PO12 4DMIA 1NOVA 4P5HA 4R8HA 4LBQD 1K5MB 2KM2A 2C26A 3INAA 3J7NA 3SC7X 4EWAA 3J7MA 1UYPA 2FBEA 1WA4A 2ZEXA 2VZUA 2ZBJA 5FK7A 3VBFC 4XF3A 2C1FA 3B93A 4BQ1A 1QH7A 1MEC1 2E63A 3ITQA 4OYUA 1GOGA 1UX6A 3AX4A 1W9YA 1E5HA 2DYCA 3VBSA 3SH3A 4ES8A 4QPIA 4Q4V2 2JD9A 4FPOB 3TNPB 1WA6X 1YO8A 1QDCA 4XW3A 1IQAA 2OA2A 5FRAA 3WY6A 1RXFA 5DZFA 1WLCA 3OGJA 4O7XA 4AVAA 5C9AA 1A34A 3J9SA 4D7YA 4EZHA 1SLLA 3UGHA 1O4TA 1KDKA 1W8HA 2G19A 2VG9A 3KT7A 3RZZA 1TME2 2D98A 1TEIA 1F31A 3JBG2 3MFAA 2VW0A 4I30A 4RQPB 2WABA 3OD0A 4FFIA 2WJSA 5B4NA 4Y5SA 2ZX4A 1N3QA 5FYVA 5DDJ3 1FNZA 3H1WA 3QLQA 3MW3A 1W0NA 3CZJA 5FLIA 4BIFA 3VZOA 5FY0A 3I49A 1QOOA 2XXZA 3PTYA 5E1RA 4OMCA 1O8PA 1YHFA 2VUJA 1AL22 5GZCA 2D3PA 3EO6A 2P1BA 1ZRRA 1OVPA 1L3JA 4QPIB 4KU7A 1REFA 3AFKA 5HBAA 3AMQA 4KWJA 1GNZA 4GH4A 3VV1A 1Q8PA 1RHI1 4GMP0 3ZXLA 2ZGSA 1XYOA 1TMF1 2VM9A 3RI8A 1EAH3 1AR82 5EXOA 3SCFA 1WCKA 1Z7S3 1UW8A 4RA0A 3JD72 1YJLA 2FHRA 3HEIA 1K5MA 2WR9A 4G9SB 1AR73 4LUMA 2GN7A 1GZWB 1IS6A 4LIUA 5J7MA 1QJEA 2XUMA 3WP6A 5LK7B 2XWBB 1V9U3 3ZXAC 1JYWA 4B3NA 4XEZA 3PMSA 1KJRA 5FV3A 3W9AA 3ZXFA 3N7JA 2OW4A 4IV3B 1K45A 3SCGA 3UJOA 4HK9A 2W68A 3KV5A 4Q29A 2BFUS 4TXWA 1JI6A 4A6SA 4CCKA 4DRVA 1PNFA 4XMAA 1W9FA 4XFIA 3ZXEA 1WGPA 4CCLA 3RWNA 5FTTC 5IAVA 1BK1A 3WDUA 4CP9A 1UY4A 5GLVA 4K6BA 4S2DA 4Q8LA 2AEYA 1I1EA 5K4LA 5A1AA 3POJA 4X6RB 5I91A 4LE4A 1OD5A 1DZRA 1OPMA 1MQTA 1UY0A 2D3SA 2XOMA 1UU6A 5FYTA 4BQYA 3M8LA 3NV3A 3ZKYA 2HEWF 3WG4A 4FPLA 4J6GA 2SBAA 1GZTA 4N43B 4PQ9A 1R083 1QJY1 2GN3A 4XVHA 5H9PA 3WW3A 1H4GA 4QKFA 4F83A 1YRZA 5FXZA 4DXZA 3VHNA 3H7JA 3T30A 3THTA 1SEFA 2UU8A 3I3BA 1ASJ3 4PI0A 3I3MA 1E5SA 1R091 4MADA 2YPDA 1B35C 5DAWA 1C28A 3WNXA 5T3NA 5LBBA 1HRI1 5C8CA 2GC1A 5HCHA 4BJ0A 3ECQA 3OCPA 4GWIA 4PDWB 3T2TA 2R061 1UXXX 3KQ4B 5K0UB 4HPKA 1ZRCA 1LJ7A 3M3CA 4K1YA 4L97A 3V65A 1SQ4A 3VBRB 3ZN4A 4LHKA 2LM3A 4YM2A 4ORFA 1NKGA 4L2NA 4Y5TA 3OBRA 1YXWA 4NHLA 1S4CA 4IUGA 2JE7A 2QDRA 3OY8B 1VBC3 4MSVA 3AP7A 5EV7A 4XIKA 4FPFA 3DYPA 2XBO1 4IEVA 3I3DA 3PJYA 5L9VA 1AXKA 4P9XA 2OYZA 1SFNA 4OI2A 2F17A 4FFFA 4IERA 5FK8A 1H2LA 1L7RA 4OCTA 4HN1A 3LAGA 1CZVA 2CWSA 1ZBE3 2WZR2 1SPPA 4XQDA 2MHFA 4JRLA 5F3CA 2EALA 4FPJA 5LRSA 2W2IA 3APBA 1XNBA 3BTAA 2RV9A 4IEZA 4P08A 3NNGA 4XQWA 4AI1A 2PTMA 3NO8A 3ZN5A 1O6UA 2V72A 1DQ4A 5KHJA 1RHI2 4YW5A 2YDEA 4NHKA 5FMCA 2BJSA 5EZWA 5SV8A 4B4RA 3LZZA 4QHZA 1QJU2 4YZ2A 4HSLA 1Q5OA 3VD4A 3ZYFA 1RUH2 1PO22 2V09A 4GIQA 2HWD1 4AI9A 2VR4A 5A6QA 4MYEA 2ZGPA 3GCWA 4AEMA 3NJYA 5FBJA 4AI8A 5JXGA 3O1PA 1W8ZA 5FYBA 1BEV1 3KF3A 1MR5A 1YQ2A 1HB2A 1RC6A 2Q1FA 3ILRA 4GKXA 2IVJA 1OXCA 4WZCA 2ADDA 5EPAA 2GNTA 2DVFA 4S2FA 1V6NA 1RUJ3 1D4VB 3EB7A 4D0QA 1MACA 3D82A 1PIV3 2ZXQA 5C4WB 4J1WA 4AZZA 1ZZBA 1FXZA 4I3PA 3DPRA 4DXTA 1VRH1 3MLLA 4C0HA 5DN2A 2QVSB 2PLV1 3CHXA 1DQ2A 5L9RA 3K46A 2BNOA 2WUHA 3D0SA 4CEWC 4CDWA 5GZEA 2GC3A 5CBLA 2BGPA 3KS7A 1YQ8A 2ZHKA 3E1F1 1SDDB 3GZAA 4FQZA 1RUD3 2YBSA 2VNVA 2GNBA 4Y26A 1Q8VA 4YGDA 2E26A 3QCWA 4MGKE 2TBVA 5J09A 5FZCA 3POIA 2VZOA 5FMBA 3PU3A 1J58A 4E27A 4LKFA 2RR12 3MIHA 5DZEA 1W8NA 1S0GA 1ND2C 2D3RA 2X05A 3RDIA 3WNOA 2HYXA 1FT9A 3GHMA 4A4AA 2K46A 4XBNA 3KSCA 2A3WA 3WCSA 2WAOA 3MUY1 5EJ1B 2JENA 2QKDA 1OHFA 4CP2A 1HJGA 1JU4A 4QX8A 2Y6FA 5FZLA 4AAPA 1BK0A 2HWF2 1XSQA 4XBQA 2J1VA 3AP9A 4CXXA 1HN1A 4XABA 1OPOA 3KZ4C 5CFCB 3TAYA 1CQ9A 3LDKA 2J7MA 5DAXA 4XETA 2BP6A 3CJIC 2XMLA 4ES9A 4GB32 2EXKA 2VZPA 2CYFA 2UWCA 3THDA 4NROA 4XDQA 5IVFA 1VBE1 3AJYA 4BB3A 1EYBA 1WKYA 5EQUA 2RMU2 3W5NA 4R4ZA 5LY1A 2P17A 1CPNA 1FMD3 4WBBA 4YFZA 5L7OB 3MEPA 3AP5A 3HN1A 2DBIA 4OHVA 1BBT2 1JH5A 2HWB3 3VHPA 3LB9A 2JIJA 5DMYA 1LU1A 2BEOA 1AR62 4PDWA 4XIOA 1NXMA 3UT0A 4BXSV 3MF6A 1HQWA 1MEC3 1S2KA 3ENRA 3BALA 1SLIA 3I2DA 3EBRA 4XTMA 5JPNB 1P8JA 1CD3G 1OA4A 2P37A 2X5IB 1W06A 3Q9OA 4QMAA 5G05L 3U11A 3OGGA 4K8FA 4QGLA 3B5LB 2XJSA 3ZSEA 5ACA2 1UY2A 5J36A 3WDWA 3OUJA 4UAPA 1IKPA 4LE3A 1O3SA 2WRAA 4GMP3 1L7LA 1XU2A 2ZX0A 3D5OA 3C7EA 1VBA3 2VZVA 2XGXA 1SCRA 5SV5A 2ZHMA 4AVBA 1KQRA 2CWMA 3ZN6A 4CCNA 1N3OA 1NQJA 2DCKA 3FC0A 4Q0UA 5C6CA 2XLAA 1CAXB 1J1LA 1UKGA 2X5IA 3T0AA 1BVP1 3DYOA 2Y34A 2DVGA 4FAGA 4NE9A 5FJHA 4IESA 3ZFEB 5C5UA 1W99A 4COVA 2PA7A 1W39A 1OLQA 1O4YA 1GWLA 1RXGA 1XNDA 5ERLA 5F2SA 1T6GC 4Q1RA 3WF1A 2H0BA 2Q8OA 4Q27A 2RDSA 4OUSA 2JJ6A 1PVC3 2QQUA 4MVTA 3VZLA 5I0DA 1HRI2 1ACCA 4UOJA 2RS52 5ANNA 2WNVB 2QQLA 1NXD1 4CA9A 1LHWA 2O0OA 2A6XA 3DECA 3KV6A 3OEBA 4KGQA 3O1TA 3ILFA 1R1A2 3LEGA 5CVRA 1F4AA 4NAMA 1IG3A 1I5ZA 4AI0A 4MLOA 4B29A 2TUNA 1L7QA 1AR71 5FZKA 3GJAA 4IEUA 1EY2A 5A3TA 1MQTC 2R1BA 4JKMA 4N90A 4Q0QA 2UYBA 2BUKA 2VCMA 4JQRA 2VNGA 4Y22B 3UL2A 4EROA 2EXHA 5K0UA 4A3XA 2XL9A 3DKQA 2VMEA 2Y38A 3FBYA 2XBO2 2ZGNA 1RUF1 4GAZA 3N9QA 5F8PA 2W95A 4P9GA 4ASLA 3HQXA 2GP5A 5K8SA 3N7MA 4C90A 3RMXA 4QKDA 2HEYF 2FDFA 5FZ6A 2JD4A 4RHV2 1RINA 4XF9A 1XU1A 2PELA 1RUI2 5E16A 1D4M3 5FJKA 2BWCA 3BVCA 1GICA 1WW6A 3IDCB 5FZGA 3WVJA 1NA1A 5IK4A 2BTVC 3VHOA 5JR7B 5T50A 5FO8B 2JDAA 1DFQA 1G86A 2XKPA 4QXBA 3SEPA 1ONAA 2AZ5A 1DU3D 1AR61 1GV9A 1WWYA 4LA3A 1C5IA 1O4ZA 2R32A 4XFGA 4Z8BA 3ON7A 4XUTA 3OGSA 4AEDC 5LASA 2JKXA 3LSDA 4IEXA 4URAA 5KXEA 1YCIA 1BEV2 4EV0A 1ZZ6A 2JG9A 3QBQA 3NNMA 5ACA1 4QQLA 5JOWA 1OOPC 2ZX1A 3TEYA 4UF0A 2ZMLA 1QJZA 1FPN1 5JIUA 2B9UA 2VZRA 4NWWA 4YVWA 3MW4A 3IAQA 3K4ZA 1BJQA 2TNFA 3IDEA 3VBHB 4SBVA 2J1EA 2FDKA 3AYEA 3NNJA 4YVSC 2A7AA 2HKXA 1ND3B 4MHRA 4N53A 1NG0A 4PJYA 3N9NA 4IXLA 4RFRB 5I0TA 1S1AA 4HK8A 4YVSB 2ES3A 2HJIA 3BTZA 4EN8B 5CAZA 2YGLA 1ZBE1 4M01A 4QGMA 5IFTA 3I3QA 5F1RA 3IDAA 1TMF3 3N9PA 1HXS3 4Q2FA 5FYMA 3ZFGC 4P00B 1Z7S1 3N35A 4HSJA 5FPUA 1OOPB 3O1VA 4QM9A 5A7WA 5BV6A 4JGZC 4DO0A 3WINE 3NV1A 5KHGA 1GOFA 5FKBA 3ZMNA 2YC0A 2Y6HA 3UKNA 1ZA7A 2VMFA 4Q4V1 3WNPA 5GKAC 4Q0SA 1LECA 4XE9A 3U4SA 3C7HA 4AEDB 3VUOA 1QY4A 3OPTA 1JZ7A 1WBLA 1U5XA 3I2GA 2IFRA 4KI5M 2EVXA 1TNFA 2BBVA 1JYNA 2WO7A 3LKJA 4BCUA 2ZAHA 4HPKB 4LBQA 4LOSA 4Z82A 4C0BA 1OFSA 3RSJA
chains in the Genus database with same CATH topology
