3DL3A

Crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
RIPKNWTIQRSTPFFTKDNVPEALLTHHNTAVDVFGQICVMEGVVTYYGFANSEATEPEIKVVINAGQFATSPPQYWHRIELSDDAQFNINFWSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Tellurite resistance protein B
publication title Crystal structure of the tellurite resistance protein TehB. Northeast Structural Genomics Consortium target VfR98.
rcsb
source organism Vibrio fischeri es114
total genus 15
structure length 96
sequence length 96
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dl3A00
2OYZA 5KHJA 3EO6A 1DGWA 5I93A 5JSRA 4Q0VA 4B29A 1SEFA 4XF4A 3KGLA 5J7MA 2XKOA 2B9UA 3FE5A 3L2HA 4KL1A 5FQ0B 1RTVA 5FPZA 3UKVA 3OTFA 5C8WA 4RD7A 3H1MA 3BCWA 2FMYA 4HVOA 2GU9A 3EJKA 3I54A 2K9ZA 4I3PA 1ZZBA 1QXRA 1L3JA 4L2NA 3FJSA 1O7FA 2H6BA 4N9HA 3N4MA 1VR3A 2EAAA 1ZNPA 3HT2A 2B5HA 4JTOA 4N9IA 3ZDSA 3SCGA 1UW8A 5KHIA 1EY2A 4MGIE 5FLJA 4IEPA 2OZJA 4BH9A 4YRDA 4YSFA 1UD1A 2I45A 1CAUA 2BGCA 4KU8A 4Q0PA 4WVZA 3S7EA 3S7IA 3E97A 3LWCA 5F1RA 4XFIA 3ST7A 5BXXA 1ZRRA 1O5UA 4EWDA 5FPXA 4PIYA 4HBNA 5CVRA 5BPXA 1U12A 2PHDA 2IXHA 2K0GA 2IXKA 2EVXA 1NYWA 4O9EA 1X8EA 2IXLA 3C3VA 3ELNA 1DGRA 1H1MA 4TLFA 3DN7A 4H7LA 1ZRCA 3E6BA 2XHKA 2C0ZA 4HSLA 3BB6A 4MGZE 2FQPA 4LUMA 2UY9A 2IXIA 4DINB 4IEWA 1VJ2A 1J59A 3CJXA 2XLFA 1O4TA 2XKPA 4HVRA 3EQEA 2GAUA 3SMHA 5LRSA 2CAVA 4PIZA 1G6NA 1NXMA 1LRHA 1Q3EA 2CAUA 2CV6A 2KXLA 4LA2A 4FT8A 4NVPA 1WA4A 1ZZ7A 5EFUA 5LEJA 3JZVA 3FFQA 1EP0A 4X6QB 3M70A 4D7TA 1RUOA 2UYAA 3UKNA 4UXAA 5FLIA 4IEVA 3PVBB 2V09A 1FI2A 1CX4A 5EZWA 1Q43A 4XEZA 4D7SA 1WLTA 2E9QA 4OLLA 3D0JA 2BYVE 4HN1A 1FT9A 4R8HA 5BY5A 1ZZ8A 5I0TA 4I2OA 4AQ6A 2ET1A 2PFWA 3FHIB 1IPJA 1ZZCA 3D0SA 2WC2A 3PLQA 4EROA 4E2QA 5LRRA 4KWLA 2GC0A 1GQGA 3QACA 3E6CC 3LOIA 2VQAA 3PNAA 5JAXA 4IERA 1QXJA 3IDBB 1PMIA 4OFGA 4ZU5A 1CAVB 1EPZA 4META 1V70A 1YFXA 5BV6A 1CGPA 4IEYA 3RPQA 3RYPA 2QVSB 5I8SA 4YNIA 2DCTA 1Q5OA 5KHHA 4QGNA 2BNOA 2Q30A 1I5ZA 5I91A 3U11A 4LEJA 4XF0A 5FQ0A 2H0VA 3OF1A 4QXKA 2XLGA 2OA2A 1VP6A 4BYYA 4P9GA 2PQQA 4FAHA 2H6CA 5J3UA 5HI0A 1UCXA 1FXZA 3CEWA 4J1XA 4JVAA 2PAEA 1J1LA 3VHRA 2OZ6A 2MHFA 3GBFA 3H8UA 2MPFA 3OCPA 5C6CA 5KHKA 3KCCA 4HZFA 2GC2A 4GULA 4LUKA 1LR5A 4QMAA 1ZZ6A 2QCSB 3SCFA 1LKNA 3FX3A 3U10A 1RL3A 1I6XA 5BUVA 1YLLA 3WW4A 5I0SA 4XFHA 2D40A 3DV8A 1RC6A 5AVPA 5D1IA 4Q0QA 1O3SA 4QGMA 2PA7A 1ZZ9A 2VPVA 3IIAA 1NE4A 2O8QA 3SXWA 4PJYA 3S0MA 3ETQA 3UKTA 3USSA 4EV0A 3IBMA 4MGYE 4XETA 4I01A 3H7JA 4Z07A 2D93A 2GH2A 3H7YA 3RYRA 4IETA 4LTAA 3LA2A 2IXCA 2QDRA 5E16A 4CYDA 3EHKA 5CU1A 3LAGA 3DKWA 3O14A 4BHPA 4J1WA 1HW5A 4LA3A 4QGLA 3I7DA 4O9GA 5JSOA 1OFNA 3BU7A 4XF3A 1ZREA 4FBFA 1H1IA 1Y9QA 3E5XA 1Y3TA 2UYBA 4ZU7A 5K8SA 3E5QA 4AVBA 4UBGA 2PYTA 1ZVFA 3HT1A 5KHGA 4KWJA 4I02A 3FWEA 1ZRDA 1UIJA 4XF9A 1TQ5A 2IXJA 3RYKA 2D5HA 2Y0OA 1WGPA 1CAXB 1DZTA 1CAWB 1YFYA 3SHRA 3NSTA 2UY8A 4KU7A 4MV2A 1NZCA 1SFNA 3MPBA 4JV4A 1O3QA 4XF1A 1X8MA 3BALA 2GZWA 1PM7A 1XE8A 2N7GA 2HJIA 2CGPA 5FDBA 1NE6A 3M3IA 1X7NA 4XFBA 3DL3A 1CAXA 3KSCA 5I0UA 3D82A 4FAGA 4XFAA 4XFGA 4LULA 4IEOA 1QWRA 3NVCA 3E5UA 3IDCB 1LB2A 2HKXA 2XL7A 3H3UA 3TNPB 1O5LA 3NL1A 4QM9A 1X82A 4I0BA 4R52A 4XFCA 1CAVA 5JR7B 4Z82A 2EA7A 3CLPA 2BNNA 1OI6A 4AXOA 4XFFA 4E2SA 2Z2SB 1DZRA 3CL1A 3TNQA 4F7ZA 3E6DA 4MZUA 1IPKA 4A2UA 1CAUB 1YWKA 1J3QA 2PAMA 1EYBA 3NJZA 4WBBA 3NW4A 2B8MA 1XRUA 1YFWA 4HN0A 1O3TA 5CADA 5I8TA 3WW3A 4KWKA 3KGZA 4YYOA 5I8YA 2GC3A 4ONUA 2F4PA 4BIFA 5J48A 3BPZA 3LA3A 1O3RA 2PTMA 3NKTA 2ET7A 3ACLA 5KBFA 5JCTA 3MZHA 2PAKA 1J3RA 1XE7A 1YUDA 3QOPA 4ZU4A 3ES1A 1YHFA 3HQXA 4JTNA 2ATFA 3CF6E 2O1QA 2VECA 4YARA 4HLTA 3WW2A 3RZZA 5JSPA 1J58A 3GYDA 3OGJA 2XGXA 3HIFA 4MH0E 4F8AA 1OD5A 3G7DA 4IEQA 1SQ4A 2QNKA 4PIXA 4X6RB 4MX3A 3LA7A 4HMZA 3SCHA 1RUNA 1ZX5A 2BNMA 3EBRA 4Q0SA 4I0AA 1OMIA 3KMHA 3CO2A 4IESA 4L11A 3FZ3A 5FLHA 5I0RA 3H9AA 3H50A 3I59B 4EWEA 2Q0AA 2PHLA 3LZZA 3H1YA 3ROUA 2D5FA 3WW1A 4MUVA 1QY4A 4I09A 3RNSA 5T3NA 3ES4A 3H1WA 4EWAA 2GC1A 4IEZA 2IC1A 4IEUA 1ZRFA 3B02A 1RGSA 2ETEA 4AVCA 1UPIA 1UIKA 4K8FA 3H3ZA 4AVAA 2Z69A 3I59A 3U0ZA 4Q0UA 4QM8A 1JUHA 4QX5A 3OD0A 4LLOA 4Q29A 4HSJA 2OPKA 1J3PA 2Q4SA 2Q1ZB 5E1RA 4WZCA 1YFUA 5LEKA 4ORFA 2QJVA 1GQHA 2P17A 2XL9A 3MDPA 4IEXA 3MYXA 2XLAA 4MGKE 4AQ2A 2ZKLA 4UBHA 2BEOA 2MNGA 4E2GA 3RDIA 1CAWA 3R6SA 4HVQA 2ZCWA 2WFPA 5FCCA 3IWZA
chains in the Genus database with same CATH superfamily
