1KS5A

Structure of aspergillus niger endoglucanase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
QTMCSQYDSASSPPYSVNQNLWGEYQGTGSQCVYVDKLSSSGASWHTEWTWSGGEGTVKSYSNSGVTFNKKLVSDVSSIPTSVEWKQDNTNVNADVAYDLFTAANVDHATSSGDYELMIWLARYGNIQPIGKQIATATVGGKSWEVWYGSTTQAGAEQRTYSFVSESPINSYSGDINAFFSYLTQNQGFPASSQYLINLQFGTEAFTGGPATFTVDNWTASVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title Determination of the structure of an endoglucanase from Aspergillus niger and its mode of inhibition by palladium chloride.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ks5A00
1REFA 4XQ4A 3M4FA 1AXKA 2BW8A 3VZMA 4HK9A 1HV1A 2QZ3A 1BCXA 1HIXA 1H1AA 3WP6A 3WT3A 1QH6A 3AKTA 1XNCA 2Z79A 3ZSEA 1XYPA 2JENA 3VHOA 2DFCA 4S2GA 4XPVA 2B45X 1H4HA 2B42B 1XYOA 2D97A 3AMPA 1XNDA 3LGRA 3MF6A 1UU4A 3WP5A 3VZKA 5K9YA 2VG9A 2DCJA 2JEMA 1REDA 2VGDA 4XQDA 2BVVA 1C5IA 3MF9A 1OA3A 3MFAA 3WR0A 1H0BA 1XXNA 3AKQA 2BWCA 2NQYA 1T6GC 4NPRA 3AMQA 1F5JA 1ENXA 3VL9A 1QH7A 1H4GA 3AMNA 3WQ1A 5HXVA 2DCYA 4IXLA 1OA2A 1UU5A 4S2HA 3VHNA 3RI9A 3WP4A 1BK1A 1UKRA 2B46X 3WX5A 5K7PA 3VZLA 2QZ2A 1XNBA 2JICA 3O7OA 3RI8A 2DFBA 2C1FA 3VL8A 3LB9A 2NLRA 3AMHA 3VZOA 1BVVA 2BWAA 1XYNA 3WY6A 3AKSA 1M4WA 1REEA 1OLQA 1OA4A 4H7MA 4S2DA 3AKRA 3VGIA 1C5HA 3AKPA 1YNAA 3HD8B 1KS5A 2D98A 1HV0A 2DCKA 3EXUA 1IGOA 4XQWA 2VULA 1UU6A 3VLBB 3B5LB 3VZNA 4HK8A 5EJ3A 3VHPA 1NLRA 3WP3A 3VZJA 3MFCA 3WQ7A 4HKOA 2VUJA 2F6BA 1H8VA 1OLRA 4HKWA 1W2UA 3WXPA 4HKLA 1KS4A 1TE1B 2DCZA 1PVXA 1XNKA 4S2FA 3AMMA 3B7MA 3WQ0A
chains in the Genus database with same CATH superfamily
1UPIA 4XQ4A 3VKLA 3ON7A 4ES8A 1OH3A 1AXKA 2DCTA 3HQXA 5FP4A 1JUHA 1FNZA 1E5SA 3FX3A 3MIEA 4HK9A 4EZHA 1X7NA 2HKXA 5E89A 2QZ3A 2X10A 1D2SA 2ARBA 1HIXA 4XTMA 3RGBA 2ZGSA 3UKTA 4OUMA 3VDDB 5FY0A 1RUC3 3AXEA 2RM22 4GAZA 4TZDA 1DU3D 2A1XA 3DF0A 1F9KA 1ZBE3 1T2XA 2D5HA 2YU1A 5FZOA 3TAYA 3RWKX 1QJX2 2YROA 5HI0A 3JZVA 2A6WA 2WAOA 2UWBA 4AFDA 4XFHA 4ASLA 1W04A 1BK0A 1XSQA 1BVP1 2HWC2 3N7LA 1WD4A 3OUJA 1APNA 1Z78A 4P00B 4RFT0 5FJHA 3LDRA 4ZPIA 2ZACA 3T2PA 3WQBA 5J3UA 1PGW2 1UO9A 1JODA 1O8PA 1PM4A 5F3IA 4AI9A 1W6QA 4RFRB 4AVCA 1H9WA 4XFBA 5DZFA 5A3PA 4B4QA 4R4ZA 3VBRA 1DZTA 4P14A 3WUDA 4AHWA 4LUKA 3AP4A 3WR0A 4CCMA 4C90A 5IK8A 2QQPA 1GBGA 4NRQA 1RUF3 4YVSB 1T6GC 4R9BA 4UFJA 4OHVA 1TNRA 1TEIA 3K51A 4GB31 1X33A 1AYN2 4XBNA 1RUH1 2GSYA 3VL9A 2XJRA 5FPVA 1KEXA 3H1YA 4PBPA 1NCRA 4OQ9A 2VMFA 2VMEA 3W58A 1JZ8A 3WW1A 1QXRA 4FOWA 5LBEA 3VBSA 2GNTA 4NIDA 3T2TA 3VBHA 4YZ2A 4HL0A 3VHNA 1ZM1A 5FLJA 1R091 4CEWB 1XC6A 4JGZB 3ZKUA 4MH0E 3AYDA 4UXAA 4CCLA 1AF9A 1N1SA 2YFZA 1WA4A 4GXLA 3WNPA 3MW4A 1D4VB 2P34A 1O7FA 2DFBA 3VL8A 1W6MB 2O1QA 3RSJA 4CDXC 3AX4A 1TMF1 3UV9A 2R6QA 4CPBA 2WBKA 5F5CA 4AVVA 1N47A 3VZOA 3BODA 2NPIA 1ZNPA 5FZ3A 5FFOC 5J37A 2AENA 3J8F2 3THCA 2NM1A 1RUJ1 2HWE2 1REEA 3AYCA 1W28A 3UL2A 3JBG2 1I1EA 3MO4A 1OA4A 4ZXEA 2A3XA 4LE4A 2Y60A 4UWDA 3WHTA 2WQ4A 1AR91 1JOBA 3ST7A 1RHI1 1OH4A 2XG3A 2Q8EA 4DIQA 2PQQA 4GB33 4QKBA 1RUH3 2PHFA 3GCWA 4XAAA 3N9OA 1H1IA 4Q4X1 3RYRA 2OIIA 1IPSA 1VR3A 4NJ4A 4XF3A 1B35B 1JOJA 1CZVA 3KGLA 1NQDA 4MVTA 4AG4A 1G9AA 3GZTB 3WDUA 2DVBA 4DXTA 5B2GB 1AR71 1R093 2CWSA 1GUIA 3UGGA 1VBC2 1DQ2A 1GP6A 2BNNA 4HKLA 3V64A 1QY4A 2DVAA 2QQLA 3CQOA 3WLUA 5I8YA 1DBNA 1HN0A 1YJKA 2X53S 4P9XA 4QKNA 1W3XA 4S2FA 5DABA 5SV5A 4AEMA 4YSFA 4GA9A 2BNOA 2Q8CA 1TMF3 4YVSC 1OQDA 5JZGC 2R071 4EJRA 2IVJA 4N43C 3ROUA 4ARXA 3AP9A 3POBA 3FZ3A 1F4HA 4TN7A 2VQAA 4D6QA 1UW8A 1Y9MA 5ACA1 4CXWA 2E7TA 3ZDSA 1RUJ3 5A1FA 2ZOEB 4ZS3A 3WCSA 1UY4A 1CQ9A 1MEC1 4A42A 4XUOA 4QPGB 5JXJA 4LO7A 2FMYA 5F2WA 1AR93 4BMBA 4BWOA 1LEDA 2ZGNA 5FYUA 2C6SA 1RHI3 4E4DX 3V0AB 5ISLA 4JGZC 2HWF2 5HCAA 5EWSA 2WYSA 4IV1C 1W6NA 1CVNA 4Q4X3 5CNAA 4N7IA 1DIWA 4LBQA 4YWAA 5FYHA 3SH5A 2R7EB 3MV01 5LB6A 4PQ9A 1EYBA 5DUUA 5F2SA 3T0AA 4UI9L 4BCUA 1AR73 1H0BA 5JOXA 3H0OA 1JS9A 3AP7A 3THPA 1CN1A 5AC91 1HJGA 4E8CA 4KG8A 2VCMA 3KV9A 3RQ0A 3Q8BA 3SXWA 1W9YA 3LSEA 2YFUA 4EWAA 2O14A 3NRUA 5IWFA 5FPZA 3WDXA 2R073 2QJVA 1ULFA 1W2AX 5HXVA 1PGL2 4RS5A 1K5JA 1NX9A 5ACA3 3J7LA 4MHUA 4RSUA 1LOBA 3RZMA 3KWVA 3B9IA 1ZRIA 5FIXA 4LBQD 1HB1A 2VVEA 3A21A 1VE0A 3P3NA 1MEC3 3PDQA 3NNMA 4R9DA 2IZWA 3MPPG 3FC0A 3CJIC 3WDTA 3B02A 5JOZA 1H8TA 3CZJA 5IVYA 3WEZA 3DKWA 1LJ7A 2P3JA 5GKAC 4XAEA 3MPBA 1S0EA 4BXSV 3W5MA 3AL6A 1D2QA 3FJSA 4FPJA 4LULA 2R32A 2KM2A 4UF0A 4JVAA 3V56A 1XYNA 1RVF2 3Q8EA 1XU2A 1W0PA 3M3IA 1N1YA 3I2GA 2QUOA 3AP6A 5BV6A 3J9SA 3PURA 3SH4A 2JDAA 1EV12 2ZAAA 1OKOA 3WNOA 2RE9A 3HIFA 2VQTA 4NHLA 3E5XA 5AC93 1VRH3 5BNPA 5KHGA 4LLFA 5T5LA 3H8OA 3EXUA 4QPGC 4XF4A 4Y26A 1UU6A 3VKNA 4D7TA 4IEOA 1K5MC 5A3MA 2VZVA 4CVUA 1O4YA 3FFQA 1UYZA 1JYCA 5JPNB 3GZUC 1QMJA 2A71A 2ZZJA 3OGSA 1RINA 3PU3A 5FQ0A 2VPVA 2TEPA 3MFCA 4YG0A 5J7MA 3F2ZA 4EN7B 4Q0SA 2LROA 5JSOA 1NXMA 2VBDA 1MQTB 3PNAA 3S7EA 1ENRA 1YQ2A 1GQPA 1XNKA 2Q1MA 3T08A 4NIHA 2CL2A 1W3VA 2J7MA 5CFDA 1VBD1 1SG3A 2WC2A 3VDCA 5D8AC 3USUB 1UZZA 3UYJA 4MGKE 5FZ7A 1HXS1 1UZ0A 2J42A 2RHPA 1OF4A 4AHXA 2EALA 2GH2A 3ILNA 4ARYA 2A6XA 3ZYIB 2ZGTA 2CTVA 5DMYA 4B1MA 4YM1A 1BJQA 4MZUA 1N3QA 3WHUA 1ND2A 2BJSA 