3DL3A

Crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 .
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
RIPKNWTIQRSTPFFTKDNVPEALLTHHNTAVDVFGQICVMEGVVTYYGFANSEATEPEIKVVINAGQFATSPPQYWHRIELSDDAQFNINFWSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tellurite resistance protein B
publication title Crystal structure of the tellurite resistance protein TehB. Northeast Structural Genomics Consortium target VfR98.
rcsb
source organism Vibrio fischeri es114
molecule tags Structural genomics, unknown function
total genus 15
structure length 96
sequence length 96
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09313 DUF1971 Domain of unknown function (DUF1971)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dl3A00
4OFGA 5FLIA 4H7LA 3HIFA 3KGZA 2OZJA 2BYVE 1Y3TA 2GC2A 2EA7A 3PVBB 4IEZA 5FCCA 2IXKA 3U11A 1J59A 1V70A 3MDPA 3B02A 2QDRA 3ACLA 3OCPA 4EROA 1SQ4A 3CEWA 3LA2A 1CAXB 3NVCA 3OD0A 5I8TA 2XLAA 1O3SA 3KMHA 4MGYE 3NJZA 2EAAA 1CAVA 2H6CA 4N9HA 4ZU4A 5KHKA 2O8QA 5KHJA 3LAGA 1DGWA 5I0RA 5KHGA 2Q4SA 4MUVA 4P9GA 1CAWA 4FAHA 4JVAA 3U10A 3SCFA 2B8MA 1NE6A 5J3UA 2CGPA 2ATFA 5I91A 3H1YA 4F8AA 5LEKA 3TNPB 2FMYA 3IWZA 3BB6A 1EY2A 4EV0A 3OF1A 5BPXA 1VP6A 1LR5A 3I59A 2VQAA 5I0UA 3BALA 3E6BA 2Z2SB 1NE4A 3VHRA 2CAVA 3ES4A 4HSJA 4XETA 3KSCA 3FZ3A 2PYTA 4Q0UA 4MV2A 2VPVA 4I0BA 2WC2A 3MPBA 3IIAA 5I8YA 3E6DA 3CLPA 2Y0OA 3GYDA 5FPXA 2H6BA 2GC0A 3LA7A 1O5UA 4HBNA 4Q0SA 2B5HA 1U12A 4LLOA 3SHRA 4L2NA 4FBFA 5C8WA 4PIYA 2D5FA 1VJ2A 5F1RA 3I54A 4NVPA 1Q5OA 4QM8A 1DZRA 4IEVA 1YHFA 3H8UA 5D1IA 1O3TA 1OI6A 1XE7A 2K0GA 4XFIA 2QJVA 3HQXA 4YRDA 2XL7A 5BY5A 4OLLA 2GC1A 4F7ZA 3CJXA 3HT1A 2B9UA 2XKOA 4QM9A 4ZU5A 4KWLA 3ETQA 5KBFA 1NYWA 1CAWB 3ES1A 2PAKA 4IEWA 2FQPA 2QCSB 3H3UA 1ZRFA 1FXZA 1EYBA 4Z07A 5JR7B 4YYOA 4JTOA 4E2SA 2GH2A 5E16A 5FLHA 2MHFA 4ORFA 1RC6A 5I0SA 3I59B 5LEJA 3LOIA 4E2QA 2D93A 4MGIE 2IC1A 5KHIA 2XLFA 1ZZCA 1LB2A 1TQ5A 4IEPA 3UKVA 3E5XA 2ETEA 4Q0PA 4QGMA 1LRHA 1YUDA 2Q1ZB 4KU8A 1OD5A 4MX3A 3FFQA 2K9ZA 1ZRCA 1QXRA 4K8FA 1J3PA 4HLTA 3FE5A 4HSLA 5C6CA 4MZUA 1ZX5A 2IXIA 4R8HA 3EHKA 2PHLA 1X7NA 2CV6A 4IEQA 2XLGA 2Z69A 2WFPA 1UD1A 3U0ZA 1HW5A 3SCHA 1H1IA 4Q0QA 1X82A 2Q0AA 4HN1A 4R52A 4J1WA 5FPZA 3IDCB 4XF0A 2OPKA 4XEZA 4META 1ZZ6A 2BGCA 1YWKA 2MPFA 5CVRA 4KL1A 2VECA 4PIZA 1J3RA 1FT9A 3NL1A 2GU9A 1X8MA 4Q0VA 3FHIB 3KCCA 1WA4A 1ZZ9A 1EPZA 1QXJA 3EJKA 4KWKA 3RYPA 4HZFA 1O3QA 4HVRA 1YFXA 3L2HA 4X6QB 1Q3EA 4XF1A 3BU7A 5I8SA 1ZZ7A 2EVXA 4EWDA 4HMZA 1YLLA 3ELNA 1ZZ8A 4MH0E 3SCGA 4Q29A 1FI2A 2BEOA 1J1LA 2ET7A 3LA3A 4BYYA 3PNAA 3S7IA 5JCTA 4D7TA 5AVPA 2OZ6A 3FX3A 4AQ6A 4E2GA 1O3RA 4AQ2A 1ZREA 1IPKA 1PM7A 3BCWA 5BV6A 5JSRA 1RGSA 1CAUB 4EWAA 3D0SA 4XFGA 5EFUA 4IEYA 2KXLA 3IDBB 4YSFA 4L11A 3H7YA 2PTMA 3CF6E 2N7GA 2PAMA 1NZCA 5BXXA 4AVAA 4LUKA 3E6CC 1O4TA 4Z82A 2MNGA 2C0ZA 2DCTA 1ZZBA 3H9AA 2IXJA 3RYKA 3O14A 1QWRA 5EZWA 4KU7A 3M3IA 3ZDSA 2CAUA 1YFWA 3H1WA 4PIXA 3EBRA 2XGXA 1ZVFA 4QGLA 4XFBA 1H1MA 5FQ0B 2D40A 4WZCA 4XFAA 1UPIA 3DKWA 4IERA 2XHKA 5I0TA 3CL1A 2XL9A 4LTAA 4O9EA 4MGZE 1RL3A 5BUVA 3FJSA 3NKTA 4J1XA 3H7JA 1EP0A 3E97A 4UBHA 1Q43A 5FDBA 1CAUA 2ZKLA 2F4PA 4YARA 3MZHA 3ROUA 5T3NA 3H1MA 2PHDA 4B29A 5HI0A 1IPJA 3DL3A 3LZZA 4XF9A 3UKTA 1ZRDA 2XKPA 5J7MA 5E1RA 1J58A 4AXOA 4UBGA 3PLQA 1VR3A 2GC3A 4I09A 5I93A 2BNOA 1YFYA 2E9QA 3I7DA 4PJYA 3SXWA 5JSOA 4QMAA 4WVZA 1RUNA 1L3JA 2BNMA 4UXAA 1DZTA 4GULA 4RD7A 4A2UA 2QVSB 3DV8A 4O9GA 2UY8A 4XFHA 2I45A 1RUOA 5JAXA 4XF3A 3RNSA 3S0MA 2BNNA 2D5HA 3S7EA 5FQ0A 3N4MA 2P17A 1O7FA 3HT2A 4AVCA 3RDIA 2UYAA 4I2OA 2PFWA 5LRSA 1OMIA 1Y9QA 1SEFA 4LA3A 2HKXA 3FWEA 4I02A 2OYZA 3WW1A 4FAGA 1ZRRA 3OGJA 2V09A 3M70A 1UIJA 4FT8A 4DINB 3E5QA 2IXHA 4LULA 5CU1A 1I5ZA 2PA7A 3CO2A 3WW3A 4AVBA 4I3PA 2UY9A 3IBMA 3LWCA 1LKNA 3UKNA 3E5UA 3BPZA 2PAEA 5J48A 1UIKA 1G6NA 1JUHA 4MGKE 1ZNPA 3C3VA 1RTVA 2PQQA 1QY4A 1DGRA 1GQHA 3USSA 3NW4A 2GAUA 1OFNA 4JTNA 4I0AA 4D7SA 1CX4A 1CAXA 5JSPA 4HN0A 4LA2A 1SFNA 4ZU7A 2HJIA 3WW2A 4XF4A 1UCXA 1GQGA 1XRUA 4BHPA 1PMIA 3OTFA 3G7DA 1WLTA 4KWJA 2QNKA 5FLJA 4XFCA 5KHHA 1WGPA 1NXMA 3MYXA 4WBBA 4BIFA 3R6SA 4IEUA 1I6XA 2O1QA 2UYBA 4HVOA 4XFFA 1CAVB 4X6RB 4QX5A 3SMHA 1J3QA 4CYDA 1X8EA 2H0VA 4EWEA 2GZWA 4IEXA 3QACA 4HVQA 2IXCA 3KGLA 5K8SA 3H50A 1YFUA 3DN7A 2OA2A 3H3ZA 4YNIA 3WW4A 4LEJA 4LUMA 5LRRA 1O5LA 4JV4A 3ST7A 3GBFA 4ONUA 3JZVA 4BH9A 2IXLA 3QOPA 3RPQA 1CGPA 3EQEA 3D82A 4IEOA 3EO6A 4QXKA 1UW8A 2Q30A 4IESA 4I01A 3NSTA 3RZZA 2ZCWA 1XE8A 3RYRA 4TLFA 4QGNA 5CADA 4N9IA 3D0JA 4IETA 3TNQA 2ET1A
chains in the Genus database with same CATH superfamily
