1KS5A

Structure of aspergillus niger endoglucanase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
QTMCSQYDSASSPPYSVNQNLWGEYQGTGSQCVYVDKLSSSGASWHTEWTWSGGEGTVKSYSNSGVTFNKKLVSDVSSIPTSVEWKQDNTNVNADVAYDLFTAANVDHATSSGDYELMIWLARYGNIQPIGKQIATATVGGKSWEVWYGSTTQAGAEQRTYSFVSESPINSYSGDINAFFSYLTQNQGFPASSQYLINLQFGTEAFTGGPATFTVDNWTASVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the structure of an endoglucanase from Aspergillus niger and its mode of inhibition by palladium chloride.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Endoglucanase A
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ks5A00
1YNAA 3LGRA 1ENXA 3VHOA 2B42B 2DCJA 3AMMA 3WP3A 3VLBB 2D98A 2F6BA 4S2DA 1OA2A 3VZJA 4HKWA 3RI8A 3AKQA 1XNDA 4XQ4A 1XXNA 3WQ7A 1TE1B 3AKSA 1REFA 2DFCA 2VG9A 3VL9A 1H4HA 1UU6A 2JICA 4HK9A 3VZMA 3WQ1A 4H7MA 1H1AA 3M4FA 1BCXA 3LB9A 3B5LB 3RI9A 2QZ2A 1UU4A 2BWCA 1REDA 3AMQA 5EJ3A 1PVXA 2B45X 1XYNA 3MFCA 2VGDA 3WY6A 5K9YA 1OA4A 3AMNA 2BW8A 3MF6A 3AKRA 1UKRA 4XPVA 4NPRA 4S2FA 1AXKA 1H8VA 3VGIA 2QZ3A 3WP5A 2JENA 2VULA 1KS4A 4HKLA 1NLRA 2DFBA 3EXUA 2NLRA 3ZSEA 1OLRA 2DCKA 4XQWA 2C1FA 3WQ0A 1QH6A 3WT3A 3B7MA 1C5HA 3AKTA 1REEA 3O7OA 5K7PA 4S2HA 3VZLA 4HK8A 1OLQA 1HV1A 1OA3A 5HXVA 1C5IA 1HIXA 3WXPA 1M4WA 1XNBA 1IGOA 2JEMA 3HD8B 1QH7A 1BVVA 3VHPA 3AKPA 4HKOA 1H0BA 3VZOA 2DCYA 1W2UA 2Z79A 3WP4A 2DCZA 2NQYA 1XYOA 3WR0A 1KS5A 3VZKA 2BWAA 4XQDA 3MFAA 3VZNA 2D97A 2VUJA 3WP6A 1XNCA 1XYPA 1UU5A 2BVVA 4S2GA 3MF9A 4IXLA 1T6GC 3AMPA 3VL8A 3VHNA 3WX5A 3AMHA 1HV0A 2B46X 1BK1A 1F5JA 1XNKA 1H4GA
chains in the Genus database with same CATH superfamily
4L0PA 5LBCA 3WNPA 3E1F1 2VZ1A 1R081 3P5BA 2E53A 4QAWA 2B7YA 1QY4A 1BMV2 4GA9A 1DLLA 4HOOA 4S2DA 3RZGA 5LY1A 4LBQA 4QQ2A 2P3IA 1HJGA 2FHRA 4WV8A 3LQCA 2WO2A 4FQZA 3ATGA 5F3EA 3WDVA 4A3ZA 1LEDA 4AVSA 5CADA 1GQGA 3NJZA 4B8EA 2A70A 2YHJA 2AZ5A 4EN0A 1KJLA 5JSOA 1LOCA 5APAA 3OUIA 4AI9A 5JR2A 1AR72 2JKXA 3FHAA 1BEV2 3NQHA 3N4MA 3VL9A 5F39A 1LENA 2VW2A 4BM8A 4LLOA 2JB4A 1AX1A 1FV3A 3BPSA 1RUE2 5LBEA 3SXWA 4BCUA 5F5AA 4TLFA 3TEZA 2E63A 3HEIA 3UGHA 3T4VA 1ZBE3 4XZPA 1JU4A 1D2SA 4C1WA 2GNBA 2H0BA 2O0OA 2D6OX 2K2SA 1V6JA 3T1MA 3O12A 1N1SA 1SPPB 1ZM1A 3F95A 3LF7A 1O3TA 4DZGA 4JV4A 2J1VA 2VMFA 1U12A 2WT0A 4Z82A 3HR9A 2IFRA 1UL9A 1ULFA 2V4AA 2Q8OA 2BZDA 2ILMA 3WNOA 3ZFEA 2DU0A 4NPRA 5KXEA 2EICA 3SISA 4IE5A 2I2SA 5EWSA 2O14A 4FT8A 4GJZA 5DMYA 2W68A 3SITA 3VD5A 2DVAA 4NRPA 4A7KA 3PIJA 4QGNA 1SFNA 3OBRA 1MZ5A 4SLIA 4B7KA 1GNHA 2VCBA 2ADEA 3B94A 5L7OC 4FPYA 3AJZA 5GLVA 4AHYA 4BQ3A 3O1MA 1X9PA 3AZYA 5C4WC 2XJPA 2ES3A 2GDFA 3JCIA 1UKGA 1LAJA 3VBOB 4INDA 1W28A 1OQDA 3I3MA 1RUC1 2PQQA 3HN1A 2JG9C 1H9WA 4OULA 2HWC3 3HJRA 4UXAA 3EQEA 3U0ZA 1RUH2 1BJQA 4RYDA 3GZUC 1HB3A 1RUJ3 1ST8A 4PLMA 4FTSA 5I0SA 3V0BA 4OQ8A 3Q8AA 1BBT2 1PO21 4YW1A 1QQP3 3NL1A 4AQSA 2CL2A 3GJBA 1RUOA 3WP4A 1DGLA 3WW4A 5JOWA 4ZPIA 3H1WA 4KH9A 1CX4A 2UY9A 4QPWA 4AVBA 4IEPA 5A3PA 2GALA 1DZQA 2ET1A 4YG0A 4YW7A 4GAZA 1NKGA 4NN0A 3GZTB 4QDQA 1APNA 2Q8CA 4AVAA 2Y64A 4XBNA 4KGQA 4EJRA 1RJ8A 4YZ2A 1OLMA 1RXGA 1TQ5A 3CF6E 1C1FA 4LK6A 2FMYA 2ZEYA 2ZMLA 4AQTA 4BQXA 1C4RA 5F1RA 3MIEA 3KHCA 1X9TA 1W9SA 3I8TA 4P9XA 4Q26A 1E5HA 3VDDB 3MICA 4NIDA 3WF4A 2HBUA 4XZUG 1HQWA 4CDWC 3TN92 4Q4Y3 1LCLA 5C5TA 3LA7A 3OBTA 2WC2A 4QKNA 3AMMA 3I3DA 5LRRA 2W94A 1C1LA 4XFIA 2IC1A 5EJ1B 4P5HA 4M4RA 3WINE 1ZZBA 2VNVA 2VM9A 3TN91 1WLDA 1LOEA 2DV9A 2YBSA 5BNNB 2JKBA 4CYDA 1RC6A 3NJVA 1XNDA 4KMQA 1XXNA 5FPLA 2IUWA 1KFUL 1YQ6A 4R9DA 1XC6A 1J58A 1VBA2 5F8PA 3JZVA 3OD4A 3WDUA 2R041 2ZACA 3SKJE 4ZXEA 5ABJB 4KWKA 2WS92 3R4DB 5CB7A 1FV2A 1ULDA 4XOGA 5F3IA 5GZDA 1SBDA 2CU5A 3NVCA 3EYPA 3VDBA 1IZ3A 2P6HA 4H7MA 1GLHA 5JI9A 1HQLA 3B9CA 1QJY1 1QXPA 2QZ2A 1LHOA 2P3KA 2XKOA 4UFJA 3VKNA 4GB33 1HB2A 2WWUA 5IATA 4ASMB 4DS0A 1POV0 3AYDA 3JBG2 2LW8A 5T54A 3K51A 4QQOA 5CG9A 1ULEA 1TEIA 2QE3A 4Q29A 2XL7A 2Y6HA 4XBQA 3SQOA 3KF5A 1RUD1 5LY2A 3SLIA 1CX1A 3H8RA 1V6IA 4QM8A 4YW5A 4ZZ5A 1CWPA 2ID4A 2ZKNA 3Q9OA 3RVHA 2FDIA 3ZPOA 4ORFA 2XB6C 5IK8A 2WLQA 3MGUA 3O1RA 1CPMA 1P8JA 1O8PA 4RN5A 2JDUA 2Y6FA 1F5FA 1COV3 1GICA 4CCJA 5FXVA 4BPZA 1R092 3OUJA 2WT1A 2WZEA 2AGSA 2X5IA 4LUKA 5IVEA 5ABJA 5L19A 2RS12 3UETA 4DINB 1YQ8A 5FYMA 3GJAA 3WQ0A 5L7OB 1UYYA 2Y8KA 1EP0A 2VW0A 4Y3OA 1EUTA 3B7MA 1UF2C 3SMHA 1IS4A 3DYPA 3U11A 2VOWA 4FPKA 4LITA 5F5IA 4CEYA 1GOFA 1OVSA 4AI2A 4AEDA 5HPOA 4QU1A 5KR7A 1H6YA 2VJXA 5FZBA 2WZ8A 2VH9A 3SHRA 4UAPA 2RVAA 1ZZCA 3UL2A 4BHPA 3ES1A 4D0QA 2ZAHA 3P3NA 4P9YA 4RS5B 4OZXA 3J9SA 1M4WA 4UFLA 3PHMA 5FZCA 3VBRC 3ZMOA 1QH7A 5FYVA 5FZ0A 4NO4A 2XL9A 1Z7S1 4BQ2A 3GZAA 2C9KA 3MW2A 2RS13 2Z79A 4IEXA 1NCQB 1XYOA 1L3JA 2ZGMA 1V6KA 2ZMKA 3LSEA 4AXOA 4I09A 1GZWA 1GKBA 1JS9A 1GBGA 1W9FA 2Q4SA 3QCWA 1RUE3 3N3HA 4LKFA 4UI9L 5FY8A 5JSRA 4Y4RA 2VR4A 2Y60A 1RMU1 2G1MA 1NXMA 1UO9A 3DPRB 4QGMA 5EHDA 2QQVA 3ON7A 4GWIA 1F31A 1G9CA 5FWJA 1UIJA 3BTXA 2LROA 2R042 2RG4A 5KXBA 1GUIA 3VHNA 5A33A 3ETPA 4LKDA 4D7TA 2B46X 2IXCA 3FN9A 1X7NA 3BODA 2X09A 1LGCA 4XDQA 1DQ4A 3GZEA 3JBG3 5IWFA 1S1AA 3WNXA 4AEDB 4WM7A 4KWJA 5FOJB 1AR61 1ZRRA 2QBXA 3MV11 3T2QA 1ENXA 