3MFCA 2OYZA 5KHJA 1F4AA 1QXPA 3EO6A 1QQP1 5L9RA 4IV3A 1H2NA 4AEDC 2VVFA 2VNVA 1KGYA 2JWPA 4YG0A 4XJAA 2VVEA 5FZCA 1HQLA 1SEFA 4XF4A 5FFOC 3ZXFA 1KS5A 5HPOA 2RJ2A 1W6QA 1WMFA 1V9U3 2IVIB 4JCKA 3UKVA 4NPMA 1NAEA 3WF3A 2W47A 3H1MA 1AVBA 2TBVA 4Q4W1 2J42A 2PN5A 1UY4A 3VBRA 2RG4A 2BQPA 2QQKA 4KWUA 4YW1A 2GMEA 1JODA 4L2NA 1SLCA 1NT0A 1XBFA 1RUI1 1O7FA 3PJQA 1DG6A 4AWDA 1BK1A 5JR2A 2JKBA 4OI0A 2VCAA 1W6PA 2EICA 2P3YA 5AVAA 4BLIA 3N9MA 2ZMLA 3HT2A 4RR3A 3KT7A 2R061 3SCGA 5J1XA 1UW8A 2XJTA 5KHIA 1XOYA 3N7JA 4M3CA 4W6XA 1RJ7A 2PLV1 4LBQB 2ZS6B 4LITA 4MGIE 1YNAA 4LIUA 5FKBA 5I0DA 4CUBA 4N7IA 4LR4A 2LALA 4BA6A 1UD1A 2VOWA 2W9XA 3NV4A 4IGOA 1H8TA 4CDXB 4DRVA 1IKQA 1RUE2 5FBJA 1OLRA 2A6VA 1UO9A 2AEZA 2NMOA 1BEV1 1L7QA 1MS8A 2ZPXA 1GFF2 3LWCA 2FHRA 3FBYA 4CCMA 4MYEA 3ST7A 4FO9A 3V0BA 3VD5A 5C3SA 1ZRRA 5FZ4A 4FXGB 3PIGA 3RRDA 4XW3A 4AR2A 4FQ4A 1HQWA 3OBAA 3KV4A 3SITA 3WNMA 3R4SA 1MS5A 2WIIB 5BPXA 5A1LA 1U12A 4PLMA 2W1UA 2YPDA 3AVRA 2J1AA 3GCWA 4NJ4A 2IXKA 1NYWA 4Q4Y2 4O9EA 1X8EA 2IXLA 4OMDA 5FJKA 3GHNA 1GSLA 5HCBA 4GWJA 3T4VA 3CNAA 1H9PA 1YQ6A 4Q1RA 2QE3A 5FY4A 3THTA 3JB4C 4TLFA 3DN7A 3FC0A 5FZ8A 4L97A 2WAAA 1URXA 4MGZE 1ENXA 4CUGA 1QJU3 4P9LA 2R041 5GLWA 3O0WA 5GALA 3S57A 2X5IB 5F6LB 2IXIA 3IAPA 2PHFA 3R4DB 1J1TA 4QAWA 4OULA 2VL4A 1NA1C 3ITQA 2XLFA 4IE0A 2ID4A 5LY2A 2XKPA 5EHDA 3VD9A 3ZFFA 3BTXA 4P9WA 2VQ0A 2ZGNA 1FMD2 2ZKNA 2BV4A 5LRSA 4PIZA 1H6YA 2A73B 4IE4A 1K42A 2C1FA 4NROA 2G4IA 1B09A 5LA0A 1AL21 1Q3EA 1RUC2 3CJIC 1MR5A 1C8NA 2IFWA 3WNKA 4YFWA 4FOQA 3W58A 2Q8CA 5G05L 1G9FA 1GMMA 2YGLA 1W8TA 3T09A 4Q5OA 1G9BA 3CBNA 1DDLA 2JX9A 2VNRA 1ZZ7A 5EFUA 3I2GA 1HRV1 1G86A 1PZ9A 1FPN1 4BQ4A 3JZVA 4MXWA 5C3PA 1NCRB 1RXFA 3T2OA 2JDMA 1AR82 3AKPA 4XDQA 3LFMA 3WX5A 4IEVA 4CCCA 3ABZA 2VCCA 4A42A 5A7SA 2ZGOA 1QKQA 2A70A 2RS32 4AFBA 2JB8A 3KV6A 1WLTA 1W0NA 3OEAA 1AYN3 2R0FA 4RS5A 1HQNA 3D0JA 3K3NA 3PURA 4H14A 4HN1A 4QQPA 1BLZA 5KC5A 1FT9A 4UOJA 5BY5A 3M1HA 1ZZ8A 3B9IA 4RGKA 2VZQA 5IFTA 2GMMA 2PFWA 1RXGA 4KMQA 4COUA 4QB6A 2WR9A 2YZ4A 1NY72 2WC2A 5F2WA 5LATA 4P5YA 3K2OA 4EROA 3I2OA 3ZR6A 4E2QA 4KWLA 5F39A 4N90A 2GC0A 3TAYA 3E6CC 2IVJA 2CGNA 2VOTA 3GALA 2A5ZA 5JAXA 1LTEA 1AR91 1K5MC 1VBD3 2CNAA 4S2DA 2GNMA 4YFZA 1P8JA 2XUEA 3SKJE 3C7OA 5EYYA 4ZU5A 1S0GA 1UYYA 1UOFA 4PQQA 1SMVA 3DPRC 4CPBD 3N9OA 3HVDA 4I30A 1DFQA 4UW5A 4E8DA 3S6PA 2JE7A 2ZGPA 3AMMA 2Q8OA 1JS9A 3WSOA 1CPMA 2IUWA 3T1LA 4AW7A 3EXUA 3RYPA 4Y4YA 5DUVA 5FZIA 3JD73 4R9CA 4C0HA 3BN6A 5HV0A 3VB9A 3WNXA 1R083 4C90A 1COV3 1H8VA 3MIDA 5L7OB 5CFDA 1JOPA 5A3WA 4IV1A 4LT5A 1Q5OA 2XBO3 5FYBA 3HBZA 2JDHA 4XIKA 1JZ6A 2Y6LA 3TB0A 1SFYA 4LOTA 4PF1A 2I74A 4QXKA 1R092 1YRZA 1XNCA 3NAPA 1E5HA 1VP6A 4AI1A 3GJBA 2RJKA 5ANQA 4CDWC 4CDUC 1DQ0A 2ZEZA 5H9QA 1R082 2ZACA 2RVAA 4FPKA 3A22A 4HKWA 1HXS2 4DXTA 2WFF2 4NIAA 1MQTA 2WZR2 2HWC3 3T0BA 2WWJA 2RDRA 1VRH1 3WQ7A 3NV2A 1BZWA 4TWTA 3O1OA 1QJFA 2W1WA 3KWVA 1QJX1 2VR4A 1RHI1 3ZOIA 5C9AB 3V64A 4Z8BA 3GBFA 4AVVA 3TN92 1XJAA 3POEA 2G9FA 3NNJA 2GH8A 5FYYA 5IK5A 2MPFA 3OUJA 3PUHA 4Q4X2 2ZGRA 3AMNA 1ZA4A 4GIQA 5J37A 3AJZA 2VULA 4K8RB 1CZSA 2VG9A 1WCDJ 5SV8A 2BERA 4FOYA 4QWNA 3SH4A 1YLLA 4AEDA 1POQA 5I0SA 4FPOB 4A4AA 2ZGLA 3N7LA 1UMHA 3IM0A 5DZGA 2BOJA 1UX7A 1AR73 5DAXA 5D1IA 3J7MA 1MEC2 4INDA 2WZPP 3BOWA 1Y4WA 3AXDA 4WM7B 5FTTC 5K7PA 1Q56A 4QQ2A 2FDJA 1ZRIA 2LUWA 1Q8SA 3VBUA 4G9SB 5BNPA 3S0MA 3UKTA 1RVF3 2QQPA 5JXGA 3WNPA 4RA0A 3ZX7A 1GANA 1PO22 1DQ1A 2BBVA 1DGLA 4LTAA 3INAA 4NHXA 4CP2A 2QDRA 5JI9A 1XU1A 2RR12 3P6BA 5FYVA 2BUKA 2EIDA 5L9VA 3B7MA 2DFBA 3VDAA 2HWE2 1JTZX 1LHUA 4J1WA 3AYCA 2YC2A 4QGLA 1V6MA 4O9GA 3BU7A 4K40A 4YG3A 2E33A 1Y3TA 1W2NA 3C2UA 3VZJA 2WO2A 4R4XA 4ZU7A 4OQ8A 1AJKA 2GP3A 3E5QA 2AREA 1VAKA 4CEWA 2LRPA 2VMDA 2WNVC 3D3AA 5FYMA 1OA2A 4BLJA 4IQPA 1MACA 5F9TA 3B5LB 4GALA 3ZYBA 4TXWA 5A1AA 2DV9A 2E53A 4UFIA 5ERLA 1UIJA 4KGGA 4DUWA 2IXJA 3T2QA 1OT5A 2TEPA 4BMBA 2NP0A 2AACA 1CAWB 5DPNA 3NSTA 5LBFA 4XHBA 4OHWA 3WHTA 2A6YA 4ZZ5A 3O1PA 3K75B 4NMIA 4M3CF 1LOGA 3FL7A 4Y26A 2YBKA 4FFGA 2DCJA 2GZWA 3I2IA 4BPZA 2G1MA 4NHKA 1JOJA 4EQVA 3MW4A 5CIRA 1LGBA 3PTYA 2ERFA 2WINB 3VZOA 5FDBA 4RQPC 4ZS3A 1RUJ2 5BNQA 1S0EA 5ABJB 3VDBA 2R16A 3SEEA 2GNBA 4I0WB 3DL3A 4LBKA 1CAXA 4W50A 3RJ2X 3H8OA 4FPJA 2RM22 4UFMA 1PK6B 5T5LA 1IS6A 1C3HA 2OIIA 5IAXA 1RYYA 1X9TA 2XJSA 1ZBE1 1YEWA 2JXAA 2XVGA 3LSDA 3NO8A 4O61A 4X8NA 2HKXA 5T54A 3H3UA 4XPVA 2W5FA 3CJIA 5FRAA 4I0BA 2RS53 5AC93 4XFCA 1GNHA 3N36A 4NHLA 3JXSA 4ASKA 2FDGA 4YW7A 2W95A 5JIUA 2QFEA 1KS4A 5KXBA 3POSA 3D6EA 5C5TA 3V56A 5F32A 5A32A 4YVSA 5LWBA 3UJQA 1QHDA 4XFFA 4G3YC 4PHZA 4E2SA 2NYYA 2R0HA 2Y0IA 3OPZA 3ZYRA 3AZXA 1OF4A 5HBAA 1ASJ3 2DU0A 4A2UA 3IMMA 1NLQA 2EIBA 2BZDA 4AFAA 1YFWA 4F83A 2VMIA 5CADA 3WW3A 5C70A 1BKZA 2YDEA 3V0BB 3UJOA 2Y60A 3OUHA 5I8YA 3D8CA 4NWVA 1UZWA 5FZGA 1GZCA 1W9SA 5FZMA 1LOFA 4MADA 4ZPIA 5J48A 5FZLA 3LA3A 2P3KA 2VMFA 1OC1A 1OLQA 5FKCA 5DQ0A 3NKTA 2CGOA 3PVOA 2DURA 2WNUB 4CSWA 2Q5TA 1IG0A 1ZBA2 2DU1A 2J1UA 2CDPA 3AYEA 4L8QA 3GGLA 3ATGA 4MHRA 1VBA3 1JMUB 3KVBA 4CVUA 5CEHA 2WS93 1A6CA 4QHZA 3QD6A 4C8DA 2DWRA 3DPRA 3TEWA 2Z4FA 5J96B 3AM2A 3DECA 1XSRA 5A3LA 3WNNA 1QOOA 5JSPA 3JBG2 3OGJA 3FLPA 4XC9A 4MH0E 1OQEA 2WABA 4F8AA 1OD5A 1YQ5A 1AR71 4R9BA 5JVVA 1PX4A 4CP9A 2QNKA 4X6RB 1ND3C 1W8WA 4V1PA 4OHYA 4YGCA 3AKSA 3SCHA 2KR2A 2JG8A 4AI9A 2UWBA 1PIV2 3I97A 2DF7A 3M3QA 3EBRA 1KD7A 2XG3A 4I0AA 3ZSJA 1I1EA 3KMHA 2VU9A 4WZFA 1EAH1 1OQ1A 2B39A 2GP5A 3ME2A 3PUQA 2NLRA 4IW3A 4MGQA 5FZ9A 5A6ZA 5LASA 1JYCA 3AJYA 4RN5A 5I0RA 4K1YA 2RMU3 4RHV3 2WQ4A 3J8F2 2WNOA 2Q0AA 1JZ8A 2PHLA 3ZXAC 4CDWA 3MHZA 5B2GB 4CDUA 1C8M2 2D5FA 2R071 4XMAA 4E4ZA 1CX1A 4FPEA 1DU3D 2BP6A 3SEPA 1VBB3 2D6MA 1C4RA 4D3WA 3PVNA 4MXVA 1GWMA 4D0QA 3O5SA 1LHWA 3S30A 5EIYB 4IEUA 1GZTA 4LBMA 2Y33A 4P9JA 3PJYA 1W2UA 5BNNC 3ZFEB 1LENA 2VOVA 4RHV2 4RS5B 1UIKA 