3BGAA 2CGNA 4OFGA 5DAWA 1LOAA 3K4ZA 3POJA 4XAAA 1YI7A 2QQUA 1X33A 2JENA 1EAH2 3AL6A 2GC2A 3ILFA 2OW4A 4IEZA 4FPYA 1ZYBA 2IXKA 1DIWA 5HXMA 4AGGA 1J59A 1V70A 3B02A 4RGAA 1ST8A 1POV3 2DURA 1UN1A 3NVCA 4NPMA 4XBQA 5IJRA 3ZYFA 3WW1A 4L97A 3KMHA 4UAPA 5H9PA 2DUPA 2JDKA 3VBRB 1ULEA 1PO13 4MGYE 4TN7A 4PCRA 3WV6A 4ZZ8A 2HWB1 1AL0G 4A3ZA 2WQZC 5IHRA 4ZU4A 3VBHB 1VMHA 3INAA 3C7EA 3JD72 3M3EA 2JG9B 5LY1A 1DGWA 4MXWA 5KHGA 1LGBA 1W6MA 1DGWX 4A41A 3NNLA 5JVVA 3WQ0A 1STMA 3KCXA 3RQ0A 4A6OA 4HG6B 3F2ZA 3NNGA 4FAHA 1JTZX 5A7PA 2DU0A 1O8PA 3SCFA 3KT1A 2GNBA 3KCYA 2XBO2 1YQ6A 4CDUA 2CGPA 2TEPA 2ATFA 3AXEA 3GJAA 4AF9A 3H1YA 1UYYA 1JBCA 4F8AA 1EV13 1I5PA 2XDVA 5DUXA 4WV8A 3PURA 2ZMKA 3NMBA 2VZ1A 1OUXA 2X8KA 3BB6A 2Y6FA 1QQP2 2Q8CA 4YZ5A 1E5RA 1LR5A 1OLME 2I74A 3I59A 4QKDA 3RRDA 1TME3 1UL9A 3I2IA 4P02B 5GZEA 3E6BA 3N7JA 3KHBA 3AKSA 3GCXA 1L7LA 4RHV1 4YGBA 2KD7A 1PGW2 2QQMA 2BV4A 5FZLA 3P6BA 2QQPA 1KRIA 1JZ6A 2YPJA 1LEMA 5FKCA 3QBQA 1MEC3 2YDEA 4YWAA 2DVBA 2ORXA 3W58A 1O91A 1RVF2 3MPBA 5K0UC 3AYAA 1JI6A 3CLPA 5FY5A 4Q4V1 4Q8KA 5FPXA 4CEYC 2H6BA 2B39A 3AXDA 5DDJ2 4RGKA 4LLFA 1O5UA 1COV1 4FPGA 2B5HA 5LA1A 2PHXA 5FYSA 1RUJ2 1VAVA 4P5YA 4BIOA 3VBRA 1VBD2 5FZMA 4EZHA 1NY71 3HEIA 5C8WA 3VBHA 1D2QA 2D5FA 2JG9A 1TG7A 3WDWA 4JCKA 5CFDB 4NVPA 3UGFA 1QMJA 1W6NA 4IEVA 5M0TA 1I9RA 4FFHA 5CAZA 2HWB3 5K7PA 1WMXA 4W8JA 1I1EA 4B1MA 1O3TA 4R4XA 2BFUS 4YZ1A 1ALYA 3WY6A 1XYNA 5AFEA 1C5HA 3JBG1 3MLLA 3KF3A 4LOTA 3NQHA 1H0BA 5FZAA 5L73A 4A7YA 5FOJB 3VKLA 5LA0A 2GC1A 1CJDA 1LOBA 1W0NA 2BZDA 1PO12 2FDHA 2HWC2 2Y38A 1NG0A 4KH9A 2RS51 4P9XA 4ZU5A 2O0OA 1PX4A 2OT7A 2D3PA 1CAWB 4YLZA 1FATA 2C9AA 4IEWA 5LATA 3ZXAC 3PIJA 4CDQA 4ES9A 5JLVA 4TSVA 1ZRFA 1OPOA 1ENSA 5FJKA 1EYBA 1GBGA 3JUUA 4ZS3A 5FYUA 5FZFA 1S1AA 5T5PA 4AQSA 1QOTA 4MYEA 5EXOA 1IHMA 5JR7B 3B93A 4XQWA 2CL2A 2ZKNA 4S2DA 1JOBA 4Q4W1 2ARBA 5EJ1B 3T2QA 4AG4A 1CONA 4BOWA 3OB8A 4XUNA 2EIGA 4LT5A 5FLHA 3A0NA 1EV12 4RHV3 3RWNA 3I49A 5FWEA 1RC6A 1POQA 5I0SA 2WNOA 2YC0A 4E2QA 2D93A 3OGVA 5FY9A 2FDFA 1JHNA 3WDUA 4CUGA 1IOAA 2JE7A 4ZHNA 5FP8A 1ULPA 1TME2 1ZZCA 4JGZB 3VDCA 1UOBA 2DCZA 2JB4A 1YJKA 1FMD1 3CJIB 4Q4V3 2Z79A 1VB4A 2CDPA 4LBQB 1F5JA 1F4HA 1O8SA 4AEJA 3I2FA 3ILRA 1IKPA 4K20A 4QGMA 1VRH2 1COV3 3OUHA 2VD7A 4YW4A 5CFDA 1MEC2 4KU8A 1MVQA 2ZGSA 4WM8C 4BQXA 1WW6A 4OHWA 3WNOA 5CFCC 2GSYA 2XJPA 4FXKB 4LIUA 1GQPA 1H4HA 5FO7B 5FZGA 2J1UA 1UQXA 3FE5A 4QAWA 5B4XA 4D6RA 5E88A 2R30A 1RUG1 2HBTA 5J96B 1C4RA 1ZX5A 3ACIA 4QB1A 4XDQA 1V9U1 1H8TA 2JKBA 4SLIA 1GOGA 2WL1A 3MO4A 3JBG3 1DCSA 4I0WB 5FZ3A 3FLTA 4U36A 1XPWA 2WABA 2XJSA 3IAPA 4JC1A 2XMLA 2ZX3A 4AWDA 2F6BA 3KS7A 2ZOEB 1QOSA 1UD1A 2HWB2 2RS53 5JI9A 4CCJA 1O4YA 2E7AA 4HN1A 4R52A 5T5JA 4YG3A 2J1RA 5F6KA 2RDQA 3UGGA 4XF0A 1ND3B 3OUJA 5J09A 3WG1A 5FZ7A 2LW8A 3K77A 3V64A 1XU2A 4DEVA 2W1QA 1JZ8A 4PHZA 4XOGA 1YWKA 4B3NA 1TZOA 2WWSA 4KL1A 1JMUB 2FCVA 5JXHA 4Q4W3 2OQ6A 4CU7A 5FY0A 2ZHKA 2WA3A 5C9AB 2G4IA 1LHUA 3BIWE 2ZACA 1C3HA 3POGA 2WNVB 4KMQA 2DVGA 2ZPXA 3KV6A 5GZDA 4IE7A 2ZEZA 3FHIB 3KCCA 2BTVC 2Q5TA 4LPLA 3SEPA 3VD3A 1QXJA 4ISQA 1RXFA 4YM1A 2SLIA 5BNNB 3GM8A 3RZLA 1W0OA 4MHUA 2MEV1 4R9DA 2TBVA 1CPNA 1FMD3 1NLQA 4OZOA 5JPNB 4Q8LA 3THCA 1GNZA 3POBA 3POIA 2WT2A 4KBZA 2HBUA 2JKXA 2VZ3A 4JKLA 1DU3D 4LO4B 4NHYA 2D6LX 1J1LA 2ET7A 3K46A 3LA3A 4BYYA 3A23A 3PNAA 5JCTA 4CPBD 4XYXA 1CESA 1VBA1 4EE2A 4CEWB 4URAA 3NO8A 4ZS2A 3VKNA 1O3RA 2EAKA 4LORA 1RUG3 1Y43B 3PUHA 3VZJA 1PM7A 4AFCA 4AI0A 2VE1A 3VBHC 5CISA 1JXNA 1V9U3 2JG9C 3CU7A 4XFGA 1FOD2 1LOEA 1NY72 1Y9GA 4M00A 3IDBB 1CD3G 4LIVA 4L11A 4Y1UA 1RMU1 4XZUG 2WN2A 4Y5SA 4AYUA 2N7GA 4XW3A 1W90A 3SKVA 5BXXA 4AVAA 5F5AA 4Q1RA 1C28A 4E8CA 5DABA 3ZFGB 2MNGA 2C0ZA 2R071 4A3XA 5BYNA 5JXIA 4CPBA 2VW2A 3Q8AA 4OI4A 3AKPA 3KHCA 1ZZBA 3S6PA 1QJY1 3JBG2 3ZFFA 3H9AA 2QBXA 2WZPP 3RYKA 4CCKA 4CP2A 2QZ3A 1UZYA 3AB0A 3O14A 5EZWA 3WLUA 4QPIA 2RS52 1Q8SA 3NV1A 1JYVA 2VNVA 3VZKA 3OEAA 3M3IA 2YMZA 4GMP1 1TVGA 5LBBA 2NQYA 3EXUA 3VL9A 3WDXA 3WUCA 3H1WA 5BNNA 1W6OB 2BWCA 3CMGA 2FDKA 1HQWA 1Y7BA 1SLLA 2JECA 4IDZA 4PIXA 5FYVA 3IMMA 3VLBB 3PL0A 5CFCA 4O65A 3H8OA 4XFBA 2WQ4A 3O0VA 5FQ0B 3NRUA 5H9RA 3LOBA 2VU9A 4WZCA 1N47A 3LEMA 1DQ1A 1PO21 3CL1A 4Q4W2 1QH7A 2MEV3 4LTAA 3PUAA 3RMXA 1BEV1 1U5XA 2X09A 1RINA 3LEIA 1UY4A 3KV9A 4CEWA 3OSDA 3D6EA 4UBHA 2J1VA 2WUHA 4PBPA 3VL8A 5FYHA 1WBLA 3BODA 4IXLA 4E4HA 4YGCA 1VBA3 1FMD2 2DUOA 4QT6A 2RV9A 3NV4A 1DGLA 4UWDA 2FBEA 3A21A 3H1MA 2ZGTA 2J1EA 2QQOA 2AEYA 3LZZA 4O61A 1MS5A 2RDRA 3KVAA 4QQOA 4QB2A 2XONA 1Y4WA 5E1RA 1J58A 2RR11 3DPRB 4AXOA 1RMU3 1A8DA 2GC3A 3A7QA 2W39A 2XQRA 1RUG2 5A3PA 4PJYA 1JS9A 3GBWA 4RYDA 4BZ4A 1OVSA 2JWPA 4IGQA 4XBLA 4K21A 1RHI2 1V9U2 4QU1A 2R073 3KQRA 3J7LA 4YW7A 1L3JA 5LBFA 2RJ2A 1RUE2 5FZ1A 4UXAA 2YV8A 1QJY3 1VBB1 2VMFA 3T0BA 4LK6A 1W6OA 3AX4A 3ZN6B 4O9GA 2UY8A 5JAXA 1PK6B 2I2SA 2WINB 4XC9A 5C3QA 5JDBA 4L8QA 2D5HA 3S7EA 4DZGA 5FQ0A 3N4MA 4GMP3 1RUF1 4P9LA 4AZZA 2UYAA 1SBDA 3VBOB 1T2XA 4KBBA 3GZTB 4URTA 3VD9A 3I97A 4GA9A 1W9SA 3N9PA 2ZHMA 4LA3A 2KA3A 4HPKB 1HX6A 1JU4A 2TNFA 3NKGA 4FAGA 3GZEA 2ZX4A 1N1TA 3I2DA 2WLQA 1OPMA 1PO23 1JHJA 4JGZC 4W6WA 4ATEA 1BMV1 2QQJA 3CJIC 1I5ZA 1IS6A 5CU1A 5EP9A 1LAJA 1BEV3 4M01A 1BQPA 2OVUA 2UY9A 3AKRA 3IBMA 3IKWA 3N3HA 4YW6A 2ZJCA 4FO9A 3V0BA 1ULFA 2ZMNA 3E5UA 2R7EB 2JJ6A 3AZWA 4AHYA 2P3IA 2WN3A 4LMFA 4A6SA 2XB6C 2MEV2 2Y0IA 1CZSA 3USSA 3T0DA 3B9IA 5IVEA 3NW4A 2GAUA 2VZUA 3Q8EA 3NJXA 1RITA 5JPMB 1WW5A 1BZWA 3M2MA 4I0AA 1ONAA 3SEEA 4YW2A 1OKQA 3RS6A 3IM0A 5EQUA 2IZWA 1G9FA 4LA2A 2PHWA 3DGTA 3AVRA 4N53A 3HVDA 2DBNA 5IYYA 1IS3A 1RUH1 1VBA2 1NZIA 2RR13 4XQDA 3ZKUA 1GR3A 4HFSA 4B4QA 2ZX2A 1IQDC 2Y6KA 4MLOA 3ZDVA 4BMEA 3RZKA 