1KS5A

Structure of aspergillus niger endoglucanase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
QTMCSQYDSASSPPYSVNQNLWGEYQGTGSQCVYVDKLSSSGASWHTEWTWSGGEGTVKSYSNSGVTFNKKLVSDVSSIPTSVEWKQDNTNVNADVAYDLFTAANVDHATSSGDYELMIWLARYGNIQPIGKQIATATVGGKSWEVWYGSTTQAGAEQRTYSFVSESPINSYSGDINAFFSYLTQNQGFPASSQYLINLQFGTEAFTGGPATFTVDNWTASVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title Determination of the structure of an endoglucanase from Aspergillus niger and its mode of inhibition by palladium chloride.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ks5A00
1HIXA 3VZLA 1XYNA 1XXNA 2D97A 2C1FA 4HKLA 3AMPA 4XQWA 1HV0A 1IGOA 2DFCA 1REEA 5EJ3A 2F6BA 3VZKA 4H7MA 3WP6A 4XQ4A 2DCKA 2BWCA 3WP3A 4HKWA 2BWAA 3MF9A 1UU4A 3VZMA 5K9YA 3VHPA 1NLRA 3VL8A 3WT3A 2QZ2A 4HK9A 1OLQA 4S2FA 1BCXA 3VHOA 3VZNA 4XPVA 2DFBA 3RI9A 3WQ0A 3AKSA 2BVVA 1ENXA 3VGIA 1H4HA 3AMQA 3WP5A 3WQ7A 4HK8A 1QH6A 1UKRA 2NQYA 1BVVA 3LGRA 3B7MA 3AKPA 1QH7A 1KS4A 3AMNA 3VLBB 1OA3A 2DCJA 1H1AA 3O7OA 1XNKA 2QZ3A 3EXUA 2JEMA 1F5JA 2VG9A 3WP4A 1KS5A 1UU6A 1OLRA 3MFAA 1W2UA 3RI8A 4S2DA 3AKQA 3WX5A 1BK1A 1T6GC 1UU5A 3VHNA 1C5HA 3VZOA 3AMMA 1REFA 2Z79A 3MF6A 4XQDA 4HKOA 4S2HA 2B45X 2NLRA 3AKRA 4NPRA 1M4WA 3ZSEA 1REDA 2DCYA 3LB9A 3AKTA 2D98A 3AMHA 2VULA 1OA2A 2B46X 5HXVA 3VZJA 3WY6A 1H4GA 3WQ1A 1XYOA 2BW8A 5K7PA 1YNAA 2JICA 3M4FA 3VL9A 1OA4A 2B42B 1XNDA 2VUJA 3WR0A 1XYPA 4IXLA 2VGDA 1XNCA 1H8VA 1HV1A 1PVXA 1C5IA 1TE1B 1AXKA 3B5LB 3WXPA 4S2GA 2JENA 2DCZA 1XNBA 3MFCA 1H0BA 3HD8B
chains in the Genus database with same CATH superfamily
3ZN6B 3AFGA 1AL21 1CIWA 2WNVB 3POWA 3HQXA 4OYUA 2ZHKA 1GNHA 1YFYA 2VECA 3WF3A 2WQ8A 3VDDB 2JDPA 2JG8A 4AEKA 4AZZA 5GZDA 1RINA 1QJU2 1VRH1 3R4UA 3RYPA 5A6XA 3I2OA 3H1MA 5FYSA 3WP6A 3TYJA 1Y3TA 5I0TA 5M0TA 3GCWA 5KXBA 4R9BA 2K46A 3GYDA 1JMUB 4Z8BA 3PVNA 4LKDA 3ZKYA 2JJ6A 2CHHA 2P1BA 2RS11 3HQRA 1NLRA 2PHFA 4FBFA 3POGA 4NIHA 4HVQA 4FTBA 4DEVA 1PO12 2IVIB 1GOHA 4ISRA 1SBEA 4RSUA 4RFRB 3WQ0A 5EIYB 2PHWA 2VPVA 2YV8A 3OBAA 3VBOB 4YVSB 5F5IA 4Y3OA 4ZPIA 1IPSA 1AYM1 1YIPA 2VBBA 1K45A 1V9U1 2JDHA 3F95A 1S0IA 5C8CA 4D8MA 4QDSA 4KWLA 4JDMA 5L9VA 1AR73 1AZDA 3PTYA 3H8RA 1FPN2 1BMV1 4COZA 1L3JA 4KWUA 1QGLA 1BZWA 5HI0A 4EROA 2R041 4NIGA 1PNGA 1S1AA 5L7OC 2Z2SB 2D6LX 1RUF3 1LESA 3ZYGA 2JG8B 4S2DA 3AKQA 5EV7A 4LHKA 1FMD3 3ACFA 3CBNA 1RUG3 2JDZA 2Y8KA 2W95A 1DLLA 5GZFA 3G7DA 1AR61 2WKKA 4QM9A 4XUNA 2QUOA 2W9XA 3VBUC 4JTNA 1TVGA 3A22A 4GIQA 3OBTA 1ACCA 3AVRA 4BXFA 5DAWA 2DVGA 4MOAA 5C71A 2I07B 3QOPA 4UFMA 2J22A 5C9AC 1QDOA 4K3UA 4R8HA 2HYXA 2RG4A 4HSLA 4UW4A 3CZUA 1UX6A 2WNOA 4XFIA 4CCJA 1HN0A 1XB9A 4FQ4A 4UI9L 4H2AA 1WCQA 1JXNA 3KM5A 1YWKA 2VAUA 5T5JA 4IL7A 4AVCA 1AR93 2UYBA 1AX2A 1AR72 5FUPA 4NRMA 4DQAA 2Q1FA 4HPKB 2VUJA 2ZMKA 4HXCA 3BOPA 1E57A 1W3XA 2XJQA 4K1ZA 1WLDA 1GWKA 5CADA 1ZA7A 1N1VA 1NLSA 2OZ6A 2OA2A 2VMGA 1CWPA 1CJDA 2Y6GA 4YGEA 3SXWA 1W8UA 3H3UA 3AM2A 2EIEA 3JZVA 3WXPA 1LGCA 2W1SA 2YGLA 1HLCA 4OZXA 3RVHA 5FTTC 4CU9A 4H14A 3IDBB 2JENA 1BK0A 2VZ3A 3BKZA 1PZ7A 2ZEWA 1JW6A 1DF0A 1OLME 2ZX0A 3K4AA 5FK7A 2Q5TA 4RFT0 4TYSA 3T1MA 2C1FA 1IS4A 2Z42A 3ENRA 4NAOA 3DL3A 5F8PA 1JYCA 4ONUA 5JPNB 1ULFA 5FZMA 1OC1A 5F7UA 3RZHA 3GGLA 2Q1MA 4K20A 1RUE1 2QTWB 1PGSA 2W2IA 1HRI1 2BWCA 5FY7A 4IE0A 4PF5A 1FAYA 5FK8A 1R1A3 5T5OA 2BWAA 3H8XA 4B7KA 1UWWA 4JGYC 1ASJ2 4O61A 5FY5A 5JSOA 1VBC1 4R4XA 2Y33A 5C9AA 1AR92 1QJY2 3IDAA 1ZZ9A 4ZXKA 1AJKA 1DZRA 3SEEA 3KS7A 4F3JA 1UZZA 1W8NA 5A3OA 1C1LA 5A3LA 2JKBA 3CKHA 5FP9A 2ZTNA 2BJSA 4GMP1 3A0NA 4P02B 1QJZA 1DQ0A 2BNNA 1ZRDA 3QACA 3M3IA 4CP0A 4E2GA 1SLTA 2HWB3 1YEWA 3SCHA 1WCDJ 4QB1A 1GP4A 1Q5OA 5FZHA 3HN1A 4XACA 4AVTA 1D4VB 4FSJA 4B3NA 2CYFA 4XCBA 3LPGA 4K8FA 4XFAA 2ZACA 1Z0HA 2VG9A 1W0OA 3IDCB 4Q4V3 3T0AA 5IHRA 1LOEA 1OKOA 3O1UA 3VBHC 1UU6A 2LRPA 2B9VA 1O3QA 2XPJA 4OHXA 1PMHX 2RJLA 1ZA4A 3J7HA 5F1RA 3BIWE 4L0PA 1GZWA 2GNDA 2WQZC 1ULGA 4AI0A 1HB1A 1CN1A 2XJPA 5EXOA 2E53A 1V6KA 1H6XA 1JOJA 4XFCA 4Y1UA 2ZGUA 4EQVA 1I1EA 4KQ7A 5IK5A 2FDKA 3GZUC 4LE3A 3WDYA 2WFF3 4GB33 2EICA 3R4SA 4Z2AA 4D7YA 2XBO3 1UIKA 1CZTA 3I2IA 5FZAA 2WT2A 3NV1A 3IWZA 2ZGLA 4Y5TA 5CU1A 5F37A 3AXDA 4JGYA 5FZ3A 4Q0QA 5LY2A 2ORXA 3THTA 4ARYA 3GM8A 4IGQA 1CR7A 4LO8A 2NN8A 1LJ7A 5L36A 2WAOA 1ULCA 4NPMA 4AHYA 1G9FA 3TAYA 1FNYA 2XUMA 1WCSA 3D0SA 2Y0IA 4JDOA 2BTVC 1YHFA 1UXXX 2QQMA 2W52A 2ZKNA 3M7AA 3O14A 4MSVA 4ATFA 4CUAA 4WM7C 1LCLA 3FFZA 4FVVA 4Q4V2 2VBPA 2VH9A 3J8F2 4HVRA 2VNGA 2XQXA 4LK6A 1GZWB 2VNRA 2X8KA 3K2OA 3JCIA 4E4ZA 2EIDA 1ST8A 1W9YA 3UGHA 3HVDA 4B7EA 3V0BB 2OZJA 3IPVA 3UGFA 4V2VA 2Y6KA 3EO6A 5KHGA 4LULA 5FZLA 1ODMA 2KA3A 3U14A 2DDUA 3VBHA 4LBMA 4GB32 3GZAA 2ILMA 4IV1C 1D2SA 3KZ4C 2XBO2 3ZMNA 3VUOA 1YQ6A 2QQOA 5EZWA 3WLUA 4LLFA 1PIV3 5A7NA 3OTFA 4JGYB 4RHV3 2XR4A 4CP9A 4WVMB 2OUHA 5LEKA 5FZOA 4CUGA 3K3OA 5T54A 1OT5A 4INDA 4LBJA 5FIXA 1STMA 4XAAA 5EJZB 3MIEA 2Y6JA 1AYN1 4A44A 4AGRA 5FP4A 4GWNA 4KG8A 3U1XA 3VZNA 2ZX1A 3WUCA 1BJQA 1QIQA 2YBPA 1G9AA 4QHZA 4ZZ8A 5GLTA 1O5LA 3L2YA 3IAQA 3LOBA 3LA3A 3LFIA 3KWVA 1RHI1 4JQTA 4I09A 3SH3A 4XUTA 4W8JA 4ASKA 2A73B 3M3CA 4LORA 2PN5A 4XBQA 5A6ZA 