3DL3A

Crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
RIPKNWTIQRSTPFFTKDNVPEALLTHHNTAVDVFGQICVMEGVVTYYGFANSEATEPEIKVVINAGQFATSPPQYWHRIELSDDAQFNINFWSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the tellurite resistance protein TehB. Northeast Structural Genomics Consortium target VfR98.
rcsb
source organism Vibrio fischeri es114
molecule tags Structural genomics, unknown function
molecule keywords Tellurite resistance protein B
total genus 15
structure length 96
sequence length 96
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dl3A00
4OLLA 5C8WA 3EO6A 4FT8A 1QWRA 4ORFA 4PIZA 1LKNA 3OD0A 3NW4A 1EY2A 3I59A 5CVRA 3MDPA 5JR7B 1L3JA 2VQAA 3H7YA 4HBNA 3H1WA 3ELNA 3CF6E 3E5UA 1NYWA 2OZ6A 4MH0E 1VP6A 1UW8A 3LA2A 3HT1A 4HSJA 2BGCA 5I93A 4Q0SA 2XLGA 2B5HA 2O8QA 3QOPA 3LAGA 1J1LA 1DGWA 1O3SA 3FHIB 2Z69A 3ROUA 5BV6A 2PHDA 4HSLA 4L2NA 1ZRRA 4KL1A 1YWKA 4XFGA 1Q43A 2GH2A 3H3ZA 2D40A 1RUNA 4JTNA 1PM7A 2XKPA 4I09A 4R52A 4AVBA 1ZVFA 4XF3A 4BIFA 3DKWA 4XF0A 4A2UA 2D5HA 4O9GA 3WW1A 5E1RA 4YSFA 2PQQA 4D7SA 2QVSB 3I7DA 3RYRA 3BPZA 5C6CA 1ZNPA 2GAUA 2BNMA 1LRHA 1ZZ6A 4AQ6A 4IEXA 3UKNA 4FAHA 3EHKA 5JSPA 5BPXA 3S7EA 5LRSA 4H7LA 2D5FA 3R6SA 4YYOA 4MGYE 3RPQA 1J3PA 4HVRA 5KHKA 2IC1A 4JV4A 5I91A 4QGLA 4O9EA 4XFAA 4UBGA 3FWEA 4XFBA 3IBMA 3IDCB 2PAKA 1YFYA 2Q0AA 1ZZBA 2BYVE 1QY4A 4IEVA 4AQ2A 1O4TA 3BB6A 4LTAA 3O14A 5LEKA 3GYDA 1V70A 2PTMA 5I8YA 3PNAA 3LOIA 1RC6A 1IPJA 1NZCA 1YFXA 2VPVA 1UD1A 3OF1A 4LUMA 4KU8A 4Q29A 1QXRA 1Y3TA 5FQ0A 1CAWB 4IEUA 1J59A 1FXZA 5D1IA 1ZZ7A 2PHLA 5I8SA 3LA7A 2GU9A 2WC2A 3SCHA 2GC3A 3DN7A 1ZREA 3CEWA 1H1MA 3D0SA 1PMIA 2OZJA 4Q0VA 1CAVB 2IXHA 3LWCA 3NL1A 4KWLA 1DZTA 2XKOA 4XF9A 4DINB 3B02A 4WZCA 2IXCA 4IESA 3IWZA 2DCTA 3D0JA 4ONUA 3M70A 3KGZA 3IIAA 1EPZA 5JAXA 4Z07A 4I2OA 2EA7A 1Q5OA 4AVAA 4QMAA 2EVXA 5FLJA 3CLPA 1VR3A 4LEJA 1FI2A 5J48A 4IETA 4LA2A 2H6BA 4RD7A 4KWJA 3MYXA 2QNKA 1ZRFA 4J1WA 4HLTA 2ZCWA 2QCSB 2GZWA 4EROA 3DV8A 4IEZA 1UIJA 3BU7A 1XE8A 1H1IA 1EYBA 1X7NA 1ZZ8A 3H3UA 3CO2A 5FLHA 4J1XA 1FT9A 3RYKA 3SHRA 2UY8A 2EAAA 1HW5A 4ZU4A 1OD5A 4Q0UA 3NSTA 1NXMA 3OGJA 4AVCA 3ST7A 3HIFA 3ACLA 3E5QA 5AVPA 2Q1ZB 1YLLA 2Y0OA 4GULA 1SEFA 4META 3RNSA 4D7TA 2UYBA 1O5UA 3NVCA 4FBFA 5FDBA 1RUOA 2OYZA 2ZKLA 2IXJA 3FFQA 4K8FA 1J58A 2O1QA 3CJXA 3EQEA 5EFUA 1O3QA 4IERA 1GQGA 1CGPA 2IXIA 4PIYA 4XF1A 4N9HA 4MX3A 4Q0QA 2IXLA 3FE5A 3D82A 1I6XA 3WW2A 4E2QA 3GBFA 2PAMA 1OI6A 3UKVA 3OTFA 4Z82A 1DGRA 2XGXA 1XE7A 1QXJA 1TQ5A 5EZWA 2CAUA 3LA3A 3RZZA 3DL3A 4MGKE 1LB2A 3E5XA 4QM9A 4LUKA 3IDBB 4KU7A 1EP0A 1O3TA 4IEYA 3H50A 1O5LA 4I0BA 2H0VA 2H6CA 1I5ZA 4HZFA 3WW4A 4E2SA 1RTVA 1Q3EA 3NJZA 3JZVA 1JUHA 1LR5A 4LULA 4QGNA 4ZU5A 5I0UA 2BEOA 3WW3A 4IEOA 1X8MA 3MPBA 2FQPA 2HJIA 3H9AA 4BHPA 3E6DA 3PLQA 3ES4A 2QJVA 4BYYA 2XLFA 4AXOA 3ETQA 4IEQA 2E9QA 4L11A 2Q30A 4HMZA 4YRDA 5K8SA 3U11A 2D93A 2Q4SA 5KBFA 4EV0A 5LRRA 4P9GA 2OA2A 2ATFA 2I45A 5CADA 2ET1A 3QACA 2GC0A 4JTOA 3S0MA 4Q0PA 5FCCA 3N4MA 2V09A 2N7GA 5CU1A 1YHFA 1OFNA 5KHJA 1WLTA 4WBBA 2P17A 2OPKA 4HN0A 3BCWA 3SCGA 4XFFA 3TNQA 4E2GA 3VHRA 1ZZ9A 1ZX5A 4MGIE 2PAEA 3C3VA 4KWKA 4MZUA 4EWAA 4I3PA 3SXWA 4EWDA 1CAWA 2WFPA 4UXAA 3MZHA 1NE6A 4B29A 2ETEA 1GQHA 3H8UA 5FPXA 5BUVA 1SQ4A 2UY9A 1ZRCA 2Z2SB 3PVBB 3G7DA 2C0ZA 5I8TA 4MUVA 1DZRA 4I0AA 1U12A 4CYDA 4HVQA 3U0ZA 4XEZA 2CAVA 3BALA 3H1MA 2HKXA 2BNOA 4HVOA 4XFCA 3FZ3A 1OMIA 4UBHA 3KMHA 3SCFA 1O7FA 2CV6A 4XFHA 4QX5A 5KHHA 4OFGA 3RYPA 1SFNA 4EWEA 4F8AA 4PJYA 4X6RB 2XLAA 3FJSA 3U10A 3UKTA 5J3UA 3H7JA 4R8HA 1X8EA 2F4PA 2GC2A 2XL7A 3RDIA 5FPZA 3KSCA 1YFUA 2VECA 3CL1A 4I02A 5LEJA 1WGPA 4MGZE 1CAUB 3FX3A 5I0RA 3NKTA 4N9IA 3I54A 1RL3A 4F7ZA 2FMYA 3ES1A 1RGSA 3TNPB 2IXKA 5FLIA 1CAXA 4XETA 3KCCA 2UYAA 4LLOA 2PFWA 2BNNA 2MPFA 4MV2A 5JSRA 3OCPA 4NVPA 4QXKA 3HQXA 1J3RA 1VJ2A 1UIKA 1UCXA 4X6QB 3EJKA 1CX4A 2B8MA 4FAGA 3S7IA 2PYTA 4TLFA 2CGPA 5KHIA 1Y9QA 2MHFA 2PA7A 1CAVA 1ZZCA 3EBRA 4PIXA 2MNGA 4ZU7A 3E97A 5J7MA 5T3NA 5FQ0B 3E6BA 4JVAA 1IPKA 5KHGA 1WA4A 1YUDA 1UPIA 4YARA 2QDRA 1G6NA 4LA3A 2K9ZA 4WVZA 2XL9A 3H1YA 1CAUA 2B9UA 3KGLA 5I0SA 5JCTA 4QM8A 3L2HA 3I59B 5JSOA 5BY5A 5I0TA 1J3QA 1ZRDA 3LZZA 3M3IA 3HT2A 4BH9A 5HI0A 1CAXB 2XHKA 1XRUA 2KXLA 4HN1A 3SMHA 2GC1A 2K0GA 5BXXA 1NE4A 4XF4A 5E16A 5F1RA 2ET7A 4IEWA 3E6CC 3ZDSA 4XFIA 1O3RA 1X82A 3USSA 4I01A 1YFWA 4QGMA 4YNIA 4IEPA
chains in the Genus database with same CATH superfamily