4CUGA 3KV6A 5FXXA 5A1LA 5IVVA 4IGQA 5FV3A 5FZKA 5A3WA 3PUAA 2YBPA 3KV5A 5FWEA 2YBSA 4CCKA 5A3TA 3AL6A 3RVHA 5FZBA 3DXUA 2OQ7A 4QXCA 5FYIA 5A3PA 5F5AA 5FZOA 5FZCA 4CCLA 3PU3A 5F32A 5F39A 4EYUA 3KV4A 4GAZA 4Y3OA 3N9QA 5FUNA 4DIQA 5FWJA 5K4LA 2GP5A 4GJZA 5FZFA 5FZ9A 1VRBA 5A7PA 4QWNA 5FZEA 5A80A 5FZ1A 5FYTA 5FZ6A 5FYHA 5FYUA 5FXVA 5FY4A 2YU1A 5IVYA 5ANQA 3PUSA 5IW0A 4UF0B 3LD8A 4QX8A 4CCOA 2GP3A 5FZLA 5FJKA 4AAPA 2OT7A 5FXZA 5FZGA 5F5CA 4E4HA 2XUEA 3K3OA 3OPWA 5F2WA 2OQ6A 3PUQA 3N9MA 2YPDA 5FP7A 4V2WA 5FYYA 5IVBA 5F37A 5A7WB 4QXBA 5FZ7A 5FP9A 5FPAA 3K3NA 3ZLIA 2XMLA 4C8DA 5FZDA 4LITA 5A7OA 5IVCA 4CSWA 2P5BA 5IVFA 4Y33A 4TN7A 4XDPA 4URAA 5IVJA 5FZ4A 5FP4A 5FPLA 5FPBA 4ASKA 4BISA 5FZIA 5LWBA 5LY1A 3PDQA 5E6HA 2XDVA 5A7SA 3KVBA 3KVAA 5FZMA 4D6QA 5FY9A 4UF0A 5ISLA 4CCJA 4Y4RA 4V2VA 5FY8A 2WWJA 5FZ3A 5FY7A 4LIVA 4BU2A 5F3IA 5FZ0A 2WWUA 2PXJA 5FZHA 5FP8A 5FYCA 3DXTA 4IGOA 3AVRA 5FZAA 4EZHA 3KV9A 5F3EA 3N9NA 5F3CA 5FYSA 3AVSA 5FXWA 2W2IA 5CEHA 5FZOB 4CCMA 3PTRB 5IVEA 4XDOA 2Q8CA 4GJYA 5FYVA 5F3GA 2OX0A 2Q8EA 4CCNA 4GD4A 3N9PA 4BXFA 5FYMA 3K2OA 3U78A 5FPVA 4IGPA 5FY0A 3AL5A 5FPUA 2XXZA 4LXLA 5FZ8A 5F5IA 5A7WA 4AI9A 4QU1A 4DO0A 2VD7A 3N9OA 3NJYA 5LY2A 5FBJA 5FY5A 5LW9A 5FY1A 5FJHA 5FYBA 2YU2A 3U4SA 3ZPOA 3OPTA 3PU8A 3UYJA 5A3NA 4D6RA 5IWFA 2OS2A 5FUPA 5F2SA 3LDBA 3PURA 5FYZA 4EZ4A 4HOOA 2Q8DA 4QX7A 4D6SA 4QXHA 5A7NA 3N9LA 2YBKA 5A1FA 5KR7A 4NUBA 5A7QA 4LIUA 4HONA 5FP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUG A;  3KV6 A;  5FXX A;  5A1L A;  5IVV A;  4IGQ A;  5FV3 A;  5FZK A;  5A3W A;  3PUA A;  2YBP A;  3KV5 A;  5FWE A;  2YBS A;  4CCK A;  5A3T A;  3AL6 A;  3RVH A;  5FZB A;  3DXU A;  2OQ7 A;  4QXC A;  5FYI A;  5A3P A;  5F5A A;  5FZO A;  5FZC A;  4CCL A;  3PU3 A;  5F32 A;  5F39 A;  4EYU A;  3KV4 A;  4GAZ A;  4Y3O A;  3N9Q A;  5FUN A;  4DIQ A;  5FWJ A;  5K4L A;  2GP5 A;  4GJZ A;  5FZF A;  5FZ9 A;  1VRB A;  5A7P A;  4QWN A;  5FZE A;  5A80 A;  5FZ1 A;  5FYT A;  5FZ6 A;  5FYH A;  5FYU A;  5FXV A;  5FY4 A;  2YU1 A;  5IVY A;  5ANQ A;  3PUS A;  5IW0 A;  4UF0 B;  3LD8 A;  4QX8 A;  4CCO A;  2GP3 A;  5FZL A;  5FJK A;  4AAP A;  2OT7 A;  5FXZ A;  5FZG A;  5F5C A;  4E4H A;  2XUE A;  3K3O A;  3OPW A;  5F2W A;  2OQ6 A;  3PUQ A;  3N9M A;  2YPD A;  5FP7 A;  4V2W A;  5FYY A;  5IVB A;  5F37 A;  5A7W B;  4QXB A;  5FZ7 A;  5FP9 A;  5FPA A;  3K3N A;  3ZLI A;  2XML A;  4C8D A;  5FZD A;  4LIT A;  5A7O A;  5IVC A;  4CSW A;  2P5B A;  5IVF A;  4Y33 A;  4TN7 A;  4XDP A;  4URA A;  5IVJ A;  5FZ4 A;  5FP4 A;  5FPL A;  5FPB A;  4ASK A;  4BIS A;  5FZI A;  5LWB A;  5LY1 A;  3PDQ A;  5E6H A;  2XDV A;  5A7S A;  3KVB A;  3KVA A;  5FZM A;  4D6Q A;  5FY9 A;  4UF0 A;  5ISL A;  4CCJ A;  4Y4R A;  4V2V A;  5FY8 A;  2WWJ A;  5FZ3 A;  5FY7 A;  4LIV A;  4BU2 A;  5F3I A;  5FZ0 A;  2WWU A;  2PXJ A;  5FZH A;  5FP8 A;  5FYC A;  3DXT A;  4IGO A;  3AVR A;  5FZA A;  4EZH A;  3KV9 A;  5F3E A;  3N9N A;  5F3C A;  5FYS A;  3AVS A;  5FXW A;  2W2I A;  5CEH A;  5FZO B;  4CCM A;  3PTR B;  5IVE A;  4XDO A;  2Q8C A;  4GJY A;  5FYV A;  5F3G A;  2OX0 A;  2Q8E A;  4CCN A;  4GD4 A;  3N9P A;  4BXF A;  5FYM A;  3K2O A;  3U78 A;  5FPV A;  4IGP A;  5FY0 A;  3AL5 A;  5FPU A;  2XXZ A;  4LXL A;  5FZ8 A;  5F5I A;  5A7W A;  4AI9 A;  4QU1 A;  4DO0 A;  2VD7 A;  3N9O A;  3NJY A;  5LY2 A;  5FBJ A;  5FY5 A;  5LW9 A;  5FY1 A;  5FJH A;  5FYB A;  2YU2 A;  3U4S A;  3ZPO A;  3OPT A;  3PU8 A;  3UYJ A;  5A3N A;  4D6R A;  5IWF A;  2OS2 A;  5FUP A;  5F2S A;  3LDB A;  3PUR A;  5FYZ A;  4EZ4 A;  4HOO A;  2Q8D A;  4QX7 A;  4D6S A;  4QXH A;  5A7N A;  3N9L A;  2YBK A;  5A1F A;  5KR7 A;  4NUB A;  5A7Q A;  4LIU A;  4HON A;  5FP3 A; 
#chains in the Genus database with same CATH topology
 2IXJ A;  4AVS A;  3LQC A;  2PHL A;  3PVB B;  4Q0P A;  4Y1Z A;  1PIV 1;  3V64 A;  3FBM A;  2WFP A;  4OQ9 A;  5I8T A;  4J25 A;  3R4U A;  3TEZ A;  3ZPY A;  4JAA A;  5GJ6 A;  4LO8 A;  4GUL A;  1W3V A;  5A3W A;  2ZZQ A;  2XL7 A;  1GKB A;  1TNR A;  1ULF A;  2WA4 A;  1QF3 A;  2YY1 A;  3OBZ A;  1S0I A;  1ZZ9 A;  4YW1 A;  4QXC A;  4DXS A;  2VXR A;  4C1X A;  4N43 A;  3IM0 A;  4CTE A;  5FWJ A;  1C4R A;  4PCR A;  5FZF A;  4X8P A;  1MQT B;  2R04 3;  5A80 A;  2RDR A;  4LKS A;  4XZP A;  1S0D A;  4XCA A;  1AJO A;  2J1A A;  3ETQ A;  4FXK B;  3HMY A;  2Y0O A;  3TRS B;  3LFI A;  3I2K A;  1AF9 A;  4NMI A;  4CP9 B;  2V5Y A;  1PNG A;  2A6Z A;  3NV4 A;  1YIF A;  1GQG A;  2GP3 A;  1RMU 1;  3HNM A;  4WVV A;  1XOY A;  3VHR A;  5BNQ A;  5FR3 A;  2VC9 A;  1CZT A;  1G6N A;  3AYA A;  2VOT A;  2PHU A;  1QJX 2;  1YFW A;  1LB2 A;  1OMI A;  3GBG A;  3GXU A;  1CAU A;  1VMH A;  2BVV A;  4XF1 A;  5FPA A;  1OH4 A;  2BZD A;  2VBP A;  1IOA A;  2WBK A;  4B4Q A;  1UKR A;  3POS A;  1MS8 A;  3ZYR A;  1ZBA 2;  1DDL A;  3WP4 A;  4BK4 A;  4UBH A;  2B46 X;  5A6Y A;  1URX A;  3OUI A;  4U2A A;  4XF0 A;  1A8M A;  5FPL A;  1FOD 1;  1PZ9 A;  5FPB A;  4BIS A;  5FZI A;  4TZD A;  3LSE A;  3PDQ A;  3C2U A;  4GAL A;  3BB6 A;  4Q1P A;  3THP A;  3KVA A;  5LEK A;  1YUD A;  4P9L A;  3CU7 A;  3L2H A;  2WIN B;  4L11 A;  4Y4R A;  5FY8 A;  1Y7B A;  4JRA A;  1J3Q A;  3AMH A;  3SKJ E;  1CZS A;  4BU2 A;  4GWJ A;  5T55 A;  3W58 A;  3RZH A;  3AJZ A;  1QJY 2;  4DY3 A;  2LRP A;  3C8X A;  2YRO A;  1W2N A;  3E6B A;  2WNV A;  3KQR A;  1ENQ A;  5FYC A;  3NAP A;  5GLZ A;  1R1A 1;  3ZSM A;  3A0K A;  4NHY A;  2JKB A;  4AFC A;  2FDG A;  4AFB A;  1LOD A;  3AVS A;  2WKK A;  2VBB A;  2TEP A;  4IE5 A;  1S2E A;  1CON A;  1RL3 A;  1JHJ A;  2LAL A;  2X5I C;  2IUW A;  5BUV A;  1OF3 A;  4FT8 A;  2VUL A;  5EJZ B;  5DQ0 A;  3A21 A;  2R06 2;  3LGR A;  1AR9 2;  1TME 1;  4A42 A;  3N4M A;  3JBG 1;  2ATF A;  3CQO A;  5J3U A;  4CU7 A;  3QH6 A;  4OHY A;  3IPV B;  1U5Y A;  2ZA9 A;  5BY5 A;  1VAL A;  1RGS A;  2QQJ A;  2QQK A;  2WS9 1;  2A70 A;  1IPS A;  3UGG A;  1PGL 2;  2HEV F;  5F5I A;  3A4U A;  1VRH 3;  5LB6 A;  2RS1 3;  4N9H A;  2CHH A;  1K42 A;  5CFD B;  1OI6 A;  2PLV 3;  3MO4 A;  3OYW A;  4D3W A;  3AZX A;  1IS4 A;  3AMN A;  1XB9 A;  1W6M A;  2ZGL A;  3VD7 A;  2WQ4 A;  4CUB A;  3WUD A;  1W9W A;  3AMP A;  2ZGQ A;  3CJI B;  4FOV A;  1ND3 A;  1RTV A;  1NCR A;  1SAC A;  2E7A A;  4QHB A;  4QT6 A;  5I0S A;  5KC6 A;  1LR5 A;  2W39 A;  5CFC C;  1EPW A;  1KJL A;  1UZ0 A;  2D44 A;  3SHR A;  1DGR N;  1NLS A;  3R0R A;  2GME A;  2JE9 A;  2Y64 A;  4OZX A;  5C8W A;  3POF A;  2ZEZ A;  2CTV A;  2BPA 2;  5A32 B;  4YYO A;  3J8F 3;  2Q1Z B;  5FBZ A;  3X29 B;  2ZPX A;  4A2U A;  1UOJ A;  1MS3 A;  4LEJ A;  4XIL A;  1H2N A;  4CDQ A;  3OTF A;  3LWC A;  1PO2 1;  1DCS A;  1ND2 B;  2HWD 2;  4NHX A;  3H8U A;  3N3H A;  4LHS A;  1OUR A;  4UW3 A;  4Y20 A;  1VBD 2;  4Y3O A;  2F4L A;  2PHD A;  3PLQ A;  1IZ3 A;  5FMO L;  4MGS A;  1NA1 C;  3DCQ A;  4HBN A;  5B2G B;  5FZ1 A;  5D1I A;  1KIT A;  4YW7 A;  5F5Q A;  2EAK A;  5F6K