3DL3A

Crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
RIPKNWTIQRSTPFFTKDNVPEALLTHHNTAVDVFGQICVMEGVVTYYGFANSEATEPEIKVVINAGQFATSPPQYWHRIELSDDAQFNINFWSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the tellurite resistance protein TehB. Northeast Structural Genomics Consortium target VfR98.
rcsb
source organism Vibrio fischeri es114
molecule tags Structural genomics, unknown function
molecule keywords Tellurite resistance protein B
total genus 15
structure length 96
sequence length 96
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dl3A00
4KU8A 2P17A 1UW8A 1SEFA 3OCPA 1YLLA 1UIKA 3O14A 1CAUA 1X8EA 2C0ZA 1LRHA 4I02A 2OPKA 4HN0A 4WBBA 5KHHA 5JCTA 4X6QB 4LA2A 3PVBB 4QXKA 3RDIA 2PAEA 4Z82A 3LA3A 5J48A 2ET1A 5HI0A 1WA4A 4E2GA 3I59A 1YFXA 2QVSB 3H9AA 1UD1A 1CAWA 3BU7A 1L3JA 3ETQA 1O3TA 1NE4A 1XE7A 5CADA 2CV6A 1ZRCA 1ZZCA 4XF9A 2Z69A 4LA3A 3KCCA 3G7DA 4BH9A 3CF6E 1FI2A 3ES4A 1QXJA 1J3RA 2VPVA 4MGYE 3KSCA 4BIFA 1OMIA 2VQAA 4JTNA 1CAUB 1JUHA 4MH0E 1WLTA 1I6XA 2OZ6A 4ZU4A 2XGXA 3R6SA 4LTAA 3KGLA 2ZKLA 4HN1A 4AXOA 1FXZA 2N7GA 3C3VA 4EWDA 3SXWA 3IDBB 2IXHA 2Y0OA 5FQ0A 3IDCB 1O3QA 3H1MA 3H3UA 3WW1A 3PLQA 5KHGA 2PAKA 3RYPA 1J1LA 4I01A 2PAMA 1H1MA 3I59B 4D7SA 4ZU7A 4QM9A 1NXMA 4Z07A 4FBFA 1RUOA 3EJKA 2O1QA 2K0GA 1O5LA 5FLIA 2BGCA 5JSRA 3U11A 2D40A 2XLFA 1Y9QA 4HSJA 4I09A 4PJYA 2F4PA 5I8SA 2ZCWA 2H6BA 2PYTA 2IXCA 2KXLA 3H7YA 3JZVA 3LAGA 3E5QA 1ZZ7A 2MNGA 3CL1A 1NZCA 3BALA 3NSTA 3ES1A 3MPBA 4XFHA 5FQ0B 4J1WA 2MPFA 1EP0A 1O5UA 3E97A 2UY8A 5JR7B 2BNNA 4PIYA 3D82A 1CAWB 1ZZ8A 2Q0AA 3H7JA 4L11A 1O3RA 3L2HA 1YFUA 4MV2A 4JTOA 3NL1A 5I8TA 1OD5A 4X6RB 2XLAA 4GULA 3TNPB 1RUNA 3HQXA 5I8YA 1ZZ9A 3MYXA 4EROA 3CLPA 3DN7A 1UCXA 5T3NA 4YNIA 2EA7A 2ATFA 2MHFA 1RGSA 2GH2A 3EBRA 4IEZA 1CGPA 3SCHA 4IEOA 4AVCA 2PFWA 4UBGA 1J59A 1IPKA 3DL3A 5BXXA 2Q1ZB 3LA7A 2IXKA 4IEPA 4PIXA 3QOPA 4YRDA 3DKWA 2DCTA 3E6CC 5I0TA 1RL3A 1DZRA 4Q0VA 4DINB 1O7FA 5C8WA 4BYYA 3TNQA 1VP6A 3CEWA 5I93A 1PMIA 5BY5A 3D0SA 4KL1A 2UYAA 4BHPA 2QCSB 3ELNA 2IC1A 5BV6A 3EHKA 3HT2A 1DZTA 4AVAA 3BPZA 4IEWA 3FE5A 2CAVA 4AVBA 3OTFA 1ZX5A 1YFYA 1Y3TA 1ZRRA 2XKPA 3FFQA 3QACA 3NKTA 1DGRA 1CAVA 4R52A 1UPIA 3GBFA 1I5ZA 1V70A 1Q43A 5FCCA 1ZVFA 3HIFA 5BUVA 5I0RA 1YHFA 2OZJA 3IBMA 4WZCA 3FHIB 3GYDA 3U0ZA 1OI6A 4HSLA 2EAAA 1EYBA 4YYOA 1SFNA 5LRRA 4O9GA 3BCWA 1QXRA 3USSA 3EQEA 3KGZA 2GC3A 2FQPA 5KHKA 2D93A 4QGMA 1TQ5A 2GC1A 1LKNA 1LR5A 4ONUA 5D1IA 5AVPA 3B02A 3M3IA 3FZ3A 5C6CA 4XFGA 4HBNA 3LOIA 2B5HA 1CAVB 2E9QA 5LRSA 1UIJA 2PQQA 5JSPA 3H1YA 4IEYA 4AQ6A 1ZRFA 4R8HA 4XFCA 3UKTA 4LLOA 4HLTA 1DGWA 2XLGA 4IEXA 4F7ZA 1O4TA 4XFAA 1ZRDA 4ORFA 1YFWA 2CAUA 1YWKA 2HKXA 2PHDA 3OGJA 3S0MA 2D5FA 3OF1A 4K8FA 4QX5A 2Q4SA 2UYBA 2BNOA 3SCGA 3HT1A 1VJ2A 3NJZA 4D7TA 5FDBA 2BNMA 2PHLA 3RZZA 3OD0A 4H7LA 4JVAA 4MGIE 2H6CA 4LULA 4KU7A 1X7NA 1J58A 5EFUA 1FT9A 4F8AA 3WW3A 1XE8A 2B9UA 1HW5A 4XETA 4HVQA 1CX4A 2WC2A 3RNSA 1NE6A 1J3PA 1WGPA 5KHIA 1Q5OA 4JV4A 5E1RA 5EZWA 4XF0A 2HJIA 2FMYA 4MZUA 4MGZE 3FJSA 4OLLA 1GQHA 2GU9A 4KWKA 2O8QA 4HMZA 4PIZA 5KHJA 4MGKE 3H3ZA 1EPZA 3LA2A 2GZWA 4YARA 3M70A 4Q0UA 2WFPA 1H1IA 4XFFA 4EV0A 4Q0QA 3WW4A 4HVRA 5KBFA 1XRUA 3NVCA 2UY9A 5F1RA 1J3QA 3EO6A 3RYKA 4N9HA 4IERA 4RD7A 4LUMA 1ZREA 5BPXA 2GC0A 4UBHA 3S7IA 4P9GA 5FLJA 4IEVA 4XFIA 3FWEA 4WVZA 1ZZ6A 1U12A 3NW4A 2PTMA 4A2UA 3MZHA 3ROUA 4OFGA 2OYZA 5I0UA 4QM8A 3UKVA 4NVPA 3UKNA 5FPXA 3ACLA 1ZZBA 3I7DA 4EWEA 2IXIA 3CO2A 4ZU5A 1EY2A 3D0JA 4FT8A 5J7MA 4HZFA 3FX3A 2QNKA 1Q3EA 2VECA 1RC6A 3H50A 2B8MA 3I54A 1PM7A 2BEOA 5K8SA 4IEQA 2GAUA 4XF3A 2IXJA 2QJVA 5LEKA 1O3SA 5JAXA 4META 4AQ2A 4FAGA 2D5HA 3RYRA 4QGLA 3SMHA 5CU1A 1LB2A 4TLFA 1CAXA 5FLHA 3LWCA 2PA7A 1SQ4A 1VR3A 4E2QA 4O9EA 1QWRA 2Z2SB 1IPJA 4Q0SA 3SCFA 3H1WA 3E6DA 4B29A 2XL9A 3U10A 5JSOA 3ZDSA 3IIAA 3DV8A 3SHRA 3KMHA 4MX3A 5E16A 1QY4A 4N9IA 2GC2A 4I0AA 4FAHA 1X8MA 3BB6A 5J3UA 5LEJA 2V09A 5I91A 3LZZA 4MUVA 1RTVA 4QMAA 4EWAA 4IESA 4IEUA 2K9ZA 2XHKA 1YUDA 3E6BA 3H8UA 2Q30A 4IETA 3E5UA 4QGNA 4UXAA 1GQGA 2IXLA 4XF4A 3E5XA 3WW2A 4YSFA 4Q0PA 3MDPA 2BYVE 4Q29A 3IWZA 2CGPA 4L2NA 1NYWA 4LUKA 2ET7A 4KWJA 4E2SA 2H0VA 4I0BA 3N4MA 3PNAA 4XF1A 1OFNA 2QDRA 2XKOA 3CJXA 4HVOA 3S7EA 5CVRA 1CAXB 4J1XA 3ST7A 3VHRA 4I3PA 2XL7A 1G6NA 4LEJA 4KWLA 4I2OA 2OA2A 4XFBA 1X82A 2I45A 3RPQA 5I0SA 2ETEA 1ZNPA 4CYDA 4XEZA 5FPZA 2EVXA
chains in the Genus database with same CATH superfamily