5APAA 3B00A 1CONA 5C8WA 4GJYA 2BVBA 4KG0A 3KQ4B 3RSJA 4JGYC 4ORFA 4LBQB 4WM7A 1GV9A 1IHMA 2HWF2 3WUDA 2YROA 2OS2A 1BCXA 2AENA 3OD0A 4OHXA 4P9JA 1RMU2 5LA2A 1W0PA 2D43A 4CCMA 4OI0A 4G4FA 4XXPA 1Q8PA 1RUG2 1Z7S1 3H7YA 1H2MA 2HWF1 4YW3A 2HWC3 2ZX0A 4NIDA 1WMDA 3ELNA 2ENRA 3CF6E 1V6IA 1GWKA 5FFOC 1GNYA 1K42A 1FMD2 1UW8A 4Y5SA 2GP3A 2BOIA 1PGW2 4OUSA 4NPMA 4YZ4A 4D7YA 1JW6A 2OUJA 2WNUB 5LASA 5I93A 2ZX2A 1AYM2 5HPOA 4L0PA 4Q26A 2RJ2A 3ROUA 5A32A 4IE6A 4LBJA 5FZ4A 2WL1A 1ZRRA 2HWD2 4E27A 4XCBA 1YQ6A 5FY4A 4LBLA 1OOPB 2VU9A 4JTNA 3VN4A 1K3IA 1OA4A 3O0VA 5KXEA 4MO3M 4MGSA 1BHGA 1FOD1 3DPRA 2AR6A 1RUF3 4HK9A 2D5HA 1HN0A 4S2DA 1IPSA 1W6OA 1W6MA 4LKEA 2PQQA 4ARXA 1SLCA 4Q4Y1 2WLQA 3T3YA 3OUJA 1SACA 2R063 5IVYA 2D3RA 2PHRA 3BPZA 1ZNPA 5JI7A 1ZZ6A 3M3QA 1KS5A 4LJHA 2WAOA 4JX0A 4AQ6A 4FAHA 5JSPA 1HV0A 4YPJA 4Y1YA 3WSOA 4H7LA 5DAXA 1GZWB 4RSUA 4B3NA 2X10A 1EV13 1HRI1 4QHOA 4CCDA 3OB8A 4Z8BA 3C7EA 3GZTB 2VQ0A 2QE3A 4P14A 1A34A 1J3PA 4HVRA 2KR2A 1W28A 2RJKA 3FC0A 4H2AA 3VDDB 3ZN4A 5AVAA 5L9VA 3OGSA 3MIDA 5KHKA 5DZEA 3VBRA 1YEWA 2XBO3 5DUWA 4S2GA 2Q8DA 1EAH3 5DDJ3 1WUVA 2TEPA 4YFWA 4TXWA 5F8PA 1ASJ3 1CPMA 5FRAA 4NHKA 1UAIA 3NAPC 4I3GA 4Q4W2 1OBNA 5LW9A 4YGBA 3ZYHA 2X53S 3WCRA 5F37A 3TN93 5IK8A 2KM2A 2PAKA 3LDBA 1JHJA 4CCLA 1F5FA 2Q0AA 2F17A 3KV9A 1JZ3A 3GM8A 1HXS2 2WYSA 4QX2A 1UZVA 3ZXGA 2OUHA 4J25A 1W2AX 1XSQA 2LRPA 2C9AA 1V70A 1FOD2 3ETPA 4YW1A 1IS4A 5LA0A 3VKOA 3D6EA 2P3KA 3LOIA 2ZMLA 4WVMA 1RC6A 1NZCA 1YFXA 5IWFA 2VPVA 1PIV1 3N7LA 4KU8A 2G1MA 3P3PA 2JEMA 1DP0A 1Q8VA 3B9CA 3MLKA 3LA7A 4RS5A 2GU9A 5C9AB 4YZ5A 3UGFA 1W8ZA 2GC3A 2XQXA 2HYKA 1RUJ3 4EE2A 3M3EA 1PMIA 2OZJA 4Z1VA 2WNEA 1JU3A 3ZXEA 2IXHA 2GP5A 2RS51 4XJAA 1V9U3 3NL1A 2R0FA 3MUZ1 2XKOA 3DXTA 3PUHA 3B02A 5FXVA 4JGZA 2IXCA 5A1LA 1PZ9A 4Q1PA 3D0JA 1S1AA 3ZSJA 2C26A 3KGZA 2E51A 4TSVA 3RFRA 1GBGA 2JJ6A 3L2YA 3S5AA 2G9ZA 4OMDA 3T0AA 2JG8C 1F4HA 1VBB1 5A1FA 4LR4A 1WA6X 4QMAA 4AQSA 1VBD3 2L9LA 1ULOA 2VBBA 4HPKB 2AACA 4M3CA 5FIXA 2H6BA 2CYFA 1O91A 5A3UA 3O1OA 1LEMA 4XCAA 4HT1T 3WNKA 1DHKB 1OPOA 3ZXKA 4MVTA 2X8KA 1R081 2QQVA 4RS5C 4J1WA 5FXWA 3KD4A 3ZXFA 4EROA 3THPA 5A3PA 1H4GA 3JQXA 4AGGA 1GU3A 1UIJA 1BK0A 1XE8A 3LKJA 3VBHB 1AL0G 1GZWA 1UN1A 1EYBA 3HPNA 1AX2A 1AHSA 2EIDA 1OF3A 3PTRB 4ZHNA 5BNOA 4GKXA 4AFDA 2MEV1 1W8UA 2ARXA 4Q4Y2 1NXMA 2A6YA 2YGLA 5EYXA 4CEYC 3A0KA 4FOVA 1JOJA 2VNVA 3E5QA 5AVPA 4ITCA 4NHXA 1H8TB 1MQTC 5IAVA 4GULA 1C4RA 3RNSA 1E5HA 2UYBA 2WNVA 5FDBA 3MFCA 3N7MA 4K1ZA 4XTPA 5GKAC 1AR73 1RUOA 2P34A 1TVGA 2OYZA 1ZRIA 2RS52 4K8FA 2ZBJA 4QB6A 3WINE 4UFLA 5CFDC 5KC6A 2I07B 5T52A 4KNCA 3JD72 1J83A 1Q8QA 2QBXA 3FLRA 3VD4A 1W6PA 1RHI2 3ZKYA 4OI4A 3UK9A 5FY1A 4AHYA 5JIAA 4MX3A 2DBNA 1GMMA 5DZFA 5JXHA 4MXVA 3H8XA 2Y6HA 1PX4A 2IXLA 1GZ9A 3FE5A 1VBB2 1I6XA 2HWB3 3D82A 1I3HA 5FJHA 3RZMA 1HLCA 4RQPA 3NWKA 1RUE2 2RV9A 3ACHA 3H8OA 3KT4A 4ISQA 5JVVA 4XUOA 2VZVA 5DABA 1YCIA 2WNUA 3BIWE 1DCSA 1LU1A 4D6QA 5A6XA 2PAMA 4O7XA 4Y22B 1OKQA 3TEXA 2GNMA 2ID4A 1DGRA 4RFT0 3DUIA 3W5NA 4GWMA 4IV3C 3I2DA 1ULCA 1TQ5A 4LK7A 3HN3A 1GANA 2CAUA 1Z7S2 1JUIA 1RUG1 5EZWA 3KF3A 4R9CA 1XXNA 3VDAA 3WG3A 2BRTA 5BNQA 5CFCC 4FTEA 4F83A 2JD4A 3RZZA 1J84A 2QZ2A 5FY5A 3ZSKA 1UYYA 2HEYF 3DL3A 3I97A 2UWBA 5FZ8A 5FZAA 3E5XA 4OI1A 3WNMA 1VRH3 1EP0A 2XMLA 4IEYA 2HWC1 4UFIA 5F39A 4DEVA 4I0BA 1LECA 2H6CA 4OHZA 3VBSA 4JAAA 5FKCA 3WW4A 4E2SA 1RB8G 2Y8KA 1VMHA 3KM5A 4QDQA 5JOXA 2DWRA 2BJSA 4FPHA 4WZFA 4NIIA 3SH5A 3I2GA 2JECA 2PLV3 2VM9A 1JUHA 3T2PA 3ON7A 4LIVA 3BGAA 1LR5A 4PI2A 4QGNA 4E8CA 1WMFA 3AYDA 4NPLA 4FTSA 1SDDB 4YZ3A 1N3PA 1X8MA 4M3CB 2ZMNA 2FDKA 2WO2A 2Y64A 2QJVA 5FZ9A 3VKNA 4YZ1A 4CP9A 1FX5A 3PJYA 1MVEA 5SV8A 4R9BA 1C5IA 3HNMA 2O8OA 1FPN2 1G86A 4XAEA 5HCAA 3VL8A 4AFAA 1WBLA 5KBFA 2Z4FA 2WRAA 2WZR3 2A6ZA 4BPZA 2CDOA 4LT5A 5LRRA 4UF0A 1R092 3C2UA 2ATFA 2O0OA 4RR3A 3ZFGC 4Y4RA 2YUEA 3W59A 5CISA 2E7QA 3SKJE 1ND2A 1OA2A 2QQKA 4JQRA 3U07A 5CG9A 1R082 4Q0PA 3N4MA 3CMGA 2HWF3 3IT8A 5CU1A 1HRI2 1XU1A 2VOWA 4WV8A 4A6SA 4Z2AA 3EXUA 5FOJB 3HNYM 3JU9A 1F2NA 3MW2A 1RJ8A 2XR4A 3ZFGB 4HN0A 2WIIB 2VMHA 3PUAA 3SCGA 4KWUA 1WLWA 3AFGA 3TNQA 5K0UB 3DYMA 1AXYA 2HWC2 4HK8A 3POIA 2AEZA 1KFUL 2MEV2 4LKSA 4PF5A 1KJRA 3C3VA 1DQ6A 4XBQA 1UZWA 1O8PA 3I3BA 1FMD3 2DVBA 3FHAA 5F5CA 2WFPA 4RYDA 4UXAA 3VUOA 1A8DA 2ZOEB 3VV1A 4HONA 3MZHA 4CRQA 4ZS2A 1XNBA 2PQSA 3VBSC 2ETEA 4FPYA 2XVLA 1S0EA 1SQ4A 1H0BA 2HWD3 1QJY2 1ZRCA 2JWPA 4AFMA 3ILRA 3IN9A 1DQ1A 3I3MA 1POV0 3G7DA 5GZDA 5I8TA 3O1RA 2RS33 1DZRA 3M8LA 3POSA 1LULA 3A4UA 3WT3A 3QD6A 5AC92 1U12A 1CJPA 4HVQA 3ZKUA 4C8DA 4QX3A 1PIV2 2BNOA 2HBUA 2J1UA 4HVOA 5FBJA 5A6ZA 2AH2A 3AKRA 4K7JA 5FYHA 3FZ3A 1IG3A 4QPIA 1VAKA 1COV3 3KS7A 4BQWA 2ZAAA 2CV6A 3W21A 2QZ3A 2Y6JA 1UOFA 2JDPA 1KGYA 4OFGA 1OKOA 5FMOS 3RYPA 1AUYA 4EWEA 4H3WA 4F8AA 2YC2A 4KGQA 3U10A 3THDA 5ACA3 1XPWA 5L19A 3FHQA 3RDIA 1H8TA 1BYHA 5FPZA 3GZEA 4I02A 2VECA 1E5SA 1NQJA 5DAQA 1V00A 2V4AA 2J22A 2CSGA 4C0HA 1WGPA 4Y1XA 3VBHA 2OVUA 1HRV3 4Y1UA 4CDQB 2DFCA 3KHBA 4LORA 3FUOA 3I54A 3U78A 1JZ5A 4W6WA 4F7ZA 5FKBA 1GWMA 5FXXA 1EAH2 1BBT2 4N8MA 4UW6A 5LK7B 2P3IA 2ZACA 1NXD1 1Y9MA 3KCCA 3NJXA 2Y6LA 1YI9A 2UYAA 3RJRA 1WBFA 3TN92 3AP9A 4L92A 3WNPA 2YC4A 1PO23 3SLIA 2BNNA 2EXHA 2WT2A 1J1TA 1FV3A 2DCJA 5C3PA 2DFBA 3LSDA 5JIUA 5JSRA 4CXYA 1D0HA 3OPZA 3R4UA 3ZFFC 2UU8A 5FZLA 3O1UA 1RUI3 3T09A 3RMXA 1VJ2A 2GDFA 1MQTB 4N53C 2D6NA 2BTVC 5BNNA 1CX4A 1E5IA 1IS5A 2I74A 3N9OA 5CNAA 5J98B 2PYTA 4M0HA 4CEYB 4D8MA 2UURA 3WF3A 2CGPA 5KHIA 3RRDA 4AAPA 3ZIWA 2VE1A 1CAVA 1FNYA 1ZZCA 5FR3A 3M4FA 2FHRA 3K3NA 4V2WA 2V4VA 2GSYA 2CWMA 3AJYA 1GKBA 3AKSA 5FUPA 3SEEA 1OVPA 3E97A 1R1A1 2DTYA 1UMHA 3GJAA 5FQ0B 2NYYA 5T3NA 2EALA 1AF9A 1UF2C 3E6BA 1IPKA 4WM8C 4A42A 3FBYA 1RMU1 1R1A3 2BW8A 5FP7A 2A75A 2BWAA 1YUDA 2I2SA 5GALA 4Y22A 2W47A 2VNOA 4H14A 4XC9A 5A3NA 