1VBC1 2VUDA 4KWJA 3HMYA 3ILNA 4XJ9A 4XFCA 5D2AA 3ZN6A 5HCBA 1PK6A 3M8LA 2BDRA 4TZDA 4WBBA 2CU5A 3ZXGA 3ZPYA 1ND3C 1VBB3 1LU2A 3VBOA 1I6XA 1NA1A 2XG3A 2JDYA 3RI8A 1CAVB 3WNXA 1D7PM 2VCMA 1LHVA 1N1YA 5ACA1 4HPKA 4LE4A 2VQ0A 1S0FA 2H0VA 5C9AC 3ZXLA 2R072 1RUF3 2QQVA 3JB4C 4G4FA 2WNVC 2BUKA 5IT6A 1H8VA 1DDLA 5ANQA 1QJY2 1DLCA 3S5AA 1QEXA 3KF5A 3TRSB 4YNIA 5J98B 4Z2WA 2WZR1 4LEJA 5BNNC 2VOWA 1J83A 3USUB 5HPOA 3LSDA 2D44A 2ZGLA 5AFBA 3WZ1A 4H14A 3TWIA 1WW4A 4NPLA 2FHRA 5H9SA 4QPWA 2HWE1 4YFWA 1UYXA 1JZ3A 3EO6A 5CKQA 3UK9A 3ZMNA 3E1F1 4I01A 3RZZA 4ASKA 2G9ZA 2ZCWA 1PO22 3RYRA 5F39A 1YIFA 4D8MA 3UYJA 4CEWC 5FZ0A 1BEV2 4AQ6A 3TNQA 2ET1A 1FPN1 1LOGA 3KLSA 5E8AA 4C91A 4JGYA 5CYYA 5FLIA 3I4IA 1UPSA 3KM5A 2VVEA 3TOJA 3HIFA 3LB9A 2W47A 2DBIA 4RSUA 5F8PA 3VD5A 3B01A 1JZ5A 3POFA 3VZLA 4XCAA 3PTYA 5FCCA 2GNDA 3K48A 3U11A 3U78A 2WBKA 1QHDA 1RUH3 1MPXA 2DV9A 1US2A 1SQ4A 2R1DA 3ACLA 3OCPA 1W8TA 1A8MA 2CHHA 5L19A 3OD0A 4OHXA 5I8TA 2CGOA 4C90A 3C7FA 2JICA 3O1SA 1W06A 2YYOA 1PGSA 1V6JA 1VBC3 1O59A 3ZMOA 2NLRA 3KZ4C 2W5FA 3WR0A 3ZFGC 3MHZA 3ZSJA 1CAVA 2H6CA 3UT0A 3U4SA 1HIXA 5FO9B 2ZA9A 4DRVA 2X5IB 4UFKA 5C3PA 3NNJA 2RR12 5I0RA 4AEDB 2FD8A 2J7MA 4P00B 4KNCA 4P9GA 1UKGA 2VZQA 3QH6A 2YU2A 5EJ3A 4AR2A 5ACA3 1JZ7A 5C4WC 1AX1A 1MS1A 2B8MA 2V5YA 5FWJA 1W9FA 2ZGKA 4K1ZA 1LU1A 3USUA 1XNDA 1KS4A 3MV11 3ON7A 2JX9A 5LEKA 3FUOA 1K3IA 2C9KA 2FMYA 3NJYA 3TNPB 1UMHA 3ZIXA 5BNQA 5JUVA 2L9LA 3V0AB 1WA6X 4N8MA 5GLUA 1EY2A 4EV0A 2WZR3 1WW7A 3OF1A 5BPXA 1VP6A 3B5LB 1H1AA 1QOOA 2VQAA 1W3VA 1J84A 1RUF2 2B45X 2VMEA 1UY3A 4AAPA 2P4EA 3AYEA 3RWKX 5JR2A 3WNLA 5DZGA 3DUIA 2BPA2 4NIDA 2CAVA 2HWE3 4X8PA 2CTVA 2VCAA 5FZKA 4QX1A 1WBFA 2ILMA 3BVCA 3FZ3A 2PYTA 4Q0UA 3C8XA 2VPVA 4IE5A 4GB32 4MV2A 4DY5A 4N43B 4FFIA 2Y6LA 3IIAA 5FKBA 2VNRA 1NXD1 3MGUA 3SISA 2I07B 5GLVA 4A4AA 1FPN3 4P5HA 2Q8DA 1AZDA 3T2TA 2ARCA 4FOWA 4AHWA 2RMU1 2Y60A 3ACFA 3LFIA 1VBE1 5DG2A 4Q0SA 4MGQA 5FK8A 1SDDB 5JOZA 3DKQA 2D6OX 2LM3A 3DPRC 1JYNA 5F5QA 5A1FA 2HLEA 1IG0A 1UYZA 2PXJA 1VJ2A 2X5IA 1W8WA 2BGPA 5FZIA 4RQPB 4AEDA 2J1SA 3D5OA 4CP0A 1ND2A 1WD4A 4AFDA 3DEMA 3H8UA 3LEKA 1AJKA 5B4NA 4NRMA 3PU8A 5D1IA 1UX7A 1OI6A 1XE7A 1GNHA 1RUH2 2QJVA 3P3PA 2WIIB 4RFRB 3B3QE 4BK5A 5HV4A 3HQXA 4YRDA 4GH4B 2YG0A 3QLQA 1HRI1 2A71A 1PK6C 5FO8B 1XNKA 4DRRA 3M1HA 4OLLA 5DUWA 5FPUA 4MXWB 1YCIA 3CJXA 1GUIA 2R6QA 3RZHA 1GKBA 2JIGA 4QHZA 4XUQA 2OUHA 3VBOC 3ETQA 4OYUA 3H8XA 2ID4A 3ES1A 1GICA 5HCHA 1W9WA 2IWGB 2WWUA 4FOYA 1URXA 2ZEYA 5L7OA 2VOXA 5FY7A 1OLQA 2G9FA 1JYXA 3VZMA 5ACA2 5IVVA 1PX3A 4E2SA 1CJPA 4JTOA 3ZO0B 5C8CC 3DXUA 5JXJA 4DS0A 3I3DA 5GM0A 2GH2A 1F4AA 5E16A 5HV0A 2ARAA 4CXWA 4ORFA 1ULOA 2VMDA 5C33A 3I59B 3WD5A 3SQOA 1WKYA 3OGRA 2ZZJA 2XJVA 4MGIE 2WZR2 1UKRA 2W08A 1UY0A 3IAQA 4IW3A 3J26N 2VH9A 1LB2A 1TQ5A 4XXPA 4CVUA 2A1XA 4PI0A 2QQKA 2EALA 1VAKA 1V00A 2RMU3 3POSA 1VBE3 1XE0A 4R9AA 1LRHA 1AF9A 2Q1ZB 4RQPA 3W9AA 1V6LA 4UT5A 1OD5A 1AXKA 2P2KA 2XQXA 2TUNA 2K9ZA 3HWJA 1REFA 3WDYA 1DHKB 1HDKA 3LCPA 2ADDA 1QXRA 1FPN2 4K8FA 4BISA 2VMCA 4HLTA 1BK0A 4W65A 2C24A 4HSLA 2PHTA 3H42B 3VHOA 1PZ7A 3N35A 5L9VA 4NWWA 2K2SA 4GH4A 1SLAA 2RS31 1GZCA 5DPNA 5GZCA 2IXIA 4FCAA 1OF3A 1K12A 1OOPA 2ENRA 2WO2A 3OPWA 2PHLA 4FFFA 4FVVA 4QPGB 3K51A 4ZPIA 5IVBA 2QQWA 3PVNA 1G9CA 1W6NB 1QH6A 1BVVA 5FZCA 4G3YC 5FYTA 2XLGA 2Z69A 4IQPA 4NRPA 1HRI3 2P3KA 4WZFA 3BTZA 4FSJA 4GZ9A 2R061 1H1IA 1W8UA 4Q0QA 3HPNA 1OKOA 2Q0AA 1PGL1 1W9TA 5DAVA 3NAPC 1T6BX 1AYM1 1YI9A 2C6SA 3I2JA 5K4LA 4CE8A 1NT0A 5EYYA 1FNYA 1BHGA 4Y20B 5A80A 4XEZA 1QIQA 5FP4A 1PZ8A 3AMMA 1XXNA 3WQ7A 4NRQA 4XTMA 4LO5B 2MPFA 4CDQB 3IDEA 1KITA 5GJ6A 1KXGA 1SDWA 2DF7A 4EQVA 4COYA 5FIXA 1FT9A 3NL1A 2J22A 4UFLA 4K6BA 1H9PA 2QDNA 2WZEA 2XWJB 2ERFA 3APBA 1BYHA 1FX5A 1X8MA 3ZLIA 4KWUA 4QKBA 2QTWB 4FQ4A 3UV9A 4DXZA 1V6IA 1WA4A 1ZZ9A 2VO5A 3I3EA 3RYPA 3EJKA 4OQ8A 1R1A1 4HZFA 1WZXA 1MS4A 2A3XA 1YJLA 5ABJA 4HVRA 1MZEA 2W1UA 1YFXA 2WSUA 1TNFA 2ZEWA 2WR9A 4IV3B 4FPLA 1ZZ7A 4YW1A 5FXVA 1YLLA 3ELNA 4F3JA 1ZZ8A 4MH0E 3SCGA 1XOYA 4Q29A 5IK4A 2D7FA 2A6WA 3AP7A 3ME2A 3CDZB 3OBZA 5LWBA 4YVWC 5BNOA 1KDMA 4D7TA 2XH6A 4QPGA 5AVPA 5FPAA 5FBZA 3RG0A 1TE1B 2OIIA 3I8TA 2R1BA 1W0PA 3VN4A 3WVJA 1E57A 3J4UH 3MIBA 1VBE2 4DPNA 2RS33 1ZREA 2G19A 3AMQA 3VKFC 5JSRA 1RGSA 2XPJA 2V4VA 2AUYA 1CAUB 4Z8BA 1R64A 2X5IC 4PT6A 1UOGA 5EFUA 1BXHA 4H3WA 5DAQA 5FZ4A 1JU3A 1B35C 2J42A 4FPKA 3OGGA 2BU9A 2VGDA 3NNFA 3O12A 4BWOA 1H8TB 2PAMA 1NZCA 2BGOA 4Y20A 4FPOB 4GJYA 2R063 2F4LA 4NO4A 2WZ8A 3UL2A 2DDUA 1O4TA 3WUDA 4YW5A 4AI3A 1F15A 4Q2FA 3KD4A 1AYM3 3VBFB 5FAXA 3VZOA 2GH8A 2ZGMA 3WDTA 1HRI2 1QDCA 1KEXA 2FDJA 4TLGA 2AR6A 3MLJA 2VQUA 3I2OA 2HWD1 1NQDA 3R4DB 5D8AC 1BLZA 3B69A 3CQOA 3OY8B 4JRAA 1NOVA 1JYIA 3TBDA 2CAUA 3ECQA 1E5SA 2BJSA 5DAPA 1YFWA 4D7YA 4BQ2A 1SCSA 1GP5A 4CZSA 4XACA 5FUNA 5C5TA 4DOUA 2XGXA 1SLBA 4QGLA 5LK5A 4IV3A 1DLLA 2JB8A 1R1A3 1W8NA 2VVFA 4N43C 1H6YA 1E5IA 1CZVA 4IERA 2VVDA 2XHKA 4XFAA 3WNPA 2GALA 4X8NA 4NIGA 2XL9A 3AP9A 4FTSA 4RN5A 1XU1A 5IAVA 5BUVA 1GSLA 5KR7A 3FC0A 5LK7B 3FJSA 2PN5A 2W46A 3H7JA 2R0FA 3E97A 3NKTA 4C8DA 4YM3A 5KXEA 1UMZA 5FMOL 1IKQA 2ZXQA 2XOMA 1CAUA 