A;  1RUF 3;  4LHN A;  1HJF A;  1VBE 3;  2IXK A;  4CEW B;  1O91 A;  2KA3 A;  4XFH A;  1XNT A;  2ZGT A;  4OHW A;  1TG7 A;  1BHG A;  1KS4 A;  4RGK A;  3T2O A;  2DCJ A;  3ZFE A;  5C4W C;  5JXH A;  2R7E B;  1OQD A;  5JXI A;  1D4M 1;  2XPJ A;  1XYP A;  5BNO A;  1NUK A;  1Y43 B;  3C3V A;  4LBL A;  3WHT A;  3B9I A;  4IEQ A;  1IPK A;  1HV0 A;  2XLF A;  4M4P A;  4Y33 A;  4YVW C;  3UET A;  5BNN A;  1LED A;  3HT2 A;  4NRQ A;  3B94 A;  1MZ5 A;  4D69 A;  1V6O A;  5T5P A;  5I8S A;  2EIE A;  2ORX A;  4JX0 A;  1RUE 3;  1W6P A;  4LO6 B;  4FPG A;  1VMF A;  2E33 A;  4D6Q A;  4COY A;  3BN6 A;  4GMP 1;  5LEJ A;  1RVF 3;  3GZT B;  2PAE A;  1JZ5 A;  5JZG A;  2HWE 3;  1VBA 1;  4AW7 A;  3T0B A;  4OI0 A;  1VMJ A;  2QNK A;  2XLG A;  4AFD A;  2IXC A;  4IW3 A;  4CUA A;  3BOD A;  2VVD A;  2OUJ A;  3T09 A;  1C1L A;  3UK9 A;  3JXS A;  1RUG 3;  1DQ0 A;  3AC0 A;  5FOJ B;  3VD9 A;  2WS9 2;  4ZU4 A;  1YQ5 A;  3FX3 A;  5FAX A;  1YQ6 A;  5FYS A;  1PGL 1;  4LKE A;  4NIG A;  3ROU A;  1MS5 A;  3ACG A;  3H42 B;  5H9Q A;  3AFG A;  2DCT A;  2VNR A;  3LEM A;  3PVE A;  4IE4 A;  3FLP A;  4HZF A;  1QMJ A;  4PIX A;  4ARY A;  4GJY A;  1HB3 A;  5FPX A;  2IXI A;  1IGO A;  4UW5 A;  3URF A;  1RUN A;  3MIE A;  4GD4 A;  3PVO A;  4JHT A;  1CAX A;  1NY7 1;  4I2O A;  2DBN A;  3IN9 A;  2V4V A;  3AL5 A;  2YC4 A;  2Q4S A;  2YFZ A;  3BGA A;  3H9A A;  4XJW A;  4PQQ A;  3N9O A;  1QJU 1;  3RPQ A;  3WOG A;  2MEV 2;  1D2S A;  3EXU A;  5CU1 A;  3VBR C;  1O5U A;  4XUN A;  5A6Z A;  2XHN A;  2C9K A;  4KWL A;  1ENR A;  3RZM A;  4JKL A;  4JZR A;  2OZ6 A;  4QB1 A;  4BM8 A;  1QOT A;  3I54 A;  4Z1V A;  2B39 A;  1OLM A;  5FFO C;  5FUP A;  1WCS A;  1IHM A;  3K77 A;  1B35 B;  2AAC A;  3VD5 A;  1UX7 A;  1W28 A;  2WFF 2;  4E4S A;  1RYY A;  1STM A;  1DGW X;  2Z2S B;  1UNB A;  5H9S A;  3EMR A;  4BE3 A;  1NE4 A;  3BU7 A;  1W90 A;  4OI4 A;  1H8T A;  3CBN A;  1LOE A;  3R4S A;  4I0B A;  4O65 A;  4NHM A;  4BLJ A;  4XBL A;  3TN9 2;  1LHU A;  4N43 C;  5IVV A;  2JEC A;  1YC6 1;  2Y6G A;  5L7O A;  3FWE A;  2IFW A;  1WMD A;  1G9C A;  2J42 A;  2FZ1 A;  3CO2 A;  1FAY A;  5KXC A;  4H7L A;  2FMD A;  4Q4Y 3;  5F32 A;  4W4Z A;  2W3J A;  1PMH X;  2D6K A;  1JOJ A;  4WV8 A;  3BPS A;  1I5P A;  2WQ8 A;  4ZXE A;  3E97 A;  2QQN A;  4QWN A;  3M4F A;  4A7Z A;  1COV 2;  1HDK A;  4GKY A;  1JZ3 A;  2NN8 A;  4XJZ A;  4IV3 C;  5JUV A;  1KGY A;  3VKM A;  2R49 A;  5FY4 A;  3NKG A;  4I01 A;  3WLU A;  3ZM8 A;  4EWE A;  1S0B A;  1RUO A;  3PIG A;  3ZMO A;  1YQC A;  4Q4W 3;  4E4H A;  4YG6 A;  2K2S A;  4K1Z A;  3OPW A;  5F2W A;  4AQ6 A;  4QXK A;  4XC9 A;  4M3C F;  3WHU A;  1FPN 3;  2FQP A;  5IK5 A;  3H8R A;  1RMU 3;  4HET A;  4CCD A;  3RFR A;  2VOV A;  4UFM A;  3KCC A;  3VKF C;  4NO4 A;  3BIW E;  4QB2 A;  1JTZ X;  2XJT A;  3ZIW A;  4QPI C;  4ZU5 A;  2X09 A;  5HCF A;  2A75 A;  3ZYG A;  4AI2 A;  4GB3 1;  2E7T A;  4WM7 C;  4ASK A;  3VGI A;  5IFP A;  5LWB A;  1VBB 2;  1RUH 1;  3AP4 A;  1GR3 A;  4HVO A;  5C9A C;  1QQP 3;  3ST7 A;  2XJP A;  2Y26 A;  4NPR A;  1CAV B;  1ENS A;  4MGQ A;  3N7K A;  4WM8 A;  5FY7 A;  1RUC 3;  1ENX A;  2VQA A;  4MO3 M;  1VB4 A;  1BCX A;  1HXS 1;  3DPR B;  2WNU A;  3WQB A;  3CDZ B;  3FE5 A;  1XJA A;  4UYB A;  4RQP C;  1VP6 A;  1FX5 A;  3AZY A;  2E9Q A;  2W94 A;  2HYK A;  1Y3T A;  1X33 A;  3ALQ A;  1LHV A;  1UD1 A;  4QKN A;  4YG0 A;  5DDJ 1;  1WLD A;  5GZF A;  4AEJ A;  4PLN A;  4NJ4 A;  3KGL A;  1ST8 A;  1DBN A;  3BUC A;  3MFC A;  1W6N A;  3KWV A;  1UO9 A;  5IUQ A;  3U37 A;  4FO9 A;  4XUR A;  2OVU A;  4FTB A;  2NMN A;  3USU A;  3K4A A;  3H50 A;  5LAT A;  5J48 A;  3GDB A;  5CFC A;  4W6W A;  4GXL A;  2ARC A;  4Y1X A;  3IMM A;  2YU2 A;  1K5M C;  1PM4 A;  5KXD A;  3VBU A;  3TN9 1;  1YLL A;  5LRR A;  1ALY A;  4D6R A;  4EN9 B;  2WDB A;  2WYF A;  3E5X A;  2AUY A;  2RS5 1;  2X53 S;  1OLR A;  3VKO A;  3AK0 A;  2O8Q A;  3SMH A;  3ZYJ B;  3DL3 A;  4XMI A;  5L19 A;  3WF0 A;  3ACI A;  4S2G A;  2WZ8 A;  2DCY A;  5T5L A;  4QX5 A;  5C33 A;  4QDS A;  4XHX A;  2Y6L A;  1DGL A;  1LOF C;  4LUL A;  2HBU A;  3WNM A;  3VDA A;  1G7Y A;  4NAO A;  2WYS A;  4DRR A;  1QWR A;  2DFC A;  4PHZ A;  5BXX A;  3KLS A;  4G4F A;  2EIC A;  4PBO A;  1UIK A;  3NNF A;  1EV1 1;  4I02 A;  4HXC A;  4MHU A;  4EYU A;  2F6B A;  4QX3 A;  5CB7 A;  3ME2 A;  3OG2 A;  1PO1 3;  2O14 A;  4XJ9 A;  1R08 1;  1GZW A;  3F2Z A;  4Q4X 2;  2BER A;  1M06 G;  3U4X A;  2VQT A;  5FZE A;  5C4W A;  1BBT 1;  1F2N A;  2BWA A;  1N1Y A;  4Z2W A;  4EWD A;  2ET7 A;  3HNY M;  2W08 A;  3UV9 A;  3WV6 A;  1ASJ 1;  1O3T A;  3AB0 A;  2LS6 A;  3PUS A;  1N1S A;  2GNM A;  2Q5T A;  2QQI A;  5FPZ A;  4BME A;  5BNP C;  4CCO A;  4UT5 A;  1FOD 3;  4QX2 A;  1LOA A;  2OUH A;  2VJX A;  4RN5 A;  4UW4 A;  3ZSJ A;  2RE9 A;  3WNK A;  4V1P A;  3HD8 B;  1CES A;  2XQX A;  3S6P A;  2IXL A;  2ZGU A;  4NN0 A;  3PHM A;  4XFA A;  5DZG A;  1LEM A;  1H1A A;  2WO2 A;  4LQR A;  1X36 A;  3JD7 1;  2VE1 A;  2R07 3;  4GH4 C;  4RD7 A;  5CZK A;  3ZLI A;  1JYX A;  1GLH A;  1V6J A;  5JIA A;  2D7F A;  2WC2 A;  3MBW A;  1IS3 A;  1N1T A;  3BPZ A;  3CEW A;  5BNO B;  1JHN A;  5JZG C;  4HLT A;  5ABJ B;  4I09 A;  1NCQ A;  2XB6 C;  5J98 B;  2RS3 2;  1H2M A;  2IVI B;  4QPG C;  1PZ7 A;  2LW8 A;  1OUX A;  4LR4 A;  1EUT A;  3DPR C;  3OBA A;  3GGL A;  3KVB A;  1AX2 A;  1ZZ8 A;  3ACH A;  3OGV A;  3ZXK A;  3FZ3 A;  3KT1 A;  4ZKT B;  3WG3 A;  3PVN A;  1PGS A;  3UKV A;  5K9Y A;  1RUE 1;  2FDJ A;  4MV2 A;  5F3I A;  2W0X A;  4LO7 A;  5LBE A;  5C9A B;  1HV1 A;  1RIT A;  2QQO A;  4RS5 A;  2H6B A;  3AYD A;  4OUL A;  2CSG A;  2JIG A;  3DYM A;  4BHP A;  2XKO A;  4WM7 B;  2QQM A;  4IGO A;  4UFI A;  4E8D A;  1PHM A;  4F7Z A;  3VKL A;  1G9F A;  1BQP A;  1QOS A;  4H7M A;  3AXD A;  3VZK A;  5CNA A;  5T54 A;  4FAH A;  1IQD C;  2E6V A;  2FD8 A;  4KH9 A;  4IV1 B;  2VGD A;  1W6Q A;  1UOF A;  1Z7S 2;  2I07 B;  1VB2 A;  1POV 3;  5EFU A;  1R1Z A;  2A73 B;  3HJR A;  3OPZ A;  3VL8 A;  2VQ0 A;  1AR7 2;  3ZDV A;  1IG0 A;  3I59 B;  4CDX A;  4JC1 A;  1RED A;  2R0H A;  3MV1 1;  5CG9 A;  3BTY A;  3AP6 A;  5J96 B;  4FPE A;  1B35 A;  2ZCW A;  3QH7 A;  4Y4Y A;  4CP1 A;  3RZG A;  2Y6J A;  1U5I A;  2RVA A;  4AGG A;  2HLE A;  1D7P M;  1J83 A;  2E53 A;  1VLN A;  3I3E A;  3PNA A;  3CJI A;  5JOZ A;  2DWR A;  1H8T C;  2Q30 A;  4URT A;  4LMF A;  4E2G A;  1YFX A;  1O3R A;  2OS2 A;  1E57 A;  3BYW A;  1FNY A;  2A3Y A;  1JYI A;  1ZX5 