3CIHA 3O0WA 4HKLA 4XQ4A 3EB7A 1V6LA 3IMNA 2QDRA 2BPA2 3ZPYA 3HEIA 1YYNA 2YYOA 1G6NA 5C8CB 2K9ZA 1S2BA 4LNVA 1F15A 1WCKA 3WR0A 5FY8A 1XNCA 2AYHA 4LPLA 5I0SA 3KGLA 2W46A 4CCEA 2QQNA 5LBBA 1JZ8A 3L2HA 2KD7A 2VY0A 3I59B 2W9XA 3U37A 5EPAA 1RUC1 4BK4A 4EYUA 1JYNA 4QHZA 1X50A 1SLIA 2B7YA 4ZONA 3TEWA 1SMVA 5HXMA 4Q2FA 3O0XA 3VBSB 1DQ5A 2P2KA 4BH9A 3HT2A 4E4ZA 3A21A 2RDSA 3AVSA 5F3GA 2BBAA 2KXLA 4XJ8A 1YQ2A 5A7PA 1WD3A 2EIBA 2D3PA 4CU7A 1ZA4A 3ZYGA 1NE4A 1JOPA 3RZHA 4QQLA 1QJX3 1REDA 1NCQC 1LU2A 4Q4W1 4FFFA 5IFTA 2ET7A 4DY3A 2FDFA 4CXWA 2WO3A 1O3RA 2JDAA 4XIKA 1UXXX 1X82A 3B01A 4RR3B 5JR2A 3OY8B 5LK5A 1W2NA 2ZGOA 5A80A 3SH4A 1ND2B 2VR4A 4YNIA 2CTVA 5IATA 2VCMA 1PZ7A 2YU1A 5FMBA 1AYN2 4MLOA 4MSVA 1MS8A 1KDMA 1PZ8A 1LKNA 1OXCA 4Q4Y3 4O65A 1GZCA 2VMCA 2VZOA 2Z42A 5CVRA 3KT7A 3UNPA 1SBDA 2RG4A 3LD8A 4NE9A 1L3JA 5F3IA 1VALA 4K3UA 2VQAA 2H0BA 3C7FA 3ZFFB 3ZX7A 5DZGA 1PK6A 2HEWF 4CCKA 2Q1MA 5A3TA 3K4AA 3PIJA 3RZJA 3MICA 1NYWA 2OZ6A 1VP6A 3DECA 4JC1A 3LA2A 5B2GB 4HSJA 5F9TA 2JG9A 1ULFA 4NIHA 4QPIC 4Q0SA 4XQWA 1QOTA 3LAGA 3NJVA 1J1LA 2VMDA 1O3SA 5GLVA 2HWB1 2W1UA 4XDPA 2Y26A 4Y20A 1R1ZA 4A7ZA 3MBWA 3OGVA 2NM1A 1LENA 1W9SA 2RMU2 2YXSA 3OJBA 5DUUA 5FZEA 4XFGA 3VBOC 5J36A 5F32A 2XVGA 5FYSA 5CG8A 2D44A 4P9LA 4F3JA 4DIQA 1B35A 1ZBE1 2D40A 4GB33 2YMZA 1K5JA 1PM7A 2JX9A 3E1F1 5D8AB 4R52A 2ZMKA 1LOBA 1MVQA 4LK6A 1ZVFA 1UOJA 1TME2 3NNFA 3VL9A 4YGCA 3DKWA 4H55A 4XF0A 4LBNA 5FP4A 4O9GA 4LHKA 3ACGA 4XUNA 5ABJC 4BQYA 1ND3A 3HBKA 4YSFA 4IDZA 4JKKA 2X09A 4LO8A 4GWNA 2HLEA 1JS9A 1VBA2 3MV01 4EN0A 3U4XA 3ZXJA 3K75B 2GAUA 2BNMA 4HANA 1OC1A 1QJU1 1DGRN 1W39A 4GWIA 4K8RB 4OHWA 3P6BA 3ZM8A 3M7AA 3ZVXA 1JH5A 1QJU3 4CP2A 4CDUB 3S5QA 2GN7A 5HV0A 1KS4A 4LLFA 4PF1A 4B8EA 1G9BA 2ZHLA 4LOTA 3WQ7A 2QQLA 3RPQA 4AE2A 1NQDA 4E4HA 5FZOA 1RINA 5CIRA 4GXLA 2X05A 3ZLIA 1RUJ1 4LHNA 2ZXQA 5H9PA 3VBUC 3HQUA 4LBQA 1WW7A 2J7MA 5I91A 1LCLA 1NLSA 2A70A 3M2MA 4QGLA 4MHRA 1PGSA 3FLPA 2WQ4A 3R4DB 4LXLA 4BK5A 1T6BX 1XU2A 4AI1A 4CDWA 4CUCA 2WFF2 3IBMA 2VVFA 2VMGA 4GQ7A 4QKNA 1UZYA 3IDCB 3RS6A 5IFPA 4OI2A 1Q56A 1GYKA 1TNRA 5EWSA 4L99A 5H9RA 5A7SA 4BXFA 1FPN3 1DG6A 1MZ5A 3UJOA 3WCSA 1W3XA 4CP1A 4IEVA 4AQ2A 4IGPA 5DAVA 4LTAA 4DB5A 1LGBA 4W4ZA 3LIHA 3ZR5A 4CUGA 2A3YA 1DYKA 3PMEA 3GYDA 4CEYA 1R093 1TME1 3IIIA 3IKWA 4AGVA 4IE5A 3DEMA 1S0IA 5I8YA 3N7KA 4NWWA 4YWAA 2Q1FA 1LOFC 1COV1 1K45A 3OF1A 1DIWA 2Q8EA 2E6VA 5FQ0A 1URXA 4IEUA 1APNA 2VZ3A 1FXZA 2PHLA 3ME2A 2WS93 5DG1A 1W9YA 5KXCA 3SCHA 2AREA 2JG9B 4Q4V3 1ENXA 1N1TA 2YPJA 3LEMA 3Q8AA 2ZHMA 3CQOA 1ZREA 3DPRB 4WM7B 3D0SA 2R7EB 3IAQA 4Q0VA 1X36A 3O1TA 2MEV3 4DUWA 5HCHA 1HN1A 1CAVB 3Q8CA 5C3QA 2CY6A 3LWCA 3I3DA 1W6MB 3N9LA 5BNOC 5FPBA 1HB2A 4XF9A 2ORZA 2ERFA 1H2LA 3IWZA 3TN91 2DCTA 4ONUA 3M70A 4P9WA 1CESA 3O1SA 3S6PA 4DXTA 1S0FA 3FFZA 4YM1A 5FTTC 5FV3A 1AR91 2EA7A 3BU0A 4NRPA 1BEV2 1VR3A 1QJY1 4LHSA 1OF4A 4XJZA 5J48A 4LA2A 4JDNA 5AC93 1U5ZA 1C8M3 1CQ9A 1YNAA 3GGLA 2W2IA 3NMBA 2QNKA 5F6KA 2E33A 1ZRFA 2J42A 4NHYA 4CCCA 1GWLA 2ZCWA 2QCSB 2GZWA 5CFDA 1HB1A 2RDQA 3DV8A 4PBPA 5IK4A 2BQPA 3QH6A 2WS91 4QX1A 5LB6A 3GBGA 1G9AA 4XMIA 4AFCA 1X9PA 5ANNA 1ZZ8A 4AFBA 2CU5A 1O6UA 4D6RA 3FL7A 2B39A 4DXRA 4EN8B 3VKFC 3RYKA 4E9KA 2G9GA 5ACA2 1HW5A 1UX7A 4Y5TA 4ZU4A 3TAYA 2YBSA 3NSTA 3ZXDA 2F4LA 3LF7A 5FP3A 3CU7A 3ST7A 4DS0A 3HIFA 3ACLA 3SQOA 5C5UA 3OY8A 2ZX3A 1YLLA 1XSRA 1WW4A 2Y0OA 3GCWA 4XVHA 1LOFA 2R071 1XQNA 1A6CA 3POFA 5G04L 1HRV2 2VMEA 4FPOB 4D0QA 1DF0A 1MS4A 2GNDA 2ZKLA 3FFQA 2O1QA 1AR93 2ORXA 3J9SA 1UOGA 2Y6GA 2ZS6B 1MACA 1UY2A 3EQEA 4Y26A 1AYM3 2B42B 4FQ4A 5EFUA 3BN6A 1O3QA 4D94A 2D6OX 4PIYA 2P6CA 1KD7A 4Q4X2 3ACFA 2VZTA 1LGNA 4Y1VA 4Y5Z0 5FUNA 4AEMA 1CJDA 3I4IA 4XAAA 1W04A 3LCPA 4MGQA 4AI8A 3ZSLA 2ZGSA 4LBMA 1F4AA 3OPTA 3GDBA 4CDXB 5J09A 2ZGUA 3WDYA 4C1WA 5GLTA 3L9JT 4B1MA 1OI6A 3J7MA 1JBCA 2PHWA 3OTFA 3WP4A 1VBC1 4Z82A 1JYXA 2NLRA 1V6NA 3QBQA 1QXJA 2XQRA 2VNGA 3AK0A 1IKPA 3V0BA 1AR81 3AM2A 3B9IA 3OGGA 4P9YA 3H42B 1AR83 4DPNA 4MGKE 4YG6A 2JDNA 3IDEA 1QQP2 2VUAA 1LB2A 4Q8LA 3AP5A 4V2VA 3K77A 2W91A 2TNFA 4KU7A 1R1A2 4HXCA 2BP6A 1UU4A 3V0AA 1JYWA 1A8MA 4NIAA 1I5ZA 4JCKA 4Y3OA 1VRH1 2A6WA 1GQPA 5FYCA 4AR2A 1Q3EA 4ASLA 5FK8A 5T5LA 2A7AA 3AKTA 3N9PA 3JZVA 3Q9OA 4U2AA 5HBAA 3I2JA 3KVAA 2W5FA 1OOPC 2LS6A 3GNEA 4L9BA 4URAA 2VQTA 1XYNA 5FZ3A 1F9KA 1MS0A 5IJRA 2XBO2 3EMRA 2VW2A 5DDJ2 3SC7X 5FZFA 4CPBD 2EXJA 3E6DA 2E7TA 1YJKA 2VBPA 4Q4W3 1PGL1 3ETQA 2W87A 2W0XA 4IEQA 2E9QA 3OBTA 1PVXA 1MZEA 2Q30A 1TE1B 1U5YA 1C3HA 4HMZA 4N43B 4AG4A 3LFMA 4OCTA 3RZGA 5KXBA 4GMP1 1H8VA 2D93A 5ABJA 3MLLA 3J8F3 4PT6A 5FAXA 5JXIA 1PGL2 2Q4SA 2HBTA 4XBLA 5A33B 2V5DA 2XB6C 1T2XA 3ZFEA 1FOD3 4KH9A 1FPN1 2SLIA 3GF6A 4HPKA 4M0NA 2J1SA 2WAAA 4FPCA 5T55A 3ZYRA 3LEIA 2YG0A 2NQYA 4IL7A 4A3ZA 2XUEA 2DVFA 1AYN3 3DYOA 3OBAA 3WZ1A 2N7GA 2V73A 4MXWB 3RZLA 5F5IA 1YHFA 2OX0A 3VBFA 2WZEA 3TYJA 3B5LB 4CA9A 2ARAA 2P17A 1NG0A 2J1TA 4JQTA 4M3CF 5BNPA 2GN3A 2QTWB 2YU2A 3BCWA 2HWE2 4XW3A 1OH3A 1RUJ2 5CYYA 2DF7A 1ZZ9A 3H3LA 4ZZ5A 3NV1A 2PAEA 1SDWA 3A22A 3QH7A 5ACA1 5FPVA 1AXZA 1V6JA 4M01A 3KWVA 4XDOA 4EWAA 4QQ2A 5ERLA 2GH8A 1OD3A 