5IVVA 4O61A 2PHWA 4XXAA 2P2KA 3ZYBA 1PMIA 5HCHA 4QMAA 4MX3A 2XWBB 2DCJA 1W0OA 2VBPA 2RE9A 3I2IA 4QPGB 4URTA 5IVYA 1V9U2 4M01A 3BTYA 4MGTA 3NW4A 2HWD1 2E7QA 5FJHA 5FTTC 4M0HA 4NJ4A 4WVMA 1XU1A 2PYTA 4E2GA 1TE1B 1GZWB 1MZ6A 1W99A 3C8XA 4KQ7A 1AYN3 4TSVA 4AQ2A 4CCNA 2HWF2 4E2QA 3MBWA 1NX9A 2GH2A 1X36A 1VBD3 3UKVA 4JVAA 1Q56A 5EYXA 5FFOC 4A4AA 1DBNA 3A23A 5CAZA 1OC1A 1VPHA 2XPJA 2JG8A 1DYPA 4HT1T 1FMD1 4YG6A 1W6QB 3TEWA 2VZOA 5A33B 1W6OA 1YQ2A 2BWCA 2J1SA 3I2HA 3KHBA 1NA1B 2XG3A 3TN93 5IK7A 2HWE1 1JODA 4LHKA 3RMYA 1UOBA 1BYHA 2Y26A 3ILNA 3KQ4B 4XAAA 3ZMNA 1VBE2 2NYYA 3FE5A 1LHVA 1FYUA 2Y6LA 3Q8EA 2HEYF 3AXEA 2WUHA 1X33A 4CP9A 3LEMA 4IEVA 4XPVA 5A32A 1WGPA 3LD8A 1PGW1 1ZZ8A 2Q1MA 1WUVA 2GAUA 3ACLA 3LCPA 4UOJA 5JDBA 2ZHMA 4FXKB 4A6SA 3NV1A 4WVMB 1OKOA 4IV1A 2JENA 4YVWC 1ACCA 3DEMA 4W6WA 4GULA 2NLRA 1UXXX 1PMJX 1CVNA 1DLCA 4GKYA 1ASJ2 1US2A 4CU8A 5C9AC 2J7MA 4DY5A 5L9VA 2DF7A 1YQ5A 4MGQA 3KV9A 3DXTA 4AI0A 3CLPA 4WZCA 4NROA 3WF3A 1KDMA 4YWAA 1B35A 4JTNA 4MGSA 4RR3B 5JWPA 4CEYC 5FLHA 2HWC1 4XUQA 1UX6A 4OQ9A 4IE7A 3T3YA 4AEDC 2XONA 3PUHA 4EN9B 2QNKA 1HV1A 3M3CA 1LOFA 3LDRA 3RZKA 1OFSA 2ZZQA 4WM8A 1PIV1 2A6WA 4W8JA 4Y5SA 3NV2A 1PNFA 3NNJA 4OUMA 5A32B 4CP9B 1WCSA 2R072 3B01A 4X6QB 1SHWB 1ZBA1 3HPNA 1MVEA 4DXZA 2FCUA 1O8SA 2P4EA 1W2UA 4Q0SA 1UN1A 3VZKA 5LB6A 4X6RB 3KS7A 3OCPA 1CONA 1RTVA 1YLLA 4R8HA 4CTEA 3HQXA 1FT9A 1GNYA 4QX7A 5FY5A 5T5LA 3K3OA 3VZNA 1AF9A 1LGNA 3FWEA 4ZHNA 4OHYA 5E89A 3LPGA 4C0BA 1AX2A 1W39A 4P14A 3IIIA 4YZ1A 1IQAA 2Z5WA 1EAH2 3VBUA 5DQ0A 4MSVA 5CBLA 4LBQB 5FLJA 3VL8A 2ZBJA 1CAVA 4CZSA 1VRBA 3CDZB 2JDMA 4J1XA 4Q4X3 2WNVA 4J6GA 4UWDA 4CSWA 1SLLA 1Y7BA 3LZZA 1RINA 4NWWA 1KEXA 3FL7A 5FPZA 1C8M1 1LODA 2D5FA 3I4IA 4B1LA 3RZLA 3VHOA 2VZSA 3LFMA 2HWD2 3BOPA 4GWJA 3CKHA 5C5UA 1ZBE2 1HQNA 5A3LA 3WP3A 4BYYA 4HLTA 2BV4A 1BZWA 4YFZA 3MPBA 2EIGA 2VQUA 5GM0A 1PGL1 2WIIB 3I2FA 3PTYA 5H9SA 1K5MC 2MNGA 1AR71 4HVOA 2P37A 4HKWA 2WA4A 1NZIA 5LRSA 4COZA 2PHUA 4PBOA 2D3SA 1JYTA 1TNFA 2JE7A 1US3A 3WDXA 5C3SA 3AKSA 4R4XA 3ZFEB 3UNPA 4I02A 3WCRA 1YO8A 3SC7X 5DAVA 2ORZA 1MEC2 2ZCWA 5DPNA 5AC91 5JXGA 2P1BA 2XWJB 3ZPYA 3VDAA 4MXWB 5GLUA 5A7OA 2JE9A 4HG6B 1VR3A 2E7AA 2OUJA 5EV7A 1A3KA 2WNVB 4YW4A 1DZRA 1Y4WA 3M8LA 3RRDA 4AVVA 4Q8KA 2TNFA 3RGBA 2MEV1 2WNVC 1VP6A 2ZHLA 1F9KA 2W92A 5BNOB 4L99A 2PMWB 2YROA 4AVTA 1RJ7A 2WLPA 5H9QA 4LE3A 1AYM2 1AYN1 5FJKA 2DTWA 4LHLA 3WW1A 3ZIXA 2FBEA 1SCRA 4QT6A 3NRUA 5F5QA 3A0KA 2Q8EA 2X05A 4QX0A 3SH3A 5FYSA 4HSLA 5GZEA 3HQRA 2JXAA 1J3RA 3FFZA 5ACA1 1LKNA 1H8TB 1NLRA 2WWSA 3LEKA 3KT1A 1RL3A 4FCAA 5ANQA 5F3GA 1FOD1 2I74A 4AGVA 1OOPB 4ZU7A 3EO6A 1MQTC 3ZM8A 1H9PA 2A7AA 3ACIA 4XXPA 4XQWA 4UW6A 4BLJA 2Y33A 4E27A 1HRI3 5C9AB 1KXGA 5A70A 4YGEA 2W08A 1R1ZA 3TEYA 3O1TA 1IS6A 1DQ5A 3E5UA 4PF5A 2RJ2A 2G9FA 2VQTA 3J7MA 4CCCA 1UPSA 3GYDA 4YM3A 1NCRB 1GP4A 2VU9A 1YCIA 3OUHA 2C26A 1OH4A 4A7YA 2WYFA 2JEMA 1UZVA 4CDXA 2J1UA 5FZ7A 2RS11 4HKOA 4XCBA 2RM21 1NYWA 4CU6A 1VBC1 3T2PA 1FOD2 1I1EA 1WW5A 1MS9A 1QQP1 2LM3A 2E31A 4XBLA 1W6MB 1WZXA 4IETA 4XF0A 2QQNA 1J84A 1LR5A 4MXVA 3WD5A 2DUOA 4JQTA 3W9AA 4GD4A 4LBOA 1W90A 4N53C 5FKBA 2DDUA 2E6VA 4V1PA 3HQUA 3O0XA 1YJKA 1WLTA 4DXSA 1VMFA 1ZRFA 3BKZA 4LO6B 2A3XA 3M1HA 3NV4A 4U2AA 4JAAA 2FDGA 5FZ1A 2VMIA 4MHRA 1QDCA 3PVBB 1W05A 1XU2A 5A1FA 4HFSA 5C8CB 3LGRA 5AFEA 4OCTA 1SDWA 4RSUA 1T6BX 2OZ6A 5EPAA 2KM2A 1H2LA 3OTFA 4P9GA 5FPUA 4CDXB 4EE2A 1BEV1 1SBFA 4N9IA 1HN0A 4CDQA 1FPN2 3N36A 4Q2FA 2JX9A 4NIHA 3ZSMA 1O91A 3L9JT 3NKGA 1W2AX 2WJSA 1L7QA 3AJYA 3AP9A 2E32A 2VXRA 1DGWA 1Q8QA 2HBTA 2ZGOA 2C9AA 3EJKA 4YG3A 5C4WA 4XIOA 3K3NA 2FCVA 3U1XA 2WNEA 1VAVA 5BYNA 5FR3A 3THPA 2GC3A 4ZXKA 4CEWC 3U14A 1R083 4AFDA 4BIFA 4Y33A 3RPQA 1MVQA 4NIGA 4MLOA 3BB6A 3J8F2 4M3CE 3BU7A 3M3IA 4AI3A 2HJIA 2ZXQA 3IDEA 5C8WA 3PUIA 2B45X 2DVBA 2J1TA 3MFCA 4JCKA 4FOWA 5D8AB 1HB1A 4XUPA 4I3PA 4UBGA 1GMMA 4BQ4A 1AL0G 2WDBA 3ORJA 4PLOA 1OA4A 3AFKA 2PELA 3ES4A 3Q8FA 1VB2A 1W8TA 3P6BA 5FZEA 2Q30A 5ABJC 1DP0A 4CE8A 3RS6A 3JXSA 4OYUA 4UFHA 5F32A 4S2FA 5T5JA 2BFUS 3SCGA 3S7EA 2UYBA 5JIUA 2JD9A 3S5AA 3IWZA 4RA0A 3JD72 4HMZA 4MG2A 2WA3A 5KXCA 1Q8VA 3Q8CA 1COV1 1LU1A 4FOYA 5IT6A 5JI7A 4DPNA 3ZSEA 3WW2A 1R093 4KG8A 2WSVA 1OURA 1WWYA 1PZ8A 3WG1A 4OHZA 1G8WA 1COV2 1NCQA 3NAPB 3ILRA 5F6KA 1REEA 2BBVA 1LEMA 3UT0A 5K7PA 1LESA 2ARCA 3RNSA 3T09A 5CIRA 4CDWA 1TVGA 1PMHX 2VOXA 5D8AA 1KGYA 1PIV3 3NO8A 1H30A 3VKOA 4PQ9A 3KCYA 1EPZA 5HXVA 2D6MA 1XQNA 2CYFA 5IUQA 5J48A 4IE6A 3AKPA 4QPIA 1MS4A 1ASJ1 4MOAA 5CKNA 1SEFA 4F83A 1VBE1 4QQPA 4XACA 2QQPA 5FZHA 4ARYA 2CV6A 3NJYA 4NHYA 2XMLA 3I97A 4JX0A 5F5CA 3T1LA 4QX8A 4ARXA 4CCMA 3USUB 3PLQA 3OJBA 4LO5B 2EXHA 3H1MA 2WS91 1QGLA 2WABA 3OGSA 4EROA 3KM5A 3H3LA 4N53B 3J7NA 3MF9A 5IK4A 2HEVF 4ET7A 2C6SA 1IG0A 1HRV1 4HONA 5LASA 3GNEA 1NE6A 3WX5A 4LBMA 1ND3C 2Q8DA 1CD3G 4I3GA 4ZS2A 4DMIA 1K5JA 3AXDA 5L9RA 1MS8A 3IAPA 4B7EA 4JKLA 2UWCA 4QPGC 1AJOA 4EV0A 4GIQA 4ITCA 4LMFA 3ZX7A 5FRAA 4TTGA 4Q4Y2 2UU8A 3RYPA 2KXLA 5F9TA 1W6QA 3BTAA 3VLBB 5C70A 3ZFFB 4AAXA 5GLZA 4ES8A 2BJSA 3VZJA 3RI8A 1NA1A 2VPVA 1OD5A 3AVRA 3FJSA 2FDJA 2PLV2 4Y5Z0 4DOUA 5IAXA 