3DL3A

Crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'RIPKNWTIQRSTPFFTKDNVPEALLTHHNTAVDVFGQICVMEGVVTYYGFANSEATEPEIKVVINAGQFATSPPQYWHRIELSDDAQFNINFWSDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tellurite resistance protein B
publication title Crystal structure of the tellurite resistance protein TehB. Northeast Structural Genomics Consortium target VfR98.
rcsb
source organism Vibrio fischeri es114
molecule tags Structural genomics, unknown function
total genus 15
structure length 96
sequence length 96
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dl3A00
4JTNA 5J3UA 2QDRA 3QACA 4ORFA 1O3SA 2BEOA 3E97A 3EJKA 1CAXB 1SEFA 3RDIA 1GQHA 2QJVA 5BY5A 5FLHA 1RC6A 1YWKA 3ACLA 4CYDA 4I0AA 1GQGA 1NE4A 1YFXA 1CAVB 1X82A 2Q1ZB 3I59A 2CV6A 1ZREA 2H0VA 2BNNA 3G7DA 4JVAA 2Z69A 3N4MA 4IEQA 3GYDA 2B5HA 5K8SA 4E2QA 2D40A 1Y3TA 3H50A 5I8TA 4HVQA 4YSFA 4MX3A 5BPXA 2N7GA 1Q43A 5HI0A 3HQXA 2K0GA 2ATFA 5C8WA 4GULA 2GC3A 3NVCA 3CEWA 2B9UA 2OYZA 3DN7A 2XKPA 3OGJA 3ES4A 4XEZA 2EAAA 5KHKA 5JSPA 1ZRDA 4L11A 2FMYA 3IBMA 4EROA 4AQ6A 5KHGA 1G6NA 2QNKA 1QXJA 4XF9A 1DZRA 4QXKA 1J58A 4AQ2A 4MGZE 4FT8A 4ONUA 5CADA 1J3PA 1OI6A 4WBBA 1EY2A 3HIFA 2OZ6A 4UBGA 4LLOA 4Q0SA 3SCFA 3BALA 2H6BA 1O5UA 3EO6A 3ROUA 5BV6A 2P17A 4WVZA 3EQEA 3CL1A 4EWAA 2IXKA 4IERA 1O3TA 4KU7A 5T3NA 3JZVA 1ZZBA 3SHRA 4OLLA 4O9GA 1FT9A 1HW5A 2CAVA 2QVSB 3E6DA 3FZ3A 4I01A 2IC1A 4JTOA 2IXHA 4HSJA 4A2UA 4D7SA 2O8QA 3UKTA 4Q0UA 5E16A 2D5HA 3VHRA 3S0MA 5LEKA 5FQ0A 1SFNA 4B29A 5I0TA 3PNAA 4N9IA 5E1RA 4Q29A 1UIJA 3ST7A 3D82A 3H8UA 1ZRRA 2GZWA 2OA2A 3LWCA 1O5LA 1NZCA 2VECA 2PA7A 1X8MA 3H3ZA 5KHHA 4J1XA 4QGLA 3TNPB 4ZU7A 1ZZ9A 3O14A 4E2SA 3S7EA 1YLLA 4K8FA 4IEXA 4Q0PA 2XGXA 4KWJA 4BH9A 2D93A 3SCHA 3IWZA 3KMHA 2HKXA 3SXWA 1Q3EA 4KWLA 1FXZA 1YUDA 1UW8A 3HT1A 3USSA 3I59B 1OMIA 1Y9QA 3ETQA 3IDBB 4YRDA 2XHKA 2GAUA 2GC1A 4PIYA 4WZCA 1OD5A 2XL9A 2GC0A 1PMIA 2B8MA 2Y0OA 1XE8A 4HLTA 1H1IA 3ES1A 4MZUA 1U12A 4JV4A 3RZZA 2UYAA 3PVBB 4D7TA 1J59A 4EV0A 5FPXA 1X8EA 5JSRA 4RD7A 3EBRA 3H7YA 3H9AA 3E6CC 1LKNA 4MGKE 3E5QA 4HVRA 5I0SA 1OFNA 2IXJA 4KU8A 4QGMA 4AXOA 2EA7A 3D0JA 1WLTA 4UBHA 1YFYA 4OFGA 1RTVA 3H1MA 1DGWA 2O1QA 4HVOA 4AVBA 2BGCA 3EHKA 3FWEA 3MPBA 2MNGA 4XFHA 1RUOA 2PAMA 5KHIA 1I5ZA 2H6CA 2QCSB 4QMAA 1ZZ6A 1DGRA 4XFFA 4PIZA 4YNIA 4IESA 1WGPA 2GU9A 4KWKA 2UY8A 1TQ5A 2C0ZA 1ZNPA 4Q0VA 1X7NA 2XLFA 1QY4A 4IEOA 4IEWA 1VJ2A 4PJYA 3TNQA 3KCCA 2PQQA 3D0SA 3U0ZA 3ZDSA 2PFWA 1ZX5A 1IPKA 4LA3A 4I02A 3FX3A 1CGPA 2WC2A 3FE5A 3WW1A 1QXRA 5KHJA 5FQ0B 3LZZA 2FQPA 4Z07A 3KGLA 2PAEA 1ZRFA 4R52A 3DKWA 4IEUA 1LR5A 5AVPA 3CJXA 4IEPA 3WW4A 1PM7A 5I93A 4X6RB 3MYXA 2ET7A 3I54A 2BYVE 3KGZA 3BB6A 1SQ4A 4DINB 3OTFA 4R8HA 1O3QA 4H7LA 4X6QB 4XF0A 5CVRA 4MGIE 3OD0A 1EPZA 2PHLA 4XF1A 3BU7A 2KXLA 4I09A 4MH0E 1LB2A 3KSCA 4KL1A 5I8SA 3U10A 3E5XA 5I0UA 4HN0A 3FFQA 4META 5FLIA 4EWDA 2ET1A 4XFAA 1CX4A 3H7JA 4LTAA 4HSLA 2GH2A 3MDPA 2PTMA 4IEVA 3ELNA 5BXXA 1ZVFA 1O7FA 4HZFA 4EWEA 4QX5A 2HJIA 2CGPA 2CAUA 3M3IA 1VP6A 4HN1A 5I91A 1NYWA 5J48A 1IPJA 5J7MA 1JUHA 1ZZCA 5JR7B 4LUMA 2ZKLA 3WW2A 3RPQA 5D1IA 1XE7A 4BIFA 4YYOA 3RYRA 1CAUB 3M70A 4I2OA 2WFPA 3OF1A 3UKVA 2DCTA 1VR3A 2OPKA 2XLAA 3LA2A 4QM8A 1EYBA 2MHFA 4I3PA 1RUNA 4BHPA 3C3VA 4PIXA 1J1LA 3NKTA 1J3RA 4MV2A 2IXCA 3L2HA 1CAUA 1CAWA 3IIAA 3S7IA 3CLPA 4LA2A 2ETEA 1UIKA 5FPZA 5JSOA 2VPVA 1NE6A 4E2GA 4FAGA 1RGSA 4IEZA 3NJZA 2ZCWA 4F8AA 1CAXA 2PHDA 1H1MA 5FLJA 5KBFA 1O3RA 2BNOA 3HT2A 2XL7A 2Q4SA 5CU1A 4Q0QA 3CF6E 2GC2A 1ZZ8A 2VQAA 5EFUA 2MPFA 5BUVA 1CAVA 5LRSA 2V09A 3LA3A 4MGYE 4MUVA 1NXMA 2XKOA 4NVPA 4XF3A 1V70A 3WW3A 3U11A 2K9ZA 3E6BA 3OCPA 4I0BA 2I45A 4AVAA 2Q0AA 5JAXA 5LRRA 2BNMA 4QM9A 2PAKA 4HBNA 3H1YA 4LULA 3SCGA 3H3UA 4YARA 3MZHA 4XF4A 4XFGA 3RNSA 3IDCB 2D5FA 1UPIA 1UCXA 3RYKA 4AVCA 4BYYA 1J3QA 4FAHA 3UKNA 2PYTA 1DZTA 1ZRCA 4UXAA 1UD1A 4F7ZA 3H1WA 1FI2A 4QGNA 3FHIB 2IXIA 3GBFA 2UYBA 4LUKA 3QOPA 1L3JA 2E9QA 3NL1A 4ZU4A 5FCCA 1Q5OA 4XFCA 4Z82A 3PLQA 1YHFA 2IXLA 3B02A 2UY9A 4TLFA 3CO2A 3NW4A 3RYPA 3BCWA 1WA4A 3LOIA 4L2NA 5F1RA 5EZWA 2EVXA 1YFWA 3FJSA 4HMZA 2XLGA 5JCTA 1I6XA 5C6CA 3E5UA 5I0RA 1O4TA 4IEYA 1LRHA 3LA7A 1RL3A 1ZZ7A 4XETA 4ZU5A 4O9EA 2Z2SB 5LEJA 3SMHA 4N9HA 3NSTA 1QWRA 5I8YA 4FBFA 2Q30A 4J1WA 4XFIA 3BPZA 5FDBA 4XFBA 1YFUA 3DV8A 4LEJA 4P9GA 1EP0A 3R6SA 2F4PA 2OZJA 4IETA 1CAWB 1XRUA 3LAGA 3DL3A 3I7DA
chains in the Genus database with same CATH superfamily