2ZKLA 1R081 2Q8OA 3AYCA 1WCUA 1PNFA 4RQPC 2JDAA 3JQXA 1UY1A 3OJBA 4JDMA 3HQUA 1W6QB 3J8F1 3MW4A 3UKTA 1LOFA 2LTNA 3WEZA 2WDBA 1ZRDA 3I2KA 4MSVA 5AC91 5CG8A 3GHMA 3IDAA 3K2OA 5HCFA 1RJ7A 4LBLA 5EIYB 4R9BA 3FBMA 4AGRA 1QF3A 4GH4C 2VNGA 4ZY9A 1CN1A 1HN1A 1L7QA 3LF7A 3AKTA 4I09A 3VBFA 2NMOA 2VJXA 3OBRA 2E9QA 2X05A 4YGEA 1ENQA 3IN9A 4S2FA 1UU6A 1V6NA 4Q1PA 3SC7X 3A4UA 3OY8A 3TAYA 2VBBA 2B7YA 2BVBA 1AJOA 5DG1A 5L9RA 1NAEA 4RD7A 4CDUC 2WRAA 1HB1A 1RUOA 1HXS1 2VMGA 4F83A 4OHYA 2HWD3 3M4FA 3K4AA 3RNSA 3GCWA 4WVMB 5FK7A 4YZ2A 2P17A 1O7FA 3HT2A 3QH7A 2UURA 2Z42A 1SG3A 4A42A 4LKSA 1W2TA 3ZFFB 3GZAA 1UZWA 1AYM2 4ET7A 4I2OA 3TEXA 4OI0A 4JRLA 1F9KA 5LRSA 1JOPA 3LPGA 4QPIB 2RS11 2WS91 3FHQA 1SEFA 5FMDA 4I02A 5FJHA 1AR61 1UIJA 3RFRA 5FYMA 1N3OA 1U0AA 4LULA 1XQNA 2BWAA 4RHV2 2PA7A 1M4WA 1QJFA 2XUMA 4XUPA 2DFCA 5FP9A 4XURA 5FZOB 1ZBA1 2ZX1A 2WT0A 2JDHA 3LKJA 4Y4RA 4XUOA 3T4VA 4XXAA 2PAEA 1W2UA 1KGYA 1UIKA 1G6NA 1R1A2 4W6YA 4C1WA 1W6QA 5DZEA 4MGKE 4QQHA 2A7AA 2VAUA 4NE9A 4Q4V2 5DXDA 1RTVA 1R083 2P6CA 2JG8A 4J25A 5A33A 1G9DA 4OUSA 1F5FA 3VBRC 4XIKA 1COV2 3WG4A 1C1LA 1OFNA 1RUD1 2FZ1A 3J8F3 4Q27A 4UYBA 1IPSA 2VXJA 4YG6A 3ABZA 4D7SA 5JWPA 1CAXA 2A6VA 1JOJA 2ZABA 2DTWA 5JZGB 5AC93 2BOJA 2VNOA 1HB2A 3KT4A 5JXGA 3ATGA 4DUXA 1XBFA 4FXGB 3NV2A 4XCBA 3ZYHA 4C0HA 2A6ZA 3V56A 4CCDA 3AP4A 5FYBA 1XRUA 4INDA 4BHPA 2A6YA 2WNEA 1WLTA 2Y64A 3POYA 5EV7A 3U37A 2VMHA 1X9TA 2NM1A 2EXKA 2V73A 1B09A 3TEWA 1AR81 4WVMA 4H7MA 3R6SA 3T2OA 4BQ1A 4EN0A 4OZXA 4IEUA 1FAYA 2P3JA 3P1IA 3NV3A 4D0QA 2ZHNA 4XTPA 5FZDA 4CUBA 3O1PA 3JU9A 1HXS3 2VZSA 4NUBA 2QQLA 4QX5A 4TYSA 4CDQC 1J3QA 4LO7A 3UESA 1X8EA 4EWEA 1MZ5A 4IEXA 1DP0A 5F3GA 3K3OA 3N9MA 5CKNA 4HKWA 3H50A 1U5YA 1R091 2P37A 3VB9A 4UW6A 2RS13 2WS93 4DNYA 2OA2A 5FZOA 1REEA 2WKKA 1N3QA 3R4SA 1F8VA 2D97A 2HWD2 1S0JA 1AR63 3NWKA 1O5LA 1OA4A 2C5DA 4QDQA 2VY0A 1UZ0A 3GBFA 5A3NA 5H9QA 1FV2A 2ZAHA 5K9YA 2WYSA 2FCTA 4SBVA 5FYIA 4XAEA 1V6KA 2IXLA 4IV3C 4PQQA 1ZBA3 1CX1A 2XHNA 4BE3A 4TTGA 3ZXFA 1UMIA 4NHLA 4QXKA 2A5ZA 4IESA 4AQTA 1XE8A 1UY2A 4PLNA 3VDDB 4QXHA 5LW9A 3V0BB 5CFDC 1CWPA 5JZGA 4N9IA 2VUAA 2E33A 3D0JA 3BU0A 5CG9A 3DYOA 4PLOA 4CCLA 5A7QA 3D3AA 1RUD3 3C7GA 3W5MA 3GHNA 4Z92B 5KWRA 3KGZA 3MW2A 2BYVE 4HT1T 3LD8A 4LKEA 1EPWA 1OT5A 1W8HA 2BBVA 1R082 4EROA 3RVHA 3CEWA 3AKQA 4FP2A 5GKAC 1YO8A 4QWNA 1H8TC 2A3WA 5CIRA 4AOCA 4XVHA 3T0AA 4XJWA 4N53B 2XLAA 5ISLA 3J8F2 1O3SA 1UOJA 3KVBA 4Y24A 3MF9A 1ZBE1 2RJLA 1QJX1 2EAAA 4KI5M 2VCBA 4N7IA 5KHKA 1H4GA 1QNWA 2OS2A 1AR83 5FY1A 4CP9A 1SHWB 1H2LA 1P8JA 5C5UA 2CY6A 2DYCA 4MUVA 2GP3A 3WX5A 1CZTA 3ZYIB 4BB3A 1AXZA 2P34A 4JVAA 4LE3A 3HQRA 2WNUA 2BQPA 5EHDA 3U10A 5FPLA 2HWF1 1NE6A 3J7NA 1BJQA 1GP4A 4N7UA 5IW0A 4NIIA 4DEQA 5JIAA 1NA1B 1CVNA 5I91A 5DAXA 1X36A 2Y33A 1K5JA 1R093 2R49A 2RDSA 2W92A 4LQRA 3O0WA 5GLZA 3AK0A 1XNTA 3IWZA 1C5IA 2ORZA 5FZ8A 1XYPA 2B46X 3T2PA 4H55A 4MG2A 1HXS2 4GWNA 3SH4A 2EICA 4CCNA 1NCRA 5IVCA 4YVSA 1E5HA 4FPEA 1RB8G 5A3LA 2DWRA 2Q1FA 2XVGA 2C26A 1AX2A 5I0UA 3VDDA 5F2WA 1QJZA 2GMPA 1JW6A 3POEA 2Z2SB 3PUQA 1NE4A 3T1MA 2VOKA 2RS12 1K5MB 4K1YA 1Z7S1 4HSJA 3VBSB 3UETA 1Y9MA 1VB2A 3WF2A 4D6SA 2CSGA 4XJZA 4DXRA 1AR62 4CRQA 2UWCA 5F37A 3MV01 4I0BA 3GZUC 1DBNA 1OBNA 2DFBA 2WC2A 4XMAA 3E6DA 3WQ1A 2GNMA 1ULGA 4MGTA 4COZA 2Y0OA 2LRPA 4NIAA 2W94A 3RI9A 4S2HA 3U07A 1AX0A 3EMRA 3WINE 2GC0A 1YNAA 4NMIA 2E7QA 2F17A 3PVEA 4BPZA 3LEGA 5A3OA 1CPMA 2J1AA 1AXYA 3G6JB 2RM21 3AJZA 3AMHA 3I3MA 4JGYB 4L92A 5LA2A 4WVVA 3ASIA 4L2NA 4GJZA 4NAMA 3AVSA 3GXUA 3ORJA 3ZVXA 5JIUA 2HYXA 5F1RA 3I54A 1RUD2 5A32A 1XNCA 3RZJA 1IS4A 1FNZA 4QM8A 1EUTA 1HN0A 2YU1A 1HQLA 1FV3A 1ZBE3 3GJBA 1QJX3 1DQ2A 3TEYA 1G7YA 1YHFA 3RJRA 4PF1A 5A1AA 1NLRA 1SBEA 2Y34A 4HXCA 2DTYA 4OHZA 2K0GA 3LPFA 1RMU2 1S55A 5JOYA 2VW1A 2LS6A 5BY5A 5E6HA 1OSGA 5I0DA 2A3YA 4Y5TA 1S0CA 4GALA 5J3UA 3HT1A 2HYKA 1LGNA 2JIJA 3Q8CA 5KC6A 2HWF3 4YZ3A 2XKOA 1TNRA 3ZFFC 4GXLA 3PMEA 1AR82 1K45A 5T55A 2FQPA 2QCSB 3H3UA 4QPIC 4D6QA 5DMYA 1QJU1 2P6HA 2BRTA 4CCOA 1ODNA 2V4AA 3RZMA 4HOOA 1BVP1 1K5MA 4IV1B 3VBSA 5IAXA 1BCXA 1S4CA 2O14A 1JODA 2FCUA 3THPA 4GKYA 1W99A 1Q56A 1MS0A 2OX0A 1QDOA 5LZ6A 2W2IA 2NMNA 3PDQA 4GIQA 5LEJA 1Z7S3 3LOIA 3HBKA 3I2GA 2JDPA 2IC1A 5KHIA 1S0EA 1OXCA 2PLV1 2R041 2XLFA 2RJKA 5GZFA 3ZSEA 2FDIA 1S2BA 4Y5Z0 4Z2AA 1JH5A 1WCDJ 3HNBM 4BK4A 4Q5OA 1H6XA 2DCKA 3E5XA 3MPPG 4BQ3A 4HANA 1C1FA 3PJQA 1OLRA 5JZGC 1UZZA 2RM23 3OBTA 4FQZA 1POV0 4MX3A 4YW3A 3UGHA 3ZR5A 4D94A 4AGVA 4FTEA 1UXXX 4CTEA 3ZX7A 1Q8QA 4HL0A 5FOBB 3BI3A 3ZN5A 4OMCA 2XJRA 3RGBA 1J3PA 5K0UB 1Q8PA 3N9QA 4E8DA 2AYHA 4BQYA 2DCYA 4QQ2A 1DG6A 4MZUA 3DYMA 4Y22A 3MI8A 3CZJA 4E4ZA 5IVJA 1X7NA 4IGOA 1ND2B 4IEQA 4PI2A 5FZBA 5IVFA 4I3GA 1GWLA 3AJYA 4W4ZA 1D2SA 1ULDA 4PBOA 3B94A 2EIEA 2WFF1 3WP6A 1ZBE2 1HW5A 3SCHA 4CDXB 1QJX2 3VDBA 1X82A 3OGSA 1MQTB 4IV1A 2VULA 4MXVA 4UF0A 1VBB2 2AZ5A 2XBO1 5A6QA 4J1WA 4Y3OA 5FPZA 3IDCB 1CQ9A 1OD3A 1QJU3 2OPKA 2ARXA 4AHZA 4META 1W03A 2XVLA 1BKZA 3CIHA 5CVRA 2HWF2 4UW5A 1QQP1 4PIZA 5IWFA 5L7OB 2VOVA 5JMCA 1D4M1 5FUIA 2PQSA 3O7OA 5FZ9A 1HQNA 3Q9OA 3WNNA 4NHXA 4ZXKA 2CWSA 4LBKA 4Q0VA 4EN8B 3ZFEB 3TEZA 3N36A 