2VVEA 1SMVA 3AVSA 4N43C 3P3PA 5FP3A 1NY72 4L9BA 1HRV2 3ZKUA 2DUPA 5F2SA 5B2GB 4E4DX 5LBBA 3PURA 4CUCA 1NQDA 2WN2A 3WDYA 4IW3A 4R52A 4IE0A 4AHXA 1AL21 1ZBE1 4QHBA 3ZYHA 2LRPA 4P9WA 4IV1B 2QQJA 3RDIA 5DABA 1YFYA 1PVXA 1YXWA 2NMOA 4IV1C 2WAOA 1QQP2 2VC9A 3F2ZA 4I0BA 1BBT3 1LRHA 1W6NA 1D0GA 3WY6A 2JDKA 4Q27A 5E88A 1ODMA 2BNNA 3O1PA 4LA3A 4DUXA 1F2NA 4RS5C 1JUIA 3CNAA 2EAAA 1HDKA 1JYCA 1LGBA 2JDNA 2WFF1 3AKRA 4MUVA 2VZVA 4PT6A 1Q8OA 4XE9A 4YPJA 4RR3A 4BWOA 1G86A 1Q5OA 3ACFA 2D3RA 2PFWA 4K6BA 1GZTA 1XOYA 4RD7A 1RMU2 5FZOA 2WAAA 4NRMA 3HT1A 1DDLA 1SFYA 2MHFA 1GQPA 1QJU2 2QQLA 2GU9A 3LIHA 1KS4A 4A41A 4QKBA 3C2UA 4X8PA 3ZXGA 4KGGA 4MO3M 5L7OA 1CAXA 3FZ3A 5CZKA 3C3VA 2BPA2 4Y1ZA 4AG4A 5DUUA 1G9AA 4KBZA 1RUNA 3WDTA 4DRVA 4D7SA 2K46A 3PVOA 4AE2A 2VZUA 4PF1A 1N3OA 5CYYA 4WM7C 2KA3A 4DIQA 3IPVB 5JXHA 1NUKA 4CCOA 3BIEA 3Q8BA 2OX0A 2BP6A 4FQ4A 3ZDVA 4TYSA 4AQ6A 4JZRA 3RZMA 2AACA 3URFA 1KQRA 1PVC3 5FUIA 5KC6A 4LTAA 4AAPA 2HYKA 1YEWA 5FOBB 1OLME 1C5IA 2A6XA 1TME2 1ZA7A 5G05L 5EFUA 2LALA 5A7QA 3ZFGA 4PDWC 3BUCA 2PHRA 1F4AA 1MPXA 4KBBA 4PI2A 4QXKA 4EWDA 4JDNA 1RXFA 1OUXA 1S2KA 4YVWB 2HWB2 2NQYA 4K40A 1KS5A 2WNUB 5DDJ2 3U37A 4JQRA 2W2IA 3NV3A 1QJY2 3OYWB 1DGRA 5JOYA 1O3SA 1H2NA 3T0AA 4CCEA 3OGVA 4PCRA 4AZZA 3I59A 2VMHA 3ZSJA 3SEEA 1JYNA 3ITQA 5I91A 1MS5A 1NLSA 5FMOS 4E8DA 3WSOA 4D6QA 3LA2A 1NE4A 1SACA 5FYZA 1PM4A 3RSJA 2D6KA 4K3UA 2C0ZA 2V72A 3ALQA 4AYUA 1GZCA 4FPLA 1K12A 1RUG1 1JXNA 4QPGA 4BE3A 1LHNA 5IVCA 5LEKA 4META 4OZOA 2VZTA 3THCA 2ADDA 1QU0A 2E9QA 1HKDA 3CJIA 2AENA 2XUMA 2HWE3 5IFTA 4PIZA 5JPMB 2DBIA 1GZ9A 2NMNA 4YVWA 5FYIA 1RHI3 2R061 4C8DA 3RWNA 2W9XA 2R043 2WWJA 3NSTA 1PK6B 3PUAA 1O5LA 1REFA 2GP5A 5FY9A 2VBDA 2AYHA 3VBFB 4AI1A 3ACGA 3GBFA 5EZWA 5SV8A 2QJVA 1JZ2A 5GLWA 3WOGA 3R4UA 5LATA 1S0EA 2JB8A 1LNSA 1Q8SA 2BTVC 2NM1A 2ZGNA 4HK9A 4I30A 4BQWA 4CP2A 4L11A 1RUG2 1W9TA 3POJA 2HWB3 1UU4A 2VOTA 4GB31 1REDA 5I0UA 3B69A 5EJ3A 2Y0OA 2VBBA 1KRIA 3IM0A 4LK7A 2CY6A 4FFIA 5FKCA 1WMFA 4AGRA 3TRSB 3K46A 4DFSA 1UWWA 4CP1A 1O7FA 4BQ5A 4BIOA 1OF3A 2D7FA 5CG8A 1OQEA 4CUGA 1WA4A 2W1SA 1YRZA 1H8VA 2XVKA 3DPRC 1RVF2 3B93A 4O9EA 4KNCA 3MIFA 1HLCA 3I54A 4YRDA 5GJ6A 2QZ3A 3FX3A 4JTOA 1EV12 1GOGA 5I8SA 3CJIC 4W50A 2YPDA 3RZHA 1QHDA 3NMBA 2A3YA 1GNZA 5HCFA 4AEKA 1SBEA 3DN7A 1W8WA 1VBB1 4FPOB 3AYEA 4A6OA 2Y6JA 3B02A 3E6DA 1RYYA 1JN2P 3U75A 4B29A 1RUF1 3AKTA 2BNMA 3MI8A 2YY1A 4QHZA 5CU1A 2SBAA 5FPAA 3VBUC 3IAQA 1UNBA 1A6CA 1OLQA 3MDPA 4XUOA 4WM8B 5FZMA 3WF1A 1GP6A 5A6QA 4RR3C 1ODNA 1YI7A 2B9UA 3N9NA 4Q4X1 2B8MA 1AR93 1JTZX 4GXLA 1IKQA 1UY0A 2FD8A 3BOWA 4COWA 1C8M3 5CFDA 3O1VA 4UYBA 2RM23 2WQZC 4U36A 1A78A 1IS3A 4FO9A 4NMIA 2WSUA 1N3QA 5C8CA 3TNPB 3BN6A 1SLTA 2XLGA 3N9LA 2F4PA 2Q0AA 2UYAA 2WS93 3PVNA 3ILFA 4FTEA 5FMDA 2WZR2 1RIRA 5FZGA 1RUI1 1JOPA 2YC0A 1JU3A 5JSPA 1ZZ7A 4TN7A 1T6GC 2OYZA 1IHMA 5SV5A 2YXSA 2PLV3 5A7SA 1H2MA 3S7IA 1HW5A 4GWNA 3V64A 3SEPA 3W21A 1CAWA 2IXHA 3RYRA 1FPN1 4UF0A 3CU7A 5C4WB 5FO8B 3K4AA 4UW3A 1OVPA 1BLZA 1UD1A 2R0HA 5DG2A 5AC93 2Q1FA 3G7DA 2XQRA 4IEZA 1YIFA 1R1A3 4KL1A 4CXXA 1Y9QA 2WL1A 4PDWB 2D98A 2CDOA 2PTMA 1FX5A 5GZFA 4YZ4A 4COVA 5IVFA 1IG3A 1NY71 3AKQA 5FZDA 4A45A 4M0NA 3ZOIA 1OHFA 2QQMA 5AVAA 4NIAA 4AGGA 2AEYA 4Q0QA 2QFEA 2XBO2 2A5ZA 3IDBB 1JMUB 2WT2A 2OA2A 2BUKA 2VG9A 2X10A 1JI6A 2XQXA 2JICA 3PJQA 5DUWA 4MXWA 1CPNA 3PU8A 5GKAC 3WG4A 4IGQA 2ORXA 3IMNA 2TUNA 4QQHA 1V9U3 3H8XA 2RDSA 3S30A 3RI9A 4IEWA 1YWKA 4V2WA 3VD4A 2ATFA 4EWAA 5CA6A 2WINB 3LEIA 1XYNA 2YU2A 2DBNA 1AR83 1VBC2 4XFHA 3DECA 5FPBA 1PHMA 3NNGA 4LBNA 5HBAA 4AWDA 5FY4A 1CR7A 1PIV2 3NAPA 2Q5TA 3TWIA 4A44A 5EP9A 2BOIA 1UYPA 2VUAA 4AFAA 3VGIA 2D43A 5IK5A 4XTPA 2N7GA 4D6RA 4OLLA 4AW7A 2GC0A 1CGPA 4H55A 4K7JA 2GNTA 1OOPA 3BGAA 2ERFA 2HWB1 3KZ4C 1RUF2 2PHDA 4O7XA 3V0AA 5DDJ3 3AP7A 4GKXA 5BNNA 3MHZA 4CDQC 4HL0A 5FYUA 5FZ3A 1W3XA 2NP0A 1LTEA 4NHKA 4UBHA 4ATFA 1CAUB 3DF0A 1H1IA 3INAA 3VBSB 2O8QA 3M3OA 4LO7A 2X5IC 3WNNA 4GH4C 4C91A 3USUA 1PVC2 4HK8A 4NPMA 5K0UB 2NZ9A 1K3IA 5KHJA 2QVSB 3C7FA 3KLSA 4I0AA 3M2MA 2B9VA 4LOTA 1OXCA 1OA3A 4YW3A 1ZA4A 3VHPA 3KQRA 4IV3A 4P5YA 1R64A 2LUWA 3IDCB 2FZ1A 2ZKLA 2F17A 3BTZA 4RFT0 3HNMA 4XHBA 3POWA 4XFCA 3U07A 1QJX3 1RUF3 2VCAA 2ZX3A 5FBZA 4XFFA 1TMF3 4XQDA 5FYBA 1XE7A 5D21A 5FZIA 2BFUL 3K4ZA 1GQHA 3FLTA 1UYZA 2UURA 4M4PA 1BEV3 1XYPA 2MPFA 2RS31 3OD0A 1RMU3 1TG7A 1G9BA 4LE4A 2BVVA 4W6YA 3OPZA 2XHKA 5LA0A 3K2OA 1EUUA 4K20A 3CIHA 5LW9A 1IPKA 3QH6A 2OPWA 1GSLA 1QMJA 2X5IB 3G6JB 2A6VA 3VHRA 4Y1UA 1VBC3 3HOBA 4J25A 3HNBM 5K0UA 4R9CA 4GB32 1V0AA 4RGKA 1YUDA 5BNPA 2YZ4A 2YC4A 2D6NA 1WLWA 3D6EA 3A22A 3AP4A 3OBAA 4HN0A 4Y1XA 3ZFFC 3EHKA 4B4RA 5L36A 2NN8A 2F6BA 5BUVA 4IV3B 3DKQA 1N3PA 4YNIA 2OW4A 5KHKA 2UWAA 3IZOA 2GC1A 5A6YA 4TZDA 2QCSB 2W46A 3BPZA 1QWRA 2X29A 1H1MA 1VBA3 3MLJA 3N7MA 4KI5M 3QOPA 5LBFA 2DFCA 4N9HA 5F37A 4LT5A 3C7GA 1V6OA 3ST7A 5A7PA 4B1MA 4IUGA 5FWEA 5FP4A 2A75A 3FBMA 4NHXA 1DZTA 3ZDSA 1S0CA 5F3CA 1UY4A 2ZX1A 3AZVA 1A34A 1AL23 1XPWA 4OI4A 1BCXA 2P6CA 3K75B 1AXYA 4YFWA 3AX4A 2W39A 1PO12 4GALA 4FBFA 3D82A 2I07B 2XKPA 2FDHA 2VVDA 5CNAA 5FMOL 5JMOA 3I2DA 2R49A 3ENRA 