4K8FA 5C4WA 4XQWA 2ZHLA 1UQXA 3KM5A 4AAPA 2QQUA 3F2ZA 4DXSA 5CAZA 3RQ0A 4KGQA 1E57A 1UXZA 4QM8A 3RFRA 1PGL1 1YQ8A 4LLOA 1GICA 4FFHA 4Q29A 4ZY9A 1OOPB 3I2FA 3ILRA 4XUOA 3WDWA 1V6NA 4CCKA 2JE8A 2EAKA 1QJY1 5IAVA 3WP4A 1LHVA 3MV01 4Q4V2 5E1RA 3CHXA 3ZYJB 1HV0A 1YFUA 3BPSA 5GLZA 2QJVA 1GQHA 1RINA 4KG0A 3MDPA 3OD4A 5L73A 3KHCA 4IEXA 2GNDA 4AHWA 1OH4A 2K2SA 3MUZ1 1WBFA 1HX6A 2XLAA 1SZBA 4MGKE 5K4LA 1E5RA 1U5YA 1RUH3 3ZYHA 4IL7A 3LDBA 4CCDA 1UY0A 1LJ7A 1O91A 2BEOA 3TEZA 4XUPA 4AFMA 1QEXA 1S0FA 2DVAA 3RDIA 4HVQA 3QBQA 4GB31 4YZ3A 1QQP3 5FCCA 2WBKA 1LU2A 3OBZA 1VAMA 2ADEA 1V6OA 4QQLA 4MSVA 1MVQA 4K9SA 4YW3A 4QDRA 1SLLA 4J25A 1WMDA 4B1LA 4OMCA 2MEV2 5CFDB 5JSRA 4IV1B 1DIWA 5FYTA 5ISLA 4XAAA 1AXKA 1LOAA 4L0PA 4FQZA 3KGLA 4UI9L 4Q4W3 3VL8A 4CP1A 2HYXA 1IHMA 4OVEA 3OTFA 4XXAA 1BMV1 4E8CA 4RD7A 1AXYA 4DUVA 1WW7A 3K51A 2PHTA 4AEKA 1FOD3 4JKMA 4BOWA 3U14A 4AGGA 3SH3A 1TZOA 1RUI3 1D4VB 1UN1A 3EJKA 3ON7A 1Y43B 4PDWB 3I54A 1MQTB 1W0PA 4JX0A 4BJ0A 1FV3A 2D43A 4LBNA 3FJSA 5JMCA 4QPGC 1US3A 3LEGA 4N9HA 4LQRA 1H6XA 4YGDA 2WNVA 5IVJA 3J9SA 3N4MA 1VR3A 3AZVA 1UZVA 3MIGA 2DDUA 4AGVA 1VBE1 1LGNA 1X33A 2PLV3 2QDNA 5KWRA 1YCIA 1VPHA 1QH7A 1TE1B 5A3MA 3CU7A 2XWJB 4AOCA 1EY2A 1HIXA 1GP6A 1MVEA 3K48A 3AL5A 2BTVC 3NKGA 5FLJA 4BH9A 5DUXA 2OT7A 2HLEA 3MPPG 1BEV3 4UFKA 2ES3A 3VBHB 2BGCA 4Q0PA 3S7EA 2R062 3I4IA 2HYKA 3KQRA 4V2WA 4YW4A 1DYKA 5F3GA 1Z7S1 5EPAA 1N1TA 4XFIA 4XUQA 2WUHA 1BCXA 1ULOA 3I8TA 1S4CA 1W9TA 4IDZA 3NJVA 3D5OA 4B4RA 1RITA 4CXYA 2VXJA 1GNYA 4AI8A 1O5UA 2HWD1 2ZZJA 4PIYA 2WS91 4LO8A 3KVAA 3NV1A 5DAVA 4HBNA 3BIWE 1ZA7A 2IXHA 2DTWA 1AYM1 1ND2B 1DGWX 2EVXA 1CVNA 3AFGA 3ELNA 3VBUB 4BMEA 2V73A 3IN9A 2VZUA 4N53C 5BNPB 1UYPA 5DDJ2 4HPKB 4BZ4A 2VOXA 1H1MA 1S0IA 5A6QA 1OXCA 1W8OA 2R043 1HLCA 2XJRA 1VALA 5IVVA 2ZEYA 2F17A 3UYJA 3VDDC 1SPPA 3IIIA 2C0ZA 1DYPA 4HSLA 3BB6A 3WUCA 5GZCA 3TEYA 2ZAHA 3AK0A 1S0JA 1V0AA 3ZKUA 4O65A 1RB8G 5GZEA 1HRI2 4DEVA 2EIGA 1W03A 5LA1A 3ALQA 3AZZA 1J59A 3CJXA 5BYNA 4AHXA 1O4TA 4HVRA 4GXLA 4CUCA 2P2KA 4UW3A 2FDKA 4JKKA 4XXPA 2LW8A 3VBFB 1MS3A 1AL23 2W92A 3MIHA 1G6NA 2W2IA 4LBQD 2ZHKA 3USUA 2ZZQA 5DUWA 4LIVA 3P5BA 4NN0A 1GBGA 3HQRA 4CA9A 3O0VA 5A7NA 2CAUA 1VB4A 2CV6A 1REDA 1XXNA 2SLIA 3ACIA 3N9NA 3RMXA 3VBOB 1HRV3 1FPN3 3M3EA 4NVPA 2WZEA 5KXCA 4LKDA 4YW2A 3BTZA 1OBNA 3FFQA 2DVGA 2ZBJA 2FCUA 4C0BA 5ACA3 2B42B 1LECA 4D7TA 1JYVA 4QT6A 1UXXX 4YWAA 2VZRA 5FZHA 3ILFA 1RUOA 5FLIA 1JU4A 2DCYA 4QHOA 4AVTA 4CPBA 3KF5A 1W28A 2V09A 5F6KA 5J98B 2BWCA 1TMF2 5EZWA 4D7SA 2E7QA 4M00A 2C6SA 2E9QA 1ODNA 5FREA 4BXSV 1KRIA 1LHNA 2L9LA 3OG2A 2BFUL 1YQ2A 2E51A 2Y38A 3ZXDA 4Y3OA 1HV1A 2JICA 2Y6GA 2BFUS 4AQ6A 3M3CA 3AP6A 2NPIA 3B93A 3BUCA 3FHIB 2DFCA 4NHYA 4NOTA 3HQUA 2O0OA 2QZ3A 1EV12 1LOEA 1ND3A 2W1SA 3PLQA 4FVVA 2Y34A 1PO12 2QQWA 4M3CE 5LRRA 1AR93 3ZVXA 5A1FA 1GQGA 1W9FA 3B69A 3LOIA 4QX1A 1ULDA 3PVEA 2VE1A 3J26N 4DXRA 3GZTB 4PI2A 1QXJA 3IDBB 2WN2A 4JGZC 5K0UC 1RUF1 4PLOA 3CJIB 4GWIA 1NG0A 4YG6A 4NHMA 1EPZA 1WW4A 3HOBA 2A3XA 3M7AA 4RFRB 5LA2A 2V5YA 4META 1V70A 1QIQA 5E88A 2GN7A 1CGPA 3RI9A 4W6WA 1NCQC 1Q8QA 3OSDA 4YVSB 2EF6A 3W59A 4CCEA 3QLQA 2A71A 2ZGMA 3POYA 1IKPA 4YNIA 4FCAA 2AH2A 4QX0A 1FOD1 2VZSA 3B00A 5FWJA 4KBZA 1JOBA 4JDNA 4XDPA 2EIEA 1RUG1 2CWSA 5BNNA 5FP8A 1V9U2 1I5ZA 3WDYA 1VRBA 5CKMA 2GNTA 3UESA 5FQ0A 1V00A 2H0VA 3OGSA 3VBSC 2OA2A 4KI5M 2H6CA 5T50A 2WL1A 5J3UA 5C3RA 5LBEA 3B9CA 2X53S 4J1XA 1DCSA 1VRH3 3LGRA 5FO8B 2FDFA 1QJX3 1RMU1 1RHI3 4CE8A 1J1LA 5DMYA 1F2NA 3H0OA 3VHRA 2OZ6A 2W94A 3ZYGA 5JZGC 1UY2A 2MHFA 5FPUA 1PZ8A 5BNOC 1FYUA 2YG0A 4FFIA 3HN1A 4HZFA 4GULA 3WNLA 4E9KA 3ZSMA 4QMAA 5FJHA 2ZHNA 2QCSB 3KB5A 3SCFA 1LKNA 3FX3A 3POJA 3NNFA 3ZXJA 2HWB3 4FOWA 1BBT1 3IB3A 2JG8B 1SLTA 3MEPA 1I6XA 1XC6A 3AC0A 4LHKA 5A3UA 2DBIA 4D6SA 3IZOA 4XFHA 1GZWA 3DGTA 3DV8A 3IWZA 2A1XA 2WYFA 3POBA 1ENQA 3ZM8A 1M4WA 4PF5A 3I3DA 2AYHA 2VZVA 4JC1A 5C8CC 5JUVA 1O3SA 3LB9A 3I2DA 5F2SA 1W6OA 4CDWB 4CEYC 1CIWA 1ZZ9A 2VPVA 5JXJA 5LBCA 4KBBA 5FZ1A 1E5IA 2HEYF 4GH4C 2O8QA 3SXWA 3ETQA 4BXFA 4EV0A 3IBMA 4MGYE 4QPGA 1HN1A 2DTYA 2HWF1 4I01A 4XETA 1REFA 5F5IA 2D93A 3ACFA 3GDBA 1SLAA 3H7YA 1QJU2 2Y8KA 4IETA 5EV7A 3RYRA 2R49A 1H2LA 2IXCA 4K1ZA 5C4WB 4SBVA 5FYIA 3OOXA 3O14A 5FBZA 4BHPA 2XJVA 4AZZA 1HW5A 3BGAA 4LA3A 5A6XA 5JSOA 3P1IA 3R4UA 1FNZA 2FZ2A 1DGRN 1OFNA 1STMA 1SLIA 5M0TA 1ZREA 1HB3A 1US2A 4XACA 1YIFA 3E5XA 2D6PA 1QDOA 3FLTA 3RS6A 3WQBA 1PHMA 1MZFA 3PUAA 5ACA1 3WF4A 5K8SA 1W2TA 4AVBA 4UBGA 3CIHA 5DAPA 5C7GA 2WO1A 1R1A1 4N43B 5G04L 2ILMA 3DF0A 3W5NA 4NWWA 3OY8A 5KHGA 2ORZA 2VBPA 1DF0A 5T55A 5JOWA 2QTWB 1TQ5A 1YXWA 3VHOA 2WSVA 2YROA 3WOGA 3WP3A 3AZWA 4FPYA 2D5HA 1UZZA 2VXRA 1GP4A 3BIEA 5CFCB 3MLJA 4MV2A 4JV4A 1GP5A 4GMP1 4N53A 4Y20A 4AFCA 4IE6A 1JI6A 5F5CA 1ENSA 4NIDA 5L19A 1AYN2 1XYOA 2RS11 1PM7A 4UFHA 4XJ8A 4DNYA 4XBNA 3VDDA 4ET7A 2P4EA 2A6WA 4GZ9A 1RUD1 1XPWA 1ULEA 1VAVA 2VO5A 4YM1A 4A3XA 2D6KA 1D7PM 5F3EA 4AK3A 4DY3A 2FD8A 1BQPA 1R1ZA 2D3RA 3RSJA 3ZN5A 4B8EA 4XFBA 5C33A 1S2KA 1N3OA 3ZIXA 3CZUA 3AP9A 3KF3A 1ZBE3 4UFLA 1S55A 3HD8B 5EP9A 1ULCA 3NRUA 4B7KA 4FAGA 1XNTA 3O1MA 4COWA 