5F5IA

Crystal structure of human jmjd2a complexed with kdooa011340
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f5iA01
3PURA 5FPAA 5FZ6A 2Q8EA 5F3GA 4IGQA 5FY9A 5FPLA 4QXHA 3PUQA 5FXXA 5A7PA 3U78A 5F3CA 5FZEA 3DXUA 4HONA 4IGOA 5FZGA 3PU8A 3PU3A 4LITA 4LIVA 5F5AA 5F2WA 5FYYA 5FZ1A 4CCOA 4LXLA 1VRBA 2XXZA 4QWNA 5FZFA 4C8DA 5A3PA 5LY1A 5F2SA 3N9MA 2XUEA 4Y33A 5FPBA 5FZHA 5FYHA 5A7WB 4Y4RA 2OQ7A 4GJYA 2YU1A 5FPUA 3ZLIA 5FY7A 3KV5A 3KVBA 3LDBA 5FZAA 2GP5A 3PUAA 5FYIA 4V2WA 5FZKA 3OPWA 5A7WA 4E4HA 5A3NA 5FWJA 5F3IA 5IVBA 5FYBA 3KVAA 5A3WA 5FY0A 4CCNA 5F5CA 5FBJA 4QXBA 3UYJA 4URAA 2WWJA 5A7SA 5A3TA 5ISLA 5CEHA 3KV6A 2Q8CA 3OPTA 4D6RA 5FV3A 5A1FA 4CCMA 4GAZA 5F37A 5FP3A 3K3NA 2YBSA 5ANQA 5FZ7A 5FZ9A 4EZ4A 5FZBA 3AL6A 3AVRA 2YBPA 3PTRB 3NJYA 2W2IA 2OT7A 5FYVA 4BISA 4UF0A 5IW0A 5FZ0A 5IVCA 3PUSA 2OS2A 3RVHA 4CUGA 5IVVA 5FUNA 5FY5A 5FZOB 5FJHA 5LW9A 4QXCA 5F32A 4AAPA 3AVSA 5FPVA 4BXFA 4TN7A 5A80A 5FYZA 5IVEA 5FP8A 4Y3OA 2OX0A 2OQ6A 4NUBA 4V2VA 5FZOA 5FYTA 4UF0B 5FP9A 5F5IA 2WWUA 2VD7A 5FZDA 4EZHA 4EYUA 4XDPA 5FYUA 5KR7A 2YPDA 4ASKA 4CCJA 5FYMA 5A7NA 3DXTA 2PXJA 5FY4A 3N9PA 4D6SA 5FZMA 5K4LA 2XDVA 3K2OA 4QX8A 5IVYA 4BU2A 4QU1A 5FJKA 5FUPA 4DO0A 5IVJA 3KV4A 3N9NA 5LY2A 5A1LA 2YBKA 5FZLA 5F3EA 3KV9A 5FP4A 5FZ4A 2XMLA 4QX7A 4DIQA 5A7OA 5FY1A 5FXZA 4CSWA 3N9QA 3PDQA 4D6QA 5FYCA 2Q8DA 4LIUA 5FXWA 3U4SA 3ZPOA 5F39A 2YU2A 5FWEA 5FP7A 5FZCA 5A7QA 5IWFA 3AL5A 2P5BA 5FZ8A 4XDOA 4GD4A 2GP3A 5FZIA 5FXVA 4IGPA 4CCLA 3N9LA 4HOOA 4AI9A 4GJZA 5FZ3A 5E6HA 5FY8A 3N9OA 5LWBA 5FYSA 5IVFA 3LD8A 4CCKA 3K3OA
chains in the Genus database with same CATH superfamily
1S2BA 3SNMA 1KRIA 5F3GA 4HMZA 4Q4Y3 2WL1A 2QQIA 1RUF1 4H3WA 1GUIA 2GC1A 5FLIA 5FZEA 4AGVA 4RGGA 3F2ZA 4A7ZA 2I07B 1Z7S3 3VKNA 3C3VA 5JIUA 3GHMA 5DZFA 1ZRDA 1H8TC 4OUMA 1VBB1 1RUF2 2GAUA 4FSJA 3RG0A 1CAWB 2QQPA 4GXLA 3GHNA 1A6CA 2Z5WA 1RUG1 4HETA 5C3QA 4Y1VA 5JIAA 1NA1B 2H0BA 1VBB2 2LM3A 3CNAA 5FY7A 3BU0A 4CEWC 4BPZA 4CEYA 4AE2A 4QGLA 1NLRA 1FPN3 2ZACA 3LDRA 3V0AB 4HKWA 1RUG2 4XQWA 2GP5A 1W6MB 3ILFA 4YVSA 2ZX0A 3O1SA 3WD5A 2JG9B 2QKDA 3HNYM 4Z8BA 4CCNA 1APNA 5A3TA 3I2HA 2RS11 1QJY1 1O7FA 2NQYA 3NV2A 4XTPA 1REEA 3MDPA 4U2AA 3LEGA 4RQPC 3VZMA 1UY4A 3FUOA 2BBAA 1LKNA 1AR93 4QPGB 4EN9B 5BV6A 1W06A 2DVBA 4A3XA 3VZKA 3NAPC 2OUJA 4OI4A 2RS12 1QJY2 3DN7A 2AZ5A 1JYWA 2R0HA 4YZ1A 3CMGA 2H6BA 2ZX3A 4RL7A 1J58A 2LTNA 1UXXX 2QJVA 1Q8VA 5IFTA 1UYPA 4CDQB 4LKEA 3RZJA 4QX1A 2VUDA 1S1AA 2YYOA 5JZGB 3HVDA 3WG3A 2VZ3A 1QKQA 2I74A 4Y20A 2F6BA 1X50A 3SCHA 4XJZA 1Z0HA 5FMBA 3Q8FA 3ZFEA 5IVVA 4K6BA 4Q8KA 5FOJB 2GN3A 4BQ4A 1OPOA 1U5ZA 4GWNA 3ZSEA 3HT1A 3BB6A 1TMF3 4HANA 3VZNA 4I0WB 4MHUA 4H7LA 1H2KA 4EN0A 2VTXA 3JBG3 1OH4A 2G9FA 2Q5TA 1B35B 3UT0A 3M1HA 4AR2A 3TEWA 1H2LA 2EXHA 2OVUA 4P9GA 4F83A 4UF0B 4EWAA 3CF6E 1FXZA 3VBRC 2VD7A 5FPXA 1NKGA 3I3QA 2FDFA 5A3OA 1S0JA 1C28A 1POV1 4TLGA 1C1LA 1W0OA 3VL9A 4BQ5A 2FDKA 1NCQB 1AR63 3KQRA 1LCLA 1OT5A 1MS3A 3PVOA 1W8HA 4LQRA 1UL9A 2XDVA 3UGHA 2RM23 1PZ7A 2J1SA 4PDWB 4YYOA 2CAVA 3MV01 4Q27A 3IDAA 3DYPA 1HRI1 5A6YA 4L99A 4XJUA 3GBFA 2BP6A 5FXZA 3A4UA 1QDCA 4JKKA 3WOGA 1BKZA 2V73A 4LIUA 2PQQA 2G4IA 4JX0A 4Q0VA 4XFHA 1NCRB 4AQSA 5J3UA 4XF9A 1CAVA 3WP6A 3CLPA 1ND2A 3AP6A 3EQEA 1VBD1 4RHV3 4TYSA 1HRI2 1LR5A 2P5BA 3W58A 3ZFGA 3FHIB 4DQAA 4I02A 3HQRA 4HOOA 4J1WA 3IMMA 3BIEA 4WVMB 4LA2A 1HLCA 4DZGA 1VBD2 3IPVB 2EXJA 1UOFA 2XPJA 2HJIA 3BN6A 2WINB 4YM0A 3URFA 4ZU7A 2NLRA 4ISRA 1OLMA 2W3JA 2CV6A 3C8XA 3ECQA 4FPGA 1LNSA 2WA3A 5ACA1 5FZGA 2XQRA 3HJRA 1QU0A 2E7TA 2XOMA 3FBYA 4FPLA 5DAPA 1AUYA 4ISQA 4XHBA 4W6YA 3HQXA 4XUNA 4UT5A 5ACA2 1C8NA 1IOAA 1FX5A 5T5PA 3E97A 3WNMA 1OA4A 1HB1A 4XF3A 5H9RA 4FAGA 4D94A 5KXDA 3T0DA 2BVBA 1BBT3 1TG7A 1XB9A 5C4WC 4K1ZA 3OGJA 5FUIA 3VDDB 3KWVA 4Q4Y1 4ZS2A 2EALA 3WNPA 3HOBA 4BZ4A 5A3NA 3JQWA 2Y6JA 1K5MB 4JAAA 2JENA 3NKGA 1Z7S1 2WQ8A 3FBMA 4FTSA 2W47A 1YFYA 4JC1A 4Q4Y2 1RUI3 2QVSB 4FCAA 4MGIE 3ZMOA 1X9PA 2Q8CA 3V0BB 1OLRA 1OSGA 1SCRA 1Z7S2 1MS1A 2VQTA 2EA7A 1NG0A 3GBWA 3I2DA 3KSCA 1OQDA 5DUXA 5FP3A 5I91A 5KC5A 1W90A 3B69A 2ZGTA 3FN9A 3AL6A 2HWD3 5HV4A 3ZSMA 4NIGA 1RMU2 1FPN1 1O4ZA 1MZFA 4RSUA 4ZXEA 1ND3B 3WDWA 4V1PA 4C90A 1OA2A 1UOGA 2DYCA 3LQCA 1UY0A 3WY6A 3I2GA 4JTOA 1UF2C 3RQ0A 1OC1A 3M3EA 2QZ2A 2RR13 1YQ5A 1FPN2 3VKLA 3I59A 2A7AA 4ZZ8A 1ZX5A 2BPA2 2EAKA 2XL9A 5JMOA 5LW9A 1N1VA 2JG8C 1N1TA 1FV2A 1RJ8A 3ZXEA 5HBAA 1JH5A 1H8TA 1AR91 4CP1A 3USUA 4NHXA 1UZYA 3PNAA 2A6ZA 2BGCA 4YM1A 1V6JA 5J48A 3WVJA 1JZ8A 5DXDA 2D6MA 3Q8CA 1NT0A 1IPKA 1V6OA 4S2DA 1AR92 5C8CC 1WCSA 2KR2A 2WZEA 3SEPA 2B7YA 2VNRA 2WWUA 5FZDA 2E6VA 3CU7A 2FDIA 4IEPA 2ZGSA 1CAUB 3I97A 5FFOC 3AMMA 2E33A 4OLLA 1GMMA 4HFSA 5GLUA 1PMHX 3O1RA 5KC6A 3ACFA 4O9EA 5EV7A 5LY2A 1KS4A 4RQPA 4YVWC 4EROA 2WT2A 1PNGA 4CSWA 2Q1MA 1NXD1 1WMDA 1XSRA 4XURA 3ZMNA 1IS6A 1DCSA 3JBG1 4ET7A 2BV4A 4N90A 1TMF2 4XF0A 5FZCA 5A7QA 4Q0SA 3DCQA 1XE8A 4MGYE 2G1MA 5BNQA 1NLSA 2D98A 5EWSA 3JBG2 1XPWA 4R52A 1HJGA 2PN5A 3EYPA 4XETA 3FHAA 3HWJA 1AR61 3PLQA 2ZGKA 2ZBJA 4W4ZA 2JWPA 4XVHA 2RM21 1F5FA 3WG1A 5IAXA 1A34A 1RUE3 2FCTA 1HDKA 3K3OA 3PURA 2Z42A 4RS5B 2PHWA 4KWKA 1UWWA 5F3CA 1AR62 4QM8A 4Y22B 4A4AA 3RWNA 3ZN5A 2CWSA 2RM22 3WLUA 3WT3A 3ZFGB 3NKTA 3MV11 4YM3A 1SFNA 4CZSA 2GH2A 3KD4A 2I45A 3IWZA 4RHV1 1IKQA 5FREA 3RSJA 2JE7A 1D2SA 1GOHA 1BVP1 1UX6A 2VNOA 2X10A 4LBNA 4QPIA 1JZ3A 1W2OA 4Y4RA 5A70A 4YFWA 3VBRA 4NHYA 3I8TA 1UOJA 1SZBA 1US2A 4P9JA 1RUC3 4XFFA 3O1UA 3BCWA 3LA3A 1IS3A 3AX4A 4RHV2 5C3PA 2ZX4A 4LHLA 1W8TA 2PAKA 3L2HA 4J1XA 4RN5A 5DAWA 4BA6A 3N36A 1CVNA 4IV3B 5G04L 5IYYA 5FWJA 2XVGA 3H1YA 3IBMA 1EUTA 5L9BA 3SC7X 1JZ6A 4XBLA 3UYJA 1YFWA 1ENSA 2V5DA 3R4DB 2EVXA 1M06G 1AX1A 3BTZA 1AJOA 2J1VA 3WW4A 5CFCC 2GMEA 5CZKA 3HQUA 4BHPA 4Y1YA 4ES9A 3VLBB 2E51A 1PVC1 2WNUB 1WA6X 1UY3A 1VJ2A 2HWE3 3FE5A 4R9AA 3K4ZA 2VXRA 3RZMA 1LHNA 2DVGA 1KDKA 1BBT1 1S0FA 1E5IA 2HEWF 1W8OA 2HKXA 3WF3A 4F8AA 2OXBA 4UI9L 2YUEA 1QXJA 5LA0A 4LBQD 4QDSA 3O0VA 5EJ3A 5CFDA 3EMRA 1BBT2 3NJYA 3KCCA 4XEZA 1OD3A 1RUI1 4D8MA 4CUGA 5CA6A 1OOPB 2TEPA 3R0RA 1ZYBA 4PCRA 1XRUA 2ET7A 4XDQA 1VAVA 2X5IA 4YZ3A 2GNBA 3PTYA 4BYYA 4BXFA 1PM7A 1RITA 3I7DA 3MFAA 1HXS3 3VD5A 1RUI2 1RUOA 1DLCA 4CP9B 1Q56A 2HWD1 3AKPA 2WUHA 4FPHA 3NQHA 4M3CF 2OQ6A 1LGBA 4FXGB 1YJKA 3PJYA 5D2AA 5C4WA 2PHLA 3POWA 2IXJA 3P1IA 4MX3A 1QQP3 4QQOA 2VO5A 2HWD2 2W1SA 3Q8EA 2RR11 2K2SA 5LK7B 1H8TB 2XJVA 1AXYA 1GQHA 3LIGA 3OY8B 3Q9OA 5FY4A 4DNYA 2VZRA 1UY2A 3M2MA 3ZN4A 1W0NA 4IV1C 1AF9A 5BXXA 5LB6A 3WHUA 4MOAA 5BUVA 2DCJA 5A1LA 1AR73 1DGRA 2RR12 2X09A 3MPBA 4HVOA 2B9UA 3ZPYA 1AXKA 4OZOA 1XU2A 4BQYA 4CEWB 4B1MA 3N9QA 1V0AA 1NA1C 1NE4A 2XHNA 4OYUA 1RUH3 3LFMA 4QGMA 2GH8A 2VBBA 5A6QA 2DCZA 1QEXA 4AGRA 2BNOA 1O91A 3O0XA 1BEV1 4QU2A 1QF3A 2ZGNA 4QHBA 1KS5A 5FZ8A 3NV3A 4KU8A 2JG9C 1O3TA 1JW6A 2QDNA 4FPEA 4FQZA 4I0BA 2GMMA 5FY8A 1OMIA 1A3KA 2BZDA 2XLGA 3NNMA 4GB31 3NAPB 2A73B 3BOPA 1LULA 5C9AC 4XF1A 1MS9A 4LNVA 2O8OA 3THCA 5B4XA 4LXLA 1SLBA 4QWNA 5CIRA 4C8DA 4CDQC 1BMV2 3OB8A 3WF2A 3DPRC 4AQ2A 3RYRA 2ENRA 2QTWB 4IW3A 4OMCA 1SPPA 3WG4A 3IN9A 3H8UA 4LE3A 3I3DA 4XJWA 5C8CA 1I1EA 2W92A 5A7WB 4PBOA 3R6SA 1GZCA 1H9PA 4XZUG 1NYWA 2E32A 3E6DA 4QB2A 1RUE1 5EJZB 3ZYBA 2FDHA 1W0PA 2Y38A 3I3EA 5FZAA 2VVEA 1QJEA 3CL1A 3VD9A 1QNWA 2A3YA 5E89A 3THPA 4E4HA 4LK6A 4WM8C 1RUE2 3SQOA 4QXBA 1GNYA 2WWJA 4AOCA 2ZOEB 2C26A 1XBFA 2HWB3 4DEQA 1A8MA 4Q8LA 2PAMA 4YW1A 1DGWX 1ZVFA 4AFDA 4BQ3A 5KHIA 1W6OB 4CDWC 4OVEA 1IGOA 1ZRRA 3J4UH 4AFBA 2WT0A 4XYXA 1RUC1 2D97A 3HN1A 5KHKA 3AJYA 1ZZBA 2BERA 5DAVA 1DZRA 4O9GA 4PDWC 4OZXA 2KA3A 2TUNA 5J37A 4A3ZA 1JU4A 1MZ5A 5E1RA 1RUC2 2WNOA 3TAYA 2BW8A 1ENRA 1KEXA 1UMHA 2BOJA 1NCRC 2OW4A 3P3NA 3FC0A 2XWJB 5FTTC 3POIA 1DIWA 4YG6A 3EBRA 3RVHA 3NW4A 5LBCA 3U75A 5L7OC 4KWLA 5C71A 2VZTA 3HEIA 1IQDC 1LEDA 1KJLA 4BE3A 3A0NA 2HWE1 5K7PA 1V6IA 5J09A 1QHDA 4WZCA 3ZVXA 4UW3A 2P17A 2VGDA 4QT6A 3LFIA 1CR7A 2W1UA 3BYWA 1S0BA 3PHMA 5FYTA 3SH3A 1KJRA 1RUNA 4WM7C 2V72A 5B4NA 2HWE2 1G9CA 4K40A 3J7MA 1UYYA 4D7SA 3AKQA 5KR7A 4E8CA 3VZLA 3O1TA 1UU4A 1JYTA 3POSA 1GFF2 4EN6B 1J59A 1W6NB 5APAA 3EO6A 4AHYA 2VZSA 2VW1A 4DO0A 1HQNA 4YFZA 1YI9A 1UO9A 2AEZA 2Y60A 5CFCA 4P14A 4J25A 2AGSA 2Q1ZB 5A7OA 1HXS1 1RUJ3 5C4WB 1GQPA 1T2XA 5DZGA 2UY8A 4IEWA 4LO8A 3U4SA 5JDBA 1PK6A 2QBXA 1UOBA 3VDDC 2YGLA 3UESA 2NN8A 2WR9A 2BWAA 2WRAA 3IAPA 4N53A 1VALA 4G3YC 4KGQA 5F37A 1HXS2 4QQ2A 4LBLA 3TEXA 1QQP1 2YGMA 3QD6A 1K5MC 1O8SA 5GZGA 3MIEA 4UFJA 1RINA 3I4IA 4RFRB 3I2JA 1QOSA 3ZKYA 3N7KA 1GOFA 2HEVF 1QQP2 4MGSA 1QNYA 3BTAA 1AR71 2RS53 2A6WA 3QH6A 3BIWE 2P34A 5A7PA 3UNPA 1RUD3 3TNQA 1JZ4A 1I9RA 1RUH1 1TEIA 2VPVA 2VOTA 2R32A 3R4UA 4HKLA 3V65A 2YDEA 1ND3C 3U10A 4N7IA 4ZONA 1AR72 5GZDA 4AEKA 2NP0A 2B46X 3ILRA 1ACCA 1IS5A 4Y5Z0 3POFA 1RUH2 4KMQA 1SMVA 1YFXA 4GJYA 3WF0A 3HD8B 4FVVA 2JG8B 2VOKA 3ABZA 3VD7A 5K9YA 1DU3D 2VZOA 2DBIA 1GZTA 1E5HA 3GZUC 3KVBA 1ODMA 4GWIA 4IV1A 3VGIA 1PZ9A 2VMIA 1CAWA 1GWLA 2H6CA 3AKTA 4L8QA 4YPJA 2FZ1A 5D8AB 4KGGA 2WFPA 1SLAA 4W6WA 3GF6A 4M4PA 1YLLA 1GBGA 5FY0A 5A3WA 1SFPA 4NROA 5C8CB 1NA1A 4QKFA 3S5AA 1W03A 1DQ5A 3MUY1 3PVNA 3VBUB 3NV1A 3V0AA 1CQ9A 4HVRA 3OPTA 3WNLA 3OUHA 2XBO3 4JRLA 1H6YA 4XFIA 1D4VB 2BU9A 2P37A 3AKRA 4FPYA 