3AZWA 2ZX2A 4WM7A 3WCSA 4X6RB 3FHQA 3RJRA 3K48A 2AZ5A 5ABJB 4CCDA 2VW1A 2HBTA 4DO0A 3MFAA 4E2SA 4N8MA 2IXJA 2E7QA 1ZVFA 4F8AA 1PVC3 3HQUA 1Z7S1 4Q4W1 3I2FA 1PIV2 2VZVA 3POSA 3WF4A 5FZOB 2BGPA 2K0GA 2VO5A 4I3PA 4Q1RA 4UWDA 5FYHA 1UOBA 2QE3A 4KBBA 1REFA 3WG1A 4PDWB 5FFOC 3ZN4A 4JCKA 4ZU4A 3HT1A 2HWF3 1O59A 1YRZA 3V65A 4DUXA 4IV1A 4Q0VA 3AP5A 2VQAA 2PHDA 1OMIA 4IE7A 3UJQA 1EAH2 4BB3A 1RUNA 2AEZA 4U36A 4XABA 2VVDA 1ULEA 2UWAA 3PMSA 1WLWA 3TNPB 2RS31 3S0MA 1JZ8A 2G9ZA 2WZ8A 3DXTA 5FUNA 4BQ3A 2R071 1X33A 1CPMA 3UESA 2DTYA 2R49A 5GLVA 5CFCC 1F15A 5FZ9A 1OLMA 3FWEA 4XZUG 1VR3A 4WM7B 5C5TA 3AL5A 3LD8A 4QPGC 2FMDA 1XNDA 4OI2A 1ND3B 1SFNA 1CZVA 2XJRA 5LRRA 1AL23 2VXJA 4C0BA 1HQLA 1NE6A 1ZBE1 4E4SA 1RUD3 2EF6A 1UY0A 1PVC2 2OKXA 4DXRA 3GF6A 3M2MA 5LBCA 5I93A 1ZZBA 3VB9A 1VRBA 5LA0A 2C26A 3E6DA 5EFUA 4D94A 3UKTA 4DY3A 1CPNA 3KT7A 5FXZA 4D69A 4R9CA 1JZ6A 5LB6A 3T2QA 4ARXA 1VB2A 4CUBA 4IV1B 2WWSA 1S55A 4L99A 2HWF2 4B4PA 2PAKA 4K6BA 1NY71 4ISQA 4LEJA 4QX1A 3UETA 5E8AA 5CG8A 1FXZA 1WMFA 5JOWA 1JYTA 2DFCA 4HMZA 1B35C 4NHYA 1QU0A 3OEAA 4TZDA 1O4ZA 1Y7BA 2DBNA 5FYMA 3VZKA 1SFPA 2VOXA 4Y4YA 2YUEA 5AFBA 2DCKA 1RUI1 4NHMA 5KHHA 3SKJE 3U4SA 4H55A 4BK5A 1F35A 1KFUL 3WW4A 3ZXEA 4AI1A 1L7RA 1GNZA 1UU4A 1V9U3 2OQ6A 5DUVA 4MHRA 3MW4A 1YFWA 3MV01 4A7ZA 1IHMA 3NJVA 1TMF1 1YC61 1OQDA 5I0DA 1BBT2 3LSDA 1KFXL 3OY8A 3QCWA 5DAVA 2D6OX 1HXS2 2NMNA 4AK3A 5BNNC 4GKYA 4AGGA 1JH5A 1OVPA 2RM23 3SNMA 2G9GA 3VGIA 2VR4A 4MGTA 3WQ7A 4AVSA 4HONA 1LHUA 2YXSA 1BHGA 4NRQA 1DQ1A 1RUD2 1US2A 3HOBA 3HT2A 5FXWA 5BUVA 3M3OA 3VKOA 1S0CA 3EB7A 3N9OA 3FE5A 3UKNA 2D6MA 1QQP1 2EXJA 1WCUA 1DDLA 1LENA 1PO21 5DAQA 1AR63 4E27A 1H1MA 5CAZA 5LEJA 1DGLA 4QPGA 4ZU7A 2GMEA 4O9EA 2XDVA 3O7OA 2E6VA 2JEMA 4UBHA 1F5JA 4D0QA 3NNFA 2PELA 1X82A 4NN0A 1WW7A 3FX3A 1W2TA 3EJKA 3JD73 4XILA 3AJYA 5GLUA 5LRSA 4IGPA 4HFSA 2HWE2 4ES8A 4UW6A 3KMHA 4AW7A 3BUCA 2VOVA 3DUIA 2ZABA 5A7PA 4DXTA 1PK6B 1DBNA 3H0OA 1QWRA 3BTZA 4G4FA 5JWPA 4JTOA 2XKOA 3OY8B 5JI9A 3CJXA 5FZFA 4D7SA 5FKBA 1N3PA 1J83A 3KV5A 1B35A 1S2KA 2HWD1 3P5BA 2TBVA 3R0RA 4YVWC 2PYTA 3WHUA 3NV2A 2D98A 4UFIA 1HB3A 5L73A 2RM22 3RZGA 1MS5A 5D8AB 2XGXA 4QGMA 5BNOA 1NKGA 2JDUA 5SV8A 1C8M3 4ATEA 1NCRC 1S2EA 4PLOA 1GQPA 3WV6A 4B1LA 1XOYA 2A6ZA 3APBA 4R9DA 3NAPC 5T52A 2YBSA 1BEV1 2C0ZA 1H2NA 3MDPA 4UOJA 2XHKA 4QPGB 1POV3 5BNNA 4LE4A 4LHLA 1JI6A 3HR9A 1WGPA 2BOIA 1JYNA 1GMMA 3BOWA 4EZHA 3I7DA 1HB4A 4BHPA 3I4IA 2WS91 4BQ1A 3OGJA 3NNJA 3ZXDA 3JD72 2Y64A 2Z69A 4P9LA 5DZGA 4CDUC 3BODA 3U78A 3KQ4B 4PT6A 1VBA2 2Q30A 3MLJA 1RUE3 4QT6A 2XG3A 4Q5OA 4UW5A 3AVSA 4YGCA 1JHNA 1HRI3 1UMHA 5JPMB 2ET7A 4GALA 2JKXA 3EYPA 2VZOA 3K77A 3TEWA 2CGPA 3S57A 1SBFA 3NJYA 2ADDA 4GWMA 5CIRA 4A45A 1VBC3 1HIXA 1BXHA 4UFKA 4EN8B 1ZRFA 3CJIC 4LNVA 5IAVA 4MGYE 1BKZA 5FZGA 5I8SA 2LROA 4QXCA 4OI1A 4C8DA 1MS9A 3CQOA 2OPWA 5CKNA 2XVLA 1WKYA 4YG3A 3TN91 1DYPA 1X50A 2R0HA 1J1LA 3LOIA 4AXOA 5I0RA 4X8NA 1D0HA 1C8M2 1YLLA 5CNAA 4DMIA 3PDQA 1LHOA 1MACA 4N7UA 4UBGA 1TME3 3S30A 1NOVA 5G05L 3GBGA 3KVAA 2QCSB 3B9CA 5FKCA 4AEDC 2HYKA 3AP4A 4OMDA 4EE2A 4YVWA 3AP7A 3D0JA 3ZPYA 4TSVA 3ZFGC 3DYMA 5A7SA 4A6OA 1ULPA 2VW2A 2BGOA 1ZNPA 5FZ4A 4H7LA 5F3EA 3E5UA 1NCRA 1R083 4C91A 5FYCA 1POV0 3NAPA 5IUQA 5EPAA 2K9ZA 2RE9A 4OI4A 5FYZA 3W58A 4MO3M 1JZ5A 3H3ZA 5FP8A 3LQCA 5CYYA 4XJZA 1RMU2 1XC6A 2RS53 2VTXA 4BMEA 1ZZ7A 2AUYA 3K75B 1OKQA 3MHZA 3WG3A 2C9AA 3GZEA 4OZOA 4MH0E 4XJ8A 3LEKA 5KXEA 3MUY1 4LBQB 1LHVA 3AYDA 4AI3A 4CDUA 5GM0A 3WNOA 1BQPA 1MEC1 3RDIA 4BYYA 3HBZA 5C3QA 2ZJCA 4ZKTB 3BI3A 4J1WA 4YG6A 4GJZA 4QD2A 1GLHA 1TME2 1VAMA 4QQ2A 1W8HA 2JD4A 2ARAA 1JYIA 4YVWB 1SDWA 3CJIA 2QQVA 1DIWA 3AZXA 3DN7A 2XWJB 1YJLA 2A5ZA 5GZEA 4EN9B 3E1F1 2FMYA 3R05A 4NVPA 4I0BA 1K5MB 4FFGA 1NCRB 1RUH1 3NAPB 1SACA 4GWIA 3I3DA 1R082 1UOFA 4FTEA 4JHTA 5DDJ3 1SPPA 4OHZA 3IN9A 1KDMA 1G6NA 3FN9A 4TXWA 4AEDA 5ACA1 1ZX5A 5FPXA 5HCAA 3NSTA 1FOD1 4YW1A 3WW1A 3MIFA 4WM8B 2RS52 3N7LA 5FY0A 4ZHNA 1AVBA 1Q56A 5EQUA 3ZFGA 3WCRA 1W6QA 2EAAA 3D5OA 1W6NA 2V73A 3NWKA 4ZU5A 3O0WA 3P3NA 4DNYA 4EWAA 4X8PA 2VZRA 2ZOEB 2J1RA 3T0BA 4CDUB 2FBEA 3WSOA 3HNYM 4NHLA 3K4ZA 4C1WA 1A8MA 1LOAA 2QQNA 2EXIA 4QAWA 3N7MA 3FLPA 5EHDA 1H6YA 1GZTA 3O12A 5A80A 3OPWA 2CL2A 3S7EA 3X29B 4N43B 1QOTA 1W0NA 2JB8A 1U5ZA 4DS0A 4RD7A 1OI6A 4K40A 4UF0A 5LCWL 4W6XA 1O5UA 1AHSA 4JGZC 5FPVA 4BIOA 1ZM1A 3DXUA 4DOUA 1OQ1A 4RGAA 1DG6A 4W6WA 3NMBA 2FZ2A 2JB4A 4TLFA 2Q1ZB 1XSQA 4IE6A 1V0AA 1W0PA 1V6LA 3ITQA 1TNFA 3WQBA 3MGUA 3WNNA 4HETA 2Y6LA 5DMYA 1P8JA 4AEDB 5DDJ2 3OYWB 2R063 1TZOA 3CU7A 3HIFA 3N4MA 5BNOC 4X6QB 3WF2A 2YFUA 5FO9B 2AEYA 4XMIA 1HQNA 1BCXA 1W6QB 3M70A 1W6NB 4YGBA 4Q4X1 4QKDA 1EV11 1LOCA 2OX0A 5AC93 1RJ7A 5CG9A 4YRDA 1XBFA 2Y6HA 1GQHA 3LEIA 4OUMA 5K4LA 3WW2A 4RQPC 3WP5A 1RB8G 5FV3A 1RVF1 3KF5A 5E88A 4Z1VA 4Q4W3 4N90A 2WSUA 4FP3A 2R7EB 2ZKLA 2ZGRA 1V6OA 4LUKA 3FUOA 1OF4A 4PIZA 4BQ4A 1QMJA 2JECA 2RR13 3WUDA 1KGYA 1W9WA 1HN1A 4NRPA 3PIJA 1COV1 1GOFA 5A3NA 4AF9A 1H1AA 1LU2A 1AF9A 4URAA 1G8WA 2C5DA 3PUIA 2A6XA 5FCCA 3ZN5A 3NKGA 5JZGC 4NHXA 2AR6A 1W2UA 2XLGA 4YW2A 5C6CA 1DQ5A 3AZYA 2YU2A 3PU8A 3NV4A 1GNYA 