4XFGA 4LULA 4CDXC 2AGSA 4JGYB 1T6BX 3OBTA 1VBD2 4HFSA 2NQYA 3V0AA 3E5UA 4BQYA 1NZIA 1LB2A 1X50A 5A70A 1APNA 1N1VA 2WWUA 2DCZA 4NAOA 1HJGA 3SKVA 1KJLA 1O5LA 3KQ4B 3NL1A 1X82A 1DBNA 1UYXA 5EXOA 1A34A 1UOBA 1IS4A 1CAVA 2CYFA 2R1DA 4Z82A 1G9DA 3W20A 1W6MA 3CLPA 2VMEA 2XQRA 4W4ZA 5JPMB 5H9RA 3N35A 2Q8DA 3JD72 3AMQA 4AQSA 1F31A 4AXOA 2ZMKA 5FZOA 3J4UH 3PU8A 3RGBA 1COV2 2BVBA 4M0HA 1TVGA 3TNQA 3FHQA 3E6DA 1ONAA 4MZUA 1FAYA 3P3NA 2XBO2 2YBSA 2R30A 5IVYA 3UETA 1O4YA 1QOSA 1NXD1 3NJZA 3VD7A 1C1LA 4Q26A 3NW4A 5CKQA 3I3EA 5FYSA 1O3TA 3AMHA 2W68A 3KGZA 4YVWA 1JN2P 3EB7A 5EYXA 4YYOA 2VUAA 2X8KA 3THCA 4A41A 1RUE1 2ZA9A 2G9GA 2GC3A 1DLLA 2X5IC 1QOTA 5FMCA 3WUDA 1W3VA 2YGMA 2F4PA 1D4M1 5F3IA 4BIFA 1SLBA 2WO3A 5FYCA 1KDKA 1UKRA 4HKLA 5KBFA 2ET7A 2HWC2 3MZHA 2PAKA 3RZLA 1FATA 3QOPA 3LPGA 5D8AB 1G8WA 1SFPA 4ZU4A 1YHFA 3HQXA 3Q8BA 4CU8A 2HWB1 4JGZA 4Q4Y1 3LEIA 1Q8PA 2AUYA 5FXWA 2UURA 1M06G 2O1QA 4CCLA 3PUIA 3ZYIB 1LNSA 2GDFA 3MI8A 4F3JA 3HEIA 4OZOA 1CJPA 1I5PA 2YPJA 2ZAAA 1J58A 5LA9A 3GYDA 3WW2A 1ACCA 2XGXA 4A45A 1NCQA 1NCRC 3ZXEA 2GALA 1LU1A 3G7DA 4WM8C 1XNBA 4UF0A 4HMZA 4XUNA 1C28A 4HONA 5DUUA 5JLVA 1EAH3 1L7RA 4K21A 1OQDA 1ZX5A 2BNMA 4Q8KA 5T52A 4X8PA 3Q8CA 4COVA 4LKEA 2B9VA 1AXZA 4BCUA 2RE9A 4BU2A 2R7EB 1AR72 1BVP1 1DLCA 3UGHA 4D69A 5FLHA 1UF2C 2R073 5H9SA 3JQWA 2J1SA 4OHVA 3I59B 2VOKA 5JOZA 1EUTA 2VAUA 4EWEA 3LZZA 3ROUA 5FY0A 1RUC1 3HN3A 4LBOA 1RVF2 3WW1A 4B4QA 5DAQA 1KEXA 4CCOA 2VGDA 4I09A 3I3MA 5FZ3A 3H8RA 3RZMA 3HNMA 4P08A 3RNSA 5T3NA 3ES4A 4EWAA 2GC1A 2OPWA 4EE2A 5CKNA 4Z1VA 4WVMB 5CB7A 3UL2A 5F7UA 5HXMA 2IC1A 1ZRFA 2YUEA 1AR81 1RGSA 1SDDB 3MIFA 5CZKA 4DY5A 4IGQA 1WCKA 4W6YA 2WLPA 5BNOA 2AENA 3H3ZA 3MF9A 1NQJA 2QQOA 3VV1A 2HBTA 4XYXA 2ZEXA 4AI3A 1GOHA 3M3OA 4HK9A 1QJY3 1JUHA 1KDMA 3OD0A 4YGBA 1LEMA 5A7WA 4HSJA 5IUQA 1J3PA 3VLBB 1WZXA 2Q4SA 2Q1FA 5D21A 4QXBA 5L7OC 2WA4A 1HJFA 3VHPA 3GBGA 4WZCA 2K46A 4K3UA 1GOFA 3GHMA 1MS4A 5E8AA 5A7OA 2NZ9A 3C7EA 4IV3B 1NY71 1GR3A 4Y24A 4A44A 2ZX4A 1WUVA 1W8FA 3GJAA 5FYUA 3W9AA 2ARCA 1JW6A 1PGL2 2JDYA 1W6QB 3U4XA 5C8CA 1GUIA 4GB33 4AQ2A 4JQRA 2VW2A 1DQ6A 1NA1A 1DP0A 2MNGA 4XE9A 4CEYA 4E2GA 1PGW2 3U75A 1YJLA 2ZCWA 3I3QA 5FZKA 4GH4A 5GKAC 3VBRB 2AEYA 1U0AA 3ZYPA 2ARBA 4B1MA 2QQVA 4JDOA 1D0HA 4QX3A 1B35C 3ZXKA 1LGCA 2BRTA 3KHBA 1Y9MA 4BIOA 3AZYA 4NO4A 3VKOA 5FO7B 3PMSA 1W6PB 4Q0VA 5APAA 2RDQA 3O1UA 4AYUA 5J7MA 2XKOA 4RR3B 5FQ0B 2CU5A 2OS2A 2WZ8A 5FPZA 5FZ0A 5C8WA 2LROA 1W6NA 3BCWA 4M3CB 1K3IA 1C5IA 3WDXA 2R6QA 4JRAA 1OFSA 3ZKYA 4BQ1A 1GLHA 1R091 1ZZBA 2WT0A 1H8TB 1QXRA 2G19A 3WDVA 1L3JA 2D6OX 5GZGA 3EYPA 3QCWA 1VBE3 2JEMA 2H6BA 2RS52 3U1XA 5AC92 3LFIA 1GKBA 1FX5A 2LS6A 3UV9A 1HXS1 2ZGTA 2EAAA 4Q27A 2WT2A 2WZR1 1ZNPA 3ZMOA 1W8HA 4LKFA 2CY6A 4JHTA 3KS7A 4GJYA 3DXUA 4WM7C 1JXNA 1H30A 2E26A 2JKXA 1C57A 1N47A 1YJKA 4NRQA 1A8MA 4IEPA 2OZJA 1QJEA 1ASJ2 2PELA 1H2KA 2YHJA 1TME3 3TN91 2I45A 4LHLA 1Z7S3 4WV8A 1W3XA 4WVZA 5FZAA 3AYAA 3S7IA 3E97A 4Q4X1 3NNMA 2YC0A 1K5MA 5FY8A 3SC7X 3UGGA 4HK8A 5A7QA 5F1RA 3AP4A 2HWD3 5FP9A 1Q8VA 3KV5A 1GZWB 2W91A 2ARXA 5FYZA 3IKWA 1QH6A 4JHZA 3VUOA 5JWPA 4NIHA 1AYM3 4CDQC 4LBQA 4R9DA 4UW4A 4ES9A 2YB7A 5IVBA 2QZ2A 2FDIA 1GWKA 3R0RA 4LJHA 2PHDA 3ZPOA 2JDPA 2XXZA 2C9KA 1W6OB 3ZSEA 2WKKA 1MZ6A 2XQXA 1Q8OA 3O12A 4OHXA 3C3VA 4YZ4A 2WAOA 4LE3A 3ZFFB 1ENRA 2FDHA 4YW5A 5FZ6A 1DGRA 1VBA2 4D6RA 2WS92 1X9PA 3G6JB 4H7LA 2H0BA 2E63A 2HH9A 1VBC1 3SQOA 1ZRCA 5CBLA 1CR7A 2XHKA 3KV9A 1S2BA 1XNKA 4ARXA 2EXHA 2UU8A 3LEMA 1POV1 3WQ0A 4DINB 2TNFA 1PO21 4IEWA 2EXJA 1W9YA 4MG2A 2RR11 4MXWB 1S0BA 2OX0A 3KLSA 2BW8A 2VMGA 4ZS2A 1ZM1A 1UU4A 2GAUA 2JDKA 4JQTA 4A6OA 3SMHA 4DUXA 2VZOA 4PT6A 3WQ1A 4QXCA 4YM0A 3TEXA 1VMHA 2CAVA 2HWE1 2JG9C 3AFKA 4XTMA 2DVFA 1QDCA 1NXMA 1LRHA 2JENA 4P00B 4P5HA 5GJ6A 2RMU2 1JU3A 3OY8B 1WCUA 2X5IA 4FT8A 5CISA 5ABJC 4CP0A 4XIOA 4ASMB 4B3NA 4P02B 3WD5A 2ZEWA 3A0NA 1AL0G 5LEJA 3J7LA 1VBB2 5FY7A 4DMIA 2YFUA 1PK6C 2JDUA 1HB2A 3M70A 3IMNA 1OPMA 2UYAA 5FUNA 2XUMA 1CJDA 4N53B 1LOBA 3Q8FA 4QDQA 5LB6A 1GWLA 1CX4A 1Q43A 3WNOA 4XEZA 4CRQA 3GZAA 4OLLA 2VJXA 2WT1A 2ZGKA 1U5ZA 2BYVE 4AEMA 1R64A 3N9LA 4E4DX 2BWAA 5KC6A 4R8HA 1LCLA 1CPNA 3VN4A 2JB4A 5I0TA 5CA6A 2QQJA 1HKDA 4UAPA 3CKHA 1IPJA 1J83A 1ZZCA 2V5DA 3D0SA 4P14A 4WM8A 1UY3A 3JUUA 4DRRA 3ZFGC 3LCPA 4ITCA 1RUJ1 4RFT0 3TOJA 4P9YA 3Q8EA 1RUF3 2ORXA 3T2PA 3OGRA 1QMJA 4IERA 1WLCA 3T3YA 3K4ZA 1JYTA 1MS9A 1PMIA 2VBBA 4OFGA 2V4VA 1S0DA 1RUH2 4XVHA 3DUIA 4CU9A 1CAVB 2W39A 5FOJB 3ENRA 4CCNA 3OPWA 3A21A 4M01A 3UT0A 1W6MB 3VKMA 3ASIA 4DS0A 1YFXA 3NAPB 1QQP2 3K3OA 1RIRA 3NNLA 2C5DA 3RG0A 4Y5SA 3RPQA 3MUY1 2WNUC 2ENRA 1MS1A 1ST8A 4AFDA 1NX9A 2NM1A 1BVVA 5IVFA 1RUG3 5KXDA 2YV8A 3PIJA 5IK4A 5FZBA 1OKOA 1H2MA 5KHHA 4Q4W2 4LLFA 2BNOA 4NIIA 4M4RA 2A6ZA 3IDAA 1XB9A 2EXKA 3U11A 3DYPA 4YVWB 2P1BA 4XF0A 3WCSA 4CEWB 1UY1A 3OF1A 4DXZA 4GKXA 5F5QA 5IT6A 2XPJA 1NKGA 1FOD2 2WNEA 2PQQA 2XB6C 4H3WA 1RUI2 1F5FA 3WEZA 1UCXA 5DG1A 5HI0A 1OHFA 2E31A 5LK7B 1RUG2 1RMU3 4JVAA 3U4SA 2PAEA 1TG7A 1AR63 3LKJA 1K5JA 4RYDA 4NE9A 1U5IA 1QU0A 4OYUA 1TME1 1UOGA 2C24A 4UFJA 3AX4A 1XQNA 2PLV2 4R4ZA 1UPSA 