3RI9A 3H8OA 2BNMA 4KQ7A 3ON7A 4BH9A 3SEEA 3NJZA 2JG9A 4LKDA 4A42A 3UKNA 5T52A 4EZ4A 5BNOC 3LCPA 3E5UA 4NRPA 4YVWB 1PO22 3RMYA 5DAXA 1H30A 3P6BA 4XPVA 4NWWA 4XHXA 4QPGA 4K3UA 2Y6HA 4JGZC 3ORJA 5CNAA 3NO8A 3R4SA 4OHZA 3RI8A 3VL8A 4YSFA 2ZMLA 3WHTA 4CCCA 5HCFA 1JOJA 5FYVA 3ZIXA 1DZTA 4EJRA 3V56A 1MS8A 5HCAA 1VR3A 3O1VA 4O7XA 3PUSA 2HWB1 3ZYFA 3D4KA 2QFEA 3H9AA 3JB4C 5FJHA 4XXAA 4CDQA 3L9JT 3T2TA 4R9BA 1RHI3 5I0UA 3VHPA 2GNMA 1CZTA 2ZA9A 4LBQB 2YROA 5LASA 2HWB2 1F2NA 2VW2A 4SLIA 3VBOC 5FP8A 4NHLA 1HN1A 1EY2A 4QHOA 2YY1A 3ENRA 1WLCA 1NZIA 2VW0A 1ODNA 4Q4V3 4RS5C 2JXAA 4UFKA 5DMYA 2Q0AA 2YMZA 3KT7A 5F8PA 5CG9A 3SXWA 3KCYA 4DPNA 3VDBA 1JBCA 2WLQA 5I0SA 1XYOA 1LESA 1UZWA 2VMHA 1CZVA 1HIXA 1K3IA 5A7NA 3N7MA 2D6NA 1D4M3 1B35A 3NNJA 3N7JA 3K2OA 3HMYA 1S0CA 2QQMA 3A21A 4XE9A 5C3SA 5JPMB 1YQ8A 2R0FA 4UFLA 2WNEA 5GJ6A 4C1XA 1YIFA 2J42A 1NCQA 5JOZA 5H9PA 2B45X 2JICA 4Y5TA 3T0AA 2XGXA 4QQPA 2P3KA 3OEBA 2ZEYA 1WCQA 1VRH3 4PDWA 2XJTA 4PQQA 4DB5A 1UN1A 4LA3A 3W5NA 2UURA 1XJAA 5FXVA 3MUZ1 3LSDA 2F4PA 3DF0A 3SCGA 3DGTA 1YWKA 5ERLA 1WLWA 1NCRA 1W6QA 3CO2A 3ZSKA 2C9KA 5JXIA 4JQTA 1LHOA 3NSTA 3SKVA 4BMEA 2VZUA 2QQWA 5L7OA 4Y1ZA 2WNUC 3IMNA 5I93A 3U1XA 2DV9A 1G9FA 1RUJ1 4XTMA 4PLOA 1C57A 4Q2FA 2JB8A 2GALA 1UZZA 4LITA 4WVMA 3IPVA 5T5OA 4MXWA 1NXMA 2LW8A 3N9MA 3ES1A 5FO9B 1RUJ2 4NIDA 2W87A 3WUCA 1EP0A 5FZHA 1LU1A 4CXYA 2OQ7A 1QJFA 4D7TA 3NVCA 1R64A 5L9VA 2CNAA 4FOYA 4FP2A 1SFYA 3WSOA 1YI7A 1YQ2A 2RS51 2ORXA 3C7FA 4AQTA 3BU7A 2LUWA 4V2WA 4Y24A 1RUD1 4AFAA 2ETEA 1HV0A 3KVAA 2O1QA 2JDPA 2RHPA 4AG4A 4OHWA 4A44A 3ZR6A 2E63A 1LOCA 2P3YA 4GMP3 5ISLA 2RS52 1JS9A 1PIV3 3VDDA 4XJ8A 1RUD2 4D6RA 2YC2A 4YGCA 3U07A 1QH6A 2VZPA 3W5MA 3BTXA 5EPAA 4GAZA 4PIYA 1K5MA 2MPFA 2P6HA 1UMIA 4XJAA 4IV1B 4HKOA 4QMAA 5FZ9A 4XJ9A 1NQJA 1RMU3 2YC4A 2FMYA 3ZXFA 5BY5A 1CAXB 4KG0A 3UETA 1QJX2 4JGYC 3P5BA 2D5FA 4K7JA 5LBFA 4B4PA 2CAUA 2DF7A 1SLIA 4FOWA 4XCAA 4YW7A 4FTEA 2XL7A 3V0BA 3W21A 2TBVA 2WFF3 2WQZC 5A32B 3OJBA 5LATA 4OI0A 1QH7A 2R30A 1YYNA 2D40A 1Y9QA 1HRV3 1SACA 3SLIA 1DYPA 5KHHA 4CUAA 4EE2A 3PIGA 1LU2A 1ND3A 2XBO1 2R063 4QB6A 4XILA 1X9TA 1BK0A 2WC2A 4Z82A 4XUQA 5E16A 3MBWA 4AVBA 3DKWA 4KU7A 4NJ4A 5HI0A 3GBGA 2XBO2 4ITCA 5FCCA 3S7EA 3U14A 4FPJA 3VD4A 2K0GA 2OX0A 5AC93 5C9AB 4MYEA 2RJKA 3JD73 4MGKE 5CU1A 4ATFA 4NMIA 1ZRIA 1CIWA 1KFUL 2YPDA 3M4FA 4UW6A 4RGAA 4WV8A 4ZPIA 3DPRB 5E88A 1AYN3 5A3LA 1QJU3 1POV0 3LIHA 3RS6A 4E2QA 2CDOA 2EAAA 1RHI1 5CAZA 1R1ZA 4S2HA 5FP4A 3SCFA 4XQDA 2WJSA 4E9KA 4NHMA 1CAUA 3FX3A 3IIAA 1UZVA 4LUMA 3ZYPA 2ID4A 3LDKA 3UKTA 4NIHA 3O0WA 3JU9A 1RHI2 4Q4V1 5F9TA 3B9IA 2DURA 2IWGB 2YC0A 2NM1A 3BALA 3AL5A 3K77A 4M3CE 2E7AA 4WM8B 4N9IA 2EIDA 4XDOA 1PHMA 2C4XA 2VC9A 4Z2WA 1VBA3 3S6PA 5EP9A 4IGPA 4C0HA 4AI9A 4GJZA 4Q4V2 5E6HA 5A3MA 1D4M1 4ZU4A 3AKSA 5C70A 2WIIB 3OUJA 4CDWB 4NPMA 1FNYA 5C33A 1NAEA 3CIHA 1WBFA 4IGQA 3AMQA 4O65A 2PHRA 1AYM3 1J3QA 1W8FA 1D4M2 2JIGA 1VBE3 2CL2A 1W2TA 5JCTA 1L3JA 5F5AA 5F2WA 4H2AA 1KDMA 4LMFA 5DABA 2XXZA 2ZZJA 4A7KA 1W2UA 5A3PA 3FHQA 1VRH1 4RS5A 3U4XA 4Q4W3 1W6QB 3NMBA 4FQ4A 2Q4SA 4Y22A 2YU1A 3UGGA 4M00A 4FOQA 5L7OB 3B00A 1H6XA 1VRH2 4YW6A 3WNKA 4K1YA 3GYDA 4MADA 1TNRA 1IKPA 3UGFA 4GH4B 3ZR5A 4MXWB 5DPNA 4EV0A 2IXKA 3UL2A 1SEFA 2VULA 4JVAA 3W59A 3KF5A 5FMOS 3MW3A 4COYA 1N1SA 2D6LX 4GMP0 2EF6A 4Q29A 4WM7B 1URXA 1CONA 5A7SA 3MGUA 5BNPC 1CWPA 2IUWA 1SHWB 4HG6B 2OZ6A 4IV3A 4XCBA 4BM8A 4OI1A 1QXPA 1W28A 5CG8A 1U12A 1X8MA 3VHRA 3A0KA 3HNMA 4Z1VA 1WCUA 5J1XA 3OUIA 4OQ9A 2HWC3 3FFZA 4Q26A 1J84A 3N3HA 1E5SA 1HV1A 1C1FA 2QZ3A 4HL0A 2VCCA 3ZXGA 5FOBB 2PHDA 4META 3MYXA 1OUXA 3LEIA 3ST7A 2G19A 2GNDA 2XKOA 2ZMNA 4RD7A 5GLVA 3POEA 5SV5A 2WNUA 2ZHKA 5GZCA 4Q4X3 2L9LA 1ULFA 5AVPA 4BOWA 2W2IA 1IZ3A 1AX2A 1Q8PA 1UD1A 5E8AA 4GMP1 1OF3A 1OKQA 1TVGA 3OEAA 1PIV1 3OD4A 1U5YA 2WDBA 3M7AA 1HQLA 1NY71 4LOTA 4OULA 5F5QA 2ZKNA 2C1FA 2PYTA 3SMHA 1J3PA 1DGLA 3B93A 4R8HA 4N7UA 2B42B 1RMU1 3K48A 4IDZA 3ZKUA 1PIV2 1GQGA 1XNKA 5BYNA 4QXKA 5L73A 1NY72 1PGSA 5IK7A 1OHFA 1OOPA 2WQ4A 3WF4A 4GKYA 3B5LB 3OGVA 1F8VA 2KM2A 2WFF1 3ZYGA 3ELNA 4M0HA 3WXPA 2AUYA 3NJXA 1S0DA 5JVVA 4IESA 4QKNA 3VB9A 2HLEA 2JDYA 1LGNA 4CP9A 1HRV1 1C5IA 5J98B 4D6SA 1NOVA 3WZ1A 1O3SA 4SBVA 2VCBA 1VE0A 2WFF2 2R061 3KGZA 2PHFA 1VMFA 4HBNA 1OVSA 1EV13 4QX7A 1HRV2 3AXEA 2ERFA 2WN2A 1F15A 1K42A 1XQNA 3OY8A 4AI8A 4B7KA 2R062 2ZGOA 5AC91 4YW5A 3QH7A 2WN3A 4JTNA 2JDHA 3JD71 1UYZA 2H0VA 5D8AC 5A33B 3J7NA 4CEWA 1UNBA 3WDXA 2JECA 4YZ5A 1ZBA2 3CZUA 5AC92 1QJU1 3VBUC 2Y34A 1QMJA 3JD72 1WMFA 4AK3A 2QDRA 2OA2A 1MS4A 2CGOA 2W52A 5BNOB 5DDJ3 1AYN2 3WQ7A 2E31A 4PIZA 1QJU2 3KHBA 1WW6A 2R6QA 4PT6A 1TMF1 2ARXA 4QQHA 2JDZA 4I2OA 4KWJA 3AP7A 3MFCA 1WCKA 1LOBA 1VRBA 3I54A 1JI6A 3PMEA 4JGZB 3RMXA 1REDA 5A6XA 1KXGA 3BPSA 4IEZA 3T2OA 3NAPA 2E9QA 3PMSA 1VBA1 3GJBA 1LHUA 2P6CA 1UAIA 4QDQA 2X8KA 4LJHA 5T55A 4O61A 2AH2A 4IE0A 1JHNA 2CU5A 4TXWA 4N43C 3B9CA 1WBLA 1U0AA 4M4RA 4R4ZA 1VBA2 2CTVA 1KGYA 1Y4WA 3HBKA 3ZN6A 3VBOB 4LPLA 4YZ4A 1FATA 2VUJA 5A7WA 1AYM1 1D7PM 4UOJA 3G7DA 1VBE1 3SH5A 2D3SA 4AHXA 5F5CA 2KD7A 5CADA 4GALA 4NR1A 1BJQA 3WG2A 1NUKA 3VBSC 1AYM2 3PJQA 4Q4W1 4QD2A 1VBE2 2VMEA 1S2EA 4M0NA 1ULPA 2YBSA 1TME3 2XQXA 4PHZA 1V00A 3EJKA 1MS0A 4Q4W2 1YJLA 3KT1A 4YGEA 1JZ2A 4ZHNA 4K9SA 4AEMA 3WV6A 1W6OA 2ZEWA 2P3JA 4QAWA 3JB8A 1D2QA 2ZS6B 4BQXA 3IKWA 5T50A 1VLNA 1OQEA 3QBQA 4AI3A 4NHKA 5FAXA 4FPCA 2V5YA 1BK1A 2A6XA 1HB3A 4PIXA 2XG3A 4DMIA 3NWKA 4JHTA 2XONA 3ZXJA 4HLTA 4BLIA 2OIIA 1SLLA 2C6SA 3HIFA 4DFSA 1G9AA 3I2OA 3LOBA 2DBNA 2HWC1 5LRSA 1ZM1A 4YG3A 1C5HA 2NPIA 5JAXA 5FMOL 1HKDA 3H7JA 1GP4A 4K21A 1LHWA 1O6UA 1OLME 3GNEA 4V2VA 3OGRA 4UFHA 5FP9A 2GU9A 2VOXA 1DZQA 1YQ6A 2HWC2 4MGTA 3NRUA 4KH9A 2WZR3 2Y6KA 2Z69A 4Q4X1 2EICA 1ST8A 5D1IA 4MSVA 5K0UB 3I49A 3ES4A 2VOVA 1D0GA 3TEYA 1RXFA 2XJSA 1M4WA 2WT1A 3MLJA 1O5UA 4Q4X2 5BNPA 2YV8A 5AFEA 5FZLA 3E5QA 4DIQA 1FI2A 2O0OA 3BGAA 2BRTA 3VBHB 1UPIA 3PDQA 5L36A 3LB9A 3O12A 1LEMA 3E6BA 3ZPOA 3IM0A 1W6NA 2XJRA 4GWMA 3NNLA 4XFCA 2ZGQA 2RJLA 4Q5OA 5IHRA 5H9SA 2Z79A 1C4RA 1AHSA 1JHJA 1QWRA 4N8MA 3K75B 4AAPA 1U5XA 4NAOA 4LHNA 5FZIA 3CQOA 2OYZA 2JB4A 1LAJA 4P9WA 1Q3EA 5GZFA 2UWCA 2O14A 1RYYA 1DQ1A 3U37A 2NMOA 1YEWA 3ZFFB 1WW7A 1XE7A 4JKLA 2J1EA 4KNCA 1EYBA 4MHRA 1CGPA 2OPWA 4TTGA 2ZXQA 4R4XA 5JOWA 3VBFC 4IERA 1EV11 1F9KA 1OFSA 4QXHA 5FPLA 3ZYIB 4FBFA 3DXUA 4YNIA 4JGYB 4HONA 2WWSA 4Q0PA 3SHRA 5I8SA 1YC61 4CCOA 1LB2A 5JSOA 2AENA 3OTFA 1EV12 4BCUA 1SBFA 1JN2P 2UWAA 2XB6C 3KGLA 5CISA 4FTBA 4BLJA 4JQRA 4DXZA 3RZLA 3VDCA 3WNOA 2DTYA 2UYAA 1GWKA 3S7IA 5CKQA 4CUCA 1JMUB 1CPMA 3WF1A 3ZLIA 1DYKA 1W8ZA 2E7QA 1X33A 3A7QA 3RZGA 3FFQA 1OBNA 1JU3A 4ORFA 5DDJ1 1ZZ9A 2HBUA 2JKXA 1XNBA 4X6RB 4EQVA 4P9LA 5IK5A 3ETQA 3OBZA 2ZJCA 4QX2A 1BMV1 4CDUC 4NWVA 2JG8A 2PMWB 2WA4A 3FLTA 1VBC3 2FDJA 4QQLA 1WGPA 2JD4A 4Y26A 5DDJ2 2IXIA 2PAEA 3KV6A 4ARYA 1R093 2VECA 2CGNA 4KWUA 5I8TA 3AM2A 5D8AA 4KL1A 2IXLA 1SBEA 1AJKA 1PO23 4GQ7A 1W8UA 1ZNPA 2UWBA 3VBUA 4QB1A 1H4HA 3ZXLA 3F95A 4XUOA 5JOYA 1I6XA 3AMPA 1UKRA 1JXNA 1OF4A 4BMBA 1W99A 1PMJX 2MNGA 5JMCA 2RS32 5H9QA 4BISA 1US3A 4YVWA 4ZKTB 4YGDA 5FK8A 5FZOB 1GU3A 1WKYA 1MQTB 3D8CA 1MZEA 2X53S 4YZ2A 1UW8A 4E4ZA 5C3RA 5GZEA 5L9RA 1NLQA 1SG3A 3AXDA 1CX4A 3KB5A 3O14A 1LOFC 5FPVA 3VDAA 3LKJA 5IVEA 2HEYF 3MPPG 4LBMA 4QKDA 4NVPA 5DAQA 2W95A 3T1MA 3GGLA 1TME2 4FOVA 3APBA 4UXAA 2HH9A 3I2FA 1AVBA 2EXIA 4LBQA 4XDPA 4CP0A 1F4HA 4XFGA 3DUIA 1X8EA 1QOTA 2DU1A 2C24A 3D82A 5K4LA 3BUCA 1ZZCA 2W39A 3MIFA 4LBKA 5FMCA 1GNZA 4CU7A 3T4VA 1Q8SA 4IEUA 1O59A 4CYDA 1O4TA 4GULA 3HT2A 2VM9A 3IDEA 5C3OA 2E26A 2R1DA 3CJXA 4CDXC 4YARA 4I30A 3H8RA 4NN0A 1X7NA 2D3PA 2ZX1A 1XXNA 4GH4C 3VHNA 4CUBA 2WNVC 4LHKA 1LECA 3AB0A 3T09A 2WZR1 2GP3A 2ZPXA 5BNPB 1ASJ3 3KM5A 5FLJA 4XAEA 1GOGA 3CHXA 3LSEA 1XNTA 3ZDVA 1RIRA 4IEYA 4CCKA 4RA0A 5CBLA 2WZR2 5FZ6A 4CU9A 5EQUA 1LENA 1OKOA 3OBRA 4HN1A 3ZXKA 1WCDJ 1F5JA 4RR3C 4EWEA 3INAA 4QPWA 4XF4A 4L9BA 5FYYA 4XBNA 5J36A 3LPGA 4X8NA 3SH4A 1G8WA 3AFKA 1IPJA 1QOOA 3OBAA 1TZOA 4XXPA 5DG1A 3JZVA 3WQBA 5BNNB 4P5YA 3CDZB 1XNAA 3IAQA 4K20A 1DP0A 3LOIA 4CTEA 2P3IA 5FMDA 2Y6GA 1OFNA 4BIOA 3ASIA 3Q8BA 5A3UA 3WNNA 1JTZX 3MIGA 4W8JA 2QQKA 1ONAA 2J1RA 1FAYA 1GP5A 2OPKA 4CXWA 1V6MA 3OPWA 5IT6A 4UBHA 1RJ7A 2RE9A 4ASLA 1SCSA 5FBJA 3TNPB 2W94A 4XQ4A 1UMZA 3OOXA 1OA3A 4D3WA 1HN0A 2SLIA 3DEMA 4QPYA 5FPZA 4FI9A 3IDCB 2A6VA 4LO7A 2FBEA 4P00B 1QJX3 3ME2A 3FLPA 3POJA 2VVDA 2VJXA 2V09A 2YB7A 4UFIA 5EFUA 1CD3G 5EHDA 1WLDA 4QX5A 4BQ2A 1OH3A 3TEZA 4CU8A 4CEYC 1QDOA 5DG2A 2ARBA 4CCDA 4P02B 3RRDA 3ZYJB 1HX6A 2QQVA 3ACGA 1KFXL 1VBC1 1A78A 5IVCA 1CAXA 4COVA 1H1MA 1SDWA 2A3WA 4YVSC 1GNHA 5FY5A 1R091 2ILMA 1C8M3 2J1AA 3HNBM 3LAGA 4DXTA 1QXRA 1S0EA 2WSUA 2DCYA 4OI2A 2BJSA 1UU6A 1VBC2 2VUCA 5A32A 3B02A 4TN7A 4OCTA 1V9U3 4XABA 3AYCA 5FYZA 3RYPA 1PO21 4LHSA 1R092 3C7OA 1JYXA 3K4DA 1SLTA 5CB7A 3WNXA 2VQAA 4CVUA 2WS92 4L92A 3WQ0A 4AQ6A 3NNFA 4D69A 2DU0A 4E4DX 3H7YA 5JSPA 3B01A 2RDNA 4X8PA 3WCSA 2YPJA 4EYUA 2W5FA 1W8WA 2JE8A 1WA4A 1D0HA 4G9SB 1YUDA 1PX4A 5C9AA 3L2YA 2N7GA 3SITA 2BOIA 1FNZA 4PLMA 4QU1A 5FJKA 4BU2A 3N9NA 1PO13 4A2UA 5LEKA 5SV8A 3POYA 3ZFEC 2VUAA 4N43B 2ZEXA 2XJPA 4KI5M 5HCHA 1G9DA 1REFA 1FV3A 1SQ4A 3DPRA 