2F17A 3GF6A 1JH5A 2P3YA 3IAQA 3I3BA 1UIKA 1WCDJ 1LGCA 2ZABA 1CPMA 1BK0A 1CAUA 1N1YA 4AHXA 3MW4A 1GWMA 1LRHA 3PMEA 2FZ1A 5JPNB 2Y38A 3S57A 5JCTA 1VBD2 3NO8A 3ZN6B 2WO7A 4CUCA 2YY1A 3B93A 1RUJ2 2DUOA 2B9VA 1QH6A 2VW1A 2QVSB 2FCTA 2HEYF 2RR13 5T5JA 4XPVA 1NE4A 1A8DA 1KDMA 2CV6A 2LTNA 1WD4A 1QF3A 1ZZCA 4NHXA 4OUSA 1OA4A 2Y6KA 4KBZA 3LSEA 1UU5A 3NNLA 2Z69A 1VBC2 2RMU1 4RQPB 5FYUA 3U37A 3RWNA 3VBSC 4HONA 1VAKA 2WAOA 1K5MB 4BH9A 1LHWA 1VBB3 4NPMA 4S2HA 2RJKA 2V72A 3HEIA 1W8OA 2ARAA 2VZ3A 1NZIA 1PO23 3ES4A 5A80A 1QXJA 1J3RA 1WZXA 2D3PA 1BEV3 2VPVA 2R063 2WQZC 1WBFA 1FNZA 5DDJ1 4AQTA 2VO5A 2GNTA 1PGL1 2HWF1 2HH9A 1WLTA 1CR7A 2DBIA 4Y5SA 2J1EA 2GMPA 2CWSA 1VBA2 3HBKA 3I4IA 5JLVA 3KV6A 3VBUC 1RUH1 2IFRA 2XJVA 3WNKA 5LY1A 4RGGA 1MEC3 4AGGA 4ZU4A 2R1DA 1AR81 3R6SA 3R4UA 4O61A 4CTEA 1N1VA 1BEV1 2ZTNA 3KGLA 2D7FA 1W2OA 4HN1A 5F5IA 5FXWA 3ZYFA 5JMOA 5IVYA 1B35B 1B09A 1VMHA 3VBUA 2VY0A 1AYM1 3ZR5A 4CU7A 3W59A 3IDCB 1EAH2 3ILFA 2VZTA 2VR4A 2B42B 3SITA 4BJ0A 1O3QA 5F39A 2A71A 4N53B 3WW1A 2ZEYA 1VB4A 5KHGA 2TBVA 4I01A 3OGRA 4NWVA 3AFGA 4YGBA 4M01A 5F3GA 3T4VA 2C9AA 2YU2A 1H8VA 1XB9A 1AYM3 2K0GA 3OPTA 5FZ9A 4PHZA 4CDUC 2DU0A 2BGCA 2CDOA 1A3KA 2ZAHA 1C8NA 2VVFA 1XNCA 1F4HA 3V0AA 1JU3A 1Y9QA 5KWRA 4Q4W2 2OUJA 4XJUA 2QQWA 2F4PA 5H9SA 3B00A 5F8PA 3I97A 3CJIC 4TSVA 3ZOIA 2DUQA 2R0HA 3TN91 4JC1A 3H7YA 2BWAA 3WQ7A 3K48A 4IGQA 3CBNA 4B7KA 1ZBE2 1F5JA 1W6MA 2TUNA 3BALA 2DUPA 3NSTA 4RHV3 1I3HA 3ES1A 3HR9A 1PGSA 3MF9A 2HWC2 4QT6A 3Q8BA 1EP0A 5IFPA 1MS3A 5HPOA 5ERLA 3ZFFC 3H8XA 2UY8A 3AP6A 2Y6GA 2DCJA 3IMMA 4PIYA 4QX1A 4CXXA 5IUQA 1CAWB 4YM2A 3DYMA 3LD8A 4DY3A 1ALYA 1SCSA 2X8KA 1ZBA1 5IT6A 1GOFA 5JZGC 1YC61 2QQIA 2JECA 3ACGA 3CZJA 1GUIA 2YMZA 3LKJA 1JZ2A 2ZGNA 5D21A 1D0GA 4GALA 4BXSV 5J37A 5I8YA 1ZZ9A 2XONA 4HPKA 4I0WB 1IS4A 2E53A 3C7EA 1UCXA 3DUIA 5CEHA 3MUZ1 2RS12 3ETPA 4MGSA 1V6NA 1UOBA 5CISA 1WMDA 5LBFA 1F4AA 1O8PA 4AAPA 2VMFA 2MHFA 1HDKA 1RGSA 4NRPA 1AYN1 1PZ7A 3AKQA 4IV3C 2VM9A 3UK9A 1DFQA 4AVCA 4A7KA 5DMYA 4ISRA 1J59A 1OH4A 2NMOA 2VU9A 2NPIA 3UESA 1OF4A 3K4ZA 1WLDA 3FUQA 2BVVA 1S2KA 3WT3A 3QOPA 4BQ4A 4YRDA 1S2EA 3DKWA 3WHTA 4BQ2A 1VAVA 2WBKA 1A78A 3FN9A 3POIA 1O7FA 5C8WA 1AYN3 3A7QA 5C9AC 2DTYA 4NRQA 1D0HA 3AKSA 1DBNA 3AXDA 5C7GA 5F9TA 2J7MA 3LSDA 5EYXA 5FJKA 1LOAA 4RGAA 5CKNA 1AR91 3EYPA 4XJ9A 3TNQA 5C33A 1IG0A 1V6MA 1VP6A 2WT1A 5I93A 1UMHA 3HN3A 3MLKA 4BLIA 4JGYB 2R073 2IC1A 4CA9A 4H7MA 4JGYC 3BPZA 2AH2A 4SBVA 4LLFA 4NHLA 2CAVA 5D8AC 2FCUA 5FMOL 3OTFA 3TYJA 2WZ8A 1ZX5A 2ARBA 1X50A 5A7WB 4Y5Z0 1Y3TA 1C3HA 1S0JA 4YZ5A 1QDOA 2YXSA 4AFMA 1DGRA 3ILNA 4F83A 4K21A 3B7MA 4LKDA 1I5ZA 3J26N 2HWE3 5EJ3A 2QQPA 3WDUA 5B4NA 3QH6A 4NO4A 5DUWA 2OZJA 2JDKA 1HRI2 1ZBA2 1IS6A 3IBMA 1MQTC 3M1HA 5FMDA 4TZDA 1HXS1 3GYDA 5J1XA 1YQ5A 1WD3A 5A6YA 5GLWA 4LO7A 1UYPA 2EAAA 1EYBA 2CU5A 3BOPA 1JHNA 5IK8A 3HNMA 1SFNA 5F37A 5LRRA 4OZOA 5EIYB 4QPIB 3BCWA 5IAVA 4FPFA 2QFEA 1QXRA 3QLQA 4UFMA 3ZFGA 1WLWA 5HCHA 1RXFA 2PLV2 3OUJA 2VMEA 2XBO3 4LO4B 4W4ZA 2FQPA 1OOPB 3JB4C 5JZGA 4YW4A 4HT1T 2D44A 5FZGA 2VQUA 2D93A 1AR73 1BZWA 3THDA 3OY8B 5FOJB 2P3JA 1RUE3 1W0NA 3ENRA 3I2HA 3Q8CA 4P14A 4XMAA 2GC1A 2BBVA 2VQ0A 3B02A 3M3IA 5FP9A 1RJ8A 2E32A 5C6CA 5BNOC 3VZOA 4OULA 1W9TA 3RI9A 1RUD1 1RUJ3 2ZPXA 3IN9A 2DF7A 1W6MB 2W08A 4W50A 4XAEA 5LRSA 3P1IA 5JSPA 3H1YA 1GNZA 1JW6A 4P5HA 1ZRFA 2GNDA 4OI4A 4R8HA 3UKTA 4IV1B 4ZZ5A 2RM21 1PM4A 1UKRA 4XDPA 5IK5A 1DQ0A 3J7LA 3T0AA 2W1WA 5L9BA 1QDCA 3T3YA 1YFWA 5CKQA 3PJYA 5AFEA 4CPBD 4XJ8A 1ND2B 1VBC3 1YWKA 5HXMA 5CG8A 4MHRA 2GSYA 1W06A 3OF1A 4WM8B 2Q4SA 2UYBA 4Y1XA 2Z5WA 3AX4A 3WUCA 2ZMKA 3IDAA 3HT1A 2RM23 1NKGA 1YJLA 4XACA 2P6CA 3IPVA 1BJQA 4AI3A 1REEA 5ANNA 3O1VA 2NZ9A 2ZOEB 1IHMA 4LULA 4P9XA 3KS7A 4R4XA 4U36A 4P9IA 2XQRA 4GKYA 1MEC2 1QOTA 4XYXA 1GP6A 2XVLA 1OBNA 3VBRB 1HN1A 4S2FA 1GP4A 3VBHB 1QQP2 4YZ2A 3WG3A 5IATA 4HVQA 5FZKA 1CX4A 5FPLA 3RNSA 2E31A 2WNEA 2WSUA 4FQZA 3VKNA 4CE8A 4CEWA 1D4M3 3TEYA 4H3WA 2P5BA 4GIQA 5FY7A 4BB3A 1CIYA 4OHVA 4QD2A 1OVPA 2BVBA 2JDZA 1PMJX 3QH7A 3CJIB 5EZWA 1PIV2 4L97A 2WFF1 3MW2A 3UJQA 4MOAA 4Q4Y2 3RMXA 4CDXA 2PLV1 1G8WA 3LFIA 1HX6A 4FO9A 2CHHA 1QNWA 4GMP0 5JIAA 1HB3A 1H6XA 2BGPA 2E51A 4GB31 1O8SA 3ZXKA 4XQDA 2DCKA 5FYYA 1JUIA 4MGKE 3THTA 4E4ZA 3GBWA 3LA2A 5FBZA 1NA1A 3ZO0B 3AVSA 5DDJ3 2XHNA 1ND2A 4AQSA 2V4VA 2XVKA 3PMSA 4FXKB 1DQ5A 4ZY9A 4RGKA 4XFFA 3VBHC 3ZFGC 5F5CA 3GGLA 4EV0A 1U0AA 3O12A 1RUF1 2R7EB 3VD3A 4Q0QA 5CA6A 2NYYA 4Y24A 1EV11 1HRV1 2E33A 1Y7BA 3F95A 4JGZB 2P37A 4AGVA 3DKQA 2D6OX 4DZGA 4HVRA 5KBFA 4N90A 1XRUA 4RFRB 3ZFEA 5F1RA 3WG4A 1RITA 1X9PA 4YM3A 2QZ2A 1H2LA 2JXAA 1DGWX 1YYNA 4N9HA 3W5NA 1XXNA 1CPNA 4TXWA 4LUMA 5FR3A 1R1A2 1AHSA 3DYOA 2QQUA 4Q4V3 4QAWA 4XUOA 2GC0A 3N9QA 2OVUA 4IEVA 5FLJA 4NHKA 1UWWA 1Y4WA 4JHTA 4K8RB 3HNBM 4WM8C 4K1YA 3T0BA 2BPA2 1J84A 2QQJA 5B4XA 4A2UA 3U78A 3VBFA 4A6OA 5FY5A 2OYZA 3UKVA 4HFSA 1TMF1 1YQ8A 5GLUA 2GALA 3ACLA 1ZZBA 3ZIWA 3I7DA 3RJRA 2WKKA 4ZU5A 1EY2A 3D0JA 5LASA 2WIIB 1O4YA 4FT8A 2J1VA 3FX3A 1K3IA 4AEKA 3LGRA 1NCQB 5H9QA 2W9XA 3WP3A 2VXRA 1W6PA 5BNPB 3AB0A 2XJUA 2RS13 3VKMA 1UY2A 2Z4FA 3TN93 4WM7C 5BNPC 2I07B 2OX0A 3JB8A 2W92A 4XF3A 4DFSA 2HEVF 5FYBA 4KG0A 1AL21 3POWA 1MS9A 3UT0A 5LEKA 1JI6A 1GP5A 5FY0A 3D3AA 2X09A 1MS8A 1V6JA 3OBAA 2X5IB 3JBG3 2F4LA 1UZZA 4META 3ZLIA 1ODNA 1SLAA 1UZYA 2P6HA 4Q4Y1 1UY1A 2XVGA 4UF0A 4CCMA 4Z1VA 4YGDA 1SLLA 1XC6A 1FATA 1F2NA 4Y20B 4A42A 1AX2A 4NOTA 4W6YA 4DPNA 5APAA 1VR3A 4FXGB 3AZWA 3POFA 4E2QA 4ZHNA 2GN3A 3EMRA 1SPPA 4ITCA 4B29A 3C8XA 1NLRA 3U10A 2XJQA 5T5LA 5LA9A 4QQOA 3ZDSA 2LALA 3ZMNA 3IIAA 5J98B 5DUUA 5IFTA 2ZHKA 3DV8A 1PX4A 4FFFA 3SHRA 1WW4A 1HJGA 4XDOA 1QY4A 1DQ2A 1LENA 2JG9B 1EV12 1HRV2 2EIDA 3PU8A 1O91A 5FPBA 5T5PA 2X5IA 3N9OA 5FZEA 5DG1A 5LEJA 5IVFA 3RZHA 4FSJA 1LAJA 1YO8A 2E7AA 4Y4RA 1RTVA 1HN0A 4EWAA 