4R9AA 2VNGA 1UZ0A 1JHJA 4YZ3A 4JHTA 2W5FA 2RR13 4XUNA 1SZBA 3M7AA 4ISRA 2ZEWA 1RUI2 3T0BA 4QXCA 3UGGA 3ME2A 1S4CA 1VE0A 3KT7A 4PI0A 3MYXA 4BJ0A 4LO4B 2RS52 1KJRA 4WVZA 3UK9A 1YFUA 2A73B 2BBAA 4A2UA 4CDUB 2P17A 4P9JA 2XH6A 5LEJA 1Z7S3 5BNNC 2W47A 2XJVA 1HRI1 2DCKA 1PO22 2R7EB 2ZX4A 5JZGB 5CISA 1QOTA 3SH4A 3WT3A 4MGYE 5M0TA 1EYBA 3VD9A 2ZGQA 1ND3B 1W0NA 3LWCA 3O1UA 1DQ1A 3MW4A 3RG0A 1ALYA 4TXWA 3DKWA 1DU3D 2HWC2 4XFBA 3T08A 2WNOA 1DYKA 1HIXA 2RV9A 2DVGA 3R05A 2D6LX 4CDXC 2V73A 5FP9A 3WHTA 1QOOA 2R16A 3ACHA 4BMBA 2WO1A 3MIBA 3VZOA 1CESA 3ZR6A 3KV5A 5K8SA 1F8VA 1AR63 4PQQA 3IBMA 4PLNA 3V65A 4D6SA 4ZS3A 4N43A 1CZTA 4LO8A 4MGIE 5EIYB 3EMRA 3JD71 3T30A 4CDUC 2FQPA 3OEBA 3O5SA 4NPLA 1S2BA 1HX6A 4Y22B 1WD4A 3U10A 4ONUA 4KWLA 4N53A 2Y0IA 4HANA 2UWBA 4JGZA 5G04L 4CEWB 2Z4FA 1AUYA 2Q1ZB 1RUD2 2B5HA 4CPBA 5LWBA 3UKTA 4IXLA 3AMPA 2GN3A 1DGWX 2SLIA 4ASLA 5JZGA 2E26A 3JU9A 1LHWA 4Y26A 5FV3A 4Z92B 2BVBA 2IVJA 2IXLA 2OZJA 2GMEA 2QDNA 3AC0A 4FFFA 5L9BA 2HH9A 4G9SB 3VBFA 4LBLA 5C33A 5KC5A 4N90A 1MACA 2CWSA 4C90A 1KD7A 4GWMA 3VBOC 1X8MA 2ZGSA 5FP7A 5DAPA 1XRUA 1RUG3 3KVBA 4QD2A 1V70A 4DO0A 2PN5A 1UY2A 5BNQA 4ZY9A 3ZO0B 4UFMA 3PL0A 1MQTB 1XNAA 4XJZA 5EJZB 4B4PA 4M3CA 1Q8PA 1W0PA 2XBO1 3C7OA 1EY2A 1AR73 5J1XA 3K48A 2AH2A 4FFHA 5A6ZA 1J3PA 3QACA 4EN7B 1I3HA 1EAH3 2WFF3 3AFGA 3X29B 4HXCA 4N7IA 1RHI2 1RB8G 2JG9A 4HVQA 4XC9A 2WR9A 4O65A 1TZOA 3POEA 1C3HA 4YGCA 2RDQA 2XOMA 3KT4A 2OT7A 2LS6A 2YV8A 3P1IA 5FZLA 1DFQA 1POQA 1CQ9A 4QXBA 4JGZC 5J96B 4EN6B 3POFA 4L2NA 4NRQA 5E6HA 3M70A 5F6LB 1RITA 2EALA 4QHOA 3WHUA 4XTMA 4LEJA 4IERA 1LOGA 4D7YA 4Z2AA 4FTBA 2ZGTA 1WLCA 1CAVB 1D4M3 1BKZA 4Q4W3 4R4ZA 3FHIB 1OI6A 2GN7A 3GCWA 2Y6GA 4XF3A 3O1OA 3WG2A 3LE0A 3SCFA 5C3RA 2L9LA 2XLAA 3J7HA 1SLBA 2HLEA 4M3CB 4BK4A 3JQWA 3AB0A 2WNUC 4MZUA 5BXXA 2WQ4A 3OGRA 4CVUA 5DDJ1 5D2AA 4LXLA 4XAEA 4DUVA 2XDVA 4XILA 5ERLA 2JDHA 5ACA3 2DCTA 5LK5A 1VIWB 1Z7S2 1FOD3 2R071 4AVCA 2A3WA 2IXJA 3CHXA 4BU2A 3I3EA 1MS1A 1VBB3 4D3WA 1UMHA 1JYIA 1NCRC 1TME3 1OPMA 3IPVA 4L8QA 1V6NA 1W8NA 2B4KA 1ZRIA 3VZLA 4UW4A 5DUXA 3TAYA 1D0HA 4W6XA 1QJEA 1UPIA 1V00A 3CEWA 2EIDA 4IESA 5FYCA 2JWPA 1S0DA 3H3UA 4JDOA 2RR12 4H7LA 5HV0A 2PHXA 3HD8B 4LNVA 4ES9A 2Z69A 1VBE3 1DGRN 4LJHA 2VE1A 4Q1RA 4UW5A 1UXZA 3S6PA 3THDA 1HRI2 4OMCA 1GR3A 3POBA 2GC2A 4A7ZA 4EZHA 2ZGKA 3R0RA 3TB0A 4AHZA 5FUNA 3GALA 5FREA 1W8ZA 3ZYFA 3RZZA 3MFAA 3OSDA 1VALA 2RS33 2ZEZA 3J26N 4Z8BA 2JJ6A 2YDEA 5EQUA 1W8UA 3WNLA 2WN3A 2A1XA 2HWF3 2EIBA 1AYN2 1SPPA 3BCWA 3PDQA 3NKTA 3DYMA 4FI9A 1RHI1 2R063 4XDOA 4MVTA 1H8TA 3SNMA 3V56A 1O3RA 2CDPA 2V09A 1LOBA 1POV1 3M3QA 4UFKA 4Q4W2 2XJUA 2PLV1 4ASKA 2G9ZA 2D93A 1UQXA 4C0HA 2BDRA 2VUDA 1N1VA 5C9AA 1PO11 2KR2A 3FMGA 4E2SA 4CU7A 4JRLA 4XFAA 2ETEA 3I2JA 3H7YA 2YFZA 1V6LA 4FPGA 1WD3A 1MR5A 2E51A 1OT5A 2O8OA 1R1A1 3R6SA 4BXSV 3EBRA 5FO7B 4LR4A 3NWKA 2TEPA 2WKKA 2VOKA 1LB2A 1VBA1 4PIXA 3PU3A 2YC2A 3PVEA 3WQ7A 5A3UA 5IVJA 3VDDC 2ZS6B 2OQ7A 3T4HB 3H42B 4BZ4A 1WW6A 3I7DA 1K45A 4Q0PA 5JCTA 3W20A 4HZFA 1H4HA 1WMDA 4XJWA 2IFWA 2WZR1 4OMDA 4BK5A 2AREA 5FZAA 3VBRA 3POSA 5DZFA 2W95A 4CXWA 3LB9A 3ZN5A 2CHHA 1S0GA 4NHMA 3AP5A 1VJ2A 1ENRA 2BQPA 4G4FA 1H8TC 4Z1VA 5KBFA 3W5MA 2EXIA 2VO5A 2ZOEB 2JDYA 4D69A 1VMHA 1SCSA 5CVRA 5F7UA 3HIFA 2BW8A 4Q4X2 4CCLA 3IT8A 4OFGA 1W6PA 5CFDC 3T0DA 1Y9MA 3CO2A 2ARBA 1WKYA 1AXKA 1YI9A 5FYTA 3USSA 3VBSA 3D8CA 3HNYM 1DHKB 1SFPA 2D40A 4RGAA 3TYJA 5LCWL 1E57A 4Q4V2 1L7RA 1FNZA 1VRH1 3LFIA 1BXHA 2D5HA 4RHV2 3A0NA 4XIKA 1W2TA 3TBDA 3KGZA 4QXHA 3WP5A 2D3PA 3IN9A 2JECA 4FSJA 2JG8C 1QJZA 3EXUA 3GDBA 1I5ZA 4OI2A 4QKFA 4CCDA 4H14A 1J1TA 1S2EA 4CDQB 2W0XA 4I0WB 3VD7A 3LSDA 2UY8A 4ISQA 1NT0A 2EA7A 4XJUA 3BU0A 2J22A 1YHFA 3MO4A 3LOIA 2ZGLA 2EXKA 2ZTNA 2ZMNA 2QUOA 1RUC3 5HCBA 3VKLA 3ZXEA 3FHQA 1EV11 5TSWA 1D7PM 5J3UA 4FVVA 2V4VA 2Z2SB 2GNDA 1BK0A 5IW0A 2FZ2A 3UKNA 3QBQA 4DEVA 1JH5A 3WXPA 2ZGRA 2RJLA 3BYWA 3CJXA 3VBHA 5CFCC 1OH3A 2OVUA 2WYSA 5D8AC 2PXJA 4LA2A 5A1AA 4YM0A 1PM7A 1ASJ3 4QB2A 3H0OA 3UV9A 1LU2A 2J42A 3C7EA 3WR0A 5HI0A 1NXD1 3J8F1 3MIDA 1O3QA 1QJU1 4CPBD 2DUQA 3LPFA 4HETA 2JIJA 5T55A 4LBQD 1JZ8A 1QF3A 1CJDA 4V2VA 5C3PA 3CL1A 2YBPA 1T2XA 4N7UA 3JB8A 1UX7A 4XFGA 4FPHA 3AMHA 2ZABA 1HV0A 3N9OA 4BA6A 4WM8C 4XJ9A 1PNGA 1DQ6A 1O5UA 4WVVA 1IS5A 2O1QA 5EXOA 4PJYA 3WEZA 1U0AA 4Y1YA 1D2QA 4LBJA 1VLNA 3IKWA 1R1A2 3NAPC 1V9U1 4AF9A 3DXUA 3K77A 4AHWA 4I2OA 4BQ1A 1YFXA 1YIPA 4KWUA 1AL22 3THTA 4YVSB 1FI2A 2TBVA 4RQPC 1Y43B 3ABZA 1ULCA 4CDWB 4CRQA 3VBHB 2VUCA 3S0MA 4R9BA 1NOVA 1CIYA 3KCCA 2RDNA 2VMGA 1VBD2 1G9FA 1J83A 4F3JA 3FLRA 3W59A 3KCXA 3OY8B 3ZN4A 4QPIB 5FZKA 1POV3 1F15A 5JAXA 3APBA 2PQSA 1J3QA 4CEYB 4OUEA 3ZYRA 5FY1A 5JMCA 1FPN3 3VKFC 4IGPA 3CMGA 2A6ZA 5JR7B 2YPJA 1ONAA 1OOPC 2W1UA 1IPJA 3DUIA 5JVVA 4RS5A 4ZKTB 1NZCA 4PIYA 3LAGA 1C8M2 4YARA 5A7WA 1OF4A 5KHHA 1O4ZA 1NG0A 1ULGA 2GMMA 5B4NA 1AR92 3H8OA 2GNMA 4Q1PA 1RUJ2 4E4HA 4XCAA 4MH0E 2RHPA 2H0VA 2ET7A 4XURA 5CFCB 5LK7B 2WBKA 4LBKA 1Z78A 2OIIA 2RR11 2X8KA 3KF3A 3O0VA 3ELNA 3DPRA 4K1ZA 4YVSA 4HPKB 4QWNA 4AFMA 2OS2A 2RMU2 4QDRA 4QB6A 3RYKA 1RUC2 2ZX0A 1CZSA 5IJRA 4FOVA 5E16A 2VULA 