3O5SA 3ETPA 1JODA 3AMNA 3WP5A 1W39A 2HWF3 4YW2A 4KBBA 5HPOA 4ATEA 5FR3A 1OVPA 4AI0A 1VAMA 2BGOA 2YHJA 3FMGA 1IQAA 1H2NA 2GZWA 1AL23 3QCWA 4EN8B 1X36A 2PLV3 3VBSB 1PM4A 1BXHA 3AYAA 5AVAA 2D6PA 1W3VA 2DVFA 4C91A 3LD8A 1GZ9A 5CYYA 4JDMA 2VQUA 1ZA7A 4LEJA 2Q8EA 2AEYA 3WDYA 2ZEZA 5G05L 4WM8A 3W20A 2ZMKA 1W9FA 5GKAC 4JZRA 2R073 2XHKA 4TSVA 2JD9A 1DQ2A 1UIKA 4DXSA 2WYFA 3OCPA 4CDWA 4DUWA 3N4MA 1S0GA 4AZZA 3S57A 4XBQA 5IATA 3T30A 3AMHA 4FXKB 3WW3A 5JLVA 2OUHA 3NV4A 4MGQA 4NE9A 1ASJ1 1HB4A 2I2SA 4WBBA 4XACA 3S5QA 5FPUA 4FAHA 1UCXA 4F7ZA 3OYWB 1ZBE3 5T5JA 1LGCA 4DINB 4K8FA 2UU8A 3EB7A 3LDBA 1DYOA 4L2NA 1ASJ2 1POQA 2VXJA 3RJRA 1PNFA 2GNTA 5FQ0B 1L7QA 5FYBA 4QM9A 4D0QA 4C1WA 4YLZA 2UY9A 5JXHA 1Y9GA 4AVVA 1UQXA 4CDXA 3FUQA 3RWKX 2QQOA 4GH4A 4CCMA 3O7OA 2ADEA 3M70A 2WNVA 4AEJA 4AWDA 2BWCA 4I0AA 4NOTA 4AFCA 1STMA 2VE1A 3BPZA 4LO5B 3X29B 4WM7A 2G9GA 5K0UC 1ZREA 3DECA 5FZBA 4ZZ5A 4YWAA 3N7LA 3OGSA 4JKMA 2DCTA 1XYNA 3ZIWA 2KXLA 3VBHC 1BYHA 2W0XA 2ZAAA 2RVAA 5BPXA 3T1LA 5KXBA 1GSLA 3T2QA 2ZKLA 1ENQA 3M3IA 4I01A 4E2GA 2XH6A 1ULCA 5FUNA 2WAAA 1YNAA 5HXMA 5CKMA 4R9CA 5KXEA 5F6LB 4QXCA 2ES3A 2VZVA 1DF0A 3TB0A 1W9TA 5EYYA 5T3NA 2QNKA 3TN93 1QJX1 3MHZA 1I5ZA 1GLHA 4FT8A 3ZFFC 1OD5A 3J9SA 3LA7A 1SBDA 3T08A 3VBFB 5C7GA 3PUHA 1VMJA 2VQ0A 2VU9A 2D5HA 4NIAA 2R043 2Q8OA 4RFT0 4EZHA 3BKZA 1G9BA 3S0MA 2TNFA 2HYKA 1DLLA 2B9VA 4LK7A 4A45A 4XW3A 2WAOA 3SKJE 2B4KA 4TLFA 4MO3M 4XFBA 1Y3TA 3N9PA 5KHJA 2Y8KA 3WCRA 5C5TA 1YFUA 1FOD3 1C8M1 5ABJC 3H1MA 2A71A 4MH0E 4ONUA 2YXSA 5F3EA 3OD0A 1V9U1 2AREA 3BODA 4HPKB 5FDBA 4D6QA 1C8M2 1K12A 3H3LA 1QIQA 5LA9A 3H50A 1WMEA 4DUVA 4AXOA 2Y64A 5IWFA 1V9U2 4CDUB 4MG2A 1ZBA3 5CKNA 2XLAA 5T54A 1AL0G 3TBDA 2JDMA 3M8LA 2J1UA 5JWPA 3AZXA 4OQ8A 5LWBA 4E4SA 4WVVA 1AX0A 2QQLA 4FPFA 3LPFA 4IE7A 4JHZA 3SISA 1ENXA 4M01A 4AHWA 1PO11 4Y1UA 4XAAA 5A33A 1KITA 3KZ4C 2RG4A 1U5IA 2XR4A 4H7MA 4FPOB 4P5HA 4A7YA 4L97A 2HWF1 3ITQA 1PO12 3LEMA 4XC9A 3AZWA 5EXOA 5F2SA 4BWOA 2XUEA 4LTAA 2VCMA 3H3ZA 5BNOA 4X6QB 1F4AA 5FO7B 5KWRA 4M3CB 1AL21 5JI7A 2FMDA 2VVFA 1VMHA 2HWF2 2PLV1 2P1BA 4DRRA 2PTMA 3CJIB 5JXGA 5FKBA 5JUVA 1J3RA 4JGZA 1MQTC 4A6SA 2DUQA 1DQ4A 4B7EA 1AL22 1W6PB 2PLV2 1Y9MA 4H14A 2R071 2DVDA 1DHKB 5F3IA 1K45A 4I3GA 4CU6A 4P08A 1OUSA 3OSDA 1BZWA 5CEHA 4LKFA 2QCSB 2W9XA 5C8WA 2R072 2DFBA 4XUTA 3VBOA 1V70A 3K46A 4COWA 5EIYB 1YCIA 1EAH3 2D7FA 4FFIA 4DUXA 1VB4A 1BQPA 2ADDA 2EIBA 4QPIC 4FFFA 5GLTA 3JQXA 1ZBE1 4XUPA 4Y5SA 1W05A 1L7LA 3LEKA 4LR4A 3WX5A 4OUSA 3IZOA 2FCUA 2XVKA 4W50A 2YBPA 1XSQA 5LZ6A 4LBOA 5LCWL 4CDXB 3CKHA 1W3XA 1ZBE2 4DRVA 4DXRA 3C2UA 1PVXA 2WNVB 3HPNA 5F6KA 4COUA 5T5LA 5DUWA 3V64A 2FD8A 1YHFA 1MACA 2IVJA 1IG3A 4JRAA 1R083 3H3UA 3UJOA 4P9XA 1KQRA 4Z07A 2ZGUA 1XYPA 1J83A 3ALQA 4ZU5A 2Y6LA 5DN2A 3GDBA 2ZAHA 3KCXA 1DQ6A 3VKOA 1GWMA 4ASMB 1IPSA 2ZGLA 3E6CC 3IDBB 2QUOA 4LO6B 4Q1RA 4XFAA 2LRPA 3D0SA 3MW4A 4RR3B 2R7EB 2W08A 2RDSA 5FYUA 1LHVA 3RDIA 2VBPA 4GIQA 3HAGA 1O3RA 3H42B 3HN3A 1JOPA 4D7YA 2D44A 3QOPA 4AVAA 1ZRCA 5CFDC 4AI1A 1NX9A 3GJAA 5IVYA 1QJZA 5BNNC 4G4FA 3ZYRA 4Q1PA 1GZWA 2AC1A 3B7MA 5FY1A 1R1A3 3TN91 3UV9A 4JCKA 3KF3A 2Q1FA 4TWTA 3BOWA 3THDA 2X5IC 3TOJA 5K0UA 4IUGA 3RGBA 3HBZA 1PMIA 2A1XA 3GZEA 3NL1A 2HYXA 2ZHNA 2R041 1PVC3 5FBZA 1COV3 3TN92 2JIJA 3AP9A 4ZS3A 2WSVA 4HXCA 1PGW1 3VBHA 4W65A 2K9ZA 1CN1A 1CIYA 3A23A 1XC6A 2DTWA 2ARCA 3USSA 3CBNA 1H9WA 2R042 2VL4A 4S2FA 1FOD1 2Y0OA 1PGW2 5FPAA 2WBKA 2DUPA 2SBAA 2D43A 1ULEA 1YQCA 2AR6A 1FOD2 4LIVA 2XLFA 3PU3A 2XKPA 4LORA 2J7MA 1MEC3 4LE4A 4QX0A 3ZFFA 4A41A 3MIBA 2JJ6A 3PVEA 3RZKA 1WUVA 4CEYB 2X05A 2VAUA 5FRAA 2ZGPA 3RYKA 5JR7B 1ZBA1 5FYHA 1LODA 2BFUS 4JGYA 5LA1A 4YVSB 5GLWA 3T2PA 4HK9A 1CESA 1UX7A 2MEV3 3IB3A 2QQUA 3KV5A 1AYN1 2Y26A 4WVWA 5ABJA 2ET1A 1W2AX 2V4VA 2O8QA 3AP5A 2D6KA 2C5DA 3ACLA 4MVTA 3MLLA 4UBGA 4URAA 1NQDA 2VMCA 2ZHLA 2RMU3 2X29A 3OPZA 3I2KA 2J1TA 4XZPA 4UFMA 1Q8OA 5A1FA 1JOBA 3ZOIA 1AR83 3JXSA 2RV9A 1OXCA 2ORZA 4GZ9A 2VMDA 5L19A 1BEV3 4Y20B 3FL7A 3ZFEB 4NO4A 4BB3A 4UAPA 3VKMA 4CRQA 2RS33 3T3YA 1AXZA 5HCBA 5HXVA 1X82A 2AACA 4LULA 4QX3A 4IE6A 1S4CA 1GP6A 4DY5A 3ROUA 4FP3A 1K5JA 3QLQA 2VMFA 4GB33 4IL7A 4DEVA 4E2SA 3DYOA 5KHGA 3AZZA 1S0IA 1RXGA 1Q8QA 4MGZE 4W6XA 2Z4FA 4BQWA 1O8PA 1EAH1 1GR3A 3CEWA 1XNDA 1XOYA 3VUOA 1HW5A 4FFGA 1SDDB 2QQJA 5IUQA 5I0RA 1AZDA 4PI0A 3RZZA 4QGNA 1O3QA 1N3PA 5FZOA 1JYNA 1JZ7A 1MQTA 2D3RA 1EAH2 3D3AA 4EWDA 3WUDA 1XE0A 4N9HA 1RL3A 3D6EA 4LT5A 5DZEA 2FQPA 2DWRA 1N3QA 5FYMA 2D6OX 4QHZA 3WW2A 3J8F3 2PXJA 2NMNA 4AF9A 5GM0A 1LOGA 1CAVB 5DQ0A 1ND2B 1R081 3TWIA 2BUKA 2ARAA 4TZDA 4YM2A 3RJ2X 3WW1A 3KV9A 5FZ4A 2VY0A 2XMLA 1WD3A 1XNCA 4NRMA 4AEDC 1R082 1BHGA 1ZZ8A 3MIDA 1GYKA 2BQPA 2LALA 2WO3A 2GC3A 3EHKA 1UU5A 1W9SA 1W2NA 5TSWA 2PHTA 5KXCA 2FDGA 3ZDSA 2DDUA 1WMXA 2VMGA 2YFUA 5FZ3A 3WDTA 2IFRA 5C5UA 4NAMA 3OBTA 2ZGRA 4MLOA 1GZWB 2ZABA 4OMDA 3OGGA 2CDPA 3WR0A 3DYMA 5DUVA 3ZSLA 2PHXA 4JDOA 5FY9A 4B4QA 3U78A 2JDUA 2ZZQA 1GICA 1R1A1 2GN7A 4PI2A 2EIGA 1GV9A 2VH9A 3OF1A 1F31A 2VCAA 2YFZA 3B94A 2EIEA 3BVCA 3MF6A 3NJVA 5LY1A 1G86A 2JE9A 2QE3A 2XVLA 4LKSA 1COV1 1Y43B 1R1A2 3ACIA 3AZYA 4Y33A 1WD4A 2NYYA 1PK6C 2A75A 5I8YA 2IC1A 4HT1T 4N53C 2WO7A 3ZN6B 2F17A 2WYSA 1PVC2 2JX9A 3LGRA 1COV2 4C0BA 3RNSA 1ALYA 3PUIA 2ZCWA 1H1AA 1YXWA 2PHUA 4I3PA 2JDAA 2VNVA 2G9ZA 4AFMA 1RC6A 1VB2A 2ZTNA 5BNNA 3KLSA 4IQPA 1UY1A 4BK4A 5M0TA 2DCKA 1LRHA 3POBA 3T0BA 1CJPA 3NNGA 1ZRFA 4XIOA 3AFGA 1MEC1 1KD7A 4HSLA 3VZJA 4QKBA 1T6BX 1OI6A 3A22A 3MIHA 4CPBD 3ZSJA 2RDRA 4AVTA 3RPQA 4IEXA 2V4AA 1GKBA 5D21A 4AL9A 3N35A 4NRQA 1MEC2 1Q43A 5CVRA 1P8JA 3K3NA 4A6OA 4RGKA 3FJSA 4ZY9A 1B09A 2LS6A 5ABJB 2A6YA 2Q30A 1DQ0A 1I5PA 2R1BA 2MEV1 3I59B 2YG0A 4AVCA 2E53A 2FHRA 4MZUA 4CA9A 1V6LA 5LEJA 3KHCA 3USUB 2CYFA 2GDFA 2MEV2 3HR9A 1HQWA 3D0JA 4Z92B 1IS4A 3C7HA 3QACA 2BFUL 2RMU1 1QGLA 5JXJA 3BTYA 2OS2A 4YRDA 3WINE 1MVQA 1DG6A 3AYDA 4GA9A 4ES8A 2JEMA 2R49A 3AVSA 1AR81 4BXSV 1LOAA 2RMU2 3B3QE 5A80A 1VAKA 2WS93 1GANA 1QY4A 2GC0A 2UYBA 4IXLA 4PJYA 4PLNA 1EPWA 4Y3OA 1ZZ7A 1YO8A 2R16A 2Z2SB 5GALA 1UYXA 1AR82 2RS31 2B5HA 3WP3A 2P4EA 4RQPB 4UW5A 1BEV2 4INDA 5IK4A 3LWCA 4YW4A 3DXTA 4HN0A 1IHMA 1J1TA 1H8VA 1Z78A 4QPGC 4DOUA 3VKFC 3I3MA 1I3HA 3VZOA 4QX8A 1PZ8A 5FUPA 4NIIA 5IVJA 3KV4A 4UWDA 4IEQA 3ATGA 5IAVA 3THTA 3AK0A 3UK9A 1JYCA 3ACHA 2WKKA 4GB32 2QQNA 3CJIC 5DUUA 1JZ5A 1YIPA 3MF9A 3VV1A 2PA7A 5JZGC 3E1F1 1TME1 2XJUA 3ZYHA 5B2GB 2VTFA 4BIFA 2DUOA 3VD3A 4YW3A 2GSYA 4HK8A 3FWEA 4LLFA 4N43A 3ZXDA 4OFGA 4PQ9A 1ULGA 3MICA 1N47A 3FZ3A 2IXHA 3J8F1 1ULOA 4CP2A 2Y0IA 3MLKA 2BYVE 3G6JB 2RJ2A 4J6GA 1W8NA 3I2IA 3MI8A 4QPIB 1Q5OA 3KT4A 1G7YA 5LRRA 1B35C 3J8F2 3PUQA 5FXXA 4IE4A 4MUVA 3VBRB 3MW2A 4IGOA 3VBSA 1A8DA 5KBFA 5FZ1A 3GALA 1T6GC 1RVF3 1S55A 3JUUA 2C9AA 1MS5A 2XJQA 1NCQC 4MXVA 4Q0UA 3J7HA 3PIJA 5FPBA 1H0BA 4CXXA 4AW7A 2WZ8A 3UJQA 3ZX7A 3KS7A 4GWJA 4QDRA 5IJRA 3TRSB 3GCWA 2VNGA 5LK5A 2ATFA 5FYIA 1C3HA 1EPZA 1JUHA 5FZKA 3C7GA 1NZCA 2OZJA 3OYWA 4CPBA 4IEOA 2HBTA 4AEDA 3GM8A 4XMAA 2ZHMA 1FMD3 5J7MA 3LF7A 5FQ0A 2BTVC 2GC2A 2A70A 2F4LA 1VIWB 1VPHA 5ANQA 5I0TA 3VHOA 2DVAA 5FZ7A 4AGGA 5CFDB 2VTXJ 2YZ4A 3ZXAC 1WZXA 1ZZ6A 3IT8A 1XU1A 1BCXA 4WVZA 4OHYA 1OPMA 2A3XA 3W9AA 4AVSA 1O4YA 2X5IB 3PTRB 4LUKA 5ANNA 3GZAA 4LOSA 2VG9A 5K8SA 5FZ0A 4IE5A 4XIKA 4DY3A 3AZVA 1E57A 1JYVA 2VR4A 1SLCA 4S2GA 5F1RA 3WDUA 2W68A 3WP4A 1J1LA 5GLZA 3WQ1A 4P9YA 3R05A 4R9DA 4U36A 3CZJA 3ZM8A 1WW5A 2W1WA 4L11A 3S30A 2PQSA 2CGPA 1ZA4A 4NUBA 4B29A 4B1LA 4Q0QA 4XMIA 5HV0A 3O1MA 5LBBA 2PELA 3ZO0B 3DL3A 5F5IA 4HZFA 4E27A 3MZHA 2BDRA 4ASKA 4CCJA 4ARXA 1TE1B 2K46A 2W46A 5JI9A 4HSJA 3VBFA 1PX3A 3GZTB 5FZMA 2JDNA 3LZZA 2IVIB 4WZFA 1OQ1A 1WW4A 2VOWA 4Y1XA 2BNNA 1W04A 3PL0A 4UW4A 4BK5A 1H4GA 5F7UA 2VZQA 1OURA 1WLTA 2YBKA 4BDVB 1RUF3 3AYEA 2WS91 3GCXA 2Q8DA 1W9WA 3VN4A 5FXWA 4DS0A 1CX1A 5FO8B 4KBZA 3RFRA 1PGL1 2ZGMA 3OG2A 4LBJA 2WABA 5F39A 5FWEA 5JPNB 3BI3A 1EUUA 1BLZA 4I09A 4NPLA 1VBB3 3MEPA 3KMHA 3C7EA 4GD4A 2CHHA 5EJ1B 2WLPA 2WZPP 2BEOA 4HPKA 5LA2A 1DGRN 4CCLA 2IZWA 5AFBA 1PGL2 1RUG3 3EXUA 4MV2A 4NPRA 4YGBA 3N9OA 1L7RA 3UKVA 4KG8A 4AYUA 4P9IA 2CSGA 1MR5A 1BVVA 4AI2A 4UYBA 3LA2A 4CDUA 4Z2AA 1SPPB 1UPSA 5C6CA 1DDLA 3U0ZA 4OHVA 2GMPA 3D5OA 1RGSA 1VP6A 3PU8A 4JDNA 2J22A 4YG0A 2EXKA 3WDVA 3WEZA 2FZ2A 5FZFA 1F35A 2RS13 1QJY3 1W6MA 3U11A 1ULDA 3TYJA 3PVBB 2XWBB 4AAXA 4COZA 1DFQA 2C0ZA 4GKXA 3K51A 3I3BA 2ZX2A 4LO4B 4EN7B 3AJZA 3KQ4B 3O1OA 2CY6A 2Y6FA 5JR2A 1UXZA 2NZ9A 2XUMA 3LE0A 4Y4YA 1W9YA 5IK8A 5FLHA 3PUAA 4M3CA 4B4RA 1TNFA 3M3QA 1N3OA 5IVBA 4FFHA 1FT9A 3CJIA 1MZ6A 4B8EA 1Y7BA 1YRZA 1RVF1 1S2KA 1LOEA 1UZ0A 4ZXKA 3T4HB 5JZGA 1LOFA 5FV3A 1W6PA 1N1YA 3J26N 3DKQA 3FLRA 5FK7A 2DFCA 4CE8A 1RVF2 4PF1A 1HJFA 5A1AA 1ND2C 4H55A 3AVRA 3O1PA 3JCIA 2WO1A 1CJDA 5I0DA 4HVQA 4FO9A 3ZFGC 4URTA 2W91A 4AEDB 3MO4A 4K8RB 1MPXA 1CZSA 2RDQA 1POV3 3H8XA 3E5XA 2OT7A 2PFWA 4RYDA 4F3JA 4UF0A 1V6KA 5IW0A 4BJ0A 2LROA 4FPKA 3GXUA 3DV8A 2IXCA 4PF5A 2P2KA 3ILNA 5FKCA 1LJ7A 1FMD1 2VZ1A 3M3CA 4XOGA 5F32A 4OHXA 2WO2A 4IEVA 4L0PA 5FIXA 2FCVA 1HRI3 1CPNA 1E5RA 1MVEA 4CCEA 2VBDA 1DGWA 5JSRA 4IV3C 3RZHA 1O5LA 1FMD2 4E8DA 1RTVA 3IIIA 2OKXA 2IFWA 1VBD3 3H0OA 5J96B 2BGPA 5CFCB 1V6NA 2Y33A 4OUEA 5LBEA 1HB2A 3M3OA 5A6ZA 3Q8AA 1H2MA 4AHZA 1H1IA 2A5ZA 2W1QA 3K4AA 1PK6B 2MHFA 5JOXA 5EYXA 1WWYA 2BBVA 4B3NA 4N53B 3POGA 3P3PA 4RR3A 3J7LA 2CWMA 1JUIA 2B39A 1IG0A 1TQ5A 5ACA3 4IETA 4PBPA 1UKGA 5FYCA 2B8MA 1OLQA 2YU2A 2JKBA 1LTEA 1UIJA 5FP7A 4JV4A 1FYUA 2D93A 3AP4A 5EZWA 5IFPA 2BVVA 1OOPC 2AYHA 3N9LA 1NE6A 3AC0A 1RB8G 1G6NA 4BQ1A 2JDKA 5FYSA 3H1WA 5IVFA 1JYIA 4LLOA 1DBNA