2HWF2 3IZOA 4IESA 2YFZA 1LOBA 4FCAA 4HL0A 3WX5A 3N7LA 2K9ZA 3WG1A 5JZGB 4GH4B 1W8FA 4G9SB 1VBA1 1QOSA 1VBE1 5C3PA 4JRAA 5D8AB 2W0XA 1SMVA 3M7AA 4UXAA 4HXCA 1RHI2 4AVSA 1JZ7A 2RS31 3KCXA 4XTPA 4CCNA 4CEWB 4ZKTB 2A73B 4E4HA 2XJTA 3MICA 2VNRA 3IWZA 2CGPA 3OYWA 3R4SA 3T09A 3VKFC 1NYWA 4AFBA 1R091 5H9RA 2BU9A 4OHXA 4QKBA 4XJWA 3KLSA 4GWMA 5HCBA 1PNGA 3PNAA 4JX0A 1XYPA 3B94A 2RS33 1CN1A 4LJHA 4BISA 1HLCA 3VHOA 3WNMA 3S7EA 1K5JA 4ZPIA 5CVRA 4QXBA 4Y5TA 2OQ6A 2ZHLA 1C5IA 4Q4X3 5D8AA 4EE2A 4HG6B 4I3PA 1AL22 2ENRA 1G6NA 1ZBE3 3SQOA 3UNPA 4LEJA 1ZM1A 2OA2A 1RUE2 3GCXA 2I45A 4JGZA 1RVF3 4H55A 1FYUA 2Q8EA 3MIEA 1CONA 3AMMA 1IKQA 2W39A 1UZVA 4XEZA 5GLZA 3J7NA 4LO8A 2DVDA 2BW8A 2ZGMA 3GALA 4INDA 4KU8A 4DQAA 4Z2AA 5C8CC 2PXJA 2VUDA 1AXZA 1G7YA 5DZFA 4ZS3A 5IVVA 4DXZA 1JS9A 1ZBE1 2Q1FA 3O14A 1PVXA 2WN3A 4DUXA 2C0ZA 4AWDA 1QJY2 4OYUA 1OXCA 2C5DA 1OVSA 4B1LA 5KHHA 4X6QB 4GJYA 5H9PA 4M3CE 3DECA 5EJZB 5FAXA 1HXS3 3EXUA 1LECA 4LKFA 5HBAA 5FYMA 3MGUA 3LA3A 3MLJA 4FPJA 3QBQA 4BK5A 3VDCA 2ET1A 1IPSA 1GZWB 1X33A 4E2GA 3LE0A 4GXLA 1JYIA 4SLIA 3H9AA 3VZLA 4QQLA 1L3JA 3ETQA 3I2GA 1XE7A 3ABZA 4DS0A 1ZRCA 2VCCA 1COV3 4FPYA 5AC92 3BGAA 2G19A 3OBZA 4XF9A 2QQVA 5L36A 4AEMA 4A7ZA 2WNUC 1UZWA 4NJ4A 4UW4A 4QDSA 3G7DA 2PHUA 3G6JB 1BHGA 3F2ZA 3FLPA 2AZ5A 1B35A 1KS5A 2DVGA 5FYZA 2JB8A 1PO11 3LB9A 1OD3A 4K40A 1N47A 3WQ1A 1RYYA 4XMIA 1IQAA 3WLUA 4BXFA 4LXLA 1R092 4BIFA 4LBMA 4IW3A 4R9CA 2VQAA 4AFCA 1CAUB 1JUHA 1TEIA 2PHWA 1AYN2 1DG6A 1H4GA 2ZZJA 4DUVA 4CCJA 1P8JA 5HCFA 3VHNA 1I6XA 5K7PA 1XNDA 3D5OA 1SFPA 4CEYC 5KC6A 3GM8A 1DLCA 4CZSA 3VL8A 1RB8G 2DFCA 2VMHA 3C3VA 3AP5A 4UAPA 4EWDA 5C71A 4DUWA 3IDBB 4RR3B 4AVTA 3M4FA 5FQ0A 3PUAA 4KWUA 4B4QA 3UGGA 3AK0A 4LKSA 1YQCA 3H3UA 2PELA 4NIDA 3PU3A 3NQHA 2QQNA 4RQPA 5FK8A 4QB6A 2PAKA 3JUUA 1J1LA 3POEA 1XU1A 2QE3A 3AVRA 3X29B 4P00B 4CDQC 4CCCA 3RZGA 3UJOA 1UQXA 2AREA 2OKXA 4QM9A 4LBJA 2WZEA 1AXKA 1G9AA 3DF0A 3VZJA 3EJKA 1C4RA 2VCBA 3H0OA 5IHRA 5JXGA 1OQDA 5FLIA 1SFYA 4CDQA 4CPBA 2IVIB 3AKTA 2I2SA 2JB4A 3CKHA 4CUBA 5C3RA 4Y33A 5LZ6A 3J7MA 3MIDA 4HSJA 3OOXA 3QCWA 5HXVA 4ES8A 4CU8A 2H6BA 3SH5A 2IXCA 3QD6A 4QX2A 5IAXA 1D4VB 3NNFA 3MFAA 1ZZ7A 2BQPA 2MNGA 3WNPA 1MZ6A 2DURA 3CL1A 4COYA 5FIXA 3T1MA 4Y26A 4XJZA 3K77A 5EYYA 4EN7B 5JOYA 4XFHA 1Q8OA 3NNGA 4OQ9A 1ENXA 4A45A 5C4WB 3T2QA 3NV2A 2V4AA 1O5UA 4YZ3A 4OVEA 2BOJA 1V6OA 3HWJA 2WNUB 3Q8AA 3D82A 1QH7A 1XSQA 2VNOA 3H7JA 3T2TA 4BU2A 3WNXA 1D7PM 1OURA 2F6BA 3NL1A 5I8TA 1QHDA 4Z8BA 5L19A 2XLAA 4L92A 5EXOA 5F2SA 3SISA 2UWCA 1NY72 4FTEA 3TNPB 3AMHA 4UWDA 1DF0A 3GJAA 2GMEA 1GR3A 2QUOA 1UMZA 3P6BA 3MYXA 1LOFC 5DAXA 1F9KA 4EROA 5C9AA 1GZTA 1FOD2 3DN7A 4LOTA 2LM3A 3ZYPA 3IB3A 2AEYA 3C7FA 4LMFA 4UOJA 5C70A 2ORZA 3IAPA 3PURA 5FZ0A 3GHMA 2GN7A 1JMUB 3VKLA 3EBRA 2VG9A 1CZVA 5KXEA 1J83A 4FTBA 3O0XA 3JD73 5LK7B 2RMU3 5DZGA 2XOMA 4QU2A 4BMBA 3POJA 5A6XA 5M0TA 3O1TA 3H8OA 1W6NA 3LIGA 3Q8FA 1BXHA 2E6VA 2E26A 1NCRB 4ASMB 4YGEA 3O1MA 3E6CC 2B46X 3KT4A 5KXBA 2HWE1 5LW9A 1W8ZA 4LHSA 1UU6A 4M0NA 3T4HB 1JYVA 2VJXA 4RR3A 5LATA 1QQP3 2W46A 3ZXGA 4COZA 3C7OA 2HWF3 5EV7A 4BYYA 3GCWA 2WWJA 1JODA 3PTYA 2R30A 4BPZA 1WMFA 1S0GA 3B01A 4JGZC 4M00A 4AOCA 3D0SA 1W8NA 1Y9MA 3KV4A 2OXBA 2A70A 3ELNA 1RHI3 2BZDA 3DGTA 2FDFA 3VD5A 1DZTA 1YQ2A 5IW0A 2WUHA 1QQP1 3R0RA 2VOTA 2FHRA 1OSGA 2HWD3 4GMP3 4NAMA 3ACHA 3V0BA 1K12A 1QOOA 2CY6A 4N43B 4YW7A 1OT5A 3FFQA 1S0BA 3NKTA 4IL7A 5F2WA 5SV5A 4XHBA 1CAVA 1UPIA 3GBFA 4FPOB 2W1SA 1V00A 1ZVFA 2JICA 2PHFA 1R1ZA 3VBUB 1JBCA 1YHFA 5I0RA 5J36A 2C24A 4CDUA 1RUC1 5C5UA 3N7JA 1XQNA 4BE3A 2HWD1 4GMP1 1DCSA 4LNVA 3AP9A 2YC0A 1A8MA 1AL23 1NY71 3I2FA 3U0ZA 1OA3A 1OI6A 2ARXA 3UYJA 1ULFA 2VZPA 4YM1A 3M3CA 1KITA 5FP8A 2DCZA 3V65A 4CRQA 1V9U3 2HLEA 4Q8KA 4QX7A 2WS91 2WL1A 5LCWL 1RVF2 1CZSA 4LQRA 3ZN6A 4AF9A 1HKDA 3HQUA 2P4EA 5E8AA 5LK5A 4ATFA 3USSA 1W8WA 2W68A 2GC3A 2VQTA 2YGLA 3WSOA 3ZXAC 1KD7A 2QTWB 4CXYA 3MV11 2OIIA 4ZS2A 4U2AA 4FPLA 2P2KA 3KF5A 4Q1RA 3WXPA 4PT6A 2PQSA 4CDUB 1TQ5A 3D6EA 2IWGB 4LPLA 5FMOS 3VUOA 1HRI3 1LKNA 4CCDA 1ULDA 2OT7A 3FZ3A 1T6BX 3K3OA 4P9JA 4XFGA 1R1A1 1UF2C 1JOJA 2B5HA 3SH4A 4AW7A 3O7OA 1YIFA 2DBNA 1UIJA 5BNOB 4Y3OA 3IT8A 4AQ6A 4IEYA 4GH4C 2CTVA 2JDNA 1SBFA 4P9YA 3J8F2 2Q8OA 4UT5A 2ZGLA 3KM5A 3WHUA 2CL2A 4IEXA 4XFAA 1ZRDA 1H4HA 5JMCA 4BQ1A 2RDSA 5AC93 1L7QA 1MPXA 2P1BA 3MUY1 1LOCA 4NRMA 4YG3A 3MW3A 4YVWA 3S0MA 3WEZA 1DU3D 2D5FA 4RQPC 4K8FA 3VV1A 4NPRA 2B39A 3HPNA 1RUI1 1LU1A 1W8UA 3IM0A 4QHOA 2CGNA 5FZOA 2EIBA 5ISLA 4COWA 3IIIA 4LO5B 2RV9A 2MEV2 3VN4A 4ARXA 4D7TA 3VBSB 1APNA 2UU8A 2ZJCA 4BOWA 5FDBA 2BNMA 3MO4A 3T08A 2A3YA 2D6LX 1H9WA 2D6KA 3W58A 1YEWA 2ZGRA 1WWYA 1SLTA 4RS5B 3ZXEA 3VD4A 4NHYA 4KU7A 4CU6A 1ASJ1 3N9PA 4LK6A 2WNVC 1UN1A 2XB6C 4WM7B 1J58A 5EFUA 4XW3A 2VOKA 5A32A 2RS53 4N7UA 4XOGA 4V2VA 5FZFA 2BV4A 3UL2A 2D43A 2A6ZA 1HW5A 2YUEA 4XETA 4XVHA 5A7PA 5BNNB 1LHUA 1ENRA 1W6NB 4GWIA 1V6LA 4PDWB 1TE1B 4MSVA 2BGOA 2W3JA 2DU1A 4UW3A 1WKYA 3THPA 3USUB 3DPRB 1ASJ3 2A75A 2A6WA 4MLOA 4CUGA 2ZGTA 1KEXA 3V0AB 5FYIA 3AP4A 4MZUA 1GU3A 1LHVA 1ND3C 4UW5A 4ZXEA 3SH3A 3BIWE 2QDNA 5FO9B 2EAKA 1GQHA 2EIGA 