3OF1A 4N53B 4NPLA 2C5DA 2VR4A 2PLV3 4O7XA 4BZ4A 5KHIA 3ES1A 1O3QA 4C1XA 4B4RA 1URXA 4O61A 5DAWA 5A1LA 2J1RA 3PU8A 5F9TA 2GC0A 4JGYB 2BGPA 5CBLA 2AUYA 1QJY2 4URAA 3GZEA 1ZBA1 3VZKA 3POIA 4IGQA 1RUI1 4PLNA 1ZRRA 5JSPA 3O0XA 4MGTA 4XOGA 2XL9A 3HNYM 3ZFGA 4AI8A 5FR3A 3J7HA 1UXZA 2WFF2 4QGNA 3OB8A 4IW3A 3MF9A 2EIGA 5F3GA 4DPNA 4Y1ZA 4DQAA 1ZA4A 3U78A 3UT0A 4B1LA 2GMMA 3I2IA 4QM8A 2VY0A 4CXYA 3SKJE 1N3OA 3O1PA 5L73A 2G9ZA 1IKQA 1QH7A 1H4GA 1VBD3 5FDBA 4EWEA 2G9GA 2VE1A 1HXS3 1NCQB 2XMLA 1ZZBA 4GWNA 4WVMB 2WWJA 4HXCA 4KG0A 4TSVA 2JWPA 1V6JA 1ODMA 3K4ZA 3P1IA 3Q8CA 3Q8AA 4GJZA 3SC7X 1VMFA 1CZSA 4LKFA 5L36A 3ZYJB 2BBAA 3RI9A 3U75A 1FPN2 2GC2A 2B46X 2P3IA 2RMU2 4PQQA 4YLZA 3VKMA 5K7PA 1PK6C 4DRVA 5LY1A 4K9SA 4NE9A 5FREA 2VNOA 2VCAA 4KWJA 1POQA 3LIGA 1MVEA 5K0UA 4CP9B 5FUNA 1QXPA 3RFRA 1SDWA 1X82A 2CGPA 5A3LA 1NY72 4MUVA 1ULEA 2W47A 4XURA 5A7WB 1MQTC 4BK5A 1LNSA 1COV2 1EY2A 3VUOA 1MS3A 1ZBA3 2GC1A 2XVKA 4FFIA 5FYBA 4P08A 2D5FA 1GQHA 1BMV2 3POFA 4YZ5A 1OKQA 4MV2A 2WLPA 5CKQA 3I49A 1DDLA 5K4LA 5GLWA 4PF1A 1IG3A 2DUQA 4YGCA 2OYZA 2OZJA 2VMGA 5IATA 4YVWA 4S2DA 4XACA 1QNYA 1QJU1 3HBKA 3AKPA 1KGYA 3ZXDA 4C0HA 5CFCB 3AK0A 1UN1A 2JG8C 1XQNA 1JYVA 3J4UH 4Y20B 4CA9A 5L7OA 4FOYA 4Y5Z0 1DHKB 1BYHA 1UWWA 4JGYC 2A5ZA 3POGA 5EYXA 4OI1A 2WR9A 2FDKA 3S57A 1PZ7A 1A8MA 4YW6A 2HWD2 1UZYA 1AUYA 1HQNA 2RS32 1V6OA 2DF7A 5FXWA 4AQSA 1OXCA 4XMAA 2A6YA 1G8WA 3K4AA 3QACA 5FY8A 2PN5A 5FZEA 3AL5A 3G6JB 3NV3A 5F6KA 2EXIA 2Y26A 4DRRA 1PVC1 3VD4A 1REFA 4QX0A 3SLIA 1AXZA 4MSVA 3ZN6B 4FSJA 2JDUA 4HONA 2YU2A 3AC0A 4MGQA 1Q8QA 2XKPA 3KSCA 4CEYA 4OZXA 4ISRA 5CU1A 4U36A 3VDDA 3WP6A 3PUIA 4AEDB 1A34A 3SISA 2WJSA 2ZGUA 3I4IA 1X8EA 4W6XA 2WS91 1NCQC 1WW7A 4O65A 1WMDA 4LA2A 4OHYA 4URTA 3M70A 1Q56A 4YM2A 1UNBA 4JAAA 1QJU3 1H6XA 2WN2A 3C8XA 2Q5TA 5JSRA 1FMD1 2VQUA 4I02A 3JXSA 4K8FA 2H0BA 5FWJA 3RDIA 4YPJA 1LKNA 1XRUA 1JHJA 3WP5A 1D4M1 2P37A 4HANA 1S1AA 1AJOA 1S2EA 3M1HA 3OPZA 4NHMA 3OD0A 2R1BA 3P5BA 3T30A 4Y1VA 2JEMA 2VGDA 1OQEA 2C9AA 1UL9A 4IEVA 2WNVB 4UBHA 4M4RA 3OBRA 3AKQA 1JH5A 4LBJA 4RQPB 4NVPA 2CU5A 2MHFA 2DYCA 1PVC3 1RITA 3VBOB 2JJ6A 3AMNA 2E63A 2BOIA 2Q0AA 3VHRA 1JZ4A 1YFXA 3LA3A 1W39A 3R4SA 3MBWA 4QQPA 2XKOA 4NIAA 3VBRC 5JIAA 4QD2A 4H3WA 3O1TA 5GLZA 4CEWA 2WS93 1FV2A 2CY6A 1OOPC 2QQUA 1U5IA 2IXJA 2RM21 3NWKA 4K1YA 4XXPA 4W65A 3D3AA 4F7ZA 3NJXA 2QVSB 1XNBA 3PIGA 2QCSB 2JDZA 2E32A 1AR82 1NCRC 3DPRC 1W6MA 3NJYA 5FY7A 5G04L 4B3NA 3J7NA 5EJ1B 1ND3B 3MIBA 3H50A 5FKBA 4CP1A 2HWC1 2CHHA 2D6NA 3PHMA 2IVIB 4XJZA 1D4M3 4M4PA 5JI7A 1UOJA 5BYNA 4PI0A 1PGW1 5I0TA 3VD5A 3WY6A 3K2OA 3H3ZA 4HVOA 1M4WA 2Z42A 2HWB2 4TLFA 4CCDA 4EN6B 1LRHA 4L11A 5GZFA 2ZX0A 4M3CE 3LDKA 2FCTA 1LGNA 3FFZA 3WV6A 5GZCA 4NUBA 2A7AA 1HRV2 1LHVA 4DMIA 2D98A 1V6LA 4XVHA 1AYN1 2NZ9A 1IGOA 4AI2A 4NN0A 2BNMA 3CNAA 4BPZA 3ALQA 1B35A 1AX0A 5C4WA 4CRQA 3A7QA 4P5HA 1JYWA 3IZOA 3ACIA 2OA2A 3POWA 4YZ3A 2ZEYA 4L2NA 1DFQA 2FHRA 5M0TA 4BISA 2X5IB 3TYJA 5FO8B 5F5QA 2RM23 2VOTA 4C1WA 1OFSA 3EYPA 4IE7A 3C7FA 3L2YA 4QQ2A 3NKGA 3KS7A 5C8CC 1EUTA 3PL0A 1JZ3A 5L19A 5DUXA 1CAVB 4N9IA 4DXZA 3FLTA 2VBPA 4RQPC 5JLVA 4QT6A 1EAH2 2SLIA 4YG3A 3U14A 1PO12 1VAVA 2VH9A 5DAPA 2AR6A 5A80A 4DXRA 3ZM8A 3AKTA 4XFGA 5BNOC 3JQXA 4GWIA 3VBFA 5KXEA 5JR7B 3ZSEA 1XYPA 5IJRA 2VMIA 4QQOA 4LLOA 3L9JT 4J6GA 5J1XA 1MZ6A 3JBG1 4OMCA 4QB1A 5FYTA 5A33B 3BU7A 2E26A 2DFCA 1WW5A 3MHZA 4D7YA 3V0AA 2ES3A 2I2SA 2ZGOA 2ZS6B 3D8CA 3MUZ1 4LHSA 4NHYA 1O91A 1XSRA 3DECA 1W2NA 1XNDA 2VM9A 3LGRA 4NO4A 4P9WA 1AYN3 1HKDA 1UYPA 1S0DA 2DVFA 2K2SA 2QQNA 4IQPA 1YQ6A 5B4NA 2JX9A 2PHUA 3ES4A 3WW3A 5C9AC 3ZO0B 4MHRA 4JV4A 5A3TA 2ZGLA 4CUBA 4GALA 4YRDA 5FYCA 4CTEA 2KXLA 3B00A 3LEGA 4PLMA 1HB4A 1LOEA 1NA1B 3AJZA 3NO8A 5L9BA 2WT1A 2GMPA 1O3RA 1OF3A 3DN7A 1VBE2 1VBC1 1SCSA 1YFWA 3H9AA 4XUQA 2VNRA 1VMHA 1SMVA 3B9CA 5H9PA 1PM7A 2OQ7A 4AI1A 2ZKLA 3FUOA 4XF1A 1QOTA 2IXHA 3S6PA 2ZX1A 2Q30A 3U1XA 2C24A 1GICA 2B5HA 4XUPA 3DXUA 4WM8C 3MIHA 1HRI2 4FXGB 1LR5A 1W8TA 2ENRA 4GH4B 1J58A 4YW4A 3U07A 1O5UA 5DAXA 2OW4A 4FQZA 3O0VA 3Q8FA 3JBG3 4XFAA 3NL1A 4L8QA 2ZHNA 1GWKA 2DU1A 4E2QA 4Y5SA 4LBKA 2HWF1 2Y6JA 1S0CA 5CFCA 1PIV2 4RS5C 2Y33A 2JKBA 1DGWX 3VDBA 1LHUA 4Z92B 5D1IA 4KQ7A 2ZHKA 4XDOA 2Z5WA 3N9LA 4QXBA 2DDUA 1AYM2 2QKDA 3I2JA 2VNGA 5HBAA 3CKHA 3MLLA 4K20A 5APAA 3H1WA 3OSDA 4HN1A 1O4TA 1H8TC 4QGLA 3KB5A 3ZYBA 3ACHA 4OQ8A 1VBC3 1FX5A 5IVJA 1YI7A 3O1OA 1YRZA 4Q27A 3WF1A 4JDOA 1V0AA 2B9UA 1WW6A 1VBB2 3WF2A 4AVBA 3FN9A 4WVZA 2W87A 2QE3A 3B5LB 1YI9A 5T54A 1NLQA 3LDBA 5EJ3A 1YFYA 1NZCA 3JU9A 3ZYPA 1PGL1 1C28A 4LNVA 3WG2A 4FPCA 3VZJA 2R0FA 2NMOA 1KXGA 3ZYRA 1U5YA 3CLPA 1DQ0A 1LECA 3GALA 1UY1A 3RG0A 5A3OA 2UY8A 2I07B 2QTWB 1TE1B 1UMZA 2DCZA 1JMUB 2IUWA 1FAYA 1V6KA 1UYXA 2VZRA 1DQ4A 2VMCA 2YUEA 3M3CA 3USUA 3LPGA 3MI8A 2HWF3 1CWPA 3FBMA 5FXXA 1DGRN 2PHWA 4LO6B 3IAPA 2BVBA 2WZPP 2H0VA 2ZX4A 4CDWC 1VRBA 1LGBA 1MS9A 5FJKA 1XNCA 1RVF1 1W6PA 2Z79A 5T5OA 1MACA 3T1LA 1O8SA 2UYBA 4FXKB 1ZZ7A 4N53A 2JIGA 3ACGA 5ABJA 4OHXA 3PVOA 4TXWA 2CAUA 1W03A 1EV11 1QDOA 4COZA 4LITA 4EN8B 4YG6A 2Y6KA 4CDXB 3DCQA 4BQ2A 1P8JA 3GF6A 4HZFA 5A7PA 5HV0A 