chains in the Genus database with same CATH topology
3PURA 5FPAA 5FZ6A 2Q8EA 5F3GA 4IGQA 5FY9A 5FPLA 4QXHA 3PUQA 5FXXA 5A7PA 3U78A 5F3CA 5FZEA 3DXUA 4HONA 4IGOA 5FZGA 3PU8A 3PU3A 4LITA 4LIVA 5F5AA 5F2WA 5FYYA 5FZ1A 4CCOA 4LXLA 1VRBA 2XXZA 4QWNA 5FZFA 4C8DA 5A3PA 5LY1A 5F2SA 3N9MA 2XUEA 4Y33A 5FPBA 5FZHA 5FYHA 5A7WB 4Y4RA 2OQ7A 4GJYA 2YU1A 5FPUA 3ZLIA 5FY7A 3KV5A 3KVBA 3LDBA 5FZAA 2GP5A 3PUAA 5FYIA 4V2WA 5FZKA 3OPWA 5A7WA 4E4HA 5A3NA 5FWJA 5F3IA 5IVBA 5FYBA 3KVAA 5A3WA 5FY0A 4CCNA 5F5CA 5FBJA 4QXBA 3UYJA 4URAA 2WWJA 5A7SA 5A3TA 5ISLA 5CEHA 3KV6A 2Q8CA 3OPTA 4D6RA 5FV3A 5A1FA 4CCMA 4GAZA 5F37A 5FP3A 3K3NA 2YBSA 5ANQA 5FZ7A 5FZ9A 4EZ4A 5FZBA 3AL6A 3AVRA 2YBPA 3PTRB 3NJYA 2W2IA 2OT7A 5FYVA 4BISA 4UF0A 5IW0A 5FZ0A 5IVCA 3PUSA 2OS2A 3RVHA 4CUGA 5IVVA 5FUNA 5FY5A 5FZOB 5FJHA 5LW9A 4QXCA 5F32A 4AAPA 3AVSA 5FPVA 4BXFA 4TN7A 5A80A 5FYZA 5IVEA 5FP8A 4Y3OA 2OX0A 2OQ6A 4NUBA 4V2VA 5FZOA 5FYTA 4UF0B 5FP9A 5F5IA 2WWUA 2VD7A 5FZDA 4EZHA 4EYUA 4XDPA 5FYUA 5KR7A 2YPDA 4ASKA 4CCJA 5FYMA 5A7NA 3DXTA 2PXJA 5FY4A 3N9PA 4D6SA 5FZMA 5K4LA 2XDVA 3K2OA 4QX8A 5IVYA 4BU2A 4QU1A 5FJKA 5FUPA 4DO0A 5IVJA 3KV4A 3N9NA 5LY2A 5A1LA 2YBKA 5FZLA 5F3EA 3KV9A 5FP4A 5FZ4A 2XMLA 4QX7A 4DIQA 5A7OA 5FY1A 5FXZA 4CSWA 3N9QA 3PDQA 4D6QA 5FYCA 2Q8DA 4LIUA 5FXWA 3U4SA 3ZPOA 5F39A 2YU2A 5FWEA 5FP7A 5FZCA 5A7QA 5IWFA 3AL5A 2P5BA 5FZ8A 4XDOA 4GD4A 2GP3A 5FZIA 5FXVA 4IGPA 4CCLA 3N9LA 4HOOA 4AI9A 4GJZA 5FZ3A 5E6HA 5FY8A 3N9OA 5LWBA 5FYSA 5IVFA 3LD8A 4CCKA 3K3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUR A;  5FPA A;  5FZ6 A;  2Q8E A;  5F3G A;  4IGQ A;  5FY9 A;  5FPL A;  4QXH A;  3PUQ A;  5FXX A;  5A7P A;  3U78 A;  5F3C A;  5FZE A;  3DXU A;  4HON A;  4IGO A;  5FZG A;  3PU8 A;  3PU3 A;  4LIT A;  4LIV A;  5F5A A;  5F2W A;  5FYY A;  5FZ1 A;  4CCO A;  4LXL A;  1VRB A;  2XXZ A;  4QWN A;  5FZF A;  4C8D A;  5A3P A;  5LY1 A;  5F2S A;  3N9M A;  2XUE A;  4Y33 A;  5FPB A;  5FZH A;  5FYH A;  5A7W B;  4Y4R A;  2OQ7 A;  4GJY A;  2YU1 A;  5FPU A;  3ZLI A;  5FY7 A;  3KV5 A;  3KVB A;  3LDB A;  5FZA A;  2GP5 A;  3PUA A;  5FYI A;  4V2W A;  5FZK A;  3OPW A;  5A7W A;  4E4H A;  5A3N A;  5FWJ A;  5F3I A;  5IVB A;  5FYB A;  3KVA A;  5A3W A;  5FY0 A;  4CCN A;  5F5C A;  5FBJ A;  4QXB A;  3UYJ A;  4URA A;  2WWJ A;  5A7S A;  5A3T A;  5ISL A;  5CEH A;  3KV6 A;  2Q8C A;  3OPT A;  4D6R A;  5FV3 A;  5A1F A;  4CCM A;  4GAZ A;  5F37 A;  5FP3 A;  3K3N A;  2YBS A;  5ANQ A;  5FZ7 A;  5FZ9 A;  4EZ4 A;  5FZB A;  3AL6 A;  3AVR A;  2YBP A;  3PTR B;  3NJY A;  2W2I A;  2OT7 A;  5FYV A;  4BIS A;  4UF0 A;  5IW0 A;  5FZ0 A;  5IVC A;  3PUS A;  2OS2 A;  3RVH A;  4CUG A;  5IVV A;  5FUN A;  5FY5 A;  5FZO B;  5FJH A;  5LW9 A;  4QXC A;  5F32 A;  4AAP A;  3AVS A;  5FPV A;  4BXF A;  4TN7 A;  5A80 A;  5FYZ A;  5IVE A;  5FP8 A;  4Y3O A;  2OX0 A;  2OQ6 A;  4NUB A;  4V2V A;  5FZO A;  5FYT A;  4UF0 B;  5FP9 A;  5F5I A;  2WWU A;  2VD7 A;  5FZD A;  4EZH A;  4EYU A;  4XDP A;  5FYU A;  5KR7 A;  2YPD A;  4ASK A;  4CCJ A;  5FYM A;  5A7N A;  3DXT A;  2PXJ A;  5FY4 A;  3N9P A;  4D6S A;  5FZM A;  5K4L A;  2XDV A;  3K2O A;  4QX8 A;  5IVY A;  4BU2 A;  4QU1 A;  5FJK A;  5FUP A;  4DO0 A;  5IVJ A;  3KV4 A;  3N9N A;  5LY2 A;  5A1L A;  2YBK A;  5FZL A;  5F3E A;  3KV9 A;  5FP4 A;  5FZ4 A;  2XML A;  4QX7 A;  4DIQ A;  5A7O A;  5FY1 A;  5FXZ A;  4CSW A;  3N9Q A;  3PDQ A;  4D6Q A;  5FYC A;  2Q8D A;  4LIU A;  5FXW A;  3U4S A;  3ZPO A;  5F39 A;  2YU2 A;  5FWE A;  5FP7 A;  5FZC A;  5A7Q A;  5IWF A;  3AL5 A;  2P5B A;  5FZ8 A;  4XDO A;  4GD4 A;  2GP3 A;  5FZI A;  5FXV A;  4IGP A;  4CCL A;  3N9L A;  4HOO A;  4AI9 A;  4GJZ A;  5FZ3 A;  5E6H A;  5FY8 A;  3N9O A;  5LWB A;  5FYS A;  5IVF A;  3LD8 A;  4CCK A;  3K3O A; 
#chains in the Genus database with same CATH topology
 1S2B A;  3SNM A;  1KRI A;  5F3G A;  4HMZ A;  4Q4Y 3;  2WL1 A;  2QQI A;  1RUF 1;  4H3W A;  1GUI A;  2GC1 A;  5FLI A;  5FZE A;  4AGV A;  4RGG A;  3F2Z A;  4A7Z A;  2I07 B;  1Z7S 3;  3VKN A;  3C3V A;  5JIU A;  3GHM A;  5DZF A;  1ZRD A;  1H8T C;  4OUM A;  1VBB 1;  1RUF 2;  2GAU A;  4FSJ A;  3RG0 A;  1CAW B;  2QQP A;  4GXL A;  3GHN A;  1A6C A;  2Z5W A;  1RUG 1;  4HET A;  5C3Q A;  4Y1V A;  5JIA A;  1NA1 B;  2H0B A;  1VBB 2;  2LM3 A;  3CNA A;  5FY7 A;  3BU0 A;  4CEW C;  4BPZ A;  4CEY A;  4AE2 A;  4QGL A;  1NLR A;  1FPN 3;  2ZAC A;  3LDR A;  3V0A B;  4HKW A;  1RUG 2;  4XQW A;  2GP5 A;  1W6M B;  3ILF A;  4YVS A;  2ZX0 A;  3O1S A;  3WD5 A;  2JG9 B;  2QKD A;  3HNY M;  4Z8B A;  4CCN A;  1APN A;  5A3T A;  3I2H A;  2RS1 1;  1QJY 1;  1O7F A;  2NQY A;  3NV2 A;  4XTP A;  1REE A;  3MDP A;  4U2A A;  3LEG A;  4RQP C;  3VZM A;  1UY4 A;  3FUO A;  2BBA A;  1LKN A;  1AR9 3;  4QPG B;  4EN9 B;  5BV6 A;  1W06 A;  2DVB A;  4A3X A;  3VZK A;  3NAP C;  2OUJ A;  4OI4 A;  2RS1 2;  1QJY 2;  3DN7 A;  2AZ5 A;  1JYW A;  2R0H A;  4YZ1 A;  3CMG A;  2H6B A;  2ZX3 A;  4RL7 A;  1J58 A;  2LTN A;  1UXX X;  2QJV A;  1Q8V A;  5IFT A;  1UYP A;  4CDQ B;  4LKE A;  3RZJ A;  4QX1 A;  2VUD A;  1S1A A;  2YYO A;  5JZG B;  3HVD A;  3WG3 A;  2VZ3 A;  1QKQ A;  2I74 A;  4Y20 A;  2F6B A;  1X50 A;  3SCH A;  4XJZ A;  1Z0H A;  5FMB A;  3Q8F A;  3ZFE A;  5IVV A;  4K6B A;  4Q8K A;  5FOJ B;  2GN3 A;  4BQ4 A;  1OPO A;  1U5Z A;  4GWN A;  3ZSE A;  3HT1 A;  3BB6 A;  1TMF 3;  4HAN A;  3VZN A;  4I0W B;  4MHU A;  4H7L A;  1H2K A;  4EN0 A;  2VTX A;  3JBG 3;  1OH4 A;  2G9F A;  2Q5T A;  1B35 B;  3UT0 A;  3M1H A;  4AR2 A;  3TEW A;  1H2L A;  2EXH A;  2OVU A;  4P9G A;  4F83 A;  4UF0 B;  4EWA A;  3CF6 E;  1FXZ A;  3VBR C;  2VD7 A;  5FPX A;  1NKG A;  3I3Q A;  2FDF A;  5A3O A;  1S0J A;  1C28 A;  1POV 1;  4TLG A;  1C1L A;  1W0O A;  3VL9 A;  4BQ5 A;  2FDK A;  1NCQ B;  1AR6 3;  3KQR A;  1LCL A;  1OT5 A;  1MS3 A;  3PVO A;  1W8H A;  4LQR A;  1UL9 A;  2XDV A;  3UGH A;  2RM2 3;  1PZ7 A;  2J1S A;  4PDW B;  4YYO A;  2CAV A;  3MV0 1;  4Q27 A;  3IDA A;  3DYP A;  1HRI 1;  5A6Y A;  4L99 A;  4XJU A;  3GBF A;  2BP6 A;  5FXZ A;  3A4U A;  1QDC A;  4JKK A;  3WOG A;  1BKZ A;  2V73 A;  4LIU A;  2PQQ A;  2G4I A;  4JX0 A;  4Q0V A;  4XFH A;  1NCR B;  4AQS A;  5J3U A;  4XF9 A;  1CAV A;  3WP6 A;  3CLP A;  1ND2 A;  3AP6 A;  3EQE A;  1VBD 1;  4RHV 3;  4TYS A;  1HRI 2;  1LR5 A;  2P5B A;  3W58 A;  3ZFG A;  3FHI B;  4DQA A;  4I02 A;  3HQR A;  4HOO A;  4J1W A;  3IMM A;  3BIE A;  4WVM B;  4LA2 A;  1HLC A;  4DZG A;  1VBD 2;  3IPV B;  2EXJ A;  1UOF A;  2XPJ A;  2HJI A;  3BN6 A;  2WIN B;  4YM0 A;  3URF A;  4ZU7 A;  2NLR A;  4ISR A;  1OLM A;  2W3J A;  2CV6 A;  3C8X A;  3ECQ A;  4FPG A;  1LNS A;  2WA3 A;  5ACA 1;  5FZG A;  2XQR A;  3HJR A;  1QU0 A;  2E7T A;  2XOM A;  3FBY A;  4FPL A;  5DAP A;  1AUY A;  4ISQ A;  4XHB A;  4W6Y A;  3HQX A;  4XUN A;  4UT5 A;  5ACA 2;  1C8N A;  1IOA A;  1FX5 A;  5T5P A;  3E97 A;  3WNM A;  1OA4 A;  1HB1 A;  4XF3 A;  5H9R A;  4FAG A;  4D94 A;  5KXD A;  3T0D A;  2BVB A;  1BBT 3;  1TG7 A;  1XB9 A;  5C4W C;  4K1Z A;  3OGJ A;  5FUI A;  3VDD B;  3KWV A;  4Q4Y 1;  4ZS2 A;  2EAL A;  3WNP A;  3HOB A;  4BZ4 A;  5A3N A;  3JQW A;  2Y6J A;  1K5M B;  4JAA A;  2JEN A;  3NKG A;  1Z7S 1;  2WQ8 A;  3FBM A;  4FTS A;  2W47 A;  1YFY A;  4JC1 A;  4Q4Y 2;  1RUI 3;  2QVS B;  4FCA A;  4MGI E;  3ZMO A;  1X9P A;  2Q8C A;  3V0B B;  1OLR A;  1OSG A;  1SCR A;  1Z7S 2;  1MS1 A;  2VQT A;  2EA7 A;  1NG0 A;  3GBW A;  3I2D A;  3KSC A;  1OQD A;  5DUX A;  5FP3 A;  5I91 A;  5KC5 A;  1W90 A;  3B69 A;  2ZGT A;  3FN9 A;  3AL6 A;  2HWD 3;  5HV4 A;  3ZSM A;  4NIG A;  1RMU 2;  1FPN 1;  1O4Z A;  1MZF A;  4RSU A;  4ZXE A;  1ND3 B;  3WDW A;  4V1P A;  4C90 A;  1OA2 A;  1UOG A;  2DYC A;  3LQC A;  1UY0 A;  3WY6 A;  3I2G A;  4JTO A;  1UF2 C;  3RQ0 A;  1OC1 A;  3M3E A;  2QZ2 A;  2RR1 3;  1YQ5 A;  1FPN 2;  3VKL A;  3I59 A;  2A7A A;  4ZZ8 A;  1ZX5 A;  2BPA 2;  2EAK A;  2XL9 A;  5JMO A;  5LW9 A;  1N1V A;  2JG8 C;  1N1T A;  1FV2 A;  1RJ8 A;  3ZXE A;  5HBA A;  1JH5 A;  1H8T A;  1AR9 1;  4CP1 A;  3USU A;  4NHX A;  1UZY A;  3PNA A;  2A6Z A;  2BGC A;  4YM1 A;  1V6J A;  5J48 A;  3WVJ A;  1JZ8 A;  5DXD A;  2D6M A;  3Q8C A;  1NT0 A;  1IPK A;  1V6O A;  4S2D A;  1AR9 2;  5C8C C;  1WCS A;  2KR2 A;  2WZE A;  3SEP A;  2B7Y A;  2VNR A;  2WWU A;  5FZD A;  2E6V A;  3CU7 A;  2FDI A;  4IEP A;  2ZGS A;  1CAU B;  3I97 A;  5FFO C;  3AMM A;  2E33 A;  4OLL A;  1GMM A;  4HFS A;  5GLU A;  1PMH X;  3O1R A;  5KC6 A;  3ACF A;  4O9E A;  5EV7 A;  5LY2 A;  1KS4 A;  4RQP A;  4YVW C;  4ERO A;  2WT2 A;  1PNG A;  4CSW A;  2Q1M A;  1NXD 1;  1WMD A;  1XSR A;  4XUR A;  3ZMN A;  1IS6 A;  1DCS A;  3JBG 1;  4ET7 A;  2BV4 A;  4N90 A;  1TMF 2;  4XF0 A;  5FZC A;  5A7Q A;  4Q0S A;  3DCQ A;  1XE8 A;  4MGY E;  2G1M A;  5BNQ A;  1NLS A;  2D98 A;  5EWS A;  3JBG 2;  1XPW A;  4R52 A;  1HJG A;  2PN5 A;  3EYP