2YFZA 4JGZB 4AEDB 5FO9B 2QUOA 4XBLA 1ZBA1 1JUIA 2JIGA 4QX8A 2R1BA 4XZUG 4RQPA 5FP4A 5KR7A 4QQOA 4Q2FA 3ZN6A 3A0KA 2UWAA 4PBOA 2XVKA 1N3QA 3OCPA 4KG8A 5C6CA 3KCCA 3VZLA 1BEV2 5FMOL 1SBDA 2AC1A 1BBT3 2GC2A 4KQ7A 4Y22A 2D6LX 1LR5A 3U07A 2PHRA 2JIJA 1ZZ6A 3B94A 5IW0A 5FMOS 1PVC1 5GLVA 5AFBA 2BPA2 2WWSA 4WVVA 5JDBA 1B35A 3JBG1 2F4LA 3U10A 3DEMA 2RJLA 4IGPA 1HB1A 4EN7B 2NMNA 4Z2AA 5BUVA 4AQTA 3WW4A 1W8ZA 2D40A 3ZFEC 2FBEA 2PQSA 3FN9A 4RS5C 3SH5A 3H3LA 1CONA 1KFUL 2WJSA 3ZR5A 3WG3A 2X09A 2X05A 3JU9A 4Q0QA 4QPIC 4PLNA 5I91A 4U36A 1RJ8A 2XWBB 4TYSA 4B7EA 3WF0A 3VKNA 2HWF3 1OOPC 3IIAA 3ZMNA 1NE4A 2JJ6A 4MLOA 4FTBA 2ZMNA 3A23A 2R042 3USSA 3J8F1 2YBPA 3OBRA 4FI9A 3MBWA 5FXVA 2XJQA 2CHHA 3MF6A 1VB2A 3BYWA 2HEVF 4Z07A 1C8M1 5E16A 2CL2A 4CUAA 4CYDA 3EHKA 3DKWA 4N7UA 1XE0A 4WM7A 5EWSA 4Y33A 2DVBA 2HWF2 1WW5A 3BTAA 5FP3A 4COYA 3A4UA 4TZDA 3I7DA 1CD3G 4XF3A 1AL22 5FZFA 4C1WA 4LBLA 3AMPA 1H1IA 1Y9QA 4Q8LA 4S2FA 1WA6X 5A7WB 2UYBA 2Z5WA 4W8JA 4IE5A 1GOGA 1R1A3 1T2XA 3P3PA 4BK4A 3FBMA 1AX1A 5A3PA 5L9BA 5CFDC 3I3BA 2BDRA 3M8LA 4IV1C 3ZYFA 1REEA 2V72A 1HRV2 3GM8A 4UYBA 1FPN2 1ZYBA 1W2AX 2VTFA 2PYTA 1ZVFA 4QX7A 3HT1A 4Y5Z0 4EN0A 3MLKA 2QBXA 1S0CA 4KWJA 1PZ7A 2C26A 3FWEA 4DOUA 4A6SA 1IZ3A 2VZPA 4Q4V1 4AAXA 1UX6A 3AKTA 3OJBA 4CDQA 1XU2A 3LIGA 3WXPA 4K6BA 4XF9A 3ZPYA 5ACA2 1CESA 4GMP3 4CU6A 1NA1B 3TWIA 5FWEA 1CAXB 4FP3A 4XJUA 5CNAA 1R1A2 3L9JT 5FY5A 4OQ9A 2UY8A 3SHRA 4LO7A 1CN1A 4LO6B 2RS13 1MQTC 4PDWC 1NZCA 5FUIA 3MPBA 3H8XA 2ZX1A 1SCRA 3T2TA 3VZNA 1JHNA 4XF1A 1X8MA 4XJZA 1RUD3 3BALA 2HEWF 4YLZA 2CSGA 2N7GA 2A75A 1JZ4A 1KQRA 1OLMA 1OA4A 1VIWB 2HJIA 5IVCA 4JKLA 1F5JA 3J7NA 4JZRA 5A6YA 2V4AA 2VCMA 2W46A 1W06A 3GNEA 3OGVA 1UNBA 3AKRA 3M3IA 5L36A 2MEV1 4DQAA 2PHWA 1JH5A 1W6NB 2DUOA 3T1MA 4OZXA 5FMDA 5A32B 1OA3A 1AR92 4BQWA 2HBUA 4HL0A 4XQDA 1JYXA 5I0UA 3POFA 4XAEA 3VBHC 1QWRA 3MIEA 1HN0A 4ZONA 2JG9A 3FUQA 1JZ7A 1V6LA 4PCRA 4CTEA 3IDCB 1F15A 4NAMA 5FAXA 3TNPB 3OPTA 5K9YA 5JR7B 1FV2A 2P34A 5ABJA 3I2KA 2EA7A 4URTA 1OURA 1T6GC 4XILA 1OI6A 1W04A 2QQLA 1IQDC 4XUTA 2KM2A 2DYCA 1ND2C 1PK6A 1K12A 1PMJX 2Z2SB 5A7PA 3CL1A 5LZ6A 3CMGA 5DG2A 3VBUC 2AZ5A 5BNPC 1IPKA 3WR0A 5FXXA 1WLWA 1O59A 1YWKA 4TSVA 5CYYA 3WG4A 4AG4A 1AR61 2TUNA 1PMHX 1RUE3 1XRUA 2B8MA 1K5MB 3AP7A 4HN0A 1XYPA 4GD4A 4LE4A 1D4M3 2J1RA 1W8UA 1WBLA 3DPRB 4MGTA 5TSWA 1AF9A 3TYJA 1UU5A 1KITA 2LTNA 1UOJA 1YC61 3T30A 3BPZA 3KD4A 1VRH2 4B4PA 1H0BA 2PTMA 3ACLA 3ZFGA 2W0XA 5DXDA 2OUHA 2YXSA 3VBFC 1QJX2 4CP9B 3O1TA 1J3RA 1RHI2 4L92A 1XE7A 1YUDA 4Q4Y3 2D3PA 3ECQA 5FY1A 2J1EA 1LAJA 4CXWA 1D4M2 2ATFA 2YY1A 3B3QE 3BTYA 3CF6E 5JXIA 3VBOC 3PMEA 1VMJA 2VNGA 3O0XA 3RI8A 5C71A 5FPBA 1LEDA 2CDOA 5FZ7A 5DDJ1 4A3ZA 2VC9A 1KXGA 4HLTA 4UWDA 3HIFA 3ZIWA 1WCSA 2HWB2 2WNUA 4CDUB 1SQ4A 1JYIA 3WDTA 3LA7A 2VMHA 3TRSB 3BKZA 1RUNA 1HRI1 1W05A 2P37A 1I9RA 3FUOA 3ZDVA 4H7MA 2Y6JA 4EJRA 1FMD3 1OMIA 2I2SA 4L11A 4QHBA 3I2JA 2JDAA 4JAAA 3FZ3A 4M0NA 1RUC3 3PDQA 5FZDA 3H9AA 4ARYA 3H50A 3OB8A 4OI4A 2J7MA 2JECA 4NR1A 4YZ5A 4MUVA 3VHNA 5A3TA 3SISA 1U5XA 1AR83 1JYWA 4IEZA 5FPLA 5F37A 3B02A 5FMBA 4AVCA 1FNYA 3LE0A 2RS33 1L7LA 2WN3A 1UPIA 2WRAA 5JXHA 2Z69A 2ZGUA 3KCYA 1TMF1 2P3JA 3LEKA 4PBPA 3BODA 3LPFA 4Q0UA 4TN7A 4YVSC 4QX5A 1C1FA 4WM8B 3IPVA 2A7AA 3GXUA 3MW2A 2EXIA 3O7OA 5FYHA 5FK7A 3K4DA 2D7FA 2Q1ZB 4CZSA 3RZGA 1MZEA 2XL9A 3MW3A 3ZFEA 1EV11 5GZFA 3WP6A 2VH9A 1S2EA 1PO11 3MYXA 2XJPA 3VZKA 2BBAA 2D3SA 1QJZA 1WD3A 1J84A 1N1SA 3T0DA 2ZKLA 2WQZC 3CQOA 4QPIA 3HWJA 4Y4RA 1LHOA 1LOFC 4L9BA 2OVUA 4XURA 4CU7A 5DZFA 3R6SA 1OOPA 2R32A 4ZHNA 2WFPA 1A78A 1PNFA 2A3YA 3MO4A 4J6GA 2J1TA 3AL6A 1GNZA 5IHRA 5HV4A 1DGWA 3CDZB 2DUPA 4GQ7A 2XOMA 2VW0A 2ZX3A 3UK9A 4A7ZA 5I93A 5IYYA 2ZJCA 3JCIA 3D4KA 2WNVB 4TLGA 3TBDA 3KT1A 4B29A 2OQ7A 2WO7A 4NPLA 4P9IA 2B9UA 3FE5A 4K20A 2VMCA 3L2HA 4KL1A 1RTVA 1DQ4A 3A7QA 1PM4A 1ZBE2 3WG2A 3ZXLA 5A33B 1IGOA 4FFFA 5IFPA 3M2MA 1R093 1V9U1 2FMYA 2Y26A 1OD3A 1IQAA 4HVOA 2GU9A 3HMYA 3PHMA 3VKFC 4HG6B 3AB0A 4URAA 2K9ZA 3DKQA 4I3PA 1YI7A 2JG8C 1HXS3 3HAGA 2WFF3 1KFXL 2WZR3 4S2GA 5AFEA 3N9QA 1DHKB 1OVSA 4XHXA 3POWA 4YPJA 1OKQA 1YYNA 5IJRA 4R9AA 4BQ3A 4AI0A 2VCBA 2ADDA 4JTOA 2B5HA 3QH7A 4N9IA 3T08A 2GMPA 3ZDSA 2B7YA 4RQPB 1CZVA 4NRMA 4CCJA 3DYMA 3ZN6B 1UMZA 4W65A 3TN93 5T5PA 5C5UA 5IK7A 4S2HA 3GZEA 5C3QA 5LCWL 5E6HA 4Y22B 4YRDA 5A33A 2IFRA 4Q4X3 4PDWA 2XVLA 4YSFA 4FSJA 5IATA 2GSYA 4ATEA 1CAUA 2FCVA 2JDNA 4KU8A 1H4HA 2E7TA 1B35B 5T5JA 2QQMA 4GMP0 1QNYA 2W52A 5GZDA 4E4SA 5IK8A 4AI2A 2PMWB 2XONA 3B01A 2E7AA 1C5HA 2Y6KA 3JQXA 5K0UA 1NUKA 3ZXGA 5BXXA 1SPPB 3K46A 4XDOA 3BVCA 2VTXJ 4DB5A 5C4WC 5FPXA 4EWDA 5GLTA 5LBBA 4ZXEA 5LY1A 4FOVA 5CVRA 2K0GA 3RWNA 1MEC3 2XMLA 4HANA 3IAQA 4QXHA 2VQUA 4QPWA 3VBHA 2ZGSA 5F5AA 2PHUA 1VBC3 2VNOA 3HPNA 3FFZA 4GKYA 1EPWA 4QX2A 4COZA 1LOCA 4AF9A 1TEIA 4D6QA 1MZ5A 4Y5TA 5FXZA 4OUSA 3ZN4A 3USUB 3E6BA 4N43C 1POV3 2JD4A 4IXLA 2OKXA 4OCTA 3OUIA 2WLQA 5JIAA 1PO23 2FQPA 1OH3A 1TNRA 1FMD1 4LUMA 4YZ2A 4Z92B 1SBFA 2XR4A 2UY9A 5CG9A 2RR13 3VBSA 3VKLA 3WDUA 5J36A 3C7FA 1QJU1 3U78A 1UWWA 1VJ2A 3WG1A 1ND2A 1TNFA 3WY6A 1VBC2 2HWE3 3ORJA 1EAH2 