4BE3A 4FXKB 4CEYC 2RS33 1ZBA3 2FHRA 5FYYA 3A21A 2R073 2R6QA 2BFUS 1H8TC 3AP9A 4XUQA 3IT8A 4CDWC 4UFHA 2R062 4JGZA 4XQDA 2BU9A 3A0KA 2NLRA 5F32A 3UGGA 2VL4A 1ENQA 3OD0A 4KWJA 1WBFA 2WN3A 1PM4A 2C24A 1UO9A 2YMZA 2ZEXA 3PHMA 5AC92 2GN3A 3OBZA 2VULA 2MEV1 3B9IA 5DZFA 4YYOA 3O0VA 3WNXA 5A3UA 4QQHA 5F5QA 5HPOA 1QJEA 2HWC1 4BQ2A 5KR7A 5A7QA 3T0DA 5FZKA 2YB7A 1UZ0A 3V56A 1D4M1 1ZZ6A 2RR12 3ZSJA 2JICA 3VHRA 1VP6A 4XF4A 1WZXA 2EA7A 1JOBA 2AACA 3VV1A 4DRVA 5F5AA 2QQWA 3KLSA 2OQ7A 4RQPA 3OCPA 1A34A 3MW3A 3ZYHA 4R9AA 2CWMA 5F9TA 2VY0A 2L9LA 4LITA 4B8EA 1GOGA 2YC2A 1UXZA 3LSEA 4LA3A 4BWOA 4JKKA 1C5IA 2EAKA 1R1ZA 2C4XA 2FCVA 1CQ9A 1ZBA2 1UL9A 2MNGA 3I2GA 3LDBA 3L9JT 1RUI3 2R072 4CCNA 3MI8A 4DIQA 3W5MA 1LEMA 3I3EA 1L7LA 2QJVA 3KCXA 4JGZB 4SBVA 4Y1VA 4S2GA 2VUCA 3I49A 3U11A 2WNEA 3UJOA 1W06A 5C8CB 5HV4A 2D7FA 3GJAA 5HXVA 2ATFA 5JZGA 4CCLA 3UKVA 2IXCA 4HZFA 4LO7A 2FDJA 2BDRA 1REEA 4ITCA 2GALA 4CEYA 1R091 1QJFA 3HAGA 1VAVA 1AR83 2WLQA 3CNAA 1CAVA 1H8TA 3PVEA 1J3PA 4W6YA 4A3XA 4NIDA 3H42B 3MV11 3FUQA 4CDWA 4AAXA 4G9SB 5A3PA 1RUF2 4HKWA 3IMNA 4LBOA 5CKQA 1QQP3 5K8SA 2CSGA 3DPRC 3EQEA 3IDEA 1E5SA 1FMD2 1DQ2A 1PO23 1UYPA 3VHPA 3LWCA 2QZ2A 2IC1A 4S2FA 1RUG2 2AYHA 4G3YC 1FT9A 1OQEA 4GJYA 4RQPB 3BCWA 3WF0A 3B02A 2GP3A 5L7OA 5KWRA 2CGOA 1N3OA 1SLAA 2W5FA 2XONA 3H1YA 5G04L 3T1LA 3HWJA 4QXBA 2JG9C 2OT7A 3P6BA 3KGLA 4FPEA 3PLQA 3GDBA 4XJAA 4HOOA 3OSDA 5BNQA 5IVJA 2W68A 3FFQA 2EXKA 2ORZA 4Q0PA 3ETQA 3AK0A 1H9WA 1W28A 1VJ2A 3VDCA 1YIFA 1LB2A 2IWGB 2J1VA 1ND2C 3ZYBA 3VBUA 4A7KA 2ZZJA 3M8LA 4NWVA 5GKAC 4ZONA 3ZXJA 3LEGA 1J3QA 1KJRA 1ULOA 4OFGA 5DQ0A 3ZM8A 5DUUA 3D82A 2WT1A 1DHKB 1VBE1 2HWD3 4RYDA 3WF1A 2HH9A 4CEYB 2BBVA 1G7YA 5FPBA 4I01A 1CAVB 3ZX7A 2Q8OA 5FLHA 2ZGSA 4CDWB 4FT8A 1AR82 4IETA 4JAAA 4MGZE 3T30A 1XU2A 1NA1C 4JKLA 4AI8A 4AEMA 4Q4Y1 4QX8A 4FOQA 5JUVA 1CZSA 3AFKA 4XAEA 1GICA 2IVJA 2PMWB 3MBWA 3SKVA 3F2ZA 3ZPOA 3ZSMA 3SHRA 1BYHA 4IGOA 2VD7A 1QXRA 4Y5Z0 4XBNA 1HRV1 4ZZ5A 2CV6A 4XVHA 5L7OB 4CCOA 3M3EA 5FZCA 1RJ8A 4M00A 4IESA 4BLJA 1UOGA 2WS93 1PGL1 3KF3A 3S7IA 4M4RA 2KD7A 4OCTA 3DPRA 5FYUA 3J4UH 1N1TA 3OBRA 4XIKA 3U07A 1CX1A 1F31A 5J36A 2CNAA 4TTGA 3VBUB 1RC6A 4FPJA 4AEJA 5HV0A 2WZR1 1TEIA 4CYDA 1DGRA 1ULDA 3POBA 3ZFEC 4NJ4A 1ZYBA 2ES3A 3U37A 1R1A2 2P2KA 5C9AB 1UN1A 2JG9A 2R16A 2VGDA 1XNCA 2ZXQA 3C7HA 1Y9GA 5DPNA 4FAHA 2VOTA 5F3IA 4Z2WA 2YY1A 3FMGA 1EY2A 2Z5WA 2VM9A 5C33A 2RDQA 1ND2A 4LBNA 4GAZA 2RMU3 2VZTA 3LEMA 4IDZA 2WABA 1WMXA 3RQ0A 1JUHA 1KDKA 2WC2A 2DCZA 1WA6X 3L2HA 3NNGA 5GZCA 4BCUA 5K0UC 1DZQA 2HWB2 1V6MA 1RUC1 1TG7A 1KJLA 4XE9A 3O1TA 5FYTA 1NA1A 3KCCA 3KCYA 2WS92 3RG0A 2RHPA 4IV3C 2PHUA 3JBG1 4AVBA 5GLZA 3DYOA 4JV4A 2UY8A 4I0WB 4OHYA 1Q8PA 2OPKA 2ZGMA 1H2MA 2W1UA 3N9QA 5FZ7A 3T09A 3WG2A 1XE8A 2PHRA 2P3YA 2PQSA 3ECQA 1Q8OA 5DUXA 3VHOA 3HNMA 5HXMA 5EP9A 3E5QA 4ES9A 2DFBA 4WZCA 4YARA 3UV9A 2JG9B 2YGMA 4Y26A 1UY1A 3S5AA 1RUJ1 1V6JA 2WLPA 3I2KA 3ZFFC 4AWDA 4W4ZA 2JIJA 2PLV1 2WFF2 1QH6A 4Q26A 4KG0A 3SCFA 2WSVA 1MEC3 2X5IC 1C4RA 1ONAA 2AGSA 2PHLA 2JDNA 1E5RA 1EUTA 2VBDA 3QH7A 1W04A 1QJX3 1TQ5A 5GALA 2FDHA 2RMU2 5JOYA 4XC9A 1O6UA 3WVJA 3V0AA 5JXIA 1VLNA 2BFUL 3OD4A 1C1FA 3NO8A 4K1YA 5IWFA 3W5NA 1POQA 3EXUA 1W39A 4RS5C 4MZUA 2OIIA 4XBLA 3MLKA 2D44A 2QBXA 3ETPA 3VKLA 3N9NA 3BU0A 3RGBA 2W46A 1NA1B 2TNFA 4XDPA 1PGW2 2DTWA 4QMAA 3E97A 2JDKA 1MS0A 1O4TA 3RZKA 5F2WA 5K0UA 3UYJA 1H2KA 1A3KA 3ACIA 5ACA3 1ENRA 1QOSA 2W47A 5LY1A 1QJU1 2B45X 3RRDA 3O1VA 3AJZA 2B5HA 3KHBA 3U10A 3CEWA 2GN7A 2QNKA 3IPVB 3MIHA 5IJRA 3WG4A 3KB5A 3WW3A 3UT0A 3LB9A 1UPIA 3ST7A 1U5IA 4OULA 1ZREA 5GLWA 1JZ7A 1PHMA 1W8FA 5SV5A 4MVTA 3VBHB 2BYVE 4YWAA 3HNBM 2XL7A 3U75A 4IV3A 5JR7B 2LUWA 1PO11 1VMFA 1G9BA 4QQOA 4F83A 1W90A 2Y60A 3NW4A 1ZZCA 3NV3A 4XJUA 5I0SA 4CP9B 3V0AB 1QJX2 5LA2A 3ROUA 1VB4A 4RHV2 5C4WC 5IVBA 1SCSA 1JOPA 2DUOA 3BIEA 4E9KA 3VBFC 1ZRRA 2OW4A 4QB2A 3ZFFA 4NWWA 1XRUA 1J1TA 4IXLA 4BISA 1T6BX 1FPN1 2X5IA 4AQ2A 5CA6A 2WR9A 3KGZA 1FATA 1WLCA 2SBAA 4AQSA 3ILRA 3OPZA 2KM2A 2E7AA 2ETEA 1SLCA 3N3HA 4ZS3A 2IFRA 2OXBA 3WDTA 5JOXA 2WA4A 3LIHA 3RWNA 4BIFA 4XYXA 2ZZQA 5K0UB 3N35A 5JR2A 2P37A 3OGVA 3ZYRA 4LKEA 2P3KA 1EUUA 2BEOA 4UFLA 4LTAA 3ZSLA 4E4HA 4CPBD 4IE5A 1HX6A 2WQ4A 4Q4X3 1E5IA 1HW5A 5J1XA 2D6NA 4URTA 3D8CA 4MX3A 4LXLA 1UPSA 2ZGNA 3J26N 4IV3B 4MUVA 5FMOL 1NT0A 4HN0A 4SLIA 4MG2A 2KR2A 1O7FA 2AH2A 4PIXA 2VCBA 4H7MA 1K3IA 4HLTA 4B1MA 2D3RA 1KXGA 2G9FA 4C1XA 3ZYPA 3C3VA 4YG0A 5IAXA 5JIUA 5JXHA 2D5FA 3ZO0B 5LBEA 3MF9A 2WZPP 4DY5A 2ENRA 2VVEA 3JB4C 2CDOA 2CY6A 4PQ9A 3C7OA 5DXDA 1VRH3 5LA9A 3S5QA 5JXJA 2X10A 3MICA 1S0FA 4MXVA 1COV3 2DV9A 3ZFFB 2O8QA 4QU2A 2OS2A 4XPVA 5DN2A 4LQRA 5FJKA 2RS13 3KV4A 1QNYA 1ENXA 4AVAA 4CDQC 5IK8A 3RFRA 2FQPA 1AR71 1JZ2A 1U12A 3JQWA 3TN93 1W8ZA 1D7PM 5FP7A 1S2BA 3PUAA 3AYCA 4IEXA 4YM1A 2RDSA 5BNPC 3W9AA 1BVVA 1WMEA 4M01A 2PHTA 4PLNA 1OH3A 2EXHA 4RR3C 4RL7A 3ZIWA 4FI9A 1Y4WA 4JVAA 4N53C 3SEPA 4ZS2A 2WWJA 4OMCA 2W1WA 1FNZA 3VBFA 1GFF2 4CP2A 1AYM3 2EIGA 2D5HA 2XUEA 2EALA 1UNBA 4NHKA 2A3XA 1NXMA 5F39A 2Q4SA 3N36A 2BP6A 4BQXA 1IKPA 2VMEA 1DYOA 1DP0A 4XFGA 4FCAA 3ZR5A 3BGAA 