1V00A 3AM2A 3OBRA 1SHWB 5LA1A 2ZHKA 4DO0A 2ZGPA 4RGGA 4BDVB 2RM22 4ORFA 5IW0A 1BMV1 1H8TB 3S6PA 3PDQA 3VHNA 1O3SA 4Y1YA 1UYZA 1LHOA 5FFOC 3EJKA 3JQWA 4EYUA 1FMD1 4ES9A 4XZPA 3NKGA 3MUZ1 2LTNA 3KB5A 4LLFA 4XUPA 1GLHA 2LALA 3ZR5A 5AC93 1WZXA 3MIGA 4LT5A 1GQGA 1AXKA 2JDHA 3J7MA 4Z92B 2R16A 1NE4A 3WUDA 3VV1A 2BOIA 1RUI3 1QH6A 5IFTA 4RQPC 3NV3A 2D3RA 2QQIA 2D43A 2H0VA 1AR91 3G7DA 4BLJA 1RUG1 3QLQA 4IGQA 4YM0A 2IUWA 4IEQA 3Q8AA 1P8JA 2WNVA 5J37A 4LBKA 5KXEA 1VBB3 2X53S 1DYOA 4DEQA 4WM8C 3O1TA 3S5AA 4YSFA 3T0BA 1F5JA 1SLIA 4MX3A 5BPXA 3PU8A 5HI0A 2GMEA 3HQXA 1PO13 4N43B 1WCKA 1Y7BA 3NVCA 1PGL1 5F3EA 3FLTA 1KJRA 3WVJA 3LCPA 5IHRA 1QJFA 3IZOA 3POEA 3OGJA 4XEZA 2EAAA 1KXGA 2RDSA 2VUAA 1YQ6A 3OGVA 5FUPA 3ZN6B 1WCQA 4NIDA 3PVNA 5KHGA 1G6NA 5DUXA 3AKSA 5F32A 5FY0A 2JXAA 1E5RA 3ZYJB 3UGGA 1Q8VA 1UOBA 2W39A 1MS3A 1CWPA 4FT8A 4UYBA 5J96B 4CDUB 3MLLA 3NNMA 4C1WA 4Q4W1 1F9KA 4JGZC 2ID4A 3KZ4C 3BALA 1SDDB 2WIIB 2I07B 4GQ7A 3I3EA 4DXTA 1Y9GA 2UWCA 2YROA 3VZNA 1MZEA 3L9JT 4MGSA 3WXPA 5BV6A 2WO7A 3NNJA 4WVZA 5FY9A 4DPNA 1GICA 2Z42A 1QJX3 2RS13 5FYMA 2KM2A 4LKFA 2IXKA 4KU7A 4QD2A 1BZWA 1H8TC 5GALA 1AYM3 4I01A 2IC1A 2J1EA 5FYCA 3PJQA 4LKEA 4NPRA 4FI9A 1SPPB 3T3YA 3O5SA 5JXGA 4ZPIA 4QX0A 3AFKA 2HBTA 3UKTA 2ILMA 1NLQA 3KHBA 3WEZA 5FZ1A 1WCDJ 3FFZA 4LBQD 5A7PA 5HCAA 2PHTA 5LEKA 5CBLA 3J8F2 2WZPP 4CUGA 3C2UA 2XG3A 5I0TA 4AEDA 3AL6A 1NCQB 4K21A 4N9IA 2CGNA 3KV5A 1VBD2 2QDNA 4Y20A 3RS6A 2QQUA 1UIJA 2V5DA 3NNFA 4LO6B 2AREA 4RGAA 3D82A 4GD4A 5FZOA 1QF3A 4NIIA 1OOPA 2OA2A 4C0HA 1J1TA 4C90A 4U2AA 3M3EA 2PA7A 3PMSA 3C7HA 1R1A3 2ZHNA 3H3ZA 1YI7A 3U14A 4COZA 1JYVA 5KHHA 3TNPB 1LHNA 3MLKA 4Z8BA 5A80A 1C28A 3IDAA 3O14A 4E2SA 2CGOA 4LOTA 1YLLA 4K8FA 1GZ9A 2J22A 2VTXJ 4IEXA 4KWJA 4LO8A 5EWSA 5A6ZA 1RB8G 2QQJA 1S0FA 4OI1A 2VM9A 2HKXA 3RWNA 1JHNA 1CVNA 3DXTA 5LY2A 4XURA 1XNKA 1LJ7A 2YXSA 5FY7A 4FPFA 2FCUA 2EXKA 2ZGNA 1Y9QA 1W04A 4YRDA 2YPDA 1CQ9A 5FZHA 5FZ7A 1PGSA 2ZPXA 4Y1ZA 4GKYA 5D2AA 4QPIB 2VZVA 1UYPA 2XL9A 2CHHA 4KBBA 4CDUC 5LY1A 1RMU2 4YGDA 3RI8A 1ULCA 1MS8A 2Y0OA 3PUAA 1U12A 2BFUS 1YQ2A 1D0HA 1QNWA 1UU6A 2UYAA 2F17A 4WM7B 4XCAA 4CTEA 2B9VA 3KQ4B 4GB33 1AL22 2QUOA 3L2YA 2OT7A 4CSWA 4EN9B 2IVIB 1BEV1 1CIYA 3MIBA 4YW1A 4XXAA 3CHXA 1REDA 3FBMA 3WZ1A 2R49A 2RHPA 4B4PA 4CDXB 3LSDA 3V0AB 2WYFA 4FSJA 2OW4A 1OFNA 3AVSA 4KI5M 1H8VA 2EA7A 1UN1A 1COV2 1IS3A 1YFYA 3MF6A 5CFCA 2WR9A 2X5IC 4INDA 5DZEA 3T4VA 3W20A 4CE8A 4OFGA 1TZOA 1RTVA 4B3NA 4BXFA 3J7NA 1JYCA 2R1DA 4MXWB 2YBKA 2OQ7A 3FWEA 1PMHX 4XFHA 1VBD1 4LITA 1I5ZA 1W8TA 5HPOA 2QCSB 2QBXA 1ST8A 1UY3A 4L0PA 5TSWA 3WUCA 4URAA 2Y34A 3BVCA 4XFFA 2DF7A 4PIZA 4XJUA 5DG2A 3WNMA 2FDKA 3FHAA 4BLIA 2GU9A 2A3WA 4KWKA 4NPLA 1V6LA 1OXCA 5DAVA 4ET7A 2AGSA 3CJIB 4A44A 4YLZA 3DPRA 4CCLA 5F5IA 3JXSA 1ZNPA 4Q0VA 3JD72 1BYHA 4FPLA 3N7LA 3PIGA 1BBT2 1W8WA 4CA9A 3KF3A 2DU1A 1N3OA 2QKDA 1DQ0A 5G05L 3O1MA 1ZX5A 1IPKA 3RZGA 1J83A 4I02A 1W6MB 1OT5A 4YVSA 2VOTA 3DXUA 3VZJA 4CDQA 3I3DA 5FQ0B 3N9OA 2FQPA 2XJVA 4EJRA 3KGLA 3RZLA 3AYDA 2VD7A 4R52A 2JX9A 5H9QA 2JECA 2SLIA 2XJQA 1JOPA 2W1SA 1POV1 5FMCA 1A34A 1ZBE1 1DQ6A 3PUSA 5C3PA 1GSLA 1W2AX 1RMU1 2GSYA 3VDAA 1NX9A 2ZAAA 1NXD1 4X6RB 3I54A 2BYVE 3KGZA 2KD7A 1S0EA 3HN1A 4Y1VA 1SQ4A 4DINB 4QWNA 1H4HA 1OLMA 1AL21 1REEA 4YW6A 1SCSA 1IG3A 4OQ9A 4XF0A 1VRH2 3T2QA 4MGIE 3OD0A 2P6HA 5FR3A 1E5SA 3D5OA 4PBOA 1HLCA 5FYHA 3R4DB 4ZKTB 4NJ4A 2KXLA 4I09A 4A7ZA 1IG0A 3OEAA 1JZ3A 3HQRA 2HWB3 3OJBA 3ZFGB 4X8PA 4BJ0A 3U37A 1U5ZA 4CDXC 1S0BA 4GKXA 1DFQA 4KL1A 1JS9A 3JUUA 4OHWA 5I8SA 3U10A 1HJGA 5L7OC 2RMU2 5CG8A 5F2SA 3ZSJA 4NIAA 2ET1A 5GLWA 1COV1 1D4M2 3NNLA 4WVVA 1PVXA 1CX4A 5DABA 4D8MA 1XNAA 3GBWA 2LM3A 4K1ZA 2JG8A 3MDPA 4LO7A 1MACA 4Y5SA 2R0FA 4DQAA 4XIKA 2F4LA 5JLVA 4JGYA 4A7YA 2W0XA 1H2NA 4HZFA 4EWEA 2G4IA 2PMWB 3B3QE 4XDQA 2D3SA 4U36A 2J1AA 4WVMA 4LHKA 2W46A 2ZX1A 1WKYA 1ND2C 1JTZX 5JOYA 3RMYA 1VP6A 1NZIA 2DUQA 4HN1A 4Y3OA 2QQKA 1HKDA 3ZIXA 1EAH2 3AZWA 4JCKA 5J7MA 2VVEA 3B9CA 3OEBA 1DF0A 1R1ZA 1US3A 4FPHA 2W1QA 3JD71 1FPN3 4LUMA 3V65A 3ZX7A 3RPQA 1BBT1 4HK9A 1Y4WA 4GIQA 1OA3A 5ABJC 3MPPG 1CAUB 2VW0A 4FPGA 5FWEA 3VBFA 1M06G 2EIGA 1X9PA 5E8AA 2RJKA 1BCXA 3OF1A 1XJAA 2DUPA 2E7QA 2AR6A 1VR3A 1PVC1 2DCTA 2XQXA 2YMZA 4C0BA 4YZ5A 5FV3A 1EYBA 3U07A 2HYKA 3LOBA 4QQ2A 1AX0A 2BV4A 4I3PA 1D2SA 4NRQA 4BHPA 1MQTB 2P2KA 4KQ7A 4PLOA 4GWIA 5K4LA 1J1LA 1GZWB 1XYPA 1TMF2 4Y33A 1JOJA 1GKBA 5BNNC 1W9WA 5EJZB 3FMGA 2A73B 2IXCA 1ZA4A 2ZZJA 3LPFA 4XILA 4YZ2A 5F37A 1ENRA 1Z7S2 3ZOIA 5F6LB 4SBVA 4GAZA 2ETEA 2ZA9A 4L97A 4F3JA 1MS1A 5E6HA 3ME2A 1ODMA 2SBAA 5FMOL 4FTSA 2DYCA 2ARBA 1LOBA 1RGSA 1OH4A 2WS93 3VBOB 4E2GA 1PNGA 4QXBA 1H8TA 4V2WA 1HX6A 4UF0B 5GZDA 5IAVA 1C1LA 3WP4A 3ZR6A 3RI9A 4CCNA 4TZDA 4CDWA 1JZ5A 4RS5C 5FMOS 1UU4A 2BBVA 5LCWL 1H1MA 2O8OA 2NLRA 5CA6A 3HT2A 2GNDA 5K9YA 3B94A 2DUOA 2WNEA 3NJVA 3KS7A 3H8RA 4H55A 2XL7A 2Q4SA 5CU1A 3IT8A 1POQA 2RMU1 4FPCA 5EFUA 2QFEA 3O0WA 1ODNA 5JXJA 1KD7A 1D4M1 1POV0 4NRPA 1RUD2 1TME2 2R32A 1UX7A 3ZFEB 1Q8PA 5F3CA 3BTAA 3WF1A 3WW3A 4QQPA 3U11A 3OCPA 3BTXA 3T0DA 1RJ8A 3VD9A 3AFGA 3T08A 3BPSA 1VMHA 1XE0A 2I45A 4AVAA 5JAXA 5LRRA 5A3WA 2BNMA 4QM9A 3OBTA 3SCGA 3H3UA 2R063 1NA1B 4N43A 1UY4A 2BWAA 4BU2A 1EAH1 2A6XA 3VD5A 3AMHA 4XAEA 2OPWA 4M0HA 5H9PA 4AFCA 1UPIA 4N7UA 1PHMA 3FUQA 4GZ9A 4NUBA 3ZN6A 5FZDA 4KH9A 1C3HA 4JRAA 3RYKA 1J3QA 4AVCA 2ZBJA 4FAHA 3CU7A 5LW9A 5FJHA 1WMFA 2NQYA 4AGGA 4QB6A 1ZRCA 5BNOC 4XDPA 4BQXA 2CDOA 4C8DA 3LEKA 4BQ5A 2VMIA 4LE3A 3POYA 1FI2A 2DVDA 1W0PA 4IDZA 2XB6C 1SZBA 4CP9B 5A33B 5CKMA 1W3VA 4HKWA 4B7EA 4CDUA 3UYJA 2EIEA 3UK9A 4JRLA 1G9AA 2UYBA 4NHLA 5FZLA 2E9QA 5F5CA 1W8ZA 2GP5A 1TMF1 3K4AA 5FZEA 2R0HA 4GA9A 3O1OA 4A42A 1RVF3 4YFZA 3NW4A 4UW5A 1WA4A 3RZMA 2Y6LA 1Z7S1 3LOIA 3ZVXA 1N1YA 3VLBB 2VMFA 3VKOA 3HBZA 5F1RA 1LESA 3KWVA 3LEIA 