A;  3O1U A;  4AVC A;  3ES1 A;  3DKW A;  2WZP P;  1DQ1 A;  2ARB A;  5A7N A;  3S0M A;  1J1T A;  5KR7 A;  4HT1 T;  5A7Q A;  1GQP A;  4AL9 A;  4AE2 A;  1Z78 A;  1AX0 A;  2VUC A;  1DZQ A;  3ETP A;  4ZS2 A;  3TNQ A;  3ZR6 A;  5JOY A;  2AEZ A;  1J3R A;  1R08 2;  4B7E A;  3MYX A;  2A71 A;  5DAV A;  1VE0 A;  1SBD A;  3IT8 A;  1XNC A;  2ZKN A;  3ZDS A;  4CDQ B;  5EP9 A;  3B02 A;  4IV3 A;  2VVE A;  4J1X A;  4YGB A;  3SH4 A;  5KHI A;  1QXP A;  1CWP A;  5IYY A;  3LA3 A;  4IND A;  2ZEW A;  1LU2 A;  5GM0 A;  2JG8 A;  4M00 A;  2XJR A;  2RM2 3;  3M3Q A;  2NPI A;  2VMI A;  4GJZ A;  4XAC A;  1VRB A;  5A7P A;  3VZN A;  4BIO A;  4EN6 B;  4NIH A;  3WQ7 A;  2NYY A;  3M3O A;  1B09 A;  2Y60 A;  3IMN A;  3W59 A;  3NVC A;  1OT5 A;  3RI9 A;  2DTY A;  2DUO A;  3U07 A;  2VNO A;  3SH5 A;  3IWZ A;  4FTE A;  3J26 N;  1W6M B;  3K75 B;  3CLP A;  1GNY A;  5GZG A;  1VBC 2;  4RYD A;  5FMD A;  4B7K A;  3ZFF B;  1UZY A;  2J1R A;  2P4E A;  4LLO A;  4M0H A;  1JZ2 A;  3PUQ A;  3OYW B;  3D6E A;  1RVF 1;  2JDM A;  3M3I A;  3LPF A;  3R05 A;  4LBM A;  5FO7 B;  5BNN B;  1LKN A;  2WZR 3;  1ZBE 2;  3GJB A;  4XQ4 A;  1CIW A;  2QZ2 A;  2DCZ A;  2OXB A;  4I3G A;  1GP4 A;  1WCD J;  1AYM 3;  1W6O B;  4ET7 A;  4RR3 A;  4IDZ A;  3ABZ A;  2P34 A;  5E89 A;  1YIP A;  1SFY A;  1R09 2;  2BDR A;  4RQP A;  4ZU7 A;  1DGR A;  1WBF A;  1UY1 A;  4YZ5 A;  5FZ3 A;  3AMM A;  2JX9 A;  3NAP B;  5KXB A;  1RUH 3;  5FZH A;  1I6X A;  4DZG A;  2AEN A;  4AQS A;  4BA6 A;  4DEQ A;  5BPX A;  2VZQ A;  5D8A C;  5FZA A;  1N1V A;  4CXW A;  4FFG A;  1TE1 B;  3D8C A;  4YVW B;  1VAK A;  2ZHN A;  1H9P A;  1MS4 A;  4FQ4 A;  3JB8 A;  4HKW A;  1UMZ A;  1UAI A;  2BNN A;  5E8A A;  1RUJ 2;  1NQD A;  3KCY A;  3DV8 A;  5AC9 2;  3T08 A;  1C8M 2;  2VZS A;  4PIY A;  1POV 0;  3USS A;  4L92 A;  4AQT A;  1DQ6 A;  1E5R A;  3ZR5 A;  2W47 A;  1VAM A;  4UFK A;  3BI3 A;  1PGW 2;  1YFU A;  3NRU A;  5C3O A;  2JE8 A;  1ZZC A;  4MZU A;  5D21 A;  5KC5 A;  2VD7 A;  5CAD A;  3OB8 A;  4AYU A;  5LZ6 A;  1NZI A;  1O8S A;  1NA1 B;  2NLR A;  4FSJ A;  3Q8F A;  2VPV A;  2WQZ C;  4QPW A;  3VBO A;  1ZRF A;  3H3Z A;  1PX4 A;  3VBO B;  2QBX A;  1CVN A;  1HW5 A;  1UL9 A;  1CJP A;  2ZKL A;  4JV4 A;  1AXZ A;  1AYN 3;  3E5U A;  3HBZ A;  4AEK A;  2GC0 A;  4M3C E;  5LA2 A;  2BOJ A;  1ZVF A;  1DIW A;  4RR3 B;  2CNA A;  4Q4Y 1;  4COU A;  3RZL A;  2ZOE B;  1A78 A;  1XSR A;  3RZJ A;  3OSD A;  1ZRI A;  1OOP A;  1RB8 G;  4GWN A;  4ATE A;  3SCH A;  4UFJ A;  1XBF A;  2A1X A;  3I59 A;  4XZU G;  1GU3 A;  3WG1 A;  4AF9 A;  1GSL A;  3ZYB A;  2ZGK A;  1YEW A;  2GSY A;  1HIX A;  5JMC A;  4A6O A;  4LNV A;  1Y9G A;  2YBP A;  5LBC A;  3GNE A;  5IT6 A;  2SLI A;  5FZB A;  5AVA A;  1WD4 A;  3HPN A;  1ULP A;  4YVS A;  4ARX A;  4Q4W 1;  2CAU A;  5JR2 A;  3USU B;  4NIA A;  3F95 A;  5DUX A;  5FUN A;  4ZON A;  1U12 A;  3KMH A;  4LBQ B;  4CVU A;  1UWW A;  2IZW A;  2WLP A;  1GP5 A;  4WVM B;  1EV1 3;  2VW2 A;  3WNN A;  1SMV A;  2ZAC A;  5CFD C;  1A3K A;  3H7Y A;  2WFF 1;  3AKR A;  3PJQ A;  4NOT A;  4DOU A;  2WZE A;  4KWK A;  1BBT 3;  3WQ1 A;  5JVV A;  2W9X A;  2O8O A;  1AR6 3;  3MDP A;  4FOY A;  3WDX A;  4WZF A;  5JSO A;  1UOG A;  4GZ9 A;  4DNY A;  2HWC 3;  3NV2 A;  4LKD A;  4QPG A;  3RG0 A;  3HQR A;  1OQ1 A;  4BYY A;  2JG9 C;  4A3Z A;  1AZD A;  5A7W B;  3O0V A;  4QPY A;  3I2F A;  1M4W A;  2VH9 A;  3SKV A;  1LTE A;  5ABJ A;  3S7E A;  2P5B A;  2R6Q A;  1UF2 C;  5ACA 3;  1CAV A;  1HRV 2;  3EYP A;  3BOP A;  1SHW B;  1YJK A;  3U1X A;  2I2S A;  1BXH A;  1NLQ A;  4K40 A;  5K7P A;  4PI2 A;  3W5M A;  1H1I A;  1GP6 A;  1Q8O A;  4F8A A;  4JKK A;  2JEM A;  1VBA 2;  1Y9M A;  4QDR A;  2D6L X;  2CL2 A;  4XFB A;  1S0F A;  3MGU A;  3R4D B;  3I2I A;  4N53 C;  3ZOI A;  5ISL A;  1HKD A;  2LUW A;  3KHB A;  3FUQ A;  4ZHN A;  2BBA A;  1LRH A;  1MZ6 A;  4Z92 B;  1SLC A;  2D6N A;  2RJK A;  1HN0 A;  4MOA A;  4PBP A;  5A33 A;  5FLJ A;  4U36 A;  1CPM A;  1PGW 1;  3ZX7 A;  5C7G A;  5JWP A;  1A8D A;  1CAW B;  3KD4 A;  1RUI 1;  5FXW A;  3KF5 A;  2JDH A;  3ZYI B;  1O5L A;  4IE6 A;  5IJR A;  1JUH A;  5JAX A;  2IC1 A;  4QGN A;  4B4P A;  4DPN A;  5A3L A;  5HV0 A;  3LIG A;  1KFU L;  2DV9 A;  1U0A A;  2VCA A;  1CJD A;  2RS5 3;  4YM1 A;  1ULO A;  4YZ4 A;  4AG4 A;  3U78 A;  1PK6 C;  3ZYP A;  4Q4V 3;  2FZ2 A;  1RJ8 A;  2B42 B;  2MEV 1;  1R1A 3;  4GA9 A;  3PIJ A;  1X50 A;  4YM0 A;  3AM2 A;  3FFQ A;  4AK3 A;  2XVK A;  4XJA A;  3M7A A;  5LY2 A;  4RS5 B;  3WW2 A;  5G04 L;  4EQV A;  5FY1 A;  4CZS A;  1YI7 A;  1VBD 1;  3CNA A;  3OEA A;  4D7T A;  4XUO A;  1X82 A;  5FMO S;  2OII A;  3CJX A;  3H1M A;  4HL0 A;  2V4A A;  4LJH A;  3PU8 A;  2YG0 A;  1D0G A;  1AVB A;  1TME 3;  3JBG 3;  4QB6 A;  4TYS A;  4Y1U A;  3MHZ A;  5FQ0 B;  2NQY A;  3PUR A;  2W1S A;  3OOX A;  3QAC A;  3O1S A;  2D93 A;  4QX7 A;  3JB4 C;  5DDJ 2;  4QXH A;  4E4D X;  1LOC A;  2YBK A;  1NCQ B;  1YNA A;  1MS0 A;  1S0E A;  2VTF A;  3B00 A;  5JXJ A;  4HON A;  5FOB B;  3U0Z A;  1PO1 1;  1ULD A;  1WMF A;  3ILN A;  3VDC A;  5HCA A;  3GBF A;  4LBJ A;  4E8C A;  5FQ0 A;  2W5F A;  4K7J A;  3VBS C;  1AL2 3;  3W21 A;  1D4M 2;  4CYD A;  4JGY B;  4X6Q B;  1QU0 A;  4IV1 A;  3LEK A;  1GOH A;  3K51 A;  1RJ7 A;  2JDU A;  2XR4 A;  4H14 A;  4L0P A;  4A7K A;  3V0B A;  1O3Q A;  1W05 A;  4ASM B;  2X10 A;  4E2S A;  3ES4 A;  2GMP A;  4Y1Y A;  1UIJ A;  4XFC A;  1KD7 A;  1Q3E A;  2D6P A;  2ZGR A;  1V6K A;  4Q26 A;  2VZ1 A;  5F39 A;  1EAH 2;  1AR8 3;  3P5B A;  4FP3 A;  4W8J A;  3N7L A;  3T2P A;  1XE0 A;  3NL1 A;  1YWK A;  3JD7 3;  1G8W A;  5FZ9 A;  1KS5 A;  4NRP A;  3WCR A;  2BNM A;  1CR7 A;  3AXE A;  2VMC A;  4UWD A;  1EUU A;  5FXV A;  1V9U 2;  1ZNP A;  1C57 A;  2ERF A;  4JGZ B;  4WM8 B;  1N47 A;  3BTX A;  4YGE A;  1XXN A;  3V0A B;  2I74 A;  4LUK A;  3P1I A;  3I7D A;  3ZFG B;  2B9V A;  5DAP A;  5AC9 1;  4XTP A;  2E51 A;  2E7Q A;  1I3H A;  2L9L A;  2WII B;  5FP7 A;  4BQ4 A;  4E9K A;  5CKN A;  2NP0 A;  1O59 A;  5FYY A;  3UJQ A;  3FN9 A;  1BKZ A;  4P9Y A;  4YAR A;  2CY6 A;  2VOK A;  3LE0 A;  5FZD A;  4CEY C;  3HVD A;  2WNE A;  3S30 A;  4BMB A;  5H9R A;  1ND3 C;  2Z4F A;  3VD3 A;  3VDB A;  3HOB A;  4KBZ A;  1W2O A;  2C9A A;  4WVZ A;  1NY7 2;  3MPB A;  2IXH A;  3VBH C;  1W0P A;  3U10 A;  1V6I A;  5FZM A;  5FY9 A;  1GQH A;  1AYM 1;  4N7U A;  4WVW A;  1TMF 2;  2QQV A;  2YGM A;  4H55 A;  3VBU B;  5TSW A;  1F4H A;  2PHF A;  4B1M A;  4CU8 