5GJ6A 4COVA 3I59A 2WO7A 5B4XA 3Q9OA 2MEV3 2R043 4JDNA 4CCEA 2ET1A 1AL22 1HB2A 3AP6A 4UXAA 3AMMA 2HWC3 1JU3A 2NPIA 3UL2A 1MS8A 5CEHA 3RZJA 1J59A 4A42A 2NYYA 4EWDA 2RDRA 4WV8A 5CFCA 3SH5A 2HKXA 1D4M3 3IAPA 1VRH2 4OLLA 4V2WA 5CB7A 4PI0A 1AXZA 5E16A 3VBSC 1O4YA 3MYXA 3FBYA 1MQTC 3ALQA 4QKFA 5LBBA 3WDVA 4CSWA 1ASJ1 2RS12 3QLQA 3HJRA 1AR91 1QJY1 5A3TA 3DECA 1CONA 2ID4A 4LLOA 4MGIE 5IVFA 4M4PA 1XYOA 2ADEA 2WJSA 3ILFA 2BBAA 2ERFA 1UYZA 1N1SA 1RGSA 5T3NA 5B2GB 4CE8A 3VBFB 5IVEA 1I3HA 3VL9A 3DF0A 4RN5A 5KBFA 5JI7A 4CDQA 1AYM2 2ARBA 2E51A 1C28A 1V9U2 1NCQC 4AQ6A 1GQGA 3O1MA 3BN6A 5E89A 3GBFA 3I59B 3IIAA 2D6PA 1JU4A 2E63A 5A7WA 1BMV2 5FWJA 4RR3A 1CAWA 1R093 3TWIA 1O8SA 2R042 4N53A 4P9WA 1KEXA 2WFPA 3RMYA 1GSLA 5FBJA 3OEBA 3VKNA 1XSRA 5CFCB 5J98B 4N9IA 1X9TA 3B94A 1QOOA 3HD8B 2DUQA 2PTMA 2WNUC 1XXNA 1OVSA 1LHNA 1AR62 3AMPA 4V1PA 1IGOA 3E5XA 3JQXA 4XW3A 4Y1XA 2G19A 3WEZA 4Y20A 2GC1A 3FBMA 4QPIC 4Z82A 3VD7A 4NO4A 1R64A 3KQRA 1UF2C 2QQKA 2RVAA 3ZXLA 2WRAA 1LU1A 1VBB1 3PMEA 4B4QA 5IVVA 4L8QA 2GNTA 1S0JA 3INAA 3KT1A 1MQTA 1HJFA 5A1LA 4CDQB 4DEQA 1IS5A 2O14A 4HL0A 2W0XA 1AUYA 1S0GA 1GWMA 4LUMA 4UT5A 4MHUA 1NXD1 3ATGA 1W8TA 3WNMA 3AKSA 1JBCA 3LA2A 4M0NA 4PBOA 1N1YA 2XMLA 3FC0A 4DUWA 1GZ9A 1B35B 1LOGA 1VBE3 1CAWB 1UYXA 4HSJA 4RR3B 3A23A 2TEPA 4XZPA 3W20A 3KD4A 5BY5A 4N53B 3KVBA 3IM0A 4TWTA 5BNOB 3OJBA 4Q4V1 1GZCA 2PFWA 3J8F1 4QDQA 2A71A 4GMP3 4J25A 2H6CA 4XXAA 3WDWA 4Q4Y3 2I2SA 2Y26A 2DCJA 4KNCA 1OURA 1MZ6A 3T4HB 1T2XA 2Q0AA 5J96B 1LODA 5BNNB 4JC1A 3H9AA 1KS5A 3OGRA 5FWEA 4IUGA 3PUSA 4Y20B 5J3UA 3RI8A 3ACLA 3MIDA 4Y24A 1JYVA 4GB31 1RXFA 4KMQA 3OUIA 1CAXA 3H7YA 5J7MA 1H1IA 1YYNA 2XBO1 2YBKA 3SH4A 2VQTA 3GHMA 1JODA 3VDDC 1PX3A 4CCMA 5A32A 1G9CA 5FUIA 1UD1A 2WNUA 4AVVA 4CA9A 4P5HA 1AL0G 1MQTB 4QHBA 1KD7A 4CRQA 1MVEA 2WUHA 5LW9A 1RUE2 1VMHA 2IZWA 2WZR3 3LKJA 3KT4A 4CCCA 1HRI2 4YM3A 1W99A 1YI9A 4QPIA 3KV6A 3TOJA 4YZ3A 1PZ9A 4EN0A 2ZGPA 1VBC2 2WZEA 3FLTA 4BM8A 5ANNA 4GH4C 1EPZA 4AFDA 2YFZA 3WZ1A 1RXGA 3BPZA 3P3PA 4P9XA 3MEPA 5T50A 4Q0SA 1WD3A 4K21A 5IVCA 4FTSA 1IQDC 4XF3A 3TB0A 3NJXA 4JX0A 2XLAA 2XOMA 4QX2A 1GP6A 1URXA 2X53S 2HEWF 3C2UA 4D7TA 2AREA 2VCCA 1CVNA 4AYUA 2VZ1A 2VZQA 3WHTA 3ZLIA 2JDAA 4GMP0 2NM1A 4KU7A 2P3IA 1W05A 3I2DA 3NRUA 4FXGB 4MYEA 1N3QA 3ZXKA 1PMIA 1CAXB 1TE1B 2BERA 3B5LB 4GA9A 4DB5A 2BQPA 3HMYA 2EIBA 1PGL2 5A32B 4AHWA 1EP0A 1W2NA 2WNUB 2W08A 3AL6A 3POIA 2FDFA 1MS1A 1EPWA 4KI5M 1PIV1 3ZYJB 4JRAA 4CPBA 4CVUA 2FD8A 3W59A 4NUBA 1DQ6A 2D97A 3HPNA 4HKLA 1H2LA 4OHWA 4QPIB 1ODNA 2P6HA 4YVSC 1UX7A 2XL9A 4COYA 4XQ4A 3ZSKA 3PUQA 2W94A 1NX9A 1EAH1 2QKDA 1U0AA 1YFUA 2C9KA 2J42A 3QD6A 4IEZA 3USUA 5K9YA 2HEYF 4FPGA 1C3HA 2LALA 1ZRCA 2XWBB 4YW7A 1QEXA 1DGRN 3RZMA 5HBAA 1SHWB 5DABA 1OBNA 3CJIB 3SCGA 4MXWA 5DG1A 4N9HA 4YM0A 3I8TA 2O1QA 1LAJA 4GH4A 4LJHA 1H4HA 4FP2A 3I2HA 1AYN3 4PIYA 3RWKX 2BNOA 5FYBA 2WO2A 5A33A 4CZSA 1OFSA 2WO3A 2RDNA 4RGGA 4B29A 4YLZA 1KS4A 1V00A 3AMNA 2W92A 1WD4A 3H50A 3VD5A 2D6KA 5FOBB 1DCSA 1KQRA 1OA3A 1W3VA 1SPPB 3NJZA 4P5YA 1PVC1 1W9TA 3S6PA 5F5CA 5D21A 5B4NA 1I6XA 3N7JA 1RHI3 3OPTA 3WP4A 2QQUA 3ZFGB 1GV9A 1OLRA 4BDVB 2ZCWA 4BMBA 4Y33A 1MZFA 1SZBA 5FPUA 3EBRA 2HWF1 1D2QA 2D3SA 2H0BA 2OUJA 4JRLA 5FMCA 3KHCA 1O3SA 5FBZA 3ZXFA 1LTEA 4GULA 4C0HA 1UMIA 2QDNA 2ZGQA 4WZFA 4AHZA 2W87A 2Z79A 1QNWA 3USUB 1WMDA 1QY4A 4H3WA 1G86A 1Z7S3 4S2HA 2ZBJA 4CDXC 4I0AA 2VMDA 1BVP1 1W2AX 4YVSA 2R32A 4UF0B 4DRRA 4MXWB 3O1SA 1NZIA 3THPA 4DZGA 4GH4B 4XFHA 3PJQA 4RA0A 3PVOA 5A33B 4FOVA 1RTVA 1BBT1 2ZHNA 1AYN2 4KL1A 1HXS1 4A41A 2JE7A 4I2OA 3I3BA 4D3WA 4GZ9A 3RZLA 3IKWA 2R30A 1U5XA 4KBZA 1Y9QA 1YI7A 4HANA 3RPQA 3ZDVA 5IFTA 1RYYA 3SQOA 3ZOIA 1NYWA 2D40A 4EZ4A 1YNAA 3B69A 1VBD1 1RUD1 3M4FA 5DAPA 3OF1A 4BPZA 4YGDA 5CZKA 1DLCA 3C7FA 1K42A 1SFYA 1XYPA 1RHI2 4LOTA 5LA1A 4FFIA 1A8DA 2AC1A 4YZ4A 1DGWX 4YFZA 2BNMA 5FY9A 1W8WA 1HV1A 1PVXA 4Y1ZA 4LO6B 4XOGA 3WD5A 2DBIA 3SITA 2QVSB 1ZBE3 4FFFA 4KH9A 2WBKA 2MHFA 3WINE 4QQLA 4C90A 1LEDA 1Y9MA 4CU7A 2FCTA 5C5UA 2QQPA 5T55A 4IEOA 1NAEA 1Z7S2 2HWE1 3K3NA 4OUEA 4IE4A 4Q4W2 3D3AA 1XYNA 5LATA 1HQWA 1HV0A 1I5ZA 2ZAHA 2DVAA 2UWCA 5JVVA 4YZ5A 1D0GA 2DVBA 2CAUA 2P4EA 2WINB 2ZEYA 3FHIB 4GD4A 1N47A 5KHIA 4CEWC 5FY8A 2XB6C 4NAMA 3QH6A 4PQQA 4CDXA 3M1HA 4A6SA 4HPKA 2RM21 4PJYA 5FZ1A 2DU1A 2F17A 3PL0A 1A78A 1SMVA 4KGGA 3JB8A 4CP1A 4EN6B 2RS32 2WIIB 1UZVA 3THDA 1NG0A 1K12A 1APNA 3VD3A 2GDFA 2VJXA 2FZ1A 3LE0A 2ARCA 4QB6A 5GZGA 1JUIA 4LA2A 4F7ZA 3OUJA 3K51A 2DURA 3ABZA 3LZZA 1TMF3 1IOAA 1GYKA 2H0VA 4Y22A 1UKRA 4YW5A 4DXSA 3ON7A 2DVDA 1OFNA 2B7YA 1QH7A 2YU1A 1MVQA 2UWBA 2JDMA 4XHBA 2JX9A 4NE9A 5JDBA 3JD71 5FZDA 1ZBE2 4HT1T 2N7GA 3RS6A 1GP5A 4WVVA 2VW0A 1VBA1 5CKMA 3WNLA 1JTZX 4QPYA 4BA6A 5BV6A 1QF3A 1O3TA 3H1WA 5FMDA 2GNBA 3MO4A 1ASJ3 5FMOS 2ZEZA 1AX0A 1PNFA 4YNIA 5DZEA 3PJYA 1QJY3 2PAEA 2VNOA 4CDXB 4CU6A 1NY72 4HG6B 3B00A 4JHZA 3ME2A 3AYAA 2B9UA 3HN3A 4OQ8A 4EN7B 4RGKA 4NPRA 1AX1A 1M4WA 2XLFA 5C70A 5J09A 1V6NA 2V4VA 5BPXA 1C8M1 2V5DA 1OUSA 3C8XA 5LK5A 3AYEA 4PBPA 5IK7A 1RUI2 1BLZA 2W91A 2GSYA 5ISLA 1SQ4A 2GMMA 3POYA 3T08A 5FO8B 3O1RA 1C8NA 5DAXA 2YROA 