5CFCC 4TTGA 4LHNA 2OQ6A 1W90A 3EQEA 3UNPA 1JZ3A 2CTVA 3N7MA 4HPKA 1CIYA 3FLRA 2P6HA 4UW6A 1NLRA 2VW1A 5JI7A 1HB4A 4H2AA 4OUEA 3RWKX 5JZGA 4MGSA 3ACGA 2R072 1WLDA 2KXLA 4LA2A 2WYSA 4LPLA 3MICA 4QB1A 1AUYA 2OUJA 4CDQB 1XNAA 1WA4A 3O1RA 2BGPA 2RS31 4AL9A 2YU2A 3DYOA 2DUQA 3AP5A 1EP0A 2Y6FA 3EMRA 4X6QB 4Z2WA 3VBFA 2VZ1A 1OF3A 4RSUA 1ND3B 4JGYC 3UKNA 4UXAA 3JB8A 2D98A 3E1F1 3PVBB 3ZSKA 3WCRA 1FI2A 3WVJA 4E4HA 5FIXA 4OUMA 2O8OA 2WQ8A 1WMEA 3KT4A 1PX3A 2VY0A 4LBJA 1VMFA 4RL7A 2PXJA 3O1SA 4LOSA 3VBOA 4MHUA 3C8XA 5B4NA 3C7GA 1QJY2 1AYN1 4YM2A 3OEBA 4I2OA 1RUJ3 4DIQA 2ET1A 1SACA 4ISRA 4BDVB 1EUUA 2Q1MA 3WV6A 4HT1T 1G9CA 4AEJA 2W1QA 2JD9A 4QB2A 4XABA 1QF3A 5EJZB 2RM23 3QACA 5GM0A 1WWYA 5JMOA 4IUGA 2VQAA 2JG9B 3RZKA 3GZUC 3PNAA 4Q1PA 3OYWA 4EN9B 4FTSA 4ES8A 5BNNB 5C9AC 4GB32 5KXEA 2RDNA 4DFSA 1VBD1 3KZ4C 1AX0A 1UKGA 5BV6A 1NQDA 4LHSA 2XH6A 4IEYA 2DVDA 1DQ2A 4DO0A 2QVSB 2VQTA 1GYKA 1I3HA 1D2QA 2DCTA 5EJ3A 5I8SA 4FTEA 3U37A 1F8VA 2VTXA 4LNVA 5D8AC 1OSGA 4C91A 2A6XA 4QPYA 5LK5A 3JD71 1BMV2 3O1VA 4MVTA 2VM9A 1WCQA 1BXHA 1R081 4QGNA 1W39A 1COV1 1LULA 2BGOA 2Q30A 2WFF1 1YIPA 2F6BA 5EJ1B 5T5OA 1QGLA 1QNWA 5FPVA 4AHZA 4LEJA 5DN2A 3NWKA 1K45A 1YI9A 2E32A 2XBO1 3PTRB 3W21A 3W5MA 1G7YA 2XLGA 3AXEA 4BYYA 4P9GA 4Y1YA 5FOBB 4EN6B 3LIHA 4FAHA 4FXKB 4QU1A 4XCAA 3WZ1A 4P9XA 2B4KA 2ZTNA 3PU3A 4SLIA 1FXZA 2YYOA 3CEWA 4KNCA 2Z42A 3ZFGB 5HCAA 2ZX2A 4ZKTB 1VBE2 5JOXA 5IVEA 2PHXA 2B45X 4EYUA 1F4HA 2BJSA 4LXLA 1ZBA3 4XCBA 4QQHA 1UZYA 1IPSA 3MV11 2Y6HA 3HNYM 2HWC1 2VUJA 1GZ9A 2SBAA 4KH9A 3H8UA 4NPRA 4XMIA 5FZEA 3NV3A 3MIBA 4QKNA 4A7KA 2YC4A 3T4HB 1Z0HA 1S1AA 1AJOA 5GLUA 1PVC3 5KHKA 1TME2 3LQCA 4K7JA 4G4FA 1IS3A 1Z7S2 2OW4A 1UZ0A 3DXTA 3GCXA 2XDVA 3JBG3 4LUKA 4QU2A 2KD7A 4D94A 3THDA 4CDXA 3LSEA 4Y1VA 3NJXA 1MEC1 1RL3A 2HWD2 3VGIA 4QPGB 1PIV3 2ZGQA 3APBA 5IWFA 2QQIA 1V6JA 1VLNA 1AYM2 3K77A 3WLUA 1RC6A 2BU9A 3AVSA 1O4ZA 1PVC2 3HBKA 3POIA 5AVPA 3FMGA 3ETPA 1GQPA 3ZO0B 1UYZA 3KCXA 3VD4A 2D97A 2FMDA 4QGMA 2PA7A 3J8F3 4D8MA 4ZZ8A 1PVXA 1SCSA 1O6UA 1ULPA 2DBNA 3BOPA 5HCFA 5FR3A 2WSUA 4FP2A 1C8M3 4PJYA 1PNGA 3ILNA 3BU0A 4OHZA 3S5AA 4LO4B 1NOVA 3H7JA 1D0GA 2GH2A 3IT8A 4IV3C 5H9PA 1RVF1 2VZTA 2W3JA 3GF6A 3LA2A 3MGUA 3N7KA 4Y1ZA 4EZHA 3BI3A 1UL9A 4PI0A 5CU1A 3RVHA 1ULFA 4ATFA 3LAGA 3V65A 1ODMA 2QKDA 1DYOA 2QQNA 1SDWA 4GA9A 2NN8A 3FHAA 3VBRC 4FBFA 1LESA 3K4AA 3IPVB 3LD8A 2YMZA 2Z79A 4FPHA 4Y20B 4CXXA 4FPLA 4UT5A 3HR9A 4QKFA 1PGSA 1OVPA 2FCTA 2JDZA 1JHJA 3ACHA 4OI1A 4WVWA 4Q4V3 3VDDB 2P5BA 4BWOA 4I02A 4RR3C 3DCQA 1ZRDA 1CWPA 1A3KA 1OPOA 4Y1XA 3LDKA 1O8PA 4QPIB 2UWCA 3RYKA 4C1XA 1NCRA 2Y0OA 3CZJA 3SLIA 3Q8AA 1WGPA 1CZTA 1DZTA 1YFYA 3POGA 2VZ3A 4KU7A 2ZX0A 1Y9GA 1O3QA 1SFNA 1H8TC 4E27A 1IG3A 4LMFA 3HNBM 5DZEA 2ZOEB 5F3CA 3PUSA 4LORA 3V0AB 2AR6A 1XE8A 4EN8B 1PGW1 4N43A 2RM21 4DEQA 3ZLIA 2MEV3 2CGPA 1LODA 4GAZA 1NE6A 1ULGA 2OXBA 1X7NA 1W99A 5DABA 1POV0 1OUSA 5FUPA 1BJQA 1W9WA 1XYNA 5CFCA 5F8PA 3KSCA 5FZOB 3D82A 1RUF2 3N9PA 2XJUA 4NRPA 4XFAA 1DQ5A 4HXCA 2Q8EA 4IEOA 2FZ1A 1H9WA 2RV9A 3NVCA 1H1AA 1JZ2A 4XOGA 2A3WA 4BQ2A 2XL7A 4BQXA 1V6IA 4QM9A 4R52A 1MS0A 4LKSA 1WW6A 5JPNB 3Q9OA 1AX2A 5FY9A 4QKBA 1NLSA 2IWGB 1XNDA 2BNNA 2RS51 5AC91 1GU3A 3ZSLA 4LO5B 2BVVA 4GWMA 2I07B 3ZFFC 1DZRA 2KA3A 1W0OA 2WDBA 1WKYA 4JGYA 1OUXA 3NMBA 2W08A 3SNMA 4BK5A 1WMXA 4F7ZA 5C3OA 5L7OA 4A7YA 1CAUB 4BQ5A 1J3QA 1JBCA 1SHWB 2PAMA 1EYBA 3I2HA 3THPA 3VD3A 5D2AA 3RZHA 2RHPA 3MFAA 4WBBA 2J1VA 2R063 1ASJ1 5I8TA 5K0UB 4KWKA 4YM3A 4BISA 1O8SA 1UU6A 4Y1UA 4GJZA 1E5SA 4AHYA 4OI2A 5A3NA 3NNGA 2VVDA 4JRLA 4AE2A 4HOOA 4ONUA 5HCHA 2Y64A 4LK6A 5FV3A 1RMU2 2G9ZA 3S5QA 1AR62 1O3RA 2B46X 1SG3A 1NCQB 2CWMA 2ARAA 3F95A 5JCTA 5FK8A 3RZJA 4HKOA 2EALA 4UF0B 2YU1A 5SV5A 1H4GA 1JYNA 3LDRA 2X10A 3NJYA 5ANNA 3VL9A 4ASLA 1YQCA 3ES1A 4LK7A 5B4XA 4XBQA 4JTNA 3N3HA 4BB3A 3LF7A 5DDJ3 4GWNA 1V6KA 2VECA 3MLLA 5C9AA 4YARA 1PIV1 1A8DA 1VBA1 2GN3A 4RGGA 4EZ4A 4M4PA 1YO8A 3RZZA 1BBT2 3LOBA 3VBSB 4AVSA 3T0AA 1BK0A 1HRI3 4DPNA 4U2AA 4IEQA 4YGEA 3I49A 4PIXA 2ZHMA 4AGRA 4MX3A 4XQ4A 1IOAA 3WF2A 4RGAA 3PL0A 5D8AA 3RMYA 1JZ5A 1N1YA 4Q0SA 5LW9A 2RDSA 1AZDA 2DCKA 1KJRA 3CO2A 5FP7A 4ZXKA 4IESA 4MOAA 5JZGB 1VE0A 1G9AA 1HDKA 2LM3A 2ZXQA 1CQ9A 4QDSA 3WP5A 2WA3A 3WF1A 3OGGA 5BNOB 4HETA 1N3PA 4L99A 2VUDA 2C4XA 1OLME 4NUBA 2XHNA 2P3IA 1AHSA 1BHGA 2P6CA 3H1YA 4XJ9A 3M4FA 1W8NA 2JE9A 2RMU1 4RHV1 5A3OA 1QY4A 4V2VA 1ALYA 3QH6A 3VZMA 2W87A 3J7HA 2D6NA 5A80A 4D7YA 3H1WA 3RJRA 1GV9A 1VBB1 1IS5A 3R05A 4YZ1A 3L2YA 5HXVA 1DZQA 2ETEA 1UMIA 2VUCA 1TMF3 2VBDA 2J22A 2VD7A 3VDCA 4BM8A 4AVAA 4H55A 3I59A 4FPGA 4XTPA 1Y7BA 5J09A 3NAPC 2C9AA 5C8CB 4ISQA 5JOYA 3U0ZA 5E89A 1XSQA 2ZABA 2IZWA 2O14A 3X29B 4CEYB 4NIGA 1D2SA 4I3GA 4MO3M 4FPFA 4O7XA 2OPKA 4GH4B 4XJWA 4DZGA 1EV13 4WVMA 4FPCA 1PO13 1X36A 5LEKA 4ORFA 5EQUA 5FPAA 3GBWA 1F9KA 2P17A 1WD4A 1W2OA 3OYWB 4YW6A 4PQ9A 3UGFA 4YVWC 5DAWA 4CEWC 4JDMA 2BOIA 4BE3A 3WHUA 4N8MA 4QKDA 3NQHA 1SBEA 3H42B 1F35A 3IDEA 2D44A 5CG8A 3AYDA 4UBHA 1MPXA 2RS12 2E6VA 1CAWA 3C7HA 4QD2A 1RUH1 1Z78A 1BYHA 3AKQA 4IE7A 3WINE 3WT3A 4XZPA 3HJRA 1RUD2 2X29A 1UAIA 3URFA