5A3MA 4QU2A 3T2TA 2JDPA 1YJLA 1TNRA 3V0AB 2DFBA 3ASIA 3OY8A 3ZFFA 1QJX2 1Y9GA 2B39A 4RL7A 1ZRDA 1XBFA 1UW8A 3AM2A 4P9LA 3AP6A 1AR81 3MEPA 1DQ2A 4IDZA 3KGLA 1TME1 1W03A 2VOVA 3DL3A 2OKXA 3U78A 1QJX1 1CZVA 3FC0A 1G7YA 1UY1A 3ETQA 3O7OA 4N43B 2E7TA 2YU1A 4RGGA 1X50A 4SBVA 4EQVA 2IZWA 4Q4V3 2VMEA 1CN1A 4BB3A 4ZU4A 1RVF3 3BI3A 4RHV1 5A7WB 4Y22A 3GBGA 1VAMA 2IXKA 2VECA 4CEWA 1MZFA 1GWMA 4QM9A 5DZEA 3VBSC 3I2OA 3OF1A 1XNBA 5H9PA 1RGSA 4XEZA 4NVPA 4BMEA 4LQRA 5FDBA 3I2KA 3QLQA 4QX5A 5E8AA 4E9KA 2PAKA 1YFWA 3ZYPA 2F4LA 3ZXDA 1CIWA 2DCZA 3H50A 4YW6A 5FBJA 4JGYC 4YYOA 4BLIA 3DGTA 2JG8B 5DAXA 1XE0A 1E5IA 2ZAAA 4JGYB 3UYJA 1UZWA 2GP3A 1O4YA 1OD3A 3VKMA 3O1SA 1W6OB 4LKEA 2Y6KA 1YQCA 5FZOB 1GANA 1JOJA 1AZDA 2YGLA 1MQTA 1UOFA 2VCCA 4YM1A 2QQKA 2PA7A 5CKQA 3RFRA 1QKQA 5BNOC 4F8AA 5IVBA 1AYM3 2GSYA 4CU9A 3WZ1A 5JUVA 3H9AA 5FXZA 2R6QA 2ZGPA 2PHTA 2IVIB 2HWE2 2ARAA 2R1DA 1WBLA 1H4GA 5BNPB 1N1TA 3LDKA 5DZGA 4RQPB 2J1EA 3ZSLA 2QQUA 2B42B 3C7HA 1F4HA 3HBKA 1TMF1 3A4UA 4Q4Y1 4MGKE 3WVJA 3GCXA 3DYOA 1AXZA 1B09A 1UOJA 3LEGA 1UYXA 5J09A 3VDCA 1OA2A 1S0IA 1MEC3 1PK6C 5C8CC 1QDOA 1U5ZA 4XQ4A 4FP2A 4GZ9A 4LPLA 3J7LA 2VAUA 2XBO3 3OB8A 4P00B 4FAGA 3AZWA 4CA9A 2LTNA 1I9RA 1Q43A 5FZ9A 3R4SA 3M3EA 1OUSA 3DV8A 3CZJA 5FY7A 3RJRA 1PGL2 1FMD3 2RS32 2YUEA 3I49A 3S57A 2OPKA 2C4XA 2OQ6A 1PZ7A 5LA1A 1LECA 3VZMA 4XVHA 1LJ7A 4K21A 2OXBA 4BXFA 1OQ1A 3I59B 4Q8LA 1WCDJ 2NPIA 5FMBA 1UAIA 4OUSA 4ZZ8A 5DAQA 1O4TA 5K9YA 3N9PA 2BU9A 4RQPA 5IYYA 1J59A 1S0FA 5JXIA 5FY0A 3HT2A 2PHLA 5I8TA 4QX3A 3D3AA 3MPPG 3ZN6B 2VY0A 4NHLA 4F7ZA 3RZJA 4YLZA 3IMMA 1UMIA 5FXXA 4FPJA 1GFF2 3POIA 4JDMA 1VB4A 1O6UA 1JBCA 2OUHA 5LZ6A 2JDZA 1B35C 2D44A 4DRRA 4YSFA 4QQLA 4IQPA 4ZU5A 1SQ4A 1XJAA 2RM22 3T2OA 2ZGUA 4GMP0 1F35A 4CUBA 1WCKA 4QX2A 4HBNA 3U4SA 3RWKX 3ROUA 5IHRA 2R073 5ANNA 4Y20A 1ND3A 3B00A 2CGPA 3RJ2X 3S5QA 3HBZA 5FZ6A 4S2HA 4OHWA 3VBFC 4QKDA 1ZYBA 1RUH3 3E5QA 3VBOA 1GV9A 1AJKA 2EIEA 1JZ6A 1SLCA 2A6YA 5FP8A 1DQ0A 3ZVXA 1HXS1 1W8HA 1XSRA 2QQOA 2YGMA 3PIGA 4WVWA 5K4LA 1D4M2 3WNMA 1BVVA 3AYAA 4IV3C 4WZFA 5CEHA 4IGOA 4JRAA 3V0BB 3PUSA 3ZN6A 1AR91 1SDDB 4FFGA 1G6NA 3KVAA 2V5DA 1WW7A 2VMCA 1PGSA 4AEJA 4NAOA 3ZYJB 1NCQC 2D97A 2VZRA 1W3VA 1BVP1 1W04A 1HB4A 2VUJA 2X53S 4JGZB 4Q4V1 2WO7A 3PNAA 1JHNA 1ZVFA 4MHUA 2PHFA 3UGFA 1I6XA 2KD7A 2WFF2 1QNYA 5IAVA 4AOCA 4NWVA 5BNOA 4Y20B 3D0SA 1NLQA 4CCKA 1QOSA 3OPWA 5FPVA 1JW6A 1BK1A 4H3WA 4NIIA 1OMIA 3AYCA 5I8YA 1J1LA 3VDDA 1ULOA 4NE9A 1U5IA 5JOXA 4KU7A 4P02B 1AHSA 4BISA 1JUHA 2HEWF 4XF1A 2JIGA 5A80A 3VBRB 3ZFGB 5J98B 4B3NA 1WW4A 3N7JA 1FAYA 2GZWA 2G9GA 3WCSA 4EZ4A 2JDAA 4MADA 2VTFA 4QPIC 5A1LA 1URXA 1H6XA 1LULA 5JXJA 4Q4W1 4Q0VA 2FDFA 1XB9A 1QJFA 1UZYA 4GMP1 4LLFA 4DEQA 5BV6A 1RUD3 1D4VB 4GH4B 1W6PB 3ZFGC 5CFDB 2AUYA 3N9QA 2P34A 1UU6A 1V6MA 1YYNA 5J37A 3IDAA 1LHUA 1NCRA 3GHNA 1ZX5A 5DAWA 3ZR5A 3WQ1A 1WMXA 2P3JA 2ZA9A 2ZHKA 4AEMA 2CSGA 4G3YC 4J1WA 5DXDA 1NAEA 2RJKA 2BRTA 2VNOA 4FPEA 4K1YA 5HV4A 2VCMA 5BNPC 4Q0UA 2ARXA 1QXRA 2IWGB 3POYA 2VGDA 1OSGA 2VVFA 5FUPA 1Y3TA 4IEQA 4CP0A 1W6MA 3RQ0A 1LOFC 3MF6A 5DG1A 2WO3A 2QDRA 1DYOA 3GGLA 3WV6A 2VQAA 3FFQA 1CAWB 3E5XA 1JZ5A 1BMV1 4UF0B 4XMIA 1UY3A 1IKPA 3N35A 4LIVA 4K8RB 4DY3A 2FDKA 3ZXKA 3O0WA 3MZHA 1OFNA 2BGPA 4PDWA 3B9IA 1QJY3 4WBBA 2ZX2A 4I01A 1WBFA 3KSCA 5FZ4A 4PHZA 2BERA 4E8CA 4QX1A 5FYYA 4MGZE 2JE8A 4RFRB 2RS53 3MIGA 3WF0A 5FXWA 4RHV3 1O59A 5LA9A 3HN3A 3UJQA 3ZYGA 3OBZA 5FPXA 1RUI3 1GWLA 4YGDA 5A3OA 4BDVB 3VB9A 1SG3A 4XETA 2H6CA 5T50A 1PX4A 2XJQA 4LHNA 3UESA 2I45A 2XR4A 1IGOA 4A42A 2JD4A 5FIXA 2K0GA 3FUQA 3MLLA 4O9GA 4FAHA 4XABA 1KDKA 3JBG1 2BGCA 1DF0A 5A6XA 2MEV2 5KHIA 4XJ8A 1PO13 1KITA 3PUQA 2WRAA 3SH5A 4QGLA 3JB4C 3KV4A 1VMJA 4ATEA 1UMZA 3TOJA 1VRH2 1QJU3 5T5PA 3ZYIB 1I5PA 1E5RA 1W06A 1XNCA 5FQ0B 2RMU3 1PGW2 3KWVA 3A7QA 4DQAA 3JQXA 1L7LA 4S2GA 2ZEXA 4LORA 2DTYA 3OG2A 1IOAA 2XUEA 4GJYA 5FYHA 1WCQA 1HXS3 2W91A 3H8UA 4GQ7A 5JPNB 3MIHA 4HSJA 4EWEA 3NNFA 2AR6A 2DWRA 2P5BA 5GLTA 2D6PA 4YZ5A 4OI1A 4NAMA 3ZXLA 1X82A 2ENRA 5FLIA 1MS0A 1A8MA 4IE4A 1QNWA 1QEXA 4YGBA 2C5DA 3BALA 3I3QA 3NNLA 5DUVA 4W4ZA 3PTRB 3VN4A 4DB5A 1XE8A 1XNTA 1YNAA 1VAKA 3E6BA 1CAUA 4CUAA 2W1WA 3TEXA 1RUE1 4LULA 3ZXFA 2VTXA 2ZPXA 1MEC1 2R0FA 1UZZA 4Y5TA 3JUUA 4XMAA 3HWJA 4XUTA 2HWF1 1W2OA 4M3CF 1JZ7A 2AEZA 2XLFA 1HRV3 1KFXL 3AZZA 3WNKA 4EYUA 1ND2A 2R062 2VTXJ 3L2YA 4LUMA 4MV2A 3FUOA 2CNAA 4JHZA 4AR2A 1JZ3A 3W58A 5CFCA 5I0DA 3IIAA 4IEUA 3OGJA 5FQ0A 1VRH3 4AFBA 4HPKA 2XJTA 1TMF2 3FBYA 5BPXA 2J1RA 2RDRA 3I2GA 2QQWA 5L73A 3M4FA 4XW3A 2EAKA 2PAMA 5LA2A 5J7MA 3AMQA 2EF6A 3A21A 2V5YA 4AI8A 2YG0A 2PAEA 2DURA 5C6CA 2DVDA 4OI0A 1FXZA 1ZBA2 1HN1A 4AL9A 3OGGA 3LIGA 2W3JA 2J1AA 3HMYA 1JYWA 3HVDA 1UKRA 2CAVA 4XF9A 4LKSA 1ZZ6A 2CGOA 4JKMA 1YC61 2YYOA 4XJAA 5D1IA 4LIUA 5FAXA 3I3BA 1N47A 2QQIA 1AVBA 1C28A 5DN2A 3GBWA 1GYKA 1CJPA 4NUBA 3OPTA 3WF2A 1U5XA 1ND2B 4M00A 3KD4A 3H3ZA 1UOGA 2C24A 5AFBA 2VW1A 3N7LA 5GALA 1OLRA 5JLVA 4XYXA 1BBT1 1Q3EA 1EPWA 2R30A 2R32A 3AK0A 3GXUA 4W65A 4COYA 4L97A 3QD6A 2VNRA 4Y4YA 5T52A 1GOHA 1QH6A 2CTVA 4E4SA 1C5HA 2H6BA 4AK3A 1M06G 1RUH1 1IQDC 2VZPA 5KWRA 5C3OA 