1B09A 5FZ8A 4CEWA 5JZGB 4Y22B 1POV1 1TMF2 1MPXA 2VMCA 4YPJA 4DINB 3R4DB 2D93A 1SEFA 1UY3A 1EYBA 2J1UA 1UOJA 1LR5A 3MLLA 4HN1A 4AFMA 1ALYA 1H8TB 2BW8A 1XE0A 1XJAA 4NROA 4WBBA 3FZ3A 3PURA 3J7MA 4Q1PA 3Q8FA 3ZXAC 5CFDC 1OA4A 3TBDA 3I54A 4DFSA 3I2JA 2D3PA 5AFEA 2Y0OA 4EJRA 1BEV3 1QQP2 1RMU1 3ZR6A 1NQDA 1YXWA 3H8UA 1PO22 3JUUA 4WVZA 3GHNA 3NVCA 3VBRC 3UK9A 2DUPA 5J37A 1W2OA 1IQAA 1QXJA 4LR4A 5JSPA 3RYKA 3DKQA 2XJUA 4E8DA 1WLTA 2ZGKA 1VBB3 1A6CA 1GWLA 4XXPA 1OXCA 4AL9A 3R6SA 3WNPA 1U5YA 3POEA 1Q8VA 1YQ2A 2DWRA 1KITA 1VAKA 4WVWA 3NNMA 1W9FA 3POJA 4NPLA 4CEWB 5JMCA 1TME1 1JS9A 2XH6A 4HBNA 4L11A 5I8TA 4GWJA 1G9DA 4QU1A 5IYYA 1UW8A 1LKNA 5KHKA 4XFBA 4IERA 3PU3A 4CTEA 2B39A 2EVXA 5E6HA 3D6EA 4M3CE 1W6MA 4PF1A 4L97A 2HWD2 3PTRB 4O65A 5EJ1B 5EWSA 4K9SA 5L9BA 4AQTA 3LDRA 4XURA 1JHJA 1AXYA 3J8F3 5IK4A 4MGQA 5DG2A 5JIAA 1R081 2HJIA 4MGSA 1C57A 4HK9A 1OLQA 3N7KA 2ZMLA 4P9JA 4AAPA 4D6SA 5ABJC 1HJGA 1NQJA 5BYNA 5DUWA 3DCQA 3HEIA 2LM3A 2FDIA 4XDOA 1WW6A 2BVVA 2GAUA 2MPFA 1BEV2 3MPPG 1DYKA 4QKNA 2RS51 3DV8A 4XF0A 4M3CF 4AR2A 4FPCA 3GJBA 3VDBA 2VVFA 2A3YA 3MW2A 3V0BA 2J1AA 5FLJA 3BU7A 2ZS6B 3E6BA 5HCBA 2E32A 1YUDA 1V6IA 1F4HA 4PDWC 4EWEA 3MZHA 5CFDA 2JD9A 4OVEA 1IPKA 2VTXJ 2D43A 3DPRB 1VBB2 4XJ9A 4FPKA 2X09A 4L92A 5JLVA 3ILNA 5I91A 5LWBA 5FYVA 2KXLA 4FOWA 3Q8BA 4UYBA 5H9RA 3FHAA 3VBRA 4P9IA 2WAAA 4WVMA 3PIGA 5JCTA 1DQ4A 4W65A 1UU5A 1UZYA 4M0HA 3LCPA 3LFMA 3N9LA 5D1IA 2CWSA 3OB8A 1W6MB 1WW5A 5AVAA 5IW0A 3LA7A 1J84A 4YW3A 3JXSA 1UQXA 1UY2A 2A7AA 1JZ3A 2K2SA 1US3A 3MF6A 3M3QA 4J6GA 3I97A 2A1XA 2HLEA 1ND2B 4LIVA 3RYRA 1IS6A 2R0FA 1OOPC 2UYAA 2Y34A 2Z4FA 4GQ7A 3TN92 3ZSEA 3ZVXA 4EV0A 2PXJA 2W3JA 1ND3C 3ZFEA 3W21A 2DCYA 5DDJ1 4PI2A 2CGNA 4I02A 3NQHA 1Q43A 1UMZA 1OD5A 1WA4A 1GR3A 4QPWA 2JWPA 5C3PA 1FI2A 2X05A 5T5LA 3MIBA 4Z07A 4BK4A 1OHFA 1H4GA 3AC0A 3WQ1A 5I8YA 4A7YA 5FPZA 2P6CA 5CFDB 4QM8A 3N9MA 5K7PA 5FZEA 5ABJA 2VOWA 1IPJA 1RUH3 1CJPA 3LAGA 4XJWA 4A4AA 1VIWB 2XQRA 1LHWA 1LNSA 1OD3A 2ZHLA 2C6SA 2YPDA 5L9RA 1PMJX 4YFWA 2YC4A 3CF6E 3P1IA 4FPLA 4J1XA 4LBQD 3WR0A 3VBRB 5FZ6A 4NMIA 5FR3A 2TUNA 1FOD3 1S0BA 1W6PA 1XU1A 3OOXA 1QKQA 1SDDB 4EYUA 1W8OA 2GNMA 2BGCA 4Y5SA 5C3SA 4IEPA 4PDWA 3USSA 5FLIA 5FPAA 5C3OA 2RJ2A 1KRIA 5FOJB 4BQ5A 2ZGTA 4N7IA 2PQQA 1EAH3 1HDKA 1X8EA 1YO8A 3GXUA 1MEC2 1UKGA 1XNBA 2IUWA 1S0EA 2P17A 2R1BA 3MFCA 3VZLA 3ZFEB 4PCRA 4AOCA 3PNAA 5FYIA 4ET7A 2BZDA 1YJKA 3ZIXA 2IXLA 2R061 1F2NA 4AFCA 5FY4A 2F6BA 1X36A 2VNVA 2VU9A 3GZTB 2NMOA 3K46A 4QDRA 4AFBA 3RJ2X 3POFA 3BALA 4LKFA 2WO1A 4QGLA 4LBKA 1X8MA 5AC91 5H9SA 4NIIA 4UW3A 4ZY9A 4CXWA 1OOPA 2VUAA 3FJSA 2AENA 1ND3A 4QHOA 4QX0A 1QDCA 1RUH2 1LECA 4IEVA 1UAIA 2DCTA 5C8WA 2B8MA 5IVYA 2DVFA 3Q8AA 4Z92B 5ANQA 1I5PA 1UZWA 1W6PB 5ACA2 2RR11 1FV2A 4ORFA 4RS5A 1FOD2 1IG3A 3ZYIB 3LF7A 2G4IA 3J9SA 1EV13 2I45A 1Q8QA 2NQYA 1PK6C 3LGRA 2JDYA 4P9GA 3WDXA 2G1MA 5LBFA 2LS6A 2WWUA 4U2AA 3VLBB 3VD9A 4BQYA 2J1TA 3T2TA 4Y4RA 3ES4A 5HCFA 1RVF3 4R52A 5A7OA 2J1SA 3ZDSA 5A1FA 1MZEA 1VALA 1XQNA 2VCMA 5L19A 1XNKA 2QZ3A 2IFWA 1JZ4A 1ZBA1 4AI2A 4NIAA 3LPFA 3C7EA 2LTNA 4XUOA 2GU9A 5H9PA 3U0ZA 2Q8EA 5D8AC 2A6YA 2PHXA 4CUCA 4FQZA 1BK1A 1T6GC 2JE9A 2YG0A 2BPA2 2XHNA 1BBT3 2X5IB 3AX4A 1HXS3 5JMOA 2VZUA 5A70A 5JAXA 5A6YA 1OOPB 1I9RA 2VMIA 2CDPA 4P08A 3CZJA 2RV9A 3C7GA 3RNSA 2XVKA 3THCA 2A6WA 3V64A 1VBD3 1RL3A 2VQ0A 4MV2A 5C4WA 3AZVA 1FYUA 1REDA 1RUF1 1ZZ8A 2VTFA 4AGVA 5IT6A 2F4LA 1NUKA 1QXPA 2BV4A 1NZCA 3AKTA 3AMHA 1F5FA 1OA2A 4RS5B 1CAUA 2DF7A 2NP0A 1FMD1 3O0XA 1W6OA 2B46X 4PHZA 2A3WA 4TN7A 4L2NA 1Z78A 4GKXA 1RUG1 4XTPA 3WY6A 2GC2A 4DUVA 2IXIA 2V4AA 4IEQA 4Q4X2 1EV12 4BQWA 4BU2A 5A3WA 1JN2P 1DGWA 5JOZA 5EYXA 1LGNA 2GP5A 3B93A 2GZWA 4P9YA 1IKQA 2IXHA 3SC7X 4YM2A 3HBKA 1RVF2 1VPHA 2B42B 2HWE3 1L7QA 4UFJA 3B3QE 3T4VA 2ZPXA 5D2AA 5C7GA 3DYPA 1H8VA 1IS3A 1CIYA 2P3JA 2W1QA 1PK6A 1COV2 2SLIA 4FFHA 4LO4B 2XXZA 4E8CA 5KXDA 3RMXA 4M3CA 4K7JA 1S0DA 2CAVA 3VKFC 2VXRA 5FDBA 1LRHA 2H6BA 2WYFA 4FPYA 1YQ8A 2GC0A 3IMMA 5FJHA 4YSFA 3TRSB 1OF3A 3QBQA 4JZRA 1MS4A 5F2SA 1H0BA 1AR81 5FMBA 5C4WB 2NZ9A 5D8AA 1VBD2 2P34A 2QQLA 4OQ9A 1V70A 5CISA 5F6LB 1CAUB 4LIUA 1ENSA 2ZHMA 5JSRA 1W03A 1E5HA 1W6OB 4Q8KA 5E1RA 3J7LA 4D6QA 1M06G 1MS3A 4BXSV 2I74A 3A4UA 4IW3A 2O0OA 3CHXA 2VZSA 5FY1A 3WP3A 4COWA 2CU5A 5ERLA 5BNPA 5KC6A 3ORJA 4GXLA 4A2UA 5LZ6A 3ZXGA 2MEV2 2E9QA 4XFFA 4XCAA 3VL8A 2W39A 4QXHA 2WYSA 4LMFA 4MGKE 2O8OA 4Q8LA 4I3GA 2HWC2 5LK7B 3DEMA 2J1EA 1VBA3 3OUHA 4FO9A 4Q0UA 4XIOA 4BZ4A 4Q29A 1NLQA 3E6CC 5T5PA 2GH8A 1D4M2 2E7TA 2Y38A 4IEWA 1SLIA 1MZ5A 2HEVF 2RJKA 1IG0A 4QX7A 1XE7A 2X29A 4M3CB 4XHXA 1R1A1 2QQJA 3ZMOA 2VMFA 2UU8A 3B7MA 4QKBA 3AKPA 3BB6A 2A70A 2BOJA 1H9PA 4QX5A 4YZ2A 4O7XA 1PX4A 4B4RA 2FDGA 1F8VA 3EHKA 1J3RA 2HBUA 3IB3A 3G6JB 3O5SA 3RSJA 3VBSA 1K5MC 2QQIA 2XVGA 5I0UA 4JQRA 4AI9A 3WX5A 1LULA 1WCKA 4Y1YA 3ZKUA 3VHNA 5F3GA 2HWB1 1C5HA 5FQ0A 2VOKA 3FLRA 4QX3A 3H3LA 2FCUA 3VZOA 4D6RA 4LBLA 2PA7A 5A7WB 5BNPB 5A6QA 2XJVA 3KSCA 4K8RB 3CO2A 2ZX3A 4WM8C 4FPOB 2YDEA 2CTVA 5CBLA 4HKOA 1LOBA 5APAA 1R092 3AKRA 3KV9A 4XF1A 4FPFA 2VE1A 3AZZA 4LHSA 4E2QA 4XETA 5EYYA 2YZ4A 1SLBA 