A;  4XET A;  3FHA A;  3HWJ A;  1AR6 1;  3PLQ A;  2ZGK A;  2ZBJ A;  4W4Z A;  2JWP A;  4XVH A;  2RM2 1;  1F5F A;  3WG1 A;  5IAX A;  1A34 A;  1RUE 3;  2FCT A;  1HDK A;  3K3O A;  3PUR A;  2Z42 A;  4RS5 B;  2PHW A;  4KWK A;  1UWW A;  5F3C A;  1AR6 2;  4QM8 A;  4Y22 B;  4A4A A;  3RWN A;  3ZN5 A;  2CWS A;  2RM2 2;  3WLU A;  3WT3 A;  3ZFG B;  3NKT A;  3MV1 1;  4YM3 A;  1SFN A;  4CZS A;  2GH2 A;  3KD4 A;  2I45 A;  3IWZ A;  4RHV 1;  1IKQ A;  5FRE A;  3RSJ A;  2JE7 A;  1D2S A;  1GOH A;  1BVP 1;  1UX6 A;  2VNO A;  2X10 A;  4LBN A;  4QPI A;  1JZ3 A;  1W2O A;  4Y4R A;  5A70 A;  4YFW A;  3VBR A;  4NHY A;  3I8T A;  1UOJ A;  1SZB A;  1US2 A;  4P9J A;  1RUC 3;  4XFF A;  3O1U A;  3BCW A;  3LA3 A;  1IS3 A;  3AX4 A;  4RHV 2;  5C3P A;  2ZX4 A;  4LHL A;  1W8T A;  2PAK A;  3L2H A;  4J1X A;  4RN5 A;  5DAW A;  4BA6 A;  3N36 A;  1CVN A;  4IV3 B;  5G04 L;  5IYY A;  5FWJ A;  2XVG A;  3H1Y A;  3IBM A;  1EUT A;  5L9B A;  3SC7 X;  1JZ6 A;  4XBL A;  3UYJ A;  1YFW A;  1ENS A;  2V5D A;  3R4D B;  2EVX A;  1M06 G;  1AX1 A;  3BTZ A;  1AJO A;  2J1V A;  3WW4 A;  5CFC C;  2GME A;  5CZK A;  3HQU A;  4BHP A;  4Y1Y A;  4ES9 A;  3VLB B;  2E51 A;  1PVC 1;  2WNU B;  1WA6 X;  1UY3 A;  1VJ2 A;  2HWE 3;  3FE5 A;  4R9A A;  3K4Z A;  2VXR A;  3RZM A;  1LHN A;  2DVG A;  1KDK A;  1BBT 1;  1S0F A;  1E5I A;  2HEW F;  1W8O A;  2HKX A;  3WF3 A;  4F8A A;  2OXB A;  4UI9 L;  2YUE A;  1QXJ A;  5LA0 A;  4LBQ D;  4QDS A;  3O0V A;  5EJ3 A;  5CFD A;  3EMR A;  1BBT 2;  3NJY A;  3KCC A;  4XEZ A;  1OD3 A;  1RUI 1;  4D8M A;  4CUG A;  5CA6 A;  1OOP B;  2TEP A;  3R0R A;  1ZYB A;  4PCR A;  1XRU A;  2ET7 A;  4XDQ A;  1VAV A;  2X5I A;  4YZ3 A;  2GNB A;  3PTY A;  4BYY A;  4BXF A;  1PM7 A;  1RIT A;  3I7D A;  3MFA A;  1HXS 3;  3VD5 A;  1RUI 2;  1RUO A;  1DLC A;  4CP9 B;  1Q56 A;  2HWD 1;  3AKP A;  2WUH A;  4FPH A;  3NQH A;  4M3C F;  2OQ6 A;  1LGB A;  4FXG B;  1YJK A;  3PJY A;  5D2A A;  5C4W A;  2PHL A;  3POW A;  2IXJ A;  3P1I A;  4MX3 A;  1QQP 3;  4QQO A;  2VO5 A;  2HWD 2;  2W1S A;  3Q8E A;  2RR1 1;  2K2S A;  5LK7 B;  1H8T B;  2XJV A;  1AXY A;  1GQH A;  3LIG A;  3OY8 B;  3Q9O A;  5FY4 A;  4DNY A;  2VZR A;  1UY2 A;  3M2M A;  3ZN4 A;  1W0N A;  4IV1 C;  1AF9 A;  5BXX A;  5LB6 A;  3WHU A;  4MOA A;  5BUV A;  2DCJ A;  5A1L A;  1AR7 3;  1DGR A;  2RR1 2;  2X09 A;  3MPB A;  4HVO A;  2B9U A;  3ZPY A;  1AXK A;  4OZO A;  1XU2 A;  4BQY A;  4CEW B;  4B1M A;  3N9Q A;  1V0A A;  1NA1 C;  1NE4 A;  2XHN A;  4OYU A;  1RUH 3;  3LFM A;  4QGM A;  2GH8 A;  2VBB A;  5A6Q A;  2DCZ A;  1QEX A;  4AGR A;  2BNO A;  1O91 A;  3O0X A;  1BEV 1;  4QU2 A;  1QF3 A;  2ZGN A;  4QHB A;  1KS5 A;  5FZ8 A;  3NV3 A;  4KU8 A;  2JG9 C;  1O3T A;  1JW6 A;  2QDN A;  4FPE A;  4FQZ A;  4I0B A;  2GMM A;  5FY8 A;  1OMI A;  1A3K A;  2BZD A;  2XLG A;  3NNM A;  4GB3 1;  3NAP B;  2A73 B;  3BOP A;  1LUL A;  5C9A C;  4XF1 A;  1MS9 A;  4LNV A;  2O8O A;  3THC A;  5B4X A;  4LXL A;  1SLB A;  4QWN A;  5CIR A;  4C8D A;  4CDQ C;  1BMV 2;  3OB8 A;  3WF2 A;  3DPR C;  4AQ2 A;  3RYR A;  2ENR A;  2QTW B;  4IW3 A;  4OMC A;  1SPP A;  3WG4 A;  3IN9 A;  3H8U A;  4LE3 A;  3I3D A;  4XJW A;  5C8C A;  1I1E A;  2W92 A;  5A7W B;  4PBO A;  3R6S A;  1GZC A;  1H9P A;  4XZU G;  1NYW A;  2E32 A;  3E6D A;  4QB2 A;  1RUE 1;  5EJZ B;  3ZYB A;  2FDH A;  1W0P A;  2Y38 A;  3I3E A;  5FZA A;  2VVE A;  1QJE A;  3CL1 A;  3VD9 A;  1QNW A;  2A3Y A;  5E89 A;  3THP A;  4E4H A;  4LK6 A;  4WM8 C;  1RUE 2;  3SQO A;  4QXB A;  1GNY A;  2WWJ A;  4AOC A;  2ZOE B;  2C26 A;  1XBF A;  2HWB 3;  4DEQ A;  1A8M A;  4Q8L A;  2PAM A;  4YW1 A;  1DGW X;  1ZVF A;  4AFD A;  4BQ3 A;  5KHI A;  1W6O B;  4CDW C;  4OVE A;  1IGO A;  1ZRR A;  3J4U H;  4AFB A;  2WT0 A;  4XYX A;  1RUC 1;  2D97 A;  3HN1 A;  5KHK A;  3AJY A;  1ZZB A;  2BER A;  5DAV A;  1DZR A;  4O9G A;  4PDW C;  4OZX A;  2KA3 A;  2TUN A;  5J37 A;  4A3Z A;  1JU4 A;  1MZ5 A;  5E1R A;  1RUC 2;  2WNO A;  3TAY A;  2BW8 A;  1ENR A;  1KEX A;  1UMH A;  2BOJ A;  1NCR C;  2OW4 A;  3P3N A;  3FC0 A;  2XWJ B;  5FTT C;  3POI A;  1DIW A;  4YG6 A;  3EBR A;  3RVH A;  3NW4 A;  5LBC A;  3U75 A;  5L7O C;  4KWL A;  5C71 A;  2VZT A;  3HEI A;  1IQD C;  1LED A;  1KJL A;  4BE3 A;  3A0N A;  2HWE 1;  5K7P A;  1V6I A;  5J09 A;  1QHD A;  4WZC A;  3ZVX A;  4UW3 A;  2P17 A;  2VGD A;  4QT6 A;  3LFI A;  1CR7 A;  2W1U A;  3BYW A;  1S0B A;  3PHM A;  5FYT A;  3SH3 A;  1KJR A;  1RUN A;  4WM7 C;  2V72 A;  5B4N A;  2HWE 2;  1G9C A;  4K40 A;  3J7M A;  1UYY A;  4D7S A;  3AKQ A;  5KR7 A;  4E8C A;  3VZL A;  3O1T A;  1UU4 A;  1JYT A;  3POS A;  1GFF 2;  4EN6 B;  1J59 A;  1W6N B;  5APA A;  3EO6 A;  4AHY A;  2VZS A;  2VW1 A;  4DO0 A;  1HQN A;  4YFZ A;  1YI9 A;  1UO9 A;  2AEZ A;  2Y60 A;  5CFC A;  4P14 A;  4J25 A;  2AGS A;  2Q1Z B;  5A7O A;  1HXS 1;  1RUJ 3;  5C4W B;  1GQP A;  1T2X A;  5DZG A;  2UY8 A;  4IEW A;  4LO8 A;  3U4S A;  5JDB A;  1PK6 A;  2QBX A;  1UOB A;  3VDD C;  2YGL A;  3UES A;  2NN8 A;  2WR9 A;  2BWA A;  2WRA A;  3IAP A;  4N53 A;  1VAL A;  4G3Y C;  4KGQ A;  5F37 A;  1HXS 2;  4QQ2 A;  4LBL A;  3TEX A;  1QQP 1;  2YGM A;  3QD6 A;  1K5M C;  1O8S A;  5GZG A;  3MIE A;  4UFJ A;  1RIN A;  3I4I A;  4RFR B;  3I2J A;  1QOS A;  3ZKY A;  3N7K A;  1GOF A;  2HEV F;  1QQP 2;  4MGS A;  1QNY A;  3BTA A;  1AR7 1;  2RS5 3;  2A6W A;  3QH6 A;  3BIW E;  2P34 A;  5A7P A;  3UNP A;  1RUD 3;  3TNQ A;  1JZ4 A;  1I9R A;  1RUH 1;  1TEI A;  2VPV A;  2VOT A;  2R32 A;  3R4U A;  4HKL A;  3V65 A;  2YDE A;  1ND3 C;  3U10 A;  4N7I A;  4ZON A;  1AR7 2;  5GZD A;  4AEK A;  2NP0 A;  2B46 X;  3ILR A;  1ACC A;  1IS5 A;  4Y5Z 0;  3POF A;  1RUH 2;  4KMQ A;  1SMV A;  1YFX A;  4GJY A;  3WF0 A;  3HD8 B;  4FVV A;  2JG8 B;  2VOK A;  3ABZ A;  3VD7 A;  5K9Y A;  1DU3 D;  2VZO A;  2DBI A;  1GZT A;  1E5H A;  3GZU C;  3KVB A;  1ODM A;  4GWI A;  4IV1 A;  3VGI A;  1PZ9 A;  2VMI A;  1CAW A;  1GWL A;  2H6C A;  3AKT A;  4L8Q A;  4YPJ A;  2FZ1 A;  5D8A B;  4KGG A;  2WFP A;  1SLA A;  4W6W A;  3GF6 A;  4M4P A;  1YLL A;  1GBG A;  5FY0 A;  5A3W A;  1SFP A;  4NRO A;  5C8C B;  1NA1 A;  4QKF A;  3S5A A;  1W03 A;  1DQ5 A;  3MUY 1;  3PVN A;  3VBU B;  3NV1 A;  3V0A A;  1CQ9 A;  4HVR A;  3OPT A;  3WNL A;  3OUH A;  2XBO 3;  4JRL A;  1H6Y A;  4XFI A;  1D4V B;  2BU9 A;  2P37 A;  3AKR A;  4FPY A;  3RI9 A;  3H8O A;  2BNM A;  4KQ7 A;  3ON7 A;  4BH9 A;  3SEE A;  3NJZ A;  2JG9 A;  4LKD A;  4A42 A;  3UKN A;  5T52 A;  4EZ4 A;  5BNO C;  3LCP A;  3E5U A;  4NRP A;  4YVW B;  1PO2 2;  3RMY A;  5DAX A;  1H30 A;  3P6B A;  4XPV A;  4NWW A;  4XHX A;  4QPG A;  4K3U A;  2Y6H A;  4JGZ C;  3ORJ A;  5CNA A;  3NO8 A;  3R4S A;  4OHZ A;  3RI8 A;  3VL8 A;  4YSF A;  2ZML A;  3WHT A;  4CCC A;  5HCF A;  1JOJ A;  5FYV A;  3ZIX A;  1DZT A;  4EJR A;  3V56 A;  1MS8 A;  5HCA A;  1VR3 A;  3O1V A;  4O7X A;  3PUS A;  2HWB 1;  3ZYF A;  3D4K A;  2QFE A;  3H9A A;  3JB4 C;  5FJH A;  4XXA A;  4CDQ A;  3L9J T;  3T2T A;  4R9B A;  1RHI 3;  5I0U A;  3VHP A;  2GNM A;  1CZT A;  2ZA9 A;  4LBQ B;  2YRO A;  5LAS A;  2HWB 2;  1F2N A;  2VW2 A;  4SLI A;  3VBO C;  5FP8 A;  4NHL A;  1HN1 A;  1EY2 A;  4QHO A;  2YY1 A;  3ENR A;  1WLC A;  1NZI A;  2VW0 A;  1ODN A;  4Q4V 3;  4RS5 C;  2JXA A;  4UFK A;  5DMY A;  2Q0A A;  2YMZ A;  3KT7 A;  5F8P A;  5CG9 A;  3SXW A;  3KCY A;  4DPN A;  3VDB A;  1JBC A;  2WLQ A;  5I0S A;  1XYO A;  1LES A;  1UZW A;  2VMH A;  1CZV A;  1HIX A;  1K3I A;  5A7N A;  3N7M A;  2D6N A;  1D4M 3;  1B35 A;  3NNJ A;  3N7J A;  3K2O A;  3HMY A;  1S0C A;  2QQM A;  3A21 A;  4XE9 A;  5C3S A;  5JPM B;  1YQ8 A;  2R0F A;  4UFL A;  2WNE A;  5GJ6 A;  4C1X A;  1YIF A;  2J42 A;  1NCQ A;  5JOZ A;  5H9P A;  2B45 X;  2JIC A;  4Y5T A;  3T0A A;  2XGX A;  4QQP A;  2P3K A;  3OEB A;  2ZEY A;  1WCQ A;  1VRH 3;  4PDW A;  2XJT A;  4PQQ A;  4DB5 A;  1UN1 A;  4LA3 A;  3W5N A;  2UUR A;  1XJA A;  5FXV A;  3MUZ 1;  3LSD A;  2F4P A;  3DF0 A;  3SCG A;  3DGT A;  1YWK A;  5ERL A;  1WLW A;  1NCR A;  1W6Q A;  3CO2 A;  3ZSK A;  2C9K A;  5JXI A;  4JQT A;  1LHO A;  3NST A;  3SKV A;  4BME A;  2VZU A;  2QQW A;  5L7O A;  4Y1Z A;  2WNU C;  3IMN A;  5I93 A;  3U1X A;  2DV9 A;  1G9F A;  1RUJ 1;  4XTM A;  4PLO A;  1C57 A;  4Q2F A;  2JB8 A;  2GAL A;  1UZZ A;  4LIT A;  4WVM A;  3IPV A;  5T5O A;  4MXW A;  1NXM A;  2LW8 A;  3N9M A;  3ES1 A;  5FO9 B;  1RUJ 2;  4NID A;  2W87 A;  3WUC A;  1EP0 A;  5FZH A;  1LU1 A;  4CXY A;  2OQ7 A;  1QJF A;  4D7T A;  3NVC A;  1R64 A;  5L9V A;  2CNA A;  4FOY A;  4FP2 A;  1SFY A;  3WSO A;  1YI7 A;  1YQ2 A;  2RS5 1;  2ORX A;  3C7F A;  4AQT A;  3BU7 A;  2LUW A;  4V2W A;  4Y24 A;  1RUD 1;  4AFA A;  2ETE A;  1HV0 A;  3KVA A;  2O1Q A;  2JDP A;  2RHP A;  4AG4 A;  4OHW A;  4A44 A;  3ZR6 A;  2E63 A;  1LOC A;  2P3Y A;  4GMP 3;  5ISL A;  2RS5 2;  1JS9 A;  1PIV 3;  3VDD A;  4XJ8 A;  1RUD 2;  4D6R A;  2YC2 A;  4YGC A;  3U07 A;  1QH6 A;  2VZP A;  3W5M A;  3BTX A;  5EPA A;  4GAZ A;  4PIY A;  1K5M A;  2MPF A;  2P6H A;  1UMI A;  4XJA A;  4IV1 B;  4HKO A;  4QMA A;  5FZ9 A;  4XJ9 A;  1NQJ A;  1RMU 3;  2YC4 A;  2FMY A;  3ZXF A;  5BY5 A;  1CAX B;  4KG0 A;  3UET A;  1QJX 2;  4JGY C;  3P5B A;  2D5F A;  4K7J A;  5LBF A;  4B4P A;  2CAU A;  