4GWNA 2W08A 2EVXA 1YFWA 4ZY9A 1AX2A 1I6XA 3H42B 4QX1A 1LOGA 3VZOA 1LECA 3E5UA 3KV4A 2C9AA 1ZBA2 3TN92 1O4TA 4GH4B 1G9CA 1ZZ7A 2WNUC 2VVFA 3QH6A 1MPXA 5ANNA 5AFBA 4YW2A 3ZFFC 5G04L 2R6QA 1SPPA 5L19A 4N9HA 3NSTA 4XJZA 3RJRA 1F4HA 4JX0A 1D7PM 3AKQA 5I8YA 3GZUC 4FBFA 1RUE2 1V6OA 2J1SA 3VBUB 5FDBA 2DFBA 1OH3A 3ZPOA 1RUI2 3LFIA 2Q8CA 3MW3A 2WLPA 4DRVA 1OF4A 1NCQA 2AH2A 5HCFA 4YW4A 4CU8A 1RUD1 1TME1 3VHOA 4H7MA 2FCTA 1W0OA 1MS0A 1AF9A 1OPOA 1VBA1 2TUNA 3VKLA 1E57A 1QQP2 4IETA 4E4DX 2ZGQA 4CP1A 1AR73 2HWE1 2WQ8A 3DL3A 3ZFEC 3M3OA 1V9U1 1IKPA 4XUTA 4LIVA 4JTNA 4R9DA 3ZXJA 3LB9A 4O65A 2A75A 1VAMA 3U4SA 1CJPA 1K5MB 4TLGA 5LASA 3WCRA 5HBAA 2WUHA 3ILNA 2XXZA 2RDRA 2NN8A 1OD3A 1PM4A 1SEFA 2QJVA 4Y5Z0 2JKXA 5BY5A 1GNZA 3MBWA 4YZ4A 1SG3A 1C8M3 4FFGA 4I0AA 1W9FA 3MO4A 4D0QA 4DY3A 1VBC3 2X29A 1JMUB 4BB3A 2VZUA 4OI2A 2R041 2XVKA 4B8EA 4DXRA 3NV1A 1RUJ1 3OGSA 1X82A 2CV6A 1ZREA 2BNNA 3POFA 3HBKA 4ZS3A 1QJZA 3HVDA 5LK5A 3CDZB 1BVP1 2VMHA 2Z5WA 3PMEA 4A4AA 1CX1A 5FKBA 5LA9A 2YBPA 2AEZA 2B5HA 3P3PA 4QPIA 4EN6B 2YFUA 5K8SA 2D6LX 3A23A 2WO3A 4E2QA 2WNOA 5BNPA 3H50A 5FWJA 4HPKA 3KQRA 3LGRA 1SCRA 3NV2A 5IUQA 4P9XA 4LQRA 5T54A 3LIHA 4CEWB 2ATFA 3AKPA 3B93A 4WM7A 4FOVA 1W6PA 1CONA 1UKGA 1H6YA 1LEDA 2MEV2 5FO8B 2P3KA 3ZMOA 4K20A 1LOAA 1LGNA 1PO23 2XKPA 3HWJA 1AYN2 3SH3A 1PK6B 1HB2A 4BQ2A 1QJX2 2XOMA 4YZ1A 2QZ2A 3NAPB 1PZ8A 2FMYA 4L11A 2P34A 4C1XA 4UI9L 1RHI2 1VBE3 2VG9A 1K45A 2E63A 2EXIA 5DN2A 4AQ6A 4CDXA 3V0AA 1LULA 4I0WB 3TN91 1UYXA 1DQ1A 1QXJA 3AMPA 4XF9A 3T09A 3WSOA 1SLAA 3LF7A 2PLV3 4JQTA 1J58A 3ORJA 3MEPA 2A5ZA 4AQ2A 2BPA2 1MZFA 4ONUA 1Q8SA 3KD4A 1J3PA 5GZGA 2RDQA 5L9RA 2Q1FA 3Q8FA 1RUE1 3I2FA 3K51A 5JI7A 3VBRA 4XJAA 1HRV2 2ZX2A 4LR4A 3THPA 3QD6A 1RUH3 3KT7A 4LLOA 4UBGA 3VBUC 4CU6A 5T5LA 3SCFA 4MXWA 4PDWA 1DQ5A 1WBFA 4COVA 3VBSC 2H6BA 4RQPB 1QQP1 2A6WA 1O5UA 1DGLA 3EO6A 4G9SB 1GYKA 2B39A 2UWBA 5IK8A 4QX8A 5DZGA 1K5JA 2HEYF 3C8XA 3HMYA 5FXZA 4RA0A 4AEKA 3CL1A 1LOFA 5A3TA 3MI8A 4FFFA 3O1SA 3CJIA 2WZ8A 4WM8B 3LPGA 2GMPA 1EPWA 1W90A 4ATEA 1ZZBA 1QIQA 2AC1A 4OLLA 4O9GA 2D6NA 1L7RA 3PTRB 3SHRA 2FD8A 3I3MA 3DKQA 3KLSA 1HW5A 1V6NA 5FO9B 2ZABA 5FZ9A 2FHRA 1G8WA 4JTOA 4COYA 4HSJA 5GLVA 1UZ0A 4RL7A 1HQLA 2HWC3 3WF3A 2P3IA 1SLBA 1W6MA 1NQJA 2VMCA 5FQ0A 1XNDA 4B29A 1F35A 3V0BB 1R083 5FPUA 1UAIA 2HWD2 1V9U3 5FBJA 3THTA 3ST7A 4RFT0 1B35B 2ZEXA 3JB8A 2DCKA 4AHWA 3H8UA 5CIRA 2WZR3 1DIWA 4CZSA 1XQNA 1S0GA 3MUY1 2DVFA 1S2BA 2R073 4OZOA 3VGIA 5L36A 1NZCA 1Y43B 2VECA 3LDBA 4LHSA 4P00B 4CXWA 1MEC2 5AFEA 4TWTA 1TNFA 4QGLA 4JGZB 3UGHA 1NQDA 1OQDA 1W2OA 1ZZ9A 2RE9A 3BGAA 3IPVB 1SDWA 2QQMA 4IE0A 1AYN1 4V2VA 2XGXA 4QX7A 2D93A 3B00A 5IFPA 3SCHA 3IWZA 3KMHA 2R043 4FCAA 1RHI1 3NAPC 3SXWA 4KWLA 1SLTA 3ZFGA 1F8VA 3NO8A 1S0IA 4FQ4A 1UQXA 3USSA 3I59B 1CZTA 5CISA 5DPNA 1OMIA 3ETQA 3O1RA 4PIYA 3VKNA 3FBYA 3FC0A 3WP3A 1J84A 1W6QA 4N8MA 4QPGC 4NIHA 1FYUA 1PZ7A 1NLSA 1PMIA 2Q8EA 1HRV1 4JHTA 1XB9A 1I1EA 4OZXA 4JV4A 5T5OA 4ARXA 5GZCA 1GP5A 4NRMA 5FPXA 4BMBA 3SKJE 2VTFA 5IYYA 3HAGA 1NT0A 3WG2A 4ZXKA 4RD7A 1ZRIA 1BQPA 3AYCA 4JQRA 1T6GC 1WMDA 4KG8A 5EQUA 3ZKUA 3E6CC 4YM2A 2WSUA 3POJA 3PTYA 1XOYA 2F6BA 1RUC1 3M7AA 1S4CA 4FXKB 1XSQA 5CEHA 1T2XA 3OY8B 4KGQA 3EB7A 4QGMA 2C26A 2HWF3 1IHMA 2DDUA 1YXWA 3D0JA 1WLTA 3JQXA 2AACA 4UBHA 3WHTA 1MS9A 1QDOA 4W6YA 5CYYA 4Q4V1 4L92A 1ONAA 2A71A 3H1MA 4XXPA 5JIAA 4GALA 1QJEA 3GZEA 5HCHA 5FUNA 3F2ZA 1MQTA 3MIDA 1KRIA 2BGCA 2UU8A 3MPBA 5B4NA 2D6KA 5FO7B 4YM1A 2PAMA 1GZWA 2HWD1 2H6CA 4Y22B 5F6KA 5KHIA 2ZGRA 4WV8A 4Q4X3 1WD4A 4OMDA 3ZYBA 4OCTA 3ZYHA 2LUWA 1LGCA 1S2EA 4TYSA 3WR0A 5JZGB 3VZKA 1B35C 1WGPA 2VCMA 3B9IA 4FTEA 4LXLA 5FXWA 3N9QA 4NROA 2VNVA 1DHKB 4TXWA 1X36A 3W9AA 1MEC1 3HJRA 3VBOA 5L9VA 1QY4A 4IEOA 4AHYA 4IEWA 1VJ2A 3D0SA 4UF0A 4P9IA 5A3PA 2PELA 4Q4Y3 5T50A 1HN1A 4WVWA 4IV1C 3G6JB 2Y6JA 2W94A 4AI3A 3SC7X 3ZXKA 1RUF3 3P1IA 3W59A 1W9YA 3FE5A 3I2HA 3SNMA 4B4QA 3O0VA 4CEYB 1QXRA 3AX4A 2VZPA 1U0AA 2VZOA 3WQ7A 2RM21 1WW6A 4P02B 3DKWA 5IT6A 2WAAA 4QB1A 1W2NA 3LDRA 4XQDA 4BWOA 4ZS2A 4DRRA 2VCBA 4OHZA 3ZFEA 3CQOA 3OUIA 3WW4A 5H9RA 3ZDVA 2X5IB 1X50A 3POSA 4OVEA 2NZ9A 4CU9A 1W2UA 2J1TA 3RZHA 2WRAA 1I5PA 1SLCA 1GOGA 3JBG2 3OTFA 1OKOA 4EN7B 2QE3A 5GM0A 5D8AC 4P08A 5JR2A 5CVRA 1NA1A 1C5HA 1OHFA 2BRTA 1IKQA 1AR83 2BERA 2PHLA 2WT1A 4GWMA 2PHUA 4YM3A 3BU7A 4L9BA 3U78A 1LB2A 1OLQA 1R092 3WQ1A 4BQ4A 2WFF2 1WCSA 5A3OA 3KV9A 2VZSA 4XHBA 1AJKA 3E5XA 1FMD3 4B1LA 1ULDA 4B4RA 4META 4AW7A 1WA6X 4XFAA 3IB3A 1LTEA 1EUTA 1YIPA 3H7JA 1QOTA 1QGLA 4HSLA 2GH2A 2D97A 4LTAA 1JUIA 3LDKA 4M3CE 4Q5OA 3ZPYA 4AFAA 5C3QA 1OVSA 4M3CF 4PLMA 1BK1A 5JOXA 1O7FA 3K3OA 1PIV2 4QX5A 3LKJA 4YFWA 2VOKA 2XVGA 2LRPA 1AR93 3C7OA 3CMGA 1RUG3 3D3AA 2VBBA 4JKLA 5CAZA 1KS5A 5I91A 5LZ6A 1RXGA 4ZZ5A 5IVVA 5JZGC 2ZTNA 1XSRA 2BFUL 4KNCA 5J48A 2Y64A 5FJKA 1JUHA 2GALA 5FYYA 4XTMA 1CR7A 5JR7B 1AR62 2D6PA 2WS92 3ACGA 1EV12 1K3IA 3BN6A 2WA3A 1FOD2 3I8TA 1H30A 4GH4A 3KT4A 4I2OA 1RXFA 1F2NA 5DDJ2 2WFPA 4Y26A 3UKVA 2YG0A 3I2DA 2XLAA 4HKOA 2W1UA 4UFJA 1VMFA 5EP9A 2GH8A 3AC0A 3WV6A 2D6OX 2MHFA 3POBA 4OI4A 4BQYA 1GOFA 5IAXA 3DYPA 5KWRA 4AHZA 