4Q27A 1Z0HA 2VO5A 2FDGA 2XWBB 1YRZA 5ISLA 1W2OA 5GZCA 4MHUA 3N35A 4H7MA 4KG8A 3OOXA 1CIWA 4P00B 2WWSA 5AFBA 5LY1A 1OT5A 3H8UA 2F6BA 1DFQA 1EAH1 2Q5TA 5DDJ1 3F2ZA 1PM4A 5IAXA 1HDKA 2Y0IA 4DUVA 1RUC2 2C0ZA 2RM22 4W8JA 4MUVA 3K51A 1D0GA 4GB32 1XYOA 2Y6FA 3NKGA 1QOSA 2FBEA 1QXPA 3V0BB 4XEZA 3BALA 4FCAA 3P5BA 3MIBA 3CBNA 2HKXA 3WP6A 4AAXA 1YO8A 5LATA 1POQA 4IW3A 1OPMA 2WNVB 2R1DA 3KMHA 3W20A 3AZZA 4DZGA 3AMMA 5C7GA 1A78A 2IFRA 5IHRA 5A3MA 4GIQA 4XPVA 4R9AA 2ES3A 1DYOA 3R0RA 3FJSA 1QMJA 3UKTA 1DBNA 2WSVA 1QJU2 5T5OA 4R8HA 1KQRA 1OHFA 2ZGLA 3D4KA 4Q5OA 3ZFGA 1G9DA 5D2AA 3K4DA 4GH4A 5FWEA 3BYWA 3TB0A 3OGRA 1YFUA 2VNRA 3NJYA 3RVHA 2BZDA 4M3CE 5ANQA 1UQXA 5JOWA 4XJWA 3P1IA 3POJA 4I0WB 2YY1A 3PDQA 2D6LX 2ARCA 1CAUB 3BODA 1F31A 4ZKTB 3NKTA 3T30A 1W9WA 1JU4A 1QJEA 3WDTA 2FMYA 4YVSC 4P5YA 3UGGA 4EZHA 2R073 3WF2A 1KFXL 5C4WB 4WVVA 2QQOA 3TNPB 3LGRA 5FY0A 5C71A 1WW6A 4QDSA 1CAXA 3WHUA 2WFF3 2PXJA 2WDBA 1FV2A 4LQRA 2Q8OA 2C1FA 4LO6B 3KLSA 2HWB2 4ES8A 3R05A 3T1LA 1QJZA 1H8TC 1RUE3 1RVF1 2QQJA 1PNFA 4CDXA 3B7MA 1J3RA 1W8TA 1U5IA 2TUNA 4X8NA 2B8MA 4N43C 4FAGA 3S7IA 1CZSA 2BGPA 1LOGA 4GH4C 4DXZA 2D3SA 2MHFA 3VBRC 2PA7A 4K9SA 4NHMA 1QHDA 3AB0A 1GOGA 4YM3A 4K6BA 1SG3A 1LOAA 3VBHC 4CU8A 5A3OA 2MNGA 3NNLA 3GBWA 3MF6A 4K21A 4B4RA 5J7MA 1NZIA 1W2UA 5IVFA 1AR62 1C1FA 3GZUC 5F3CA 1SZBA 4HG6B 1VBE2 2VAUA 4Q4V2 1ALYA 5FMCA 3TRSB 1RUD3 4NMIA 3J7NA 2PHTA 1D4M1 4QT6A 1LHOA 4AK3A 4B7EA 5L7OC 1ZBA3 4RL7A 4CPBA 1YQ8A 2PLV2 4V1PA 5A1AA 3BTXA 2WUHA 2XL9A 3H1YA 1F5JA 1PNGA 2DDUA 1C28A 2WA3A 2WR9A 4AHZA 2AZ5A 3ZDVA 4LO4B 3AYCA 1REFA 1YQCA 3USUB 3VDCA 4YW4A 2QQIA 1T6GC 3RMYA 1YI7A 1H4HA 5GM0A 4CCOA 3O1MA 1RUE1 1GSLA 1W9TA 2DCYA 1ZRDA 1PVC1 5FZIA 2GNTA 2XHKA 1OQ1A 1XRUA 2X5IA 3LDRA 2EXIA 2BV4A 2YV8A 3QLQA 4WM8A 4BB3A 5KWRA 1V6OA 1PVC3 3MFAA 4M4PA 4YZ2A 4XJ9A 4XJUA 5BXXA 5FYVA 1CX1A 1WCUA 3VZJA 5C3OA 3AC0A 3WDWA 4NRQA 5E16A 1C8M2 4M4RA 1MEC3 5F1RA 2OPWA 2TBVA 3AJZA 4IEWA 5IUQA 3ZDSA 4XFIA 3RZKA 2WZR2 4UW5A 3TBDA 4ATFA 3USSA 2XDVA 4QPGC 5LBFA 3AL5A 2YHJA 4ZXEA 3POBA 4JGZC 3JB8A 1WLDA 3MO4A 2ZHKA 1Z78A 2C6SA 4P9XA 4UAPA 5LA9A 1BMV1 1JI6A 3EO6A 4FT8A 5GZEA 4IGOA 4XURA 2VMIA 4NN0A 1L7RA 5D21A 3UESA 1EY2A 5ABJB 4IUGA 2PHXA 1Y7BA 4QPIB 2OQ7A 2ZX4A 2QQWA 3N7JA 4YM2A 1U5XA 2C4XA 1UL9A 2PMWB 4ZY9A 1W6OB 5F6LB 2QQPA 3H1WA 1UZZA 4TLGA 1JOBA 4GMP0 2W1WA 4YW5A 1W0OA 4HFSA 5F5AA 2WQZC 3K48A 4MH0E 3HT1A 2WO7A 3KF5A 4DRRA 4FFGA 2BERA 2XJTA 2BBVA 1QH6A 2B5HA 2XLGA 2JDMA 3LSEA 3B3QE 3QOPA 1DGWA 1WCSA 2NMNA 3UYJA 5BV6A 4HSLA 1LOEA 1ULGA 2YGMA 1QJX1 3MF9A 3JD71 1BJQA 1ULPA 2FCTA 3FMGA 3MEPA 4KL1A 4NWVA 2R16A 4QPGB 1Q43A 4W6XA 3ZN6A 2BGOA 4AQTA 4NIGA 3HBZA 1NX9A 4FVVA 1CPNA 1IS6A 4AHXA 2RS32 3PTYA 1RUNA 5JDBA 1W8HA 3JXSA 2XKPA 5FYTA 2R1BA 4JHTA 5SV5A 4AGRA 4XOGA 2RMU1 4HOOA 4KBBA 1IGOA 4AVBA 4B4QA 4BIFA 4XDQA 2EIEA 2ZEZA 2VCCA 4A2UA 3GXUA 2EAKA 1ULDA 2DBIA 4COZA 4NJ4A 3J7HA 1N1VA 2FDJA 2J1EA 4CDQA 1COV2 3LIGA 5FZGA 3WF1A 2P6HA 3K2OA 3D8CA 4HETA 3PVNA 2QVSB 3S30A 5LBCA 3I2KA 1MZFA 1XOYA 3KB5A 4QU2A 1AR82 2ZGRA 4IEXA 3UKNA 3EHKA 2DVDA 1H2NA 3S7EA 5FP8A 3JBG1 4YGEA 4ZS3A 5JZGB 3LB9A 3U75A 2D5FA 5CA6A 5F5QA 3O12A 3NV2A 2P1BA 4BQ1A 4B7KA 3JBG3 4UOJA 4YYOA 4MGYE 2BOJA 5C33A 1TMF2 3WY6A 4JGYA 4JDOA 4WM7C 3DPRC 4RFRB 4A3XA 2K46A 4BQ5A 2VUDA 1XB9A 2ARBA 2LUWA 4DXSA 1B09A 2JDUA 3F95A 4WM8B 3N3HA 2EICA 1OH4A 3H0OA 5DQ0A 1UU6A 1QH7A 4O9EA 1MR5A 3TWIA 4GH4B 1MS3A 2XBO1 3FWEA 4UBGA 4XFBA 5BYNA 1W8FA 1QIQA 4HKWA 4N7UA 2IFWA 2W92A 4CU9A 4GJZA 1NY72 5FREA 2OIIA 5KC5A 1N3QA 1YFYA 2NPIA 3JCIA 1ZZBA 3MHZA 4LO5B 1SLAA 3PU3A 5JWPA 1QY4A 1UZ0A 3J8F2 1O4TA 3BB6A 4FPJA 3O14A 4XZPA 4CZSA 2Z79A 3MUY1 2ZGTA 3CKHA 4QB1A 4KI5M 4DQAA 3VBOA 1YC61 4A7KA 5F2SA 3PNAA 1Y4WA 2Y6KA 3NNMA 1CN1A 1WZXA 3CNAA 4Y33A 1UD1A 1ENRA 2CWSA 2RR12 4LUMA 2VULA 1RXGA 3APBA 4Q29A 3ZYIB 5FYIA 1NAEA 1DQ2A 5I8SA 5D8AA 3ILFA 3VBUB 1UKGA 1FMD1 4BOWA 4FXKB 2HWE3 3KV4A 4CDQC 3CEWA 1DGWX 1H1MA 1AL21 4OUMA 3W58A 2OXBA 3NO8A 2ZEYA 2W1SA 4ASMB 4XXAA 4KWLA 2JDKA 4QPGA 5JPMB 1VMFA 5FZOB 1AXKA 4IESA 4AEDA 4RHV3 4XACA 1W8NA 1SPPB 1Y9GA 1PK6B 1D2QA 4ARYA 4ES9A 4AI0A 2GNBA 1EPZA 1DQ0A 3NV3A 4YW7A 5FZ1A 5JAXA 5J37A 3J26N 3MLJA 1A3KA 4MG2A 4Z07A 2WNVC 4I2OA 3WLUA 1V6MA 5J1XA 3OSDA 1Q5OA 4AVAA 5FLJA 4COVA 5GZGA 1RUC3 3CLPA 2VZ1A 4LEJA 5FO7B 2O14A 5J96B 2A1XA 4IETA 4PDWA 5DMYA 1QJX2 4RD7A 3H8RA 2G19A 3U14A 2HH9A 5FYUA 5C9AA 2GMEA 2WO1A 5D8AC 3CJIC 4HLTA 3C8XA 1GZTA 2JDZA 4P9IA 4R4ZA 3O1PA 2W08A 1CR7A 4UT5A 1ZYBA 3OUIA 3I2IA 4YW2A 2ZEWA 4ZXKA 3UT0A 1SHWB 1O59A 2VCAA 3BU7A 4YVWB 5IVJA 3ZOIA 1H1IA 3MV11 2ZTNA 4X8PA 1GNZA 2E53A 3VD5A 2HWE1 1S0DA 3CO2A 3H3UA 2ADEA 3N36A 5JI9A 5FLHA 3WD5A 1JN2P 2ADDA 2E31A 2PELA 3WOGA 2EAAA 4EQVA 1AL23 1OD5A 1ULEA 2E63A 4Q0UA 2IUWA 5KR7A 1XNTA 3OGJA 1JZ7A 2LROA 4N7IA 3WP5A 4COUA 3ZYFA 5A3LA 3POEA 1OLME 5GLUA 4D7TA 3NVCA 2BU9A 4QKDA 4JKMA 5K0UC 3VD7A 4DFSA 3IB3A 2IXJA 4IE0A 1AYM1 4XE9A 4NOTA 1BZWA 4FO9A 4W6YA 4IV1A 4XYXA 1PO13 2WA4A 3HQRA 5JXJA 3PMSA 5FP9A 1ND3B 5FZMA 5FXZA 3BOWA 3MIFA 4BISA 4DMIA 4A7YA 1CGPA 1UWWA 4XF1A 1W06A 2RJLA 4BQ4A 1BBT1 3OBRA 