3O1MA 4KWKA 1OH3A 1LECA 5A1LA 1LHWA 1LHNA 2PLV3 2R043 3VKMA 1BMV2 1JYTA 3D8CA 4PDWB 4Y1YA 4XJUA 4GAZA 5FV3A 4QPYA 4U2AA 5C7GA 3L2HA 4R4ZA 5FYCA 4QX8A 4EWDA 5I8SA 4HMZA 2CYFA 1Z7S2 2ZBJA 1U5ZA 5K0UA 1YQ8A 4ES8A 1FI2A 5A6YA 1GLHA 2D6MA 2BEOA 1UXZA 4XBNA 4AFBA 4DUWA 4NROA 3S7IA 1ENRA 1C8NA 4N53C 1OH4A 3FX3A 3PVOA 4E2GA 5FFOC 4DMIA 4JDOA 1IPKA 2YROA 3BCWA 1JYCA 2W9XA 2E53A 2RM22 3EB7A 4AI8A 1YXWA 4QKNA 3T09A 2QKDA 2W68A 1N3PA 5CB7A 3ZXJA 5HCAA 4CDXA 4DXSA 3PIGA 1RXGA 4J6GA 3IB3A 4EN6B 1MQTA 1XJAA 2A70A 2B4KA 3OG2A 4DXTA 1OOPB 1VBC2 1XB9A 4MADA 3BN6A 3ZYRA 3WNKA 2WWJA 4V1PA 4EZ4A 5G05L 1WCSA 2BP6A 1WMEA 1G9AA 4BLIA 2WFF3 4L99A 2EXHA 3IPVA 3H3LA 4RGGA 1NA1C 2JDNA 3ACHA 4QXBA 2E63A 2FMDA 2HWC1 4Y26A 2XBO3 1W2OA 3J9SA 3KV4A 2XJTA 1MZ6A 4AL9A 4QX0A 5LY2A 2SBAA 4UFJA 3FHAA 1MS8A 3JB8A 3ZFEA 1QWRA 1HV1A 1AUYA 3Q8FA 1QQP3 2IVIB 2NPIA 3ZDSA 1GWKA 5F7UA 1D4M3 3N7KA 4PDWA 2YC2A 4QXCA 3OYWB 2RVAA 1YQCA 3D4KA 3VBSC 1QJU2 1RUC1 1UAIA 2LALA 5A3WA 4FPJA 1VAMA 2EF6A 4FPCA 1H1MA 5EYXA 1X9PA 4BLJA 5FXWA 1WCKA 5FP3A 1OUSA 3DKWA 4DIQA 2NYYA 4MGZE 4BMBA 1RL3A 2HWE2 2D3SA 2VUCA 5ABJB 1EP0A 1ULCA 3U14A 1MR5A 3AFKA 1Q43A 5A7NA 3ENRA 1UWWA 4JGYC 1W28A 5FDBA 1VRH1 3O1VA 2R042 4CDWA 3K4DA 4MVTA 1PM4A 2F4PA 4NR1A 4RL7A 4YARA 4Z1VA 1XYOA 3MZHA 3T1LA 3M3CA 4WM8A 1F35A 4XIOA 5T3NA 4B29A 5BNOB 3HOBA 5GZGA 5HI0A 4NJ4A 3THTA 4ZKTB 1NCQB 3AMNA 4XF9A 2VZTA 4TXWA 2P1BA 4LNVA 3JQWA 2D98A 2QQNA 4FOQA 5J7MA 1UX6A 4M3CF 4AVSA 3HNYM 4XDPA 1REDA 4YM0A 4UBGA 4AAXA 1VR3A 3AP6A 3WF4A 3GNEA 5JSOA 3LGRA 1LESA 1UU5A 1OLMA 1DYOA 3HAGA 3R05A 4W50A 1UOFA 4BXFA 4IUGA 2KR2A 4QMAA 3J7HA 2HWC3 2RDNA 4QX2A 3WF0A 1DQ5A 4LITA 4ASMB 1CIYA 2BNMA 4GD4A 4FP3A 1DZTA 5FPVA 5KXCA 5J36A 2QVSB 4YFZA 1WMFA 4COWA 3OYWA 2EXJA 2I45A 4IV1C 4LO6B 3I3QA 4HONA 4KGQA 2WFF2 4ITCA 2BNNA 1AR91 1XNAA 2B42B 5GLTA 1ENXA 3MF6A 1OURA 4AVCA 3RDIA 2VZVA 2PFWA 5KXDA 4HVQA 5EWSA 4QQLA 1S2EA 1RUC3 1IG3A 1GP6A 2B9VA 5CNAA 3FWEA 1HLCA 3ZXEA 1ZRRA 4JHTA 2GNTA 3M70A 5T52A 4QX3A 4DINB 3F95A 1RUI1 2V72A 3ETPA 4RR3B 1PIV1 1D4M2 4I3PA 4LHNA 3RMYA 3WW3A 3ACGA 3LWCA 2PHUA 3OOXA 3ALQA 1CR7A 1LKNA 1QXPA 1YYNA 4K40A 2JD4A 3UKNA 4A45A 4CA9A 2LROA 1GWMA 4NIHA 4OUEA 4WM7B 4W6XA 1LEDA 3VV1A 1VRH3 3AM2A 2DU1A 1ZNPA 2VCCA 1NCQA 4K3UA 1OFSA 3AL5A 4P9YA 3UJQA 3C3VA 5CEHA 2Y6JA 1KD7A 1VIWB 1KDKA 4Y1ZA 2PQQA 1QY4A 1DGRA 1GQHA 1V6MA 4ARYA 5C3RA 1Q8VA 2RMU2 2W1SA 3BPSA 1DQ6A 4JZRA 4CU8A 3GDBA 2EXIA 1LCLA 2BFUL 5JOWA 2XWBB 1CX4A 1H9WA 1RYYA 2D6KA 1SFPA 4HN0A 4AEDC 4E4SA 2FZ2A 1ND2C 1Z78A 1W04A 1SACA 4ZU7A 3V65A 4LJHA 4FFGA 1CIWA 1FOD1 1I3HA 2DUQA 4M0NA 4XF4A 1V6OA 3WW2A 3ZOIA 5A6ZA 2JXAA 1HB4A 4L0PA 1GQGA 1C8M1 1HV0A 3OEBA 1PMIA 4JHZA 4CDXC 2QNKA 5FLJA 2X53S 5KHHA 2EIDA 1WGPA 1L7RA 1MQTC 3HBZA 5T50A 1NXMA 3VHNA 3MYXA 4NOTA 3A22A 3ZIWA 2DVAA 1VLNA 5CZKA 3KT7A 1KS5A 4XDOA 1UYPA 1U5IA 5C71A 4JKKA 2YFUA 4BQ5A 3PJYA 4HVOA 4X6RB 1QGLA 4MO3M 3FL7A 2HH9A 5B2GB 2PELA 1AR93 3FN9A 2GZWA 5L7OC 3QACA 3HNMA 1GZ9A 2E31A 4IL7A 1YFUA 3DN7A 4XZPA 3JXSA 3M7AA 4RR3A 4EJRA 3ZFEC 5L36A 2ZMLA 4G9SB 4LBJA 1R1ZA 1GOFA 3H3ZA 4ATFA 3WW4A 4QX7A 3WHUA 1FYUA 2WO7A 4LUMA 4PDWC 4YZ4A 1OA3A 1DF0A 2CDOA 3C7HA 4WM7A 1RUI3 5A3TA 1PIV3 3JZVA 4LHKA 3URFA 3H8RA 3MIGA 4NHMA 1CGPA 3RPQA 2YXSA 3D82A 3N7MA 1RUC2 5T5OA 4Q26A 3DYPA 5EPAA 4AEKA 5FR3A 3PUIA 4QD2A 3NSTA 2NZ9A 3MFCA 1OHFA 3L2YA 4Y4YA 5AVAA 3W5NA 4TLFA 2Q1MA 4YM2A 1SZBA 4QGNA 1S0BA 5SV5A 5CADA 2E26A 4LKFA 5IFTA 4XHBA 5EJZB 3FUQA 3ZYBA 5IK8A 4AHXA 4GWJA 3O0XA 4H7LA 3X29B 4CDWC 4YGDA 2W91A 4CCEA 1GZTA 2PHFA 3IMNA 1AL21 2OZJA 1S2KA 1Y3TA 2EA7A 2JG8B 3PVBB 3GALA 4XABA 5ANNA 5A33B 2VZPA 4NPRA 3MDPA 4ASLA 2D3RA 2QDRA 4AK3A 1FOD3 1HRV1 1OOPC 1CAXB 1W8FA 3LA2A 5CKMA 5FMOS 5LA9A 1OQ1A 1WWYA 2RS32 5J1XA 1C8M3 4UW3A 2UWBA 2W95A 2LUWA 1LODA 3ZR6A 4EN7B 3NJZA 4N9HA 1SBFA 3IZOA 5FZEA 2O8QA 5G04L 5KHJA 4LBMA 3LAGA 1RHI1 5C70A 2Q4SA 4IE4A 2A6XA 4R9CA 2YHJA 1RUE1 2R062 1CAWA 4GMP0 1PGL2 4QDSA 4LBQD 3LSEA 5JMOA 3C7OA 3ZSMA 3B9CA 3TB0A 1TMF1 2OPWA 3ZXDA 3KQ4B 2VZRA 5F3IA 2YPDA 2GMEA 2AEZA 3FLPA 1YQ2A 3AZYA 4UW4A 3T30A 3VGIA 3ZPOA 4B4PA 1UO9A 5A3MA 3AZZA 1VMJA 1AR92 3MICA 1LULA 1F31A 5A6XA 3U4XA 1VRBA 1IZ3A 2VQTA 3BALA 4LHSA 3P5BA 2K46A 5ABJC 3VHRA 4RFT0 1IQAA 1OVPA 3B00A 3DXTA 1XSRA 3ES4A 4JGZA 2YUEA 4JQRA 4OVEA 4XETA 1YEWA 3KSCA 2WJSA 3CJIA 5A7SA 4BM8A 4CCCA 4KGGA 1NX9A 2XJQA 4LBQA 4V2WA 3TN91 4HETA 1VE0A 3ZSKA 1RUI2 1GOHA 1BK1A 2YC4A 3Q8BA 5I8YA 4KG8A 3VD7A 1PIV2 4IGPA 2PMWB 3B7MA 4XE9A 2CWMA 3GYDA 2YBKA 2VBDA 5BNOC 5FTTC 3QCWA 1NCQC 4QPGC 2Y26A 4FTBA 3N9LA 1DQ0A 3LFMA 3LA7A 4HBNA 1AL23 1BBT1 4FPFA 4QDRA 4DY3A 1WMDA 1U12A 3LDRA 4LLOA 3UJOA 1JZ4A 2YBSA 5F9TA 3WCRA 3IIIA 3SHRA 1US3A 4FBFA 3K75B 4O7XA 1HRV3 3MBWA 4PIYA 4A7ZA 2G1MA 3VHPA 1W8ZA 2YY1A 5IK7A 1Q5OA 3PHMA 2P5BA 1DZRA 3JCIA 2ZGOA 4UFIA 5FYZA 4BDVB 1JZ2A 1ZA4A 2GMMA 2JDZA 3L9JT 4HKLA 1DYKA 1AHSA 1RHI3 4JDNA 4XFIA 5DZFA 4NN0A 2XL7A 1UNBA 3OPTA 3AC0A 4B7KA 4Y33A 1RUE3 1C8M2 2VM9A 2IFRA 4LBOA 4CP9B 4P9WA 2WAOA 4F7ZA 2XR4A 1ND3A 1TEIA 1VALA 2WSVA 3K3NA 2B9UA 1Z0HA 3MIDA 4Q4Y1 4QM9A 4M0HA 4KWLA 4ISRA 1TMF3 3O1UA 3MIHA 1NYWA 