4CEYC 4LHNA 3SH4A 3VZLA 3VBUA 2WAOA 1HXS2 4Z1VA 3OYWB 4LIUA 1NCRA 4DUXA 2ZZQA 3WHUA 2DFCA 4ATFA 4MV2A 5L7OB 3MW2A 5DAXA 3CIHA 3J7LA 4ITCA 1UOJA 2A7AA 3R4UA 3L2HA 1F15A 4HT1T 4A3XA 1REFA 3S7IA 4BMEA 1A3KA 1GBGA 2YFZA 3B5LB 4JDNA 4AEJA 3WDTA 4Q4W3 3WQ0A 4DXZA 4YG0A 1C5IA 4XC9A 4N53C 3JBG1 2RDNA 4PF1A 4RYDA 4FO9A 3J8F1 3HPNA 3J7HA 3SITA 4AAPA 4XOGA 3PIJA 5IVJA 1K5MA 3J9SA 4F8AA 1ND2B 3N7JA 3SLIA 3RQ0A 5FBZA 5CFDC 4GMP1 2WT2A 5FLJA 1KEXA 3V56A 1O3RA 4B7KA 1R091 4DS0A 2WFF1 3MIEA 1HDKA 1VB4A 5FUIA 4Y1UA 4ISRA 1HB3A 5A6XA 4R9AA 4PCRA 1UF2C 4UFLA 5BUVA 3U75A 5EV7A 2WWUA 1DQ2A 1LAJA 3VDDB 5FTTC 4IXLA 5ABJB 3NV4A 2V09A 3LA3A 5C4WC 3NWKA 5IVBA 1NXMA 5LATA 5F7UA 1AJOA 1V70A 3S5QA 2ZX4A 3E6BA 3KV6A 2BDRA 1PIV1 5E89A 3KF5A 2BW8A 1SBEA 1H9PA 2W95A 3H0OA 2G19A 3I3QA 4HBNA 3H1YA 3JB4C 3TEWA 3NJYA 4CEWA 2WA4A 3PUIA 1RVF2 3VL8A 3LIGA 1Q56A 3TBDA 4A7KA 4XMAA 2YYOA 5BNNB 5FP8A 4QQLA 5GJ6A 3RRDA 3SH5A 4IE4A 1PK6A 4IE7A 1UCXA 5LA0A 1AR61 4D69A 3NAPA 5F5AA 4NHYA 2Q8DA 4YGEA 1B09A 1EV11 2PYTA 3C7GA 2EIDA 1HRI2 1FOD1 2RR12 1H6XA 5GKAC 1UD1A 3TEYA 1ENQA 3GZAA 3KCYA 2XUEA 1OURA 2RJ2A 2P3JA 5FPBA 2CU5A 3GXUA 4NN0A 1W28A 5F8PA 4AAXA 2CNAA 5EIYB 2XWBB 4RS5B 2IXIA 5FZBA 1OA4A 1DU3D 2D7FA 5H9SA 5F5QA 1L3JA 4YW7A 4DUVA 1HXS1 2GN3A 5FCCA 2L9LA 3Q8BA 3A0NA 4OUEA 4Z82A 5FXXA 3ASIA 5A7WB 2ZGKA 1LOCA 3K4DA 2ZMLA 1YHFA 3CZJA 2UY9A 4UW6A 4RQPA 5KC5A 3POGA 3WOGA 2YC0A 5CKQA 1JZ2A 3VKFC 2GP3A 4XPVA 4CCKA 3VUOA 4XQWA 5FY5A 2TEPA 3IKWA 1W2TA 1WMXA 2QQOA 2ZHLA 3FJSA 2VMEA 5DXDA 3O7OA 1W39A 1IQDC 4WM8A 4DFSA 5I0RA 1WMEA 5DMYA 1DDLA 5J36A 2ARCA 4IEYA 1JYTA 2O14A 1BEV3 3R4SA 3EYPA 2DBIA 4O9EA 5LEJA 3SKVA 3SMHA 1N3PA 1OA2A 1OF3A 4FOQA 4YZ3A 1X33A 1GNHA 2DTWA 1OLRA 3WLUA 1QDCA 1PGW2 2HBUA 4PLNA 1VBC2 1W8NA 1G86A 4NPMA 3AZVA 4BK5A 3BPZA 4CPBA 1QJY2 1NAEA 3P5BA 1YFUA 2RS52 2WLQA 1H9WA 3QH7A 4XCBA 3V0BA 5IJRA 1GNYA 5A32B 1XNTA 2HH9A 1UOGA 3VDDC 5BNOB 3I2IA 3PURA 3PUQA 2F4PA 3IAPA 4QKNA 1HV0A 1V6MA 1XRUA 2VR4A 1B35A 3A22A 3AJZA 1V6JA 3LAGA 3N9MA 4RN5A 4S2FA 4Y4YA 3T4HB 5D21A 4A41A 3UGFA 3WNKA 1WW5A 2E51A 3I4IA 2QDRA 3QACA 5JUVA 1VLNA 1VBD3 5C5TA 3E97A 1UOFA 3CZUA 3MFAA 1VALA 1MVEA 4JGZA 4HG6B 2XJPA 1UZYA 1WW4A 2XPJA 3IPVA 5IWFA 2JDZA 1GQHA 4GMP0 4CXYA 3OUHA 5FLHA 1RC6A 4E4HA 1YWKA 3A21A 4AVTA 2BBAA 3ACLA 4CYDA 2YZ4A 1CPMA 2IFRA 1ND3C 2XJSA 2RR11 1HRI1 3MGUA 2FMDA 1YFXA 3P6BA 1OC1A 3WNLA 3K77A 4XIOA 1AHSA 3I59A 2Q1ZB 2JICA 3AZZA 2XBO2 3ETPA 3WX5A 2A1XA 4PI0A 1VRH1 2WNUB 4UWDA 2W1WA 1UX6A 3ZFFB 3GYDA 1TNRA 1LOEA 2GNMA 3FLPA 2D40A 1Y3TA 4AK3A 5I8TA 3UL2A 5IK5A 4AI8A 1Q43A 4FVVA 1QJU2 2W68A 1Z0HA 1POV3 5JIUA 5C8WA 4GULA 2GC3A 1ZBE3 2FBEA 3B7MA 3CEWA 4RHV2 1GP6A 4IV3C 1PMJX 1QXPA 1RMU3 3VBHC 1F5FA 1X9TA 3ES4A 4D94A 2YGMA 5JSPA 4AFBA 2JDNA 5ACA2 4IGOA 2W2IA 4BISA 3Q8EA 2TBVA 4TTGA 5K0UC 1QU0A 3WDVA 3AP6A 2B4KA 3D8CA 2ZGMA 1G9BA 1AL23 1OUXA 3PUHA 3AMNA 3LD8A 4QXKA 1W0NA 3OY8A 2A3XA 5LK7B 4XUQA 3BOWA 2EALA 2IFWA 3WP5A 5CADA 5ANQA 1PGW1 2WWSA 4WBBA 3VL9A 2XR4A 4Q1RA 2OZ6A 1JH5A 3MICA 1QJY1 1U5IA 1W03A 2JENA 4OHVA 2RS51 2WN2A 4AE2A 3I49A 2RS32 2Y0IA 1COV3 4Y22A 3LE0A 1A8DA 1DQ4A 2Q1MA 3WDWA 2A6VA 2IWGB 5FYSA 2QZ3A 4BQ3A 2P17A 4Q8LA 1US2A 1H2KA 3EQEA 2WZR2 4S2DA 5J09A 2C4XA 3WG3A 4M00A 2AENA 2R072 1O3TA 4A6SA 4IERA 3Q8CA 5DG1A 2JD9A 2JEMA 5T3NA 1PZ9A 1DP0A 1ACCA 5IATA 4OHXA 1FT9A 4ASMB 2VVDA 2Y33A 4AQSA 2CAVA 1AX1A 1LGBA 3FZ3A 4R4ZA 2WNVC 2IXHA 2W5FA 2YPJA 4A2UA 3MFCA 3DECA 1MS4A 4D7SA 5KXBA 1S0DA 1V6IA 2JE7A 2WWJA 3ILRA 3VD4A 4Q0UA 3NMBA 1DYPA 3S0MA 1QKQA 1ASJ2 3JD73 2J1RA 4CEYA 3UETA 2A70A 3SISA 1BBT3 5FMBA 1UXZA 2BZDA 3A7QA 3PNAA 2XBO1 4Y4RA 4MO3M 3U1XA 1A78A 4Q29A 2JIGA 1PVC3 2WL1A 2CTVA 4UT5A 3ZSLA 1UYYA 2GN7A 1W8UA 3O1PA 2PXJA 1ZRRA 3LWCA 4AWDA 3ILFA 2X5IA 4HFSA 2YU2A 2XJTA 5AC92 4HKLA 4D6RA 5E88A 1X8MA 1UMIA 3DYMA 4RHV1 4S2HA 2NP0A 2VOWA 3RVHA 1FATA 2BOJA 2XVLA 3WCSA 3IM0A 4AL9A 2BGPA 3N7KA 1JHJA 3VBSB 1IZ3A 3S7EA 1JYIA 1H2MA 1DGRN 2ZS6B 4BH9A 5ACA1 5IK7A 1QEXA 3ZXLA 3FN9A 3C7FA 2WBKA 3IN9A 4YVWB 2JDYA 4LORA 1HQWA 1VBB2 2X09A 1GWMA 4CU7A 1UW8A 3HT1A 4XDOA 3K46A 4DXSA 4LJHA 3UJOA 1IGOA 2JG9B 5JMOA 3IDBB 5A33A 2E31A 1YIFA 1S2KA 2XHKA 2GAUA 2GC1A 4Q27A 4AZZA 3T1MA 1PO12 4FTBA 2CDPA 4Q2FA 1MZ6A 2VCCA 2V5YA 5JWPA 4OYUA 2BWCA 1QOSA 3W21A 2ZJCA 3AZXA 2GC0A 2QQPA 4DOUA 1XE8A 3AP4A 3ES1A 2ORXA 2RMU3 5JDBA 2RS31 4PF5A 3BOPA 5HCBA 3RZZA 1D4M3 4OQ8A 4D7TA 5C9AB 3RZKA 3GBGA 3HD8B 2WZEA 1MVQA 3NNGA 5L73A 1ULOA 2W9XA 4CCOA 3EBRA 3M1HA 3H9AA 1FAYA 1UU5A 2CWMA 4QQHA 4QDRA 1QHDA 3HEIA 4D7YA 1K12A 3GZTB 1XNCA 5C8CB 1KJLA 4O7XA 2OIIA 4AEDC 2C6SA 2VZ3A 3E5QA 4HVRA 1I3HA 4FPYA 2JDAA 2YGLA 3HOBA 1BHGA 2WQZC 4IE5A 4KU8A 1EAH3 1XYOA 4XACA 1OOPC 2Y6KA 3AKRA 2D44A 2TNFA 3WNPA 2E53A 1YO8A 4FPKA 1O59A 4JDOA 1RUF2 2W92A 3AKTA 2OQ6A 4P9WA 1MR5A 1ASJ1 1YCIA 4QHBA 5A3UA 5DZFA 4OI0A 2XJUA 2J1VA 1DGWA 2O1QA 2RS12 4NAOA 1H1AA 1WUVA 4L8QA 4UFMA 4LHLA 3WF0A 4AHXA 4AVBA 2VAUA 1RUOA 2MNGA 2P1BA 3OYWA 4FPEA 4JKKA 4P5YA 5L7OA 1ZBA1 4WZFA 2BVVA 4D6SA 2V4AA 1AYM2 1DGRA 4DB5A 4XQ4A 4YNIA 2V73A 2IVJA 4FFHA 5T52A 4QPGB 2UY8A 2Y26A 2E26A 5AC91 