4IXLA 1GR3A 3SH3A 1BXHA 3BKZA 1ND2C 3Q8BA 1LOCA 1LEDA 1W90A 4OQ9A 3C7GA 4AZZA 5L73A 2DCKA 1LHNA 4DUXA 4E2QA 3ILNA 3GBFA 4TYSA 1NCQB 3M3OA 1NCRB 1W6NA 2D6PA 1IQAA 3N9NA 2JKBA 4P08A 1UMIA 3UKVA 4CEWB 1G9FA 3VBUA 5EIYB 1AX1A 3J8F1 2ZX1A 4HL0A 4YFZA 1XE7A 5LZ6A 1QDCA 1VBA3 1YIPA 1UY1A 1AJOA 3LA3A 1NUKA 3FBMA 3KVBA 2JIGA 3HJRA 5F3EA 1W0NA 3K4ZA 1QKQA 4BWOA 2QUOA 2R32A 1HV1A 1MS9A 1KITA 4LUKA 3WG4A 2YPDA 1TEIA 3ZFEC 1O3TA 2LW8A 3CZJA 1O5LA 1RUD2 1UY3A 3H50A 2H0VA 5C8CC 4QHBA 4LOSA 5FYYA 5FO9B 5DPNA 3VKMA 1ZBA2 1H9WA 2PHUA 5DXDA 2XJUA 4P02B 2A6VA 3NJZA 1VAVA 4OZXA 2ZHNA 3P3NA 5A7QA 2XH6A 2DU0A 4QDRA 4UW3A 3V64A 3KQRA 1S0CA 4LULA 4ZU5A 5I0UA 1UYPA 2QQMA 5FZ0A 4IEOA 3MPBA 5EQUA 1DU3D 4QQPA 1ENQA 4BHPA 5A7WB 3THCA 3HNBM 5FYZA 4JDMA 4BYYA 5CFCA 2XLFA 3PUQA 3LDKA 1K12A 3OG2A 1HIXA 3T0DA 3Q8EA 3I2HA 5B4NA 1S4CA 1QU0A 4L11A 4LITA 2VCBA 5FY9A 4YRDA 5K8SA 2WQ8A 3DXUA 4PLNA 5GLZA 3U11A 2RVAA 2WYFA 4N53B 5JOYA 1F8VA 1CIYA 1JODA 1N47A 2V72A 5EJZB 1XC6A 5EXOA 4EV0A 1BVP1 4LBOA 1PHMA 3VBOB 3AZVA 2GMPA 4P9GA 5IK7A 2FD8A 2W94A 2I45A 3A0NA 4QQOA 3WXPA 5CADA 1L7LA 2GMMA 3CZUA 3T4HB 4AEDC 1SFPA 2AGSA 3QACA 2EXKA 2VQUA 3OEAA 2GC0A 3SISA 5IVCA 3S0MA 5E6HA 4DO0A 5FCCA 5JLVA 3VHPA 1OUXA 4BQ2A 1OFNA 2W68A 1AYN1 1RXFA 2X29A 4WBBA 5CFDB 5EV7A 1I9RA 2UWAA 2OPKA 3GZAA 2QFEA 2A5ZA 4XFFA 5T5PA 4ET7A 4E2GA 1OURA 4N90A 5FK7A 2VZUA 3VHRA 3WQBA 4CP9B 1ZX5A 3OD4A 1X9TA 4MGIE 1P8JA 4KWKA 4UFJA 4A41A 1HX6A 1PGW1 3DCQA 2UWCA 1RHI1 5E89A 1LHUA 3SXWA 3AZWA 4EWDA 1VAMA 1IZ3A 4WVWA 4S2FA 4JHZA 3AZXA 3PL0A 1MS1A 2C5DA 3J7LA 4NRMA 5CB7A 4JKLA 1GQHA 4A44A 2Y38A 5FPXA 5BUVA 2UY9A 3ALQA 1YJLA 2ZGQA 4RR3C 1NCRA 3PVBB 1JHNA 1OVSA 1PX3A 4AVTA 2B9VA 2JB4A 4OUEA 2XONA 5BNPC 1K5MB 2J1RA 1NKGA 2RS31 3U0ZA 1XNKA 1NLQA 2CAVA 3H1MA 2K2SA 1RUF2 1IQDC 2VD7A 3WNOA 1LHWA 2BUKA 3DYPA 4C91A 1Q8OA 4XFCA 3ZFEB 3VGIA 4UBHA 5A32B 2VTXA 4TWTA 2VTFA 2AC1A 2JG8B 3SCFA 2RHPA 2R062 2DUOA 5A6YA 1RUH1 5KHHA 1CWPA 5CBLA 1QGLA 1SFNA 2R49A 3VHNA 2WT1A 4PJYA 2BVVA 4X6RB 3VZNA 4CCNA 2JB8A 4NR1A 2XJVA 4N43A 5J3UA 3H7JA 1D4M2 4CEWC 1JMUB 1X8EA 4IE7A 5B4XA 4COYA 5K7PA 4C1XA 2XL7A 3MGUA 5FOBB 3W5MA 1EV12 5A33A 3KSCA 1VBE1 2VBDA 3IAPA 5LEJA 4IE4A 2D7FA 2C24A 4YVWA 1KRIA 3GHNA 1AJKA 5A7WA 4MGZE 1GNHA 3FX3A 3WG2A 1WW5A 5I0RA 4UWDA 4N9IA 3G6JB 1HRV1 2W3JA 1AR92 2E32A 3ABZA 4RA0A 2HEVF 2WABA 3T2TA 2JIJA 2IXKA 4RHV1 5FLIA 1WD4A 2RDRA 1KDKA 3KZ4C 2ZAHA 1Y43B 4Q4X3 1JZ6A 3TEYA 2PFWA 1ODMA 2D98A 1HXS1 2MPFA 1RVF3 5FZKA 2WFF1 1EUUA 3AYEA 2WN3A 1C8M1 4CU6A 4NAMA 4CXXA 1IG0A 2WWJA 2XJQA 1HXS3 4YM0A 3HQXA 4XQDA 4AF9A 1REEA 5HCFA 1TG7A 2ZZQA 3RJ2X 5DG2A 3AKPA 4MADA 1ZBE2 2WKKA 1UPSA 3ZN5A 4PLOA 4CEWA 5EJ3A 1GP4A 3C7OA 1BMV2 1GOFA 2EF6A 4LIUA 4PHZA 2EIGA 4FFHA 3AMPA 1ENSA 2IVJA 2P4EA 4PIXA 1EPWA 2JDHA 4C0BA 2VXRA 4ZU7A 2VC9A 4TZDA 1QQP3 4EJRA 1VBA1 3I2OA 1S55A 3VDDC 2JD9A 5TSWA 4FOWA 1DLCA 5A3WA 2ZGNA 4YARA 5FJKA 1AR71 4CDUC 2IZWA 1H30A 2FCUA 2VG9A 2W52A 4PQ9A 3VD3A 3ZYBA 3ACIA 3HAGA 5K4LA 1O8SA 4LE4A 5JXGA 4XUTA 3FN9A 4LA3A 2VW0A 1K5MC 4JRLA 5BNPB 3AFKA 1UOBA 4WVMB 1CAUA 2Y33A 4NHLA 2ZPXA 3PUSA 4GAZA 1SBEA 4FP2A 2NN8A 3NNGA 1TMF1 4RHV2 4EZ4A 1VBD1 1W05A 4XZUG 4EN9B 2C9KA 5BY5A 1W03A 1JTZX 5CFCB 1BVVA 2PLV1 1W2TA 1FAYA 1WLCA 5LCWL 3POYA 1PK6C 1W8WA 3D3AA 5HI0A 5FZBA 1OSGA 3O1VA 3SKVA 1CAXB 4IV3B 3HVDA 5IK5A 3O7OA 4XHXA 4QKFA 2DURA 2JENA 3SMHA 4CE8A 1VBC2 4AVVA 3ECQA 4CVUA 3BTZA 1NA1B 1LESA 5L7OA 4INDA 1WCQA 1NY71 2OT7A 4GWJA 2VL4A 3X29B 4CSWA 5DUXA 4OYUA 1TZOA 2RE9A 5JOZA 5K9YA 4QGMA 3IMMA 4GMP3 4W65A 3AZYA 4IEPA 1QQP1 1D2SA 1RIRA 4BU2A 4OLLA 3B69A 1MS5A 1SLLA 4BA6A 4EN6B 3V65A 2WZR1 3INAA 1QWRA 4AI9A 4PIZA 3MIHA 2R30A 3NW4A 1AL22 3I59A 4UW4A 2NZ9A 3MDPA 5JPNB 2CNAA 3B94A 2B46X 2WBKA 5JR7B 2A3WA 1DDLA 5DAPA 2R6QA 3VZMA 4TN7A 4HBNA 4BCUA 4LBQD 4QAWA 3THTA 3BTAA 1AR72 3E5UA 3LOBA 3LEGA 3AMNA 1EV11 2BGCA 3DGTA 1HB3A 3ZYJB 1PO12 5DAWA 2O8QA 1E5RA 2VZSA 2YDEA 3TEZA 3JD73 1XBFA 3FHIB 2Z69A 4COWA 3NQHA 1ODNA 2PHDA 4L2NA 1RHI3 2VZQA 3SEPA 4CDUA 3BI3A 1POV3 3JUUA 4C90A 2W39A 1C57A 4AI2A 1YWKA 5JMOA 4NROA 4PQQA 1L7QA 1JYVA 1K5MA 2RM23 2GH2A 3I2FA 3H3ZA 3BOPA 2VVEA 4FP3A 2JE7A 4RS5B 4SBVA 2WN2A 4YG3A 4I09A 5L36A 1JYIA 3M1HA 4LMFA 4GB31 5FZDA 5FZ6A 1N1YA 4XF3A 4XBNA 2DVGA 2P5BA 1CVNA 1YIFA 3AXEA 3GCXA 5CEHA 4W50A 2YZ4A 2VOVA 3WNLA 1G8WA 5E1RA 3WW1A 1JYTA 2VUJA 3KHCA 4CDWB 2X5IC 5FZ7A 1OQEA 1QF3A 1W9FA 2RR11 1E57A 1C5HA 1N1SA 2JKXA 3HN1A 4D7SA 1GLHA 5IVVA 1Z7S3 3I7DA 5FPLA 3RYRA 3OEBA 1BK1A 1HQWA 4CUAA 4PBOA 2X5IB 2DYCA 5C6CA 4CDWC 1LRHA 2RS11 1HJFA 5C4WA 4XMAA 5BPXA 2BDRA 2RS13 3I3EA 1VRH2 5LRSA 3V56A 5FBZA 4B4PA 1HKDA 1RUH3 4K1YA 1OLMA 3R6SA 1S0JA 2FCVA 4BLJA 3BTYA 1CZVA 1NLRA 2JG8A 3GHMA 1D7PM 1O4YA 1RYYA 1AX0A 1W6PB 4R4XA 4UFKA 5GJ6A 3OPWA 1UKRA 1UY4A 4RGGA 3BVCA 4XILA 4D6SA 2NP0A 1Q8SA 4RN5A 4IV3A 3A23A 2VXJA 1ACCA 2IC1A 2R072 1XYPA 2BWCA 4JV4A 1FATA 3SHRA 1XE0A 2XHNA 1STMA 2JE8A 3CHXA 4FSJA 4XFAA 4LKDA 3ZMNA 1ND3C 2QQUA 5A70A 1NOVA 2E26A 4B1LA 1SFYA 3R4SA 2VW1A 2HWD1 2WZPP 1W3VA 3W9AA 2BYVE 1HQNA 3WQ1A 5EHDA 1U0AA 3QCWA 4Q4X1 4S2HA 1OFSA 3WEZA 2WT0A 