1GANA 1UCXA 5HCHA 2A6VA 4DXZA 5FZBA 2F4PA 2DU0A 1YQCA 1NCQA 3GALA 4LKSA 4XF9A 1RMU3 3BVCA 4BOWA 3ZYFA 3VZJA 1LOFC 1YQ5A 5H9QA 4XDQA 1IZ3A 1JYXA 3PVBB 5C3RA 1O3RA 1HRV3 1ZRIA 4N43C 1Y43B 3BTYA 1O8PA 5FZ0A 2QFEA 4XTMA 4CCKA 2UURA 2XJTA 4AG4A 2WFF1 1F9KA 3BTAA 4YW6A 4XUPA 3TEZA 2JIGA 4LBQA 3NL1A 5BXXA 3RZZA 3U4XA 3NKTA 3VBSB 5FREA 3B01A 3CL1A 4LT5A 1F4AA 2B4KA 3H8OA 2RMU1 1WBLA 2Q8CA 3O1PA 3ASIA 1DU3D 3GBWA 3IZOA 4IEUA 1OPOA 1YCIA 5J48A 5FQ0B 2E31A 4CXXA 2GMPA 1H30A 2OVUA 4BH9A 5IATA 3O1OA 3AXEA 2J7MA 4W50A 1VBE2 3Q8EA 1CD3G 1PGW1 2QDRA 1CX4A 4OHVA 4COUA 3SLIA 5TSWA 5A3MA 3BTXA 1K5MA 2IXKA 2V09A 2YPJA 3BYWA 2YC0A 4Q27A 4QXKA 4ZXEA 1RUOA 4YZ1A 2WA3A 2GH2A 3CLPA 4XQWA 1K5JA 1YFXA 1NCQB 4Q4Y2 4QQPA 3T2PA 3I3QA 5EJ3A 2WT0A 2WNVC 4IQPA 4LO5B 3DGTA 1SG3A 2P5BA 4NR1A 4KWKA 3NNLA 2YYOA 1OUXA 2R1DA 3LIGA 4WM8A 4OUSA 1RUC3 1SLLA 2VCAA 5AVPA 1HRV2 4KU8A 3VZMA 1Q3EA 5CVRA 1XNTA 3AB0A 3JU9A 2ZA9A 3WT3A 5FAXA 5KXCA 1XPWA 2XJSA 2ZMNA 1UY4A 4HVOA 1GBGA 4LK7A 3JBG3 3RI9A 3SMHA 3CDZB 2JXAA 3I3MA 2VUDA 4YW4A 1LOFA 1RIRA 1QJX1 2VQUA 1GU3A 2WL1A 3AMQA 4RHV1 3TNQA 4HK8A 2WZR2 1AJOA 4N43A 3ACGA 5FPLA 4P14A 1FV3A 1CGPA 3VBOC 1NE4A 3DKWA 4MLOA 3H7JA 3OGSA 3OG2A 4META 3TEXA 1S4CA 5F6KA 1RUJ3 3WNKA 4A3ZA 4AHXA 5F3CA 4OI0A 3EMRA 4PLMA 2PLV3 2V5YA 1FX5A 1SBDA 4DPNA 4O9GA 1UYYA 3VN4A 4IEYA 1PM7A 4LHNA 4XMAA 4UAPA 4ASLA 1DFQA 1HKDA 2VC9A 2E33A 2DYCA 2VZPA 2A75A 2ARXA 1CESA 3SISA 1GKBA 1WW4A 3IIIA 3OYWA 2GC3A 3MIGA 4ASMB 4CXYA 1OPMA 3ES1A 2JG8C 2PAMA 2YHJA 4QWNA 2BVBA 2OYZA 1LGBA 2XKPA 1RUC2 3GNEA 4NOTA 4AFAA 3T2OA 4R4ZA 4P00B 1UIJA 1Q8SA 3TEYA 1WUVA 3LDKA 3T3YA 4FAGA 1SCRA 1VE0A 3ZN6A 3K4DA 3VD4A 2WNVA 4LOSA 5FO7B 2VMHA 3JBG2 2V72A 4LPLA 3GCXA 2WDBA 2Y6FA 1QJU3 4FOYA 1VMJA 3VDDA 1X7NA 3N9PA 5FXXA 3VDAA 1PZ8A 2LW8A 5FXVA 4AE2A 3PUHA 5FRAA 2BRTA 5LASA 1OSGA 3BPSA 4CU8A 4MADA 1RUJ2 2E26A 1WWYA 4L9BA 5C8CC 4E4DX 5A1AA 1TNRA 2PLV2 3ELNA 3J7NA 3WOGA 4JKMA 1PO13 1J58A 3MUZ1 3D4KA 2BUKA 3URFA 3FL7A 3IBMA 1O91A 4Q2FA 1JYWA 4BJ0A 1XNAA 1DZTA 4FPHA 2WN2A 4BLIA 1MR5A 5KHJA 1RITA 3CMGA 5FP3A 3VBOA 5IFPA 1OH4A 1GUIA 2ZX4A 3ACHA 1X9PA 4QGNA 3VKMA 3CIHA 1AXKA 3WDUA 4I30A 5KC5A 3UNPA 2Q8DA 3Q8CA 4TLGA 1FPN3 2UY9A 3MPBA 3OGGA 1QHDA 1W9SA 2ZGOA 4KGQA 5FZIA 5JXGA 2ZAAA 2JE8A 4XEZA 3A7QA
chains in the Genus database with same CATH topology
3ZN6B 3AFGA 1AL21 1CIWA 2WNVB 3POWA 3HQXA 2ZHKA 1GNHA 1YFYA 2VECA 3VDDB 2JG8A 4AEKA 5GZDA 1RINA 1QJU2 1VRH1 3R4UA 3RYPA 3H1MA 3WP6A 3TYJA 1Y3TA 5I0TA 5KXBA 4R9BA 3GYDA 4Z8BA 3PVNA 2JJ6A 2RS11 1NLRA 2PHFA 4FBFA 4HVQA 4FTBA 1PO12 4RSUA 4ISRA 3WQ0A 1SBEA 2PHWA 2VPVA 2YV8A 3VBOB 4YVSB 1AYM1 1YIPA 1V9U1 1S0IA 5C8CA 4KWLA 4JDMA 1AR73 1AZDA 3PTYA 1BMV1 1FPN2 4COZA 1L3JA 1QGLA 1BZWA 5HI0A 4EROA 2R041 1PNGA 1S1AA 5L7OC 2Z2SB 2D6LX 1RUF3 1LESA 3ZYGA 2JG8B 4S2DA 3AKQA 5EV7A 4LHKA 1FMD3 1RUG3 2JDZA 1DLLA 5GZFA 3G7DA 1AR61 2WKKA 4QM9A 2QUOA 3VBUC 4JTNA 4GIQA 3OBTA 2DVGA 2I07B 3QOPA 5C9AC 1QDOA 4K3UA 4R8HA 4HSLA 4UW4A 1UX6A 4XFIA 4FQ4A 1JXNA 3KM5A 1YWKA 5T5JA 4IL7A 4AVCA 1AR93 2UYBA 1AX2A 1AR72 4DQAA 4HPKB 2VUJA 2ZMKA 3BOPA 1E57A 2XJQA 4K1ZA 1WLDA 5CADA 1N1VA 1NLSA 2OZ6A 2OA2A 2VMGA 1CJDA 3SXWA 4YGEA 3H3UA 3AM2A 3JZVA 3WXPA 1LGCA 2YGLA 1HLCA 4OZXA 5FTTC 4H14A 3IDBB 2JENA 1PZ7A 1JW6A 1DF0A 2ZX0A 2Q5TA 4RFT0 4TYSA 3T1MA 2C1FA 1IS4A 2Z42A 3ENRA 3DL3A 1JYCA 4ONUA 5JPNB 1ULFA 2Q1MA 4K20A 1RUE1 1PGSA 1HRI1 2BWCA 4PF5A 5T5OA 1FAYA 1R1A3 2BWAA 4B7KA 4JGYC 1ASJ2 5JSOA 1VBC1 4R4XA 5C9AA 1AR92 1QJY2 1ZZ9A 4ZXKA 1AJKA 1DZRA 3KS7A 4F3JA 1UZZA 5A3LA 1C1LA 2JKBA 2ZTNA 4GMP1 3A0NA 1ZRDA 1QJZA 1DQ0A 2BNNA 3QACA 3M3IA 4CP0A 4E2GA 1SLTA 2HWB3 3SCHA 1WCDJ 1Q5OA 3HN1A 4AVTA 1D4VB 4FSJA 4B3NA 2CYFA 4K8FA 4XFAA 2ZACA 1Z0HA 2VG9A 1W0OA 3IDCB 4Q4V3 1LOEA 3VBHC 1UU6A 1O3QA 2XPJA 4OHXA 2RJLA 1ZA4A 5F1RA 3BIWE 1GZWA 2GNDA 2WQZC 1ULGA 4AI0A 1CN1A 2XJPA 5EXOA 2E53A 1V6KA 4XFCA 1JOJA 4Y1UA 2ZGUA 1I1EA 4KQ7A 5IK5A 3GZUC 4LE3A 3WDYA 2WFF3 4GB33 3R4SA 4D7YA 2XBO3 1UIKA 2WT2A 3NV1A 3IWZA 2ZGLA 5CU1A 3AXDA 4JGYA 4Q0QA 3THTA 1CR7A 4LO8A 2NN8A 1LJ7A 5L36A 1ULCA 4AHYA 1G9FA 3TAYA 1FNYA 2XUMA 1WCSA 3D0SA 2Y0IA 4JDOA 2BTVC 1YHFA 2W52A 3M7AA 4MSVA 2ZKNA 3O14A 4ATFA 4WM7C 1LCLA 3FFZA 4FVVA 4Q4V2 3J8F2 2VH9A 4HVRA 2VNGA 1GZWB 2VNRA 2X8KA 3JCIA 4E4ZA 4B7EA 3V0BB 2OZJA 3IPVA 3EO6A 5KHGA 4LULA 2KA3A 3VBHA 4LBMA 4GB32 3GZAA 2ILMA 4IV1C 1D2SA 3KZ4C 2XBO2 3ZMNA 3VUOA 5EZWA 3WLUA 4LLFA 1PIV3 3OTFA 4JGYB 4RHV3 4WVMB 2OUHA 5LEKA 5T54A 4INDA 4LBJA 3MIEA 1AYN1 4AGRA 4GWNA 4KG8A 3VZNA 2ZX1A 3WUCA 1BJQA 1G9AA 5GLTA 1O5LA 3L2YA 3LOBA 3LA3A 1RHI1 4I09A 3SH3A 2A73B 3M3CA 2PN5A 4XBQA 3AZWA 2ZX2A 4WM7A 3WCSA 4X6RB 3RJRA 3K48A 2AZ5A 5ABJB 2VW1A 3MFAA 4E2SA 2IXJA 2E7QA 1ZVFA 4F8AA 1PVC3 1Z7S1 4Q4W1 1PIV2 3POSA 2K0GA 4I3PA 4Q1RA 2QE3A 4KBBA 1REFA 3WG1A 4PDWB 5FFOC 3ZN4A 4JCKA 4ZU4A 3HT1A 2HWF3 1YRZA 3V65A 4IV1A 4Q0VA 3AP5A 2VQAA 2PHDA 1OMIA 3UJQA 1EAH2 1RUNA 4U36A 2VVDA 1ULEA 2UWAA 3PMSA 1WLWA 3TNPB 2RS31 3S0MA 2R071 1X33A 1CPMA 2DTYA 2R49A 5GLVA 5CFCC 3FWEA 1VR3A 4WM7B 4QPGC 2FMDA 1XNDA 4OI2A 1ND3B 1SFNA 2XJRA 5LRRA 1AL23 4C0BA 1HQLA 