1KS5A

Structure of aspergillus niger endoglucanase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
QTMCSQYDSASSPPYSVNQNLWGEYQGTGSQCVYVDKLSSSGASWHTEWTWSGGEGTVKSYSNSGVTFNKKLVSDVSSIPTSVEWKQDNTNVNADVAYDLFTAANVDHATSSGDYELMIWLARYGNIQPIGKQIATATVGGKSWEVWYGSTTQAGAEQRTYSFVSESPINSYSGDINAFFSYLTQNQGFPASSQYLINLQFGTEAFTGGPATFTVDNWTASVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the structure of an endoglucanase from Aspergillus niger and its mode of inhibition by palladium chloride.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Endoglucanase A
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ks5A00
4NPRA 1AXKA 1HIXA 3AKSA 2DFCA 3WP4A 3B5LB 1BK1A 1H4HA 3AKRA 5HXVA 4S2GA 4H7MA 2D98A 1XYOA 1OLQA 4XQDA 4S2HA 1BCXA 3O7OA 1BVVA 1HV0A 1REFA 2DCZA 2BVVA 3EXUA 4S2FA 3WXPA 1XNDA 1UU5A 3HD8B 3WQ1A 1QH6A 2JICA 1REEA 2JENA 3RI9A 1XYPA 3AKTA 3WP3A 1KS4A 3MFCA 3VHNA 3WY6A 4XPVA 3WT3A 3WR0A 3AKPA 2B45X 2VGDA 4HKWA 3VLBB 4XQWA 1REDA 3VHPA 3VZKA 1C5HA 3AKQA 1H4GA 4HKOA 4S2DA 3VZMA 3VHOA 1T6GC 3MF9A 2D97A 2DCKA 3WX5A 2NLRA 2VG9A 2BW8A 5K9YA 3MFAA 3LB9A 1UU4A 3VZJA 1XNCA 2VUJA 3LGRA 3WQ0A 2B46X 3WP6A 3AMMA 1M4WA 1XNBA 1KS5A 3WP5A 1XXNA 1OA2A 4XQ4A 3VGIA 3AMNA 2VULA 1XNKA 3VZLA 1QH7A 1HV1A 2F6BA 3B7MA 3AMPA 2NQYA 3M4FA 1H1AA 1C5IA 1ENXA 2QZ2A 1XYNA 1OLRA 1OA3A 1NLRA 3AMQA 2DFBA 1UKRA 1TE1B 2DCJA 4IXLA 3VL8A 1UU6A 1W2UA 2JEMA 3MF6A 1F5JA 3WQ7A 1OA4A 2QZ3A 2BWCA 2B42B 2Z79A 2C1FA 5EJ3A 1YNAA 4HK8A 3VZNA 1H8VA 3RI8A 4HKLA 2DCYA 1PVXA 1IGOA 3VL9A 3AMHA 5K7PA 2BWAA 1H0BA 3VZOA 3ZSEA 4HK9A
chains in the Genus database with same CATH superfamily