5LEKA 1SBFA 1WWYA 4LE3A 3T0BA 2PTMA 4UFHA 4FPLA 4RGAA 5AC91 3PURA 5FPAA 1JXNA 2LALA 2FDIA 1IPJA 5EP9A 3UETA 3KCYA 1R083 4CCJA 1QXRA 1Y3TA 1HRI3 3USUA 1CAWB 4YGDA 1J59A 3NAPA 1MZ6A 1OA3A 1S2EA 1ZZ7A 3HR9A 4QX7A 1AR63 4FXGB 5D1IA 5CKQA 3RI9A 2WC2A 3UV9A 1V0AA 1VBE3 2VMFA 3OBZA 3WV6A 3HOBA 1QOOA 3RWNA 3OUHA 1NA1C 4D69A 1WCDJ 3DN7A 4BZ4A 3WQ0A 2FMDA 4FTBA 2YC0A 3VLBB 5T5JA 1M06G 4NO4A 3JQWA 4RQPB 3CJIA 5I0DA 4OZOA 1ASJ1 1DZTA 1RUD1 3T2QA 5JMCA 1NT0A 2ZA9A 4DINB 3POWA 4WZCA 3ITQA 1C8NA 4MOAA 4RGKA 4A45A 2VTXJ 5FWJA 1QJFA 3SNMA 1HB4A 4FOYA 1US3A 2R042 4AI3A 3AP6A 3IIAA 1R64A 2J1AA 4OVEA 5L9RA 1QJY3 5JZGA 3MW4A 4FOQA 2FDHA 2EVXA 5K0UA 4GKYA 2R041 3Q8FA 4UF0B 1LJ7A 1PVC2 4M00A 1FI2A 4XIOA 1RUI1 4QPWA 1NA1A 5H9SA 4EN7B 3D5OA 4ISRA 2PN5A 4GD4A 1UMZA 1CZTA 5L7OB 1MEC2 4KWJA 3CDZB 3MYXA 4OHYA 3POGA 3OYWB 1PIV3 3I49A 4UYBA 4GA9A 1W99A 5IYYA 1I5PA 2IVIB 1IKQA 3GALA 4IV1C 5G05L 4ATEA 4DNYA 1H9PA 4QD2A 4IEZA 4XUPA 1AR61 5HCBA 4BDVB 5F2WA 3LPGA 3ZSMA 1X7NA 4P5HA 1IS3A 5T50A 4CTEA 5CZKA 1D4VB 1V6KA 4AOCA 2VZPA 5EJ1B 4J1XA 1FT9A 1RMU3 2LM3A 2UY8A 2WNUC 2ZEXA 3IM0A 2A73B 3KV5A 4J6GA 4QKBA 1BQPA 4LBKA 5C3SA 1IOAA 4AVCA 1D4M3 1RUG3 2KA3A 3ZN6B 3KV6A 1SLBA 1DGLA 2Q1ZB 3MW3A 3WF0A 1TNFA 1XJAA 4PDWC 1SEFA 1UYZA 4META 3SITA 2ZKNA 4ZPIA 1O5UA 4FBFA 5C9AC 3AL6A 2J1VA 4BMBA 1DQ4A 3ATGA 1ZBA1 1LAJA 3NNJA 1J58A 1HQLA 2OQ6A 3CJXA 3PJQA 5FMOL 1JZ4A 3RI8A 3RWKX 3UL2A 1BLZA 3WDVA 1BBT3 4IERA 2RDNA 1H6XA 1GQGA 4JGYB 1W8OA 2IXIA 3LPFA 4BQXA 4XHBA 2B4KA 4N9HA 2JDYA 1SCRA 3LQCA 2OKXA 3WUCA 4Q0QA 3NV4A 4YVSB 4KMQA 3DKQA 1PO22 5M0TA 3C7HA 1RVF2 4AWDA 1YXWA 2A71A 2VJXA 1N3OA 5DN2A 1VB4A 5C5TA 1H1AA 1RUI2 2NMOA 3WW2A 1WMEA 3IPVB 1M4WA 1LNSA 1WKYA 1YQ5A 2RM21 2ZZJA 1ZBE3 1MEC1 4SLIA 2ZGMA 5JZGC 3NAPB 3AVRA 3PVEA 2XGXA 1LHVA 4FQZA 4Z2WA 5FZCA 2JICA 3PHMA 4JRAA 3IZOA 4UI9L 1F35A 3N9MA 2E7AA 1OLRA 3U4SA 1BKZA 1VLNA 2CHHA 3WDXA 4FPFA 4OQ8A 3B93A 3ZMOA 4AL9A 4L97A 3CJIB 5FY7A 3WX5A 5C70A 4QB2A 2QDNA 4QM9A 2R061 2DCZA 3IDBB 3UJQA 4Y1ZA 4E4SA 1W6QB 4HZFA 5BNNB 4Z92B 1QNYA 1RTVA 3JBG2 3WF4A 2D6MA 4R9DA 4QXBA 1TMF3 1GOHA 3K3OA 2A3XA 1VMJA 5GLWA 3BIEA 3PUIA 4JZRA 3AMHA 2CL2A 3EYPA 5IVEA 4BIOA 2DTWA 2BEOA 3WW3A 2SBAA 3FLTA 2Y34A 4A6OA 2FQPA 2HJIA 2YFUA 3H9AA 4E4DX 2Y60A 2XWJB 1ASJ2 3ASIA 3PLQA 1GFF2 5C3RA 3ES4A 1S0GA 3WG1A 4AXOA 4OULA 3VD9A 1PMHX 3VDBA 1S2KA 5HXVA 4ASKA 3I8TA 4CUBA 2IWGB 2Q8CA 1SPPA 2P3YA 2D6KA 1VBC3 5C8CA 2QKDA 2YBKA 4LO7A 3ZSEA 3MI8A 4E8DA 4MGTA 2YBPA 1GP6A 2B45X 2XOMA 2XVKA 3AP7A 3I3QA 1UX6A 3LEKA 3MIGA 4PCRA 4XABA 3RGBA 3V0AB 2OA2A 1RUF1 5DUVA 2VOXA 3UGHA 4Y24A 4NPRA 5E88A 2ET1A 4XUQA 1G7YA 5LBEA 3ZIXA 5CKNA 5AFEA 5CAZA 4JTOA 2RR13 4AEDB 4L8QA 4GALA 2V09A 5FZHA 3RQ0A 4U36A 4YW6A 4DEQA 2VZRA 4K40A 4O61A 4IGQA 4DY5A 5KHJA 3DF0A 3NRUA 1WLTA 1ZM1A 2WWUA 4QXCA 2DUPA 1CD3G 2DV9A 1NCQA 1W6NB 1VB2A 4PDWB 4MZUA 1V9U2 3GJBA 3RG0A 4Q4V1 4BMEA 2AUYA 4I3PA 1VE0A 1LODA 1POV1 2GALA 1CAWA 5FYBA 1I1EA 2CGNA 1G9CA 1NE6A 4QPYA 1QEXA 1XNDA 2CDPA 2WLPA 4B29A 1V9U1 1WMXA 2ZJCA 5T54A 2W1QA 2RMU3 3J4UH 4AHWA 2Z2SB 1EUTA 3KT1A 1OLQA 1X33A 1VIWB 4I30A 3PIGA 4IV1B 4NAOA 1VBD2 4GZ9A 2OW4A 1OOPA 2DUQA 1KJLA 4I0AA 3ORJA 4MXWA 2DVAA 3PU8A 2WINB 4KBZA 2WJSA 1MQTA 5GZFA 3U1XA 3VBFB 3A7QA 4CYDA 3PVOA 3MIEA 1R091 1TME3 3VBFC 1PO21 2YB7A 4AEJA 2G4IA 2XUMA 2LTNA 4QXHA 1LGCA 4OMCA 1GP5A 1DZQA 1LTEA 1OMIA 1KEXA 4AEKA 2DU1A 2VVDA 1UNBA 1S0BA 1HJGA 4BQ3A 1O7FA 2D97A 1UO9A 3MPPG 4FPKA 4XFHA 4QX5A 1QNWA 4AW7A 2BFUL 2XXZA 4LKFA 2FZ2A 3WNNA 4K20A 1B35B 2XG3A 2XLAA 3VBRB 1NCRC 2RS12 2JXAA 2W95A 3OYWA 3HMYA 1FNZA 3FUQA 4Q1RA 1RUH2 2F4PA 2GC2A 2ZGKA 5FYMA 3M3CA 1JZ2A 3CL1A 4RQPC 4CDXC 2ZGPA 2YFZA 2FZ1A 2VH9A 3AYAA 3VZOA 3ZYPA 3HWJA 5LA1A 2VOTA 5IT6A 3WVJA 1RITA 1ST8A 2RS53 5JUVA 1SLTA 3LE0A 1RL3A 4FPEA 3ES1A 5A7OA 3VDDA 4XTMA 1RGSA 2WZ8A 4KQ7A 4DRVA 5F7UA 4AYUA 2VGDA 4IQPA 4TTGA 5C4WC 4XETA 5FMDA 3T08A 4BM8A 2R0HA 4PLMA 4LLOA 3WDUA 1FYUA 3AX4A 2A6XA 5FUIA 1KXGA 4LHLA 4MV2A 3T1MA 3T2OA 1VBB3 3OCPA 3ZO0B 4QQHA 4NVPA 2G9FA 4QXKA 3AKQA 3WHTA 1UY0A 1OUSA 3IPVA 2WNOA 2VOKA 3ZPOA 4YLZA 1UIKA 5LWBA 1UCXA 1BEV1 4G3YC 3EJKA 4PI0A 4QX8A 4X6QB 5A7NA 4OHVA 3ZXAC 3HD8B 4TLFA 1GUIA 4YG0A 5CKMA 2XJSA 4KGGA 4BLIA 4NUBA 1Y9QA 1UXZA 4YVSA 4BXSV 3ZR6A 5FPUA 2ZABA 3EBRA 4YVWC 3AP4A 3BPSA 4DOUA 3TOJA 3WNXA 1XNAA 4JGZB 3VZLA 4UFMA 2WS92 1JYCA 4JVAA 3T4VA 5KHGA 1WA4A 3BUCA 5LY2A 1UPIA 3WP3A 1UYXA 3JB4C 3ZFFA 3VKLA 1PMJX 3S57A 1DYPA 3K46A 4QWNA 4Q8KA 1VPHA 5E8AA 2Z5WA 3VB9A 5A6QA 2JE9A 4BJ0A 4N53A 5BNNC 5FO8B 4WVZA 1PO11 1B35C 5IW0A 1ZA7A 2AEYA 4AVSA 2B9UA 5JCTA 5L9BA 1SCSA 4QM8A 3ENRA 4MYEA 4Y4YA 2P3JA 5JSOA 2CGOA 1OQDA 2R043 1O4ZA 1ONAA 4Y20B 4D3WA 5I0TA 1MPXA 1J3QA 2XJPA 3VZKA 4A4AA 1W6QA 1H6YA 3LZZA 3M3IA 4FPGA 4QX0A 1RJ7A 4ZZ8A 4FI9A 2V5YA 1BEV3 2ILMA 1AZDA 4BE3A 1H2KA 4HN1A 1C1LA 3AMQA 4G9SB 3N9QA 2P37A 3O5SA 4HKOA 4URTA 2GC1A 2K0GA 3URFA 5BNOB 2XJRA 4QU1A 4XF4A 1DLLA 3LFIA 2BFUS 1GICA 5KXDA 1AVBA 3ZXLA 3AXDA 5HV4A 2VUCA 4FFIA 2HYXA 3E6CC 1QDOA 2WSUA 1US2A 1VRBA 3IDAA 5H9QA 2JG9C 4I01A 1UU5A 5IVBA 5EYYA 1YFWA 2PHFA 3VHOA 4CP0A 3KCXA 2XPJA