3AFGA 5KBFA 2PAKA 4XMIA 1UZVA 2WNUB 2Z5WA 4HKOA 3S57A 5LASA 1FXZA 2DCJA 3H0OA 4AEMA 4CP1A 5C9AA 3DECA 4A44A 1OQDA 4Z07A 1LGCA 1KFUL 2J1TA 2WNVA 4YYOA 3U75A 3WOGA 1G8WA 2RG4A 4RR3C 2ZGQA 1WD3A 5FZ6A 5C4WB 4P14A 2GDFA 1GZWB 1KJRA 2MHFA 3LE0A 4AI9A 1NCRB 3O1TA 1C57A 1W9YA 4B4RA 4WM7C 2E7TA 4YVSB 2H0BA 4BU2A 3ZSLA 1NUKA 3TN93 2OKXA 2VOTA 3ZYJB 2BW8A 4PF5A 4OI1A 1O4ZA 1H2MA 1KFXL 1AYN1 4IEPA 3MIFA 4S2GA 3UKVA 2ETEA 5FZHA 4LKDA 4Y1VA 3VBUB 4DUVA 1DFQA 4Q0PA 3T3YA 1W2NA 5GALA 1W39A 1ODMA 3KWVA 1BBT3 2GN3A 1YUDA 1W05A 5LB6A 3FFQA 3HN3A 4FI9A 4AE2A 3ZKYA 2GN7A 1LOFC 5F32A 5KXBA 5FRAA 4KQ7A 1ZRCA 2Q8EA 4L9BA 1DZQA 3WF3A 2JEMA 4DB5A 5FMBA 5F2SA 3WXPA 1D0GA 5D21A 1DYPA 1ASJ1 1GV9A 1MS3A 1AL22 1GFF2 1SLTA 2BVVA 1J1TA 3FMGA 5AC92 5C6CA 3AMPA 1PNGA 1DQ4A 3LIHA 5T54A 3VBFC 4R8HA 5BNPB 3EHKA 4XHXA 2JD9A 5GLWA 5A32B 5SV8A 2P3YA 1N1SA 1HRV2 2CV6A 2DVFA 4GWIA 3BTAA 3M3QA 3ZFGA 3HN1A 2VL4A 4AI2A 1NQJA 5CA6A 1D4VB 1KJLA 5L9BA 4CUAA 4FPHA 3FLRA 2WFPA 4Q4X1 3U0ZA 1PMJX 4OULA 2RE9A 2QE3A 4Q4Y3 1MACA 4DO0A 1T6GC 3WQBA 3NJVA 5A7WB 5ERLA 3OBAA 3UNPA 1ZRIA 5C4WA 1GNYA 1GZWA 2ZZQA 1VMFA 2A73B 4XUTA 1ZZ6A 1RIRA 2BGCA 2WLPA 4KG0A 2C4XA 2Y6GA 3VUOA 2VECA 2PHRA 1J3RA 2VXRA 1TMF2 4IE0A 2GU9A 3LIGA 4QB6A 2VTXA 2WS92 2R32A 1WCQA 4FOVA 2XXZA 2WO1A 2ZGPA 3N7LA 3O5SA 4RS5B 3FBYA 5FY8A 4BQ4A 3VBUA 1G86A 2R0HA 2ZX0A 3SITA 1EPZA 1SPPB 3CNAA 4QQPA 3LDKA 1O3QA 1A34A 5DN2A 2A75A 4GB31 1ZBA2 4OCTA 2NN8A 3BTYA 5C8CB 1W2AX 1AYN3 4X6QB 3OPZA 3J7MA 3P3NA 1Q3EA 4XF1A 3BU7A 2EVXA 1NLSA 1APNA 4JKMA 2JG8C 3WT3A 4BJ0A 1HKDA 3N9OA 3TN92 1HB3A 3RJ2X 1PVXA 1SCRA 5F5IA 5BNPA 2QQIA 2ZGUA 2YGMA 2OZ6A 4E9KA 3GGLA 1LTEA 5APAA 4YPJA 5A3UA 1VPHA 5IATA 4AQ2A 1ASJ3 1ZM1A 1GU3A 1BBT2 3DPRA 5BV6A 5TSWA 5HBAA 2AENA 3R0RA 4EWAA 1QU0A 3WDVA 3D0SA 1RJ8A 4XILA 3THDA 1QKQA 5FP7A 4IEYA 1OQEA 2KXLA 4QU2A 4YSFA 3H7YA 1IGOA 2PTMA 4Y22B 3DCQA 5CBLA 3CF6E 2XVKA 4UOJA 1ACCA 2WYFA 5A7WA 1JN2P 4JQTA 4COVA 1DGRN 4LUKA 1YIPA 3E6CC 3AP5A 4Q4X3 4CCMA 2G9GA 2YFZA 2C1FA 1MZFA 2ZS6B 3WG2A 2YGLA 5C3SA 3RZGA 1HJFA 4Z82A 2D6NA 5FY4A 3HR9A 3BKZA 2V5DA 2YZ4A 2DCTA 3MFAA 2X10A 1PVC1 1HJGA 3WG3A 5C3OA 5DQ0A 3SNMA 5F6LB 3U1XA 5A70A 4UF0B 2IXJA 2VZOA 4RS5A 3RSJA 2KM2A 3CKHA 4PLMA 1OF4A 4KU7A 1SPPA 4Q4Y2 1R092 2VTXJ 4LHLA 5FXZA 3SH3A 3ZXKA 4MHRA 4E27A 2FDGA 3WP5A 5J37A 4ZXEA 3WF1A 3EBRA 3HD8B 3NAPB 5C8CA 1ZVFA 5F3CA 3WHTA 4RA0A 4ARXA 2D40A 2OXBA 1UPIA 1MVEA 4M4PA 5I0TA 5T5LA 2QZ2A 4DFSA 3S30A 2VW0A 3AYDA 4O9EA 4B8EA 1GMMA 1SLCA 2Y8KA 4GB33 1AR71 4EYUA 1YRZA 1H2NA 2VMIA 4BA6A 2XUEA 4HK9A 4BCUA 1JUIA 1XNBA 1W8OA 4HK8A 1AVBA 2WQ8A 4J1XA 3HJRA 4OI2A 5DUUA 1W3XA 1EAH1 1G9BA 2YB7A 2XJUA 4LOSA 3ZM8A 1ZA7A 4BXSV 1O6UA 3BTXA 4YG0A 4CU6A 2BERA 1AYN2 5FBJA 1LENA 3MW3A 4QHBA 1IS5A 3ROUA 2PHDA 4CEYB 2IVJA 3WCSA 5LBEA 1IPJA 4AI1A 3DL3A 3W21A 1MS9A 2QFEA 5LCWL 3I3BA 2XKPA 1V0AA 3N9NA 2ZGRA 4CUCA 3ITQA 2AC1A 3JD71 2OUJA 2D43A 3NNMA 4H2AA 3S5QA 1A78A 1XC6A 4YVWB 2WT1A 3PLQA 1WLWA 3LQCA 3VD4A 5FUPA 5IUQA 3W20A 5I93A 2BNOA 3SLIA 1ASJ2 4OUMA 1YFYA 2WAAA 3I7DA 4NAOA 3SXWA 1SLIA 3BYWA 2WO3A 2UU8A 4V2VA 4A7KA 4QKFA 1S0DA 2GP5A 4CXYA 1H30A 4WVZA 1OA2A 4PQ9A 5FPBA 3SH5A 2WNUC 4K8RB 5E89A 1RUNA 2JE9A 2W3JA 3GBGA 3AZVA 1PVC3 1W6PB 3IPVB 4GULA 4A2UA 4AFMA 1UF2C 4D69A 3DV8A 3VDAA 4E4DX 2VC9A 1B35B 1S0IA 4MGSA 2E6VA 2VUJA 4XFHA 5FXXA 3VKOA 3NAPA 4Q4X2 4M3CB 4M4RA 4XF3A 5JI7A 3S0MA 2ZGNA 4P08A 2AREA 4XJAA 2R16A 3A0KA 4UFHA 1QNYA 5F5CA 1NCRC 4QHOA 3PU3A 4CXXA 2W0XA 1OMIA 4YVSC 1PGW1 3EYPA 1Y9QA 3BOPA 4AVVA 2HKXA 2ZHLA 4LXLA 2OYZA 4Y1XA 3MLKA 4ZONA 2IUWA 3VDDC 2Y6HA 4NWVA 3OGJA 5IVYA 2V09A 4FT8A 3O1RA 3E5QA 1RVF1 1WUVA 2IXHA 2VG9A 4B1LA 5DUVA 4OHVA 3CO2A 2VBPA 1AR73 3MUY1 5D8AB 4AVBA 3VBUC 3C2UA 3LDBA 1KQRA 2EIBA 1F2NA 2YBPA 1WLDA 5DDJ1 3BPZA 2HEVF 1EAH3 2IFWA 1QJEA 2RHPA 4LR4A 1NKGA 5J48A 1JYWA 5FREA 4CEYA 5JOXA 1JUHA 3PUSA 4D3WA 1RUJ1 2QUOA 1VBD1 3KB5A 4BQWA 2OQ7A 2WA4A 1UU4A 2JDUA 4GKXA 5KC5A 1LNSA 3DF0A 4COUA 2ZEXA 1N1VA 4K7JA 4XQ4A 4JTNA 4YVWA 3BUCA 1K42A 1S0GA 4IE6A 4P9JA 3ZYGA 5BNPC 2BOIA 5JSPA 1X50A 2W1WA 3ZN4A 1WLCA 3CZUA 3I2HA 3M3OA 4TWTA 4WM8B 5CFCB 3JD73 1SFNA 2NP0A 4ZZ5A 2ADEA 2HJIA 5F3EA 3GF6A 5FYYA 1EUUA 1PMHX 1POV1 1UCXA 3VZNA 5IK5A 4UI9L 1SFYA 1W6PA 3OTFA 3G7DA 4CU9A 2VR4A 4XJ8A 1PO11 2BBAA 1PZ9A 1B35A 2JDMA 2X29A 3CBNA 3POWA 4K9SA 5A7OA 2AH2A 3WP3A 4P9IA 1PHMA 4M3CA 4BIFA 3KV5A 3W59A 3ZYPA 1XSQA 4LK7A 2HEYF 4NHKA 3T08A 3BOWA 3T4HB 4AFAA 2W87A 2O1QA 1H2KA 1YC61 2UYBA 5FMCA 4XFFA 3SKJE 1SMVA 2UWAA 3MEPA 3R4UA 3SMHA 1YQ5A 2D6PA 2ZAAA 4CYDA 3IT8A 4XPVA 4C0BA 1A3KA 3WNMA 1W6MB 3V0AA 3FFZA 4CSWA 3BIEA 3O1OA 1K5MC 3QD6A 4MOAA 4WVWA 2IXCA 2ES3A 3KGLA 2DVDA 1LJ7A 2HEWF 1EV11 4GQ7A 4GWMA 5K8SA 3MUZ1 1PVC2 2W52A 4JX0A 4RS5C 5D8AA 4B7EA 4DQAA 3WSOA 5LBCA 2E32A 4LBNA 2E51A 2Z4FA 3MIEA 4CDUB 2AACA 1A6CA 1GYKA 4LO8A 4OMDA 5LRRA 1OC1A 1RVF3 4JV4A 4C1XA 1GANA 3ST7A 3WP4A 2AGSA 1TME1 4ONUA 4BH9A 1M06G 3QOPA 4I30A 3EQEA 4N43A 4M3CE 4N90A 5DDJ3 4AVTA 3CHXA 4AW7A 3TYJA 4CDWB 2PLV2 2ZTNA 4IEOA 3PMSA 1LOCA 1MEC1 1UW8A 1LHOA 2CNAA 1RUJ3 2O8OA 2Q30A 4EN9B 3PTRB 1VBD3 1Q8OA 4JAAA 4UFMA 1D0HA 2VTFA 3AZXA 5IFPA 1AR72 3OUIA 2JE8A 3OD4A 4IETA 5HXVA 4OQ9A