2GU9A 3AZVA 3PIJA 4OZXA 4CP1A 2AEZA 2O8QA 1DQ1A 2YBKA 1W99A 1Z7S3 3CU7A 4UW6A 5T52A 3WNOA 1GZCA 1Y43B 3VDDC 3OBRA 5IK7A 4L8QA 2E63A 3AJYA 3CZUA 5JWPA 1S2BA 3LPFA 4CDWB 1HB4A 1GOHA 4B7EA 5BNNA 1E5HA 1H1IA 1VBE2 4FVVA 4BZ4A 2J1AA 2VTXJ 4KNCA 4A44A 2A3XA 1VBD1 4J6GA 3N35A 4COUA 4YG0A 3ALQA 3J8F1 1W2UA 1D4M2 3ZSKA 1QMJA 2Q1MA 3WW4A 5B2GB 3UGFA 5CFDA 4ARYA 3VBRA 2G9FA 1CQ9A 3PJQA 4BQYA 4BQ3A 4LOSA 3CDZB 4PLOA 3RZLA 5IVEA 1QJX3 1W8HA 1GYKA 4IERA 4RD7A 5DG2A 2WZPP 4LBNA 3W20A 3WP4A 4LHKA 1RUI2 2VW2A 2WNOA 3PUHA 5CNAA 4XFIA 2VTXA 1X9TA 2VMIA 1U12A 2K2SA 2EIEA 3ROUA 3I8TA 1HV0A 2XMLA 4CEYA 4IE4A 4QM8A 4NVPA 2V73A 3BTYA 4LT5A 1LTEA 2GP5A 3VBFC 3BUCA 3O1PA 3ZSEA 2ZGOA 4EWEA 4RHV1 2D3RA 5ABJA 4UI9L 2BBAA 1PGL2 5A7WA 1C8M2 1WW6A 1RC6A 1BKZA 1W6OA 1LEMA 1UPSA 1D2SA 3HAGA 3H50A 1W28A 4JRLA 4YM0A 2VTFA 1JXNA 4FPGA 4JZRA 3M3QA 2O0OA 4URTA 2XWBB 5K8SA 1UX6A 4HANA 3H42B 2IXJA 5A70A 3HQRA 1JYTA 4D7YA 1U5XA 1S0DA 1ACCA 2R062 1XNAA 3LEKA 4YLZA 1QJU3 5JAXA 4FOWA 4AQ2A 1K45A 4CEYB 4FAGA 1UU4A 4IE7A 3VLBB 4CP0A 1EAH1 1OUXA 4EZ4A 3TB0A 2WLPA 1NT0A 4PCRA 2BERA 1CAXA 2CYFA 3KT1A 4PI2A 4N7IA 3WV6A 1PK6A 1S1AA 3JQXA 4O9EA 2Z2SB 1E5RA 1RUH2 4PDWA 4QPGC 4YW2A 4Q0SA 4QWNA 4WV8A 2XL9A 3KHBA 4YWAA 4AAXA 5HCAA 3OPZA 2D6MA 4S2GA 1HQLA 1QJZA 5E88A 1EAH3 1YXWA 1CVNA 1KGYA 5E16A 2FDGA 4I0AA 3GZTB 3B69A 3R05A 5DUXA 4CDWC 1KFUL 1PO12 3MI8A 5FZ6A 1QXPA 3WF1A 5C8CB 2YPDA 2WQ4A 3JBG2 5F3CA 3K4DA 1GMMA 5FREA 3A0NA 3RSJA 1DP0A 4CDWA 3KB5A 5FZCA 1NQDA 1ZA4A 2XHKA 3H8UA 5DUVA 4C0HA 2Q30A 1C1FA 3JD71 5C3QA 2WFF3 4LHLA 4D3WA 2XH6A 2OUHA 4BK4A 2HWC1 1IOAA 3E5XA 4K3UA 1US2A 4YW5A 3MDPA 3WDXA 4DMIA 2JIJA 1GANA 2QQMA 4Q4W1 4QKDA 3FLTA 3PHMA 3WNLA 3VDAA 1EV13 1HRV3 2ZGQA 1X36A 3ZSLA 1OQEA 4BQXA 4E2SA 1H2KA 5HV4A 2VMCA 5L7OB 4K20A 3DPRC 4A3ZA 4RHV2 3SCGA 3RZMA 3GBGA 4I0BA 2BP6A 1UY3A 4YPJA 3FMGA 1NOVA 5F3IA 2HWC3 1OLME 2QDRA 1FV2A 3M2MA 3TEWA 4PF1A 1OFSA 4KMQA 4OHYA 1UOGA 2JG9A 2JG8B 5FBJA 1OUSA 1JZ5A 1CAXB 4J1XA 2R042 5DXDA 1BMV2 2QKDA 3POSA 4HK8A 1T6GC 4X8PA 4YVSC 2VVEA 3ZYGA 3A21A 4W6XA 3FBMA 2Y26A 1AR83 3WQBA 4XFBA 1EUUA 4I2OA 1X82A 3PUIA 1UMIA 1ONAA 1CD3G 3TEXA 1AXYA 3IKWA 1ZNPA 3S30A 3PVNA 2ADDA 1OOPC 4GJZA 4YVSA 2PLV3 2ZHNA 3B5LB 1Q56A 2WO3A 3V64A 3OUIA 1UW8A 3OCPA 4RFT0 3PTRB 2NP0A 3SC7X 4AI1A 1X8EA 2VZQA 2W87A 4I02A 3ZX7A 2OPKA 4JGYA 4HN0A 2XBO1 3GXUA 4WBBA 3MIHA 5IVBA 2YB7A 4QXKA 4IQPA 3RDIA 3RJ2X 1FPN2 1H30A 5FYVA 5DZEA 5HI0A 3VZNA 1WA4A 2OQ7A 2KD7A 3I59A 1YFXA 1H0BA 2YYOA 2A3WA 4CXWA 4IE6A 5FZMA 3JBG1 4AR2A 1FOD3 2EXKA 3N9MA 1O3TA 5F32A 5CADA 2PHXA 3PVOA 4KI5M 1FV3A 4LITA 2FCVA 3WZ1A 3M8LA 1ST8A 4L0PA 4OHWA 5FV3A 3A0KA 2ZS6B 3LIHA 4LA3A 5G04L 1Q8VA 2XXZA 4AK3A 4Y22B 1QJEA 2WINB 3KCCA 4YGCA 1KFXL 4JKKA 1W6QB 1FMD1 2VBPA 1W9FA 3KV5A 1AR63 5FUPA 3LDRA 1U5ZA 4XC9A 3R4DB 4GKXA 4D94A 2IFWA 1E5SA 1RXGA 2W5FA 2X10A 3J4UH 1AL0G 4L99A 2IUWA 2ADEA 2Y6HA 2R1BA 1IQDC 3THCA 5IVCA 5EP9A 4BM8A 3KSCA 5JOZA 2VZ1A 1G86A 2EALA 1FMD3 2OZ6A 2BRTA 3AZXA 4BCUA 3K2OA 3AKPA 3HMYA 4COVA 4LIVA 2XGXA 5DAVA 1LNSA 1A34A 3VBOC 4LBQB 4LTAA 2HWE2 2ZKLA 5A7SA 1AUYA 1I9RA 2LW8A 4AEDA 1FXZA 2N7GA 3RWKX 4AXOA 3VL9A 1V0AA 4NAOA 1UZ0A 2WT2A 3K75B 3K3NA 4C91A 1W6PB 2PHTA 3POGA 5FK7A 3AM2A 3AYEA 1VRH2 1OA2A 3OGGA 3OPWA 4QQPA 3RRDA 1RMU2 2HYKA 4LBQD 1R093 3RYPA 3I59B 5A33A 4D7SA 4ZU7A 1E5IA 4Z07A 5FPVA 1NCQA 2O1QA 4CSWA 4YZ1A 4FPCA 4QPWA 1F8VA 2XBO2 4DEVA 3WP5A 1HV1A 2CGOA 1PGW1 3U11A 5JSRA 2D40A 4MXVA 4RSUA 4P02B 4H14A 4IV3B 3FHQA 4CDXB 5FWJA 3PVEA 2FMDA 4K1ZA 2KXLA 5SV8A 1RUI3 4GQ7A 5FXXA 1MS4A 3LAGA 4DOUA 2X53S 4LBKA 4TN7A 1ULGA 5BNQA 4JAAA 4GWNA 2ZXQA 1BBT2 5FP7A 3AL5A 1ND2C 5KXCA 3OEAA 2GNMA 2GDFA 3L9JT 3TEZA 3OSDA 1H6YA 4J1WA 5FQ0B 2QZ3A 5GLVA 2AGSA 4AYUA 1M4WA 1DYPA 5CZKA 2G1MA 1RVF1 3E97A 4TLGA 4DB5A 3N3HA 5JR7B 3ME2A 3WCSA 2LUWA 2NQYA 2Q0AA 4XQ4A 1W9SA 4L11A 1S55A 1W0PA 4LKEA 4A4AA 1O3RA 4C8DA 3MFCA 1YFUA 4FP3A 2JENA 4LBQA 4MV2A 4PF5A 5FZBA 5LA2A 3V0BB 4ISQA 1RUG2 5A3PA 1W05A 2E7TA 5A7QA 5LBCA 2VC9A 3WF2A 5FXZA 1VB2A 3RZJA 4O65A 3BTZA 3ASIA 1H8TA 1DGLA 2ZA9A 3HQXA 2FD8A 1QJU2 4TTGA 4TWTA 1HIXA 1XBFA 3KZ4C 5GZCA 1LEDA 1QJX1 4Q2FA 5LA1A 1G9DA 2YG0A 2D6NA 5T3NA 1SACA 4FQ4A 4AI9A 1NG0A 4QX0A 1NLQA 1KDKA 2GH2A 3SEEA 1CGPA 4LR4A 3VBOB 4XBQA 3VHPA 1IKPA 4AHZA 4DXRA 1I1EA 1VRH1 2FBEA 3JCIA 1MQTB 5FZIA 1IPKA 1LHNA 1W0OA 3BODA 3DL3A 4HKWA 2Q1ZB 2RR12 1W2NA 2XG3A 3LA7A 4JKMA 4YFZA 3HBZA 1H8TB 3LEMA 4N43A 2J22A 4QB1A 1MZ5A 4Q0VA 1IS5A 3VDDB 1PIV1 2P34A 5IJRA 4BQ5A 5DABA 2A1XA 3L2YA 5ANQA 3S5QA 1UYZA 1VBB2 2A6VA 2HBUA 2EXJA 2YZ4A 3CEWA 1HB2A 4QQHA 2JE7A 1PMIA 2VMDA 2B7YA 4IE5A 5BY5A 2QCSB 4HETA 2WS93 5DDJ2 5A33B 4EYUA 1LESA 1C5HA 5BV6A 3O1UA 4LO6B 3EHKA 4PBOA 3HT2A 4J25A 4AVAA 3WF4A 1VBC1 2RMU2 4IEWA 1ODMA 5C3SA 3FE5A 1PVC3 3WDWA 4AVBA 2XUEA 4E4DX 1ULCA 1Q8QA 3UETA 3ORJA 1PNFA 3QACA 5BNPA 3WDTA 1UNBA 5K0UA 2DWRA 4ASKA 1Y9GA 1JZ8A 3O5SA 1SHWB 1V70A 1Q43A 5FCCA 3PUQA 1W8TA 5IK4A 1JYWA 3HIFA 5FRAA 2YBSA 3T0DA 1D2QA 4GWJA 1PZ9A 1L7RA 5JUVA 5K0UC 4XXPA 3VBSA 4WZCA 1CJDA 3VD7A 4AEJA 5CFCA 1XNKA 3FHIB 2VZRA 3CQOA 1K5MC 3KHCA 5FZAA 3NV1A 