chains in the Genus database with same CATH topology
3B00A 1CONA 5C8WA 2BVBA 4KG0A 3RSJA 4BCUA 4JGYC 4ORFA 4LBQB 4WM7A 1GV9A 1IHMA 2HWF2 3WUDA 2YROA 1BCXA 2AENA 3OD0A 4OHXA 4P9JA 1RMU2 1W0PA 2D43A 4OI0A 4G4FA 4XXPA 1Q8PA 1RUG2 1Z7S1 3H7YA 1H2MA 2HWF1 4YW3A 2HWC3 2ZX0A 1WMDA 3ELNA 2ENRA 3CF6E 1V6IA 5FFOC 1FMD2 1UW8A 1PGW2 4OUSA 4YZ4A 4D7YA 1JW6A 2OUJA 2WNUB 5I93A 2ZX2A 1AYM2 4Q26A 3ROUA 5A32A 4LBJA 2WL1A 1ZRRA 2HWD2 4E27A 4LBLA 1OOPB 2VU9A 4JTNA 3VN4A 1OA4A 3O0VA 5KXEA 1FOD1 3DPRA 2AR6A 1RUF3 4HK9A 2D5HA 4S2DA 1W6OA 1W6MA 2PQQA 1SLCA 4Q4Y1 2WLQA 1SACA 2R063 2D3RA 2PHRA 3BPZA 1ZNPA 5JI7A 1ZZ6A 3M3QA 1KS5A 4AQ6A 4FAHA 5JSPA 1HV0A 4Y1YA 4H7LA 1GZWB 4RSUA 4B3NA 1EV13 1HRI1 4Z8BA 3GZTB 2VQ0A 2QE3A 4P14A 1J3PA 4HVRA 2RJKA 3FC0A 3VDDB 3ZN4A 5AVAA 3MIDA 5KHKA 5DZEA 3VBRA 2XBO3 5DUWA 4S2GA 1EAH3 5DDJ3 1WUVA 2TEPA 4YFWA 1ASJ3 1CPMA 5FRAA 4NHKA 1UAIA 3NAPC 4I3GA 4Q4W2 4YGBA 2X53S 3WCRA 5IK8A 3TN93 2KM2A 2PAKA 1F5FA 2Q0AA 1HXS2 3ZXGA 2OUHA 2C9AA 1V70A 1FOD2 4YW1A 1IS4A 3VKOA 3D6EA 2P3KA 3LOIA 2ZMLA 4WVMA 1RC6A 1NZCA 1YFXA 2VPVA 1PIV1 3N7LA 4KU8A 3P3PA 2JEMA 1Q8VA 3B9CA 3MLKA 3LA7A 4RS5A 2GU9A 5C9AB 4YZ5A 2GC3A 2HYKA 1RUJ3 3M3EA 1PMIA 2OZJA 4Z1VA 2WNEA 3ZXEA 2IXHA 2RS51 4XJAA 1V9U3 3NL1A 2R0FA 2XKOA 3B02A 4JGZA 2IXCA 1PZ9A 4Q1PA 3D0JA 1S1AA 3ZSJA 3KGZA 2E51A 4TSVA 1GBGA 2JJ6A 3L2YA 2JG8C 1VBB1 4LR4A 4QMAA 4AQSA 1VBD3 4HPKB 4M3CA 2H6BA 2CYFA 1O91A 1LEMA 4HT1T 1DHKB 1OPOA 3ZXKA 4MVTA 2X8KA 1R081 4RS5C 4J1WA 3KD4A 3ZXFA 4EROA 3THPA 1H4GA 3JQXA 4AGGA 1UIJA 3VBHB 1XE8A 3LKJA 1AL0G 1GZWA 1UN1A 1EYBA 1AX2A 1AHSA 5BNOA 4GKXA 4AFDA 2MEV1 4Q4Y2 2ARXA 1NXMA 2A6YA 2YGLA 5EYXA 4CEYC 3A0KA 4FOVA 1JOJA 3E5QA 5AVPA 4ITCA 1H8TB 1MQTC 4GULA 1C4RA 3RNSA 2UYBA 2WNVA 5FDBA 3MFCA 3N7MA 4K1ZA 4XTPA 5GKAC 1AR73 1RUOA 2P34A 2OYZA 2RS52 4K8FA 2ZBJA 3WINE 5KC6A 5CFDC 2I07B 5T52A 4KNCA 3JD72 1Q8QA 3FLRA 1W6PA 1RHI2 4OI4A 3UK9A 4AHYA 5JIAA 4MX3A 5DZFA 4MXVA 2IXLA 3FE5A 1GZ9A 1VBB2 1I6XA 2HWB3 3D82A 1I3HA 1HLCA 4RQPA 3NWKA 1RUE2 3KT4A 4ISQA 5JVVA 1YCIA 2WNUA 3BIWE 1LU1A 2PAMA 4Y22B 1OKQA 2GNMA 1DGRA 4RFT0 3DUIA 4GWMA 4IV3C 3I2DA 1ULCA 1TQ5A 1GANA 1JUIA 1RUG1 1Z7S2 2CAUA 5EZWA 4R9CA 1XXNA 3WG3A 5BNQA 5CFCC 4FTEA 4F83A 2JD4A 3RZZA 2QZ2A 3ZSKA 2HEYF 3DL3A 2UWBA 3E5XA 4OI1A 1VRH3 1EP0A 4IEYA 2HWC1 4I0BA 1LECA 2H6CA 4OHZA 3VBSA 4JAAA 3WW4A 4E2SA 1RB8G 3KM5A 5JOXA 2DWRA 4FPHA 4WZFA 3SH5A 2JECA 2PLV3 1JUHA 1LR5A 4QGNA 1WMFA 3AYDA 4FTSA 4YZ3A 1N3PA 1X8MA 4M3CB 2ZMNA 2QJVA 3VKNA 4YZ1A 1FX5A 3PJYA 1MVEA 5SV8A 4R9BA 1C5IA 2O8OA 1FPN2 1G86A 5HCAA 3VL8A 4AFAA 1WBLA 5KBFA 2WZR3 2A6ZA 4BPZA 4LT5A 5LRRA 1R092 3C2UA 2ATFA 2O0OA 4RR3A 3ZFGC 2YUEA 3W59A 2E7QA 1ND2A 1OA2A 4JQRA 3U07A 5CG9A 1R082 4Q0PA 3N4MA 2HWF3 3IT8A 5CU1A 1HRI2 1XU1A 2VOWA 4WV8A 5FOJB 3EXUA 3JU9A 1F2NA 3MW2A 1RJ8A 3ZFGB 4HN0A 2WIIB 2VMHA 3SCGA 3TNQA 1WLWA 3AFGA 5K0UB 1AXYA 2HWC2 4HK8A 4PF5A 2MEV2 1KFUL 1KJRA 3C3VA 1DQ6A 4XBQA 1FMD3 2DVBA 2WFPA 3VUOA 4UXAA 1A8DA 2ZOEB 3VV1A 3MZHA 4CRQA 1XNBA 3VBSC 2ETEA 4FPYA 2XVLA 1S0EA 1SQ4A 1H0BA 2HWD3 1QJY2 1ZRCA 4AFMA 3ILRA 3IN9A 1DQ1A 1POV0 3G7DA 5GZDA 5I8TA 2RS33 1DZRA 3M8LA 3POSA 1LULA 3A4UA 3WT3A 3QD6A 5AC92 1U12A 1CJPA 4HVQA 1PIV2 2BNOA 4HVOA 2AH2A 3AKRA 4K7JA 3FZ3A 4QPIA 1VAKA 1COV3 3KS7A 2ZAAA 2CV6A 2QZ3A 4OFGA 5FMOS 3RYPA 1AUYA 4EWEA 4H3WA 4F8AA 3U10A 4KGQA 5ACA3 5L19A 3RDIA 1H8TA 1BYHA 5FPZA 4I02A 2VECA 1NQJA 1V00A 4C0HA 1WGPA 4Y1XA 3VBHA 2OVUA 1HRV3 4Y1UA 4CDQB 2DFCA 3FUOA 3I54A 4W6WA 4F7ZA 1EAH2 1BBT2 4UW6A 5LK7B 2P3IA 2ZACA 1NXD1 3KCCA 1YI9A 2UYAA 3RJRA 1WBFA 3TN92 3AP9A 4L92A 1PO23 3SLIA 2BNNA 2EXHA 2WT2A 1J1TA 1FV3A 2DCJA 5JIUA 2DFBA 3LSDA 5JSRA 1D0HA 3OPZA 3R4UA 3ZFFC 2UU8A 1RUI3 3RMXA 1VJ2A 2GDFA 1MQTB 4N53C 2D6NA 2BTVC 5BNNA 1CX4A 2I74A 1IS5A 5J98B 5CNAA 2PYTA 4M0HA 4CEYB 2CGPA 2UURA 5KHIA 3RRDA 3ZIWA 1CAVA 1FNYA 1ZZCA 3M4FA 2FHRA 2GSYA 2CWMA 3AJYA 1GKBA 3AKSA 3E97A 1R1A1 2DTYA 5T3NA 5FQ0B 2NYYA 2EALA 1AF9A 1UF2C 3E6BA 1IPKA 4WM8C 3FBYA 1RMU1 1R1A3 2BW8A 2A75A 2BWAA 1YUDA 2I2SA 5GALA 4Y22A 2VNOA 4H14A 4XQ4A 3O0WA 4HKLA 1V6LA 3IMNA 2QDRA 2BPA2 3ZPYA 1YYNA 2YYOA 1G6NA 5C8CB 2K9ZA 1S2BA 4LNVA 1WCKA 3WR0A 1XNCA 2AYHA 5I0SA 3KGLA 3L2HA 2VY0A 3I59B 1RUC1 1X50A 1SLIA 2B7YA 1SMVA 4Q2FA 3O0XA 3VBSB 1DQ5A 2P2KA 4BH9A 3HT2A 4E4ZA 2KXLA 4XJ8A 1WD3A 2D3PA 1ZA4A 3ZYGA 1NE4A 4QQLA 1QJX3 1REDA 1NCQC 1LU2A 4Q4W1 2ET7A 4DY3A 1O3RA 4XIKA 1X82A 3B01A 4RR3B 3OY8B 5LK5A 2ZGOA 3SH4A 1ND2B 4YNIA 2CTVA 1PZ7A 1AYN2 4MLOA 4MSVA 1MS8A 1KDMA 1PZ8A 1LKNA 4Q4Y3 1GZCA 5CVRA 2Z42A 3KT7A 1SBDA 1L3JA 1VALA 4K3UA 2VQAA 2H0BA 3ZFFB 3ZX7A 5DZGA 1PK6A 2HEWF 2Q1MA 3MICA 1NYWA 2OZ6A 1VP6A 4JC1A 3LA2A 5B2GB 4HSJA 5F9TA 2JG9A 1ULFA 4QPIC 4Q0SA 4XQWA 1QOTA 3LAGA 1J1LA 1O3SA 5GLVA 2HWB1 4A7ZA 2Y26A 4Y20A 1R1ZA 2NM1A 1LENA 2YXSA 2RMU2 5DUUA 3OJBA 5J36A 4XFGA 3VBOC 2XVGA 5CG8A 2D44A 4P9LA 4F3JA 1B35A 1ZBE1 2D40A 4GB33 2YMZA 1PM7A 2JX9A 5D8AB 4R52A 2ZMKA 1LOBA 1MVQA 1ZVFA 1TME2 3VL9A 4YGCA 3DKWA 4H55A 4XF0A 4LBNA 4O9GA 4LHKA 1ND3A 4YSFA 4LO8A 4GWNA 1VBA2 4EN0A 3U4XA 3ZXJA 2GAUA 2BNMA 4HANA 1QJU1 1W39A 1DGRN 4OHWA 3M7AA 