chains in the Genus database with same CATH topology
2CGNA 4OFGA 1LOAA 1YI7A 1X33A 2JENA 1EAH2 2GC2A 3ILFA 2OW4A 4IEZA 4FPYA 1ZYBA 2IXKA 1DIWA 4AGGA 1J59A 1V70A 3B02A 4RGAA 1POV3 2DURA 1UN1A 3NVCA 4XBQA 4L97A 3KMHA 5H9PA 2DUPA 3VBRB 1ULEA 1PO13 4MGYE 3WV6A 4PCRA 2HWB1 1AL0G 2WQZC 4ZU4A 3VBHB 3INAA 3M3EA 3JD72 2JG9B 1DGWA 4MXWA 5KHGA 1LGBA 1W6MA 1DGWX 5JVVA 3WQ0A 3KCXA 3RQ0A 4FAHA 1JTZX 2DU0A 3SCFA 3KT1A 2GNBA 3KCYA 2XBO2 4CDUA 2CGPA 2TEPA 2ATFA 3AXEA 4AF9A 3H1YA 4F8AA 1JBCA 1EV13 5DUXA 4WV8A 2ZMKA 2X8KA 3BB6A 1QQP2 4YZ5A 1LR5A 2I74A 3I59A 3RRDA 1TME3 1UL9A 5GZEA 3E6BA 3N7JA 3AKSA 4RHV1 4YGBA 1PGW2 2QQPA 1KRIA 2YPJA 1LEMA 3QBQA 1MEC3 2YDEA 2DVBA 3W58A 1O91A 1RVF2 3MPBA 5K0UC 3AYAA 3CLPA 4Q4V1 4Q8KA 5FPXA 4CEYC 2H6BA 2B39A 3AXDA 5DDJ2 4LLFA 1O5UA 1COV1 4FPGA 2B5HA 2PHXA 1RUJ2 1VAVA 4BIOA 3VBRA 1VBD2 1NY71 5C8WA 3VBHA 1D2QA 2D5FA 2JG9A 3WDWA 4JCKA 5CFDB 4NVPA 1QMJA 1W6NA 4IEVA 1I9RA 5CAZA 2HWB3 5K7PA 1I1EA 1O3TA 4R4XA 2BFUS 4YZ1A 1ALYA 3WY6A 1XYNA 5AFEA 1C5HA 3JBG1 3MLLA 5L73A 1H0BA 4A7YA 5FOJB 3VKLA 2GC1A 1CJDA 1LOBA 1PO12 2HWC2 2Y38A 1NG0A 4KH9A 2RS51 4P9XA 4ZU5A 2O0OA 4YLZA 2D3PA 1CAWB 3ZXAC 1FATA 2C9AA 4IEWA 4CDQA 4ES9A 5JLVA 4TSVA 1ZRFA 1OPOA 1ENSA 1EYBA 1GBGA 3JUUA 1S1AA 5T5PA 4AQSA 1QOTA 4MYEA 5EXOA 1IHMA 5JR7B 3B93A 4XQWA 2CL2A 2ZKNA 4S2DA 4Q4W1 2ARBA 4AG4A 1CONA 4BOWA 2EIGA 4LT5A 5FLHA 3A0NA 1EV12 4RHV3 3RWNA 1RC6A 5I0SA 2YC0A 4E2QA 2D93A 1JHNA 3WDUA 1IOAA 2JE7A 1TME2 1ZZCA 4JGZB 2DCZA 1YJKA 1FMD1 3CJIB 4Q4V3 2Z79A 1VB4A 4LBQB 1F5JA 4AEJA 3ILRA 1IKPA 4K20A 4QGMA 1VRH2 1COV3 4YW4A 5CFDA 1MEC2 4KU8A 1MVQA 2ZGSA 4WM8C 5CFCC 1WW6A 4OHWA 2GSYA 2XJPA 4FXKB 1H4HA 5FO7B 3FE5A 5E88A 2R30A 1RUG1 5J96B 1C4RA 1ZX5A 4XDQA 1V9U1 1H8TA 2JKBA 4SLIA 2WL1A 3JBG3 4I0WB 3FLTA 4U36A 2XJSA 4JC1A 2ZX3A 4AWDA 2F6BA 3KS7A 2ZOEB 1QOSA 1UD1A 2HWB2 2RS53 5JI9A 1O4YA 2E7AA 4HN1A 4R52A 5T5JA 4YG3A 5F6KA 4XF0A 1ND3B 5J09A 3WG1A 3V64A 1XU2A 4XOGA 1YWKA 4B3NA 2WWSA 4KL1A 4Q4W3 2ZHKA 2WA3A 5C9AB 2G4IA 1LHUA 3BIWE 2ZACA 1C3HA 2WNVB 2DVGA 2ZPXA 5GZDA 3FHIB 3KCCA 2BTVC 2Q5TA 1QXJA 4ISQA 4YM1A 2SLIA 5BNNB 1W0OA 2MEV1 4R9DA 2TBVA 1CPNA 1FMD3 5JPNB 4Q8LA 1GNZA 2WT2A 4LO4B 1DU3D 2D6LX 1J1LA 2ET7A 3LA3A 4BYYA 3PNAA 5JCTA 4XYXA 1CESA 1VBA1 4CEWB 3NO8A 3VKNA 1O3RA 2EAKA 1RUG3 1Y43B 3VZJA 1PM7A 4AFCA 4AI0A 3VBHC 1JXNA 1V9U3 2JG9C 3CU7A 4XFGA 1FOD2 1LOEA 1NY72 4M00A 3IDBB 1CD3G 4L11A 4Y1UA 1RMU1 4AYUA 2N7GA 4XW3A 5BXXA 4AVAA 4Q1RA 1C28A 3ZFGB 2MNGA 2C0ZA 2R071 4A3XA 5BYNA 2VW2A 4OI4A 3AKPA 1ZZBA 3S6PA 1QJY1 3JBG2 3ZFFA 3H9AA 4CP2A 2WZPP 3RYKA 2QZ3A 1UZYA 3AB0A 3O14A 5EZWA 3WLUA 4QPIA 2RS52 1Q8SA 3NV1A 3VZKA 3VL9A 3M3IA 2YMZA 4GMP1 3WUCA 2NQYA 3EXUA 5BNNA 3WDXA 3H1WA 1W6OB 2BWCA 1HQWA 1Y7BA 1SLLA 2JECA 4PIXA 3VLBB 5CFCA 4XFBA 2WQ4A 3O0VA 5FQ0B 5H9RA 3LOBA 2VU9A 4WZCA 1N47A 1DQ1A 1PO21 3CL1A 4Q4W2 1QH7A 2MEV3 4LTAA 3RMXA 1BEV1 1U5XA 1RINA 4CEWA 3D6EA 4UBHA 4PBPA 3VL8A 1WBLA 3BODA 4IXLA 4YGCA 1VBA3 1FMD2 2DUOA 4QT6A 3NV4A 1DGLA 2FBEA 3H1MA 2ZGTA 3LZZA 1MS5A 4QQOA 5E1RA 1J58A 2RR11 3DPRB 4AXOA 1RMU3 1A8DA 2GC3A 2W39A 1RUG2 4PJYA 3GBWA 4BZ4A 4XBLA 4K21A 1RHI2 1V9U2 2R073 3KQRA 1L3JA 1RUE2 4UXAA 2YV8A 1QJY3 1VBB1 1W6OA 3AX4A 3ZN6B 4O9GA 2UY8A 5JAXA 1PK6B 2I2SA 2WINB 5JDBA 4L8QA 2D5HA 3S7EA 4DZGA 5FQ0A 3N4MA 4GMP3 1RUF1 4P9LA 2UYAA 1SBDA 3VBOB 4KBBA 3GZTB 4URTA 4GA9A 2ZHMA 4LA3A 2KA3A 4HPKB 1HX6A 2TNFA 4FAGA 3NKGA 2ZX4A 1N1TA 3I2DA 2WLQA 1OPMA 1PO23 4W6WA 4JGZC 4ATEA 1BMV1 3CJIC 5CU1A 1I5ZA 1IS6A 1BEV3 4M01A 1BQPA 2OVUA 2UY9A 3AKRA 3IBMA 3IKWA 3N3HA 2ZJCA 4FO9A 3V0BA 1ULFA 2ZMNA 3E5UA 2JJ6A 3AZWA 4AHYA 2P3IA 2XB6C 2MEV2 2Y0IA 3USSA 3B9IA 3NW4A 2GAUA 1RITA 5JPMB 1WW5A 1BZWA 3M2MA 4I0AA 1ONAA 4YW2A 1OKQA 3RS6A 3IM0A 2IZWA 1G9FA 4LA2A 2PHWA 3DGTA 4N53A 1IS3A 1RUH1 1VBA2 2RR13 4XQDA 4B4QA 1GR3A 4HFSA 2ZX2A 4MLOA 4BMEA 1VBC1 4KWJA 4XJ9A 3HMYA 3ILNA 4XFCA 3ZN6A 5HCBA 1PK6A 3M8LA 4TZDA 4WBBA 3ZXGA 3ZPYA 1ND3C 1VBB3 1LU2A 3VBOA 1I6XA 1NA1A 2XG3A 3RI8A 1CAVB 3WNXA 1LHVA 1N1YA 5ACA1 4HPKA 4LE4A 2VQ0A 1S0FA 2H0VA 5C9AC 3ZXLA 2R072 1RUF3 3JB4C 4G4FA 2WNVC 2BUKA 5IT6A 1H8VA 1DDLA 1QJY2 3TRSB 4YNIA 5J98B 4Z2WA 2WZR1 4LEJA 5BNNC 2VOWA 3USUB 3LSDA 2D44A 2ZGLA 5AFBA 3WZ1A 4H14A 3TWIA 1WW4A 2FHRA 5H9SA 2HWE1 4YFWA 3EO6A 3UK9A 3ZMNA 4I01A 3RZZA 2ZCWA 1PO22 3RYRA 1YIFA 4CEWC 1BEV2 4AQ6A 3TNQA 2ET1A 1FPN1 1LOGA 3KLSA 5E8AA 4C91A 4JGYA 5FLIA 3I4IA 1UPSA 3KM5A 2VVEA 3TOJA 3HIFA 3LB9A 4RSUA 3B01A 3VZLA 3PTYA 5FCCA 2GNDA 3K48A 3U11A 1QHDA 1RUH3 2DV9A 3ACLA 2R1DA 1SQ4A 3OCPA 5L19A 1A8MA 3OD0A 4OHXA 5I8TA 2CGOA 4C90A 2JICA 2YYOA 1PGSA 1V6JA 1VBC3 3ZMOA 2NLRA 3KZ4C 3WR0A 3ZFGC 3ZSJA 1CAVA 2H6CA 1HIXA 5FO9B 2ZA9A 4DRVA 2X5IB 2RR12 5I0RA 4AEDB 4KNCA 4P9GA 1UKGA 3QH6A 5EJ3A 5ACA3 5C4WC 1AX1A 1MS1A 2B8MA 2V5YA 2ZGKA 4K1ZA 1LU1A 3USUA 1XNDA 1KS4A 2JX9A 5LEKA 3FUOA 3TNPB 2FMYA 3ZIXA 5BNQA 3V0AB 5GLUA 1EY2A 4EV0A 2WZR3 1WW7A 3OF1A 5BPXA 1VP6A 3B5LB 1H1AA 1QOOA 2VQAA 1RUF2 2B45X 3AYEA 5DZGA 3DUIA 2BPA2 2CAVA 2HWE3 4X8PA 2CTVA 1WBFA 2ILMA 3FZ3A 2PYTA 4Q0UA 4MV2A 2VPVA 4GB32 4DY5A 4N43B 3IIAA 