1BK0A 1TMF3 4K40A 5FYIA 4W6WA 5JMCA 3W5MA 1XC6A 5FPAA 4ARYA 2RJLA 1RUI1 3KCCA 4XBQA 1DZQA 3OUJA 1Z7S3 3ZDSA 1ND2A 1T6BX 3DYOA 4I30A 4XJWA 1ZA7A 5FZKA 3FX3A 1CGPA 1XPWA 1OBNA 2Y6GA 3LQCA 5FIXA 1O8PA 1VBB1 2J1UA 3AP5A 1DG6A 4RFRB 4YVWC 2WYSA 5CKNA 1HB1A 4AOCA 1GV9A 2BUKA 2WN3A 2X10A 3TB0A 1R1A2 2ZGUA 2OVUA 5FZ6A 2JG9C 2JJ6A 5FYVA 3F95A 3WY6A 2W47A 3ZXFA 5AVPA 5ABJA 3CJXA 3FL7A 4IEPA 4M3CB 4MHRA 4QU1A 3M8LA 4LPLA 3TAYA 1PM7A 2Y6HA 2ET7A 1UMZA 2VNRA 5DUVA 1YYNA 4LO5B 3I2OA 1YJKA 3W5NA 4URTA 1FNZA 3RMXA 1KQRA 1E5HA 1D0GA 5C71A 1XU1A 1RUD3 1TME3 4R8HA 1JXNA 3BUCA 1O3QA 1VBA3 5C9AC 1RIRA 5DAQA 5CFCC 4CCCA 2HWE3 4XF1A 5BNNA 1IOAA 3ZYFA 1MS5A 4UW3A 3GHNA 2VC9A 4NAMA 1N47A 5FP9A 3ZKYA 3LSEA 3MV01 3KSCA 3AXEA 3FLRA 5C8CC 2R1BA 1AUYA 2I2SA 3FUOA 4QKDA 4JC1A 2UWAA 1XNBA 4GJZA 3WG4A 1GU3A 1PGL2 3ZSEA 2E6VA 3FFQA 1QNYA 5FLIA 3T1LA 1NUKA 4GB32 2MEV1 4OMCA 1IS6A 4CVUA 4IV1B 2PTMA 4IEVA 3DPRC 4RS5A 3BU0A 2ZEYA 1QJX1 2RS11 2VOXA 3BI3A 1FV3A 2CGPA 5FKCA 1RUJ3 5FK7A 3VBFB 3M3IA 3URFA 5A7WA 4XYXA 2WSVA 2H0BA 5B4XA 4CXXA 5C3RA 4CUBA 1LU2A 4YVSC 3OB8A 1IPJA 2VZQA 4Q4W2 5FZ8A 1ZZCA 4DMIA 1TEIA 1WWYA 4CUAA 1JBCA 2ZKLA 3VB9A 1RINA 1VRBA 5D1IA 1XE7A 3VKMA 4AYUA 5KR7A 1LNSA 2LROA 3M70A 3RYRA 4IL7A 3K2OA 4XBNA 5D8AB 1GFF2 2K2SA 4PBPA 2ZGLA 4QM8A 2OUJA 3M3CA 3S30A 3OPWA 4NWWA 2FDFA 1EUUA 2CWSA 1ZBA3 4PQ9A 3TN93 4OHYA 3C3VA 5GLTA 4CRQA 2EXHA 4LO4B 4PIXA 3ZSMA 3LFMA 1R1A1 3UESA 2PHFA 4CDWB 1XYNA 3DF0A 3K48A 5A32A 5BNOA 2VU9A 4YPJA 3PL0A 1JOBA 2ZX0A 1CAUA 3IIAA 5T55A 1L7LA 2CY6A 4LA2A 1RUE3 5CZKA 4QU2A 1UIKA 2FDGA 1GZCA 5FPZA 3GCXA 5JSOA 4V1PA 2ORZA 3AMQA 2J42A 2VPVA 1NE6A 3ACHA 4FAGA 1GR3A 5KXCA 2AUYA 3KT1A 3N3HA 4DZGA 1M4WA 1QQP3 1Q8OA 3NJZA 4P14A 2QQVA 4UFHA 4AGRA 2JG8C 2JDKA 4Q8KA 1CN1A 4DNYA 4JGYC 1FV2A 2ARAA 5KBFA 1JZ8A 3ENRA 1LENA 2VUJA 1W9TA 3UJQA 1WLCA 4Q0QA 1G9FA 3CF6E 2GC2A 2NMOA 3ALQA 1JYXA 3KM5A 5HV4A 2ZGTA 5A7SA 4MXVA 5LBEA 4Y1XA 4ZZ8A 1GMMA 3AP7A 4GB31 3BTZA 1E5IA 4LE4A 1ULGA 2OXBA 2WNUA 2VXRA 2WABA 4MUVA 4R9BA 2XKOA 4XF3A 1A8MA 4YW3A 3ZFFA 3VHPA 5FOBB 4GWJA 1HB4A 1C1FA 1BLZA 2RV9A 2WKKA 3DCQA 4KBZA 5FYBA 5FZAA 2Q0AA 4CP0A 5IVYA 2HWB2 5FP7A 2PAKA 4LK7A 1W06A 2ZACA 3VBFC 3PVEA 1G9DA 2YBSA 3T2OA 2BP6A 3ABZA 4COWA 2X05A 4XF4A 3ZM8A 5A3MA 4BCUA 3IDCB 5FY1A 3D4KA 2DCJA 3MIFA 4Y5TA 1ULFA 1GQPA 2XONA 1TE1B 1Z78A 2YHJA 1GP4A 4BYYA 4N90A 3WT3A 4MGQA 2QQWA 5A1LA 1S0CA 3I2JA 1PNFA 2VNOA 4N53B 1KDMA 2MEV3 4LBQB 4UXAA 3CBNA 4F7ZA 1V0AA 5IVCA 1BKZA 3H1WA 4H14A 3POIA 1OQEA 2J7MA 1AYN3 1BEV2 1DYKA 2HYXA 2VJXA 2VQTA 4QGNA 5FZIA 2DCYA 5A6QA 1ZM1A 5A3LA 3R05A 5CFDB 1UNBA 1RHI3 3HNMA 4NOTA 2BQPA 2YUEA 2ZMKA 4ZONA 4LUKA 3QOPA 4ZU4A 4EZ4A 4XUOA 2P5BA 5F3GA 3WF4A 4BE3A 1OLME 2XH6A 5DQ0A 1XU2A 3I97A 1FPN2 2IXLA 3B02A 4HL0A 3N35A 5FMDA 4CDWC 4D6QA 3X29B 3RYPA 2DCZA 4IUGA 5APAA 3WINE 5C4WB 4UW4A 3OBZA 1HRV3 5DUUA 5L9BA 5EZWA 4CP9A 4BOWA 1U5YA 1JN2P 3INAA 3ZXDA 4MOAA 2XLGA 5JCTA 1V6KA 5FPVA 5HV0A 3ZXEA 2VUCA 1QMJA 3LA7A 1RL3A 2KA3A 2NPIA 3J4UH 2Z2SB 4W6XA 4RSUA 5EJ1B 1KDKA 3ZYIB 4DEVA 2CYFA 1QWRA 1LHUA 3NRUA 1CIWA 1SBFA 2JDUA 5FYTA 4C91A 1RUC3 4LBLA 2B7YA 2Q30A 3OG2A 4J1WA 1KS4A 4N43C 4XFBA 4LBJA 1UKRA 1EP0A 3R6SA 3V64A 2VE1A 5C3OA 4IQPA 5ISLA 4Q4V3 1CAWB 2DVGA 4R4XA 2JWPA 2VQ0A 4MSVA 5FAXA 3RGBA 3PU3A 5DUWA 3BIEA 5J3UA 2HWB1 2D98A 5JOZA 2HWD3 2BEOA 3MF9A 2VW1A 4ISQA 2A3YA 1ZBE2 1CAXB 1W6NB 4HANA 4LMFA 3N9LA 5F3IA 1DCSA 3RDIA 3VBSA 5BNPB 1DBNA 2VXJA 3RFRA 4HPKB 5GZFA 2C24A 4E27A 3TEZA 3KHCA 2Y60A 3T2TA 1MEC3 5C70A 4YVWA 3AYAA 1JZ7A 1W3XA 1W6PB 1IS4A 2FZ1A 3DEMA 4JZRA 4E4SA 3PHMA 4JAAA 4BK4A 4W50A 1CAVB 4NWVA 2JG9A 5C33A 4JVAA 5FOJB 2ZGOA 2PN5A 2Z69A 4QKFA 2R062 3N4MA 4EQVA 5FZMA 2BU9A 4LNVA 2ZMNA 3ATGA 2EXJA 2OS2A 2E33A 4NR1A 4HVQA 1GOHA 2JE9A 2RM23 2AZ5A 4N7IA 4AEMA 2ADEA 2N7GA 4NHKA 4D3WA 1YQ8A 1HN0A 3GDBA 5FREA 5JPNB 1FPN1 2K0GA 3GJAA 4Z2WA 5C9AA 4RGKA 3A0KA 3IIIA 2B9UA 1NKGA 2OYZA 4HONA 3DN7A 1TVGA 4OULA 3N9PA 2ZGSA 3QCWA 3VBRB 5KHKA 1N1VA 4BM8A 1UZZA 1ZRDA 2YV8A 1YEWA 2GMMA 3GALA 3IBMA 4JDMA 1C4RA 4PDWB 4EROA 4A45A 5C8CA 5JOWA 1Q8QA 1NCQC 2V4VA 2QNKA 4MGTA 4K3UA 3H8XA 1CESA 3OBAA 1DZRA 1UXXX 2VMDA 4YG6A 3H8OA 1DLLA 4EE2A 3NJXA 2VBPA 4AVVA 4FOWA 1S55A 2OKXA 3JCIA 2E7AA 2JD4A 2Y8KA 3AJYA 1C8NA 4FP3A 4L99A 4MGZE 4ZXEA 3ZXAC 5FRAA 1W8HA 1OI6A 2XQRA 1D4VB 2AEYA 1EY2A 3AK0A 3HIFA 1AZDA 5EYXA 5FZ0A 1D2QA 4Q0SA 1N1TA 1ND3B 2WS91 5FK8A 3H3LA 1VMJA 4Z2AA 4E9KA 2DU0A 3K4ZA 1W05A 2VOVA 1PVC2 4YGCA 5FYUA 3ROUA 2VO5A 5DDJ1 2Z4FA 2Q5TA 1NY72 1HJFA 4NE9A 5FY4A 4QPGA 4EZHA 1S0JA 3TWIA 1SFYA 4ES8A 1APNA 4EWAA 1JZ4A 1AXZA 2PHXA 4CCJA 3O1VA 3JZVA 3K3NA 3PVOA 1KITA 1WD3A 5DAWA 2VY0A 4RR3B 3E6DA 2X8KA 2QVSB 2ZX3A 3THCA 3OGRA 4BQWA 4W4ZA 5J1XA 2W91A 2ZEZA 4QPIC 4IV3B 5FP3A 3KVBA 1W6OB 2O8QA 4LKSA 5A3NA 5BNPC 3VBHB 3HNYM 5E16A 2D5HA 3VD7A 4ZHNA 5GLUA 1AR72 1LHWA 3AVRA 2CSGA 4NHXA 1H4GA 2QTWB 5FP4A 3VHRA 1HQNA 3TOJA 3ZN5A 5K0UB 1SFNA 1UY0A 4WM7C 2RG4A 4AI9A 2OX0A 3SQOA 2BTVC 4H2AA 3B01A 4NHMA 5E1RA 3MHZA 5CB7A 1WLWA 5SV8A 5FY8A 5F9TA 3BKZA 2R061 4M01A 3USUB 4QX3A 2GDFA 2NMNA 2R30A 3N7MA 4M3CA 4MYEA 2P6CA 