chains in the Genus database with same CATH topology
3MFCA 2OYZA 5KHJA 1QXPA 3EO6A 1QQP1 4IV3A 1H2NA 4AEDC 2VVFA 4YG0A 4XJAA 2VVEA 1HQLA 1SEFA 4XF4A 5FFOC 3ZXFA 1KS5A 4JCKA 1W6QA 1WMFA 1V9U3 3UKVA 3H1MA 1AVBA 2TBVA 4Q4W1 2PN5A 3VBRA 2BQPA 4YW1A 2GMEA 4L2NA 1SLCA 1RUI1 1O7FA 3PJQA 1DG6A 4AWDA 1BK1A 4OI0A 2JKBA 1W6PA 5AVAA 4BLIA 4RR3A 2ZMLA 3HT2A 3KT7A 2R061 3SCGA 1UW8A 2XJTA 5KHIA 3N7JA 4M3CA 4W6XA 1RJ7A 2PLV1 4LBQB 2ZS6B 4MGIE 1YNAA 4N7IA 4LR4A 2LALA 4BA6A 1UD1A 2VOWA 3NV4A 1H8TA 4CDXB 4DRVA 1IKQA 1RUE2 1OLRA 2A6VA 2NMOA 1BEV1 1MS8A 2ZPXA 1GFF2 3LWCA 2FHRA 3FBYA 4MYEA 3ST7A 4FO9A 3V0BA 1ZRRA 4FXGB 3RRDA 4XW3A 4FQ4A 1HQWA 3SITA 3R4SA 1MS5A 2WIIB 5BPXA 1U12A 4PLMA 2IXKA 1NYWA 4Q4Y2 4O9EA 1X8EA 2IXLA 3GHNA 1GSLA 5HCBA 3CNAA 1H9PA 4Q1RA 2QE3A 3THTA 3JB4C 4TLFA 3DN7A 3FC0A 4L97A 1URXA 4MGZE 1ENXA 1QJU3 4P9LA 2R041 5GLWA 3O0WA 5GALA 2X5IB 5F6LB 2IXIA 2PHFA 3R4DB 1J1TA 4OULA 1NA1C 2XLFA 2XKPA 3ZFFA 4P9WA 2VQ0A 2ZGNA 1FMD2 2ZKNA 5LRSA 4PIZA 2A73B 2C1FA 2G4IA 1B09A 1AL21 1Q3EA 1RUC2 3CJIC 1MR5A 1C8NA 2IFWA 4YFWA 4FOQA 3W58A 1G9FA 2YGLA 1G9BA 1DDLA 2JX9A 2VNRA 1ZZ7A 5EFUA 1HRV1 1G86A 1PZ9A 1FPN1 3JZVA 4MXWA 1NCRB 1AR82 3AKPA 4XDQA 3WX5A 4IEVA 2ZGOA 1QKQA 2A70A 2RS32 4AFBA 1WLTA 1AYN3 2R0FA 4RS5A 1HQNA 3D0JA 4H14A 4HN1A 4QQPA 5KC5A 1FT9A 5BY5A 3M1HA 1ZZ8A 3B9IA 2GMMA 2PFWA 4COUA 2YZ4A 1NY72 2WC2A 4EROA 4E2QA 4KWLA 4N90A 2GC0A 3TAYA 3E6CC 2CGNA 5JAXA 3GALA 2A5ZA 1LTEA 1AR91 1K5MC 1VBD3 2CNAA 4S2DA 2GNMA 4YFZA 5EYYA 4ZU5A 1S0GA 1SMVA 3DPRC 4I30A 4UW5A 1DFQA 3S6PA 2JE7A 2ZGPA 3AMMA 2Q8OA 1CPMA 3T1LA 4AW7A 3EXUA 3RYPA 4Y4YA 5DUVA 4C0HA 3JD73 4R9CA 3WNXA 1R083 4C90A 1COV3 1H8VA 3MIDA 5L7OB 5CFDA 4IV1A 4LT5A 1Q5OA 2XBO3 3HBZA 4XIKA 3TB0A 1SFYA 2I74A 4QXKA 1R092 1YRZA 1XNCA 3NAPA 1VP6A 2RJKA 4CDWC 4CDUC 1DQ0A 5H9QA 1R082 2ZACA 4HKWA 4FPKA 1HXS2 2WFF2 1MQTA 2WZR2 2HWC3 1VRH1 3WQ7A 3NV2A 1BZWA 4TWTA 1QJX1 1RHI1 5C9AB 3V64A 4Z8BA 3GBFA 4AVVA 3TN92 2G9FA 2GH8A 5IK5A 2MPFA 4Q4X2 2ZGRA 3AMNA 1ZA4A 4GIQA 5J37A 3AJZA 2VULA 2VG9A 1WCDJ 5SV8A 4AEDA 4FOYA 3SH4A 1YLLA 5I0SA 4FPOB 2ZGLA 3N7LA 3IM0A 5DZGA 1AR73 5D1IA 1MEC2 4INDA 2WZPP 3BOWA 3AXDA 4WM7B 5FTTC 5K7PA 1Q56A 4QQ2A 2LUWA 1Q8SA 3VBUA 4G9SB 5BNPA 3S0MA 3UKTA 1RVF3 2QQPA 4RA0A 3ZX7A 1GANA 1PO22 1DQ1A 2BBVA 1DGLA 4LTAA 3INAA 4CP2A 2QDRA 5JI9A 1XU1A 2RR12 2BUKA 3B7MA 2DFBA 2HWE2 1JTZX 1LHUA 4J1WA 3AYCA 4QGLA 1V6MA 4O9GA 3BU7A 4K40A 4YG3A 1Y3TA 3C2UA 3VZJA 4R4XA 4ZU7A 1AJKA 3E5QA 2AREA 1VAKA 2WNVC 4BLJA 1OA2A 4IQPA 1MACA 5F9TA 3B5LB 4GALA 2DV9A 2E53A 1UIJA 4KGGA 2IXJA 2TEPA 4BMBA 2NP0A 1CAWB 3NSTA 4XHBA 4OHWA 3WHTA 2A6YA 4M3CF 1LOGA 4Y26A 2DCJA 2GZWA 4BPZA 4NHKA 1JOJA 3MW4A 5CIRA 1LGBA 3PTYA 2ERFA 2WINB 3VZOA 5FDBA 4RQPC 1RUJ2 5BNQA 1S0EA 5ABJB 2R16A 2GNBA 4I0WB 3DL3A 4LBKA 1CAXA 3RJ2X 4FPJA 2RM22 1PK6B 5T5LA 1IS6A 1C3HA 2OIIA 2XJSA 1ZBE1 2JXAA 2XVGA 3NO8A 3LSDA 4X8NA 2HKXA 5T54A 3H3UA 4XPVA 3CJIA 5FRAA 4I0BA 2RS53 5AC93 4XFCA 1GNHA 3N36A 4NHLA 5JIUA 2QFEA 1KS4A 5KXBA 3POSA 3D6EA 3V56A 5A32A 4YVSA 3UJQA 1QHDA 4XFFA 4G3YC 4E2SA 2NYYA 2R0HA 2Y0IA 3OPZA 3ZYRA 3AZXA 5HBAA 1ASJ3 2DU0A 4A2UA 4AFAA 1YFWA 4F83A 2VMIA 5CADA 3WW3A 1BKZA 2YDEA 3V0BB 3UJOA 5I8YA 3D8CA 4NWVA 1GZCA 5J48A 1LOFA 3LA3A 2P3KA 1OLQA 3NKTA 2CGOA 3PVOA 2DURA 2WNUB 2Q5TA 1ZBA2 2DU1A 3AYEA 4L8QA 3ATGA 1VBA3 2WS93 1A6CA 3QD6A 2DWRA 3DPRA 5J96B 3AM2A 5A3LA 1QOOA 5JSPA 3JBG2 3OGJA 3FLPA 4MH0E 1OQEA 4F8AA 1OD5A 1AR71 4R9BA 5JVVA 2QNKA 4X6RB 1ND3C 4V1PA 4OHYA 4YGCA 3AKSA 3SCHA 2JG8A 2UWBA 1PIV2 3M3QA 2DF7A 3ZSJA 3EBRA 1KD7A 2XG3A 4I0AA 1I1EA 3KMHA 2VU9A 4WZFA 1EAH1 1OQ1A 2B39A 3ME2A 2NLRA 1JYCA 3AJYA 5I0RA 4K1YA 2RMU3 4RHV3 2WQ4A 3J8F2 2Q0AA 2PHLA 3ZXAC 4CDWA 5B2GB 4CDUA 1C8M2 2D5FA 2R071 4XMAA 4E4ZA 4FPEA 1DU3D 1VBB3 2D6MA 1C4RA 4D3WA 3PVNA 4MXVA 3O5SA 1LHWA 3S30A 4IEUA 4LBMA 4P9JA 3PJYA 1W2UA 5BNNC 3ZFEB 1LENA 2VOVA 4RHV2 4RS5B 1UIKA 4K8FA 5C4WA 4XQWA 2ZHLA 3KM5A 5CAZA 3RQ0A 4KGQA 1E57A 4QM8A 1PGL1 4LLOA 4Q29A 1GICA 1OOPB 3WDWA 3ILRA 1V6NA 3WP4A 2EAKA 1QJY1 1LHVA 4Q4V2 5E1RA 3ZYJB 1HV0A 1YFUA 5GLZA 2QJVA 1GQHA 1RINA 4KG0A 3MDPA 3OD4A 5L73A 4IEXA 2GNDA 4AHWA 2K2SA 1WBFA 1HX6A 2XLAA 4MGKE 1U5YA 1RUH3 4IL7A 1LJ7A 1O91A 2BEOA 4AFMA 3RDIA 1S0FA 2DVAA 4HVQA 3QBQA 4GB31 4YZ3A 1QQP3 5FCCA 1LU2A 1VAMA 1V6OA 4QQLA 4MSVA 1MVQA 4K9SA 4YW3A 1SLLA 1WMDA 2MEV2 5CFDB 5JSRA 4IV1B 1DIWA 1AXKA 1LOAA 3VL8A 4FQZA 3KGLA 4CP1A 4Q4W3 1IHMA 4OVEA 3OTFA 4XXAA 1BMV1 4RD7A 1AXYA 1WW7A 3K51A 2PHTA 4AEKA 1FOD3 4BOWA 4AGGA 3SH3A 1RUI3 1D4VB 1UN1A 3EJKA 1Y43B 4PDWB 3I54A 1MQTB 1W0PA 1FV3A 2D43A 4LBNA 3FJSA 5JMCA 4QPGC 4N9HA 4YGDA 2WNVA 3N4MA 3J9SA 1VR3A 3AZVA 3MIGA 4AGVA 1VBE1 1LGNA 1X33A 2PLV3 2QDNA 5KWRA 1YCIA 1QH7A 1TE1B 5A3MA 3CU7A 2XWJB 1EY2A 1HIXA 3K48A 1MVEA 2BTVC 3NKGA 5FLJA 4BH9A 5DUXA 3MPPG 1BEV3 3VBHB 2ES3A 2BGCA 4Q0PA 3S7EA 2R062 3I4IA 2HYKA 3KQRA 4YW4A 1DYKA 1Z7S1 1N1TA 4XFIA 1BCXA 3I8TA 3D5OA 4B4RA 1RITA 4AI8A 1O5UA 2HWD1 2ZZJA 4PIYA 2WS91 4LO8A 3NV1A 4HBNA 3BIWE 2IXHA 2DTWA 1AYM1 1ND2B 1DGWX 2EVXA 1CVNA 3AFGA 3ELNA 3VBUB 4BMEA 2V73A 3IN9A 4N53C 5BNPB 5DDJ2 4BZ4A 4HPKB 2VOXA 