1NE6A 1ZBE1 4E4SA 1RUD3 2EF6A 1PVC2 3GF6A 3M2MA 5I93A 1ZZBA 3E6DA 4D94A 5EFUA 3UKTA 4DY3A 1CPNA 3KT7A 4D69A 4R9CA 1VB2A 4IV1B 2WWSA 1S55A 4L99A 2HWF2 4B4PA 2PAKA 4K6BA 1NY71 4ISQA 4LEJA 5CG8A 5E8AA 1FXZA 1WMFA 5JOWA 2DFCA 4HMZA 1B35C 1QU0A 4TZDA 1O4ZA 1Y7BA 3VZKA 2VOXA 4Y4YA 2YUEA 5AFBA 2DCKA 1RUI1 4NHMA 5KHHA 5BNOC 4H55A 1KFUL 3WW4A 3ZXEA 4AI1A 1GNZA 1UU4A 1V9U3 5DUVA 3MW4A 1YFWA 4A7ZA 1IHMA 1TMF1 1OQDA 1BBT2 3LSDA 1KFXL 3OY8A 3QCWA 2D6OX 1HXS2 2NMNA 4AK3A 5BNNC 4GKYA 4AGGA 1JH5A 2RM23 3SNMA 2G9GA 3VGIA 3WQ7A 4AVSA 2YXSA 1LHUA 5BUVA 1DQ1A 1RUD2 3HT2A 3M3OA 3VKOA 1S0CA 3UKNA 3FE5A 2D6MA 1QQP1 2EXJA 1DDLA 1LENA 1PO21 4E27A 1AR63 5CAZA 1H1MA 5LEJA 1DGLA 4QPGA 4ZU7A 2GMEA 4O9EA 3O7OA 2E6VA 2JEMA 4UBHA 1F5JA 2PELA 1X82A 4NN0A 1WW7A 3FX3A 3EJKA 3JD73 4XILA 3AJYA 5GLUA 5LRSA 4HFSA 2HWE2 4ES8A 4UW6A 3KMHA 4AW7A 2VOVA 3DUIA 2ZABA 1PK6B 1DBNA 3H0OA 1QWRA 4G4FA 5JWPA 4JTOA 2XKOA 3OY8B 5JI9A 3CJXA 4D7SA 1N3PA 1B35A 1S2KA 2HWD1 3R0RA 2TBVA 4YVWC 3WHUA 2PYTA 3NV2A 2D98A 5L73A 2RM22 1MS5A 5D8AB 2XGXA 4QGMA 5BNOA 5SV8A 1C8M3 4ATEA 1NCRC 4PLOA 3WV6A 4R9DA 2A6ZA 3APBA 3NAPC 5T52A 1BEV1 2C0ZA 1H2NA 3MDPA 2XHKA 4QPGB 1POV3 5BNNA 4LE4A 4LHLA 3HR9A 1WGPA 3BOWA 3I7DA 4BHPA 3I4IA 2WS91 4BQ1A 3OGJA 3ZXDA 3JD72 2Z69A 4P9LA 5DZGA 4CDUC 3BODA 1VBA2 2Q30A 3MLJA 1RUE3 4QT6A 2XG3A 4UW5A 4YGCA 1JHNA 1HRI3 5JPMB 2ET7A 4GALA 2CGPA 1SBFA 4GWMA 5CIRA 1VBC3 1HIXA 1BXHA 4EN8B 1ZRFA 3CJIC 4LNVA 4MGYE 1BKZA 5I8SA 4OI1A 1MS9A 2XVLA 4YG3A 3TN91 1DYPA 1X50A 2R0HA 1J1LA 3LOIA 4AXOA 5I0RA 4X8NA 1D0HA 1C8M2 1YLLA 5CNAA 4DMIA 1LHOA 1MACA 4N7UA 4UBGA 1TME3 3S30A 1NOVA 3GBGA 2QCSB 3B9CA 4AEDC 2HYKA 3AP4A 4YVWA 3AP7A 3D0JA 3ZPYA 4TSVA 3ZFGC 2VW2A 1ZNPA 4H7LA 3E5UA 1NCRA 1R083 4C91A 1POV0 3NAPA 5IUQA 2K9ZA 2RE9A 4OI4A 3W58A 3H3ZA 4XJZA 1RMU2 2RS53 4BMEA 1ZZ7A 2AUYA 1OKQA 3WG3A 2C9AA 4MH0E 4XJ8A 5KXEA 4LBQB 1LHVA 3AYDA 4AI3A 4CDUA 5GM0A 1BQPA 1MEC1 3RDIA 4BYYA 3HBZA 2ZJCA 4ZKTB 4J1WA 4YG6A 4QD2A 1GLHA 1TME2 1VAMA 4QQ2A 2JD4A 1JYIA 4YVWB 1SDWA 3CJIA 3AZXA 1DIWA 3DN7A 2XWJB 1YJLA 2A5ZA 5GZEA 4EN9B 2FMYA 3R05A 4NVPA 4I0BA 1K5MB 1NCRB 1RUH1 3NAPB 1SACA 1R082 4FTEA 5DDJ3 4OHZA 3IN9A 1KDMA 1G6NA 4AEDA 5ACA1 1ZX5A 5FPXA 5HCAA 3NSTA 1FOD1 4YW1A 3WW1A 3MIFA 4WM8B 2RS52 3N7LA 1AVBA 1Q56A 3ZFGA 3WCRA 1W6QA 2EAAA 3D5OA 1W6NA 2V73A 3NWKA 4ZU5A 3O0WA 3P3NA 4DNYA 4EWAA 4X8PA 2ZOEB 4CDUB 2FBEA 4NHLA 4C1WA 1A8MA 1LOAA 2EXIA 3N7MA 3FLPA 3O12A 2CL2A 3S7EA 3X29B 4N43B 1QOTA 1U5ZA 4DS0A 4RD7A 1OI6A 4K40A 4W6XA 1O5UA 1AHSA 4JGZC 4BIOA 1ZM1A 4DOUA 1OQ1A 4RGAA 1DG6A 4W6WA 2FZ2A 4TLFA 2Q1ZB 1W0PA 1V6LA 1TNFA 3MGUA 4HETA 4AEDB 5DDJ2 3OYWB 2R063 3CU7A 3HIFA 3N4MA 4X6QB 5FO9B 4XMIA 1HQNA 1BCXA 1W6QB 3M70A 1W6NB 4YGBA 4Q4X1 5AC93 1EV11 1LOCA 1RJ7A 5CG9A 4YRDA 4OUMA 1GQHA 3WW2A 4RQPC 3WP5A 1RB8G 1RVF1 5E88A 4Z1VA 4Q4W3 4N90A 2WSUA 4FP3A 2ZKLA 4LUKA 2ZGRA 1V6OA 4PIZA 3FUOA 1QMJA 2JECA 2RR13 3WUDA 1COV1 4AF9A 1H1AA 1LU2A 1AF9A 1G8WA 2C5DA 2A6XA 5FCCA 3ZN5A 3NKGA 5JZGC 2AR6A 1W2UA 2XLGA 4YW2A 5C6CA 1DQ5A 3AZYA 3NV4A 4BE3A 4FXKB 4CEYC 2RS33 1ZBA3 2FHRA 2R073 2R6QA 2BFUS 1H8TC 3AP9A 3IT8A 4CDWC 2R062 4JGZA 4XQDA 3A0KA 2NLRA 1ENQA 3OD0A 4KWJA 1WBFA 2YMZA 3PHMA 5AC92 2GN3A 2VULA 2MEV1 3B9IA 5DZFA 4YYOA 3O0VA 3WNXA 4QQHA 5F5QA 2HWC1 3V56A 1D4M1 1ZZ6A 2RR12 3ZSJA 2JICA 3VHRA 1VP6A 4XF4A 2EA7A 3VV1A 4DRVA 3KLSA 4RQPA 3OCPA 3MW3A 4R9AA 2CWMA 5F9TA 2VY0A 4BWOA 4B8EA 3LSEA 4LA3A 1C5IA 1R1ZA 2EAKA 1CQ9A 1ZBA2 1UL9A 2MNGA 3L9JT 1RUI3 2R072 3MI8A 1LEMA 4JGZB 2QJVA 3KCXA 4SBVA 4Y1VA 4S2GA 3U11A 2WNEA 3UJOA 5C8CB 2D7FA 5HXVA 2ATFA 5JZGA 3UKVA 2IXCA 4HZFA 4LO7A 4ITCA 1REEA 2GALA 4CEYA 1R091 3HAGA 1VAVA 1AR83 2WLQA 3CNAA 1CAVA 1H8TA 3PVEA 1J3PA 4W6YA 4A3XA 4CDWA 3FUQA 4G9SB 1RUF2 4HKWA 3IMNA 4LBOA 1QQP3 5K8SA 3DPRC 3EQEA 3IDEA 3VHPA 1FMD2 1DQ2A 1PO23 3LWCA 2QZ2A 2IC1A 4S2FA 1RUG2 2AYHA 4G3YC 1FT9A 1OQEA 4RQPB 3BCWA 3B02A 5L7OA 5KWRA 2CGOA 1N3OA 1SLAA 3T1LA 3H1YA 3HWJA 2JG9C 3KGLA 4FPEA 3PLQA 4XJAA 5BNQA 2W68A 3FFQA 2EXKA 4Q0PA 3ETQA 3AK0A 1H9WA 1VJ2A 1YIFA 1LB2A 2IWGB 1ND2C 3VBUA 4A7KA 2ZZJA 3M8LA 4NWVA 5GKAC 3ZXJA 1J3QA 1KJRA 4OFGA 5DUUA 3D82A 2WT1A 1DHKB 1VBE1 2HWD3 4CEYB 2BBVA 1G7YA 4I01A 1CAVB 3ZX7A 2Q8OA 5FLHA 2ZGSA 4CDWB 4FT8A 1AR82 4IETA 4JAAA 4MGZE 1XU2A 1NA1C 4AI8A 4AEMA 4Q4Y1 4FOQA 3AFKA 1GICA 3ZSMA 3SHRA 1BYHA 1QXRA 4Y5Z0 4XBNA 1HRV1 5L7OB 2CV6A 3M3EA 1RJ8A 4M00A 4IESA 4BLJA 2WS93 1PGL1 3S7IA 3DPRA 3J4UH 1N1TA 3OBRA 4XIKA 3U07A 1F31A 5J36A 2CNAA 3VBUB 1RC6A 4FPJA 4AEJA 2WZR1 1TEIA 4CYDA 1DGRA 1ULDA 3ZFEC 1ZYBA 2ES3A 1R1A2 2P2KA 5C9AB 1UN1A 2JG9A 2R16A 2VGDA 1XNCA 4FAHA 4Z2WA 2YY1A 3FMGA 1EY2A 2Z5WA 5C33A 1ND2A 4LBNA 2RMU3 3RQ0A 1JUHA 2WC2A 1KDKA 2DCZA 5GZCA 3L2HA 4BCUA 5K0UC 1DZQA 2HWB2 1V6MA 1RUC1 1KJLA 4XE9A 1NA1A 3KCCA 3KCYA 2WS92 3RG0A 2RHPA 4IV3C 2PHUA 3JBG1 4AVBA 5GLZA 4JV4A 2UY8A 4I0WB 4OHYA 1Q8PA 2OPKA 2ZGMA 1H2MA 3WG2A 1XE8A 2PHRA 3ECQA 1Q8OA 5DUXA 3VHOA 4ES9A 3E5QA 2DFBA 4WZCA 4YARA 3UV9A 2JG9B 2YGMA 4Y26A 1RUJ1 1V6JA 2WLPA 3ZFFC 4AWDA 2WFF2 2PLV1 1QH6A 4Q26A 4KG0A 3SCFA 2WSVA 1MEC3 2X5IC 1C4RA 1ONAA 2AGSA 2PHLA 3QH7A 