2GZWA 4HXCA 3TYJA 3NQHA 4M0NA 1O5LA 3RSJA 2Y38A 1F4AA 2E7TA 3OD4A 1C8M2 2C9KA 1LU1A 1W9SA 2P4EA 4J1XA 4ZU7A 4KMQA 5EYYA 1W6QB 5JPMB 1HV1A 3HNBM 4Q26A 1G7YA 3AB0A 1LODA 3IAQA 4Q0PA 4E4ZA 3T0AA 4CP2A 1JU3A 2FDJA 3VBRC 4EN8B 2BGOA 3JBG3 1Q3EA 4FPOB 1FXZA 3AMMA 4PDWC 3VN4A 5M0TA 3J8F3 1YUDA 1LCLA 2WQ4A 5AVAA 4XBLA 4COUA 1UY1A 2FDHA 3GJBA 4AR2A 3P3NA 1UY2A 3ON7A 5T5PA 4DUWA 1RVF1 4GMP3 4HETA 4WZCA 5LBBA 4JHZA 3A4UA 1OD5A 2WDBA 2WNVB 1I9RA 3U4XA 1R093 1LOFC 4QPYA 2WFF3 3CJIC 4IV1A 1AVBA 5LA2A 5IK4A 1PO22 4E8CA 4AVSA 2B8MA 2FDIA 4FOYA 4HLTA 1H1IA 1UZVA 4G4FA 4MZUA 3N9NA 2XMLA 4PT6A 3IMMA 3AP9A 1VBE2 1GZTA 3OOXA 3PVBB 5FZ4A 4QXHA 1J59A 4EV0A 1W8FA 4AFMA 5A7QA 1X8EA 3GCWA 5EJ3A 3KVAA 2B46X 5JSRA 1NY71 2PLV2 3H7YA 4MVTA 4XJ9A 4QT6A 2ES3A 1BJQA 4XMIA 3KCXA 3WNXA 1PIV3 2VZ1A 3OSDA 5LBCA 3VZMA 1LKNA 2YDEA 1U5XA 2JDMA 2RVAA 4MGKE 5I0SA 4W65A 2IXJA 2EAKA 3LEMA 1RUH2 4IGPA 4RR3C 3T2PA 4AXOA 5D8AA 4S2GA 1GWLA 1ULPA 5A7NA 4G3YC 5A1AA 1O91A 4K9SA 1AR63 1AR71 5I0DA 2BJSA 2DTYA 1A6CA 3O12A 2ARXA 1EV13 2DV9A 4HVOA 1FOD3 2C5DA 1O4ZA 3EHKA 1OKQA 4BIOA 4ASLA 3ITQA 5B2GB 5DDJ3 3RZJA 4NIGA 4Y24A 1UZWA 4QMAA 1ZZ6A 2CL2A 3M3QA 4YWAA 3M4FA 3BTYA 1JODA 1L7QA 4IESA 3ZFGC 2ZXQA 2ZHMA 1TQ5A 4P9YA 4XJ8A 1HXS3 3I2GA 1TG7A 1C8M1 2C0ZA 2HWC2 2DVBA 4UOJA 2VTXA 3GM8A 1SBDA 2G9GA 2W3JA 1VBC1 1X7NA 2XLFA 5JXIA 3POWA 5GZEA 2IZWA 4PJYA 3TNQA 1VBA2 1ZYBA 2PQQA 3U0ZA 1OUSA 4UFKA 1R082 2HWE2 2PFWA 3PJYA 4LOSA 4QDSA 4FFIA 2C1FA 4AI0A 4LA3A 1V9U2 5C3SA 2DBNA 5KC6A 1AL0G 3OPZA 1QH7A 3RG0A 1S1AA 2WINB 1H0BA 5F39A 1MZ5A 2PHRA 2Y6FA 2WC2A 4QX2A 3WW1A 4B1MA 2VGDA 5JZGA 5KHJA 4J6GA 4JKMA 3LZZA 3IMNA 4Z07A 3I2KA 3ZXGA 3ZYPA 3C7EA 2PAEA 2VUDA 2XWJB 4AEDB 2Z79A 1ZRFA 3APBA 1SLLA 1SMVA 2HEVF 4IEUA 1N1SA 4Y20B 1NOVA 1KFXL 1LR5A 4SLIA 4CUCA 5A6YA 4MG2A 5SV5A 4HOOA 2VH9A 5K7PA 5FZOB 1OOPB 3ZLIA 5GLZA 1PO21 3BIWE 1LEMA 4IW3A 5I93A 3MYXA 3BB6A 3SEEA 3B69A 3D6EA 2JB4A 2R042 3IDEA 1VBE1 1RUJ2 3RJ2X 3BODA 1BVVA 1AXYA 4QHZA 1JYWA 4H7LA 4X6QB 1ALYA 3ZYGA 1EPZA 2PLV1 4P9JA 4XAAA 3ZN4A 5ERLA 2ZOEB 4LKDA 5JVVA 1W8OA 2YC4A 4MH0E 4AG4A 2VMGA 1URXA 2VQUA 1WBLA 4BQ1A 3AL5A 4J25A 1MQTC 3MW4A 2D3PA 3AXDA 2G9ZA 4PQQA 4BPZA 2OUHA 4N53A 1RUH1 3ZIWA 5I0UA 1QJU1 2EIBA 4HN0A 4LBQA 4PI2A 5CG9A 4EWDA 3DGTA 5FZ3A 3WG1A 1XXNA 1GWKA 4AI2A 2ENRA 3J26N 1ENSA 2I74A 3K75B 5CFDA 5EHDA 4DIQA 3ELNA 5BXXA 2YC2A 2JB8A 1PX3A 1ZVFA 4MHUA 1ULEA 4HK8A 5FZCA 1YJLA 2P3YA 1HRI3 2RR13 3ECQA 3VBOC 2HJIA 4K7JA 1IPSA 1YQCA 3E1F1 2CAUA 5FXVA 1WCUA 3OGGA 5FZGA 4AI1A 1O4YA 1VRH3 2A6ZA 3R0RA 4OUSA 4AGVA 1KFUL 1NYWA 2ADDA 2HWF2 4XE9A 1PX4A 5F2WA 5C4WA 4FPJA 2Q8OA 2VW2A 2JIJA 1IS5A 4A6OA 5IVFA 2HWC1 3TEXA 1NCRB 5HXVA 4XABA 3T30A 3CKHA 1STMA 2ZAHA 3EXUA 3WDXA 4CCEA 4QQOA 3QBQA 3WW2A 3TRSB 4BIFA 4YYOA 1WW7A 3CNAA 2UURA 1JYNA 1R081 2KR2A 3AZYA 1KGYA 1LHVA 2QQNA 5BNQA 5CFCB 2NM1A 3VDBA 2DURA 2OPKA 4Q4X2 4IE6A 3LA2A 1SACA 4F83A 4LBMA 2WZR1 1JW6A 1ENXA 1UPSA 1VB2A 2R071 1RUNA 2DVAA 4K1YA 2VZTA 3GHMA 3ACFA 5LWBA 1OPMA 2JDPA 2K46A 3N36A 3WD5A 1NA1C 1NLRA 1H2LA 1J3RA 3NKTA 1Y9MA 5LB6A 4BXSV 2VL4A 1YRZA 3MV11 5JI9A 2B45X 2PQSA 3HN3A 1CAWA 5J98B 4Q4Y2 3CLPA 4P5HA 3UT0A 1UMHA 1VAKA 3O0XA 1QJY3 3DPRB 2YY1A 2RS53 2VBDA 4LBNA 1CJDA 5A1FA 4IEZA 2ZEWA 3JU9A 2A6YA 3S57A 4XW3A 1VIWB 2ZCWA 4MADA 1CAXA 1W6NA 5T5JA 1XBFA 3WF2A 1OQ1A 2PHDA 2QQLA 2ZKNA 4PHZA 4QHOA 4M4PA 1CZSA 2BNOA 4P9LA 4W8JA 4YVSB 4CDQB 1NG0A 4GXLA 2VCAA 4H3WA 4AF9A 1YC61 1RJ7A 1ZZ8A 3SEPA 2VQAA 2MPFA 4OUMA 4CCDA 5C7GA 1QOOA 3O1UA 1CAVA 4NMIA 4XZUG 5LRSA 1OFSA 1GANA 2VZRA 4MGYE 4X8NA 5A70A 4NVPA 1AR82 3WP6A 3GF6A 2K9ZA 4I0BA 1F31A 4FXGB 2PHWA 2NYYA 4YGBA 2E32A 1RYYA 1VE0A 2XBO3 2G9FA 4GH4C 1DGWX 1YNAA 4LK6A 4KWUA 1FNYA 2HEWF 3HR9A 4LULA 4XHXA 4O61A 1W99A 5JXHA 1BMV2 4YARA 3LEGA 4UAPA 2WO2A 4QXCA 3MZHA 2XHNA 4K6BA 1FMD2 2HWF1 4M4RA 4QPWA 4XFGA 1UWWA 5DAPA 1PO11 1UO9A 3GNEA 4UFIA 2D5FA 5EPAA 3RNSA 3DUIA 3VDDA 4E8DA 1RITA 2ERFA 3AYEA 4KGGA 1GUIA 5CNAA 3THDA 1QJU3 4YW5A 2FZ2A 1SFPA 1NCRC 3UKNA 3WDUA 4FP2A 4QKBA 1YI9A 4RHV3 1DZTA 2VULA 3RWKX 4BZ4A 3UNPA 1VAVA 1JU4A 1CZVA 3FHIB 4Q4X1 3ZSKA 5ACA3 1AR92 1RUG2 2JG8B 5EXOA 1IQAA 4JGYB 1N3QA 1C57A 3BYWA 4AFDA 1UL9A 4GJYA 4ASKA 3GBFA 4QB2A 1RUC2 1VPHA 2YB7A 3NL1A 2JE8A 1JZ6A 1K5MC 1Q5OA 4I3GA 3PLQA 4NO4A 4WVMB 4XFCA 1ND3A 2WT0A 5A7OA 3GGLA 4R9CA 3ZYRA 1FX5A 4YG3A 4TLFA 5HXMA 3VD3A 3FHQA 3CO2A 2B42B 2R7EB 3BCWA 1YQ5A 3I3BA 5BYNA 5KXDA 4Q4V2 4Q4Y1 2XJRA 3HQUA 4L2NA 2LS6A 2HLEA 4DY5A 4QAWA 2P37A 2V72A 4Q1PA 1RUF1 2D6MA 3VDCA 4CPBD 2RS33 4HMZA 4QDQA 5FZFA 2EF6A 5C6CA 4A3ZA 1CD3G 1O8SA 1O6UA 3WDYA 1HIXA 2YU1A 2AYHA 1LRHA 4FQZA 3ZMNA 4RR3A 4AQTA 2O0OA 4ZU5A 4XETA 3EMRA 3ZO0B 4LBOA 4XTPA 2XDVA 2G1MA 2W52A 3MLJA 2VNGA 2DWRA 5FPLA 1WLDA 1AYM1 3Q9OA 2GNBA 4IV3A 2FCVA 3WQBA 2JKBA 1BXHA 1W6OA 3M2MA 3VBHA 3MIHA 2GNTA 5LBFA 4EN0A 2EICA 2XUMA 4CDQC 4TSVA 2W87A 4XVHA 5C5UA 5IVEA 2LW8A 4XFIA 2WJSA 4TN7A 4CEWC 5K0UA 4BA6A 4K8RB 1DLCA 1CPNA 2BVBA 3DV8A 4LEJA 4XUNA 3W58A 3WNNA 1JI6A 4P9GA 1K42A 3OPTA 1R64A 4MLOA 2OZJA 1OSGA 1PK6C 4KG0A 3USUA 4CCMA 1AR81 3WNOA 3UV9A 1ASJ3 2WO1A 5FYZA 3ACIA 3I7DA 1OVPA