1H1MA 1S0IA 2R043 1HLCA 2XJRA 1VALA 3VDDC 2C0ZA 1DYPA 4HSLA 3BB6A 3WUCA 5GZCA 2ZAHA 3AK0A 1S0JA 1RB8G 5GZEA 1HRI2 2EIGA 3ALQA 3AZZA 1J59A 3CJXA 5BYNA 4AHXA 1O4TA 4HVRA 4GXLA 2P2KA 4UW3A 4XXPA 3VBFB 1MS3A 1AL23 3MIHA 1G6NA 4LBQD 2ZHKA 3USUA 2ZZQA 5DUWA 4NN0A 1GBGA 3O0VA 2CAUA 1VB4A 2CV6A 1REDA 1XXNA 2SLIA 3RMXA 3VBOB 1HRV3 1FPN3 3M3EA 4NVPA 5KXCA 4YW2A 3FFQA 2DVGA 2ZBJA 4C0BA 5ACA3 2B42B 1LECA 4D7TA 4QT6A 1RUOA 3ILFA 5FLIA 2DCYA 4AVTA 2V09A 5F6KA 5J98B 2BWCA 1TMF2 5EZWA 4D7SA 2E7QA 4M00A 2E9QA 5FREA 1KRIA 1LHNA 2BFUL 2E51A 2Y38A 3ZXDA 1HV1A 2JICA 2BFUS 4AQ6A 3M3CA 3AP6A 2NPIA 3B93A 3FHIB 2DFCA 4NOTA 2O0OA 2QZ3A 1EV12 1LOEA 1ND3A 4FVVA 3PLQA 4M3CE 3ZVXA 1PO12 5LRRA 1AR93 1GQGA 3B69A 3LOIA 1ULDA 3PVEA 3J26N 3GZTB 1QXJA 3IDBB 4JGZC 5K0UC 1RUF1 4PLOA 3CJIB 1NG0A 4YG6A 4NHMA 1EPZA 1WW4A 2A3XA 3M7AA 2V5YA 4META 1V70A 5E88A 2GN7A 1CGPA 3RI9A 4W6WA 1NCQC 1Q8QA 4YVSB 2EF6A 3W59A 3QLQA 2A71A 2ZGMA 3POYA 1IKPA 4YNIA 4FCAA 2AH2A 1FOD1 3B00A 4JDNA 1RUG1 2CWSA 5BNNA 1V9U2 1I5ZA 3WDYA 2GNTA 5FQ0A 1V00A 2H0VA 3VBSC 2OA2A 2H6CA 5T50A 2WL1A 5J3UA 3B9CA 2X53S 4J1XA 1VRH3 3LGRA 5FO8B 1QJX3 1RMU1 1RHI3 1J1LA 1F2NA 3H0OA 3VHRA 2OZ6A 3ZYGA 5JZGC 2MHFA 1PZ8A 5BNOC 1FYUA 3HN1A 4HZFA 4GULA 4E9KA 3ZSMA 4QMAA 2ZHNA 2QCSB 3KB5A 3SCFA 1LKNA 3FX3A 3ZXJA 2HWB3 4FOWA 1BBT1 3MEPA 2JG8B 1SLTA 1I6XA 4LHKA 4XFHA 1GZWA 3DGTA 3DV8A 3IWZA 1ENQA 1M4WA 4PF5A 2AYHA 4JC1A 5C8CC 1O3SA 3LB9A 3I2DA 1W6OA 4CDWB 4CEYC 1CIWA 1ZZ9A 2VPVA 4KBBA 2HEYF 4GH4C 2O8QA 3SXWA 3ETQA 4EV0A 3IBMA 4MGYE 4QPGA 2HWF1 2DTYA 4I01A 4XETA 1REFA 2D93A 3RYRA 3H7YA 1SLAA 1QJU2 4IETA 5EV7A 2R49A 1H2LA 2IXCA 4K1ZA 5C4WB 4SBVA 3O14A 5FBZA 4BHPA 2XJVA 1HW5A 4LA3A 5JSOA 3R4UA 1FNZA 2FZ2A 1DGRN 1OFNA 1SLIA 1ZREA 1YIFA 3E5XA 2D6PA 1QDOA 3FLTA 3RS6A 1PHMA 1MZFA 5ACA1 5K8SA 4AVBA 4UBGA 1R1A1 4N43B 2ILMA 3DF0A 4NWWA 3OY8A 5KHGA 5T55A 1DF0A 5JOWA 1TQ5A 1YXWA 3VHOA 2WSVA 2YROA 3WOGA 3WP3A 3AZWA 4FPYA 2D5HA 1UZZA 2VXRA 5CFCB 3MLJA 4MV2A 4JV4A 4N53A 4GMP1 4Y20A 4AFCA 1ENSA 5L19A 1AYN2 1XYOA 2RS11 1PM7A 4XJ8A 4DNYA 4XBNA 3VDDA 2A6WA 1RUD1 1ULEA 1VAVA 4YM1A 4A3XA 4DY3A 2D6KA 4AK3A 1BQPA 1R1ZA 2D3RA 3RSJA 3ZN5A 4B8EA 4XFBA 5C33A 1S2KA 1N3OA 3ZIXA 3AP9A 1ZBE3 1S55A 3HD8B 4B7KA 1ULCA 4FAGA 4COWA 4XFGA 4LULA 4CDXC 2AGSA 4JGYB 3OBTA 1VBD2 4HFSA 2NQYA 3V0AA 3E5UA 1LB2A 1X50A 1APNA 1N1VA 2DCZA 1KJLA 1O5LA 3NL1A 1X82A 1DBNA 5EXOA 1IS4A 1CAVA 2CYFA 2R1DA 4Z82A 1G9DA 1W6MA 3CLPA 5JPMB 5H9RA 3N35A 3JD72 3AMQA 4AQSA 1F31A 4AXOA 2ZMKA 3J4UH 1COV2 2BVBA 4M0HA 3TNQA 3E6DA 1ONAA 4MZUA 1FAYA 3P3NA 2XBO2 2R30A 1O4YA 1QOSA 1NXD1 3NJZA 1C1LA 4Q26A 3NW4A 1O3TA 3AMHA 2W68A 3KGZA 4YVWA 1JN2P 5EYXA 4YYOA 4CEWA 2VUAA 2X8KA 1RUE1 2ZA9A 2G9GA 2GC3A 1DLLA 2X5IC 1QOTA 3WUDA 2YGMA 2F4PA 1D4M1 4BIFA 1SLBA 1KDKA 1UKRA 4HKLA 5KBFA 2ET7A 2HWC2 3MZHA 2PAKA 1FATA 3QOPA 5D8AB 1G8WA 4ZU4A 1YHFA 3HQXA 2HWB1 4JGZA 4Q4Y1 1Q8PA 2AUYA 2UURA 1M06G 2O1QA 3ZYIB 2GDFA 3MI8A 4F3JA 4AI1A 1CJPA 2YPJA 2ZAAA 3WW2A 1J58A 3GYDA 2XGXA 1NCQA 1NCRC 3ZXEA 2GALA 1LU1A 3G7DA 4WM8C 1XNBA 4HMZA 1C28A 5JLVA 5DUUA 1EAH3 4K21A 1OQDA 1ZX5A 2BNMA 4Q8KA 5T52A 4X8PA 4COVA 4BCUA 1AXZA 2RE9A 1AR72 1BVP1 4D69A 5FLHA 1UF2C 2R073 5H9SA 3JQWA 4OHVA 3I59B 2VOKA 5JOZA 4EWEA 3LZZA 3ROUA 1RUC1 4LBOA 1RVF2 3WW1A 4B4QA 2VGDA 4I09A 3RNSA 5T3NA 3ES4A 4EWAA 2GC1A 4Z1VA 4WVMB 5CB7A 3UL2A 2IC1A 1ZRFA 2YUEA 1AR81 1RGSA 3MIFA 4DY5A 1WCKA 4W6YA 2WLPA 5BNOA 2AENA 3H3ZA 3MF9A 1NQJA 3VV1A 4XYXA 4AI3A 3M3OA 4HK9A 1QJY3 1JUHA 1KDMA 3OD0A 4YGBA 1LEMA 4HSJA 5IUQA 1J3PA 3VLBB 2Q4SA 5L7OC 2WA4A 3VHPA 3GBGA 4WZCA 4K3UA 3GHMA 1MS4A 5E8AA 2NZ9A 4IV3B 1NY71 1GR3A 4Y24A 2ZX4A 1WUVA 3W9AA 1JW6A 1PGL2 1W6QB 3U4XA 5C8CA 4GB33 4AQ2A 4JQRA 2VW2A 1DQ6A 1NA1A 2MNGA 4XE9A 4CEYA 4E2GA 1PGW2 1YJLA 2ZCWA 5GKAC 3VBRB 4GH4A 3ZYPA 1U0AA 2ARBA 4JDOA 1D0HA 1B35C 3ZXKA 1LGCA 4BIOA 3AZYA 4NO4A 3VKOA 5FO7B 3PMSA 1W6PB 4Q0VA 4AYUA 5J7MA 2XKOA 4RR3B 5FQ0B 5FPZA 5C8WA 1W6NA 3BCWA 4M3CB 1C5IA 3WDXA 2R6QA 4JRAA 1OFSA 4BQ1A 1GLHA 1R091 1ZZBA 2WT0A 1H8TB 1QXRA 3WDVA 1L3JA 2D6OX 5GZGA 3QCWA 1VBE3 2JEMA 2H6BA 2RS52 5AC92 1GKBA 1FX5A 3UV9A 1HXS1 2ZGTA 2EAAA 4Q27A 2WT2A 2WZR1 1ZNPA 3ZMOA 2CY6A 3KS7A 4WM7C 1JXNA 1H30A 1C57A 1N47A 1YJKA 1A8MA 4IEPA 2OZJA 2YHJA 1ASJ2 2PELA 1H2KA 1TME3 3TN91 2I45A 4LHLA 1Z7S3 4WV8A 4WVZA 3AYAA 3S7IA 3E97A 4Q4X1 2YC0A 1K5MA 5F1RA 4HK8A 3AP4A 2HWD3 1Q8VA 1GZWB 2ARXA 3IKWA 1QH6A 3VUOA 5JWPA 1AYM3 4CDQC 4LBQA 4R9DA 4UW4A 4ES9A 2QZ2A 3R0RA 2PHDA 3ZSEA 1W6OB 2WKKA 1MZ6A 4OHXA 1Q8OA 3O12A 4YZ4A 3C3VA 3ZFFB 4LE3A 1ENRA 4YW5A 1DGRA 1VBA2 2WS92 3G6JB 4H7LA 2H0BA 2E63A 1ZRCA 1VBC1 5CBLA 1CR7A 2XHKA 1S2BA 1XNKA 2EXHA 2UU8A 1POV1 3WQ0A 4DINB 2TNFA 1PO21 4IEWA 2EXJA 2RR11 4MXWB 1S0BA 3KLSA 2BW8A 2VMGA 1ZM1A 1UU4A 2GAUA 3SMHA 3WQ1A 4YM0A 2HWE1 2CAVA 2JG9C 3AFKA 4XTMA 2DVFA 1QDCA 1NXMA 1LRHA 2JENA 4P5HA 5GJ6A 2RMU2 3OY8B 2X5IA 4FT8A 5ABJC 4CP0A 4XIOA 4ASMB 4B3NA 3WD5A 3A0NA 1AL0G 5LEJA 1VBB2 4DMIA 1PK6C 3M70A 3IMNA 1OPMA 2UYAA 2XUMA 1CJDA 4N53B 1LOBA 1CX4A 1Q43A 4XEZA 4CRQA 3GZAA 4OLLA 2WT1A 2ZGKA 1U5ZA 2BYVE 4AEMA 4E4DX 5KC6A 2BWAA 4R8H