5IVCA 4QHBA 4CU6A 4L99A 1C4RA 1AX2A 4CU9A 5DZEA 1SLTA 5FYIA 3NSTA 1GSLA 4AEJA 4FOVA 4BIFA 1O3SA 3F95A 1OA3A 5FTTC 1XOYA 1ULPA 2QQWA 3DXTA 1R64A 4D0QA 5J98B 4MGSA 1UF2C 2ZMLA 4JCKA 2LRPA 1QGLA 2JB8A 2EF6A 1RL3A 1ENXA 3LCPA 2Y34A 3HPNA 4DB5A 5CKNA 4TTGA 2WNUA 3N36A 3BALA 1GFF2 1W8HA 2W3JA 4XDQA 4XHXA 2RDQA 4QWNA 4WVMA 2JE9A 3ZSLA 1OD3A 3I2KA 1RVF3 4PT6A 2JG9A 2UY9A 1DYPA 2JB4A 4LJHA 4NROA 5IFTA 4A2UA 1GQGA 2XR4A 4N9HA 2QZ2A 1RUE2 3HN1A 3NNGA 4CP9A 1EV13 1R082 1PO22 2RVAA 4DINB 3I2HA 5IK5A 1WCSA 3PLQA 1AR62 1IHMA 2J1TA 4XJUA 1L7RA 2R062 5JZGB 3GBWA 3HOBA 4N43B 1O3TA 1QJY1 2GNMA 3PMSA 1OBNA 4IETA 4NIIA 2UURA 4FTEA 2ADEA 3OYWB 1AVBA 3OY8B 2VECA 2CDPA 2QFEA 3SITA 2WFF1 5C3RA 3ZFEB 3AVSA 3RPQA 4R8HA 3RJRA 4AGVA 3H7YA 4K8RB 1GOHA 2OPKA 3HD8B 4MGZE 4QQLA 3I54A 1H2NA 4QU2A 2VZ1A 4IV1B 4XIOA 4RGAA 3VD3A 4HETA 2H6CA 2JE7A 2PA7A 5ERLA 2ARXA 4BQWA 4AZZA 1WLCA 1EPWA 2EIEA 4WZCA 4LK7A 1G9DA 3WP3A 4IE4A 1YHFA 1N1VA 1G7YA 4IE0A 5JPMB 4YVWC 1BBT2 4Q29A 2VUJA 3NKTA 4X8PA 2DVDA 2RMU1 4QPWA 3WXPA 4CZSA 2ETEA 1XE7A 3OPWA 1G9FA 1UD1A 3KVBA 2BFUL 4ISQA 3WQ0A 4FFHA 1NY71 4ATFA 3ZN6A 4MG2A 2V09A 1L7QA 1GOFA 3KT1A 3ENRA 1QJY3 2O8OA 1H1MA 4FPFA 2WABA 4PDWA 3FHQA 4Z8BA 1BCXA 3WT3A 1QJZA 2ZX2A 4XW3A 1W6OB 1PHMA 1UCXA 4XILA 1TVGA 2FDFA 2WFF3 5FPXA 1YEWA 2A6VA 5FLIA 2V73A 3CJIB 3G7DA 4CPBD 5DXDA 2WO3A 1W99A 2D97A 1YQ5A 3PVBB 1DQ6A 4UAPA 1T6BX 2C0ZA 3QCWA 3LA2A 3MGUA 4BM8A 4ORFA 4XF9A 3HWJA 2D6PA 4AW7A 3TWIA 4TWTA 1CZTA 2DWRA 1ULCA 5K9YA 4KMQA 4UW3A 4CU8A 5CYYA 3O12A 2ZGMA 2WNVA 2JDNA 4JHTA 5FY4A 4OLLA 3CU7A 4C0BA 4XFCA 1SLAA 2HWD1 2RMU3 3ZOIA 2NQYA 4INDA 2YC0A 3TEYA 4XBLA 2VTXJ 5BNQA 3INAA 4EN0A 4D6RA 3WW2A 4L97A 2JDHA 3ZFEC 3TNQA 5KC6A 4P9JA 1JTZX 1K5MB 3WQ1A 4IV3B 3E5UA 3OCPA 1TNFA 4CDUC 1V6IA 2GDFA 2ZEZA 2EIDA 2W94A 3KT7A 1Y9QA 1XNTA 1QDCA 2VW1A 1W9SA 4S2HA 5BNNA 4UW4A 4P02B 1Z7S2 3ABZA 4IERA 4LBNA 4DY3A 3BPZA 4QM9A 4GD4A 3UKVA 2QBXA 3FBYA 4Q5OA 3GDBA 4WM7A 2JICA 1J1LA 2ZABA 2BU9A 2K46A 5HPOA 1YCIA 1CPMA 5CA6A 3HT2A 1CAWB 2DBIA 1J3PA 3OUIA 5D8AB 4BMEA 3IPVB 1KITA 3IDEA 4QX3A 4EWDA 4PIZA 1FNYA 2MEV1 3WF4A 1F4AA 1C1LA 3SEPA 2R49A 2VZOA 2Y0IA 4OULA 2JDMA 3C7GA 5FY1A 3NW4A 4IUGA 1ZZ6A 2BGCA 1A3KA 2OS2A 3ACFA 3AKSA 2IXIA 2IXKA 2D3SA 3A23A 4CSWA 3I3MA 1NOVA 1CAXB 5I91A 4FPYA 2HWD3 5FPBA 2GP3A 2RDNA 1YNAA 5GM0A 4I0AA 2WSUA 1I5ZA 4PF5A 3ZR6A 2RS52 2D6KA 2ILMA 1ZREA 2C26A 2D44A 2ZEXA 3ILFA 1OPOA 2W95A 3R0RA 2OPWA 1UY2A 2QDNA 4LKEA 4ZONA 3S30A 5F1RA 1WMEA 3BTAA 4I3PA 2VOWA 2WNEA 3D0JA 3TOJA 4M0NA 4W8JA 1IS3A 2P6CA 2X5IA 4IDZA 1RYYA 5A32B 2H6BA 4A7KA 2P17A 4HKWA 5C6CA 4B29A 3M8LA 2WA4A 3CZUA 1LOCA 2VCCA 1PVXA 4BYYA 3GJAA 2PAMA 1NKGA 1ZVFA 2A73B 1CAVA 2YB7A 5C4WC 4IL7A 5IFPA 3C7EA 2XB6C 3MW2A 1QIQA 3BTXA 1PX4A 2BW8A 3VZMA 2MEV3 3SCFA 1U5ZA 3ZYHA 1KQRA 4AVSA 2YZ4A 2E9QA 5FMBA 4D69A 4HVRA 4IV3C 4QAWA 4PIYA 3VDAA 5KXBA 3GBFA 3KD4A 2HWB1 2PXJA 1PK6B 1QXJA 2YBKA 4I0BA 2J22A 5A33A 2JENA 1RUOA 4ZU4A 1W05A 4JZRA 2VTFA 2WSVA 3ZVXA 1VALA 4LBMA 4AWDA 4DS0A 1WD3A 5KBFA 5CVRA 5HCBA 1HRV1 3ACLA 3KVAA 3HN3A 4F8AA 2WKKA 2XVLA 2ZMKA 4Y22A 5KXDA 3U10A 3PVEA 1PMHX 4DOUA 5I0DA 3MUY1 3RMYA 3VBFC 4BB3A 4D3WA 1JYNA 4H2AA 5ANQA 2IXCA 1OT5A 2WZEA 3NMBA 2YBSA 1CX4A 4HT1T 1Q8SA 2J1UA 4P5YA 5C8WA 2VZPA 1NA1A 5LZ6A 3H3LA 1DLCA 3V65A 2VXJA 3RMXA 1NLSA 2WRAA 5DAVA 4R4XA 1JYTA 5A3WA 4XC9A 2F4LA 4AR2A 5FBJA 3WNKA 1LOGA 4GKYA 3PUQA 1V70A 1KJLA 4OUSA 2XJUA 2JG8B 3IDAA 2XDVA 3KM5A 3KGZA 4UFKA 3NV1A 5F3CA 1K42A 1OD5A 1ODNA 2QDRA 1RGSA 4KL1A 3N9QA 1AHSA 1ONAA 1HX6A 1VJ2A 2JIJA 1EUUA 1PO11 3PTRB 5DZGA 1OA2A 3C7OA 2MPFA 3AB0A 4OYUA 4XFFA 2FQPA 5EXOA 1AZDA 3LEKA 2FD8A 3O14A 1PMIA 1UKRA 4GH4A 2VNVA 2RJLA 2HWB3 1UZVA 1YO8A 2ZAHA 2BQPA 3DYMA 4E2SA 5DDJ1 4IEUA 4Y1YA 2VVFA 3RZZA 4AFAA 5GLTA 5CAZA 2ZGKA 3O7OA 3RS6A 2WO7A 3GBGA 1WBLA 4LOSA 3ZXFA 5FZLA 5A3UA 1HRV3 4EQVA 3SKVA 2W2IA 3K3OA 3ZYFA 1BMV1 1RMU2 4FPKA 1Q5OA 3KV6A 4ZU7A 1LOFC 2WZR2 3DYOA 1BVVA 3KMHA 3KT4A 4CUAA 2GAUA 3C7HA 4HVQA 1SLBA 3MICA 1S0BA 4OI2A 4V1PA 4BQ1A 5EIYB 4CCCA 2CWMA 3EMRA 4GB32 2Y64A 3S7IA 1WKYA 4LEJA 2CYFA 5FXVA 4UFLA 3ZFFA 4P9YA 4Y3OA 4H7MA 4IGOA 5LBFA 3UGHA 1VBE1 3IIAA 5F39A 2LM3A 3ZKYA 5CFCC 4LBLA 4XXAA 4CUCA 1SBFA 4O9GA 3CHXA 1UOFA 2DCKA 3RYPA 3KF5A 5JXGA 3JUUA 4QPIA 4Q1PA 1R092 1OLMA 1ZX5A 1SPPB 4E9KA 2RS12 3MLKA 1J1TA 4HK8A 2VW0A 1PO13 2XGXA 1XB9A 1KJRA 2ZHMA 5FZHA 4D7SA 2E7QA 1Q8OA 3H3UA 2ZA9A 4L0PA 4ZHNA 1RUI3 3K48A 1HRI1 2VZ3A 5A3NA 5C3OA 5DDJ3 2A3WA 3IMMA 2B4KA 3AMMA 3N9PA 2K9ZA 1RXFA 4CDQC 4H55A 1LHOA 1GZCA 1BLZA 1ST8A 3BPSA 3ETQA 1PIV1 1NG0A 4KBBA 4LO8A 1G9CA 2A70A 2RJ2A 5GLVA 1HV1A 3VBRB 4ES9A 3AXDA 4RR3C 4HPKB 5A7OA 2WAAA 4QB2A 4UOJA 3DKQA 3SNMA 3GM8A 3VV1A 1Y9GA 5DUWA 1OOPB 1YXWA 2RJKA 1QQP2 1A78A 4NAOA 4IEQA 1VBE3 2B45X 1LEMA 2LS6A 1NCRB 3DPRB 4I01A 4RN5A 4XCBA 4Y1UA 4ZU5A 3AMPA 1RC6A 1O6UA 1VBB1 4CXXA 1UIKA 4HMZA 4JX0A 3D4KA 3OJBA 2YMZA 3E6DA 3ITQA 2VMDA 3GNEA 3GGLA 3K3NA 3QH6A 5BXXA 5HCHA 4Q4V2 5ABJC 3R4DB 3TN92 2BVVA 3NAPC 5GLUA 4IEWA 4GULA 2VZTA 1HRI3 1JW6A 3FLRA 1CD3G 2VU9A 2VZUA 4JKKA 2CSGA 4YW1A 5J48A 1GWLA 3KV5A 4M3CF 2EAKA 4XJ8A 