1AR82 2EICA 4MVTA 4RL7A 2JG8C 4CCLA 2OW4A 4QPIC 5JXIA 3RFRA 3WG2A 4IUGA 1QJX2 1O3SA 1AYM2 4LORA 1TMF2 5DN2A 3J9SA 3W5MA 3RS6A 4GAZA 2CDPA 2Y34A 3AP7A 3EQEA 1W6QA 3KGZA 3PUSA 4FI9A 1IZ3A 1KJLA 3ACIA 4IV3A 2Q5TA 4UFKA 2X5IC 1VLNA 3ECQA 5F7UA 1LULA 1WCSA 4QGMA 1GWLA 2Y6JA 3TN92 4I30A 4B8EA 4DO0A 1UO9A 4Y1UA 1LR5A 4FOQA 2ZEZA 4QX3A 1DQ4A 3KT7A 1AX0A 1FPN3 2RR11 2WN2A 3KF3A 3K51A 3LOIA 1DLLA 4FOYA 4GB33 4HBNA 4X8NA 3MHZA 2E9QA 2VBDA 1LJ7A 1PX3A 2WZR1 2PQQA 2V5YA 1GZ9A 4RA0A 1C8M3 1A6CA 2W47A 4LLOA 4PQ9A 5A1LA 4W8JA 1V9U2 4HLTA 4MXWB 1DGWA 1WCUA 2XLGA 3HJRA 4QPYA 5EHDA 1G9CA 5E6HA 1OC1A 3BOWA 3ZYBA 4F7ZA 4MG2A 1XNTA 4ORFA 1RJ7A 4OMCA 1RUF3 2G9GA 3LQCA 4WVMA 2CAUA 2HKXA 2PHDA 3WQ0A 4MADA 4CU9A 5LWBA 4R4ZA 2XDVA 2WRAA 3I49A 3NV4A 4Q5OA 1C8M1 2BNOA 1O59A 4XZUG 3ZFGB 4OI2A 3JU9A 1FAYA 1GLHA 1H9PA 1OKOA 1VJ2A 2VZUA 1U5YA 4JCKA 1ULPA 2JEMA 3DPRA 3N7MA 4YZ4A 3ZXLA 5JI9A 3KCYA 1NAEA 4RYDA 1T2XA 2YDEA 3UV9A 3ZSMA 2VAUA 1RUH3 2Y0IA 3N9LA 1UOFA 4EQVA 4CCEA 1HQNA 1MVEA 2V5DA 2WAAA 3WF3A 4W6WA 4JVAA 3OY8A 2H6CA 3WY6A 1COV1 4KGGA 1ENQA 2FDHA 3C7GA 3POYA 1K42A 4OUEA 2JDUA 2JDYA 3U4SA 1HB1A 4F8AA 5GZGA 1Q8PA 2VL4A 2Y6FA 4XXAA 5A6ZA 4BLJA 5A1AA 2VUJA 2ZGKA 1NX9A 2PHRA 2WC2A 4IV1A 5KC5A 3ZFFA 3B3QE 3W21A 1WGPA 5K9YA 4Q8LA 2E7QA 4WZFA 4JV4A 1B35C 3DYPA 1UXZA 2JKXA 3MEPA 5J96B 3N36A 3OGVA 1OPMA 1W2TA 2HJIA 2FMYA 2MEV3 4XF0A 4IV1C 4K6BA 3VDBA 1TZOA 1BVVA 4GD4A 4OLLA 1HQWA 1ULEA 4XDQA 5FZ3A 4KWKA 3FC0A 4LBLA 4MGQA 3OB8A 4CP9A 5A3TA 4HMZA 4PIZA 1KXGA 3ZYIB 1K5MA 1EPZA 2BTVC 1W3XA 1E57A 2GZWA 2HWB3 2VNGA 1DQ6A 2BOIA 3M70A 2R072 2RS52 4D6QA 4KBBA 2XJPA 1WUVA 5GM0A 2GMMA 2ZBJA 5FJHA 2WZR2 1Z0HA 4IGOA 3OBTA 4OCTA 1DHKB 2WNUA 2J1UA 3SLIA 1QGLA 5GZEA 3AYAA 3SKJE 1RUC3 3O0VA 3P5BA 1DYKA 3NVCA 2UY9A 4NN0A 3BYWA 2ZGPA 1NCRA 1J3QA 1W3VA 4EJRA 1PZ8A 2KR2A 3LPGA 3NNJA 1GNHA 4QPGB 1CJPA 5FKBA 4F3JA 4R9DA 1C1LA 5FPUA 4ZZ8A 2WNVB 4XJAA 3RMYA 3RYKA 1YJKA 2JDMA 2ZGUA 5GJ6A 1ULOA 1Z7S2 4A3XA 1HXS2 1ZBA3 1R083 4BIOA 4UBHA 4LE3A 1Z78A 3ZXFA 4P9GA 4NWWA 3FWEA 4WVZA 1N1SA 4QU1A 2VUAA 2R16A 1BMV1 4A41A 2PTMA 5A3WA 1VBE3 1I5PA 3NJXA 4JHZA 4OFGA 4AFDA 3CHXA 4AI2A 5I0UA 5FUNA 3OEBA 3ZFFB 3KQ4B 4FPEA 4WVMB 3AMNA 4BA6A 1COV2 4YVWB 4XUQA 3INAA 2ERFA 1XSRA 3HOBA 1NCQC 5ACA2 4QPGA 2QNKA 2VZSA 5AC91 2VECA 3ZXJA 1LOEA 2WA4A 4XE9A 2NLRA 3VZKA 5FUIA 1AR72 2RE9A 1PM7A 1MZFA 3ZDVA 4CEWC 5CBLA 2GAUA 1TG7A 3S6PA 2QQLA 1H1AA 4OUMA 1BYHA 4FPKA 1ZYBA 2C6SA 1CWPA 3U4XA 4QKFA 1KS4A 1US3A 3RYRA 2O8OA 5FYHA 5GALA 2ZX0A 5CU1A 3SMHA 4TLFA 4E8DA 4NE9A 4Z2WA 4YG6A 1JYXA 3WDYA 4FTSA 4AFAA 4QQ2A 2Y60A 4ASLA 1SG3A 1SQ4A 2SLIA 1QWRA 5IYYA 1IPJA 3SCFA 3H1WA 1MS1A 3USUA 3MIBA 3BTXA 2JJ6A 2R071 5L9RA 2WNVA 4HPKB 4XUNA 2XR4A 3ZN5A 4WVWA 3KMHA 3VD9A 1FMD2 3OJBA 4YW6A 5C4WC 2RM22 3LDBA 4N9IA 5ABJB 3WD5A 4FAHA 2YC4A 3I3EA 2JIGA 1X8MA 2HYXA 1TNRA 4KQ7A 4LK7A 1MZEA 3RVHA 4DXSA 5I91A 1H2NA 4RS5A 4FFHA 5LB6A 1PMHX 2ZEXA 2Q8DA 4QMAA 1MEC1 1GBGA 2QQOA 1EPWA 1NLSA 3D4KA 4AZZA 3ITQA 3E6BA 1YUDA 3ZXDA 1SZBA 5FZDA 5KXDA 5FY4A 1VRH3 3WOGA 3E5UA 2ZKNA 4LIUA 4QGNA 3MLLA 1JZ4A 1RMU3 3N7KA 4XF4A 2WLQA 2RVAA 4YSFA 3M3OA 5F5QA 3WNNA 4UFJA 1GFF2 1TME2 2TNFA 1UKGA 1OLQA 2ET7A 3HN1A 3NRUA 4WVVA 2J1RA 5BNNC 4CCKA 4MXWA 1REFA 2JX9A 3KVBA 2ZEWA 1PO13 4Y22A 3N4MA 2NMNA 2G4IA 1RMU1 3DEMA 3A22A 4XF1A 4YW1A 4MO3M 4NIAA 3T2OA 2XKOA 5FO8B 1WMEA 3NNMA 2W1QA 2VULA 1W90A 1SLCA 1C28A 2UWBA 5BNOA 1AR71 2G9ZA 5JIUA 3VHRA 4GA9A 4Q1PA 1GQPA 1N3QA 4JKLA 5EJ1B 1URXA 5FMCA 3ZMOA 1R64A 3ZPOA 2XL7A 3I2OA 1FOD1 2WFF2 1BBT3 3J7HA 3MIGA 3GJBA 3IDEA 1PVC1 4D6SA 1PGW2 2BFUS 1S0EA 3O0WA 4KWLA 5JXHA 2CWMA 3RPQA 2WYSA 2ZACA 5I0SA 2ETEA 4CYDA 1CX1A 4GB32 4XCAA 2TEPA 2IVJA 1XE0A 1VAMA 3A23A 4DXTA 2P17A 1SEFA 4QHZA 4D0QA 1YLLA 1U5IA 3AMQA 1GWKA 1BBT1 4Y1VA 2DFBA 2AC1A 1GNYA 2DTWA 4QB2A 5FO7B 2ID4A 1F35A 1RUG3 1RUF2 4CDXC 4LA2A 4Q4V2 3PVBB 5CIRA 2PAEA 4Z82A 5T54A 2BFUL 5J48A 5G05L 1W03A 2VXJA 1JZ6A 4QXCA 4TYSA 3UGHA 3CNAA 3DXTA 4MHUA 3LF7A 2UURA 1UD1A 1CAWA 2WABA 4XURA 1TNFA 3BU7A 1VBA3 2JG8A 5A32B 4IE0A 2KM2A 1RUG1 5FY9A 1XYNA 4B4PA 5FZ1A 4XIOA 3I2KA 1ENSA 4JDMA 1VALA 2YC2A 2JD9A 4CP9B 2XQXA 5CFDB 1NXD1 4IGPA 1BVP1 3NMBA 4M3CB 1UXXX 5FKCA 1BLZA 3U07A 4FFGA 2D6PA 5FYCA 4CCOA 5C5TA 3CF6E 1FI2A 4OI0A 1OQ1A 1YI7A 4Y4YA 3TBDA 4PQQA 4M4PA 3AKRA 5FYTA 5A7NA 2WO1A 1DYOA 2GP3A 4MGYE 4QPIA 2CNAA 4DRVA 1OMIA 4JTNA 2VE1A 4XZPA 4MH0E 2ARCA 2R6QA 1AR93 5F5AA 4DEQA 1GICA 1UYYA 3ZYRA 2HWD2 4XILA 1XNBA 4NIHA 4AHWA 4W65A 4PLMA 4NR1A 1WA6X 4WM8A 3WCRA 2VBBA 2YFUA 3ZKUA 3POBA 4OQ8A 4NIGA 3EB7A 4O7XA 3AZYA 2WS92 3GNEA 3GDBA 4URAA 4XHXA 4XABA 4E27A 4M3CA 5FXVA 1STMA 1POQA 1Q8SA 1YI9A 2RJ2A 3AYCA 5EQUA 4C1WA 3BIEA 3SXWA 1AR62 1PVC2 2IXHA 2VNVA 1N1TA 2AR6A 2Y0OA 5EPAA 1VMJA 3H1MA 1SCRA 5T50A 2HWB2 1VBB1 4K9SA 1LHOA 2DDUA 2VVDA 4DY5A 3MBWA 3NJYA 4M0HA 3CIHA 3PLQA 5DAQA 5C8CA 5FZLA 1LOGA 2JD4A 3MIFA 4WM7A 2PAMA 2WA3A 2WZR3 2A7AA 1XOYA 2R32A 3ON7A 1J1TA 1H1MA 1VIWB 4FFIA 1WCQA 3ZSJA 1NXMA 2L9LA 2RG4A 5FP3A 4EN8B 4FBFA 2VOWA 4JQTA 4Q26A 5JVVA 4AL9A 2AENA 1RUOA 5IWFA 3AYDA 1DGRN 1MS0A 1O5LA 2DVFA 2VD7A 3OG2A 