2Y38A 4K8FA 4IEYA 2DU1A 3D0JA 4JGYA 5H9RA 3WUDA 1N1YA 1U5YA 3E97A 3KB5A 4FXGB 1H2KA 3MW3A 4D8MA 5C7GA 4CXYA 3WG3A 3D5OA 3N7KA 1RUJ1 1AR82 1OBNA 3AL6A 1H0BA 2EVXA 3OOXA 4BOWA 2DCYA 4DXRA 4DNYA 2W52A 3CBNA 2WZPP 1W9YA 1DG6A 1GWKA 3IB3A 2RS51 4FPFA 4BH9A 3WW3A 1ULPA 3FLPA 5HXMA 5B4XA 3WDWA 2HYXA 2XGXA 3D4KA 4HVRA 2WFPA 5FMCA 2BNOA 3JD73 4FPCA 1IPSA 2VL4A 1STMA 1FNYA 4QPYA 1ZREA 4Z07A 3AL5A 1S55A 1WCUA 1W6NB 1S0BA 1MS3A 5FZFA 3E6CC 4CDUA 5KXDA 1MZEA 3VBUB 3MUZ1 4OHXA 3QH7A 4IEOA 2AC1A 4OHVA 4XHXA 5T3NA 5JOZA 1F5JA 2CAUA 2YMZA 2CWMA 1ZBA3 2XJSA 5A3TA 3KMHA 4Z2WA 1XNKA 4MYEA 1K5MB 1Z0HA 3LDBA 5JZGC 1NA1C 4YVSC 2XHNA 3J8F3 2HWD3 5J36A 2A71A 2VXJA 5AC92 1W8OA 3RMXA 4COUA 1R082 2ZHNA 4L92A 2K9ZA 2XJRA 3ZFEC 3GF6A 1ZZ9A 5C71A 1ENQA 4A3XA 1CAXB 2Z42A 1QXJA 3GHMA 3MLKA 3POGA 4GMP3 3ZLIA 2IXIA 2BYVE 3DCQA 4B4QA 5GZGA 1JYXA 1VBD1 4WM7B 2VMDA 4FOQA 3NNMA 1EAH1 2WZR3 3VUOA 1K42A 2EXJA 3CQOA 4FP3A 3ZIWA 1AX0A 5HCAA 2DYCA 4KG0A 3O14A 4UFIA 4YW2A 1E5SA 2XVGA 5C3QA 1H1AA 4NOTA 2YBKA 3B5LB 3K4DA 4PBPA 5F2WA 4NR1A 1AR62 2G19A 4ZONA 1ND2C 2FMDA 2DVFA 1OPOA 1SLAA 2G4IA 4P08A 5EYYA 3ZKYA 1K5MA 5T5OA 3ZXAC 3OEAA 1NQJA 3AMNA 5FK7A 1UCXA 2WNUA 4HN1A 1FATA 3MV01 4URAA 2BGOA 1D4M1 2YB7A 1BQPA 1ENSA 1HXS2 1C57A 3OYWA 5I0RA 3EB7A 1WMEA 3PMSA 3LA3A 5KHGA 4E4ZA 1LOAA 5ISLA 5K0UC 2XVLA 5FK8A 2HKXA 4DXTA 3CZUA 2R1BA 1DIWA 3WLUA 4OVEA 1WA6X 4Y1VA 4HKLA 1G9DA 2W87A 3H1YA 1GP5A 3BVCA 1PO23 4X8NA 3HAGA 4BQYA 2W1QA 4LOSA 3AZXA 4P9IA 5A3WA 2C1FA 2MEV3 4AFCA 2Y34A 3W5NA 3MUY1 2BOJA 1C8NA 3SCHA 1R091 4Q5OA 4QB1A 4XF4A 5FCCA 1ZRCA 1EV13 1XSQA 2ZZJA 2JG9B 5I93A 5FZ8A 1PX3A 3ECQA 4K9SA 3LOBA 4LHSA 5A7NA 1PVC1 2VZQA 3CJIB 4UT5A 1DCSA 4KU8A 1BHGA 2P3YA 3VD3A 1UIKA 4N8MA 4D94A 1S0JA 3J4UH 1AYM1 5E1RA 3SKVA 3GM8A 4YM2A 3VBHC 1PK6A 1VBB2 2QKDA 2VD7A 1W9WA 3KV6A 4XDPA 1PZ9A 1JYVA 2E33A 1GU3A 3N9MA 2GH8A 3PMEA 4IL7A 3B3QE 4H2AA 4DUWA 2VQ0A 1JOBA 5ACA2 1B35B 2BEOA 4C1XA 3VV1A 4Y24A 1OKQA 3ZSKA 4EN8B 1ZNPA 2BWAA 4TLGA 3NJXA 3WUCA 2RMU1 1FMD2 3LKJA 1HJFA 1SLIA 3WP6A 1A8DA 2QTWB 1W8FA 1RVF1 2ZJCA 3H7JA 1W2NA 1X8EA 4QDSA 4JKKA 5AVPA 2VZ3A 3ZXJA 1UU5A 2XXZA 3PJYA 3L2HA 5JIAA 1JZ4A 1QIQA 3BIWE 2YFUA 5A3NA 5FO9B 2FCTA 2GMPA 5IFPA 5I0TA 3WQBA 4TWTA 5BY5A 2WQ8A 5CKMA 4JC1A 4GH4A 2CGNA 3TNQA 5GZCA 3U4XA 3UJOA
chains in the Genus database with same CATH topology
1R081 2E53A 2B7YA 1QY4A 1BMV2 4GA9A 1DLLA 4S2DA 4LBQA 4QQ2A 2P3IA 2FHRA 4WV8A 3WDVA 4B29A 5CADA 4FQZA 3ATGA 4AVSA 1LEDA 1GQGA 3NJZA 4B8EA 2A70A 2YHJA 2AZ5A 4EN0A 1KJLA 5JSOA 1LOCA 1AR72 1BEV2 3N4MA 3VL9A 1LENA 2VW2A 4BM8A 4LLOA 4BCUA 1AX1A 1FV3A 1RUE2 3SXWA 4TLFA 2E63A 1ZBE3 4XZPA 4C1WA 1D2SA 2GNBA 2H0BA 2O0OA 2D6OX 2K2SA 1V6JA 3T1MA 3O12A 1N1SA 1ZM1A 1O3TA 4DZGA 4JV4A 1U12A 2WT0A 4Z82A 3HR9A 2IFRA 1UL9A 1ULFA 2Q8OA 3ZFEA 2ILMA 2DU0A 4NPRA 5KXEA 3SISA 2I2SA 5EWSA 4FT8A 2W68A 3SITA 2DVAA 4A7KA 4QGNA 1SFNA 3OBRA 1MZ5A 4SLIA 4B7KA 1GNHA 3B94A 5L7OC 4FPYA 3AJZA 5GLVA 4AHYA 3AZYA 5C4WC 2XJPA 2ES3A 2GDFA 3JCIA 1UKGA 3VBOB 4INDA 1OQDA 1RUC1 2PQQA 3HN1A 2JG9C 1H9WA 4OULA 2HWC3 4UXAA 3EQEA 3U0ZA 1RUH2 1BJQA 3GZUC 1RUJ3 4PLMA 4FTSA 5I0SA 3V0BA 1BBT2 1PO21 4YW1A 1QQP3 3NL1A 4AQSA 2CL2A 1RUOA 3WP4A 1DGLA 3WW4A 5JOWA 3H1WA 4KH9A 1CX4A 2UY9A 4AVBA 4IEPA 2GALA 1DZQA 2ET1A 4YG0A 4NN0A 3GZTB 1APNA 4AVAA 4XBNA 4KGQA 4EJRA 1RJ8A 4YZ2A 1TQ5A 3CF6E 1C1FA 2FMYA 2ZMLA 4AQTA 5F1RA 1C4RA 3MIEA 3I8TA 4P9XA 4Q26A 3VDDB 3MICA 1HQWA 4CDWC 3TN92 4Q4Y3 1LCLA 3LA7A 3OBTA 2WC2A 3AMMA 5LRRA 1C1LA 4XFIA 2IC1A 3WINE 4P5HA 1ZZBA 3TN91 1WLDA 1LOEA 2DV9A 5BNNB 2JKBA 4CYDA 1RC6A 1XNDA 1XXNA 1KFUL 4R9DA 1J58A 1VBA2 3JZVA 3OD4A 3WDUA 2R041 2ZACA 5ABJB 4KWKA 2WS92 3R4DB 5CB7A 1FV2A 1ULDA 4XOGA 5GZDA 1SBDA 3NVCA 1IZ3A 4H7MA 1GLHA 5JI9A 1HQLA 3B9CA 1QJY1 1QXPA 2QZ2A 1LHOA 2P3KA 2XKOA 3VKNA 4GB33 4ASMB 4DS0A 1POV0 3AYDA 3JBG2 5T54A 3K51A 4QQOA 5CG9A 1ULEA 1TEIA 2QE3A 4Q29A 2XL7A 4XBQA 1RUD1 3SLIA 1V6IA 4QM8A 4YW5A 2ZKNA 3Q9OA 4ORFA 2XB6C 5IK8A 2WLQA 3MGUA 1CPMA 1F5FA 1COV3 1GICA 4BPZA 1R092 2WT1A 2X5IA 2AGSA 4LUKA 5ABJA 5L19A 2RS12 4DINB 5L7OB 3WQ0A 1EP0A 2VW0A 3B7MA 1UF2C 3SMHA 1IS4A 3U11A 2VOWA 4FPKA 4CEYA 4AI2A 4AEDA 2VH9A 3SHRA 1ZZCA 3UL2A 4BHPA 3ES1A 2ZAHA 3P3NA 4P9YA 4RS5B 4OZXA 3J9SA 1M4WA 3VBRC 3PHMA 3ZMOA 1QH7A 4NO4A 2XL9A 1Z7S1 3GZAA 3MW2A 2RS13 2Z79A 4IEXA 1NCQB 1XYOA 1L3JA 2ZGMA 1V6KA 2ZMKA 3LSEA 4AXOA 4I09A 1GZWA 1GKBA 2Q4SA 1GBGA 3QCWA 5JSRA 1RUE3 3N3HA 3DPRB 4BMBA 1RMU1 1NXMA 4QGMA 1F31A 1G9CA 1UIJA 2R042 5KXBA 3VHNA 5A33A 4D7TA 2B46X 2IXCA 1X7NA 3BODA 1LGCA 4XDQA 1DQ4A 3JBG3 1S1AA 3WNXA 4AEDB 4WM7A 4KWJA 5FOJB 1AR61 1ZRRA 1ENXA 2PHWA 4XXAA 2P2KA 1PMIA 4QMAA 4MX3A 2XWBB 2DCJA 1W0OA 4QPGB 2RE9A 4URTA 1V9U2 4M01A 3NW4A 2HWD1 2E7QA 5FTTC 4M0HA 4WVMA 1XU1A 2PYTA 4E2GA 1TE1B 1GZWB 1MZ6A 4KQ7A 4AQ2A 1AYN3 4TSVA 2HWF2 4E2QA 2GH2A 1X36A 1VBD3 3UKVA 4JVAA 1Q56A 5EYXA 5FFOC 5CAZA 1DBNA 2XPJA 2JG8A 1DYPA 4HT1T 1FMD1 4YG6A 1W6QB 5A33B 1W6OA 2BWCA 1NA1B 2XG3A 3TN93 5IK7A 2HWE1 4LHKA 3RMYA 2Y26A 1BYHA 3ILNA 3ZMNA 1VBE2 2NYYA 3FE5A 1LHVA 1FYUA 2HEYF 3AXEA 1X33A 5A32A 4IEVA 4XPVA 1WGPA 1PGW1 1ZZ8A 