chains in the Genus database with same CATH topology
1V00A 3AM2A 3OBRA 2ZHKA 2ZGPA 4RGGA 2RM22 4ORFA 1BMV1 1H8TB 3S6PA 3VHNA 1O3SA 4Y1YA 1LHOA 5FFOC 3EJKA 3JQWA 1FMD1 4ES9A 4XZPA 3NKGA 2LTNA 3KB5A 4LLFA 1GLHA 2LALA 5AC93 3MIGA 4LT5A 1GQGA 1AXKA 4Z92B 2R16A 1NE4A 3WUDA 3VV1A 1RUI3 1QH6A 4RQPC 3NV3A 2D3RA 2D43A 2H0VA 1AR91 3G7DA 4BLJA 1RUG1 3QLQA 4YM0A 4IEQA 5J37A 2WNVA 4LBKA 5KXEA 1VBB3 2X53S 4WM8C 4YSFA 1F5JA 1SLIA 4MX3A 5BPXA 5HI0A 2GMEA 3HQXA 1PO13 4N43B 1WCKA 1Y7BA 3NVCA 1PGL1 3FLTA 1KJRA 3WVJA 3LCPA 4XEZA 3OGJA 2EAAA 1KXGA 2VUAA 3ZN6B 3PVNA 5KHGA 1G6NA 5DUXA 3AKSA 2JXAA 3ZYJB 1Q8VA 2W39A 1MS3A 4FT8A 5J96B 4CDUB 3MLLA 4C1WA 4Q4W1 1F9KA 4JGZC 3KZ4C 3BALA 2WIIB 2I07B 4GQ7A 2UWCA 2YROA 3VZNA 1MZEA 3L9JT 3WXPA 5BV6A 4WVZA 4DPNA 1GICA 2Z42A 1QJX3 2RS13 2KM2A 2IXKA 4KU7A 4QD2A 1BZWA 1H8TC 5GALA 1AYM3 4I01A 2IC1A 3PJQA 4NPRA 3O5SA 3AFKA 3UKTA 2ILMA 1WCDJ 3FFZA 4LBQD 5HCAA 2PHTA 5LEKA 5CBLA 3J8F2 2WZPP 3C2UA 2XG3A 5I0TA 4AEDA 1NCQB 4K21A 4N9IA 2CGNA 1VBD2 2QDNA 4Y20A 3RS6A 1UIJA 4LO6B 2AREA 4RGAA 3D82A 1QF3A 1OOPA 2OA2A 4C0HA 1J1TA 4C90A 4U2AA 3M3EA 2PA7A 3PMSA 1R1A3 2ZHNA 3H3ZA 1YI7A 4COZA 5KHHA 3TNPB 1LHNA 3MLKA 4Z8BA 1C28A 3O14A 4E2SA 2CGOA 1YLLA 4K8FA 1GZ9A 4IEXA 5EWSA 1RB8G 4KWJA 4LO8A 1S0FA 4OI1A 2HKXA 3RWNA 1JHNA 1CVNA 1XNKA 1LJ7A 2YXSA 4FPFA 2EXKA 2ZGNA 1Y9QA 4YRDA 1CQ9A 1PGSA 2ZPXA 4Y1ZA 4GKYA 4QPIB 2XL9A 4KBBA 4CDUC 1RMU2 4YGDA 3RI8A 1ULCA 1MS8A 2Y0OA 1U12A 2BFUS 1D0HA 1QNWA 1UU6A 2UYAA 4WM7B 4CTEA 4GB33 1AL22 2QUOA 3L2YA 4EN9B 1BEV1 3MIBA 4YW1A 4XXAA 1REDA 3FBMA 2R49A 2RHPA 4B4PA 4CDXB 3LSDA 3V0AB 4FSJA 2OW4A 1OFNA 1H8VA 2EA7A 1UN1A 1COV2 1IS3A 1YFYA 3MF6A 5CFCA 4INDA 2X5IC 5DZEA 4OFGA 1RTVA 4B3NA 1JYCA 2R1DA 4MXWB 3FWEA 4XFHA 1VBD1 1I5ZA 2QCSB 3WUCA 5TSWA 4XFFA 4XJUA 2DF7A 4PIZA 5DG2A 4BLIA 2GU9A 2A3WA 4KWKA 1V6LA 2AGSA 3CJIB 4YLZA 3DPRA 1ZNPA 4Q0VA 3JD72 1BYHA 4FPLA 3N7LA 1BBT2 2DU1A 1N3OA 2QKDA 1DQ0A 1ZX5A 1IPKA 4I02A 1W6MB 4YVSA 3VZJA 4CDQA 5FQ0B 4EJRA 2FQPA 2XJVA 3KGLA 3AYDA 4R52A 2JX9A 5H9QA 2JECA 2SLIA 2XJQA 1POV1 1ZBE1 1DQ6A 1GSLA 1RMU1 2GSYA 2ZAAA 4X6RB 1NXD1 3I54A 2BYVE 3KGZA 1S0EA 3HN1A 4Y1VA 1SQ4A 4DINB 1H4HA 1REEA 1AL21 1SCSA 4XF0A 1VRH2 4MGIE 3OD0A 3D5OA 4PBOA 1HLCA 3R4DB 4ZKTB 2KXLA 4I09A 4A7ZA 2HWB3 3OJBA 3ZFGB 4X8PA 1U5ZA 4CDXC 1S0BA 4GKXA 1DFQA 4KL1A 3JUUA 5I8SA 4OHWA 3U10A 5L7OC 2RMU2 5CG8A 3ZSJA 2ET1A 5GLWA 1COV1 1D4M2 4WVVA 1PVXA 1CX4A 3GBWA 2LM3A 4K1ZA 2JG8A 3MDPA 4LO7A 1MACA 2R0FA 4DQAA 4XIKA 5JLVA 4JGYA 4A7YA 2W0XA 1H2NA 4HZFA 4EWEA 2G4IA 3B3QE 4XDQA 2D3SA 4U36A 4WVMA 4LHKA 2ZX1A 5JOYA 1ND2C 1JTZX 3RMYA 1VP6A 2DUQA 4HN1A 1HKDA 3ZIXA 1EAH2 3AZWA 4JCKA 5J7MA 2VVEA 3B9CA 1DF0A 1R1ZA 4FPHA 3JD71 1FPN3 4LUMA 3V65A 3ZX7A 3RPQA 1BBT1 4HK9A 4GIQA 1OA3A 5ABJC 3MPPG 1CAUB 2VW0A 4FPGA 3VBFA 1M06G 2EIGA 5E8AA 2RJKA 1BCXA 3OF1A 2E7QA 2DUPA 2YMZA 2AR6A 1VR3A 1PVC1 2DCTA 4C0BA 4YZ5A 1EYBA 3U07A 2HYKA 3LOBA 4QQ2A 1AX0A 4I3PA 1D2SA 4BHPA 1MQTB 2P2KA 4KQ7A 4PLOA 1J1LA 1GZWB 1TMF2 1XYPA 1JOJA 1GKBA 5BNNC 3FMGA 2A73B 2IXCA 1ZA4A 2ZZJA 4XILA 4YZ2A 1ENRA 1Z7S2 5F6LB 4SBVA 2ETEA 2ZA9A 4L97A 4F3JA 1MS1A 5FMOL 3ME2A 2SBAA 4FTSA 2DYCA 2ARBA 1LOBA 1RGSA 2WS93 3VBOB 4E2GA 1PNGA 1H8TA 1HX6A 5GZDA 3WP4A 1C1LA 3RI9A 4TZDA 4CDWA 4RS5C 5FMOS 1UU4A 2BBVA 1H1MA 2O8OA 2NLRA 5CA6A 3HT2A 2GNDA 5K9YA 3B94A 2DUOA 2WNEA 3KS7A 4H55A 2XL7A 2Q4SA 5CU1A 3IT8A 2RMU1 4FPCA 5EFUA 2QFEA 3O0WA 1KD7A 1D4M1 1POV0 1RUD2 1TME2 2R32A 3ZFEB 1Q8PA 3BTAA 3WW3A 4QQPA 3U11A 3OCPA 1RJ8A 3AFGA 2I45A 4AVAA 5JAXA 5LRRA 2BNMA 4QM9A 3OBTA 3SCGA 3H3UA 2R063 1NA1B 4N43A 2BWAA 1EAH1 2A6XA 3AMHA 4M0HA 5H9PA 4AFCA 1UPIA 4N7UA 1PHMA 3FUQA 3ZN6A 2QQPA 4KH9A 1C3HA 4JRAA 3RYKA 1J3QA 4AVCA 2ZBJA 4FAHA 3CU7A 1WMFA 2NQYA 4AGGA 1ZRCA 5BNOC 2VMIA 4LE3A 3POYA 1FI2A 2DVDA 1W0PA 5A33B 2XB6C 4HKWA 4B7EA 4CDUA 3UK9A 4JRLA 1G9AA 2UYBA 4NHLA 2E9QA 1TMF1 2R0HA 4GA9A 1RVF3 4YFZA 3NW4A 4UW5A 1WA4A 1Z7S1 3LOIA 3ZVXA 1N1YA 3VLBB 3VKOA 3HBZA 5F1RA 1LESA 4GWNA 2W08A 2EVXA 1YFWA 1AX2A 1I6XA 1LOGA 3VZOA 1LECA 3E5UA 2C9AA 1ZBA2 3TN92 1O4TA 4GH4B 1G9CA 1ZZ7A 2WNUC 2VVFA 3QH6A 5AFBA 4YW2A 3ZFFC 2R6QA 5L19A 4N9HA 3NSTA 4XJZA 3RJRA 3AKQA 5I8YA 3GZUC 4FBFA 1RUE2 1V6OA 3VBUB 5FDBA 2DFBA 4DRVA 1RUI2 3MW3A 2WLPA 1NCQA 2AH2A 4YW4A 1RUD1 1TME1 3VHOA 4H7MA 1MS0A 1AF9A 1OPOA 1VBA1 1W0OA 2TUNA 3VKLA 4E4DX 1E57A 1QQP2 4IETA 2ZGQA 4CP1A 1AR73 2HWE1 3DL3A 3ZFEC 3M3OA 1V9U1 1IKPA 4JTNA 4R9DA 3ZXJA 3LB9A 2A75A 1VAMA 1CJPA 1K5MB 5HBAA 3WCRA 3ILNA 2NN8A 1SEFA 2QJVA 4Y5Z0 5BY5A 1GNZA 4YZ4A 1C8M3 4I0AA 4DY3A 1VBC3 2X29A 4OI2A 2R041 2XVKA 4B8EA 3NV1A 1RUJ1 1X82A 2CV6A 1ZREA 2BNNA 1QJZA 5LK5A 1BVP1 2VMHA 2Z5WA 3PMEA 4EN6B 2B5HA 3P3PA 4QPIA 5K8SA 2D6LX 4E2QA 5BNPA 3H50A 4HPKA 3KQRA 3LGRA 1SCRA 3NV2A 5IUQA 4P9XA 5T54A 4CEWB 2ATFA 3AKPA 3B93A 4WM7A 4FOVA 1W6PA 1CONA 1UKGA 1LEDA 5FO8B 2MEV2 2P3KA 3ZMOA 4K20A 1LOAA 1LGNA 1PO23 2XKPA 3HWJA 1AYN2 3SH3A 1PK6B 1QJX2 4YZ1A 2QZ2A 3NAPB 1PZ8A 2FMYA 4L11A 2P34A 4C1XA 1RHI2 1VBE3 2VG9A 4CDXA 2E63A 2EXIA 4AQ6A 3V0AA 1LULA 4I0WB 3TN91 1DQ1A 1QXJA 3AMPA 4XF9A 1SLAA 2PLV3 1J58A 3MEPA 2A5ZA 