5FZGA 5T5JA 4A45A 3ZIXA 3CO2A 5JDBA 4LTAA 1FOD2 2AEZA 1PIV3 3TB0A 1I6XA 3LAGA 1G9BA 3DL3A 4JC1A 4NHXA 2XJSA 5J96B 2XJQA 3KLSA 2OX0A 4LMFA 3E6CC 5CG8A 3ORJA 2VBBA 3HNMA 4DEVA 3WNXA 2ZKNA 1CAUB 3BKZA 1Z0HA 3OG2A 4N8MA 5CB7A 1Y3TA 3ZMOA 4HN0A 4IEPA 4CP0A 2OXBA 5C8CB 1OC1A 5FYZA 2JDKA 4MADA 3WDWA 3WUCA 2WNUC 1TZOA 4OZOA 4XYXA 1GLHA 3P6BA 2QQIA 3H7JA 4NRPA 4YVSA 2YC2A 2GNDA 3N9MA 4FI9A 5IVFA 5JZGA 4N43A 4Q4Y2 2HBTA 4BA6A 1E5RA 3U4SA 4OI4A 4AAXA 2JG9C 2YHJA 3ZPYA 5BNOB 1YWKA 3OYWA 3W20A 3ZYGA 3BYWA 1VRH2 2X29A 4NWVA 2VOVA 5H9QA 5FBZA 3W21A 4A6SA 1W0OA 5FZFA 1H6YA 2AH2A 3BUCA 2EICA 1ZRFA 2RV9A 4JGZA 5IHRA 5EFUA 1V00A 2X05A 1KS5A 5SV8A 1HV0A 1GNYA 1LTEA 5F8PA 2EXHA 2ZCWA 4GZ9A 3QBQA 3KQRA 4EZ4A 1CPNA 5C9AB 5CG9A 3VHPA 3N9NA 1QJX1 1UOGA 1FMD3 1VAKA 2J1AA 4BLIA 3OBAA 4NR1A 4NRMA 5GJ6A 1GWMA 3VBSC 1GZTA 3CIHA 3VBHC 1NUKA 2WWUA 4FPHA 5CEHA 2V5DA 2A75A 3I3EA 1OLRA 5KHJA 1NT0A 4M3CB 5FOJB 3I3DA 5C71A 3LKJA 4LIUA 5FP3A 3BN6A 1V6MA 3THDA 4RHV2 3P3PA 1M06G 1QJEA 3B7MA 1R081 1PO21 2VMHA 3OGJA 1GZWB 4Q1RA 5FZIA 1AR61 2AYHA 1DYOA 2XBO2 3WF3A 2LTNA 4DUXA 4KI5M 2R061 1UX7A 1SACA 4AK3A 2D3PA 1CIWA 5H9SA 1WLDA 4MX3A 4WM8B 2PLV2 2XLAA 3D6EA 4JTOA 2HLEA 1W6OA 1S0IA 2W92A 2LALA 1SBEA 2W68A 2FDGA 1WUVA 2HEVF 3CJIA 1DQ1A 3ETPA 2GN7A 3I3QA 4L92A 2VQ0A 1EPZA 3PVNA 3QD6A 2V5YA 4MXWB 5FK8A 3VHOA 3BOPA 4A3XA 5LA0A 1QF3A 1BEV2 1XE8A 5FZBA 4PDWC 4PBOA 2GMEA 2A6ZA 4RS5B 1UU4A 4UW6A 4BHPA 2QQOA 2VOXA 2VZQA 4E27A 3POSA 5LRRA 3AVRA 4QXCA 3PUSA 5J36A 4LO5B 1QJX3 1W8ZA 2QQMA 3LWCA 4SLIA 3B93A 1V9U2 1HN1A 2HWC3 2XH6A 1SFPA 1R1A2 1H8TB 1BBT1 3MFAA 1UPSA 4IESA 2ET1A 2Y6LA 4JQTA 1W9TA 4FP2A 4YFZA 1IOAA 3ZXKA 1QOSA 3J8F1 2ZHLA 4E4HA 3ATGA 1RUG2 2HWE1 5FO7B 5IVEA 5JAXA 5L9VA 3LPFA 4QPGA 2D93A 1R083 4YZ4A 3AM2A 1PO23 4FTSA 4PLOA 1K5MA 1ULOA 3LEIA 5FYSA 4AI0A 4OFGA 5LWBA 1AR63 1VP6A 2YC4A 5E1RA 4Z07A 3ILRA 4XZPA 2R063 2MNGA 1E57A 2ZMNA 1UU5A 4GWJA 5GZEA 2AC1A 5T52A 2D40A 4XJ9A 1GU3A 1U0AA 4AOCA 1H2MA 1BKZA 1BQPA 5FZKA 4UBGA 5CKMA 1CAWA 3WDVA 2PHDA 3RI8A 1FT9A 2XJVA 3ZN5A 2OT7A 5D8AA 4FP3A 4HFSA 2C1FA 2D7FA 3IPVA 4XZUG 2F4PA 4Y4RA 3LB9A 3CJXA 2PFWA 3BVCA 2C4XA 3I97A 5L9RA 5BNNC 3AYEA 3ME2A 4CDWB 4B7KA 3T0BA 1JHNA 2XWBB 2WDBA 2Z4FA 2JECA 1PMJX 1DCSA 2PHTA 1CAXA 3NNJA 4FQ4A 1BBT3 4AAPA 4B8EA 4MO3M 4Z2WA 1HW5A 2BERA 4W50A 3HBZA 5CFDB 3URFA 3RNSA 1S0FA 1GNHA 3J8F3 2HWE3 4TYSA 3VD7A 4QDQA 3B01A 1MVQA 4ONUA 1O5LA 2BZDA 2EAAA 2ORXA 2XOMA 3HQRA 3S5QA 1RB8G 2RR12 5FP9A 2NP0A 1ND2B 1W2OA 2GALA 3IN9A 2DUPA 1VAMA 1FYUA 3UETA 5LATA 1Z7S1 4YW5A 2FDJA 2XHKA 1KS4A 5I8TA 4GKXA 1G86A 5LRSA 2AREA 3T4HB 3QLQA 3KV4A 5GZGA 4OI0A 1UMIA 1ZZ9A 3IDCB 2AACA 1H2KA 2X09A 4NIGA 2FMDA 5C33A 2CAVA 5BY5A 2Q4SA 2XUEA 2XUMA 4XHBA 1AL22 5JI9A 3X29B 1CR7A 4A7YA 4AGGA 5LEKA 5FP8A 5KWRA 1QJU2 3H8UA 1GP4A 2BRTA 3WD5A 3SQOA 1FATA 1PK6A 3T2OA 3DGTA 1SCRA 2VO5A 4QDRA 1C8M2 4FAGA 1ZZCA 3POEA 2P1BA 1FV3A 3BIEA 2EIBA 4S2GA 5LASA 2B42B 1LULA 2Q1ZB 1MQTA 3FMGA 3ZSJA 3IM0A 5BNPC 1J3QA 2BV4A 3OD4A 1VBA2 3MF6A 4C8DA 2XLFA 4CU7A 2WNOA 3OPTA 1N3PA 1PNFA 1IKPA 5FAXA 1RJ7A 1QJFA 2XQXA 4JDMA 5I0UA 4X8NA 4A3ZA 4RYDA 2WINB 2JXAA 2CNAA 2AGSA 1Z7S3 4LPLA 3HVDA 2WZ8A 2ZGPA 3EJKA 1GNZA 2BWCA 5FZ6A 1STMA 2YGMA 2CGOA 5C7GA 2JD9A 1EP0A 1F5JA 1OVSA 2W39A 2ZPXA 5CFDC 4Z82A 3KCXA 1CGPA 3W5NA 1NXD1 1IS5A 2PTMA 2VL4A 4E2GA 1DZQA 4HLTA 4IEYA 1CX1A 4IXLA 4JGYA 3AZWA 4H7LA 3A0KA 4YVWB 2BBVA 1UX6A 2WT0A 5DG1A 5LCWL 5KXCA 1WGPA 3AZYA 1ASJ2 3PIJA 1E5IA 2FCVA 5FWEA 3VZLA 1KRIA 1ND2C 1VB4A 3APBA 1KDKA 4HOOA 1D4M2 4YFWA 5FPLA 4QMAA 4XFIA 3GJBA 1WLTA 3WNNA 4ASMB 2FDHA 3SH3A 1UQXA 1PNGA 2ZGQA 4ATEA 3TEZA 3VBUB 2R042 4U2AA 1L3JA 2KR2A 1JZ7A 3RZJA 5FZMA 3A22A 1QHDA 5JVVA 4YW7A 2Q8OA 4COWA 5BPXA 4XE9A 5F6LB 5EHDA 3LF7A 1NCQA 2UWCA 1RUNA 3ZFGC 3BB6A 3N7MA 2FCUA 3LE0A 2G19A 5FYYA 2QQKA 1NE6A 2VJXA 1NQJA 3AP5A 3W9AA 2D6MA 1ACCA 3OBZA 4O9EA 1UZWA 3ZXAC 3J7MA 1G6NA 1POV0 4DXSA 5K8SA 3VKOA 1U12A 2IC1A 3ZSKA 2R30A 4BU2A 4W6YA 1JBCA 3OEBA 4CEYB 2W1SA 5TSWA 3K4DA 3AYAA 1N1TA 1TG7A 1O4ZA 1SPPA 3VLBB 5KC5A 5JCTA 3AZVA 2XHNA 5A7WA 1OSGA 1RUD2 1NLRA 1W9FA 3MW3A 3ECQA 3U11A 3ZFFC 1LU2A 4R9AA 4I09A 1IG0A 3GZAA 2B39A 1H8VA 2DVGA 1W2UA 2IWGB 3B94A 2XQRA 3E1F1 4GJYA 4Q0VA 1SFYA 2ORZA 3O1SA 1MS4A 2HJIA 4SBVA 5FMOL 4QPIC 5F5AA 4KWLA 1IPKA 5K0UC 5FUIA 5FZ9A 4QGMA 4AQ6A 2L9LA 5ANNA 2VUDA 1RMU1 2VUAA 2XJPA 4CDUB 3KQ4B 4EYUA 4HPKA 2TUNA 4LHNA 4Y20A 1W0NA 4N7UA 2WZR1 3OEAA 3OGGA 3IB3A 3PJQA 4W4ZA 2WA3A 3IDBB 5DUVA 1OOPA 1CONA 1W8NA 3TBDA 3GXUA 3QOPA 4P9GA 1LESA 2NMNA 1SFNA 3DEMA 4DUWA 1MS5A 3BTZA 2WYFA 3DPRA 4AE2A 1VMJA 1J84A 1ZRCA 4JTNA 1XYOA 1R1ZA 5A6QA 1FPN1 4ZKTB 3EHKA 3NVCA 2OUJA 4UFIA 4I2OA 2DCJA 5L7OC 3O1UA 4UFMA 2LUWA 2RS11 5JR2A 1DP0A 2BUKA 1GOGA 2EVXA 4BQYA 5J09A 1VLNA 1COV1 2HYXA 4Q4W2 5C3QA 2D3RA 3LSDA 3HJRA 3H42B 1GV9A 4AEDA 5CISA 5LA1A 3OOXA 4Q0QA 1ALYA 1SDDB 1HB2A 3OTFA 4OHZA 4CCJA 2PAKA 3LEMA 1F8VA 3JD72 3LOIA 5F5IA 3U4XA 3V0BB 4EE2A 1XPWA 5A70A 2ATFA 1DYKA 3UJQA 4OCTA 1XU1A 5JWPA 1RMU3 4M01A 4LQRA 1K3IA 5AVPA 3OGRA 4CEYC 2WUHA 2WZR3 5FLHA 2Y6FA 3VDDC 3HR9A 1CAUA 5IAVA 1BK1A 2BTVC 