3ZVXA 1JH5A 1QJU3 4CP2A 4CDUB 2GN7A 1KS4A 4LLFA 4B8EA 1G9BA 2ZHLA 3WQ7A 3RPQA 4AE2A 1NQDA 1RINA 5CIRA 4GXLA 1RUJ1 4LHNA 5H9PA 3VBUC 4LBQA 1WW7A 5I91A 1LCLA 1NLSA 2A70A 3M2MA 4QGLA 1PGSA 3FLPA 2WQ4A 3R4DB 1XU2A 4AI1A 4CDWA 2WFF2 3IBMA 2VVFA 2VMGA 4GQ7A 1UZYA 3IDCB 3RS6A 4OI2A 1Q56A 1GYKA 1TNRA 5EWSA 4L99A 5H9RA 1FPN3 1DG6A 1MZ5A 3UJOA 3WCSA 4CP1A 4IEVA 4AQ2A 4LTAA 4DB5A 1LGBA 2A3YA 1DYKA 3PMEA 3GYDA 4CEYA 1R093 1TME1 3IKWA 4AGVA 1S0IA 5I8YA 3N7KA 4NWWA 1LOFC 1COV1 3OF1A 1DIWA 2E6VA 5FQ0A 1URXA 4IEUA 1APNA 1FXZA 2PHLA 3ME2A 2WS93 5DG1A 5KXCA 3SCHA 2AREA 2JG9B 4Q4V3 1ENXA 1N1TA 2YPJA 2ZHMA 1ZREA 3DPRB 4WM7B 3D0SA 4Q0VA 1X36A 2MEV3 1CAVB 2CY6A 3LWCA 1W6MB 5BNOC 4XF9A 2ERFA 1H2LA 3IWZA 3TN91 2DCTA 4ONUA 3M70A 4P9WA 1CESA 3S6PA 1S0FA 3FFZA 4YM1A 5FTTC 1AR91 2EA7A 1BEV2 1VR3A 1QJY1 4XJZA 5J48A 4LA2A 4JDNA 5AC93 1U5ZA 1C8M3 1CQ9A 1YNAA 2QNKA 5F6KA 1ZRFA 2ZCWA 2QCSB 2GZWA 5CFDA 4PBPA 3DV8A 5IK4A 2BQPA 3QH6A 2WS91 3GBGA 1G9AA 4XMIA 4AFCA 1ZZ8A 4AFBA 2B39A 4EN8B 3VKFC 3RYKA 4E9KA 2G9GA 5ACA2 1HW5A 4ZU4A 3TAYA 3NSTA 3ZXDA 3CU7A 3ST7A 4DS0A 3HIFA 3ACLA 3OY8A 2ZX3A 1YLLA 1WW4A 2Y0OA 1LOFA 2R071 1XQNA 1A6CA 1HRV2 4FPOB 1DF0A 1MS4A 2GNDA 2ZKLA 3FFQA 2O1QA 1AR93 3J9SA 4Y26A 3EQEA 2ZS6B 1MACA 5EFUA 5ABJC 1AYM3 2B42B 4FQ4A 1O3QA 4D94A 2D6OX 4PIYA 1KD7A 4Q4X2 1LGNA 4Y1VA 4Y5Z0 4AEMA 1CJDA 3I4IA 3LCPA 4AI8A 3ZSLA 2ZGSA 4LBMA 4CDXB 5J09A 2ZGUA 3WDYA 4C1WA 5GLTA 3L9JT 1OI6A 1JBCA 2PHWA 3OTFA 3WP4A 1VBC1 4Z82A 2NLRA 1V6NA 3QBQA 1QXJA 3AK0A 2VNGA 1IKPA 3V0BA 3AM2A 3B9IA 1AR81 3OGGA 4P9YA 1AR83 4DPNA 4MGKE 4YG6A 3IDEA 1QQP2 2VUAA 1LB2A 4Q8LA 3AP5A 2TNFA 4KU7A 1R1A2 1UU4A 3V0AA 1A8MA 1I5ZA 4JCKA 1VRH1 2A6WA 1Q3EA 4ASLA 5T5LA 2A7AA 3AKTA 3JZVA 3Q9OA 4U2AA 5HBAA 1OOPC 3GNEA 4L9BA 1XYNA 1F9KA 1MS0A 2XBO2 2VW2A 5DDJ2 2EXJA 3E6DA 2E7TA 1YJKA 4Q4W3 1PGL1 3ETQA 2W0XA 4IEQA 2E9QA 3OBTA 1PVXA 1MZEA 2Q30A 1TE1B 1U5YA 1C3HA 4HMZA 4N43B 4AG4A 5KXBA 4GMP1 1H8VA 2D93A 5ABJA 3MLLA 3J8F3 5FAXA 1PGL2 2Q4SA 4XBLA 5A33B 2XB6C 3ZFEA 1FOD3 4KH9A 1FPN1 2SLIA 3GF6A 4HPKA 4M0NA 5T55A 4FPCA 3ZYRA 2NQYA 4IL7A 2DVFA 1AYN3 3WZ1A 2N7GA 2V73A 4MXWB 1YHFA 3VBFA 3TYJA 3B5LB 2P17A 1NG0A 4M3CF 5BNPA 2GN3A 3BCWA 2HWE2 4XW3A 1RUJ2 2DF7A 1ZZ9A 3NV1A 2PAEA 1SDWA 3QH7A 5ACA1 1AXZA 1V6JA 4M01A 4EWAA 4QQ2A 2GH8A 4Q27A 1Z0HA 2XWBB 1YRZA 5GZCA 3N35A 4H7MA 4KG8A 1CIWA 2WWSA 5AFBA 3H8UA 2F6BA 1DFQA 1EAH1 2Q5TA 5DDJ1 1HDKA 2Y0IA 1RUC2 2C0ZA 2RM22 4MUVA 3K51A 1D0GA 4GB32 1XYOA 3NKGA 1QOSA 2FBEA 1QXPA 3V0BB 4XEZA 3BALA 4FCAA 3MIBA 3WP6A 2HKXA 1YO8A 1OPMA 2WNVB 2R1DA 3KMHA 3AZZA 4DZGA 3AMMA 1A78A 2IFRA 5A3MA 4GIQA 4XPVA 4R9AA 2ES3A 3R0RA 3FJSA 1QMJA 3UKTA 1DBNA 2WSVA 1QJU2 5T5OA 4R8HA 1KQRA 1OHFA 2ZGLA 3D4KA 1G9DA 3ZFGA 4GH4A 3TB0A 1YFUA 2VNRA 4M3CE 5JOWA 4XJWA 4I0WB 2YY1A 2D6LX 1CAUB 3BODA 1F31A 4ZKTB 3NKTA 3WDTA 2FMYA 4YVSC 2R073 1KFXL 5C4WB 4WVVA 3TNPB 3LGRA 1WW6A 1CAXA 3WHUA 2WFF3 1FV2A 2Q8OA 2C1FA 4LO6B 3KLSA 2HWB2 4ES8A 3R05A 3T1LA 1QJZA 1H8TC 1RUE3 1RVF1 1PNFA 4CDXA 3B7MA 1J3RA 1U5IA 2TUNA 4X8NA 2B8MA 4N43C 4FAGA 3S7IA 1LOGA 4GH4C 4DXZA 2D3SA 2MHFA 3VBRC 2PA7A 4K9SA 4NHMA 1QHDA 3AB0A 4YM3A 4K6BA 3VBHC 1LOAA 2MNGA 3GBWA 3MF6A 4K21A 4B4RA 5J7MA 1W2UA 1AR62 1C1FA 3GZUC 1VBE2 4Q4V2 1ALYA 3TRSB 1RUD3 2PHTA 1D4M1 4QT6A 1LHOA 4AK3A 4B7EA 5L7OC 1ZBA3 4RL7A 2PLV2 4V1PA 2XL9A 3H1YA 1F5JA 1PNGA 2WA3A 1C28A 4AHZA 2AZ5A 4LO4B 3AYCA 1REFA 3USUB 4YW4A 1T6GC 3RMYA 1YI7A 1H4HA 5GM0A 1RUE1 1GSLA 2DCYA 1ZRDA 1PVC1 2GNTA 2XHKA 1OQ1A 1XRUA 2X5IA 2EXIA 3QLQA 2YV8A 4WM8A 5KWRA 1V6OA 1PVC3 3MFAA 4YZ2A 4XJ9A 4XJUA 5BXXA 3VZJA 3WDWA 5E16A 1C8M2 1MEC3 5F1RA 2TBVA 3AJZA 4IEWA 5IUQA 3ZDSA 4XFIA 2WZR2 4UW5A 3TBDA 4ATFA 3USSA 4QPGC 2YHJA 4JGZC 3JB8A 1WLDA 2ZHKA 1Z78A 4P9XA 1BMV1 3EO6A 4FT8A 5GZEA 2VMIA 4NN0A 1EY2A 5ABJB 2PHXA 1Y7BA 4QPIB 2ZX4A 3N7JA 4YM2A 1U5XA 1UL9A 1W6OB 5F6LB 2QQPA 3H1WA 1UZZA 4GMP0 4YW5A 1W0OA 4HFSA 2WQZC 3K48A 4MH0E 3HT1A 4DRRA 2XJTA 2BBVA 1QH6A 2B5HA 2XLGA 3LSEA 3QOPA 3B3QE 1DGWA 1WCSA 2NMNA 5BV6A 4HSLA 1LOEA 1ULGA 2YGMA 1QJX1 3MF9A 3JD71 1BJQA 3MEPA 3FMGA 4KL1A 4NWVA 4QPGB 4W6XA 2R16A 3ZN6A 1Q43A 4AQTA 3HBZA 4FVVA 1CPNA 1IS6A 4AHXA 2RS32 3PTYA 1RUNA 5JDBA 4AGRA 2XKPA 2R1BA 5SV5A 4XOGA 2RMU1 4KBBA 1IGOA 4AVBA 4B4QA 4BIFA 4XDQA 4A2UA 2EAKA 1ULDA 4COZA 1N1VA 4CDQA 1COV2 3D8CA 4HETA 3PVNA 2QVSB 3S30A 1MZFA 3KB5A 4QU2A 1AR82 2ZGRA 4IEXA 3UKNA 3EHKA 2DVDA 1H2NA 3S7EA 3JBG1 4YGEA 5JZGB 3LB9A 2D5FA 5CA6A 5F5QA 3O12A 3NV2A 4BQ1A 4B7KA 3JBG3 4YYOA 4MGYE 5C33A 1TMF2 3WY6A 4JGYA 4JDOA 4WM7C 3DPRC 4A3XA 2ARBA 2LUWA 1B09A 4WM8B 3N3HA 3H0OA 1UU6A 1QH7A 4O9EA 1MR5A 3TWIA 4GH4B 1MS3A 2XBO1 3FWEA 4UBGA 4XFBA 5BYNA 4HKWA 4N7UA 2IFWA 1NY72 5FREA 2OIIA 5KC5A 1N3QA 1YFYA 2NPIA 3JCIA 1ZZBA 4LO5B 1SLAA 5JWPA 1QY4A 3J8F2 1O4TA 3BB6A 4FPJA 3O14A 4XZPA 4CZSA 2Z79A 2ZGTA 4DQAA 3VBOA 4A7KA 3PNAA 1CN1A 3CNAA 1UD1A 1ENRA 2CWSA 2RR12 4LUMA 2VULA 3APBA 4Q29A 3ZYIB 1DQ2A 5I8SA 5D8AA 3ILFA 3VBUB 1UKGA 1FMD1 4BOWA 4FXKB 2HWE3 4CDQC 3CEWA 1DGWX 1H1MA 1AL21 4OUMA 3W58A 3NO8A 4ASMB 4XXAA 4KWLA 4QPGA 5JPMB 1AXKA 4IESA 4AEDA 4RHV3 1PK6B 1D2QA 4ES9A 4AI0A