2Q1MA 1WUVA 2GAUA 3ACLA 3LCPA 5JDBA 2ZHMA 4FXKB 3NV1A 4WVMB 4IV1A 2JENA 4YVWC 4W6WA 4GULA 2NLRA 1CVNA 4GKYA 1ASJ2 5C9AC 4DY5A 2DF7A 4AI0A 3CLPA 4WZCA 1KDMA 1B35A 4JTNA 4RR3B 5JWPA 4CEYC 5FLHA 2HWC1 1UX6A 4AEDC 4EN9B 2QNKA 1HV1A 3M3CA 1LOFA 1OFSA 2ZZQA 4WM8A 1PIV1 2A6WA 3NV2A 1PNFA 4OUMA 5A32B 1WCSA 2R072 3B01A 4X6QB 1ZBA1 1MVEA 4DXZA 1W2UA 4Q0SA 1UN1A 3VZKA 4X6RB 3KS7A 3OCPA 1CONA 1RTVA 1YLLA 4R8HA 4CTEA 3HQXA 1FT9A 5T5LA 3VZNA 1AF9A 1LGNA 3FWEA 4OHYA 5E89A 4C0BA 4YZ1A 1AX2A 1W39A 4P14A 1IQAA 2Z5WA 1EAH2 3VBUA 5CBLA 4MSVA 4LBQB 5FLJA 3VL8A 2ZBJA 1CAVA 4CZSA 4J1XA 4Q4X3 2WNVA 4J6GA 1SLLA 1Y7BA 3LZZA 1RINA 4NWWA 5FPZA 1C8M1 1LODA 2D5FA 3I4IA 3VHOA 2HWD2 3BOPA 1ZBE2 1HQNA 5A3LA 3WP3A 4BYYA 4HLTA 1BZWA 4YFZA 3MPBA 2EIGA 5GM0A 1PGL1 2WIIB 3PTYA 5H9SA 1K5MC 2MNGA 1AR71 4HVOA 2P37A 4HKWA 2WA4A 5LRSA 4COZA 2PHUA 4PBOA 2D3SA 1TNFA 2JE7A 3WDXA 3AKSA 4R4XA 3ZFEB 4I02A 3WCRA 1YO8A 1MEC2 2ZCWA 5AC91 2XWJB 3ZPYA 4MXWB 5GLUA 2JE9A 1VR3A 2E7AA 2OUJA 5EV7A 1A3KA 2WNVB 4YW4A 1DZRA 3M8LA 3RRDA 4AVVA 4Q8KA 2TNFA 2WNVC 2MEV1 1VP6A 2ZHLA 1F9KA 5BNOB 4L99A 2YROA 4AVTA 1RJ7A 2WLPA 5H9QA 4LE3A 1AYM2 1AYN1 2DTWA 4LHLA 3WW1A 3ZIXA 2FBEA 1SCRA 4QT6A 5F5QA 3A0KA 3SH3A 4HSLA 5GZEA 2JXAA 1J3RA 3FFZA 5ACA1 2WWSA 1LKNA 1H8TB 1NLRA 4FCAA 3KT1A 1RL3A 4AGVA 1FOD1 2I74A 4ZU7A 1OOPB 3EO6A 1MQTC 1H9PA 2A7AA 4XXPA 4XQWA 4UW6A 4BLJA 4E27A 1HRI3 5C9AB 1KXGA 4YGEA 2W08A 1R1ZA 1IS6A 1DQ5A 3E5UA 4PF5A 2G9FA 1UPSA 3GYDA 4YM3A 1NCRB 2VU9A 1YCIA 4A7YA 2JEMA 4CDXA 2RS11 4HKOA 2RM21 1NYWA 1VBC1 1FOD2 1I1EA 1WW5A 1MS9A 1QQP1 2LM3A 4XBLA 1W6MB 4IETA 4XF0A 1LR5A 4MXVA 3WD5A 2DUOA 3W9AA 4LBOA 4N53C 2E6VA 4V1PA 3O0XA 1YJKA 1WLTA 1ZRFA 4LO6B 2A3XA 3M1HA 3NV4A 4U2AA 4JAAA 2VMIA 1QDCA 3PVBB 1XU2A 4HFSA 5C8CB 3LGRA 5AFEA 1SDWA 4RSUA 2OZ6A 2KM2A 1H2LA 3OTFA 4P9GA 4CDXB 1BEV1 1SBFA 4N9IA 4CDQA 1FPN2 3N36A 4Q2FA 2JX9A 3ZSMA 1O91A 3L9JT 3NKGA 2WJSA 3AJYA 3AP9A 2VXRA 1DGWA 1Q8QA 2ZGOA 2C9AA 3EJKA 4YG3A 5C4WA 4XIOA 5BYNA 2WNEA 1VAVA 3THPA 2GC3A 4ZXKA 4CEWC 1R083 4AFDA 4BIFA 3RPQA 1MVQA 4MLOA 3BB6A 3J8F2 4M3CE 3BU7A 3M3IA 4AI3A 2HJIA 3IDEA 5C8WA 2B45X 2DVBA 4JCKA 3MFCA 5D8AB 4FOWA 4I3PA 4UBGA 1AL0G 4PLOA 1OA4A 3AFKA 2PELA 3ES4A 1VB2A 2Q30A 5ABJC 3RS6A 4S2FA 5T5JA 2BFUS 3SCGA 3S7EA 2UYBA 5JIUA 3IWZA 4RA0A 3JD72 4HMZA 2WA3A 5KXCA 1Q8VA 1COV1 1LU1A 4FOYA 5IT6A 5JI7A 4DPNA 3ZSEA 3WW2A 1R093 4KG8A 2WSVA 1PZ8A 3WG1A 4OHZA 1G8WA 1COV2 1NCQA 3NAPB 3ILRA 5F6KA 1REEA 2BBVA 1LEMA 5K7PA 1LESA 3RNSA 4CDWA 5CIRA 2VOXA 5D8AA 1PIV3 3NO8A 1H30A 3VKOA 4PQ9A 3KCYA 1EPZA 5HXVA 2D6MA 1XQNA 2CYFA 5IUQA 5J48A 3AKPA 4QPIA 1MS4A 1ASJ1 1SEFA 4F83A 1VBE1 4QQPA 2QQPA 2CV6A 3T1LA 3USUB 3PLQA 3OJBA 4LO5B 2EXHA 3H1MA 2WS91 1QGLA 4EROA 3KM5A 4N53B 3MF9A 5IK4A 2HEVF 1HRV1 3GNEA 1NE6A 3WX5A 4LBMA 1ND3C 1CD3G 4I3GA 4DMIA 3AXDA 1MS8A 4B7EA 2UWCA 4QPGC 1AJOA 4EV0A 4GIQA 4ITCA 3ZX7A 5FRAA 4Q4Y2 2UU8A 3RYPA 2KXLA 5F9TA 1W6QA 3BTAA 3VLBB 3ZFFB 5GLZA 4ES8A 3VZJA 3RI8A 1NA1A 2VPVA 1OD5A 3FJSA 2PLV2 4Y5Z0 4DOUA 2VVEA 1SMVA 4N43C 3P3PA 1NY72 4L9BA 1HRV2 2DUPA 5B2GB 4E4DX 1NQDA 3WDYA 4R52A 4AHXA 1AL21 1ZBE1 4QHBA 4P9WA 4IV1B 3RDIA 1YFYA 1PVXA 1YXWA 2NMOA 4IV1C 1QQP2 4I0BA 1BBT3 1LRHA 1W6NA 1D0GA 3WY6A 4Q27A 5E88A 2BNNA 4LA3A 1F2NA 4RS5C 1JUIA 3CNAA 2EAAA 1HDKA 1JYCA 1LGBA 2WFF1 3AKRA 4MUVA 3ZFGB 4XE9A 1Q8OA 4RR3A 4BWOA 1G86A 1Q5OA 4K6BA 2D3RA 2PFWA 4RD7A 1RMU2 3HT1A 1DDLA 1SFYA 2MHFA 1QJU2 2GU9A 1KS4A 3C2UA 4X8PA 3ZXGA 4KGGA 5L7OA 1CAXA 3FZ3A 3C3VA 2BPA2 4Y1ZA 4AG4A 5DUUA 1G9AA 1RUNA 3WDTA 4DRVA 4D7SA 3PVOA 4AE2A 1N3OA 4WM7C 2KA3A 3IPVB 4FQ4A 4AQ6A 4TYSA 3URFA 1KQRA 1PVC3 5KC6A 4LTAA 2HYKA 5FOBB 2A6XA 1C5IA 1TME2 5EFUA 2LALA 3ZFGA 4PDWC 2PHRA 4QXKA 4EWDA 4KBBA 4JDNA 1S2KA 4YVWB 2HWB2 2NQYA 4K40A 1KS5A 2WNUB 5DDJ2 4JQRA 3NV3A 1QJY2 3OYWB 1DGRA 5JOYA 1O3SA 1H2NA 4PCRA 3I59A 2VMHA 3ZSJA 5I91A 1MS5A 1NLSA 5FMOS 3LA2A 1NE4A 1SACA 3RSJA 2D6KA 4K3UA 2C0ZA 4AYUA 3ALQA 1GZCA 4FPLA 1RUG1 1JXNA 4QPGA 4BE3A 1LHNA 5LEKA 4META 2E9QA 1QU0A 1HKDA 3CJIA 2AENA 2XUMA 2HWE3 4PIZA 5JPMB 1GZ9A 2NMNA 4YVWA 1RHI3 2R061 3RWNA 2R043 3NSTA 1PK6B 1O5LA 1REFA 3VBFB 2AYHA 4AI1A 3GBFA 5EZWA 5SV8A 2QJVA 5GLWA 3WOGA 3R4UA 1S0EA 4HK9A 1Q8SA 2BTVC 2NM1A 2ZGNA 4I30A 4CP2A 4L11A 1RUG2 4GB31 2HWB3 1UU4A 1REDA 5I0UA 3B69A 5EJ3A 2Y0OA 1KRIA 3IM0A 2CY6A 1WMFA 4AGRA 3TRSB 4DFSA 4CP1A 1O7FA 4BIOA 2D7FA 5CG8A 1OQEA 1WA4A 1YRZA 1H8VA 2XVKA 3DPRC 3B93A 1RVF2 4O9EA 4KNCA 3MIFA 1HLCA 3I54A 4YRDA 5GJ6A 2QZ3A 3FX3A 4JTOA 1EV12 5I8SA 3CJIC 1QHDA 2A3YA 1GNZA 5HCFA 4AEKA 1SBEA 3DN7A 4FPOB 1VBB1 3AYEA 3B02A 3E6DA 1JN2P 1RUF1 3AKTA 2BNMA 3MI8A 2YY1A 5CU1A 2SBAA 3VBUC 3MDPA 1A6CA 1OLQA 4WM8B 4RR3C 1YI7A 2B9UA 4Q4X1 2B8MA 1AR93 1JTZX 4GXLA 1IKQA 3BOWA 4COWA 1C8M3 5CFDA 2RM23 2WQZC 4U36A 1A78A 1IS3A 4FO9A 2WSUA 1N3QA 5C8CA 3TNPB 1SLTA 2XLGA 3PVNA 2F4PA 2Q0AA 2UYAA 2WS93 4FTEA 3ILFA 1J59A 2WZR2 1RIRA 1RUI1 2YC0A 5JSPA 1ZZ7A 1T6GC 2OYZA 1IHMA 5SV5A 2YXSA 2PLV3 1H2MA 3S7IA 1HW5A 4GWNA 3V64A 1CAWA 2IXHA 3RYRA 1FPN1 3CU7A 5C4WB 5FO8B 5AC93 4UW3A 1UD1A 2R0HA 5DG2A 3G7DA 4IEZA 1YIFA 1R1A3 4KL1A 1Y9QA 2WL1A 4PDWB 2D98A 