2VD7A 2YPJA 4AXOA 2Y8KA 4CP2A 5IUQA 3N7JA 2Z2SB 5AVAA 4A4AA 5C8CA 3SCHA 3WZ1A 5I93A 4M00A 4LT5A 3AFKA 1SLLA 1QQP1 2A3YA 1MZ5A 5C4WB 3RZKA 4RQPA 1FPN3 2RS31 1PX3A 4FFFA 3GHNA 4WVVA 2XONA 2NLRA 1H9PA 2JDPA 2WQZC 3DV8A 3DYPA 3IIIA 3VBOA 4QHOA 2BPA2 2ARAA 5EJZB 1S0JA 3LQCA 4DNYA 1IS4A 2VW2A 2RS13 5BNOA 1C57A 1DGRA 2BWAA 4AEKA 3KF3A 4QX8A 3KHCA 5T55A 5FV3A 1HB3A 4Q4V1 1GKBA 1ZYBA 1COV3 1MPXA 3B3QE 5FUPA 5IW0A 3TN91 2SBAA 3MIDA 3WG3A 4E8DA 3UNPA 1JZ2A 1D7PM 3QH7A 2UU8A 2GNBA 4D8MA 4KH9A 3NV4A 2YXSA 3A4UA 3C2UA 2IXLA 3TNPB 2BYVE 1BXHA 2VULA 5C5UA 1GMMA 5FZ4A 5GALA 3E6BA 4FO9A 2ZZQA 4B7EA 4BJ0A 5C9AA 5IK4A 1X9TA 4NPMA 3VBFB 4KWUA 1FOD1 3MZHA 1POV1 1WCUA 4AI3A 1ND3A 2JKXA 1CJPA 2PHLA 4XETA 3U0ZA 1SHWB 1QOOA 3RJ2X 4K6BA 1NYWA 1YQCA 4OHWA 4LR4A 3RZLA 4HG6B 5IYYA 4CEWC 1QU0A 4M3CA 3ASIA 3MV11 1W2TA 5E6HA 1WWYA 3TRSB 2WT2A 1VPHA 4IE6A 3OGVA 4YGBA 5CADA 4ET7A 3I8TA 3WG1A 5D21A 1DF0A 1X8MA 1YJLA 1JU3A 1QQP3 4XUTA 5F32A 5E8AA 1GZWA 5FK7A 2ERFA 2RS33 3M4FA 1S0GA 3HT1A 4ITCA 3WOGA 4R9CA 5I8SA 5FO9B 4V2WA 5LK7B 4Q4Y1 1B09A 1TME2 5HCFA 4NMIA 2VZSA 5IK7A 4WM8A 4WZFA 5E16A 4EV0A 1S55A 4J25A 3WINE 1W8FA 2C9KA 1PZ8A 3FE5A 4Q4V3 1VRH1 3BU0A 3TN93 4Q8KA 4RA0A 4QX2A 1OQ1A 2CV6A 4MXWA 3UJOA 3SEEA 3I59B 2XL7A 3OBTA 5BUVA 5IT6A 1QEXA 5LBBA 4G9SB 1BZWA 4GMP0 4P9LA 3I2OA 3I2DA 1TQ5A 4FTBA 4QDSA 1LAJA 1JZ5A 1B35C 1H30A 1FOD3 1OI6A 1AR81 1POV3 2W9XA 3E5QA 4MXVA 1X36A 2CGNA 4NWWA 4QPYA 3CDZB 4UW5A 1FXZA 1RUC2 4HSJA 2RDSA 1JOPA 4AHZA 1CESA 3UK9A 3MLJA 1LGCA 1MZEA 1CJDA 1ZBE2 2VC9A 3IKWA 1XXNA 3N3HA 4AFCA 3KCYA 2PMWB 2RG4A 1LU1A 2P5BA 3CBNA 2EXKA 2E6VA 4FVVA 4NAMA 4QKDA 4RHV1 2AZ5A 4JKMA 1MS0A 5FZ0A 4ASKA 5FZAA 1DGLA 1LOAA 3UGFA 1UY3A 5JXHA 2ARCA 2BDRA 5IAXA 3VBUA 2VTXA 2XBO1 3T3YA 2JD4A 5I0RA 3AZZA 3MIFA 4Q4Y3 3ZR5A 4GIQA 5DG2A 4A44A 2PHXA 4BOWA 3PJYA 5FY5A 4MLOA 4HSLA 2PLV1 2B9VA 3MDPA 2D6OX 1OURA 3WX5A 1RUF2 5C3PA 2OVUA 1OUSA 1UYYA 3FUQA 4ZY9A 4CDQB 4CYDA 4CCOA 5JOYA 1HLCA 3HMYA 1BEV1 2PYTA 4YYOA 3JCIA 5A6YA 3AMHA 1I3HA 1YUDA 5FRAA 5FMDA 3SCGA 4RR3B 4CDWA 1E5HA 1AR83 3UESA 1F15A 2ADDA 2W52A 2YBPA 3NQHA 4DY5A 3IBMA 2XLGA 2EXJA 2Y0OA 1EAH1 3T09A 3WW4A 1V9U1 4Z1VA 2PHRA 4YNIA 1R1A1 2FDIA 3SMHA 2O0OA 1NE4A 3WNMA 3VGIA 4GQ7A 1C5HA 2YG0A 5HXMA 3D5OA 4RHV3 1RUG1 1A8DA 4KU8A 4Q26A 4QX1A 1CIYA 4BQXA 3D82A 1ZA7A 1YLLA 1S4CA 5KHKA 4YW2A 5GZDA 1UXXX 4QX7A 1W8UA 4FOQA 2OKXA 4BK4A 1YQ8A 2XBO3 3N35A 1W6PB 3VZNA 4LA3A 4OUEA 3GYDA 5ABJB 2GZWA 3NAPB 4HKOA 2K0GA 2HYKA 2ZXQA 5FKCA 2JDYA 1KFXL 2ZGRA 4QXHA 4DFSA 1HQLA 4YGEA 4XIKA 5LA9A 1QNWA 1RUH2 1YFUA 2G4IA 2Y38A 3RWNA 2W0XA 1Q8VA 3HEIA 1BEV3 1UOBA 1W06A 4N90A 3ZPOA 4OMDA 2Q1FA 5FMCA 3I3BA 4MGIE 4TLGA 1SQ4A 3LFIA 1WCKA 4X6QB 3SHRA 1W9WA 1QH6A 4GWMA 1LB2A 4A7ZA 1IZ3A 3MEPA 3K77A 1EAH3 1V9U3 4FPOB 4P9IA 1R1A3 4AF9A 3N7KA 4FCAA 2VAUA 2WNUB 5FY9A 2GN3A 1RUG3 1TMF2 2YYOA 4FFGA 1DQ5A 1LCLA 1JXNA 1ULDA 4AQ2A 3CEWA 1C8NA 5DN2A 1JYIA 4V2VA 1WMFA 2BGOA 2JG9B 1HQWA 3RRDA 2RR11 4D6SA 4H14A 2KA3A 1RUJ2 1US2A 4JHZA 2P3YA 1W6QB 4MGYE 2QQVA 3WDYA 4BQ5A 3OUHA 4GMP1 4LO4B 3R6SA 5AFBA 3ZX7A 2W1UA 3MIGA 4LKSA 1KDMA 3WF0A 5FPUA 4EN9B 1AR92 2W1WA 1RHI2 1AYM1 1SZBA 4K3UA 1Y4WA 3AMQA 1V6NA 3M7AA 4FPLA 4LORA 2Q8DA 4Y1XA 4YARA 5D2AA 4E4SA 4Q4X2 5FPAA 1JYXA 4IE5A 2IFWA 1W90A 1WBFA 3H8RA 2YY1A 4KGQA 2DURA 4IEXA 4CDXA 2E53A 2R1DA 5DPNA 1AL21 4A41A 5A7QA 4ZS2A 2BP6A 3LA7A 2O8QA 5FXZA 1KD7A 1QKQA 3ZXLA 4ZZ8A 3VBSB 2ET7A 5EPAA 1AR72 3HQUA 3VBHB 5FOBB 1AXYA 3AZXA 2ZJCA 1J3RA 4QHZA 4DZGA 4FBFA 4N53C 4AVAA 1C8M1 3RVHA 1J83A 1KFUL 3FWEA 3WCRA 4AGRA 3VD9A 2R072 1VBA1 5FP7A 2HEYF 1SLCA 2WO2A 2TBVA 3TEWA 2R0HA 5ACA2 2EA7A 1JN2P 2RR13 3ZMNA 4YZ1A 1O59A 2DV9A 2D6LX 2B7YA 4KGGA 1MEC2 1US3A 2DTYA 4GMP3 3WVJA 4R52A 2G1MA 5T50A 2RDRA 2P3KA 3L2HA 4XMIA 3FL7A 1AYM3 4AQTA 1WLWA 4BDVB 5FZDA 2UWAA 2IFRA 4PDWB 2B8MA 1YYNA 3U37A 4FAHA 3DUIA 4Y4YA 3POYA 4Y24A 1AL23 4ZXKA 1VBB3 1DG6A 3BIWE 4C91A 3EBRA 4RD7A 1AL0G 4UFHA 5LA2A 1S2KA 3KZ4C 4D94A 1ASJ1 1X9PA 4RL7A 5C5TA 5JIUA 5A6ZA 3GHMA 2WLQA 5AC92 2MEV2 3OY8A 3IMNA 1XNAA 1C8M3 3ZFEA 2E31A 4QKFA 4AFMA 1JU4A 1H2LA 4META 2GH8A 5F7UA 2DBNA 5A7NA 5FMOS 2R041 4CDUA 1NZIA 1VBA3 3O0WA 4XJAA 4OVEA 1VIWB 2CDOA 4IV1A 3M3EA 1H1AA 2JE8A 3TEXA 1GANA 4Q2FA 4UT5A 4J1WA 3T0DA 1F2NA 2D43A 1UY0A 1H4HA 2VXRA 4XPVA 2VUCA 3M3QA 2WN3A 1YC61 1ENQA 4COUA 3HAGA 2NYYA 2WFPA 4M0HA 4YW3A 3FLPA 1OMIA 1RUE1 1UMHA 2XPJA 1W6NB 5BNNB 1C3HA 3UKNA 1S2BA 4CUGA 4LBQB 2BEOA 4A6OA 5B4XA 5LW9A 2VVDA 1RUD1 3GCXA 1REDA 2BFUS 4XQDA 4KU7A 3PMEA 3I7DA 4WM7B 5T5PA 1GR3A 3AFGA 5CIRA 4DUVA 5FCCA 1ASJ3 3Q9OA 3CL1A 4I0WB 4PCRA 3ZXEA 4AL9A 4BQ4A 3BGAA 3S5AA 1ZRDA 3V0BA 2VOKA 1PZ9A 1YIFA 4X6RB 1X50A 4BE3A 2XVGA 5I0SA 4PIXA 3O1RA 2R043 3WNLA 4I30A 1AJKA 1DZRA 2WIIB 4AEDC 5A1AA 1ULGA 4LUMA 3BCWA 4UYBA 1Q8PA 3WP4A 2E33A 2PAEA 5EYYA 5F3EA 4Q0UA 3BOWA 4NOTA 4Z2AA 5E88A 4WV8A 2G9FA 5LEJA 1GYKA 2DTWA 3IAQA 4XCAA 1OPMA 1RXGA 1MZFA 3FHIB 1SBDA 3NV2A 1HJFA 1WCDJ 3K46A 3O5SA 1VBD2 1QWRA 4IGPA 5C3SA 1U5XA 2YV8A 1RJ8A 2W08A 5H9RA 3USSA 4AHYA 4LKDA 3VB9A 1HXS2 3T2QA 2VCBA 4FT8A 1RUE3 1WCQA 1WZXA 3S0MA 5G05L 1LHWA 