1QJX3 1TQ5A 5GALA 2RMU2 5JOYA 3V0AA 3WVJA 1VLNA 2BFUL 3OD4A 1C1FA 3NO8A 4K1YA 3EXUA 1W39A 4RS5C 4MZUA 2OIIA 4XBLA 3MLKA 2D44A 3VKLA 1NA1B 2TNFA 1PGW2 2DTWA 4QMAA 3E97A 1MS0A 1O4TA 5K0UA 1H2KA 1A3KA 5ACA3 1ENRA 1QOSA 1QJU1 2B45X 3RRDA 3AJZA 2B5HA 3U10A 3CEWA 2GN7A 2QNKA 3IPVB 3MIHA 3WG4A 3WW3A 3KB5A 3LB9A 1UPIA 3ST7A 1U5IA 4OULA 1ZREA 5GLWA 1PHMA 5SV5A 4MVTA 3VBHB 2BYVE 2XL7A 4IV3A 5JR7B 2LUWA 1PO11 1G9BA 4QQOA 4F83A 3NV3A 3NW4A 1ZZCA 5I0SA 4XJUA 3V0AB 1QJX2 3ROUA 1VB4A 4RHV2 5C4WC 1SCSA 2DUOA 4E9KA 3VBFC 1ZRRA 2OW4A 3ZFFA 4NWWA 1XRUA 1J1TA 4IXLA 1FPN1 2X5IA 4AQ2A 3KGZA 1FATA 1WLCA 2SBAA 4AQSA 3ILRA 3OPZA 2KM2A 2E7AA 2ETEA 1SLCA 3N3HA 3WDTA 2IFRA 5JOXA 2WA4A 3RWNA 4BIFA 4XYXA 2ZZQA 5K0UB 3N35A 2P37A 3ZYRA 2P3KA 2BEOA 4LTAA 3ZSLA 1HX6A 2WQ4A 4Q4X3 1HW5A 2D6NA 4URTA 3D8CA 4MX3A 1UPSA 2ZGNA 3J26N 4IV3B 4MUVA 5FMOL 4HN0A 4SLIA 1O7FA 2AH2A 4PIXA 4H7MA 4HLTA 2D3RA 1KXGA 2G9FA 4C1XA 3ZYPA 3C3VA 4YG0A 5JIUA 2D5FA 3ZO0B 4DY5A 3MF9A 2WZPP 2ENRA 2VVEA 3JB4C 2CY6A 4PQ9A 5DXDA 1VRH3 3MICA 1S0FA 4MXVA 1COV3 2DV9A 3ZFFB 2O8QA 4QU2A 4XPVA 4AVAA 2RS13 4CDQC 1QNYA 1ENXA 5IK8A 2FQPA 1AR71 1U12A 3JQWA 1S2BA 3AYCA 4IEXA 4YM1A 5BNPC 3W9AA 1BVVA 1WMEA 4M01A 2PHTA 4PLNA 2EXHA 4RR3C 4RL7A 3ZIWA 4JVAA 4N53C 1FNZA 3VBFA 1GFF2 4CP2A 1AYM3 2EIGA 2D5HA 2EALA 4NHKA 2A3XA 1NXMA 2Q4SA 3N36A 1IKPA 4XFGA 4FCAA 5GJ6A 4COVA 3I59A 3Q9OA 2MEV3 2R043 4JDNA 2ET1A 1AL22 3AP6A 4UXAA 3AMMA 2HWC3 2NPIA 3UL2A 1MS8A 1J59A 2NYYA 4EWDA 4WV8A 5CFCA 3SH5A 2HKXA 1D4M3 4OLLA 1VRH2 5CB7A 1AXZA 5E16A 3VBSC 1O4YA 3MYXA 3FBYA 1MQTC 3ALQA 3WDVA 1ASJ1 2RS12 3QLQA 1AR91 1QJY1 1CONA 4LLOA 4MGIE 1XYOA 2WJSA 3ILFA 2ERFA 1N1SA 1RGSA 5T3NA 5B2GB 3VBFB 1I3HA 3VL9A 3DF0A 5KBFA 5JI7A 4CDQA 1AYM2 2ARBA 2E51A 1C28A 1V9U2 1NCQC 4AQ6A 1GQGA 5E89A 3GBFA 3I59B 3IIAA 2D6PA 2E63A 1BMV2 4RR3A 1CAWA 1R093 3TWIA 2R042 4N53A 4P9WA 3RMYA 2WFPA 1GSLA 3VKNA 5CFCB 5J98B 4N9IA 3B94A 1QOOA 3HD8B 2DUQA 2PTMA 2WNUC 1XXNA 1LHNA 1AR62 3AMPA 4V1PA 1IGOA 3E5XA 3JQXA 4XW3A 4Y1XA 4Y20A 2GC1A 3FBMA 4QPIC 4Z82A 4NO4A 3KQRA 1UF2C 3ZXLA 1LU1A 1VBB1 3PMEA 4B4QA 4L8QA 2GNTA 1S0JA 3INAA 3KT1A 1MQTA 4CDQB 1IS5A 4HL0A 2W0XA 1AUYA 1S0GA 4LUMA 1NXD1 3ATGA 3AKSA 1JBCA 3LA2A 4M0NA 4PBOA 1N1YA 3FC0A 1GZ9A 1B35B 1LOGA 1VBE3 1CAWB 4HSJA 4RR3B 4XZPA 5BY5A 2TEPA 3KD4A 4N53B 3IM0A 4TWTA 5BNOB 3OJBA 4Q4V1 1GZCA 2PFWA 3J8F1 2A71A 4GMP3 4XXAA 2H6CA 3WDWA 4Q4Y3 2I2SA 2Y26A 2DCJA 4KNCA 1MZ6A 2Q0AA 5J96B 1LODA 5BNNB 4JC1A 3H9AA 1KS5A 4Y20B 5J3UA 3RI8A 3ACLA 3MIDA 4Y24A 4GB31 5J7MA 1CAXA 3H7YA 1H1IA 1YYNA 2XBO1 3SH4A 3GHMA 1G9CA 5A32A 1UD1A 2WNUA 4AVVA 4P5HA 1AL0G 1MQTB 4QHBA 1KD7A 4CRQA 1MVEA 1RUE2 2IZWA 2WZR3 3LKJA 3KT4A 1HRI2 4YM3A 1YI9A 4QPIA 3TOJA 4YZ3A 1PZ9A 4EN0A 2ZGPA 1VBC2 3FLTA 4BM8A 4GH4C 1EPZA 4AFDA 3WZ1A 3BPZA 3P3PA 4P9XA 3MEPA 5T50A 4Q0SA 1WD3A 4K21A 4FTSA 4XF3A 3TB0A 2XLAA 1URXA 3C2UA 2X53S 2HEWF 4D7TA 2AREA 1CVNA 4AYUA 3WHTA 4GMP0 2NM1A 4KU7A 2P3IA 3I2DA 4FXGB 4MYEA 1N3QA 3ZXKA 1PMIA 1CAXB 1TE1B 3B5LB 4GA9A 4DB5A 2BQPA 3HMYA 1PGL2 5A32B 4AHWA 1EP0A 2WNUB 2W08A 1MS1A 1EPWA 1PIV1 3ZYJB 4JRAA 3W59A 1DQ6A 2D97A 4HKLA 1H2LA 4OHWA 4QPIB 4YVSC 2XL9A 4COYA 4XQ4A 3ZSKA 1EAH1 2QKDA 1U0AA 1YFUA 3QD6A 4IEZA 3USUA 5K9YA 2HEYF 4FPGA 1C3HA 2LALA 1ZRCA 2XWBB 1DGRN 5HBAA 3CJIB 3SCGA 4MXWA 5DG1A 4N9HA 4YM0A 3I8TA 2O1QA 4GH4A 1H4HA 4FP2A 1AYN3 4PIYA 2BNOA 5A33A 4CZSA 1OFSA 4RGGA 4B29A 4YLZA 1KS4A 1V00A 3AMNA 3H50A 1WD4A 5FOBB 2D6KA 1OA3A 1KQRA 3NJZA 1PVC1 3S6PA 1I6XA 3N7JA 1RHI3 3WP4A 3ZFGB 1GV9A 1OLRA 2ZCWA 4BMBA 1MZFA 3EBRA 2HWF1 1D2QA 2D3SA 2H0BA 2OUJA 4JRLA 1O3SA 5FBZA 3ZXFA 1LTEA 4GULA 4C0HA 2ZGQA 2QDNA 4AHZA 4WZFA 2Z79A 1QNWA 3USUB 1WMDA 1QY4A 4H3WA 1G86A 1Z7S3 4S2HA 2ZBJA 4CDXC 4I0AA 1BVP1 4YVSA 2R32A 4DRRA 4MXWB 3THPA 4DZGA 4GH4B 4XFHA 3PJQA 4RA0A 3PVOA 5A33B 4FOVA 1RTVA 1BBT1 2ZHNA 1AYN2 4KL1A 1HXS1 2JE7A 4I2OA 4D3WA 3IKWA 2R30A 1U5XA 3RPQA 1Y9QA 1YI7A 4HANA 1NYWA 2D40A 1YNAA 3B69A 1VBD1 1RUD1 3M4FA 3OF1A 4BPZA 4YGDA 1SFYA 1XYPA 1RHI2 1A8DA 4YZ4A 1DGWX 4YFZA 2BNMA 1HV1A 1PVXA 4Y1ZA 4LO6B 4XOGA 3WD5A 3SITA 2QVSB 1ZBE3 4KH9A 2MHFA 3WINE 4QQLA 4C90A 1LEDA 2QQPA 5T55A 4IEOA 1Z7S2 2HWE1 4Q4W2 1XYNA 1HQWA 1HV0A 1I5ZA 2ZAHA 2UWCA 2DVAA 5JVVA 4YZ5A 1D0GA 2DVBA 2CAUA 2WINB 3FHIB 1N47A 5KHIA 4CEWC 2XB6C 3QH6A 4CDXA 3M1HA 4HPKA 2RM21 4PJYA 2DU1A 1A78A 1SMVA 4KGGA 3JB8A 4CP1A 4EN6B 2RS32 2WIIB 1NG0A 1APNA 2GDFA 2FZ1A 5GZGA 1JUIA 4LA2A 4F7ZA 3K51A 2DURA 3LZZA 1TMF3 1IOAA 1GYKA 2H0VA 4Y22A 1UKRA 4YW5A 2DVDA 1OFNA 2B7YA 1QH7A 1MVQA 2UWBA 4XHBA 5JDBA 2JX9A 3JD71 1ZBE2 4HT1T 2N7GA 3RS6A 4WVVA 2VW0A 1VBA1 1JTZX 4QPYA 4BA6A 5BV6A 1QF3A 1O3TA 3H1WA 2GNBA 1ASJ3 5FMOS 1AX0A 1PNFA 4YNIA 5DZEA 3PJYA 1QJY3 2PAEA 2VNOA 4CDXB 1NY72 3B00A 3ME2A 3AYAA 2B9UA 4EN7B 4NPRA 1AX1A 1M4WA 2XLFA 5J09A 1V6NA 5BPXA 5LK5A 1C8M1 5IK7A 3AYEA 4PBPA 1RUI2 2GSYA 1SQ4A 2GMMA 3POYA 5FO8B 1C8NA 2YROA 1B09A 4CEWA 5JZGB 4Y22B 1POV1 1TMF2 4DINB 3R4DB 1SEFA 2D93A 1EYBA 1LR5A 3MLLA 4HN1A 4AFMA 1ALYA 1H8TB 2BW8A 4WBBA 3FZ3A 3ZXAC 4Q1PA 5CFDC 1OA4A 3TBDA 3I54A 4DFSA 2D3PA 5AFEA 2Y0OA 4EJRA 1BEV3 1QQP2 1RMU1