2PTMA 1FX5A 5GZFA 4YZ4A 4COVA 1NY71 3AKQA 4M0NA 1OHFA 5AVAA 4AGGA 4Q0QA 2QFEA 2XBO2 2A5ZA 3IDBB 2WT2A 2OA2A 2BUKA 2VG9A 2JICA 3PJQA 5DUWA 4MXWA 1CPNA 5GKAC 3WG4A 3IMNA 4QQHA 2TUNA 1V9U3 3S30A 3RI9A 4IEWA 1YWKA 2ATFA 4EWAA 5CA6A 2WINB 1XYNA 1AR83 1VBC2 4XFHA 1PHMA 4LBNA 5HBAA 4AWDA 3TWIA 1CR7A 1PIV2 3NAPA 2Q5TA 2VUAA 4AFAA 3VGIA 2D43A 5IK5A 4XTPA 2N7GA 4OLLA 4AW7A 2GC0A 1CGPA 4H55A 4K7JA 2GNTA 1OOPA 2ERFA 2HWB1 3KZ4C 1RUF2 2PHDA 3V0AA 5DDJ3 3AP7A 4GKXA 5BNNA 4CDQC 4HL0A 2NP0A 1LTEA 4NHKA 4UBHA 4ATFA 1CAUB 3DF0A 1H1IA 3INAA 3VBSB 2O8QA 3M3OA 4LO7A 2X5IC 4C91A 4GH4C 3USUA 1PVC2 4HK8A 5K0UB 2NZ9A 5KHJA 2QVSB 3KLSA 4I0AA 3M2MA 1OA3A 4YW3A 1ZA4A 3VHPA 3KQRA 4IV3A 2LUWA 3IDCB 2FZ1A 2ZKLA 4RFT0 4XHBA 3POWA 4XFCA 3U07A 1QJX3 1RUF3 2ZX3A 5FBZA 4XFFA 1TMF3 4XQDA 1XE7A 2BFUL 1GQHA 3FLTA 2UURA 1BEV3 1XYPA 2MPFA 2RS31 3OD0A 1RMU3 1G9BA 4LE4A 2BVVA 4W6YA 3OPZA 2XHKA 4K20A 1IPKA 3QH6A 1GSLA 1QMJA 2X5IB 3G6JB 2A6VA 3VHRA 4Y1UA 1VBC3 5K0UA 4R9CA 4GB32 1YUDA 5BNPA 2YZ4A 2D6NA 1WLWA 3D6EA 3AP4A 3ZFFC 4B4RA 4HN0A 4Y1XA 1BMV1 3EHKA 5L36A 2NN8A 2F6BA 5BUVA 4IV3B 1N3PA 4YNIA 2OW4A 5KHKA 2UWAA 2GC1A 4TZDA 2QCSB 3BPZA 1QWRA 2X29A 1H1MA 1VBA3 3MLJA 3N7MA 3QOPA 2DFCA 4N9HA 4LT5A 1V6OA 3ST7A 2A75A 3FBMA 1DZTA 3ZDSA 1S0CA 2ZX1A 3AZVA 1AL23 4OI4A 4YFWA 1BCXA 1AXYA 3AX4A 2W39A 1PO12 4GALA 4FBFA 3D82A 2I07B 2XKPA 2VVDA 5CNAA 5FMOL 3I2DA 2R49A 3ENRA 4R9AA 2VNGA 4YZ3A 2RR13 3M7AA 4ISRA 1RUI2 3ME2A 3KT7A 3MYXA 4LO4B 2RS52 1KJRA 4WVZA 3UK9A 1YFUA 2A73B 4A2UA 4CDUB 2P17A 4P9JA 2XH6A 5LEJA 1Z7S3 5BNNC 2XJVA 1HRI1 2DCKA 1PO22 2ZX4A 5JZGB 1QOTA 3SH4A 3WT3A 4MGYE 1EYBA 2ZGQA 1ND3B 3LWCA 1DQ1A 3MW4A 3RG0A 1ALYA 3DKWA 1DU3D 2HWC2 4XFBA 1DYKA 1HIXA 2DVGA 3R05A 2D6LX 4CDXC 2V73A 3WHTA 1QOOA 2R16A 3MIBA 3VZOA 5K8SA 1CESA 1F8VA 1AR63 3IBMA 4PLNA 3V65A 4N43A 4LO8A 4MGIE 3JD71 4CDUC 2FQPA 3O5SA 1S2BA 1HX6A 4Y22B 1WD4A 3U10A 4ONUA 4KWLA 4N53A 2Y0IA 4HANA 2UWBA 4JGZA 4CEWB 1AUYA 2Q1ZB 1RUD2 2B5HA 3UKTA 4IXLA 3AMPA 2GN3A 1DGWX 2SLIA 4ASLA 5JZGA 3JU9A 1LHWA 4Y26A 4Z92B 2BVBA 2IXLA 2OZJA 2GMEA 2QDNA 4G9SB 3VBFA 4LBLA 5C33A 5KC5A 4N90A 1MACA 2CWSA 4C90A 1KD7A 4GWMA 3VBOC 1X8MA 2ZGSA 1XRUA 1RUG3 4QD2A 1V70A 2PN5A 5BNQA 3ZO0B 1MQTB 4XJZA 4B4PA 4M3CA 1Q8PA 1W0PA 2XBO1 1EY2A 1AR73 3K48A 2AH2A 1J3PA 3QACA 4EN7B 1I3HA 1EAH3 2WFF3 3AFGA 3X29B 4N7IA 1RHI2 1RB8G 2JG9A 4HVQA 1C3HA 4YGCA 3KT4A 2YV8A 1DFQA 1CQ9A 4JGZC 5J96B 4EN6B 4L2NA 5F6LB 3M70A 1RITA 2EALA 3WHUA 4XTMA 4LEJA 4IERA 1LOGA 4D7YA 4FTBA 2ZGTA 1WLCA 1CAVB 1D4M3 1BKZA 4Q4W3 4R4ZA 3FHIB 1OI6A 2GN7A 4XF3A 3WG2A 3SCFA 2XLAA 1SLBA 4M3CB 3JQWA 3AB0A 2WNUC 4MZUA 5BXXA 2WQ4A 5DDJ1 4XILA 5ACA3 2DCTA 5LK5A 1VIWB 1Z7S2 1FOD3 2R071 4AVCA 2A3WA 2IXJA 1MS1A 1VBB3 4D3WA 1JYIA 1NCRC 1TME3 1OPMA 3IPVA 4L8QA 1V6NA 3VZLA 4UW4A 5DUXA 3TAYA 1D0HA 4W6XA 1UPIA 1V00A 3CEWA 4IESA 1S0DA 3H3UA 4JDOA 2RR12 4H7LA 2PHXA 3HD8B 4LNVA 4ES9A 2Z69A 1VBE3 1DGRN 4UW5A 4Q1RA 3S6PA 1HRI2 1GR3A 4A7ZA 2GC2A 2ZGKA 3R0RA 3TB0A 4AHZA 3GALA 5FREA 3RZZA 3MFAA 1VALA 2RS33 4Z8BA 3J26N 2JJ6A 2YDEA 2HWF3 3BCWA 1AYN2 3NKTA 3SNMA 1RHI1 2R063 3V56A 4MVTA 1H8TA 1O3RA 2V09A 1LOBA 1POV1 3M3QA 4Q4W2 2XJUA 2PLV1 2D93A 4C0HA 1N1VA 5C9AA 1PO11 3FMGA 4E2SA 4JRLA 4XFAA 2ETEA 3H7YA 1V6LA 4FPGA 1WD3A 1MR5A 2E51A 2O8OA 3R6SA 1R1A1 3EBRA 5FO7B 4LR4A 3NWKA 2TEPA 2WKKA 2VOKA 1LB2A 1VBA1 4PIXA 3PVEA 3WQ7A 3VDDC 2ZS6B 4BZ4A 1WW6A 3I7DA 4Q0PA 5JCTA 4HZFA 1H4HA 1WMDA 4XJWA 2IFWA 2WZR1 2AREA 3VBRA 3POSA 5DZFA 3LB9A 3ZN5A 1S0GA 4NHMA 3AP5A 1VJ2A 1ENRA 2BQPA 4G4FA 1H8TC 4Z1VA 5KBFA 2EXIA 2ZOEB 4D69A 1SCSA 5CVRA 3HIFA 2BW8A 4Q4X2 5CFDC 3IT8A 4OFGA 1W6PA 3CO2A 2ARBA 3USSA 1AXKA 1YI9A 3VBSA 3D8CA 1DHKB 2D40A 4RGAA 3TYJA 1E57A 4Q4V2 1FNZA 1VRH1 1BXHA 2D5HA 4RHV2 3A0NA 4XIKA 3TBDA 3KGZA 3WP5A 2D3PA 3IN9A 2JECA 4FSJA 2JG8C 1QJZA 3EXUA 1I5ZA 4OI2A 4H14A 1J1TA 4CDQB 2W0XA 4I0WB 3LSDA 2UY8A 4ISQA 2EA7A 4XJUA 1YHFA 3LOIA 2ZGLA 2EXKA 2ZTNA 2ZMNA 2QUOA 1RUC3 5HCBA 3VKLA 3ZXEA 1EV11 5TSWA 5J3UA 4FVVA 2Z2SB 2GNDA 2FZ2A 3UKNA 3QBQA 1JH5A 3WXPA 2ZGRA 2RJLA 3CJXA 3VBHA 5CFCC 2OVUA 5D8AC 4LA2A 4YM0A 1PM7A 1ASJ3 3H0OA 3UV9A 1LU2A 3WR0A 5HI0A 1NXD1 3J8F1 3MIDA 1O3QA 1QJU1 2DUQA 4HETA 5T55A 4LBQD 1QF3A 1CJDA 3CL1A 4N7UA 3JB8A 4XFGA 4FPHA 3AMHA 2ZABA 1HV0A 4BA6A 4WM8C 4XJ9A 1PNGA 1DQ6A 1O5UA 4WVVA 1IS5A 2O1QA 5EXOA 4PJYA 1U0AA 4Y1YA 1D2QA 4LBJA 1VLNA 3IKWA 1R1A2 3NAPC 1V9U1 4AF9A 4AHWA 4I2OA 4BQ1A 1YFXA 1YIPA 3THTA 1AL22 4YVSB 1FI2A 2TBVA 4RQPC 1Y43B 4CDWB 1ULCA 4CRQA 3S0MA 3VBHB 4R9BA 1NOVA 3KCCA 2VMGA 1VBD2 1G9FA 4F3JA 3FLRA 3W59A 3KCXA 3OY8B 3ZN4A 4QPIB 5JAXA 1POV3 3APBA 1J3QA 4CEYB 3ZYRA 5JMCA 1FPN3 3VKFC 2A6ZA 5JR7B 2YPJA 1ONAA 1OOPC 1IPJA 3DUIA 5JVVA 4RS5A 4ZKTB 1NZCA 4PIYA 3LAGA 1C8M2 4YARA 5KHHA 1O4ZA 1NG0A 1ULGA 2GMMA 1AR92 2GNMA 4Q1PA 1RUJ2 4MH0E 2RHPA 2H0VA 2ET7A 5CFCB 5LK7B 4LBKA 1Z78A 2OIIA 2RR11 2X8KA 3O0VA 4K1ZA 3ELNA 3DPRA 4YVSA 4HPKB 4AFMA 2RMU2 3RYKA 1RUC2 2ZX0A 4FOVA 5E16A 2VULA 5A3MA 4QU2A 3T2TA 1YJLA 1TNRA 3V0AB 3ASIA 2DFBA 3OY8A 3ZFFA 1QJX2 2B39A 4RL7A 1ZRDA 1UW8A 3AM2A 4P9LA 3AP6A 1AR81 3MEPA 1DQ2A 3KGLA 1TME1 3DL3A 2VOVA