4D6RA 3NJVA 4Q4V1 1SLBA 2GNBA 2EXHA 2XLFA 3SKVA 3CJIA 4I09A 3K4AA 1GKBA 3LEIA 4PJYA 4Y1ZA 3AL6A 4B4RA 5I8SA 2ZCWA 3U1XA 1UAIA 1SPPB 5JXJA 2PYTA 1UL9A 1MVQA 4DNYA 3JZVA 1OLMA 1GSLA 3E5QA 2WQ8A 1TMF3 1QIQA 4OMDA 4DIQA 1H8TC 5T5OA 5AVAA 3ZIXA 4L9BA 4EN0A 1NZCA 3AXEA 3J8F3 4QX8A 3MPBA 1L7LA 1RHI1 2W95A 1SLIA 4XUTA 2VUCA 2RS32 4XBLA 3JQWA 1N3PA 1WMXA 2BJSA 2MPFA 4YW3A 3VB9A 4LBOA 1AF9A 1RUD3 3OD4A 4P9WA 1JU4A 2BNNA 4E4SA 5CFDC 4Q4X2 1ZZ8A 4CP2A 2ZAAA 4M4RA 2QQKA 1RUE1 3L2HA 2ZHMA 5LY2A 1ND3B 2X05A 4FP2A 4JTOA 1MQTA 1OD5A 4X6RB 1SDDB 3KQRA 1WBLA 1EUTA 4XQWA 2FDIA 5FY8A 4A6SA 4GULA 4S2DA 4RS5C 4YVSB 3H8RA 4I3GA 5FYSA 4CDQB 5A1FA 3O1RA 4EN6B 1RUNA 3OYWB 2LRPA 4YFWA 2MEV1 2B4KA 2RHPA 5F6KA 1GV9A 2RJLA 3VDDA 2AYHA 2J1SA 3CLPA 5FTTC 2BDRA 1KQRA 4XTMA 1N3OA 2I74A 3I3MA 4K7JA 1QJY3 4B3NA 2A5ZA 4QDRA 1FX5A 1V9U1 5AFBA 3WP6A 3AMPA 5CFCB 1CZTA 4YNIA 2EA7A 2ATFA 1GOGA 1AR61 4R9AA 2JDHA 4BDVB 4ET7A 5JPMB 5L7OC 4IEZA 1DIWA 2VCMA 3SCHA 4IEOA 2FZ2A 5I0DA 2PFWA 1UYXA 3C2UA 4UBGA 4NMIA 2JE9A 1QNYA 2BWCA 5BXXA 5F6LB 4AGRA 1YNAA 1KJRA 1MACA 1W6OB 2IXKA 3M3EA 2YBPA 4IEPA 4PIXA 5L7OA 1QJY1 4AI8A 4P9LA 3TWIA 2DCTA 5A3MA 4QDQA 1BEV2 2PMWB 2EF6A 4AEDB 3KV9A 5I0TA 1RL3A 2YU1A 4E9KA 1DZRA 4DINB 4E8CA 4NROA 5BYNA 1OPOA 1QEXA 1VPHA 2VZOA 3AFKA 3IPVB 3ZPYA 2DVAA 1S0IA 2WR9A 1XYOA 3NAPC 1JOBA 2XPJA 3CMGA 3DCQA 4KL1A 2UYAA 4BHPA 2ZX4A 4Z92B 2ZZQA 3HVDA 3NWKA 1QU0A 1OKQA 3BPSA 5A3UA 3B9IA 3GZAA 3WINE 1OF3A 5JDBA 5JOWA 2LROA 1WW5A 1YFYA 1H2MA 1ZRRA 3I3DA 3ZYJB 4UFLA 2XKPA 2KA3A 3AJZA 4ES9A 4H2AA 3BKZA 2XWJB 4MGTA 2OPWA 4R52A 4N8MA 2ZX2A 4Q4X1 4OHZA 1G9BA 5BUVA 2ZX1A 1CIWA 1NUKA 1JTZX 1W04A 2JDPA 1PO21 2AUYA 1REDA 1YIPA 2P3IA 4UFHA 3ZVXA 1LGNA 3ACFA 3MPPG 1XPWA 1NA1C 2BUKA 2VCAA 3D8CA 3T1LA 2ZMLA 4XCBA 4HSLA 1VMFA 4Q4W3 3ZM8A 1NA1B 4YYOA 3ZFEC 2VGDA 1WCKA 1TVGA 2RS51 3DXUA 3URFA 4O9GA 3FLRA 5IVJA 1G9FA 1M06G 4NPLA 2SBAA 5FZOB 2VZVA 4V2WA 3PIGA 2W52A 1ND3A 2W2IA 5FFOC 5KHKA 1LODA 3LCPA 2XJSA 3PDQA 1UX7A 5DAPA 5FZ4A 3U75A 2C9KA 3W9AA 1BQPA 1AZDA 2JDAA 1RINA 4ONUA 5D1IA 4Q27A 5AVPA 3HNYM 3WF0A 5A7OA 4A7YA 1Z7S1 1CAVB 5T55A 3S5AA 3PL0A 4LE4A 2Z42A 5GZDA 4ATEA 4HOOA 5ACA3 2RS11 4XFCA 3APBA 2R061 4N43C 2Q8CA 1NQJA 4PLNA 3O1OA 3LOBA 3P3PA 2J1TA 1JHJA 1O4TA 5A3NA 2VOVA 1VBD3 4R9BA 4HKLA 2WO2A 1OLRA 4PI0A 3OGJA 1V6IA 2Z79A 4LHNA 4C90A 1LGBA 2JG9C 5DQ0A 5ACA1 4FPHA 4QX5A 1POV1 2ILMA 2ES3A 3C7HA 2ZMNA 3FL7A 2XUMA 4KG8A 1FNYA 5J09A 2WWSA 3GHNA 3NJZA 1POV0 3LEGA 2WSVA 3N9NA 4KH9A 4BMEA 3IMNA 2JE8A 4Q4Y3 4JQRA 1V6KA 2RDNA 2PHLA 3RZZA 3NAPA 5L9VA 1IG3A 3OD0A 1AR92 4H7LA 4MGIE 3I2IA 1POV3 4AVVA 4XAAA 1KRIA 2Y33A 2RDRA 1SDWA 1S0CA 1X7NA 5GZFA 3SEPA 1FT9A 1PO22 3LDKA 3LFMA 1AX1A 4XIKA 5FY1A 3RZKA 3FBYA 3WW3A 1XE8A 5FZHA 3T2PA 2B9UA 1OOPA 3A4UA 5FMBA 2R49A 5CFCC 3JD72 3KWVA 1PK6C 1NE6A 2B45X 2AACA 1J3PA 1IS3A 4PDWC 2H0BA 1GZWA 1UY0A 1Q5OA 2LS6A 3BN6A 2R041 5E1RA 5K0UB 5KHIA 2GH8A 5C3OA 1AJOA 1F5FA 5LBEA 4GZ9A 3K46A 2NN8A 3V56A 4MGZE 1S4CA 2IZWA 3FJSA 2Y64A 2D97A 1W9WA 4PBPA 3TAYA 3BTAA 1HRI1 3KD4A 3T30A 5FZ8A 1R1A3 3O1SA 5KHJA 1QKQA 2ORXA 2HEWF 3H3ZA 1C57A 2ZX3A 2R043 3I2DA 5FP4A 1LOFA 2YPJA 4BWOA 4YARA 1TME3 5E89A 3VBHA 2HBTA 1F31A 4Q0UA 3WR0A 2WFPA 4HKOA 3WDVA 1OH3A 4G4FA 4D8MA 4GH4A 5F3EA 3ATGA 3WUDA 3VGIA 1JYNA 4ZONA 4AHYA 3FUOA 1BK1A 2NM1A 3RQ0A 4CUAA 3FFZA 3EO6A 3AZZA 1TME1 3BI3A 5EWSA 4G3YC 3ZKYA 1JYCA 3Q9OA 5CYYA 3NV3A 3KVAA 4XBNA 5K4LA 1ZREA 1RUD2 5BPXA 3VBOA 4MYEA 4Y20A 1AVBA 1IGOA 1YQ6A 3S7IA 1ZA7A 4IDZA 5L73A 4Y1YA 5C9AB 5FPAA 1FPN1 1ZZ6A 2P3KA 3NW4A 4P5YA 5JR2A 3MZHA 1MR5A 4QKNA 4QHBA 5JI7A 4BQWA 3NKGA 3UKNA 5FPXA 1O6UA 3RI8A 4EN9B 4RR3C 4YVWC 4DRRA 5A3OA 3VKOA 5LA0A 1RUC2 1YRZA 2C26A 2D98A 2IXIA 3CO2A 3ZFEB 1RIRA 1LCLA 5J7MA 4HZFA 1QJFA 1SBDA 1Q3EA 3RG0A 3ZN4A 1VRBA 3B9CA 2B8MA 1WLCA 3I54A 3GZEA 4FOVA 2VOXA 2BEOA 4AE2A 4IEQA 2K46A 2YHJA 5C4WA 1R082 1WW7A 2C1FA 3NAPB 1AJKA 2QJVA 2DCYA 5GKAC 3RGBA 3ZYHA 4D69A 2FDKA 2Y8KA 4RN5A 5CG9A 5DAWA 3TOJA 4QXHA 1PHMA 2D5HA 1HJFA 2RDQA 2W91A 3WVJA 4QGLA 2DVBA 1LB2A 4P08A 1XJAA 2EXIA 1CESA 5FLHA 2XJRA 5CB7A 1W39A 1ZRIA 2DV9A 1UOJA 2PA7A 2YGMA 3LWCA 4V1PA 3I2JA 5FOBB 1JN2P 2J42A 4XUPA 3E6DA 4JDNA 1O4ZA 4UFIA 2YROA 4N53C 5JSOA 4ZXKA 1UY4A 3ZR6A 2R0FA 4MX3A 1DZQA 1MS5A 1RUJ1 3BVCA 4C0BA 2GC2A 2WT0A 4NUBA 4N53A 3BB6A 1F15A 2X29A 5HV0A 1VE0A 2DYCA 5J3UA 2W1UA 1DDLA 2V09A 2D3SA 4IXLA 3LZZA 4UF0B 4NIIA 2ZGSA 4JDOA 4KGQA 4MUVA 3VBFB 2CSGA 3FHAA 4IEUA 1PIV3 3AC0A 1W2AX 5FWEA 5KR7A 2WYFA 3H3LA 4IETA 3ILRA 3P3NA 5LBBA 4HK9A 5TSWA 1W9YA 4OI1A 3MF6A 2O14A 3JXSA 3U14A 1GQGA 2WWUA 4NHMA 2IXLA 2JWPA 2YV8A 3OUHA 3WW2A 4Q0PA 2OS2A 1XU2A 2BYVE 3VBRC 4Q29A 5CAZA 2W94A 2A6XA 3MV01 4B1MA 4L2NA 1PK6B 1ASJ2 4LUKA 2PN5A 2QBXA 2WDBA 4KWJA 2UWAA 5ABJC 2HWB1 3GZUC 2H0VA 4EZHA 5D2AA 3VZMA 5CKMA 2VMGA 1SBEA 1S0FA 1OFNA 2VH9A 4UYBA 5JOXA 2Y6LA 3CJXA 4HVOA 3TRSB 3HD8B 1JZ3A 2FDJA 1NCRC 5A6QA 1QJU1 4AG4A 3ST7A 2A6YA 2JKBA 5A3LA 5GLTA 1R081 4AEDC 1BCXA 5FZ7A 3I3QA 4M3CF 1D4M1 1JOPA 1YCIA 4AI0A 1OHFA 2C4XA 4C1XA 4CVUA 3SNMA 3OGSA 3Q8EA 2WJSA 5FPZA 2EVXA 3E1F1 3BU0A 5DPNA 2VW0A 1LU2A