3JBG3 3GZAA 4LO5B 2Y60A 4AVSA 2WA4A 5BXXA 2EIEA 4BQ2A 3ZFFC 2RS51 4HSLA 5C33A 1DIWA 3B5LB 3B69A 2PXJA 3HBZA 3DPRB 4RHV1 4Z82A 5DG2A 3WUCA 1PM7A 5JOZA 1AR61 3J7HA 3AZWA 1IZ3A 1YLLA 1IOAA 1BVP1 4G4FA 3WCSA 2OIIA 2QQMA 2LALA 4GJYA 4MGIE 1JUIA 4ZONA 2YMZA 4X6RB 4YW6A 5J98B 4RGGA 5LRSA 2BUKA 1REFA 1FOD2 1WCSA 4UFMA 4K20A 1RUC3 5C4WA 4DXZA 1ULEA 1X9TA 3HAGA 4LHSA 3L2HA 3GBWA 2YFUA 3BODA 4LJHA 4YW1A 1K12A 1OD3A 1RUI2 1RIRA 1O4YA 3MIHA 2Y38A 3NNJA 3AJZA 1CAUB 2WNVC 2VVDA 5J96B 1W6NB 1Z7S3 3VHNA 4BE3A 4YWAA 5BNQA 5LA0A 2IXLA 5FMOL 3GJAA 2K2SA 1ASJ2 4FPGA 4OMCA 2NZ9A 1W8WA 3ETQA 5FJHA 4FBFA 3Q8CA 2QUOA 2JE7A 2E63A 1PM4A 5CFDA 3VKLA 3GHNA 1OXCA 3AC0A 4OHZA 4OZOA 3S30A 2P3JA 2WQ8A 1A78A 2ET7A 3B3QE 1S1AA 4Q4W2 3WQBA 5C3PA 1SFYA 3CLPA 2J1TA 1DZTA 5CISA 2PMWB 1S0FA 5AC91 3L9JT 4R9CA 5JVVA 5DDJ1 4NRMA 5L19A 3LAGA 3PIGA 4ZU7A 3LB9A 4ASKA 3OBTA 1DLLA 1UX7A 4ES8A 3KWVA 4URTA 2CV6A 2OZ6A 1PX3A 2CGOA 1W2OA 4QXCA 1YQCA 2DBNA 5IVBA 1OLME 1AR93 1ULOA 3VKMA 3ITQA 4QX5A 5LB6A 4LEJA 3BYWA 5L9RA 3B7MA 4NIHA 3T2TA 2GMEA 5DQ0A 3VBSA 5AC93 2FDFA 3ST7A 4DXTA 1QQP1 1OHFA 1W2NA 1RUF3 1MZ5A 2BJSA 2B4KA 3H7YA 2B9VA 3NAPB 3VBFB 2QQUA 5I8SA 5A3WA 4HT1T 3N35A 2AACA 1MVEA 3AMQA 1OQ1A 1PO23 1KXGA 3WNKA 1JYTA 3MYXA 3OBRA 3ZFGC 4KU8A 3WQ7A 5BV6A 1RUF2 2QZ3A 3TN91 3MBWA 3WNPA 5ISLA 3H3UA 4HPKA 4IEXA 2MEV2 3N9PA 1RTVA 1V6IA 4HSJA 1LOFA 3RI8A 2L9LA 4XABA 5CNAA 4E27A 3ZN6A 1DZRA 3LIGA 4FAGA 5A1AA 1ZRRA 5G04L 3JQXA 4AEJA 4BK4A 1LEDA 3POSA 5K7PA 1VRBA 2EXIA 3C2UA 2ZOEB 5FZ6A 4XC9A 5SV5A 1MS8A 2R1BA 5LASA 1JYVA 2QQOA 4Y1XA 2VZOA 3D0SA 3FUOA 4R9BA 1XQNA 1RUI3 2I45A 2VBDA 3DKQA 3EO6A 3KF5A 4K21A 4MXWA 4UFIA 4YGDA 5E1RA 3RYRA 3O1MA 5KHIA 1HRI1 3OPTA 5L9VA 4H7MA 2CHHA 3DKWA 4PLMA 5IVFA 5FZEA 3UT0A 1H1IA 1OH4A 3POYA 3WDYA 1KFUL 1BLZA 5GLWA 4UW5A 4Q0SA 4N7UA 3X29B 3ACLA 2LROA 2YYOA 3S6PA 3DPRA 2AUYA 3EXUA 1DDLA 2VCMA 2JDYA 4MO3M 1WMEA 5KR7A 2RS11 1IS6A 