A;  1ASJ 2;  4K20 A;  1XNK A;  2ZMN A;  1MS9 A;  2WWU A;  3L9J T;  1BMV 2;  4XAE A;  4P9J A;  1NLR A;  2QDN A;  3T0D A;  4LBO A;  3LOB A;  5JI9 A;  3VBF A;  1K3I A;  2C0Z A;  2C5D A;  3A0N A;  5C71 A;  3AVR A;  1AX1 A;  4I0W B;  4O9G A;  2VMD A;  3V56 A;  5EYY A;  5FLH A;  4SLI A;  4N7I A;  4JDO A;  5FCC A;  5AFE A;  3RQ0 A;  1ZZ7 A;  2HWE 1;  2MNG A;  4A44 A;  3Q8A A;  5C70 A;  5F3G A;  2ZTN A;  1ULG A;  1WCQ A;  5KHH A;  1GZC A;  3FFZ A;  3UGF A;  2Q8E A;  3MIB A;  2CU5 A;  5T52 A;  4P9I A;  3MLJ A;  3TYJ A;  1OBN A;  1LCL A;  5LA1 A;  1WD3 A;  1XYN A;  2WWS A;  3J7L A;  1SLT A;  4CDU B;  1WW4 A;  5FZ8 A;  1NCR C;  1ZBA 1;  4UW6 A;  2DUR A;  4R9B A;  1DYO A;  1SZB A;  2GZW A;  2PQQ A;  3MIF A;  1UZV A;  4XJ8 A;  3VL9 A;  2K0G A;  2YHJ A;  2VMH A;  4L99 A;  3C7G A;  1ZM1 A;  2YMZ A;  2G9Z A;  1ZA4 A;  3DUI A;  2B4K A;  4BLI A;  3DF0 A;  2YUE A;  4YWA A;  1Z0H A;  4R9D A;  3UYJ A;  4Q8K A;  5A3N A;  5C5T A;  2AYH A;  1CAW A;  1NE6 A;  4W6Y A;  3WF2 A;  3A7Q A;  1V6L A;  2NZ9 A;  1JUI A;  5FYZ A;  3ZO0 B;  3ZVX A;  5CIS A;  3LA7 A;  3MID A;  4YRD A;  1LHN A;  2NM1 A;  3B69 A;  2Q8D A;  4FCA A;  4D6S A;  3GBW A;  1RHI 3;  3MPP G;  4HFS A;  5A1F A;  2R04 2;  1Y9Q A;  3JQW A;  2X29 A;  3RNS A;  1QJU 3;  2RM2 1;  3DEM A;  3SNM A;  1UQX A;  2J1S A;  3HAG A;  1PO2 3;  1WZX A;  3CZU A;  1UU5 A;  4KNC A;  4JDM A;  4QM8 A;  3H8X A;  2C4X A;  4S2H A;  4LHL A;  4P02 B;  1Q8Q A;  2WNV C;  2D43 A;  4XAA A;  1V9U 1;  5C3Q A;  3VDD B;  4ZZ5 A;  3O1O A;  1QKQ A;  1BLZ A;  3UES A;  2WT1 A;  4O9E A;  4Q4X 1;  2FDH A;  3RJR A;  3GHN A;  4ISR A;  4AWD A;  1VBB 1;  4UXA A;  3OBT A;  3B7M A;  3KGZ A;  3P3N A;  1W9T A;  1PIV 2;  4MX3 A;  4AHW A;  1H0B A;  4FP2 A;  2W1W A;  2WNU B;  2Y33 A;  4JTN A;  5BYN A;  4YGC A;  1OA3 A;  4NPM A;  3ZFE C;  1UPS A;  4BQ5 A;  1AHS A;  2J1T A;  1OD3 A;  5FYH A;  2XVL A;  1MPX A;  5IVY A;  4COW A;  2GH2 A;  3POE A;  5IW0 A;  3LD8 A;  1C3H A;  2X8K A;  2CGO A;  1SCS A;  3GAL A;  4MGY E;  1RUD 2;  2FDI A;  3JZV A;  3O1M A;  1F8V A;  3N9M A;  2H0V A;  1QJY 3;  3VBR A;  4MGZ E;  4JGY A;  5F37 A;  1LEN A;  1SG3 A;  2KD7 A;  1G9B A;  3LPG A;  2A6Y A;  1AJK A;  2RR1 3;  1V0A A;  2RS3 1;  4LIT A;  4OUM A;  5IVC A;  4CXY A;  1UZW A;  2WAA A;  2GND A;  3CKH A;  3WDV A;  1LES A;  4OMD A;  1G9A A;  4MGT A;  5JLV A;  2XQR A;  2ZGM A;  2GAL A;  2HBT A;  2W1Q A;  2EXJ A;  4QQO A;  4YFW A;  2CGN A;  2XDV A;  5A7S A;  1QHD A;  1TVG A;  1ULC A;  2R06 3;  3HBK A;  3BKZ A;  1N3P A;  2DTW A;  2HWF 3;  1H9W A;  3O12 A;  5LK5 A;  4NRM A;  3FHA A;  1ODM A;  2JDN A;  2A6V A;  4CEW A;  3MUZ 1;  4CPB D;  1W2A X;  3NNL A;  4B1L A;  2UY8 A;  2RHP A;  2XJV A;  4M3C B;  5KWR A;  5JDB A;  4CUC A;  1UYY A;  4BQX A;  5L7O C;  1CAU B;  1OSG A;  1K5J A;  1DQ5 A;  1V70 A;  4GB3 3;  4AXO A;  4AR2 A;  2GU9 A;  4JTO A;  3ZSL A;  2PHW A;  3MIG A;  4FOW A;  4CP0 A;  1F5J A;  2GH8 A;  4CU9 A;  4MGI E;  1JOD A;  1Q8S A;  2LTN A;  2RMU 3;  2KXL A;  1O7F A;  1QQP 1;  3MV0 1;  5CIR A;  2G9F A;  5KBF A;  1FMD 2;  4XDO A;  3B3Q E;  2Q8C A;  2DVA A;  1DF0 A;  2BOI A;  2OX0 A;  3D3A A;  2UYA A;  2HWB 2;  2WLQ A;  4UFL A;  3CF6 E;  1AYN 1;  1EAH 1;  2WT0 A;  5EYX A;  1QIQ A;  5A32 A;  2E32 A;  4F3J A;  3I2H A;  4UFH A;  1MEC 2;  2B8M A;  4W50 A;  1JU3 A;  3T1L A;  4YW4 A;  4CRQ A;  3AYC A;  3J8F 2;  5F6L B;  3EJK A;  2YB7 A;  3III A;  1H4H A;  1JW6 A;  2AC1 A;  2DUP A;  1AR9 1;  4XCB A;  3WP3 A;  2HWD 3;  2XG3 A;  1UZZ A;  2DUQ A;  1SFP A;  5IWF A;  3NW4 A;  4W6X A;  4IE7 A;  1JS9 A;  2BVB A;  3WR0 A;  3DN7 A;  1FI2 A;  3T4H B;  3E6C C;  1QXJ A;  1VBD 3;  2A6W A;  1Q43 A;  2Q0A A;  1X8M A;  4JHZ A;  4WM7 A;  5HPO A;  2VO5 A;  4NVP A;  3TOJ A;  5FIX A;  4HKL A;  1H30 A;  4XOG A;  1Y4W A;  1OFN A;  2ILM A;  5DPN A;  4EJR A;  3MW2 A;  4EE2 A;  3OJB A;  5CA6 A;  1VBE 2;  2KR2 A;  3FUO A;  1UU4 A;  3RS6 A;  1DP0 A;  2WNU C;  2JDY A;  4C91 A;  4DUX A;  1AL2 1;  2AR6 A;  3A22 A;  5AVP A;  3QOP A;  1DG6 A;  2HH9 A;  1OA2 A;  1X8E A;  5L36 A;  2ARX A;  4PLM A;  4TLF A;  1LUL A;  4QX1 A;  5EJ3 A;  4DIQ A;  2VCC A;  3H8O A;  1PVC 2;  3VDD C;  3WNL A;  2VMG A;  1HRI 3;  3ELN A;  3JQX A;  3KHC A;  1CX1 A;  4HAN A;  1PMI A;  3WQ0 A;  1MZE A;  4NWV A;  4Z07 A;  2R30 A;  4PF5 A;  5CKM A;  2Y8K A;  2ZHL A;  4MUV A;  4XFF A;  1SLB A;  2FCV A;  2ARE A;  4R9A A;  3RYR A;  2O1Q A;  1TQ5 A;  4C1W A;  2OT7 A;  2BRT A;  1RVF 2;  4FPC A;  4XXP A;  5A3U A;  1EP0 A;  2GDF A;  2JIC A;  3ZIX A;  2DU1 A;  2HWE 2;  4XPV A;  3K3O A;  1VIW B;  3R6S A;  4AI3 A;  3IAP A;  2OQ6 A;  2ZGO A;  3GZE A;  5L73 A;  2WL1 A;  3VBH A;  3VN4 A;  5DG2 A;  5FDB A;  1JZ8 A;  4ITC A;  4LBN A;  5IAT A;  1H8V A;  5EHD A;  2WA3 A;  2XBO 3;  4YSF A;  2C24 A;  1OC1 A;  1S2B A;  2W1U A;  1YYN A;  3JCI A;  3Q8C A;  4O61 A;  1J3P A;  4OHZ A;  1QJF A;  4D94 A;  5B4X A;  1XNA A;  2EA7 A;  3IKW A;  2CDO A;  2K9Z A;  5M0T A;  3WW1 A;  4RHV 3;  3K48 A;  2VCB A;  3N36 A;  1NCR B;  1RUI 3;  3MIC A;  1RUC 1;  3POW A;  2UY9 A;  3T2Q A;  4CDU C;  4KU8 A;  3RZK A;  2PMW B;  2DF7 A;  2WWJ A;  3BU0 A;  1FMD 1;  3IZO A;  3BOW A;  5FZ0 A;  4XUQ A;  1REE A;  2UWA A;  2EAA A;  1UYZ A;  2HWB 1;  1W8F A;  2B7Y A;  4ZXK A;  4TWT A;  2MEV 3;  1FAT A;  4M3C A;  4XJU A;  2ZS6 B;  4AQ2 A;  3SEE A;  2VY0 A;  5F3E A;  3UKT A;  4OLL A;  1C8N A;  1OLM E;  1E5I A;  5K0U C;  1F5F A;  3IPV A;  1UN1 A;  2JDP A;  1TZO A;  5FUI A;  4PDW C;  1V6M A;  5GLT A;  1XPW A;  3T1M A;  5KHK A;  4CCM A;  2BW8 A;  2BGO A;  4MG2 A;  1BEV 3;  1XE8 A;  4DQA A;  1U5Z A;  4HN0 A;  4JCK A;  1AL0 G;  4AGR A;  4DS0 A;  3FLT A;  3JUU A;  3TEW A;  4TLG A;  3TBD A;  3K4D A;  3MI8 A;  2EF6 A;  1AUY A;  3VBU C;  4LPL A;  4IGP A;  4KG8 A;  3RWK X;  5C3S A;  2A5Z A;  3LA2 A;  5LA0 A;  1I9R A;  3TN9 3;  3LEI A;  1LHO A;  1PVX A;  1W6Q B;  2EIG A;  4OHX A;  2W91 A;  3SXW A;  1KDM A;  3ATG A;  4QAW A;  3C7F A;  2VBD A;  1S55 A;  2G9G A;  2WSV A;  1LOF A;  4CEY B;  1QH6 A;  2DVB A;  2QCS B;  4AED A;  2D40 A;  4CCC A;  4IET A;  5I0U A;  4NUB A;  1HXS 2;  1COV 3;  5J1X A;  5FP3 A;  1SDW A;  1C5H A;  4CUG A;  3WF4 A;  1LGC A;  5FXX A;  4IEP A;  1PVC 1;  4WM8 C;  2BU9 A;  2ZX3 A;  5I0R A;  1G9D A;  2XON A;  4IGQ A;  2XJQ A;  4UI9 L;  1CX4 A;  4Q4W 2;  5FWE A;  5I8Y A;  3SLI A;  4AAX A;  2EID A;  3RVH A;  1GWM A;  3ZFF A;  