chains in the Genus database with same CATH topology
3GF6A 1JH5A 1UIKA 1WCDJ 1LGCA 2ZABA 1CPMA 4AHXA 1CAUA 1N1YA 3MW4A 1LRHA 3PMEA 2FZ1A 5JPNB 2Y38A 5JCTA 1VBD2 3NO8A 3ZN6B 2YY1A 3B93A 1RUJ2 2DUOA 1QH6A 2VW1A 2QVSB 2HEYF 2RR13 5T5JA 4XPVA 1NE4A 1A8DA 1KDMA 2CV6A 2LTNA 1WD4A 1QF3A 1ZZCA 4OUSA 1OA4A 3LSEA 1UU5A 2Z69A 1VBC2 2RMU1 4RQPB 3RWNA 3VBSC 1VAKA 1K5MB 4BH9A 1LHWA 1VBB3 4S2HA 2RJKA 1PO23 3ES4A 1QXJA 1J3RA 2D3PA 1BEV3 2VPVA 2R063 2WQZC 1WBFA 1FNZA 5DDJ1 4AQTA 1PGL1 2GNTA 2HWF1 1WLTA 1CR7A 2GMPA 2CWSA 1VBA2 3I4IA 5JLVA 3VBUC 1RUH1 2IFRA 2XJVA 4RGGA 1MEC3 4AGGA 4ZU4A 2R1DA 1AR81 3R6SA 3R4UA 4CTEA 1N1VA 1BEV1 2ZTNA 3KGLA 2D7FA 4HN1A 1B35B 1B09A 3VBUA 2VY0A 1AYM1 3W59A 3IDCB 1EAH2 3ILFA 3SITA 1O3QA 2B42B 2A71A 4N53B 3WW1A 1VB4A 5KHGA 2TBVA 4I01A 4NWVA 3AFGA 4YGBA 4M01A 2C9AA 1H8VA 1AYM3 2K0GA 4CDUC 2DU0A 2BGCA 1A3KA 2ZAHA 1C8NA 2VVFA 1XNCA 3V0AA 1Y9QA 5KWRA 4Q4W2 2OUJA 4XJUA 2F4PA 5H9SA 3B00A 3CJIC 4TSVA 2DUQA 2R0HA 3TN91 4JC1A 3H7YA 2BWAA 3WQ7A 3K48A 4B7KA 1ZBE2 1F5JA 1W6MA 2TUNA 3BALA 2DUPA 3NSTA 4RHV3 1I3HA 3ES1A 3HR9A 1PGSA 3MF9A 2HWC2 4QT6A 1EP0A 1MS3A 3ZFFC 2UY8A 3AP6A 2DCJA 4PIYA 5IUQA 1CAWB 4YM2A 4DY3A 1ALYA 1SCSA 2X8KA 1ZBA1 5IT6A 5JZGC 2JECA 2YMZA 3LKJA 2ZGNA 1D0GA 4GALA 5J37A 5I8YA 1ZZ9A 4HPKA 4I0WB 1IS4A 2E53A 3DUIA 1UCXA 2RS12 1V6NA 1WMDA 2MHFA 1HDKA 1RGSA 1AYN1 1PZ7A 3AKQA 4IV3C 3UK9A 4AVCA 1DFQA 4A7KA 4ISRA 1J59A 2NMOA 2VU9A 2NPIA 1WLDA 3FUQA 2BVVA 1S2KA 3WT3A 3QOPA 4YRDA 3WHTA 3DKWA 1VAVA 1A78A 1O7FA 5C8WA 1AYN3 5C9AC 2DTYA 1D0HA 3AKSA 1DBNA 3AXDA 5F9TA 3LSDA 5EYXA 1LOAA 4RGAA 1AR91 4XJ9A 3TNQA 5C33A 1VP6A 1V6MA 2WT1A 5I93A 3MLKA 4BLIA 4JGYB 2R073 2IC1A 4H7MA 4JGYC 3BPZA 2AH2A 4SBVA 4LLFA 4NHLA 2CAVA 5D8AC 5FMOL 3TYJA 3OTFA 1ZX5A 2ARBA 1X50A 4Y5Z0 1Y3TA 1C3HA 1S0JA 4YZ5A 1QDOA 2YXSA 4AFMA 1DGRA 3ILNA 4F83A 4K21A 3B7MA 1I5ZA 3J26N 2HWE3 5EJ3A 2QQPA 3WDUA 3QH6A 4NO4A 5DUWA 2OZJA 1HRI2 1ZBA2 1IS6A 3IBMA 1MQTC 3M1HA 4TZDA 1HXS1 3GYDA 1WD3A 5GLWA 4LO7A 2EAAA 1EYBA 3BOPA 5IK8A 1JHNA 1SFNA 5LRRA 4QPIB 3BCWA 4FPFA 2QFEA 1QXRA 3QLQA 3ZFGA 1WLWA 2PLV2 2XBO3 4LO4B 2FQPA 1OOPB 3JB4C 5JZGA 4YW4A 4HT1T 2D44A 2D93A 1AR73 1BZWA 5FOJB 3OY8B 2P3JA 1RUE3 3ENRA 4P14A 2BBVA 4XMAA 2GC1A 2VQ0A 3B02A 3M3IA 1RJ8A 5C6CA 5BNOC 3VZOA 4OULA 3RI9A 1RUD1 1RUJ3 2ZPXA 3IN9A 2DF7A 1W6MB 2W08A 5LRSA 5JSPA 3H1YA 1GNZA 1JW6A 4P5HA 1ZRFA 2GNDA 4OI4A 4R8HA 3UKTA 4IV1B 2RM21 1UKRA 5IK5A 1DQ0A 1QDCA 1YFWA 3PJYA 5AFEA 4XJ8A 1ND2B 1VBC3 1YWKA 5CG8A 2GSYA 3OF1A 4WM8B 2Q4SA 2UYBA 4Y1XA 2Z5WA 3AX4A 3WUCA 2ZMKA 3HT1A 2RM23 1YJLA 3IPVA 1BJQA 4AI3A 1REEA 2NZ9A 2ZOEB 1IHMA 4LULA 4P9XA 3KS7A 4R4XA 4U36A 4P9IA 4GKYA 1MEC2 1QOTA 4XYXA 2XVLA 3VBRB 4YZ2A 4S2FA 3VBHB 1QQP2 3WG3A 4HVQA 1CX4A 3RNSA 2WNEA 2WSUA 4FQZA 3VKNA 4CEWA 1D4M3 4H3WA 4GIQA 4OHVA 4QD2A 3QH7A 2BVBA 2JDZA 3CJIB 5EZWA 1PIV2 4L97A 2WFF1 3MW2A 3UJQA 4Q4Y2 3RMXA 4CDXA 2PLV1 1G8WA 1HX6A 4FO9A 1QNWA 4GMP0 5JIAA 2E51A 4GB31 3ZXKA 4XQDA 2DCKA 1JUIA 4MGKE 3THTA 4E4ZA 3GBWA 3LA2A 5FBZA 1NA1A 3ZO0B 5DDJ3 1ND2A 4AQSA 2XVKA 3PMSA 4FXKB 1DQ5A 4XFFA 3VBHC 3ZFGC 4EV0A 1U0AA 3O12A 1RUF1 5CA6A 4Q0QA 2NYYA 4Y24A 1EV11 1HRV1 4JGZB 1Y7BA 2P37A 4AGVA 2D6OX 4DZGA 4HVRA 5KBFA 4N90A 1XRUA 3ZFEA 5F1RA 3WG4A 1RITA 4YM3A 2QZ2A 1H2LA 2JXAA 1DGWX 1YYNA 4N9HA 1XXNA 1CPNA 4LUMA 1R1A2 1AHSA 4Q4V3 2GC0A 2OVUA 4IEVA 5FLJA 4NHKA 4WM8C 2BPA2 4K1YA 4A2UA 3VBFA 2OYZA 3UKVA 4HFSA 1TMF1 5GLUA 2GALA 3ACLA 1ZZBA 3ZIWA 3I7DA 3RJRA 2WKKA 4ZU5A 1EY2A 3D0JA 4AEKA 2WIIB 1O4YA 4FT8A 3FX3A 3LGRA 1NCQB 5H9QA 3WP3A 2VXRA 1W6PA 5BNPB 3AB0A 2XJUA 2RS13 3VKMA 3TN93 4WM7C 5BNPC 2I07B 3JB8A 4XF3A 4DFSA 2HEVF 4KG0A 1AL21 3POWA 1MS9A 5LEKA 1MS8A 1V6JA 2X5IB 3JBG3 4META 1UZZA 1SLAA 1UZYA 4Q4Y1 4Z1VA 2XVGA 4YGDA 1SLLA 1F2NA 1FATA 4Y20B 1AX2A 4NOTA 4W6YA 4DPNA 1VR3A 4FXGB 3AZWA 4E2QA 2GN3A 4ITCA 4B29A 1NLRA 3U10A 2XJQA 5T5LA 3ZMNA 4QQOA 3ZDSA 2LALA 3IIAA 5J98B 5DUUA 2ZHKA 3DV8A 3SHRA 1WW4A 1QY4A 1DQ2A 1LENA 2JG9B 1EV12 1HRV2 1O91A 5T5PA 2X5IA 5DG1A 5LEJA 4FSJA 1YO8A 2E7AA 1RTVA 4EWAA 2HWF2 4IESA 1LOBA 4FCAA 4HL0A 3WX5A 3N7LA 2K9ZA 3WG1A 5JZGB 4GH4B 4G9SB 1VBA1 1QOSA 1VBE1 4JRAA 5D8AB 2W0XA 1SMVA 3M7AA 4UXAA 4AVSA 1RHI2 2RS31 3KCXA 4XTPA 4ZKTB 4CEWB 2A73B 2XJTA 3MICA 2VNRA 3IWZA 2CGPA 3OYWA 3R4SA 3VKFC 1NYWA 4AFBA 1R091 5H9RA 4OHXA 4XJWA 3KLSA 4GWMA 5HCBA 1PNGA 3PNAA 1XYPA 3B94A 2RS33 1CN1A 1HLCA 3VHOA 3S7EA 5CVRA 2ZHLA 1C5IA 4Q4X3 5D8AA 4I3PA 1AL22 2ENRA 1G6NA 1ZBE3 4LEJA 1ZM1A 2OA2A 1RUE2 2I45A 4JGZA 1RVF3 4H55A 1FYUA 3MIEA 1CONA 3AMMA 1IKQA 2W39A 4XEZA 5GLZA 4LO8A 2DVDA 2BW8A 2ZGMA 3GALA 5C8CC 4KU8A 4DQAA 5DZFA 1AXZA 1G7YA 4DXZA 1ZBE1 3O14A 1PVXA 2C0ZA 4AWDA 1QJY2 2C5DA 5KHHA 4X6QB 5H9PA 4M3CE 5HBAA 5FAXA 1HXS3 3EXUA 1LECA 3MGUA 3LA3A 3MLJA 4FPJA 3QBQA 2ET1A 1GZWB 1X33A 4E2GA 4GXLA 1JYIA 4SLIA 3H9AA 3VZLA 4QQLA 1L3JA 3ETQA 1XE7A 4DS0A 1ZRCA 1COV3 4FPYA 5AC92 5L36A 4XF9A 4AEMA 4A7ZA 2WNUC 4UW4A 3G7DA 2PHUA 3G6JB 3FLPA 2AZ5A 1B35A 1KS5A 2DVGA 1PO11 3LB9A 4K40A 1N47A 3WQ1A 4XMIA 1IQAA 3WLUA 1R092 4BIFA 4LBMA 4R9CA 2VQAA 4AFCA 1CAUB 1JUHA 1TEIA 2PHWA 1AYN2 1DG6A 1H4GA 