1UOFA 2UYAA 2DTYA 2ZX0A 3ATGA 5IAXA 4IW3A 3VD4A 3MZHA 4LITA 5FOBB 4Q4X1 3NJVA 4A3ZA 1PVC3 2D40A 2VAUA 4QU2A 1QH6A 3IN9A 4IE0A 1EYBA 1RUD1 3CJIC 4CCJA 5FZOB 4L92A 2VQTA 3WP3A 1VBD3 2WIIB 4PI2A 5F3CA 2R041 4GWJA 1AJKA 4LK7A 1QOSA 3NAPC 4QB2A 1HJGA 1E5RA 3WW1A 3DYOA 1BYHA 3ZYBA 4BK5A 2YC4A 1Z7S1 3WR0A 3H1WA 2DUPA 3EQEA 1WA4A 1VBC3 4Y20A 4B4RA 2XKPA 5IAVA 2FHRA 4GAZA 4AWDA 1K5MA 3LA2A 1YEWA 4AGVA 1FMD2 2Q4SA 3AVRA 1NCRA 3JD73 4GH4A 4LE3A 4LHNA 2EIDA 1NUKA 2FMDA 1RUH3 2LS6A 3MHZA 2Z69A 4NAOA 4CCCA 4QX1A 3TAYA 4FPEA 3ZIWA 3PUHA 1W9SA 4LNVA 4CDQB 4M3CF 3MFAA 5A3OA 3O1PA 3LEKA 5F9TA 3FFQA 1H2LA 3DCQA 3GDBA 5HCFA 3SCGA 3WDVA 1POV1 4LOTA 1W04A 1LHOA 3ZN6B 4EN9B 2B46X 2VJXA 4GB32 1RVF3 1E57A 2RS33 3SEEA 4HVQA 4MH0E 2A70A 1F15A 5A3MA 5ACA1 1KS5A 1LEMA 1HB2A 1STMA 2AH2A 3WP5A 4BLIA 2GP3A 1JZ5A 2SLIA 4D7SA 4K8RB 4FOYA 1MQTC 5F3IA 1CVNA 1F2NA 2WO3A 2ZKLA 4WVZA 5C8CC 1O4TA 3KT1A 3MICA 2NMOA 3HT1A 1EUUA 2JX9A 1YHFA 3POBA 3ZN4A 1XSQA 4YVSA 2PHTA 1V0AA 3G6JB 3N9QA 2TUNA 2VQUA 1ENXA 4GKYA 3AP5A 4QPWA 1Q8SA 2RM23 3UKVA 3OGGA 1BEV2 2ZAAA 3PUAA 1OA3A 1XNTA 4BISA 1ZRFA 1VBA3 3IIIA 4K1ZA 3AL6A 3VL8A 5A6XA 1IG3A 4LIUA 3FC0A 3OGVA 4J25A 3HN3A 3LD8A 2RS12 1HXS1 4ORFA 5BNPC 1VPHA 1OI6A 3M3CA 4P14A 1NCQA 3ETPA 2ZEZA 3M3OA 1YQ2A 4LR4A 3VL9A 5FO9B 1H6YA 2RMU1 2VZQA 1CIWA 2JG8C 2XBO2 4L2NA 4A45A 4RGAA 5LBEA 2BFUL 4M4RA 1AYN3 2GZWA 2W46A 1MR5A 4I0AA 5FPXA 4LQRA 2RHPA 2C24A 4AHZA 3T0DA 1HRV2 4WZCA 1AXKA 5CG9A 2XXZA 5FYIA 1O8PA 4Y22A 3D6EA 4QWNA 3NKTA 2VMFA 2QQPA 3WP4A 2RR12 2BP6A 2HEWF 3U4XA 3V0BA 1WCUA 1F9KA 5BNNC 3OEAA 2FDGA 2W1QA 3BTZA 4R4ZA 5T55A 3FZ3A 3QACA 4O7XA 2JDMA 5EJ1B 1VAMA 3WNLA 2ZMKA 4BA6A 1JYIA 2A3XA 2VOTA 5CADA 1R1A1 4S2FA 4RFRB 4QMAA 3KQRA 2HEVF 4CXYA 2JIJA 3KT7A 4A7ZA 1ND2B 3QCWA 