3KHBA 3JB4C 2E51A 2ZEWA 4IV3A 3ZIWA 1IQDC 3B69A 1RUD3 3JQWA 3JB8A 1DLLA 1LODA 3EQEA 4JDNA 2YGLA 4LBOA 4UF0B 5DQ0A 1Q3EA 3NJVA 2WNVC 4Q4W1 5IVBA 5LY2A 3C3VA 5KHHA 1J59A 1GP5A 4HBNA 4J1XA 4YM0A 2UYAA 1I5PA 1JUIA 1ENSA 4AYUA 4RGGA 5BNPB 4IEZA 3O1MA 1W8OA 3ELNA 3JD71 3PTYA 4QQHA 1FI2A 1MR5A 3VBOC 1ZBA2 2P2KA 1WMXA 2PELA 4ZZ5A 4CCKA 1RUI2 5DAQA 4JKLA 1Y7BA 3T4VA 3NNFA 4CCNA 5JOWA 3WG4A 3IT8A 5DDJ2 2XJTA 2Z69A 2GU9A 4DEQA 3ZN4A 3BTYA 4COVA 1MS8A 4QU1A 5FQ0B 1UIJA 4COYA 3CF6E 4RGKA 3RZGA 2F6BA 3H8XA 4QB6A 1I9RA 1LENA 1XE0A 4BQ3A 2WQ8A 1PGSA 3NNLA 1K45A 2V72A 2HBUA 4WBBA 4Y22B 3THTA 4WM7C 4PI2A 2XXZA 4Y5TA 4FPGA 1UKGA 4JRLA 1OHFA 1ND3C 2Y6GA 5JXIA 5JMOA 3LZZA 4EROA 2P4EA 5F37A 4BLJA 2R16A 4K21A 3O1VA 2P6HA 1RTVA 5EV7A 2X8KA 4Y33A 5LK5A 2GC3A 3W59A 1A6CA 2I74A 2ZTNA 5IVVA 1XJAA 4Q4W3 4B4PA 1W8WA 4XJWA 4XTPA 3I59A 5A32A 3H1MA 2W46A 4BXFA 4K40A 3LD8A 4MOAA 2F17A 3JD73 3MYXA 3IWZA 2DUOA 4KWKA 3EO6A 3LFMA 4W6WA 4F83A 1Y43B 1LOFA 4FPEA 2OUHA 2VG9A 1WA6X 2N7GA 4NHKA 4XF0A 3ZSMA 4LE3A 2J1SA 4L9BA 4LIVA 1F5FA 5T3NA 4BIOA 5KR7A 3ZFGB 4LHLA 1BHGA 4KBZA 1C5IA 4I3GA 3R4UA 2X5IC 3R05A 2HEWF 4XDPA 1D0HA 2WWSA 2I45A 5C70A 3M3OA 3J26N 1ZZ8A 4NPRA 3NJZA 4XABA 2QQJA 4MYEA 3D0SA 2V4AA 4JQRA 3WSOA 5EZWA 2GP5A 4XUNA 5FYVA 4AFBA 1JZ6A 4QX5A 4CE8A 2FZ2A 5A6XA 1XBFA 2W91A 3PUHA 1TME1 4G3YC 2FBEA 2DCYA 3CMGA 2LW8A 2J1EA 1OVPA 2RS51 3ZFFB 2KD7A 1F31A 5LBCA 1JI6A 4E4ZA 1F35A 4LXLA 5CZKA 3T1MA 3PUAA 2V4VA 4G4FA 1L7LA 4LOTA 4PHZA 4XEZA 4CDQA 4WVWA 1Q43A 4AVTA 4QPIB 1PVC2 2XWJB 3HNBM 3LIHA 2HH9A 5K0UB 3VBUC 3ZDVA 1IQAA 1K12A 2J1VA 1SEFA 5JUVA 4YM3A 2JG8A 4LK6A 4LHKA 4RR3A 5FZ1A 2W1QA 4QXKA 5A7SA 3LOBA 2OQ6A 1OLME 2WO1A 2PQSA 2OZ6A 1OFNA 3A0NA 2ZBJA 2YPDA 1RIRA 3K75B 4K1ZA 2WS92 4PJYA 2WL1A 1RUC1 1DGWA 1NA1C 4Q8LA 5AFEA 1OLQA 5FZ8A 4XBQA 3VN4A 1YIPA 2YDEA 1ZBE1 5HV4A 3N4MA 4KNCA 1WW4A 3ZLIA 3AKRA 5FYMA 4DO0A 1OUXA 1IS6A 4CCEA 1FMD2 2ID4A 2BOJA 4JRAA 2W5FA 3KCCA 2DU0A 3I2FA 3RZHA 4XQWA 3BI3A 1IPJA 1UAIA 4K7JA 5L7OB 2TNFA 3M2MA 1SLIA 1C1FA 1TME3 3RYKA 5EP9A 5FZCA 1VB2A 1NAEA 2QNKA 2AEYA 1HDKA 2RS53 3NAPA 3WQ7A 2NN8A 3EB7A 2E7AA 3AJYA 3E97A 4Q0PA 5FZOB 3FHAA 5JMCA 4GH4C 1AX1A 1GZ9A 1RUF1 3VKFC 2Y6HA 1MS1A 3POJA 1D0GA 3ZXGA 2FZ1A 2ZX3A 3ZXJA 4F3JA 1LHNA 5EQUA 4YGDA 4BH9A
chains in the Genus database with same CATH topology
1UPIA 4XQ4A 3VKLA 4ES8A 1AXKA 2DCTA 3HQXA 1JUHA 1FNZA 3FX3A 3MIEA 4HK9A 1X7NA 2HKXA 5E89A 2QZ3A 3UKTA 1D2SA 2ARBA 1HIXA 4XTMA 2ZGSA 4OUMA 3VDDB 1RUC3 3AXEA 2RM22 4TZDA 1DU3D 3DF0A 1F9KA 1ZBE3 2D5HA 3TAYA 1QJX2 2YROA 5HI0A 3JZVA 2A6WA 4AFDA 2UWBA 4ASLA 4XFHA 1BVP1 2HWC2 3N7LA 1WD4A 4RFT0 1APNA 1Z78A 4BMEA 5J3UA 2ZACA 1PGW2 4AVCA 1W6QA 1H9WA 4XFBA 5DZFA 4B4QA 4R4ZA 3VBRA 1DZTA 4P14A 3WUDA 4AHWA 4LUKA 3AP4A 3WR0A 4C90A 5IK8A 2QQPA 1GBGA 1RUF3 4YVSB 1T6GC 4R9BA 4OHVA 1TNRA 1TEIA 3K51A 4GB31 1X33A 1AYN2 4XBNA 1RUH1 2GSYA 3VL9A 2XJRA 3H1YA 4PBPA 1NCRA 3W58A 3WW1A 1QXRA 4FOWA 3VBSA 2GNTA 3T2TA 3VBHA 4YZ2A 4HL0A 3VHNA 1ZM1A 5FLJA 1R091 4CEWB 4JGZB 4MH0E 3AYDA 4UXAA 1AF9A 1N1SA 1WA4A 4GXLA 3MW4A 1D4VB 2P34A 1O7FA 2DFBA 3VL8A 1W6MB 2O1QA 3RSJA 4CDXC 3AX4A 1TMF1 3UV9A 2R6QA 4AVVA 1N47A 3VZOA 3BODA 2NPIA 1ZNPA 5FFOC 5J37A 2AENA 3J8F2 2NM1A 1RUJ1 2HWE2 1REEA 3AYCA 3UL2A 3JBG2 1I1EA 1OA4A 2A3XA 4LE4A 3WHTA 2WQ4A 1AR91 3ST7A 1RHI1 2XG3A 2PQQA 4GB33 1RUH3 2PHFA 1H1IA 4Q4X1 3RYRA 2OIIA 1VR3A 4XF3A 1B35B 1JOJA 3KGLA 1NQDA 4MVTA 4AG4A 3GZTB 3WDUA 2DVBA 5B2GB 1AR71 1R093 2CWSA 1VBC2 1DQ2A 2BNNA 4HKLA 3V64A 1QY4A 2DVAA 3WLUA 5I8YA 1DBNA 1YJKA 4S2FA 2X53S 4P9XA 5SV5A 4AEMA 4YSFA 4GA9A 2BNOA 1TMF3 4YVSC 1OQDA 5JZGC 2R071 4EJRA 4N43C 3ROUA 3AP9A 3FZ3A 2VQAA 5ACA1 1UW8A 2E7TA 3ZDSA 1RUJ3 2ZOEB 3WCSA 1CQ9A 1MEC1 4QPGB 4LO7A 2FMYA 1AR93 4BMBA 4BWOA 1LEDA 2ZGNA 3V0AB 1RHI3 4E4DX 4JGZC 2HWF2 5HCAA 5EWSA 4IV1C 1W6NA 1CVNA 4Q4X3 5CNAA 4N7IA 1DIWA 4LBQA 3SH5A 4PQ9A 1EYBA 5DUUA 4BCUA 1AR73 1H0BA 5JOXA 3H0OA 3AP7A 3THPA 1CN1A 5AC91 4KG8A 3RQ0A 3SXWA 3LSEA 3WDXA 5FPZA 2R073 2QJVA 1ULFA 1PGL2 5HXVA 4RS5A 5ACA3 4RSUA 1LOBA 3B9IA 4LBQD 2VVEA 3P3NA 1MEC3 4R9DA 2IZWA 3MPPG 3FC0A 3CJIC 3WDTA 3B02A 5JOZA 1H8TA 3DKWA 1LJ7A 2P3JA 5GKAC 3MPBA 1S0EA 1D2QA 3FJSA 4FPJA 4LULA 2R32A 2KM2A 3V56A 4JVAA 1XYNA 1RVF2 1XU2A 1W0PA 3M3IA 1N1YA 2QUOA 3AP6A 5BV6A 3J9SA 3SH4A 1EV12 2ZAAA 5AC93 2RE9A 3HIFA 4NHLA 5BNPA 3E5XA 1VRH3 5KHGA 4LLFA 5T5LA 3EXUA 4QPGC 4XF4A 4Y26A 1UU6A 3VKNA 4D7TA 4IEOA 1K5MC 5A3MA 1O4YA 3FFQA 1JYCA 5JPNB 3GZUC 1QMJA 2A71A 2ZZJA 1RINA 5FQ0A 2VPVA 2TEPA 3MFCA 4YG0A 5J7MA 4EN7B 4Q0SA 5JSOA 1NXMA 1MQTB 3PNAA 3S7EA 1ENRA 1XNKA 2Q1MA 2CL2A 5CFDA 1VBD1 2WC2A 5D8AC 3USUB 1UZZA 4MGKE 1HXS1 2RHPA 4AHXA 2EALA 2GH2A 3ILNA 2A6XA 3ZYIB 2ZGTA 2CTVA 4YM1A 1BJQA 4MZUA 1N3QA 3WHUA 1ND2A 3OF1A 4N53B 2C5DA 2PLV3 4BZ4A 5KHIA 3ES1A 1O3QA 4C1XA 4B4RA 1URXA 5F9TA 2GC0A 4JGYB 5CBLA 2AUYA 1QJY2 1ZBA1 3VZKA 1RUI1 4PLNA 1ZRRA 5JSPA 3O0XA 4XOGA 2XL9A 4AI8A 3ZFGA 2WFF2 4QGNA 3MF9A 2EIGA 4DPNA 4Y1ZA 4DQAA 1ZA4A 2GMMA 4QM8A 2VY0A 1N3OA 5L73A 1IKQA 1QH7A 1H4GA 1VBD3 5FDBA 4EWEA 2G9GA 1HXS3 1NCQB 1ZZBA 4GWNA 4WVMB 4TSVA 4KG0A 1V6JA 