2BQP A;  2ZX2 A;  3IIA A;  1RMU 2;  3LDR A;  1VJ2 A;  1UXZ A;  4FBF A;  1ZRD A;  2RDN A;  2VEC A;  2VZT A;  1LGB A;  5HXM A;  3GZU C;  4R4X A;  1US3 A;  4N9I A;  1D0H A;  2P6C A;  2DVD A;  3QD6 A;  1JXN A;  3TEX A;  3M70 A;  4FXG B;  1SLA A;  2D6O X;  4QX0 A;  2B45 X;  1APN A;  2Y0I A;  4LK7 A;  4JGY C;  1VBB 3;  1F15 A;  2YU1 A;  1C1F A;  3VBS B;  1KEX A;  4IQP A;  4DB5 A;  5IK8 A;  2R07 1;  1PM7 A;  2DU0 A;  4CE8 A;  1WW7 A;  2PFW A;  2XUE A;  1NCQ C;  2QFE A;  4LO4 B;  5DG1 A;  1NZC A;  3O0W A;  4KL1 A;  1RUC 2;  2DDU A;  1JOB A;  4V2W A;  4MXW B;  1ODN A;  2XHK A;  1HRV 1;  4RFT 0;  5FP9 A;  5FZ7 A;  2RJ2 A;  4H2A A;  3TWI A;  3O0X A;  5D2A A;  1C8M 1;  2N7G A;  2ZMK A;  1H1M A;  4TN7 A;  3VZM A;  4D8M A;  2ZJC A;  4OVE A;  4XDP A;  5IVJ A;  4UBG A;  3E5Q A;  4RS5 C;  4AFA A;  4FPH A;  2RR1 1;  1GAN A;  1XC6 A;  3WP5 A;  3PUH A;  4KMQ A;  1MVQ A;  3SQO A;  2OPK A;  1H2K A;  1DLL A;  1PK6 B;  3ZXD A;  4E2Q A;  2D5F A;  4CCJ A;  2VUA A;  4R9C A;  4V2V A;  2H6C A;  1IKQ A;  5HXV A;  3H0O A;  1QJX 3;  5A6X A;  5EWS A;  3BCW A;  4YLZ A;  4JDN A;  2P3Y A;  2VTX A;  1LGN A;  1BYH A;  3FLR A;  2UUR A;  3WDT A;  3VBF B;  1W2T A;  1PZ8 A;  4FFH A;  1KXG A;  4ONU A;  2VAU A;  3B9C A;  2Z5W A;  4M0N A;  3S5A A;  2XH6 A;  1J59 A;  3SIT A;  1T2X A;  2W46 A;  1ZBA 3;  3ASI A;  4RGA A;  4FTS A;  4PF1 A;  2RG4 A;  1HB1 A;  4YPJ A;  3WZ1 A;  1POV 1;  5CEH A;  4NID A;  3PL0 A;  3W20 A;  3M1H A;  2VTX J;  1WCU A;  2YFU A;  4P9W A;  2J22 A;  4OZO A;  2VOX A;  1W2U A;  1QEX A;  4ZS3 A;  4MET A;  1GWK A;  3WX5 A;  4KGG A;  2GC2 A;  3ZXG A;  3KT4 A;  3M2M A;  5A3M A;  5BNP A;  3FL7 A;  4N53 B;  3NJV A;  2V5D A;  2D97 A;  4QQH A;  4RL7 A;  3WDY A;  3WXP A;  1YFY A;  2IWG B;  5JI7 A;  3FHQ A;  1AXY A;  1UYX A;  4ISQ A;  4N8M A;  4QU1 A;  4HVQ A;  4XHB A;  1GFF 2;  3OD4 A;  4BOW A;  3HNB M;  1VPH A;  4AVV A;  2ADE A;  3WSO A;  4AHZ A;  1BMV 1;  2ET1 A;  2VZ3 A;  1DHK B;  3ZPO A;  4KWU A;  1DGW A;  4CDW B;  3ZYH A;  1NAE A;  3G7D A;  4BH9 A;  4LOT A;  3E6D A;  1W3X A;  3Q8E A;  4OI1 A;  4A41 A;  2D6M A;  2JG9 B;  1GZ9 A;  4XXA A;  1AR9 3;  1J84 A;  5IHR A;  4Q4X 3;  1QNY A;  1HLC A;  3MZH A;  5GAL A;  2OZJ A;  2PHT A;  5A3O A;  4LK6 A;  2PAK A;  2P6H A;  1JYC A;  2D5H A;  4KBB A;  4DFS A;  1POQ A;  2RDQ A;  3KCX A;  1VRH 2;  3T4V A;  2RS1 2;  1HX6 A;  4YZ3 A;  3ZN6 B;  3D4K A;  1FOD 2;  1WLW A;  2PLV 2;  3VDD A;  2B5H A;  1KRI A;  1JYT A;  2ID4 A;  3MLK A;  1DYK A;  4Y1V A;  1GNH A;  3ORJ A;  3DXU A;  1ZYB A;  5F5A A;  5D8A A;  5FZO A;  4NII A;  1QDO A;  4OUE A;  3RYP A;  4L8Q A;  2R07 2;  1KFX L;  3LF7 A;  3CMG A;  3GYD A;  1UPI A;  3PME A;  4IEY A;  3KB5 A;  4BK5 A;  2EIB A;  2JB8 A;  5JSP A;  3IB3 A;  3WT3 A;  1LOG A;  3S5Q A;  4AHY A;  1MS1 A;  2RS3 3;  1QNW A;  1QGL A;  4DUW A;  5FYU A;  4EN7 B;  3AZW A;  1PX3 A;  5ANQ A;  1OF4 A;  3PUI A;  4PT6 A;  3AKT A;  3ZFG A;  4DEV A;  5CKQ A;  4UF0 B;  4CDX C;  2R04 1;  2W52 A;  2YXS A;  4A7Y A;  3AKS A;  5JSR A;  4JGZ A;  4FI9 A;  5T5O A;  4W65 A;  2WZR 1;  4RR3 C;  2VOW A;  3LIH A;  4Y5Z 0;  4OQ8 A;  5I93 A;  2HWF 1;  2WT2 A;  4LT5 A;  4C8D A;  4LTA A;  4LLF A;  4LOR A;  1YI9 A;  4CDU A;  2BGC A;  3VBO C;  1JN2 P;  2QZ3 A;  4YG3 A;  2P3J A;  4X8N A;  2ORZ A;  1IPJ A;  3AZZ A;  4QQP A;  3THC A;  2PN5 A;  3EQE A;  3ZXJ A;  5C3R A;  2QE3 A;  5FZ4 A;  4BWO A;  1BZW A;  1RUF 2;  1W8O A;  3J7H A;  4TSV A;  3U14 A;  5E6H A;  1US2 A;  2RMU 1;  1CIY A;  2DFB A;  2HWC 1;  2WO3 A;  3HQU A;  3H1Y A;  4FVV A;  4HMZ A;  2C6S A;  1OH3 A;  2QTW B;  4RSU A;  5DUV A;  2CDP A;  2VXJ A;  2ZZJ A;  4YW3 A;  3NQH A;  4LIV A;  4RHV 1;  5T5J A;  1CGP A;  3H3L A;  2XWJ B;  3HWJ A;  5C8C B;  4QU2 A;  2WO1 A;  2ZAB A;  5FP8 A;  5L9B A;  1MZF A;  4BPZ A;  5DAQ A;  1JZ6 A;  4XF4 A;  2JB4 A;  4HKO A;  2P3K A;  2WN3 A;  3CIH A;  5J37 A;  1WW5 A;  2VL4 A;  1W6N B;  1WUV A;  2JG8 C;  3SIS A;  5D8A B;  2CV6 A;  4FPY A;  4KG0 A;  5FZO B;  3KM5 A;  4Y22 A;  2MPF A;  2W92 A;  1RUE 2;  2A3X A;  3P3P A;  4HVR A;  5FRE A;  4IEW A;  3NAP C;  3FJS A;  1DLC A;  5IK7 A;  2ZEY A;  3K2O A;  3L2Y A;  5HV4 A;  5FPV A;  1QXR A;  2Z79 A;  1OKQ A;  1UMI A;  2WNO A;  4LBK A;  3VLB B;  2V73 A;  1WMX A;  1ULE A;  5JOX A;  5JPM B;  1RUG 2;  4I0A A;  2W87 A;  2WS9 3;  4BDV B;  2BYV E;  3I2J A;  3V0A A;  2YPJ A;  2RS1 1;  5BNN C;  4JQT A;  3LDB A;  3NJX A;  2J1U A;  3O5S A;  2ENR A;  5HCB A;  2JWP A;  2RM2 2;  4IE0 A;  5GLW A;  2XVG A;  2I45 A;  4ZZ8 A;  1HQL A;  4ZPI A;  2Y6K A;  2GMM A;  2EXI A;  3N9L A;  4LO5 B;  4WVM A;  3ZFF C;  4R52 A;  3LCP A;  1CN1 A;  3POG A;  3MF9 A;  3OGR A;  5C3P A;  3UNP A;  2PHR A;  4BQ2 A;  4AFM A;  1NT0 A;  4K9S A;  3O1R A;  4K3U A;  1JBC A;  2XJU A;  4AVT A;  1IS5 A;  3PUA A;  3POY A;  4XYX A;  3RYK A;  3V0B B;  1RUJ 1;  1RIR A;  5FYI A;  2OQ7 A;  2AH2 A;  4IL7 A;  1OVS A;  3J8F 1;  5A3P A;  1W6O A;  4ZY9 A;  3WUC A;  2BV4 A;  4M4R A;  3KV4 A;  3O14 A;  4QD2 A;  1SPP B;  1W8U A;  1WME A;  3AKP A;  4GQ7 A;  2WFF 3;  4AGV A;  1JYV A;  2PQS A;  4CDQ C;  1AYM 2;  4K8R B;  3IBM A;  3J4U H;  5APA A;  2FCT A;  5AFB A;  2JXA A;  4AHX A;  1RUD 1;  4GWM A;  1R09 3;  2ETE A;  1LAJ A;  3B01 A;  4BZ4 A;  3I2O A;  1V00 A;  3OY8 A;  1GYK A;  2Z42 A;  4P14 A;  4YW2 A;  1VR3 A;  1W8T A;  4LA2 A;  4D7S A;  5F5C A;  3H3U A;  4BQ3 A;  2YZ4 A;  3RGB A;  2CAV A;  2E31 A;  2PYT A;  3BIE A;  1SBF A;  3HR9 A;  5IVB A;  4Q4Y 2;  5A70 A;  3K3N A;  4DIN B;  4AOC A;  1A6C A;  4Z2A A;  4FPK A;  1HB4 A;  1H6X A;  2RJL A;  4G3Y C;  4Y20 B;  5A7O A;  1H8T B;  2JG8 B;  2Z69 A;  3Q8B A;  3ACF A;  5IAX A;  2VU9 A;  1OUS A;  5E88 A;  2R16 A;  3NJZ A;  5CG8 A;  3CL1 A;  1VBC 1;  5FP4 A;  1R64 A;  1UCX A;  1W04 A;  3O7O A;  1JZ4 A;  1WLT A;  5AC9 3;  5C8C C;  1C8M 3;  1LNS A;  1MVE A;  5LA9 A;  3WF3 A;  1JMU B;  1XQN A;  1GMM A;  1NX9 A;  1W9S A;  2Q1M A;  4KQ7 A;  1VAV A;  2JDZ A;  2NMO A;  5HI0 A;  2PXJ A;  5A33 B;  2F4P A;  4IV1 C;  1GBG A;  1FPN 2;  4YZ1 A;  5FO9 B;  3A23 A;  4QQ2 A;  3VZJ A;  5JCT A;  2VW1 A;  3DXT A;  1K12 A;  1NYW A;  2G4I A;  2OPW A;  5FKC A;  3I8T A;  3KV9 A;  4QDQ A;  4Q5O A;  3S57 A;  3FHI B;  1DYP A;  2FCU A;  5DAB A;  2VVF A;  4MH0 E;  3I4I A;  1X9T A;  3JU9 A;  1RUG 1;  1AYN 2;  3PTR B;  5IVE A;  4RGG A;  4COZ A;  1XE7 A;  1W8W A;  4MXV A;  4CPB A;  1HQN A;  3POB A;  