2DF7 A;  1SLI A;  4FOW A;  4XCA A;  4YW7 A;  4FTE A;  2XL7 A;  3V0B A;  3W21 A;  2TBV A;  2WFF 3;  2WQZ C;  5A32 B;  3OJB A;  5LAT A;  4OI0 A;  1QH7 A;  2R30 A;  1YYN A;  2D40 A;  1Y9Q A;  1HRV 3;  1SAC A;  3SLI A;  1DYP A;  5KHH A;  4CUA A;  4EE2 A;  3PIG A;  1LU2 A;  1ND3 A;  2XBO 1;  2R06 3;  4QB6 A;  4XIL A;  1X9T A;  1BK0 A;  2WC2 A;  4Z82 A;  4XUQ A;  5E16 A;  3MBW A;  4AVB A;  3DKW A;  4KU7 A;  4NJ4 A;  5HI0 A;  3GBG A;  2XBO 2;  4ITC A;  5FCC A;  3S7E A;  3U14 A;  4FPJ A;  3VD4 A;  2K0G A;  2OX0 A;  5AC9 3;  5C9A B;  4MYE A;  2RJK A;  3JD7 3;  4MGK E;  5CU1 A;  4ATF A;  4NMI A;  1ZRI A;  1CIW A;  1KFU L;  2YPD A;  3M4F A;  4UW6 A;  4RGA A;  4WV8 A;  4ZPI A;  3DPR B;  5E88 A;  1AYN 3;  5A3L A;  1QJU 3;  1POV 0;  3LIH A;  3RS6 A;  4E2Q A;  2CDO A;  2EAA A;  1RHI 1;  5CAZ A;  1R1Z A;  4S2H A;  5FP4 A;  3SCF A;  4XQD A;  2WJS A;  4E9K A;  4NHM A;  1CAU A;  3FX3 A;  3IIA A;  1UZV A;  4LUM A;  3ZYP A;  2ID4 A;  3LDK A;  3UKT A;  4NIH A;  3O0W A;  3JU9 A;  1RHI 2;  4Q4V 1;  5F9T A;  3B9I A;  2DUR A;  2IWG B;  2YC0 A;  2NM1 A;  3BAL A;  3AL5 A;  3K77 A;  4M3C E;  2E7A A;  4WM8 B;  4N9I A;  2EID A;  4XDO A;  1PHM A;  2C4X A;  2VC9 A;  4Z2W A;  1VBA 3;  3S6P A;  5EP9 A;  4IGP A;  4C0H A;  4AI9 A;  4GJZ A;  4Q4V 2;  5E6H A;  5A3M A;  1D4M 1;  4ZU4 A;  3AKS A;  5C70 A;  2WII B;  3OUJ A;  4CDW B;  4NPM A;  1FNY A;  5C33 A;  1NAE A;  3CIH A;  1WBF A;  4IGQ A;  3AMQ A;  4O65 A;  2PHR A;  1AYM 3;  1J3Q A;  1W8F A;  1D4M 2;  2JIG A;  1VBE 3;  2CL2 A;  1W2T A;  5JCT A;  1L3J A;  5F5A A;  5F2W A;  4H2A A;  1KDM A;  4LMF A;  5DAB A;  2XXZ A;  2ZZJ A;  4A7K A;  1W2U A;  5A3P A;  3FHQ A;  1VRH 1;  4RS5 A;  3U4X A;  4Q4W 3;  1W6Q B;  3NMB A;  4FQ4 A;  2Q4S A;  4Y22 A;  2YU1 A;  3UGG A;  4M00 A;  4FOQ A;  5L7O B;  3B00 A;  1H6X A;  1VRH 2;  4YW6 A;  3WNK A;  4K1Y A;  3GYD A;  4MAD A;  1TNR A;  1IKP A;  3UGF A;  4GH4 B;  3ZR5 A;  4MXW B;  5DPN A;  4EV0 A;  2IXK A;  3UL2 A;  1SEF A;  2VUL A;  4JVA A;  3W59 A;  3KF5 A;  5FMO S;  3MW3 A;  4COY A;  1N1S A;  2D6L X;  4GMP 0;  2EF6 A;  4Q29 A;  4WM7 B;  1URX A;  1CON A;  5A7S A;  3MGU A;  5BNP C;  1CWP A;  2IUW A;  1SHW B;  4HG6 B;  2OZ6 A;  4IV3 A;  4XCB A;  4BM8 A;  4OI1 A;  1QXP A;  1W28 A;  5CG8 A;  1U12 A;  1X8M A;  3VHR A;  3A0K A;  3HNM A;  4Z1V A;  1WCU A;  5J1X A;  3OUI A;  4OQ9 A;  2HWC 3;  3FFZ A;  4Q26 A;  1J84 A;  3N3H A;  1E5S A;  1HV1 A;  1C1F A;  2QZ3 A;  4HL0 A;  2VCC A;  3ZXG A;  5FOB B;  2PHD A;  4MET A;  3MYX A;  1OUX A;  3LEI A;  3ST7 A;  2G19 A;  2GND A;  2XKO A;  2ZMN A;  4RD7 A;  5GLV A;  3POE A;  5SV5 A;  2WNU A;  2ZHK A;  5GZC A;  4Q4X 3;  2L9L A;  1ULF A;  5AVP A;  4BOW A;  2W2I A;  1IZ3 A;  1AX2 A;  1Q8P A;  1UD1 A;  5E8A A;  4GMP 1;  1OF3 A;  1OKQ A;  1TVG A;  3OEA A;  1PIV 1;  3OD4 A;  1U5Y A;  2WDB A;  3M7A A;  1HQL A;  1NY7 1;  4LOT A;  4OUL A;  5F5Q A;  2ZKN A;  2C1F A;  2PYT A;  3SMH A;  1J3P A;  1DGL A;  3B93 A;  4R8H A;  4N7U A;  2B42 B;  1RMU 1;  3K48 A;  4IDZ A;  3ZKU A;  1PIV 2;  1GQG A;  1XNK A;  5BYN A;  4QXK A;  5L73 A;  1NY7 2;  1PGS A;  5IK7 A;  1OHF A;  1OOP A;  2WQ4 A;  3WF4 A;  4GKY A;  3B5L B;  3OGV A;  1F8V A;  2KM2 A;  2WFF 1;  3ZYG A;  3ELN A;  4M0H A;  3WXP A;  2AUY A;  3NJX A;  1S0D A;  5JVV A;  4IES A;  4QKN A;  3VB9 A;  2HLE A;  2JDY A;  1LGN A;  4CP9 A;  1HRV 1;  1C5I A;  5J98 B;  4D6S A;  1NOV A;  3WZ1 A;  1O3S A;  4SBV A;  2VCB A;  1VE0 A;  2WFF 2;  2R06 1;  3KGZ A;  2PHF A;  1VMF A;  4HBN A;  1OVS A;  1EV1 3;  4QX7 A;  1HRV 2;  3AXE A;  2ERF A;  2WN2 A;  1F15 A;  1K42 A;  1XQN A;  3OY8 A;  4AI8 A;  4B7K A;  2R06 2;  2ZGO A;  5AC9 1;  4YW5 A;  3QH7 A;  2WN3 A;  4JTN A;  2JDH A;  3JD7 1;  1UYZ A;  2H0V A;  5D8A C;  5A33 B;  3J7N A;  4CEW A;  1UNB A;  3WDX A;  2JEC A;  4YZ5 A;  1ZBA 2;  3CZU A;  5AC9 2;  1QJU 1;  3VBU C;  2Y34 A;  1QMJ A;  3JD7 2;  1WMF A;  4AK3 A;  2QDR A;  2OA2 A;  1MS4 A;  2CGO A;  2W52 A;  5BNO B;  5DDJ 3;  1AYN 2;  3WQ7 A;  2E31 A;  4PIZ A;  1QJU 2;  3KHB A;  1WW6 A;  2R6Q A;  4PT6 A;  1TMF 1;  2ARX A;  4QQH A;  2JDZ A;  4I2O A;  4KWJ A;  3AP7 A;  3MFC A;  1WCK A;  1LOB A;  1VRB A;  3I54 A;  1JI6 A;  3PME A;  4JGZ B;  3RMX A;  1RED A;  5A6X A;  1KXG A;  3BPS A;  4IEZ A;  3T2O A;  3NAP A;  2E9Q A;  3PMS A;  1VBA 1;  3GJB A;  1LHU A;  2P6C A;  1UAI A;  4QDQ A;  2X8K A;  4LJH A;  5T55 A;  4O61 A;  2AH2 A;  4IE0 A;  1JHN A;  2CU5 A;  4TXW A;  4N43 C;  3B9C A;  1WBL A;  1U0A A;  4M4R A;  4R4Z A;  1VBA 2;  2CTV A;  1KGY A;  1Y4W A;  3HBK A;  3ZN6 A;  3VBO B;  4LPL A;  4YZ4 A;  1FAT A;  2VUJ A;  5A7W A;  1AYM 1;  1D7P M;  4UOJ A;  3G7D A;  1VBE 1;  3SH5 A;  2D3S A;  4AHX A;  5F5C A;  2KD7 A;  5CAD A;  4GAL A;  4NR1 A;  1BJQ A;  3WG2 A;  1NUK A;  3VBS C;  1AYM 2;  3PJQ A;  4Q4W 1;  4QD2 A;  1VBE 2;  2VME A;  1S2E A;  4M0N A;  1ULP A;  2YBS A;  1TME 3;  2XQX A;  4PHZ A;  1V00 A;  3EJK A;  1MS0 A;  4Q4W 2;  1YJL A;  3KT1 A;  4YGE A;  1JZ2 A;  4ZHN A;  4K9S A;  4AEM A;  3WV6 A;  1W6O A;  2ZEW A;  2P3J A;  4QAW A;  3JB8 A;  1D2Q A;  2ZS6 B;  4BQX A;  3IKW A;  5T50 A;  1VLN A;  1OQE A;  3QBQ A;  4AI3 A;  4NHK A;  5FAX A;  4FPC A;  2V5Y A;  1BK1 A;  2A6X A;  1HB3 A;  4PIX A;  2XG3 A;  4DMI A;  3NWK A;  4JHT A;  2XON A;  3ZXJ A;  4HLT A;  4BLI A;  2OII A;  1SLL A;  2C6S A;  3HIF A;  4DFS A;  1G9A A;  3I2O A;  3LOB A;  2DBN A;  2HWC 1;  5LRS A;  1ZM1 A;  4YG3 A;  1C5H A;  2NPI A;  5JAX A;  5FMO L;  1HKD A;  3H7J A;  1GP4 A;  4K21 A;  1LHW A;  1O6U A;  1OLM E;  3GNE A;  4V2V A;  3OGR A;  4UFH A;  5FP9 A;  2GU9 A;  2VOX A;  1DZQ A;  1YQ6 A;  2HWC 2;  4MGT A;  3NRU A;  4KH9 A;  2WZR 3;  2Y6K A;  2Z69 A;  4Q4X 1;  2EIC A;  1ST8 A;  5D1I A;  4MSV A;  5K0U B;  3I49 A;  3ES4 A;  2VOV A;  1D0G A;  3TEY A;  1RXF A;  2XJS A;  1M4W A;  2WT1 A;  3MLJ A;  1O5U A;  4Q4X 2;  5BNP A;  2YV8 A;  5AFE A;  5FZL A;  3E5Q A;  4DIQ A;  1FI2 A;  2O0O A;  3BGA A;  2BRT A;  3VBH B;  1UPI A;  3PDQ A;  5L36 A;  3LB9 A;  3O12 A;  1LEM A;  3E6B A;  3ZPO A;  3IM0 A;  1W6N A;  2XJR A;  4GWM A;  3NNL A;  4XFC A;  2ZGQ A;  2RJL A;  4Q5O A;  5IHR A;  5H9S A;  2Z79 A;  1C4R A;  1AHS A;  1JHJ A;  1QWR A;  4N8M A;  3K75 B;  4AAP A;  1U5X A;  4NAO A;  4LHN A;  5FZI A;  3CQO A;  2OYZ A;  2JB4 A;  1LAJ A;  4P9W A;  1Q3E A;  5GZF A;  2UWC A;  2O14 A;  1RYY A;  1DQ1 A;  3U37 A;  2NMO A;  1YEW A;  3ZFF B;  1WW7 A;  1XE7 A;  4JKL A;  2J1E A;  4KNC A;  1EYB A;  4MHR A;  1CGP A;  2OPW A;  4TTG A;  2ZXQ A;  4R4X A;  5JOW A;  3VBF C;  4IER A;  1EV1 1;  1F9K A;  1OFS A;  4QXH A;  5FPL A;  3ZYI B;  4FBF A;  3DXU A;  4YNI A;  4JGY B;  4HON A;  2WWS A;  4Q0P A;  3SHR A;  5I8S A;  1YC6 1;  4CCO A;  1LB2 A;  5JSO A;  2AEN A;  3OTF A;  1EV1 2;  4BCU A;  1SBF A;  1JN2 P;  2UWA A;  2XB6 C;  3KGL A;  5CIS A;  4FTB A;  4BLJ A;  4JQR A;  4DXZ A;  3RZL A;  3VDC A;  3WNO A;  2DTY A;  2UYA A;  1GWK A;  3S7I A;  5CKQ A;  4CUC A;  1JMU B;  1CPM A;  3WF1 A;  3ZLI A;  1DYK A;  1W8Z A;  2E7Q A;  1X33 A;  3A7Q A;  3RZG A;  3FFQ A;  1OBN A;  1JU3 A;  4ORF A;  5DDJ 1;  1ZZ9 A;  2HBU A;  2JKX A;  1XNB A;  4X6R B;  4EQV A;  4P9L A;  5IK5 A;  3ETQ A;  3OBZ A;  2ZJC A;  4QX2 A;  1BMV 1;  4CDU C;  4NWV A;  2JG8 A;  2PMW B;  2WA4 A;  3FLT A;  1VBC 3;  2FDJ A;  4QQL A;  1WGP A;  2JD4 A;  4Y26 A;  5DDJ 2;  2IXI A;  2PAE A;  3KV6 A;  4ARY A;  1R09 3;  2VEC A;  2CGN A;  4KWU A;  5I8T A;  3AM2 A;  5D8A A;  4KL1 A;  2IXL A;  1SBE A;  1AJK A;  1PO2 3;  4GQ7 A;  1W8U A;  1ZNP A;  2UWB A;  3VBU A;  4QB1 A;  1H4H A;  3ZXL A;  3F95 A;  4XUO A;  5JOY A;  1I6X A;  3AMP A;  1UKR A;  1JXN A;  1OF4 A;  4BMB A;  1W99 A;  1PMJ X;  2MNG A;  5JMC A;  2RS3 2;  5H9Q A;  4BIS A;  1US3 A;  4YVW A;  4ZKT B;  4YGD A;  5FK8 A;  5FZO B;  1GU3 A;  1WKY A;  1MQT B;  3D8C A;  1MZE A;  2X53 S;  4YZ2 A;  1UW8 A;  4E4Z A;  5C3R A;  5GZE A;  5L9R A;  1NLQ A;  1SG3 A;  3AXD A;  1CX4 A;  3KB5 A;  3O14 A;  1LOF C;  5FPV A;  3VDA A;  3LKJ A;  5IVE A;  2HEY F;  3MPP G;  4LBM A;  4QKD A;  4NVP A;  5DAQ A;  2W95 A;  3T1M A;  3GGL A;  1TME 2;  4FOV A;  3APB A;  4UXA A;  2HH9 A;  3I2F A;  1AVB A;  2EXI A;  4LBQ A;  4XDP A;  4CP0 A;  1F4H A;  4XFG A;  3DUI A;  1X8E A;  1QOT A;  2DU1 A;  2C24 A;  3D82 A;  5K4L A;  3BUC A;  1ZZC A;  2W39 A;  3MIF A;  4LBK A;  5FMC A;  1GNZ A;  4CU7 A;  3T4V A;  1Q8S A;  4IEU A;  1O59 A;  4CYD A;  1O4T A;  4GUL A;  3HT2 A;  2VM9 A;  3IDE A;  5C3O A;  2E26 A;  2R1D A;  3CJX A;  4CDX C;  4YAR A;  4I30 A;  3H8R A;  4NN0 A;  1X7N A;  2D3P A;  2ZX1 A;  1XXN A;  4GH4 C;  3VHN A;  4CUB A;  2WNV C;  4LHK A;  1LEC A;  3AB0 A;  3T09 A;  2WZR 1;  2GP3 A;  2ZPX A;  5BNP B;  1ASJ 3;  3KM5 A;  5FLJ A;  4XAE A;  1GOG A;  3CHX A;  3LSE A;  1XNT A;  3ZDV A;  1RIR A;  4IEY A;  4CCK A;  4RA0 A;  5CBL A;  2WZR 2;  5FZ6 A;  4CU9 A;  5EQU A;  1LEN A;  1OKO A;  3OBR A;  4HN1 A;  3ZXK A;  1WCD J;  1F5J A;  4RR3 C;  4EWE A;  3INA A;  4QPW A;  4XF4 A;  4L9B A;  5FYY A;  4XBN A;  5J36 A;  3LPG A;  4X8N A;  3SH4 A;  1G8W A;  3AFK A;  1IPJ A;  1QOO A;  3OBA A;  1TZO A;  4XXP A;  5DG1 A;  3JZV A;  3WQB A;  5BNN B;  4P5Y A;  3CDZ B;  1XNA