2XH6A 2RR13 5FMOS 1FPN3 2P3IA 2YBPA 3PUSA 5L73A 3T30A 4CSWA 5JCTA 1LENA 2RE9A 1CQ9A 2GMPA 4LORA 4MADA 4YGBA 2DVAA 1C1LA 4QKFA 4CCKA 1G9FA 3DECA 1OOPC 5CA6A 2DTWA 4MGYE 3C7HA 4HETA 3KCCA 5FZLA 2C5DA 1C28A 1VBC2 2E53A 2J22A 5BY5A 1TNFA 2XWJB 4HOOA 3TBDA 1HQNA 4XZPA 1NCQC 3T3YA 1OVSA 3ZDVA 2GC3A 3LA3A 5HCBA 2NYYA 3C8XA 4UFKA 3OG2A 1U12A 1VBD2 3NJYA 2BTVC 5FY4A 1U5IA 4NIAA 3N9OA 4MVTA 4QX7A 1GWKA 5HCHA 4FTSA 3DL3A 2X29A 2C9KA 2DVFA 3V56A 3I2KA 4CCEA 3JB4C 4YG6A 2GNMA 1RVF1 2RS31 5EXOA 2GN3A 1T6BX 1CZVA 3CHXA 3OGJA 4XXPA 1POV3 5E16A 3I3MA 1WLTA 2W92A 2P3YA 2VMCA 2ZJCA 3KM5A 4AG4A 3RQ0A 1JZ8A 3H1MA 3ZFEB 5LRRA 1KITA 1C1FA 4QX8A 5H9RA 5A80A 4FT8A 5H9QA 2JG8B 1UX6A 4FPKA 3W5NA 3PTRB 1V6OA 4R4XA 4D7TA 4RL7A 2CGPA 1ASJ1 1COV2 3N4MA 4E9KA 4IQPA 4QPYA 5H9SA 1G6NA 4E4SA 4GB33 1UZWA 3LEGA 2ETEA 5AVPA 1B35B 1KJRA 1SACA 5FPUA 3OBZA 3BVCA 3PVNA 5GJ6A 4AI2A 1NLRA 3FJSA 2ADEA 2WFPA 5C4WC 2QE3A 1IKQA 1US2A 2DVDA 2WNEA 2OYZA 4XBQA 1W8NA 2VMHA 4XFHA 1IS4A 4LA3A 5BNOC 1ZZCA 4IE6A 3ZSKA 1PVC1 1QXPA 1F4HA 2XJQA 5FZFA 1V00A 4AEDB 5CKQA 4YG0A 2R6QA 2ENRA 4F83A 3T4VA 3WHTA 4AEDC 1H0BA 4C0HA 4XUTA 1TZOA 3PIJA 1POQA 4WM8B 4EYUA 1LGBA 2BOJA 4YYOA 5GM0A 4BM8A 5CG8A 4AHYA 1U0AA 1JHJA 4Q4W1 1NY72 4MGSA 1X8EA 1T2XA 2WZEA 5EHDA 5CYYA 2YBSA 4M0NA 2HWE1 3GF6A 5HV0A 1QJEA 1AXYA 4MGKE 2C9AA 5L7OB 4XQDA 3ZMOA 1H6XA 4AGRA 1GKBA 5IK4A 1CPMA 1VBB2 4CXWA 4DB5A 4YW5A 1ENRA 2ZMLA 4K9SA 4N8MA 4AYUA 3VBOA 2PTMA 1BVVA 1V9U1 2JDUA 2QQKA 4LLFA 4P9LA 4RGKA 3KD4A 3MV01 1XNDA 1YCIA 3U4SA 5I0UA 3PNAA 3V65A 4A2UA 2KR2A 5DZEA 1W6OB 1QMJA 3BOWA 4YM1A 2KXLA 2F4PA 2HLEA 1HX6A 3HD8B 1HQWA 3ZFEA 4FP2A 5FWJA 2OVUA 2QVSB 1K5JA 2E33A 2P3KA 5JOXA 2GDFA 1JU3A 4N53B 4TTGA 4OUEA 1REEA 1SZBA 2LRPA 4WM7A 2O0OA 1JW6A 3TN93 2W3JA 