4AQ2A 2BPA2 1MZFA 4ONUA 1Q8SA 3KD4A 1J3PA 5GZGA 1RUE1 3K51A 5JI7A 3VBRA 4XJAA 1HRV2 2ZX2A 4LR4A 3THPA 3QD6A 1RUH3 3KT7A 4LLOA 4UBGA 3VBUC 5T5LA 3SCFA 4MXWA 4PDWA 1DQ5A 1WBFA 4COVA 3VBSC 2H6BA 4RQPB 1QQP1 2A6WA 1O5UA 1DGLA 3EO6A 4G9SB 1GYKA 2B39A 2UWBA 5IK8A 5DZGA 2HEYF 3HMYA 4RA0A 4AEKA 3CL1A 1LOFA 3MI8A 3CJIA 4WM8B 1EPWA 2GMPA 4ATEA 1ZZBA 3SHRA 4OLLA 4O9GA 2D6NA 3KLSA 1HW5A 1V6NA 5FO9B 2ZABA 2FHRA 1G8WA 4JTOA 4COYA 4HSJA 5GLVA 4RL7A 1HQLA 2HWC3 2P3IA 1SLBA 1W6MA 1NQJA 5FQ0A 1XNDA 4B29A 3V0BB 1R083 1UAIA 2HWD2 1V9U3 3THTA 3ST7A 4RFT0 1B35B 3JB8A 2DCKA 4AHWA 3H8UA 5CIRA 2WZR3 1DIWA 4CZSA 1XQNA 1S0GA 2DVFA 1S2BA 2R073 3VGIA 5L36A 1NZCA 1Y43B 2VECA 1MEC2 5AFEA 4TWTA 1TNFA 4QGLA 4JGZB 1NQDA 1OQDA 1ZZ9A 2RE9A 3IPVB 1SDWA 1AYN1 2XGXA 2D93A 3B00A 3SCHA 3IWZA 3KMHA 2R043 4FCAA 1RHI1 3NAPC 3SXWA 4KWLA 1SLTA 3ZFGA 1F8VA 3NO8A 1S0IA 4FQ4A 3USSA 3I59B 1OMIA 3ETQA 4PIYA 3VKNA 3FBYA 3FC0A 3WP3A 1W6QA 4QPGC 1FYUA 1PZ7A 1NLSA 1PMIA 1HRV1 1I1EA 4OZXA 4JV4A 5T5OA 5GZCA 5FPXA 4BMBA 3HAGA 3WG2A 4ZXKA 4RD7A 1BQPA 3AYCA 4JQRA 1T6GC 1WMDA 4KG8A 3E6CC 4YM2A 2WSUA 3PTYA 2F6BA 1RUC1 3M7AA 4FXKB 3OY8B 4KGQA 4QGMA 2HWF3 1IHMA 1YXWA 3D0JA 1WLTA 3JQXA 4UBHA 3WHTA 1MS9A 1QDOA 4W6YA 4Q4V1 4L92A 1ONAA 2A71A 3H1MA 4XXPA 5JIAA 4GALA 1MQTA 3MIDA 1KRIA 2BGCA 2UU8A 3MPBA 2D6KA 5FO7B 4YM1A 2PAMA 1GZWA 2HWD1 2H6CA 4Y22B 5F6KA 5KHIA 2ZGRA 4WV8A 4Q4X3 1WD4A 2LUWA 1LGCA 4TYSA 3WR0A 5JZGB 3VZKA 1B35C 1WGPA 4FTEA 3B9IA 3W9AA 1DHKB 1X36A 1MEC1 3VBOA 1QY4A 4IEOA 4AHYA 4IEWA 1VJ2A 3D0SA 4P9IA 2PELA 4Q4Y3 5T50A 4WVWA 4IV1C 3G6JB 4AI3A 3ZXKA 1RUF3 3W59A 3FE5A 3SNMA 4B4QA 3O0VA 4CEYB 1QXRA 3AX4A 1U0AA 3WQ7A 2RM21 1WW6A 3DKWA 5IT6A 4XQDA 4BWOA 4DRRA 4OHZA 3ZFEA 3WW4A 5H9RA 2X5IB 1X50A 3POSA 4OVEA 2NZ9A 1W2UA 1SLCA 3JBG2 3OTFA 4EN7B 2QE3A 5GM0A 5D8AC 5CVRA 1NA1A 1C5HA 1OHFA 2WT1A 1IKQA 1AR83 2PHLA 4GWMA 2PHUA 4YM3A 3BU7A 4L9BA 1LB2A 1OLQA 1R092 3WQ1A 2WFF2 1WCSA 4XHBA 1AJKA 3E5XA 1FMD3 1ULDA 4B4RA 4META 4AW7A 4XFAA 1LTEA 3H7JA 1YIPA 5A33A 1QOTA 1QGLA 4HSLA 2GH2A 2D97A 4LTAA 1JUIA 4M3CE 3ZPYA 4AFAA 4M3CF 4PLMA 1BK1A 5JOXA 1O7FA 1PIV2 4QX5A 3LKJA 4YFWA 2VOKA 2XVGA 1AR93 5CAZA 1RUG3 1KS5A 5I91A 5JZGC 2ZTNA 2BFUL 4KNCA 5J48A 1JUHA 2GALA 5JR7B 4XTMA 1CR7A 1AR62 2D6PA 2WS92 1EV12 2WA3A 1FOD2 3I8TA 1H30A 4GH4A 3KT4A 4I2OA 1F2NA 5DDJ2 2WFPA 4Y26A 3UKVA 3I2DA 2XLAA 4HKOA 2GH8A 3WV6A 2D6OX 2MHFA 4OI4A 5KWRA 4AHZA 4CEYC 4LHNA 3SH4A 3VZLA 3VBUA 4Z1VA 1HXS2 3OYWB 1NCRA 2ZZQA 3WHUA 2DFCA 4ATFA 4MV2A 5L7OB 3MW2A 4ITCA 2A7AA 3R4UA 3L2HA 4HT1T 4A3XA 1REFA 3S7IA 4BMEA 1A3KA 1GBGA 3B5LB 4JDNA 4AEJA 3WDTA 4Q4W3 3WQ0A 4DXZA 4YG0A 1C5IA 4N53C 3JBG1 4FO9A 3J8F1 3SITA 4XOGA 1K5MA 3J9SA 4F8AA 1ND2B 3N7JA 3SLIA 3RQ0A 5FBZA 5CFDC 4GMP1 2WT2A 5FLJA 3V56A 1O3RA 4B7KA 1R091 4DS0A 2WFF1 3MIEA 1HDKA 1VB4A 4Y1UA 4ISRA 4R9AA 4PCRA 1UF2C 5BUVA 5EV7A 1DQ2A 3VDDB 5FTTC 4IXLA 5ABJB 3NV4A 2V09A 3LA3A 5C4WC 3NWKA 1NXMA 1AJOA 1V70A 2ZX4A 3E6BA 1PIV1 5E89A 2BW8A 1SBEA 1H9PA 3H0OA 4HBNA 3H1YA 3JB4C 4CEWA 2WA4A 1RVF2 3VL8A 4A7KA 1Q56A 3TBDA 4XMAA 2YYOA 5BNNB 5GJ6A 4QQLA 3RRDA 3SH5A 1PK6A 1UCXA 1AR61 4D69A 3NAPA 4YGEA 1B09A 1EV11 2PYTA 2RR12 1HRI2 1FOD1 5GKAC 1UD1A 1ENQA 3GZAA 3KCYA 2P3JA 4NN0A 2CNAA 2XWBB 4RS5B 2IXIA 1OA4A 1DU3D 2D7FA 5H9SA 5F5QA 1L3JA 1HXS1 2GN3A 5FCCA 3A0NA 4Z82A 3ASIA 2ZGKA 1LOCA 2ZMLA 1YHFA 2UY9A 4UW6A 4RQPA 5KC5A 3WOGA 2YC0A 3VKFC 4XPVA 3VUOA 4XQWA 2TEPA 3IKWA 2ZHLA 3FJSA 5DXDA 3O7OA 1W39A 4WM8A 4DFSA 5I0RA 1WMEA 1DDLA 5J36A 4IEYA 1BEV3 3R4SA 4O9EA 5LEJA 3SMHA 1N3PA 1OA2A 4FOQA 4YZ3A 1X33A 1GNHA 2DTWA 1OLRA 3WLUA 1QDCA 1PGW2 4PLNA 1VBC2 1G86A 3AZVA 3BPZA 1QJY2 1YFUA 2RS52 2WLQA 1H9WA 3QH7A 3V0BA 5A32B 5BNOB 3VDDC 2F4PA 1HV0A 1V6MA 1XRUA 3AJZA 1B35A 3LAGA 4Y4YA 1V6JA 4S2FA 3WZ1A 1WW5A 2E51A 3I4IA 2QDRA 3QACA 1VLNA 1VBD3 3E97A 3MFAA 1VALA 1MVEA 4JGZA 2XJPA 1UZYA 1WW4A 2XPJA 3IPVA 2JDZA 1GQHA 4GMP0 5FLHA 1RC6A 1YWKA 4AVTA 3ACLA 4CYDA 2YZ4A 1CPMA 2IFRA 1ND3C 2XJSA 2RR11 1HRI1 3MGUA 2FMDA 1YFXA 4XIOA 1AHSA 3I59A 2Q1ZB 2JICA 3AZZA 2XBO2 3WX5A 1VRH1 2WNUB 1UX6A 3ZFFB 3GYDA 1TNRA 1LOEA 2GNMA 3FLPA 2D40A 1Y3TA 4AK3A 5I8TA 3UL2A 5IK5A 4AI8A 1Q43A 4FVVA 1QJU2 2W68A 1Z0HA 1POV3 5JIUA 5C8WA 4GULA 2GC3A 1ZBE3 2FBEA 3B7MA 3CEWA 4RHV2 4IV3C 1QXPA 1RMU3 3VBHC 1F5FA 4D94A 3ES4A 2YGMA 5JSPA 4AFBA 5ACA2 2TBVA 5K0UC 1QU0A 3WDVA 3AP6A 3D8CA 2ZGMA 1G9BA 1AL23 3AMNA 4QXKA 3OY8A 2A3XA 5LK7B 3BOWA 2EALA 2IFWA 3WP5A 5CADA 1PGW1 2WWSA 4WBBA 3VL9A 4Q1RA 2OZ6A 1JH5A 3MICA 1QJY1 1U5IA 4OHVA 2JENA 4AE2A 2RS51 2RS32 2Y0IA 1COV3 4Y22A 1A8DA 1DQ4A 2Q1MA 3WDWA 2A6VA 2IWGB 2QZ3A 2P17A 4Q8LA 3EQEA 1H2KA 4S2DA 2WZR2 5J09A 3WG3A 4M00A 2AENA 2R072 1O3TA 4IERA 5DG1A 2JEMA 5T3NA 1PZ9A 4OHXA 1FT9A 4ASMB 2VVDA 4AQSA 2CAVA 1AX1A 1LGBA 3FZ3A 4R4ZA 2WNVC 2IXHA 2YPJA 4A2UA 3MFCA 1MS4A 4D7SA 5KXBA 1S0DA 1V6IA 2JE7A 3ILRA 4Q0UA 1DYPA 3S0MA 1QKQA 1ASJ2 3JD73 4CEYA 2A70A 3SISA 1BBT3 3PNAA 2XBO1 1A78A 4Q29A 1PVC3 2WL1A 2CTVA 3ZSLA 2GN7A 1ZRRA 3LWCA 4AWDA 3ILFA 2X5IA 4HFSA 2XJTA 5AC92 4HKLA 5E88A 1X8MA 2NP0A 4RHV1 4S2HA 2VOWA 3WCSA 1FATA 2XVLA 3IM0A 3N7KA 3VBSB 1IZ3A<