5L36A 3ZYJB 3RI9A 1FPN2 2GC2A 2B46X 2P3IA 2RMU2 5K7PA 4YLZA 3VKMA 1PK6C 4DRVA 4K9SA 5FREA 2VNOA 4KWJA 1MVEA 5K0UA 1QXPA 2CGPA 1SDWA 1X82A 5A3LA 1NY72 4MUVA 1ULEA 1MQTC 1COV2 1EY2A 3VUOA 1MS3A 1ZBA3 2GC1A 2XVKA 2D5FA 1GQHA 4YZ5A 1OKQA 4MV2A 2WLPA 1DDLA 5GLWA 2DUQA 4YGCA 2OYZA 2OZJA 2VMGA 4YVWA 4S2DA 1QNYA 1QJU1 3AKPA 4C0HA 3ZXDA 3AK0A 1UN1A 2JG8C 1XQNA 3J4UH 4Y20B 5L7OA 4FOYA 4Y5Z0 1DHKB 1BYHA 4JGYC 2A5ZA 5EYXA 4OI1A 1PZ7A 1A8MA 2HWD2 2RS32 1UZYA 1AUYA 1HQNA 1V6OA 2DF7A 4AQSA 4XMAA 2A6YA 1G8WA 3QACA 2PN5A 4DRRA 3G6JB 3NV3A 5F6KA 2EXIA 2Y26A 1PVC1 1REFA 3SLIA 1AXZA 4MSVA 3ZN6B 4FSJA 1Q8QA 2XKPA 3KSCA 4CEYA 4OZXA 4ISRA 5CU1A 4U36A 3VDDA 3WP6A 4AEDB 3SISA 2WJSA 2ZGUA 3I4IA 1X8EA 4W6XA 2WS91 1NCQC 1WW7A 1WMDA 4LA2A 4OHYA 4URTA 3M70A 1Q56A 4YM2A 4JAAA 1QJU3 2Q5TA 5JSRA 1FMD1 4I02A 4K8FA 2H0BA 3RDIA 1LKNA 1XRUA 3WP5A 1D4M1 2P37A 4HANA 1S1AA 1AJOA 3M1HA 3OPZA 4NHMA 3OD0A 2R1BA 4Y1VA 2JEMA 2VGDA 1OQEA 2C9AA 1UL9A 4IEVA 2WNVB 4UBHA 3OBRA 3AKQA 1JH5A 4LBJA 4RQPB 4NVPA 2MHFA 2DYCA 1PVC3 1RITA 3VBOB 2JJ6A 3AMNA 2E63A 2Q0AA 3VHRA 1YFXA 3LA3A 1W39A 3R4SA 4QQPA 3VBRC 2XKOA 5JIAA 4QD2A 4H3WA 5GLZA 4CEWA 2WS93 1FV2A 2CY6A 1OOPC 2RM21 1U5IA 2IXJA 3NWKA 4K1YA 4XXPA 4W65A 4F7ZA 2QVSB 1XNBA 2QCSB 2JDZA 1AR82 1NCRC 3DPRC 1W6MA 4B3NA 1ND3B 3MIBA 3H50A 4CP1A 2HWC1 2D6NA 3PHMA 4XJZA 1D4M3 5JI7A 5BYNA 1PGW1 5I0TA 3WY6A 3H3ZA 4HVOA 1M4WA 2Z42A 2HWB2 4EN6B 1LRHA 4L11A 5GZFA 2ZX0A 4M3CE 3FFZA 1LGNA 3WV6A 5GZCA 2A7AA 1HRV2 1LHVA 4DMIA 2D98A 1V6LA 1AYN1 2NZ9A 1IGOA 4AI2A 4NN0A 2BNMA 3CNAA 4BPZA 3ALQA 1B35A 1AX0A 5C4WA 4CRQA 4P5HA 2OA2A 3POWA 4YZ3A 4L2NA 1DFQA 2FHRA 2X5IB 3TYJA 5FO8B 5F5QA 2RM23 4C1WA 1OFSA 3L2YA 4QQ2A 3NKGA 3KS7A 5C8CC 5L19A 5DUXA 1CAVB 4N9IA 4DXZA 3FLTA 4RQPC 5JLVA 4QT6A 1EAH2 2SLIA 4YG3A 1PO12 1VAVA 2VH9A 2AR6A 3AKTA 4XFGA 5BNOC 3JQXA 3VBFA 5KXEA 5JR7B 3ZSEA 1XYPA 2VMIA 4QQOA 4LLOA 3L9JT 4J6GA 1MZ6A 3JBG1 5A33B 3BU7A 4D7YA 2DFCA 1WW5A 3V0AA 2ES3A 2I2SA 2ZGOA 2ZS6B 3D8CA 3VBUB 4NO4A 1O91A 4P9WA 3ZVXA 1XNDA 1BMV2 3LGRA 4TLFA 5H9QA 1AYN3 1HKDA 1S0DA 2K2SA 2DVFA 4IQPA 2JX9A 2PHUA 3ES4A 3WW3A 5C9AC 3ZO0B 4JV4A 2ZGLA 4GALA 4YRDA 4CTEA 2KXLA 3B00A 4PLMA 1LOEA 1NA1B 3AJZA 3NO8A 2WT1A 2GMPA 1O3RA 3DN7A 1VBE2 1VBC1 1SCSA 1YFWA 3H9AA 2VNRA 1SMVA 3B9CA 5H9PA 1PM7A 4AI1A 2ZKLA 3FUOA 4XF1A 1QOTA 2IXHA 3S6PA 2ZX1A 2Q30A 1GICA 2B5HA 4WM8C 3MIHA 1HRI2 4FXGB 1LR5A 2ENRA 4GH4B 1J58A 4YW4A 3U07A 1O5UA 2OW4A 4FQZA 3O0VA 3JBG3 4XFAA 3NL1A 4L8QA 2ZHNA 2DU1A 4E2QA 4LBKA 2HWF1 1S0CA 5CFCA 1PIV2 4RS5C 2JKBA 1DGWX 1LHUA 4Z92B 5D1IA 4KQ7A 2ZHKA 2Z5WA 1AYM2 2QKDA 2VNGA 5HBAA 3MLLA 4K20A 3H1WA 4HN1A 1O4TA 1H8TC 4QGLA 3KB5A 1VBC3 1FX5A 1YI7A 1YRZA 4Q27A 4JDOA 2B9UA 1WW6A 1VBB2 4AVBA 4WVZA 2QE3A 3B5LB 1YI9A 5T54A 5EJ3A 1YFYA 1NZCA 3JU9A 3ZYPA 1PGL1 1C28A 4LNVA 3WG2A 4FPCA 3VZJA 2R0FA 2NMOA 1KXGA 3ZYRA 1U5YA 3CLPA 1DQ0A 1LECA 3GALA 3RG0A 2UY8A 2I07B 1TE1B 1UMZA 2DCZA 1FAYA 1V6KA 1DQ4A 2YUEA 3M3CA 3USUA 3MI8A 2HWF3 3FBMA 1DGRN 2PHWA 4LO6B 2BVBA 2WZPP 2H0VA 2ZX4A 4CDWC 1LGBA 1MS9A 1XNCA 1RVF1 1W6PA 2Z79A 5T5OA 1MACA 3T1LA 2UYBA 4FXKB 1ZZ7A 4N53A 5ABJA 4OHXA 3PVOA 2CAUA 1EV11 1QDOA 4COZA 4EN8B 4YG6A 4CDXB 3GF6A 4HZFA 4QHBA 4L99A 1C4RA 1AX2A 5DZEA 1SLTA 3NSTA 1GSLA 4AEJA 4FOVA 4BIFA 1O3SA 1OA3A 5FTTC 5J98B 1UF2C 2ZMLA 4JCKA 1QGLA 2EF6A 1RL3A 1ENXA 3LCPA 4DB5A 2WNUA 3N36A 3BALA 1GFF2 4XDQA 4XHXA 4WVMA 2JE9A 3ZSLA 1RVF3 2JG9A 2UY9A 1DYPA 4A2UA 1GQGA 4N9HA 2QZ2A 1RUE2 3HN1A 1EV13 1R082 1PO22 4DINB 5IK5A 1WCSA 3PLQA 1AR62 1IHMA 4XJUA 2R062 5JZGB 3GBWA 4N43B 1O3TA 1QJY1 2GNMA 3PMSA 4IETA 2UURA 4FTEA 3OYWB 1AVBA 3OY8B 2VECA 2QFEA 3SITA 2WFF1 3ZFEB 3RPQA 4R8HA 3RJRA 4AGVA 3H7YA 2OPKA 3HD8B 4MGZE 4QQLA 3I54A 1H2NA 4QU2A 4IV1B 4XIOA 4RGAA 4HETA 2H6CA 2JE7A 2PA7A 2ARXA 1WLCA 1EPWA 4WZCA 1G9DA 3WP3A 1YHFA 1N1VA 1G7YA 5JPMB 4YVWC 1BBT2 4Q29A 2VUJA 3NKTA 4X8PA 2DVDA 2RMU1 3WXPA 4CZSA 2ETEA 1XE7A 1G9FA 1UD1A 3WQ0A 2BFUL 4ISQA 1NY71 4ATFA 3ZN6A 2V09A 3KT1A 3ENRA 1QJY3 2O8OA 1H1MA 4FPFA 4PDWA 4Z8BA 1BCXA 3WT3A 1QJZA 2ZX2A 4XW3A 1W6OB 1PHMA 1UCXA 4XILA 2WFF3 5FPXA 2A6VA 5FLIA 2V73A 3CJIB 3G7DA 5DXDA 2D97A 3PVBB 1DQ6A 3QCWA 2C0ZA 4BM8A 3LA2A 3MGUA 4ORFA 4XF9A 3HWJA 2D6PA 4AW7A 3TWIA 4TWTA 5K9YA 2DWRA 1ULCA 4UW3A 3O12A 2ZGMA 2WNVA 4OLLA 3CU7A 4C0BA 4XFCA 1SLAA 2HWD1 2RMU3 2NQYA 4INDA 2YC0A 4XBLA 5BNQA 3INAA 4EN0A 3WW2A 4L97A 3ZFEC 3TNQA 5KC6A 4P9JA 1JTZX 1K5MB 3WQ1A 4IV3B 3E5UA 3OCPA 1TNFA 4CDUC 1V6IA 2GDFA 3KT7A 1Y9QA 1QDCA 2VW1A 4S2HA 5BNNA 4UW4A 1Z7S2 4IERA 4LBNA 4DY3A 3BPZA 4QM9A 3UKVA 3FBYA 4WM7A 2JICA 1J1LA 2ZABA 1YCIA 1CPMA 5CA6A 3HT2A 1CAWB 1J3PA 5D8AB 3IPVB 1KITA 3IDEA 4EWDA 4PIZA 1FNYA 2MEV1 1C1LA 2R49A 2Y0IA 4OULA 3NW4A 1ZZ6A 2BGCA 1A3KA 3AKSA 2IXIA 2IXKA 2D3SA 1NOVA 1CAXB 5I91A 4FPYA 2HWD3 1YNAA 5GM0A 4I0AA 2WSUA 1I5ZA 4PF5A 2RS52 2D6KA 2ILMA 1ZREA 2D44A 3ILFA 3R0RA 1OPOA 2QDNA 3S30A 5F1RA 1WMEA 3BTAA 4I3PA 2VOWA 2WNEA 3D0JA 3TOJA 4M0NA 1IS3A 2X5IA 5A32B 2H6BA 4A7KA 2P17A 4HKWA 5C6CA 4B29A 3M8LA 2WA4A 1LOCA 4BYYA 1PVXA 2PAMA 1ZVFA 2A73B 1CAVA 5C4WC 4IL7A 3MW2A 2XB6C 2BW8A 3VZMA 2MEV3 3SCFA 1U5ZA 