3W58A 4FTEA 2ZBJA 4L99A 4P5HA 1X33A 2BNOA 2FCTA 4L0PA 3WF1A 2CNAA 2JJ6A 5T5LA 1J58A 3B00A 2BBAA 2YBKA 3CO2A 3RYPA 2FCUA 4QPGA 3MW4A 4N43B 3AKQA 1RUF1 2WT2A 3NNGA 4KBBA 2RJKA 1TVGA 4FOWA 2E7TA 1W6NA 4I3PA 4CRQA 1PK6B 2MNGA 3SISA 1AR91 3AYCA 4EWAA 3O1OA 4GIQA 5FYUA 2PAMA 4JDMA 3M1HA 5FJKA 5JPNB 1GLHA 4FPHA 3K3NA 4AGGA 3WNXA 3AX4A 3U10A 1MEC2 4J6GA 4JX0A 3VZJA 5JXHA 4NPMA 1OUSA 1NXD1 1SBEA 2AGSA 1APNA 4WM8A 1K3IA 1ZA4A 1JYWA 2D6NA 3KVBA 4QHBA 1WMXA 3RG0A 3VGIA 1RUJ2 3MPPG 4LBOA 2Q1ZB 3AMNA 5FFOC 4Z8BA 1LB2A 2E7AA 3N36A 3HOBA 4JVAA 2XJSA 1HV1A 3ZYGA 4PDWC 1UZZA 2RS52 1Q5OA 3DXTA 5FYYA 1YIPA 4CPBD 2WO2A 1GFF2 1URXA 1ENSA 2VNGA 3R4UA 5JR2A 3WDWA 5CEHA 1KD7A 2XHKA 3HQRA 5A7OA 5L7OA 2QQNA 2BDRA 3IDAA 4FO9A 5IVCA 4QGNA 2R0FA 1OD5A 4RS5A 5FP8A 2DFBA 1VBE3 5FY7A 1BXHA 1KFXL 3ZPYA 2MPFA 2WR9A 2UWAA 3CEWA 1OF3A 2QKDA 4CUCA 4YRDA 1RXGA 4AAXA 2Q8DA 4V2VA 4E4HA 4M3CB 2EXHA 2YU1A 4JHZA 3NV3A 3ROUA 1IQAA 1RC6A 1X36A 3KS7A 5I0TA 1JN2P 1OURA 3EMRA 1EPZA 1C4RA 3LKJA 1WZXA 2X05A 1QGLA 4Q5OA 4IE5A 4XAEA 5LBFA 2EALA 3LPGA 5IVYA 4E2GA 4E8CA 1GYKA 3VBFC 4P00B 1XE8A 2ATFA 2R073 4P9JA 5LA9A 4OYUA 5FREA 1YYNA 2XJPA 3GZTB 2PAKA 1YFYA 4LA2A 4PIYA 1WD4A 3H3LA 2A71A 1BK1A 4XAAA 1WBFA 4JKKA 5ANNA 4OLLA 4UOJA 3R6SA 2UWBA 1O4ZA 4XVHA 1AHSA 2B7YA 2Z42A 3RZGA 1AL0G 4XILA 1MACA 4QXBA 1GWMA 1BCXA 1CAWA 1D2QA 1UY2A 5D8AB 1A3KA 4RQPC 1VBB3 5J09A 3ZXEA 2G9ZA 2W1UA 5JXGA 2YC2A 1Q3EA 3NO8A 1BKZA 4RD7A 1OUXA 3W9AA 3K46A 1GSLA 5C5TA 3AXEA 2RM21 2EAAA 1CWPA 4DUVA 1E5SA 4FP3A 1XU1A 2H6CA 2HJIA 2RMU2 5EZWA 3H42B 2PHLA 5J3UA 4MXWB 2WS93 1I6XA 4NRPA 3AKTA 1NOVA 4ITCA 4R52A 4B7KA 4YZ5A 4YM3A 1KS4A 4RYDA 5KHJA 2VO5A 4DOUA 5FY8A 2R061 4MV2A 3JCIA 2W08A 4DS0A 4PIZA 1X50A 2DCTA 3A23A 3BOPA 4IEWA 1QQP2 1REDA 3VHPA 5C70A 