3AKQ A;  1F35 A;  1QQP 2;  5CFD A;  5F9T A;  3WG2 A;  3LOI A;  4IEO A;  4BXF A;  2AGS A;  4YM3 A;  3ZSK A;  4CDX B;  3NMB A;  4LXL A;  5GLU A;  1JOP A;  2YV8 A;  2QQP A;  1COV 1;  4MXW A;  4NPL A;  3NKT A;  2OKX A;  5FY5 A;  1H6Y A;  4QPG B;  3OF1 A;  3ZKU A;  5LW9 A;  5LBF A;  4BQW A;  2VQU A;  2WN2 A;  3AZV A;  3LFM A;  1DZT A;  5ABJ C;  5BNO C;  1UY3 A;  5JZG B;  4A45 A;  3NST A;  3HT1 A;  3RJ2 X;  4CEY A;  4H3W A;  3TB0 A;  4CCE A;  1D2Q A;  1T6B X;  1FV3 A;  3EHK A;  4GH4 B;  3I97 A;  2VUD A;  4QKB A;  1W6P B;  4EZ4 A;  3WEZ A;  4HOO A;  5CYY A;  4FOQ A;  3T3Y A;  2ZAA A;  1Q56 A;  2R0F A;  3RMY A;  4YNI A;  2JDK A;  1EV1 2;  4CU6 A;  4Y24 A;  4NR1 A;  3NWK A;  3P6B A;  3OUH A;  1FYU A;  4HG6 B;  4XUP A;  4B8E A;  5A1L A;  5BNP B;  3FMG A;  1XRU A;  2P3I A;  5LCW L;  5DXD A;  1AR8 1;  2G1M A;  3S7I A;  5F7U A;  1F9K A;  2GAU A;  2HWC 2;  2R1D A;  1PMJ X;  3AL6 A;  5DUU A;  4QHO A;  1FV2 A;  2UWB A;  1S0C A;  2ARA A;  5DUW A;  3D0J A;  4E4Z A;  2CGP A;  3GF6 A;  3HIF A;  4PIZ A;  3C7O A;  4CDW C;  3WD5 A;  4DXR A;  3U75 A;  1X7N A;  2PAM A;  4TTG A;  1HRV 3;  4ATF A;  3GM8 A;  2QQW A;  2P2K A;  2YYO A;  4P5Y A;  1BVV A;  1W03 A;  3GCX A;  4EN0 A;  5GZD A;  1X9P A;  4DY5 A;  5EIY B;  4Q0V A;  3G6J B;  4L9B A;  1OQE A;  1PK6 A;  2PHX A;  1EPZ A;  2FMY A;  2QJV A;  3DGT A;  1GUI A;  1W0O A;  1ND2 A;  3IDB B;  4YW6 A;  4OFG A;  2YC2 A;  3ACL A;  4PLO A;  2WSU A;  3M3E A;  3RRD A;  3WW4 A;  3VB9 A;  1UMH A;  2QUO A;  1ZRE A;  2BFU L;  5JMO A;  3HN3 A;  1UOB A;  1OKO A;  1SBE A;  1QJX 1;  2LRO A;  4JVA A;  4DUV A;  1S0J A;  4K21 A;  4CSW A;  3VKN A;  1LOB A;  1PO1 2;  4DMI A;  1NOV A;  4P5H A;  4R8H A;  4LBQ D;  1K5M B;  2KM2 A;  2C26 A;  3INA A;  3J7N A;  3SC7 X;  4EWA A;  3J7M A;  1UYP A;  2FBE A;  1WA4 A;  2ZEX A;  2VZU A;  2ZBJ A;  5FK7 A;  3VBF C;  4XF3 A;  2C1F A;  3B93 A;  4BQ1 A;  1QH7 A;  1MEC 1;  2E63 A;  3ITQ A;  4OYU A;  1GOG A;  1UX6 A;  3AX4 A;  1W9Y A;  1E5H A;  2DYC A;  3VBS A;  3SH3 A;  4ES8 A;  4QPI A;  4Q4V 2;  2JD9 A;  4FPO B;  3TNP B;  1WA6 X;  1YO8 A;  1QDC A;  4XW3 A;  1IQA A;  2OA2 A;  5FRA A;  3WY6 A;  1RXF A;  5DZF A;  1WLC A;  3OGJ A;  4O7X A;  4AVA A;  5C9A A;  1A34 A;  3J9S A;  4D7Y A;  4EZH A;  1SLL A;  3UGH A;  1O4T A;  1KDK A;  1W8H A;  2G19 A;  2VG9 A;  3KT7 A;  3RZZ A;  1TME 2;  2D98 A;  1TEI A;  1F31 A;  3JBG 2;  3MFA A;  2VW0 A;  4I30 A;  4RQP B;  2WAB A;  3OD0 A;  4FFI A;  2WJS A;  5B4N A;  4Y5S A;  2ZX4 A;  1N3Q A;  5FYV A;  5DDJ 3;  1FNZ A;  3H1W A;  3QLQ A;  3MW3 A;  1W0N A;  3CZJ A;  5FLI A;  4BIF A;  3VZO A;  5FY0 A;  3I49 A;  1QOO A;  2XXZ A;  3PTY A;  5E1R A;  4OMC A;  1O8P A;  1YHF A;  2VUJ A;  1AL2 2;  5GZC A;  2D3P A;  3EO6 A;  2P1B A;  1ZRR A;  1OVP A;  1L3J A;  4QPI B;  4KU7 A;  1REF A;  3AFK A;  5HBA A;  3AMQ A;  4KWJ A;  1GNZ A;  4GH4 A;  3VV1 A;  1Q8P A;  1RHI 1;  4GMP 0;  3ZXL A;  2ZGS A;  1XYO A;  1TMF 1;  2VM9 A;  3RI8 A;  1EAH 3;  1AR8 2;  5EXO A;  3SCF A;  1WCK A;  1Z7S 3;  1UW8 A;  4RA0 A;  3JD7 2;  1YJL A;  2FHR A;  3HEI A;  1K5M A;  2WR9 A;  4G9S B;  1AR7 3;  4LUM A;  2GN7 A;  1GZW B;  1IS6 A;  4LIU A;  5J7M A;  1QJE A;  2XUM A;  3WP6 A;  5LK7 B;  2XWB B;  1V9U 3;  3ZXA C;  1JYW A;  4B3N A;  4XEZ A;  3PMS A;  1KJR A;  5FV3 A;  3W9A A;  3ZXF A;  3N7J A;  2OW4 A;  4IV3 B;  1K45 A;  3SCG A;  3UJO A;  4HK9 A;  2W68 A;  3KV5 A;  4Q29 A;  2BFU S;  4TXW A;  1JI6 A;  4A6S A;  4CCK A;  4DRV A;  1PNF A;  4XMA A;  1W9F A;  4XFI A;  3ZXE A;  1WGP A;  4CCL A;  3RWN A;  5FTT C;  5IAV A;  1BK1 A;  3WDU A;  4CP9 A;  1UY4 A;  5GLV A;  4K6B A;  4S2D A;  4Q8L A;  2AEY A;  1I1E A;  5K4L A;  5A1A A;  3POJ A;  4X6R B;  5I91 A;  4LE4 A;  1OD5 A;  1DZR A;  1OPM A;  1MQT A;  1UY0 A;  2D3S A;  2XOM A;  1UU6 A;  5FYT A;  4BQY A;  3M8L A;  3NV3 A;  3ZKY A;  2HEW F;  3WG4 A;  4FPL A;  4J6G A;  2SBA A;  1GZT A;  4N43 B;  4PQ9 A;  1R08 3;  1QJY 1;  2GN3 A;  4XVH A;  5H9P A;  3WW3 A;  1H4G A;  4QKF A;  4F83 A;  1YRZ A;  5FXZ A;  4DXZ A;  3VHN A;  3H7J A;  3T30 A;  3THT A;  1SEF A;  2UU8 A;  3I3B A;  1ASJ 3;  4PI0 A;  3I3M A;  1E5S A;  1R09 1;  4MAD A;  2YPD A;  1B35 C;  5DAW A;  1C28 A;  3WNX A;  5T3N A;  5LBB A;  1HRI 1;  5C8C A;  2GC1 A;  5HCH A;  4BJ0 A;  3ECQ A;  3OCP A;  4GWI A;  4PDW B;  3T2T A;  2R06 1;  1UXX X;  3KQ4 B;  5K0U B;  4HPK A;  1ZRC A;  1LJ7 A;  3M3C A;  4K1Y A;  4L97 A;  3V65 A;  1SQ4 A;  3VBR B;  3ZN4 A;  4LHK A;  2LM3 A;  4YM2 A;  4ORF A;  1NKG A;  4L2N A;  4Y5T A;  3OBR A;  1YXW A;  4NHL A;  1S4C A;  4IUG A;  2JE7 A;  2QDR A;  3OY8 B;  1VBC 3;  4MSV A;  3AP7 A;  5EV7 A;  4XIK A;  4FPF A;  3DYP A;  2XBO 1;  4IEV A;  3I3D A;  3PJY A;  5L9V A;  1AXK A;  4P9X A;  2OYZ A;  1SFN A;  4OI2 A;  2F17 A;  4FFF A;  4IER A;  5FK8 A;  1H2L A;  1L7R A;  4OCT A;  4HN1 A;  3LAG A;  1CZV A;  2CWS A;  1ZBE 3;  2WZR 2;  1SPP A;  4XQD A;  2MHF A;  4JRL A;  5F3C A;  2EAL A;  4FPJ A;  5LRS A;  2W2I A;  3APB A;  1XNB A;  3BTA A;  2RV9 A;  4IEZ A;  4P08 A;  3NNG A;  4XQW A;  4AI1 A;  2PTM A;  3NO8 A;  3ZN5 A;  1O6U A;  2V72 A;  1DQ4 A;  5KHJ A;  1RHI 2;  4YW5 A;  2YDE A;  4NHK A;  5FMC A;  2BJS A;  5EZW A;  5SV8 A;  4B4R A;  3LZZ A;  4QHZ A;  1QJU 2;  4YZ2 A;  4HSL A;  1Q5O A;  3VD4 A;  3ZYF A;  1RUH 2;  1PO2 2;  2V09 A;  4GIQ A;  2HWD 1;  4AI9 A;  2VR4 A;  5A6Q A;  4MYE A;  2ZGP A;  3GCW A;  4AEM A;  3NJY A;  5FBJ A;  4AI8 A;  5JXG A;  3O1P A;  1W8Z A;  5FYB A;  1BEV 1;  3KF3 A;  1MR5 A;  1YQ2 A;  1HB2 A;  1RC6 A;  2Q1F A;  3ILR A;  4GKX A;  2IVJ A;  1OXC A;  4WZC A;  2ADD A;  5EPA A;  2GNT A;  2DVF A;  4S2F A;  1V6N A;  1RUJ 3;  1D4V B;  3EB7 A;  4D0Q A;  1MAC A;  3D82 A;  1PIV 3;  2ZXQ A;  5C4W B;  4J1W A;  4AZZ A;  1ZZB A;  1FXZ A;  4I3P A;  3DPR A;  4DXT A;  1VRH 1;  3MLL A;  4C0H A;  5DN2 A;  2QVS B;  2PLV 1;  3CHX A;  1DQ2 A;  5L9R A;  3K46 A;  2BNO A;  2WUH A;  3D0S A;  4CEW C;  4CDW A;  5GZE A;  2GC3 A;  5CBL A;  2BGP A;  3KS7 A;  1YQ8 A;  2ZHK A;  3E1F 1;  1SDD B;  3GZA A;  4FQZ A;  1RUD 3;  2YBS A;  2VNV A;  2GNB A;  4Y26 A;  1Q8V A;  4YGD A;  2E26 A;  3QCW A;  4MGK E;  2TBV A;  5J09 A;  5FZC A;  3POI A;  2VZO A;  5FMB A;  3PU3 A;  1J58 A;  4E27 A;  4LKF A;  2RR1 2;  3MIH A;  5DZE A;  1W8N A;  1S0G A;  1ND2 C;  2D3R A;  2X05 A;  3RDI A;  3WNO A;  2HYX A;  1FT9 A;  3GHM A;  4A4A A;  2K46 A;  4XBN A;  3KSC A;  2A3W A;  3WCS A;  