A;  3IAQ A;  4K20 A;  1DP0 A;  3LOI A;  4CTE A;  2P3I A;  5FMD A;  2Y6G A;  1OFN A;  4BIO A;  3ASI A;  3Q8B A;  5A3U A;  3WNN A;  1JTZ X;  3MIG A;  4W8J A;  2QQK A;  1ONA A;  2J1R A;  1FAY A;  1GP5 A;  2OPK A;  4CXW A;  1V6M A;  3OPW A;  5IT6 A;  4UBH A;  1RJ7 A;  2RE9 A;  4ASL A;  1SCS A;  5FBJ A;  3TNP B;  2W94 A;  4XQ4 A;  1UMZ A;  3OOX A;  1OA3 A;  4D3W A;  1HN0 A;  2SLI A;  3DEM A;  4QPY A;  5FPZ A;  4FI9 A;  3IDC B;  2A6V A;  4LO7 A;  2FBE A;  4P00 B;  1QJX 3;  3ME2 A;  3FLP A;  3POJ A;  2VVD A;  2VJX A;  2V09 A;  2YB7 A;  4UFI A;  5EFU A;  1CD3 G;  5EHD A;  1WLD A;  4QX5 A;  4BQ2 A;  1OH3 A;  3TEZ A;  4CU8 A;  4CEY C;  1QDO A;  5DG2 A;  2ARB A;  4CCD A;  4P02 B;  3RRD A;  3ZYJ B;  1HX6 A;  2QQV A;  3ACG A;  1KFX L;  1VBC 1;  1A78 A;  5IVC A;  1CAX A;  4COV A;  1H1M A;  1SDW A;  2A3W A;  4YVS C;  1GNH A;  5FY5 A;  1R09 1;  2ILM A;  1C8M 3;  2J1A A;  3HNB M;  3LAG A;  4DXT A;  1QXR A;  1S0E A;  2WSU A;  2DCY A;  4OI2 A;  2BJS A;  1UU6 A;  1VBC 2;  2VUC A;  5A32 A;  3B02 A;  4TN7 A;  4OCT A;  1V9U 3;  4XAB A;  3AYC A;  5FYZ A;  3RYP A;  1PO2 1;  4LHS A;  1R09 2;  3C7O A;  1JYX A;  3K4D A;  1SLT A;  5CB7 A;  3WNX A;  2VQA A;  4CVU A;  2WS9 2;  4L92 A;  3WQ0 A;  4AQ6 A;  3NNF A;  4D69 A;  2DU0 A;  4E4D X;  3H7Y A;  5JSP A;  3B01 A;  2RDN A;  4X8P A;  3WCS A;  2YPJ A;  4EYU A;  2W5F A;  1W8W A;  2JE8 A;  1WA4 A;  1D0H A;  4G9S B;  1YUD A;  1PX4 A;  5C9A A;  3L2Y A;  2N7G A;  3SIT A;  2BOI A;  1FNZ A;  4PLM A;  4QU1 A;  5FJK A;  4BU2 A;  3N9N A;  1PO1 3;  4A2U A;  5LEK A;  5SV8 A;  3POY A;  3ZFE C;  2VUA A;  4N43 B;  2ZEX A;  2XJP A;  4KI5 M;  5HCH A;  1G9D A;  1REF A;  1FV3 A;  1SQ4 A;  3DPR A;  3O5S A;  3ETP A;  1JOD A;  3AMN A;  3WP5 A;  1W39 A;  2HWF 3;  4YW2 A;  4KBB A;  5HPO A;  4ATE A;  5FR3 A;  1OVP A;  4AI0 A;  1VAM A;  2BGO A;  2YHJ A;  3FMG A;  1IQA A;  1H2N A;  2GZW A;  1AL2 3;  3QCW A;  4EN8 B;  1X36 A;  2PLV 3;  3VBS B;  1PM4 A;  1BXH A;  3AYA A;  5AVA A;  2D6P A;  1W3V A;  2DVF A;  4C91 A;  3LD8 A;  1GZ9 A;  5CYY A;  4JDM A;  2VQU A;  1ZA7 A;  4LEJ A;  2Q8E A;  2AEY A;  3WDY A;  2ZEZ A;  5G05 L;  4WM8 A;  3W20 A;  2ZMK A;  1W9F A;  5GKA C;  4JZR A;  2R07 3;  2XHK A;  4TSV A;  2JD9 A;  1DQ2 A;  1UIK A;  4DXS A;  2WYF A;  3OCP A;  4CDW A;  4DUW A;  3N4M A;  1S0G A;  4AZZ A;  3S57 A;  4XBQ A;  5IAT A;  3T30 A;  3AMH A;  4FXK B;  3WW3 A;  5JLV A;  2OUH A;  3NV4 A;  4MGQ A;  4NE9 A;  1ASJ 1;  1HB4 A;  2I2S A;  4WBB A;  4XAC A;  3S5Q A;  5FPU A;  4FAH A;  1UCX A;  4F7Z A;  3OYW B;  1ZBE 3;  5T5J A;  1LGC A;  4DIN B;  4K8F A;  2UU8 A;  3EB7 A;  3LDB A;  1DYO A;  4L2N A;  1ASJ 2;  1POQ A;  2VXJ A;  3RJR A;  1PNF A;  2GNT A;  5FQ0 B;  1L7Q A;  5FYB A;  4QM9 A;  4D0Q A;  4C1W A;  4YLZ A;  2UY9 A;  5JXH A;  1Y9G A;  4AVV A;  1UQX A;  4CDX A;  3FUQ A;  3RWK X;  2QQO A;  4GH4 A;  4CCM A;  3O7O A;  2ADE A;  3M70 A;  2WNV A;  4AEJ A;  4AWD A;  2BWC A;  4I0A A;  4NOT A;  4AFC A;  1STM A;  2VE1 A;  3BPZ A;  4LO5 B;  3X29 B;  4WM7 A;  2G9G A;  5K0U C;  1ZRE A;  3DEC A;  5FZB A;  4ZZ5 A;  4YWA A;  3N7L A;  3OGS A;  4JKM A;  2DCT A;  1XYN A;  3ZIW A;  2KXL A;  3VBH C;  1BYH A;  2W0X A;  2ZAA A;  2RVA A;  5BPX A;  3T1L A;  5KXB A;  1GSL A;  3T2Q A;  2ZKL A;  1ENQ A;  3M3I A;  4I01 A;  4E2G A;  2XH6 A;  1ULC A;  5FUN A;  2WAA A;  1YNA A;  5HXM A;  5CKM A;  4R9C A;  5KXE A;  5F6L B;  4QXC A;  2ES3 A;  2VZV A;  1DF0 A;  3TB0 A;  1W9T A;  5EYY A;  5T3N A;  2QNK A;  3TN9 3;  1QJX 1;  3MHZ A;  1I5Z A;  1GLH A;  4FT8 A;  3ZFF C;  1OD5 A;  3J9S A;  3LA7 A;  1SBD A;  3T08 A;  3VBF B;  5C7G A;  3PUH A;  1VMJ A;  2VQ0 A;  2VU9 A;  2D5H A;  4NIA A;  2R04 3;  2Q8O A;  4RFT 0;  4EZH A;  3BKZ A;  1G9B A;  3S0M A;  2TNF A;  2HYK A;  1DLL A;  2B9V A;  4LK7 A;  4A45 A;  4XW3 A;  2WAO A;  3SKJ E;  2B4K A;  4TLF A;  4MO3 M;  4XFB A;  1Y3T A;  3N9P A;  5KHJ A;  2Y8K A;  3WCR A;  5C5T A;  1YFU A;  1FOD 3;  1C8M 1;  5ABJ C;  3H1M A;  2A71 A;  4MH0 E;  4ONU A;  2YXS A;  5F3E A;  3OD0 A;  1V9U 1;  2ARE A;  3BOD A;  4HPK B;  5FDB A;  4D6Q A;  1C8M 2;  1K12 A;  3H3L A;  1QIQ A;  5LA9 A;  3H50 A;  1WME A;  4DUV A;  4AXO A;  2Y64 A;  5IWF A;  1V9U 2;  4CDU B;  4MG2 A;  1ZBA 3;  5CKN A;  2XLA A;  5T54 A;  1AL0 G;  3TBD A;  2JDM A;  3M8L A;  2J1U A;  5JWP A;  3AZX A;  4OQ8 A;  5LWB A;  4E4S A;  4WVV A;  1AX0 A;  2QQL A;  4FPF A;  3LPF A;  4IE7 A;  4JHZ A;  3SIS A;  1ENX A;  4M01 A;  4AHW A;  1PO1 1;  4Y1U A;  4XAA A;  5A33 A;  1KIT A;  3KZ4 C;  2RG4 A;  1U5I A;  2XR4 A;  4H7M A;  4FPO B;  4P5H A;  4A7Y A;  4L97 A;  2HWF 1;  3ITQ A;  1PO1 2;  3LEM A;  4XC9 A;  3AZW A;  5EXO A;  5F2S A;  4BWO A;  2XUE A;  4LTA A;  2VCM A;  3H3Z A;  5BNO A;  4X6Q B;  1F4A A;  5FO7 B;  5KWR A;  4M3C B;  1AL2 1;  5JI7 A;  2FMD A;  2VVF A;  1VMH A;  2HWF 2;  2PLV 1;  2P1B A;  4DRR A;  2PTM A;  3CJI B;  5JXG A;  5FKB A;  5JUV A;  1J3R A;  4JGZ A;  1MQT C;  4A6S A;  2DUQ A;  1DQ4 A;  4B7E A;  1AL2 2;  1W6P B;  2PLV 2;  1Y9M A;  4H14 A;  2R07 1;  2DVD A;  1DHK B;  5F3I A;  1K45 A;  4I3G A;  4CU6 A;  4P08 A;  1OUS A;  3OSD A;  1BZW A;  5CEH A;  4LKF A;  2QCS B;  2W9X A;  5C8W A;  2R07 2;  2DFB A;  4XUT A;  3VBO A;  1V70 A;  3K46 A;  4COW A;  5EIY B;  1YCI A;  1EAH 3;  2D7F A;  4FFI A;  4DUX A;  1VB4 A;  1BQP A;  2ADD A;  2EIB A;  4QPI C;  4FFF A;  5GLT A;  3JQX A;  1ZBE 1;  4XUP A;  4Y5S A;  1W05 A;  1L7L A;  3LEK A;  4LR4 A;  3WX5 A;  4OUS A;  3IZO A;  2FCU A;  2XVK A;  4W50 A;  2YBP A;  1XSQ A;  5LZ6 A;  4LBO A;  5LCW L;  4CDX B;  3CKH A;  1W3X A;  1ZBE 2;  4DRV A;  4DXR A;  3C2U A;  1PVX A;  2WNV B;  3HPN A;  5F6K A;  4COU A;  5T5L A;  5DUW A;  3V64 A;  2FD8 A;  1YHF A;  1MAC A;  2IVJ A;  1IG3 A;  4JRA A;  1R08 3;  3H3U A;  3UJO A;  4P9X A;  1KQR A;  4Z07 A;  2ZGU A;  1XYP A;  1J83 A;  3ALQ A;  4ZU5 A;  2Y6L A;  5DN2 A;  3GDB A;  2ZAH A;  3KCX A;  1DQ6 A;  3VKO A;  1GWM A;  4ASM B;  1IPS A;  2ZGL A;  3E6C C;  3IDB B;  2QUO A;  4LO6 B;  4Q1R A;  4XFA A;  2LRP A;  3D0S A;  3MW4 A;  4RR3 B;  2R7E B;  2W08 A;  2RDS A;  5FYU A;  1LHV A;  3RDI A;  2VBP A;  4GIQ A;  3HAG A;  1O3R A;  3H42 B;  3HN3 A;  1JOP A;  4D7Y A;  2D44 A;  3QOP A;  4AVA A;  1ZRC A;  5CFD C;  4AI1 A;  1NX9 A;  3GJA A;  5IVY A;  1QJZ A;  5BNN C;  4G4F A;  3ZYR A;  4Q1P A;  1GZW A;  2AC1 A;  3B7M A;  5FY1 A;  1R1A 3;  3TN9 1;  3UV9 A;  4JCK A;  3KF3 A;  2Q1F A;  4TWT A;  3BOW A;  3THD A;  2X5I C;  3TOJ A;  5K0U A;  4IUG A;  3RGB A;  3HBZ A;  1PMI A;  2A1X A;  3GZE A;  3NL1 A;  2HYX A;  2ZHN A;  2R04 1;  1PVC 3;  5FBZ A;  1COV 3;  3TN9 2;  2JIJ A;  3AP9 A;  4ZS3 A;  2WSV A;  4HXC A;  1PGW 1;  3VBH A;  4W65 A;  2K9Z A;  1CN1 A;  1CIY A;  3A23 A;  1XC6 A;  2DTW A;  2ARC A;  3USS A;  3CBN A;  1H9W A;  2R04 2;  2VL4 A;  4S2F A;  1FOD 1;  2Y0O A;  1PGW 2;  5FPA A;  2WBK A;  2DUP A;  2SBA A;  2D43 A;  1ULE A;  1YQC A;  2AR6 A;  1FOD 2;  4LIV A;  2XLF A;  3PU3 A;  2XKP A;  4LOR A;  2J7M A;  1MEC 3;  4LE4 A;  4QX0 A;  3ZFF A;  4A41 A;  3MIB A;  2JJ6 A;  3PVE A;  3RZK A;  1WUV A;  4CEY B;  2X05 A;  2VAU A;  5FRA A;  2ZGP A;  3RYK A;  5JR7 B;  1ZBA 1;  5FYH A;  1LOD A;  2BFU S;  4JGY A;  5LA1 A;  4YVS B;  5GLW A;  3T2P A;  4HK9 A;  1CES A;  1UX7 A;  2MEV 3;  3IB3 A;  2QQU A;  3KV5 A;  1AYN 1;  2Y26 A;  4WVW A;  5ABJ A;  2ET1 A;  1W2A X;  2V4V A;  2O8Q A;  3AP5 A;  2D6K A;  2C5D A;  3ACL A;  4MVT A;  3MLL A;  4UBG A;  4URA A;  1NQD A;  2VMC A;  2ZHL A;  2RMU 3;  2X29 A;  3OPZ A;  3I2K A;  2J1T A;  4XZP A;  4UFM A;  1Q8O A;  5A1F A;  1JOB A;  3ZOI A;  1AR8 3;  3JXS A;  2RV9 A;  1OXC A;  2ORZ A;  4GZ9 A;  2VMD A;  5L19 A;  1BEV 3;  4Y20 B;  3FL7 A;  3ZFE B;  4NO4 A;  4BB3 A;  4UAP A;  3VKM A;  4CRQ A;  2RS3 3;  3T3Y A;  1AXZ A;  5HCB A;  5HXV A;  1X82 A;  2AAC A;  4LUL A;  4QX3 A;  4IE6 A;  1S4C A;  1GP6 A;  4DY5 A;  3ROU A;  4FP3 A;  1K5J A;  3QLQ A;  2VMF A;  4GB3 3;  4IL7 A;  4DEV A;  4E2S A;  3DYO A;  5KHG A;  3AZZ A;  1S0I A;  1RXG A;  1Q8Q A;  4MGZ E;  4W6X A;  2Z4F A;  4BQW A;  1O8P A;  1EAH 1;  1GR3 A;  3CEW A;  1XND A;  1XOY A;  3VUO A;  1HW5 A;  4FFG A;  1SDD B;  2QQJ A;  5IUQ A;  5I0R A;  1AZD A;  4PI0 A;  3RZZ A;  4QGN A;  1O3Q A;  1N3P A;  5FZO A;  1JYN A;  1JZ7 A;  1MQT A;  2D3R A;  1EAH 2;  3D3A A;  4EWD A;  3WUD A;  1XE0 A;  4N9H A;  1RL3 A;  3D6E A;  4LT5 A;  5DZE A;  2FQP A;  2DWR A;  1N3Q A;  5FYM A;  2D6O X;  4QHZ A;  3WW2 A;  3J8F 3;  2PXJ A;  2NMN A;  4AF9 A;  5GM0 A;  1LOG A;  1CAV B;  5DQ0 A;  1ND2 B;  1R08 1;  3TWI A;  2BUK A;  2ARA A;  4TZD A;  4YM2 A;  3RJ2 X;  3WW1 A;  3KV9 A;  5FZ4 A;  2VY0 A;  2XML A;  1WD3 A;  1XNC A;  4NRM A;  4AED C;  1R08 2;  1BHG A;  1ZZ8 A;  3MID A;  1GYK A;  2BQP A;  2LAL A;  2WO3 A;  2GC3 A;  3EHK A;  1UU5 A;  1W9S A;  1W2N A;  5TSW A;  2PHT A;  5KXC A;  2FDG A;  3ZDS A;  2DDU A;  1WMX A;  2VMG A;  2YFU A;  5FZ3 A;  3WDT A;  2IFR A;  5C5U A;  4NAM A;  3OBT A;  2ZGR A;  4MLO A;  1GZW B;  2ZAB A;  4OMD A;  3OGG A;  2CDP A;  3WR0 A;  3DYM A;  5DUV A;  3ZSL A;  2PHX A;  4JDO A;  5FY9 A;  4B4Q A;  3U78 A;  2JDU A;  2ZZQ A;  1GIC A;  1R1A 1;  2GN7 A;  4PI2 A;  2EIG A;  