3POGA 5FPLA 3LFMA 2ES3A 3KHBA 1W6QA 4HFSA 3VZMA 4DEVA 4QQPA 2D97A 4QM8A 3WZ1A 2HWF3 2G4IA 2VCBA 1G9AA 4Q4Y2 5CKMA 5FLHA 1P8JA 1OPOA 1PIV2 2Y0OA 3ACIA 3VBSC 1R1A2 1LOGA 1C8M2 1QJZA 1YIFA 4JGYB 3WNOA 2PYTA 2VTFA 5FXXA 3ZOIA 4PLNA 3I2OA 3IDEA 2HH9A 3FFZA 2HBUA 3LSEA 4WVWA 3VKOA 2ZCWA 4KWJA 5F6LB 1LHNA 2AR6A 5CFDB 3ZXKA 2P37A 1NKGA 2DVBA 2VULA 3PVBB 5FZDA 2D6PA 2WINB 3VZLA 2ZGTA 4DRVA 1WCKA 1D0HA 5T5JA 2UU8A 4QX3A 3N7LA 3WW4A 1CJPA 3ABZA 2YGMA 3JD71 5A6YA 2WLQA 5LW9A 4QT6A 4EN7B 2IXHA 2Y33A 4GMP0 4FOVA 1GZWB 2VMEA 4N53A 3SHRA 5H9PA 1G86A 3QBQA 4IV1B 1N1TA 1BBT3 1AYM3 3ELNA 1GP5A 4QKNA 4K8FA 5LY1A 2R043 4F8AA 3NAPA 4XF9A 3OD4A 4KL1A 3E6BA 2CDOA 1W2UA 5EPAA 1Y4WA 3VD9A 4AF9A 1Q8VA 3CJIB 4IEVA 5A3LA 4INDA 2WJSA 2ZGPA 2DF7A 2QNKA 4XFIA 2ZX2A 3NVCA 4FPFA 5KWRA 4NHXA 4IERA 2VU9A 4QXKA 2HWE3 1ZA7A 3THDA 1HRI3 1NQJA 3AZVA 3N3HA 3C3VA 5GLVA 1RUJ3 1JXNA 2GH2A 3R0RA 3R4SA 4LHLA 3H8XA 1KGYA 5J36A 4FVVA 5JPMB 1ONAA 1VBA2 3ASIA 2R042 3H8UA 5FZ1A 5A7NA 1HB3A 1BEV3 4JHTA 4B1MA 3ZPOA 4BJ0A 1JODA 1DCSA 1GBGA 4RR3A 3ZR6A 4BOWA 3WF0A 1W8OA 3VHRA 4DQAA 3FHAA 3ILFA 2D5HA 4LBMA 5D8AA 4ARYA 4DY3A 1QDOA 4LBQA 1H2MA 3O14A 3I2DA 4XF0A 4C0BA 1XYOA 3ECQA 2A7AA 3V64A 2BPA2 3DYMA 3O5SA 4BHPA 3BU7A 4BQ4A 4TZDA 1BQPA 4Q0UA 5BYNA 4QQ2A 3GALA 2DCZA 5FZ8A 4BQ5A 4OFGA 1NA1A 4UF0A 4J1XA 4DFSA 1AX2A 2WAOA 1N1SA 2HEYF 4IGQA 1DGWA 3FWEA 3NWKA 4PQ9A 2P4EA 1QJX3 4UYBA 1C8M3 1VE0A 2WC2A 1JOJA 3HIFA 1JYXA 1SFPA 4HN1A 4LBLA 4UBGA 4B4PA 2G9FA 3NNLA 3RI9A 3ZYHA 2WZPP 2X53S 1RUD3 3P1IA 2QTWB 2Q1MA 5FUNA 1RUH2 1XOYA 2OUHA 4XUOA 2R30A 1LU1A 3U75A 4OHWA 4M3CA 3U07A 3W21A 5F2SA 5A7PA 3ZXAC 3A4UA 3VZKA 4BB3A 3THPA 1QQP3 3GBFA 3FBYA 4AAPA 1SCRA 2EXKA 2HWE2 5GZGA 2BBVA 5JOYA 1ZZ8A 2EIGA 4CEWB 4RR3B 3OJBA 4LPLA 2UURA 3HEIA 