2ZZJA 5HCFA 3VHNA 1I6XA 5K7PA 1XNDA 3D5OA 4CEYC 5KC6A 4CZSA 3VL8A 1RB8G 2DFCA 2VMHA 3C3VA 3AP5A 4EWDA 3IDBB 4RR3B 5FQ0A 3M4FA 4B4QA 3AK0A 3H3UA 2PELA 4RQPA 2PAKA 3JUUA 1J1LA 1XU1A 2QE3A 3X29B 4CDQC 3UJOA 2AREA 4QM9A 4LBJA 1AXKA 1G9AA 3DF0A 3VZJA 3EJKA 1C4RA 3H0OA 1OQDA 5FLIA 1SFYA 4CDQA 3AKTA 2I2SA 3MIDA 4HSJA 3QCWA 5HXVA 4ES8A 2H6BA 3SH5A 2IXCA 3QD6A 1D4VB 3MFAA 1ZZ7A 2BQPA 2MNGA 1MZ6A 2DURA 3CL1A 4COYA 3T1MA 4Y26A 4XJZA 5EYYA 4EN7B 5JOYA 4XFHA 1Q8OA 5C4WB 1ENXA 3NV2A 1O5UA 4YZ3A 4OVEA 1V6OA 3HWJA 2WNUB 3D82A 1QH7A 2VNOA 3H7JA 3T2TA 3WNXA 2F6BA 3NL1A 5I8TA 1QHDA 4Z8BA 5L19A 2XLAA 4L92A 5EXOA 3SISA 2UWCA 1NY72 4FTEA 3TNPB 3AMHA 1DF0A 2GMEA 1GR3A 2QUOA 1UMZA 3MYXA 1LOFC 1F9KA 4EROA 5C9AA 3DN7A 1FOD2 2LM3A 3ZYPA 3GHMA 2GN7A 3VKLA 3EBRA 2VG9A 5KXEA 4FTBA 3O0XA 3JD73 5LK7B 2RMU3 5DZGA 4QU2A 4BMBA 1W6NA 1BXHA 2E6VA 1NCRB 4ASMB 4YGEA 3E6CC 2B46X 3KT4A 5KXBA 2HWE1 1UU6A 4M0NA 4RR3A 1QQP3 3ZXGA 4COZA 2HWF3 5EV7A 4BYYA 3PTYA 2R30A 4BPZA 1WMFA 1S0GA 3B01A 4JGZC 4M00A 3D0SA 2A70A 3ELNA 1RHI3 3DGTA 1DZTA 1QQP1 3R0RA 2FHRA 1OSGA 2HWD3 4GMP3 3V0BA 4N43B 1QOOA 2CY6A 3FFQA 1S0BA 3NKTA 4IL7A 5SV5A 4XHBA 1CAVA 1UPIA 3GBFA 4FPOB 1V00A 1ZVFA 2JICA 2PHFA 1R1ZA 3VBUB 1JBCA 1YHFA 5I0RA 5J36A 4CDUA 1RUC1 3N7JA 1XQNA 4BE3A 2HWD1 4GMP1 4LNVA 3AP9A 2YC0A 1A8MA 1AL23 1NY71 3U0ZA 1OA3A 1OI6A 2ARXA 1I1EA 1ULFA 4YM1A 3M3CA 1KITA 4CRQA 2DCZA 3V65A 4Q8KA 1V9U3 2WS91 2WL1A 1RVF2 3ZN6A 4AF9A 1HKDA 5E8AA 5LK5A 4ATFA 3USSA 2W68A 3ZXAC 2GC3A 2YGLA 1KD7A 2OIIA 4U2AA 4FPLA 2P2KA 4Q1RA 3WXPA 1LU2A 4CDUB 1TQ5A 3D6EA 2IWGB 5FMOS 3VUOA 1HRI3 1LKNA 1ULDA 3FZ3A 4P9JA 4XFGA 1R1A1 1UF2C 1JOJA 2B5HA 3SH4A 4AW7A 3O7OA 1YIFA 1UIJA 5BNOB 3IT8A 4AQ6A 4IEYA 4GH4C 2CTVA 1SBFA 4P9YA 3J8F2 2Q8OA 3WHUA 2ZGLA 3KM5A 2CL2A 4IEXA 4XFAA 1ZRDA 1H4HA 5JMCA 4BQ1A 5AC93 1LOCA 4YG3A 3MW3A 4YVWA 3S0MA 1DU3D 2D5FA 4RQPC 4K8FA 3VV1A 4NPRA 2B39A 1RUI1 1LU1A 3IM0A 2CGNA 4COWA 4LO5B 3VN4A 2MEV2 4D7TA 5FDBA 3VBSB 1APNA 2UU8A 2ZJCA 4BOWA 2BNMA 2A3YA 2D6LX 1H9WA 2D6KA 3W58A 2ZGRA 1SLTA 4RS5B 3ZXEA 4KU7A 1ASJ1 2WNVC 1UN1A 2XB6C 4WM7B 1J58A 5EFUA 4XW3A 2VOKA 5A32A 2RS53 4N7UA 4XOGA 3UL2A 2D43A 2A6ZA 1HW5A 2YUEA 4XETA 5BNNB 1LHUA 1ENRA 1W6NB 1V6LA 4PDWB 1TE1B 4MSVA 2DU1A 4UW3A 3THPA 3USUB 3DPRB 1ASJ3 2A75A 2A6WA 4MLOA 2ZGTA 3V0AB 3AP4A 4MZUA 1LHVA 1ND3C 4UW5A 3SH3A 3BIWE 2QDNA 5FO9B 2EAKA 1GQHA 2EIGA 2GU9A 3AZVA 4OZXA 4CP1A 2O8QA 1DQ1A 1Z7S3 3CU7A 4UW6A 5T52A 1GZCA 1Y43B 3VDDC 3OBRA 5IK7A 4L8QA 2E63A 3AJYA 5JWPA 1S2BA 4CDWB 4B7EA 5BNNA 1H1IA 1VBE2 4FVVA 4BZ4A 4KNCA 2A3XA 1VBD1 4J6GA 3N35A 4COUA 4YG0A 3ALQA 3J8F1 1W2UA 1D4M2 3ZSKA 1QMJA 2Q1MA 3WW4A 5B2GB 5CFDA 3VBRA 2G9FA 1CQ9A 3PJQA 4PLOA 1QJX3 1GYKA 4IERA 4RD7A 5DG2A 2WZPP 4LBNA 3WP4A 4LHKA 1RUI2 2VW2A 5CNAA 4XFIA 2VMIA 1U12A 2K2SA 3ROUA 3I8TA 1HV0A 4CEYA 4LT5A 4QM8A 4NVPA 2V73A 1LTEA 3VBFC 3ZSEA 2ZGOA 4EWEA 4RHV1 2D3RA 5ABJA 1PGL2 1C8M2 1WW6A 1RC6A 1BKZA 1W6OA 1LEMA 1UPSA 1D2SA 3HAGA 3H50A 4JRLA 4YM0A 4FPGA 1JXNA 3M3QA 2O0OA 4URTA 2XWBB 5K8SA 1UX6A 4HANA 2IXJA 4D7YA 1U5XA 1S0DA 2R062 5JAXA 1O3SA 4YLZA 1QJU3 4FOWA 4AQ2A 4CEYB 4FAGA 1UU4A 3VLBB 4CP0A 1EAH1 3TB0A 2WLPA 4PCRA 1CAXA 2CYFA 3KT1A 4N7IA 3WV6A 1PK6A 1S1AA 3JQXA 4O9EA 2Z2SB 4QPGC 1RUH2 4PDWA 4YW2A 4Q0SA 4WV8A 2XL9A 5HCAA 3OPZA 2D6MA 4S2GA 1HQLA 1QJZA 5E88A 1EAH3 1YXWA 1CVNA 5E16A 4I0AA 3GZTB 3B69A 3R05A 5DUXA 4CDWC 1KFUL 1PO12 3MI8A 1QXPA 5C8CB 2WQ4A 3JBG2 5FREA 3A0NA 3RSJA 4CDWA 3KB5A 1NQDA 1ZA4A 2XHKA 3H8UA 5DUVA 4C0HA 2Q30A 1C1FA 3JD71 2WFF3 4LHLA 4D3WA 2XH6A 2OUHA 2HWC1 1IOAA 3E5XA 4K3UA 4YW5A 3MDPA 3WDXA 4DMIA 1GANA 4Q4W1 3FLTA 3PHMA 1EV13 1HRV3 2ZGQA 1X36A 3ZSLA 1OQEA 5L7OB 4E2SA 1H2KA 4K20A 3DPRC 4RHV2 3GBGA 4I0BA 3FMGA 1NOVA 2HWC3 2QDRA 3M2MA 1FV2A 1OFSA 4OHYA 2JG9A 2JG8B 1CAXB 4J1XA 2R042 5DXDA 1BMV2 2QKDA 3POSA 4HK8A 1T6GC 4X8PA 4YVSC 2VVEA 3ZYGA 4W6XA 3FBMA 2Y26A 1AR83 4I2OA 4XFBA 1X82A 1ONAA 1CD3G 1AXYA 3IKWA 1ZNPA 3S30A 3PVNA 1OOPC 4YVSA 2ZHNA 3B5LB 1Q56A 3V64A 1UW8A 3OCPA 4RFT0 2NP0A 4AI1A 1X8EA 4I02A 3ZX7A 2OPKA 4JGYA 4HN0A 2XBO1 4WBBA 3MIHA 4QXKA 4IQPA 3RDIA 3RJ2X 1FPN2 1H30A 5DZEA 5HI0A 3VZNA 1WA4A 3I59A 1YFXA 1H0BA 2YYOA 2A3WA 3JBG1 1O3TA 1FOD3 2EXKA 5CADA 2PHXA 3PVOA 1FV3A 3WZ1A 3M8LA 4OHWA 3A0KA 2ZS6B 4LA3A 1Q8VA 4AK3A 4Y22B 2WINB 3KCCA 4YGCA 1KFXL 1W6QB 1FMD1 1AR63 1U5ZA 3R4DB 4GKXA 4D94A 2IFWA 3J4UH 1AL0G 4L99A 2R1BA 4BM8A 3KSCA 5JOZA 1G86A 2EALA 1FMD3 2OZ6A 3AZXA 4BCUA 3AKPA 3HMYA 4COVA 2XGXA 3VBOC 4LBQB 4LTAA 2HWE2 2ZKLA 1AUYA 1I9RA 4AXOA 4AEDA 1FXZA 2N7GA 3VL9A 2WT2A 4C91A 1W6PB 2PHTA 3AM2A 3AYEA 1VRH2 1OA2A 3OGGA 4QQPA 3RRDA 1RMU2 2HYKA 4LBQD 1R093 3RYPA 3I59B 5A33A 4D7SA 4ZU7A 4Z07A 1NCQA 2O1QA 4YZ1A 4FPCA 1F8VA 2XBO2 3WP5A 1HV1A 2CGOA 1PGW1 3U11A 5JSRA 2D40A 4MXVA 4RSUA 4H14A 4IV3B 4CDXB 3PVEA 2FMDA 4K1ZA 2KXLA 5SV8A 1RUI3 4GQ7A 1MS4A 3LAGA 4DOUA 2X53S 4LBKA 1ULGA 5BNQA 4JAAA 4GWNA 1BBT2 1ND2C 5KXCA 2GNMA 2GDFA 3L9JT 5FQ0B 4J1WA 2QZ3A 5GLVA 2AGSA 4AYUA 1M4WA 1DYPA 1RVF1 3E97A 4DB5A 3N3HA 5JR7B 3ME2A 3WCSA 2LUWA 2NQYA 2Q0AA 4XQ4A 4L11A 1S55A 1W0PA 1O3RA 3MFCA 1YFUA 4FP3A 2JENA 4LBQA