2VNRA 1NXD1 3MGUA 3SISA 2I07B 5GLVA 1FPN3 4P5HA 1AZDA 3T2TA 4FOWA 4AHWA 2RMU1 1VBE1 5DG2A 4Q0SA 5JOZA 2D6OX 2LM3A 3DPRC 5F5QA 1VJ2A 2X5IA 4RQPB 4AEDA 3D5OA 4CP0A 1ND2A 1WD4A 4AFDA 3H8UA 1AJKA 5D1IA 4F83A 1OI6A 1XE7A 1GNHA 1RUH2 2QJVA 3P3PA 2WIIB 3B3QE 3HQXA 4YRDA 4GH4B 3QLQA 1HRI1 2A71A 1PK6C 5FO8B 1XNKA 4DRRA 3M1HA 4OLLA 5DUWA 4MXWB 1YCIA 3CJXA 2R6QA 1GKBA 2OUHA 3VBOC 3ETQA 3ES1A 1GICA 2IWGB 4FOYA 1URXA 5L7OA 2VOXA 1OLQA 2G9FA 3VZMA 5ACA2 4E2SA 1CJPA 4JTOA 3ZO0B 5C8CC 4DS0A 5GM0A 2GH2A 5E16A 4ORFA 5C33A 3I59B 3WD5A 2ZZJA 2XJVA 4MGIE 2WZR2 1UKRA 2W08A 3J26N 2VH9A 1LB2A 1TQ5A 4XXPA 2EALA 1VAKA 1V00A 2RMU3 3POSA 1VBE3 4R9AA 1LRHA 1AF9A 2Q1ZB 4RQPA 3W9AA 1V6LA 1OD5A 1AXKA 2P2KA 2TUNA 2K9ZA 3HWJA 1REFA 3WDYA 1DHKB 1HDKA 3LCPA 1QXRA 1FPN2 4K8FA 4HLTA 4W65A 4HSLA 2PHTA 3VHOA 1PZ7A 3N35A 4NWWA 2K2SA 4GH4A 1SLAA 2RS31 1GZCA 5GZCA 2IXIA 4FCAA 1OOPA 2ENRA 4FVVA 4QPGB 2PHLA 3K51A 3PVNA 1G9CA 1W6NB 1QH6A 1BVVA 4G3YC 2XLGA 2Z69A 4IQPA 1HRI3 2P3KA 4WZFA 4FSJA 2R061 1H1IA 4Q0QA 1PGL1 2Q0AA 3NAPC 1AYM1 1YI9A 5EYYA 1FNYA 4Y20B 4XEZA 1PZ8A 3AMMA 1XXNA 3WQ7A 4XTMA 4LO5B 2MPFA 4CDQB 3IDEA 1KITA 5GJ6A 1KXGA 1SDWA 2DF7A 4COYA 1FT9A 3NL1A 4K6BA 1H9PA 2QDNA 2XWJB 2ERFA 3APBA 1BYHA 1FX5A 1X8MA 4FQ4A 3UV9A 4DXZA 1V6IA 1WA4A 1ZZ9A 3RYPA 3EJKA 1R1A1 4HZFA 1MS4A 2A3XA 1YJLA 5ABJA 4HVRA 1MZEA 1YFXA 2WSUA 1TNFA 4IV3B 4FPLA 1ZZ7A 4YW1A 1YLLA 3ELNA 4F3JA 1ZZ8A 4MH0E 3SCGA 4Q29A 5IK4A 2D7FA 2A6WA 3AP7A 3ME2A 4YVWC 5BNOA 1KDMA 4D7TA 2XH6A 4QPGA 5AVPA 5FBZA 3RG0A 1TE1B 2OIIA 3I8TA 2R1BA 1W0PA 3VN4A 3WVJA 1E57A 3J4UH 3MIBA 1VBE2 4DPNA 2RS33 1ZREA 3AMQA 3VKFC 5JSRA 2XPJA 1RGSA 4Z8BA 2AUYA 1CAUB 2X5IC 5EFUA 1BXHA 4H3WA 1B35C 4FPKA 3OGGA 2VGDA 3O12A 4BWOA 1H8TB 2PAMA 1NZCA 4Y20A 4FPOB 2R063 4NO4A 3UL2A 1O4TA 3WUDA 4YW5A 4AI3A 4Q2FA 3KD4A 1AYM3 3VBFB 5FAXA 3VZOA 2GH8A 2ZGMA 3WDTA 1HRI2 1QDCA 2AR6A 3MLJA 2HWD1 1NQDA 3R4DB 5D8AC 3B69A 3OY8B 4JRAA 1NOVA 1JYIA 3TBDA 2CAUA 3ECQA 1YFWA 4D7YA 1SCSA 4CZSA 4DOUA 2XGXA 1SLBA 4QGLA 5LK5A 4IV3A 1DLLA 1R1A3 2VVFA 4N43C 4XFAA 4IERA 2VVDA 2XHKA 4FTSA 2GALA 4X8NA 2XL9A 3AP9A 1XU1A 5BUVA 1GSLA 3FC0A 5LK7B 3FJSA 2PN5A 3NKTA 3H7JA 2R0FA 3E97A 4YM3A 1UMZA 5FMOL 1IKQA 1CAUA 2ZKLA 1R081 2Q8OA 3AYCA 1PNFA 4RQPC 3JQXA 3OJBA 4JDMA 3J8F1 1W6QB 3MW4A 3UKTA 1LOFA 2LTNA 1ZRDA 4MSVA 5AC91 5CG8A 3GHMA 5HCFA 1RJ7A 4LBLA 4R9BA 3FBMA 4AGRA 1QF3A 4GH4C 2VNGA 1CN1A 3VBFA 3AKTA 4I09A 2NMOA 3OBRA 2E9QA 4YGEA 1ENQA 3IN9A 4S2FA 1UU6A 1V6NA 4Q1PA 3A4UA 3OY8A 3TAYA 2B7YA 2BVBA 1AJOA 5DG1A 4RD7A 4CDUC 1RUOA 1HXS1 2VMGA 4OHYA 2HWD3 3M4FA 3RNSA 4WVMB 4YZ2A 2P17A 1O7FA 3HT2A 3QH7A 2UURA 2Z42A 3ZFFB 4OI0A 3GZAA 4I2OA 1AYM2 4JRLA 1F9KA 5LRSA 4QPIB 2RS11 2WS91 1SEFA 4I02A 1AR61 1UIJA 1N3OA 1U0AA 4LULA 1XQNA 2BWAA 4RHV2 2PA7A 1M4WA 2XUMA 2DFCA 1ZBA1 2ZX1A 2WT0A 3LKJA 4XXAA 2PAEA 1W2UA 1UIKA 1G6NA 1R1A2 4W6YA 4C1WA 1W6QA 5DZEA 4MGKE 4QQHA 2A7AA 4Q4V2 5DXDA 1RTVA 1R083 2JG8A 5A33A 1G9DA 4OUSA 1F5FA 3VBRC 4XIKA 1COV2 3WG4A 1C1LA 1OFNA 1RUD1 2FZ1A 3J8F3 4Q27A 5JWPA 5KXEA 4YG6A 4D7SA 1CAXA 2A6VA 1JOJA 2ZABA 2DTWA 5JZGB 5AC93 2VNOA 3KT4A 3ATGA 4FXGB 3NV2A 4C0HA 2A6ZA 3V56A 3AP4A 1XRUA 4INDA 4BHPA 2A6YA 2WNEA 1WLTA 3POYA 5EV7A 2VMHA 2NM1A 2EXKA 2V73A 1B09A 1AR81 4WVMA 4H7MA 3R6SA 4BQ1A 4EN0A 4OZXA 4IEUA 1FAYA 2P3JA 3NV3A 2ZHNA 4XTPA 3JU9A 1HXS3 4QX5A 4CDQC 4TYSA 1J3QA 4LO7A 1X8EA 4EWEA 1MZ5A 4IEXA 4HKWA 3H50A 1U5YA 1R091 2P37A 4UW6A 2RS13 2WS93 4DNYA 2OA2A 1REEA 2WKKA 1N3QA 3R4SA 1F8VA 2D97A 1S0JA 2HWD2 1AR63 3NWKA 1O5LA 1OA4A 2C5DA 2VY0A 3GBFA 5K9YA 5H9QA 1FV2A 2ZAHA 4SBVA 1V6KA 2IXLA 4IV3C 1ZBA3 4BE3A 3ZXFA 4NHLA 4QXKA 2A5ZA 4IESA 4AQTA 1XE8A 4PLNA 3VDDB 3V0BB 5CFDC 5JZGA 4N9IA 2VUAA 3D0JA 5CG9A 4PLOA 1RUD3 4Z92B 3GHNA 5KWRA 3KGZA 3MW2A 2BYVE 4HT1T 1EPWA 2BBVA 1R082 4EROA 3CEWA 3AKQA 4FP2A 5GKAC 1YO8A 1H8TC 2A3WA 5CIRA 4XJWA 4N53B 2XLAA 3J8F2 1O3SA 4Y24A 3MF9A 1ZBE1 2RJLA 1QJX1 2EAAA 4N7IA 5KHKA 1H4GA 1QNWA 1AR83 1H2LA 2CY6A 2DYCA 4MUVA 3WX5A 3ZYIB 1AXZA 2P34A 4JVAA 4LE3A 2WNUA 2BQPA 3U10A 2HWF1 1NE6A 4N7UA 1BJQA 5J3UA 5JIAA 1NA1B 1CVNA 5I91A 1X36A 1R093 2R49A 3O0WA 5GLZA 3AK0A 3IWZA 1C5IA 1XYPA 2B46X 4H55A 1HXS2 4GWNA 3SH4A 1NCRA 4YVSA 4FPEA 1RB8G 5A3LA 2DWRA 5I0UA 2XVGA 1AX2A 3VDDA 1QJZA 2GMPA 1JW6A 3T1MA 2Z2SB 1NE4A 2VOKA 2RS12 1K5MB 4K1YA 1Z7S1 4HSJA 3VBSB 1VB2A 4XJZA 1AR62 4CRQA 2UWCA 4I0BA 3GZUC 1DBNA 2DFBA 2WC2A 4XMAA 3WQ1A 3E6DA 2GNMA 1ULGA 4COZA 2Y0OA 3RI9A 4S2HA 3U07A 1AX0A 3WINE 2GC0A 1YNAA 2E7QA 3PVEA 4BPZA 1CPMA 1AXYA 3G6JB 2RM21 3AJZA 3AMHA 4JGYB 4L92A 4WVVA 3ASIA 4L2NA 3ZVXA 5JIUA 5F1RA 3I54A 1RUD2 5A32A 1XNCA 1IS4A 1FNZA 4QM8A 1HQLA 1FV3A 1ZBE3 1QJX3 1DQ2A 1G7YA 1YHFA 3RJRA 1NLRA 1SBEA 2DTYA 4OHZA 2K0GA 1RMU2 1S55A 5JOYA 2VW1A 5BY5A 1OSGA 2A3YA 1S0CA 4GALA 3HT1A 2HYKA 1LGNA 5KC6A 2HWF3 4YZ3A 2XKOA 1TNRA 3ZFFC 4GXLA 3PMEA 1AR82 5T55A 2FQPA 2QCSB 3H3UA 4QPIC 1QJU1 1BVP1 1K5MA 4IV1B 3VBSA 1BCXA 3THPA 4GKYA 1Q56A 1MS0A 1QDOA 2NMNA 4GIQA 5LEJA 1Z7S3 3LOIA 2IC1A 5KHIA 1S0EA 2PLV1 2R041 2XLFA 2RJKA 5GZFA 3ZSEA 1S2BA 4Y5Z0 1JH5A 1WCDJ 2DCKA 3MPPG 3E5XA 4HANA 1C1FA 3PJQA 1OLRA 5JZGC 1UZZA 2RM23 3OBTA