1GV9 A;  2VH9 A;  3OF1 A;  1F31 A;  2VCA A;  2YFZ A;  3B94 A;  2EIE A;  3BVC A;  3MF6 A;  3NJV A;  5LY1 A;  1G86 A;  2JE9 A;  2QE3 A;  2XVL A;  4LKS A;  1COV 1;  1Y43 B;  1R1A 2;  3ACI A;  3AZY A;  4Y33 A;  1WD4 A;  2NYY A;  1PK6 C;  2A75 A;  5I8Y A;  2IC1 A;  4HT1 T;  4N53 C;  2WO7 A;  3ZN6 B;  2F17 A;  2WYS A;  1PVC 2;  2JX9 A;  3LGR A;  1COV 2;  4C0B A;  3RNS A;  1ALY A;  3PUI A;  2ZCW A;  1H1A A;  1YXW A;  2PHU A;  4I3P A;  2JDA A;  2VNV A;  2G9Z A;  4AFM A;  1RC6 A;  1VB2 A;  2ZTN A;  5BNN A;  3KLS A;  4IQP A;  1UY1 A;  4BK4 A;  5M0T A;  2DCK A;  1LRH A;  3POB A;  3T0B A;  1CJP A;  3NNG A;  1ZRF A;  4XIO A;  3AFG A;  1MEC 1;  1KD7 A;  4HSL A;  3VZJ A;  4QKB A;  1T6B X;  1OI6 A;  3A22 A;  3MIH A;  4CPB D;  3ZSJ A;  2RDR A;  4AVT A;  3RPQ A;  4IEX A;  2V4A A;  1GKB A;  5D21 A;  4AL9 A;  3N35 A;  4NRQ A;  1MEC 2;  1Q43 A;  5CVR A;  1P8J A;  3K3N A;  4A6O A;  4RGK A;  3FJS A;  4ZY9 A;  1B09 A;  2LS6 A;  5ABJ B;  2A6Y A;  2Q30 A;  1DQ0 A;  1I5P A;  2R1B A;  2MEV 1;  3I59 B;  2YG0 A;  4AVC A;  2E53 A;  2FHR A;  4MZU A;  4CA9 A;  1V6L A;  5LEJ A;  3KHC A;  3USU B;  2CYF A;  2GDF A;  2MEV 2;  3HR9 A;  1HQW A;  3D0J A;  4Z92 B;  1IS4 A;  3C7H A;  3QAC A;  2BFU L;  2RMU 1;  1QGL A;  5JXJ A;  3BTY A;  2OS2 A;  4YRD A;  3WIN E;  1MVQ A;  1DG6 A;  3AYD A;  4GA9 A;  4ES8 A;  2JEM A;  2R49 A;  3AVS A;  1AR8 1;  4BXS V;  1LOA A;  2RMU 2;  3B3Q E;  5A80 A;  1VAK A;  2WS9 3;  1GAN A;  1QY4 A;  2GC0 A;  2UYB A;  4IXL A;  4PJY A;  4PLN A;  1EPW A;  4Y3O A;  1ZZ7 A;  1YO8 A;  2R16 A;  2Z2S B;  5GAL A;  1UYX A;  1AR8 2;  2RS3 1;  2B5H A;  3WP3 A;  2P4E A;  4RQP B;  4UW5 A;  1BEV 2;  4IND A;  5IK4 A;  3LWC A;  4YW4 A;  3DXT A;  4HN0 A;  1IHM A;  1J1T A;  1H8V A;  1Z78 A;  4QPG C;  4DOU A;  3VKF C;  3I3M A;  1I3H A;  3VZO A;  4QX8 A;  1PZ8 A;  5FUP A;  4NII A;  5IVJ A;  3KV4 A;  4UWD A;  4IEQ A;  3ATG A;  5IAV A;  3THT A;  3AK0 A;  3UK9 A;  1JYC A;  3ACH A;  2WKK A;  4GB3 2;  2QQN A;  3CJI C;  5DUU A;  1JZ5 A;  1YIP A;  3MF9 A;  3VV1 A;  2PA7 A;  5JZG C;  3E1F 1;  1TME 1;  2XJU A;  3ZYH A;  5B2G B;  2VTF A;  4BIF A;  2DUO A;  3VD3 A;  4YW3 A;  2GSY A;  4HK8 A;  3FWE A;  4LLF A;  4N43 A;  3ZXD A;  4OFG A;  4PQ9 A;  1ULG A;  3MIC A;  1N47 A;  3FZ3 A;  2IXH A;  3J8F 1;  1ULO A;  4CP2 A;  2Y0I A;  3MLK A;  2BYV E;  3G6J B;  2RJ2 A;  4J6G A;  1W8N A;  3I2I A;  3MI8 A;  4QPI B;  1Q5O A;  3KT4 A;  1G7Y A;  5LRR A;  1B35 C;  3J8F 2;  3PUQ A;  5FXX A;  4IE4 A;  4MUV A;  3VBR B;  3MW2 A;  4IGO A;  3VBS A;  1A8D A;  5KBF A;  5FZ1 A;  3GAL A;  1T6G C;  1RVF 3;  1S55 A;  3JUU A;  2C9A A;  1MS5 A;  2XJQ A;  1NCQ C;  4MXV A;  4Q0U A;  3J7H A;  3PIJ A;  5FPB A;  1H0B A;  4CXX A;  4AW7 A;  2WZ8 A;  3UJQ A;  3ZX7 A;  3KS7 A;  4GWJ A;  4QDR A;  5IJR A;  3TRS B;  3GCW A;  2VNG A;  5LK5 A;  2ATF A;  5FYI A;  1C3H A;  1EPZ A;  1JUH A;  5FZK A;  3C7G A;  1NZC A;  2OZJ A;  3OYW A;  4CPB A;  4IEO A;  2HBT A;  4AED A;  3GM8 A;  4XMA A;  2ZHM A;  1FMD 3;  5J7M A;  3LF7 A;  5FQ0 A;  2BTV C;  2GC2 A;  2A70 A;  2F4L A;  1VIW B;  1VPH A;  5ANQ A;  5I0T A;  3VHO A;  2DVA A;  5FZ7 A;  4AGG A;  5CFD B;  2VTX J;  2YZ4 A;  3ZXA C;  1WZX A;  1ZZ6 A;  3IT8 A;  1XU1 A;  1BCX A;  4WVZ A;  4OHY A;  1OPM A;  2A3X A;  3W9A A;  4AVS A;  1O4Y A;  2X5I B;  3PTR B;  4LUK A;  5ANN A;  3GZA A;  4LOS A;  2VG9 A;  5K8S A;  5FZ0 A;  4IE5 A;  4XIK A;  4DY3 A;  3AZV A;  1E57 A;  1JYV A;  2VR4 A;  1SLC A;  4S2G A;  5F1R A;  3WDU A;  2W68 A;  3WP4 A;  1J1L A;  5GLZ A;  3WQ1 A;  4P9Y A;  3R05 A;  4R9D A;  4U36 A;  3CZJ A;  3ZM8 A;  1WW5 A;  2W1W A;  4L11 A;  3S30 A;  2PQS A;  2CGP A;  1ZA4 A;  4NUB A;  4B29 A;  4B1L A;  4Q0Q A;  4XMI A;  5HV0 A;  3O1M A;  5LBB A;  2PEL A;  3ZO0 B;  3DL3 A;  5F5I A;  4HZF A;  4E27 A;  3MZH A;  2BDR A;  4ASK A;  4CCJ A;  4ARX A;  1TE1 B;  2K46 A;  2W46 A;  5JI9 A;  4HSJ A;  3VBF A;  1PX3 A;  3GZT B;  5FZM A;  2JDN A;  3LZZ A;  2IVI B;  4WZF A;  1OQ1 A;  1WW4 A;  2VOW A;  4Y1X A;  2BNN A;  1W04 A;  3PL0 A;  4UW4 A;  4BK5 A;  1H4G A;  5F7U A;  2VZQ A;  1OUR A;  1WLT A;  2YBK A;  4BDV B;  1RUF 3;  3AYE A;  2WS9 1;  3GCX A;  2Q8D A;  1W9W A;  3VN4 A;  5FXW A;  4DS0 A;  1CX1 A;  5FO8 B;  4KBZ A;  3RFR A;  1PGL 1;  2ZGM A;  3OG2 A;  4LBJ A;  2WAB A;  5F39 A;  5FWE A;  5JPN B;  3BI3 A;  1EUU A;  1BLZ A;  4I09 A;  4NPL A;  1VBB 3;  3MEP A;  3KMH A;  3C7E A;  4GD4 A;  2CHH A;  5EJ1 B;  2WLP A;  2WZP P;  2BEO A;  4HPK A;  5LA2 A;  1DGR N;  4CCL A;  2IZW A;  5AFB A;  1PGL 2;  1RUG 3;  3EXU A;  4MV2 A;  4NPR A;  4YGB A;  3N9O A;  1L7R A;  3UKV A;  4KG8 A;  4AYU A;  4P9I A;  2CSG A;  1MR5 A;  1BVV A;  4AI2 A;  4UYB A;  3LA2 A;  4CDU A;  4Z2A A;  1SPP B;  1UPS A;  5C6C A;  1DDL A;  3U0Z A;  4OHV A;  2GMP A;  3D5O A;  1RGS A;  1VP6 A;  3PU8 A;  4JDN A;  2J22 A;  4YG0 A;  2EXK A;  3WDV A;  3WEZ A;  2FZ2 A;  5FZF A;  1F35 A;  2RS1 3;  1QJY 3;  1W6M A;  3U11 A;  1ULD A;  3TYJ A;  3PVB B;  2XWB B;  4AAX A;  4COZ A;  1DFQ A;  2C0Z A;  4GKX A;  3K51 A;  3I3B A;  2ZX2 A;  4LO4 B;  4EN7 B;  3AJZ A;  3KQ4 B;  3O1O A;  2CY6 A;  2Y6F A;  5JR2 A;  1UXZ A;  2NZ9 A;  2XUM A;  3LE0 A;  4Y4Y A;  1W9Y A;  5IK8 A;  5FLH A;  3PUA A;  4M3C A;  4B4R A;  1TNF A;  3M3Q A;  1N3O A;  5IVB A;  4FFH A;  1FT9 A;  3CJI A;  1MZ6 A;  4B8E A;  1Y7B A;  1YRZ A;  1RVF 1;  1S2K A;  1LOE A;  1UZ0 A;  4ZXK A;  3T4H B;  5JZG A;  1LOF A;  5FV3 A;  1W6P A;  1N1Y A;  3J26 N;  3DKQ A;  3FLR A;  5FK7 A;  2DFC A;  4CE8 A;  1RVF 2;  4PF1 A;  1HJF A;  5A1A A;  1ND2 C;  4H55 A;  3AVR A;  3O1P A;  3JCI A;  2WO1 A;  1CJD A;  5I0D A;  4HVQ A;  4FO9 A;  3ZFG C;  4URT A;  2W91 A;  4AED B;  3MO4 A;  4K8R B;  1MPX A;  1CZS A;  2RDQ A;  1POV 3;  3H8X A;  3E5X A;  2OT7 A;  2PFW A;  4RYD A;  4F3J A;  4UF0 A;  1V6K A;  5IW0 A;  4BJ0 A;  2LRO A;  4FPK A;  3GXU A;  3DV8 A;  2IXC A;  4PF5 A;  2P2K A;  3ILN A;  5FKC A;  1LJ7 A;  1FMD 1;  2VZ1 A;  3M3C A;  4XOG A;  5F32 A;  4OHX A;  2WO2 A;  4IEV A;  4L0P A;  5FIX A;  2FCV A;  1HRI 3;  1CPN A;  1E5R A;  1MVE A;  4CCE A;  2VBD A;  1DGW A;  5JSR A;  4IV3 C;  3RZH A;  1O5L A;  1FMD 2;  4E8D A;  1RTV A;  3III A;  2OKX A;  2IFW A;  1VBD 3;  3H0O A;  5J96 B;  2BGP A;  5CFC B;  1V6N A;  2Y33 A;  4OUE A;  5LBE A;  1HB2 A;  3M3O A;  5A6Z A;  3Q8A A;  1H2M A;  4AHZ A;  1H1I A;  2A5Z A;  2W1Q A;  3K4A A;  1PK6 B;  2MHF A;  5JOX A;  5EYX A;  1WWY A;  2BBV A;  4B3N A;  4N53 B;  3POG A;  3P3P A;  4RR3 A;  3J7L A;  2CWM A;  1JUI A;  2B39 A;  1IG0 A;  1TQ5 A;  5ACA 3;  4IET A;  4PBP A;  1UKG A;  5FYC A;  2B8M A;  1OLQ A;  2YU2 A;  2JKB A;  1LTE A;  1UIJ A;  5FP7 A;  4JV4 A;  1FYU A;  2D93 A;  3AP4 A;  5EZW A;  5IFP A;  2BVV A;  1OOP C;  2AYH A;  3N9L A;  1NE6 A;  3AC0 A;  1RB8 G;  1G6N A;  4BQ1 A;  2JDK A;  5FYS A;  3H1W A;  5IVF A;  1JYI A;  4LLO A;  1DBN A; 
#chains in the Genus database with same CATH homology
 3PUR A;  5FPA A;  5FZ6 A;  2Q8E A;  5F3G A;  4IGQ A;  5FY9 A;  5FPL A;  4QXH A;  3PUQ A;  5FXX A;  5A7P A;  3U78 A;  5F3C A;  5FZE A;  3DXU A;  4HON A;  4IGO A;  5FZG A;  3PU8 A;  3PU3 A;  4LIT A;  4LIV A;  5F5A A;  5F2W A;  5FYY A;  5FZ1 A;  4CCO A;  4LXL A;  1VRB A;  2XXZ A;  4QWN A;  5FZF A;  4C8D A;  5A3P A;  5LY1 A;  5F2S A;  3N9M A;  2XUE A;  4Y33 A;  5FPB A;  5FZH A;  5FYH A;  5A7W B;  4Y4R A;  2OQ7 A;  4GJY A;  2YU1 A;  5FPU A;  3ZLI A;  5FY7 A;  3KV5 A;  3KVB A;  3LDB A;  5FZA A;  2GP5 A;  3PUA A;  5FYI A;  4V2W A;  5FZK A;  3OPW A;  5A7W A;  4E4H A;  5A3N A;  5FWJ A;  5F3I A;  5IVB A;  5FYB A;  3KVA A;  5A3W A;  5FY0 A;  4CCN A;  5F5C A;  5FBJ A;  4QXB A;  3UYJ A;  4URA A;  2WWJ A;  5A7S A;  5A3T A;  5ISL A;  5CEH A;  3KV6 A;  2Q8C A;  3OPT A;  4D6R A;  5FV3 A;  5A1F A;  4CCM A;  4GAZ A;  5F37 A;  5FP3 A;  3K3N A;  2YBS A;  5ANQ A;  5FZ7 A;  5FZ9 A;  4EZ4 A;  5FZB A;  3AL6 A;  3AVR A;  2YBP A;  3PTR B;  3NJY A;  2W2I A;  2OT7 A;  5FYV A;  4BIS A;  4UF0 A;  5IW0 A;  5FZ0 A;  5IVC A;  3PUS A;  2OS2 A;  3RVH A;  4CUG A;  5IVV A;  5FUN A;  5FY5 A;  5FZO B;  5FJH A;  5LW9 A;  4QXC A;  5F32 A;  4AAP A;  3AVS A;  5FPV A;  4BXF A;  4TN7 A;  5A80 A;  5FYZ A;  5IVE A;  5FP8 A;  4Y3O A;  2OX0 A;  2OQ6 A;  4NUB A;  4V2V A;  5FZO A;  5FYT A;  4UF0 B;  5FP9 A;  5F5I A;  2WWU A;  2VD7 A;  5FZD A;  4EZH A;  4EYU A;  4XDP A;  5FYU A;  5KR7 A;  2YPD A;  4ASK A;  4CCJ A;  5FYM A;  5A7N A;  3DXT A;  2PXJ A;  5FY4 A;  3N9P A;  4D6S A;  5FZM A;  5K4L A;  2XDV A;  3K2O A;  4QX8 A;  5IVY A;  4BU2 A;  4QU1 A;  5FJK A;  5FUP A;  4DO0 A;  5IVJ A;  3KV4 A;  3N9N A;  5LY2 A;  5A1L A;  2YBK A;  5FZL A;  5F3E A;  3KV9 A;  5FP4 A;  5FZ4 A;  2XML A;  4QX7 A;  4DIQ A;  5A7O A;  5FY1 A;  5FXZ A;  4CSW A;  3N9Q A;  3PDQ A;  4D6Q A;  5FYC A;  2Q8D A;  4LIU A;  5FXW A;  3U4S A;  3ZPO A;  5F39 A;  2YU2 A;  5FWE A;  5FP7 A;  5FZC A;  5A7Q A;  5IWF A;  3AL5 A;  2P5B A;  5FZ8 A;  4XDO A;  4GD4 A;  2GP3 A;  5FZI A;  5FXV A;  4IGP A;  4CCL A;  3N9L A;  4HOO A;  4AI9 A;  4GJZ A;  5FZ3 A;  5E6H A;  5FY8 A;  3N9O A;  5LWB A;  5FYS A;  5IVF A;  3LD8 A;  4CCK A;  3K3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...