2WAO A;  3MUY 1;  5EJ1 B;  2JEN A;  2QKD A;  1OHF A;  4CP2 A;  1HJG A;  1JU4 A;  4QX8 A;  2Y6F A;  5FZL A;  4AAP A;  1BK0 A;  2HWF 2;  1XSQ A;  4XBQ A;  2J1V A;  3AP9 A;  4CXX A;  1HN1 A;  4XAB A;  1OPO A;  3KZ4 C;  5CFC B;  3TAY A;  1CQ9 A;  3LDK A;  2J7M A;  5DAX A;  4XET A;  2BP6 A;  3CJI C;  2XML A;  4ES9 A;  4GB3 2;  2EXK A;  2VZP A;  2CYF A;  2UWC A;  3THD A;  4NRO A;  4XDQ A;  5IVF A;  1VBE 1;  3AJY A;  4BB3 A;  1EYB A;  1WKY A;  5EQU A;  2RMU 2;  3W5N A;  4R4Z A;  5LY1 A;  2P17 A;  1CPN A;  1FMD 3;  4WBB A;  4YFZ A;  5L7O B;  3MEP A;  3AP5 A;  3HN1 A;  2DBI A;  4OHV A;  1BBT 2;  1JH5 A;  2HWB 3;  3VHP A;  3LB9 A;  2JIJ A;  5DMY A;  1LU1 A;  2BEO A;  1AR6 2;  4PDW A;  4XIO A;  1NXM A;  3UT0 A;  4BXS V;  3MF6 A;  1HQW A;  1MEC 3;  1S2K A;  3ENR A;  3BAL A;  1SLI A;  3I2D A;  3EBR A;  4XTM A;  5JPN B;  1P8J A;  1CD3 G;  1OA4 A;  2P37 A;  2X5I B;  1W06 A;  3Q9O A;  4QMA A;  5G05 L;  3U11 A;  3OGG A;  4K8F A;  4QGL A;  3B5L B;  2XJS A;  3ZSE A;  5ACA 2;  1UY2 A;  5J36 A;  3WDW A;  3OUJ A;  4UAP A;  1IKP A;  4LE3 A;  1O3S A;  2WRA A;  4GMP 3;  1L7L A;  1XU2 A;  2ZX0 A;  3D5O A;  3C7E A;  1VBA 3;  2VZV A;  2XGX A;  1SCR A;  5SV5 A;  2ZHM A;  4AVB A;  1KQR A;  2CWM A;  3ZN6 A;  4CCN A;  1N3O A;  1NQJ A;  2DCK A;  3FC0 A;  4Q0U A;  5C6C A;  2XLA A;  1CAX B;  1J1L A;  1UKG A;  2X5I A;  3T0A A;  1BVP 1;  3DYO A;  2Y34 A;  2DVG A;  4FAG A;  4NE9 A;  5FJH A;  4IES A;  3ZFE B;  5C5U A;  1W99 A;  4COV A;  2PA7 A;  1W39 A;  1OLQ A;  1O4Y A;  1GWL A;  1RXG A;  1XND A;  5ERL A;  5F2S A;  1T6G C;  4Q1R A;  3WF1 A;  2H0B A;  2Q8O A;  4Q27 A;  2RDS A;  4OUS A;  2JJ6 A;  1PVC 3;  2QQU A;  4MVT A;  3VZL A;  5I0D A;  1HRI 2;  1ACC A;  4UOJ A;  2RS5 2;  5ANN A;  2WNV B;  2QQL A;  1NXD 1;  4CA9 A;  1LHW A;  2O0O A;  2A6X A;  3DEC A;  3KV6 A;  3OEB A;  4KGQ A;  3O1T A;  3ILF A;  1R1A 2;  3LEG A;  5CVR A;  1F4A A;  4NAM A;  1IG3 A;  1I5Z A;  4AI0 A;  4MLO A;  4B29 A;  2TUN A;  1L7Q A;  1AR7 1;  5FZK A;  3GJA A;  4IEU A;  1EY2 A;  5A3T A;  1MQT C;  2R1B A;  4JKM A;  4N90 A;  4Q0Q A;  2UYB A;  2BUK A;  2VCM A;  4JQR A;  2VNG A;  4Y22 B;  3UL2 A;  4ERO A;  2EXH A;  5K0U A;  4A3X A;  2XL9 A;  3DKQ A;  2VME A;  2Y38 A;  3FBY A;  2XBO 2;  2ZGN A;  1RUF 1;  4GAZ A;  3N9Q A;  5F8P A;  2W95 A;  4P9G A;  4ASL A;  3HQX A;  2GP5 A;  5K8S A;  3N7M A;  4C90 A;  3RMX A;  4QKD A;  2HEY F;  2FDF A;  5FZ6 A;  2JD4 A;  4RHV 2;  1RIN A;  4XF9 A;  1XU1 A;  2PEL A;  1RUI 2;  5E16 A;  1D4M 3;  5FJK A;  2BWC A;  3BVC A;  1GIC A;  1WW6 A;  3IDC B;  5FZG A;  3WVJ A;  1NA1 A;  5IK4 A;  2BTV C;  3VHO A;  5JR7 B;  5T50 A;  5FO8 B;  2JDA A;  1DFQ A;  1G86 A;  2XKP A;  4QXB A;  3SEP A;  1ONA A;  2AZ5 A;  1DU3 D;  1AR6 1;  1GV9 A;  1WWY A;  4LA3 A;  1C5I A;  1O4Z A;  2R32 A;  4XFG A;  4Z8B A;  3ON7 A;  4XUT A;  3OGS A;  4AED C;  5LAS A;  2JKX A;  3LSD A;  4IEX A;  4URA A;  5KXE A;  1YCI A;  1BEV 2;  4EV0 A;  1ZZ6 A;  2JG9 A;  3QBQ A;  3NNM A;  5ACA 1;  4QQL A;  5JOW A;  1OOP C;  2ZX1 A;  3TEY A;  4UF0 A;  2ZML A;  1QJZ A;  1FPN 1;  5JIU A;  2B9U A;  2VZR A;  4NWW A;  4YVW A;  3MW4 A;  3IAQ A;  3K4Z A;  1BJQ A;  2TNF A;  3IDE A;  3VBH B;  4SBV A;  2J1E A;  2FDK A;  3AYE A;  3NNJ A;  4YVS C;  2A7A A;  2HKX A;  1ND3 B;  4MHR A;  4N53 A;  1NG0 A;  4PJY A;  3N9N A;  4IXL A;  4RFR B;  5I0T A;  1S1A A;  4HK8 A;  4YVS B;  2ES3 A;  2HJI A;  3BTZ A;  4EN8 B;  5CAZ A;  2YGL A;  1ZBE 1;  4M01 A;  4QGM A;  5IFT A;  3I3Q A;  5F1R A;  3IDA A;  1TMF 3;  3N9P A;  1HXS 3;  4Q2F A;  5FYM A;  3ZFG C;  4P00 B;  1Z7S 1;  3N35 A;  4HSJ A;  5FPU A;  1OOP B;  3O1V A;  4QM9 A;  5A7W A;  5BV6 A;  4JGZ C;  4DO0 A;  3WIN E;  3NV1 A;  5KHG A;  1GOF A;  5FKB A;  3ZMN A;  2YC0 A;  2Y6H A;  3UKN A;  1ZA7 A;  2VMF A;  4Q4V 1;  3WNP A;  5GKA C;  4Q0S A;  1LEC A;  4XE9 A;  3U4S A;  3C7H A;  4AED B;  3VUO A;  1QY4 A;  3OPT A;  1JZ7 A;  1WBL A;  1U5X A;  3I2G A;  2IFR A;  4KI5 M;  2EVX A;  1TNF A;  2BBV A;  1JYN A;  2WO7 A;  3LKJ A;  4BCU A;  2ZAH A;  4HPK B;  4LBQ A;  4LOS A;  4Z82 A;  4C0B A;  1OFS A;  3RSJ A; 
#chains in the Genus database with same CATH homology
 4CUG A;  3KV6 A;  5FXX A;  5A1L A;  5IVV A;  4IGQ A;  5FV3 A;  5FZK A;  5A3W A;  3PUA A;  2YBP A;  3KV5 A;  5FWE A;  2YBS A;  4CCK A;  5A3T A;  3AL6 A;  3RVH A;  5FZB A;  3DXU A;  2OQ7 A;  4QXC A;  5FYI A;  5A3P A;  5F5A A;  5FZO A;  5FZC A;  4CCL A;  3PU3 A;  5F32 A;  5F39 A;  4EYU A;  3KV4 A;  4GAZ A;  4Y3O A;  3N9Q A;  5FUN A;  4DIQ A;  5FWJ A;  5K4L A;  2GP5 A;  4GJZ A;  5FZF A;  5FZ9 A;  1VRB A;  5A7P A;  4QWN A;  5FZE A;  5A80 A;  5FZ1 A;  5FYT A;  5FZ6 A;  5FYH A;  5FYU A;  5FXV A;  5FY4 A;  2YU1 A;  5IVY A;  5ANQ A;  3PUS A;  5IW0 A;  4UF0 B;  3LD8 A;  4QX8 A;  4CCO A;  2GP3 A;  5FZL A;  5FJK A;  4AAP A;  2OT7 A;  5FXZ A;  5FZG A;  5F5C A;  4E4H A;  2XUE A;  3K3O A;  3OPW A;  5F2W A;  2OQ6 A;  3PUQ A;  3N9M A;  2YPD A;  5FP7 A;  4V2W A;  5FYY A;  5IVB A;  5F37 A;  5A7W B;  4QXB A;  5FZ7 A;  5FP9 A;  5FPA A;  3K3N A;  3ZLI A;  2XML A;  4C8D A;  5FZD A;  4LIT A;  5A7O A;  5IVC A;  4CSW A;  2P5B A;  5IVF A;  4Y33 A;  4TN7 A;  4XDP A;  4URA A;  5IVJ A;  5FZ4 A;  5FP4 A;  5FPL A;  5FPB A;  4ASK A;  4BIS A;  5FZI A;  5LWB A;  5LY1 A;  3PDQ A;  5E6H A;  2XDV A;  5A7S A;  3KVB A;  3KVA A;  5FZM A;  4D6Q A;  5FY9 A;  4UF0 A;  5ISL A;  4CCJ A;  4Y4R A;  4V2V A;  5FY8 A;  2WWJ A;  5FZ3 A;  5FY7 A;  4LIV A;  4BU2 A;  5F3I A;  5FZ0 A;  2WWU A;  2PXJ A;  5FZH A;  5FP8 A;  5FYC A;  3DXT A;  4IGO A;  3AVR A;  5FZA A;  4EZH A;  3KV9 A;  5F3E A;  3N9N A;  5F3C A;  5FYS A;  3AVS A;  5FXW A;  2W2I A;  5CEH A;  5FZO B;  4CCM A;  3PTR B;  5IVE A;  4XDO A;  2Q8C A;  4GJY A;  5FYV A;  5F3G A;  2OX0 A;  2Q8E A;  4CCN A;  4GD4 A;  3N9P A;  4BXF A;  5FYM A;  3K2O A;  3U78 A;  5FPV A;  4IGP A;  5FY0 A;  3AL5 A;  5FPU A;  2XXZ A;  4LXL A;  5FZ8 A;  5F5I A;  5A7W A;  4AI9 A;  4QU1 A;  4DO0 A;  2VD7 A;  3N9O A;  3NJY A;  5LY2 A;  5FBJ A;  5FY5 A;  5LW9 A;  5FY1 A;  5FJH A;  5FYB A;  2YU2 A;  3U4S A;  3ZPO A;  3OPT A;  3PU8 A;  3UYJ A;  5A3N A;  4D6R A;  5IWF A;  2OS2 A;  5FUP A;  5F2S A;  3LDB A;  3PUR A;  5FYZ A;  4EZ4 A;  4HOO A;  2Q8D A;  4QX7 A;  4D6S A;  4QXH A;  5A7N A;  3N9L A;  2YBK A;  5A1F A;  5KR7 A;  4NUB A;  5A7Q A;  4LIU A;  4HON A;  5FP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...