1KQRA 4AVSA 2YZ4A 2E9QA 4D69A 4HVRA 4IV3C 4PIYA 5KXBA 3GBFA 3KD4A 2HWB1 4I0BA 1PK6B 1QXJA 1RUOA 5A33A 2JENA 4ZU4A 2WSVA 1VALA 4LBMA 4AWDA 4DS0A 1WD3A 5KBFA 5CVRA 5HCBA 1HRV1 3ACLA 4F8AA 2WKKA 2XVLA 2ZMKA 4Y22A 5KXDA 3U10A 3PVEA 4DOUA 3RMYA 3VBFC 4D3WA 2IXCA 5C8WA 4HT1T 1CX4A 1Q8SA 1NA1A 3V65A 3RMXA 1NLSA 4R4XA 1LOGA 4GKYA 1V70A 1KJLA 4OUSA 2XJUA 2JG8B 3KM5A 3KGZA 3NV1A 1OD5A 2QDRA 1RGSA 4KL1A 1AHSA 1ONAA 1HX6A 1VJ2A 1PO11 5DZGA 1OA2A 2MPFA 3AB0A 4XFFA 2FQPA 5EXOA 1AZDA 3O14A 1PMIA 1UKRA 4GH4A 2RJLA 2HWB3 2ZAHA 1YO8A 2BQPA 4E2SA 5DDJ1 4IEUA 4Y1YA 2VVFA 3RZZA 4AFAA 5GLTA 5CAZA 2ZGKA 3O7OA 3RS6A 3GBGA 1WBLA 3ZXFA 1HRV3 1BMV1 1RMU2 4FPKA 1Q5OA 4ZU7A 1LOFC 2WZR2 1BVVA 3KMHA 3KT4A 4HVQA 2GAUA 1SLBA 3MICA 1S0BA 4OI2A 4V1PA 4BQ1A 2CWMA 4GB32 3S7IA 4LEJA 2CYFA 3ZFFA 4P9YA 4H7MA 1VBE1 3IIAA 2LM3A 5CFCC 4LBLA 4XXAA 1SBFA 4O9GA 2DCKA 3RYPA 3JUUA 4QPIA 4Q1PA 1R092 1ZX5A 4E9KA 2RS12 3MLKA 1J1TA 4HK8A 2VW0A 1PO13 2XGXA 1KJRA 2ZHMA 4D7SA 2E7QA 1Q8OA 3H3UA 2ZA9A 1RUI3 3K48A 1HRI1 5DDJ3 2A3WA 3AMMA 2K9ZA 4CDQC 4H55A 1LHOA 1GZCA 3ETQA 4KBBA 1PIV1 1NG0A 4LO8A 1G9CA 2A70A 5GLVA 1HV1A 3VBRB 4ES9A 3AXDA 4RR3C 4HPKB 3SNMA 3VV1A 5DUWA 1OOPB 1YXWA 2RJKA 1QQP2 1A78A 4IEQA 1VBE3 2B45X 1LEMA 4I01A 1NCRB 3DPRB 4Y1UA 4ZU5A 3AMPA 1RC6A 1VBB1 1UIKA 4HMZA 3D4KA 3OJBA 2YMZA 3E6DA 3GNEA 5BXXA 3QH6A 4Q4V2 5ABJC 3R4DB 3TN92 2BVVA 3NAPC 5GLUA 4IEWA 4GULA 1HRI3 1JW6A 3FLRA 1CD3G 2VU9A 4YW1A 5J48A 4M3CF 4XJ8A 2EAKA 5T5JA 3ZIXA 3CO2A 5JDBA 4LTAA 1FOD2 1PIV3 3TB0A 1I6XA 3LAGA 1G9BA 3DL3A 4JC1A 2XJSA 5J96B 2XJQA 3KLSA 3E6CC 5CG8A 3WNXA 2ZKNA 1CAUB 1Z0HA 5CB7A 1Y3TA 3ZMOA 4HN0A 4IEPA 4CP0A 5C8CB 3WDWA 3WUCA 2WNUC 4XYXA 1GLHA 4YVSA 3H7JA 2GNDA 5JZGA 4N43A 4Q4Y2 4BA6A 4OI4A 2JG9C 2YHJA 3ZPYA 5BNOB 1YWKA 3OYWA 3ZYGA 1VRH2 2X29A 4NWVA 2VOVA 5FBZA 1W0OA 2AH2A 1ZRFA 4JGZA 5EFUA 1V00A 1KS5A 5SV8A 1HV0A 1LTEA 2EXHA 2ZCWA 3QBQA 3KQRA 1CPNA 5C9AB 5CG9A 3VHPA 1QJX1 1FMD3 1VAKA 4BLIA 4NR1A 5GJ6A 3VBSC 3VBHC 4FPHA 2A75A 5KHJA 1OLRA 4M3CB 5FOJB 3LKJA 1V6MA 4RHV2 3P3PA 1M06G 3B7MA 1R081 1PO21 2VMHA 3OGJA 1GZWB 4Q1RA 1AR61 2AYHA 2XBO2 2LTNA 2R061 4AK3A 1SACA 2D3PA 1CIWA 5H9SA 1WLDA 4MX3A 4WM8B 2PLV2 2XLAA 3D6EA 4JTOA 1W6OA 1S0IA 2LALA 1SBEA 2W68A 1WUVA 2HEVF 3CJIA 1DQ1A 2GN7A 3VHOA 4L92A 2VQ0A 1EPZA 3PVNA 3QD6A 2V5YA 4MXWB 4A3XA 4B4PA 3BOPA 1QF3A 1BEV2 1XE8A 4PDWC 4PBOA 2GMEA 2A6ZA 4RS5B 1UU4A 4UW6A 4BHPA 2VOXA 4EWAA 4E27A 5I0RA 3POSA 5LRRA 5J36A 4LO5B 1QJX3 3LWCA 4SLIA 3B93A 1V9U2 2XH6A 2HWC3 1R1A2 1H8TB 1BBT1 3MFAA 1UPSA 4IESA 2ET1A 4YFZA 4FP2A 1IOAA 3ZXKA 1QOSA 3J8F1 2ZHLA 3ATGA 1RUG2 2HWE1 5FO7B 5JAXA 4QPGA 2D93A 1R083 4YZ4A 3AM2A 1PO23 4FTSA 4PLOA 1K5MA 4AI0A 4OFGA 1AR63 1VP6A 5E1RA 4Z07A 3ILRA 4XZPA 2R063 2MNGA 1E57A 2ZMNA 1UU5A 5GZEA 5T52A 2D40A 4XJ9A 1U0AA 1H2MA 1BKZA 1BQPA 4UBGA 1CAWA 3WDVA 2PHDA 3RI8A 1FT9A 2XJVA 3ZN5A 5D8AA 4FP3A 4HFSA 2C1FA 2D7FA 3IPVA 2F4PA 3LB9A 3CJXA 2PFWA 5BNNC 3AYEA 3ME2A 4CDWB 4B7KA 1JHNA 2XWBB 2JECA 2PHTA 4FQ4A 1CAXA 4B8EA 1BBT3 4Z2WA 1HW5A 5CFDB 3HBZA 3URFA 3RNSA 1S0FA 1GNHA 3J8F3 2HWE3 4TYSA 3B01A 1MVQA 4ONUA 1O5LA 2EAAA 1RB8G 2RR12 2NP0A 1ND2B 2GALA 3IN9A 2DUPA 1VAMA 1FYUA 1Z7S1 4YW5A 2XHKA 1KS4A 5I8TA 4GKXA 1G86A 5LRSA 2AREA 3QLQA 5GZGA 4OI0A 1ZZ9A 3IDCB 1H2KA 2FMDA 5C33A 2CAVA 5BY5A 2Q4SA 2XUMA 4XHBA 1AL22 5JI9A 3X29B 1CR7A 4A7YA 4AGGA 5LEKA 5KWRA 1QJU2 3H8UA 3WD5A 1FATA 1PK6A 3DGTA 1SCRA 4FAGA 1C8M2 1ZZCA 1FV3A 4S2GA 2B42B 1LULA 2Q1ZB 1MQTA 3FMGA 3ZSJA 3IM0A 5BNPC 1J3QA 3OD4A 1VBA2 3MF6A 2XLFA 1N3PA 1PNFA 1IKPA 5FAXA 1RJ7A 4JDMA 5I0UA 4X8NA 2WINB 2JXAA 2CNAA 2AGSA 1Z7S3 2ZGPA 3EJKA 1GNZA 2BWCA 2YGMA 2CGOA 1EP0A 1F5JA 2W39A 2ZPXA 5CFDC 4Z82A 3KCXA 1CGPA 1NXD1 1IS5A 2PTMA 4E2GA 1DZQA 4HLTA 4IEYA 4IXLA 4JGYA 3AZWA 4H7LA 3A0KA 4YVWB 2BBVA 1UX6A 2WT0A 5DG1A 5KXCA 1WGPA 3AZYA 1ASJ2 3VZLA 1KRIA 1ND2C 1VB4A 3APBA 1KDKA 1D4M2 4YFWA 4ASMB 4QMAA 4XFIA 1WLTA 3SH3A 2ZGQA 1PNGA 4ATEA 2R042 4U2AA 1L3JA 1QHDA 5JVVA 2Q8OA 4COWA 5BPXA 4XE9A 5F6LB 1NCQA 2UWCA 1RUNA 3ZFGC 3BB6A 3N7MA 1NE6A 3W9AA 1NQJA 3AP5A 2D6MA 4O9EA 3ZXAC 5K8SA 1G6NA 1POV0 3VKOA 1U12A 2IC1A 3ZSKA 2R30A 4W6YA 1JBCA 4CEYB 5TSWA 3AYAA 1N1TA 1O4ZA 3VLBB 5KC5A 5JCTA 3AZVA 1OSGA 1RUD2 1NLRA 3MW3A 3ECQA 3U11A 3ZFFC 1LU2A 4R9AA 4I09A 3GZAA 2B39A 1H8VA 2DVGA 1W2UA 2IWGB 3B94A 4Q0VA 1SFYA 1MS4A 2HJIA 4SBVA 5FMOL 4QPIC 4KWLA 1IPKA 5K0UC 4QGMA 4AQ6A 1RMU1 2VUAA 2XJPA 4CDUB 4HPKA 2TUNA 4LHNA 4Y20A 4N7UA 2WZR1 3OGGA 3PJQA 5DUVA 2WA3A 3IDBB 1OOPA 1CONA 3TBDA 3QOPA 4P9GA 1LESA 2NMNA 1SFNA 1MS5A 3DPRA 4AE2A 1ZRCA 4JTNA 1XYOA 1R1ZA 1FPN1 4ZKTB 3EHKA 3NVCA 2OUJA 4I2OA 2DCJA 5L7OC 2LUWA 2RS11 2BUKA 2EVXA 5J09A 1VLNA 1COV1 4Q4W2 2D3RA 3LSDA 1GV9A 4AEDA 4Q0QA 1ALYA 3OTFA 4OHZA 2PAKA 1F8VA 3JD72 3LOIA 3U4XA 3V0BB 2ATFA 1DYKA 3UJQA 1XU1A 5JWPA 1RMU3 4M01A 5AVPA 4CEYC 2WZR3 5FLHA 3VDDC 3HR9A 1CAUA 1BK1A 2BTVC 2YPJA 4AXOA 4CP2A 5IUQA 3N7JA 2Z2SB 5AVAA 5C8CA 3SCHA 3WZ1A 5I93A 4M00A 4LT5A 3AFKA 1SLLA 1QQP1 2A3YA 1MZ5A 5C4WB 4RQPA 1FPN3 2RS31 3GHNA 4WVVA 2NLRA 1H9PA 3DV8A 2WQZC 3VBOA 2BPA2 4DNYA 1S0JA 2VW2A 1IS4A 2RS13 5BNOA 1C57A 1DGR