1GOFA 3IPVA 3ZDSA 1CAXA 3MLJA 1CIYA 1HKDA 3UJOA 5DABA 5FZOA 1IQDC 1VALA 1ZBE2 5G05L 3O0WA 3D82A 2D6MA 2EVXA 3S5QA 4ZU4A 3GBGA 4MZUA 5K0UB 4GJZA 1JZ6A 1YRZA 3VDAA 1AYM2 1GZ9A 3USUB 1RUOA 5A1LA 1JMUB 1CAUA 1H30A 4LK6A 3J4UH 3M7AA 3PMEA 3VBRC 3VD3A 1VAKA 5KXEA 2ZGOA 1J59A 5C3SA 1H8TC 3J8F1 4IESA 1YFWA 1ULGA 4JGZC 4UXAA 3BIEA 5JLVA 3SEPA 4QX0A 1LTEA 2QJVA 2V72A 1AR81 3BI3A 4XUNA 1WW7A 1UD1A 3FN9A 4W65A 3RVHA 1GMMA 2WNUA 4N90A 2RR11 3LEIA 4CCLA 1QF3A 1J1LA 3NV4A 3IT8A 1FOD1 1D4M2 1R081 1W06A 3H0OA 4FPJA 4QHOA 3SC7X 3RZKA 2FZ2A 2R072 3HWJA 4DY5A 3IDCB 4CUAA 3EBRA 1QOOA 1GZCA 4HONA 4PQQA 2VE1A 3SCHA 4N43C 2XLFA 1PX4A 2Z79A 4Q4Y3 4Y4RA 4AVTA 2VL4A 2CWSA 2GNBA 4IV3C 1K45A 3ILRA 2ZX4A 1H8VA 2OA2A 3OF1A 4IV3B 1SG3A 3CIHA 4HKLA 3WW2A 1LKNA 5JDBA 1F8VA 1I5PA 1W2TA 1XE0A 1YI7A 1HJFA 2C6SA 2O8OA 4NHMA 4E4ZA 4FTBA 5FK8A 3CJIA 1AR72 3C7OA 4OI1A 4CCOA 3SLIA 3VBUB 4C8DA 4Z92B 3VZOA 5I91A 3GJBA 1KDKA 1NQDA 3OYWB 5FQ0B 4DEQA 2W9XA 3N9MA 2DUQA 3TRSB 5JMOA 3AK0A 3ZXJA 5ERLA 1YFUA 1WW4A 4WVMA 5EQUA 3ZFFB 4A41A 3AVSA 5AC92 1H4HA 1OC1A 2GC0A 1O3SA 1S0GA 4AEDA 4B8EA 5BNOB 3T4HB 2D3SA 3HNYM 3ZLIA 4CEYC 4EWDA 1DQ5A 2WSVA 3BPSA 4ZXEA 5DZFA 2ZXQA 5CFCA 3N7MA 2VY0A 5F3GA 1WD3A 4COYA 1CGPA 4Z2AA 1AL21 4XFCA 4RR3C 2OUJA 3ZSMA 4P08A 5GALA 4O9GA 2AZ5A 2TNFA 3ZXDA 1C3HA 2ARXA 4GULA 5F5AA 4DXRA 1QIQA 2OX0A 2YHJA 1LODA 5FRAA 3C7GA 1JUHA 1BK0A 1ODMA 2GNDA 5FMDA 3TNQA 1NA1B 5EFUA 5FPZA 2JENA 4CTEA 1HXS2 1HN1A 1CONA 1TG7A 2RJLA 3L2YA 4GA9A 3VB9A 4LXLA 4XHXA 1SBFA 1UF2C 2UYBA 2WN3A 2PA7A 3JUUA 3PMSA 4MGZE 4YZ4A 2ZACA 5HV4A 4KWKA 5B4NA 3FUQA 3O1VA 1CN1A 3RMYA 1J3PA 4B4QA 2VGDA 1H8TB 1LHUA 5DUUA 4KG0A 4JQRA 2WFF1 4YFWA 3OY8A 2YDEA 5JSOA 2YG0A 1R64A 4S2DA 2Q8OA 1LOCA 2W87A 2RDNA 5C9AC 3HNMA 4LKDA 2G19A 1TME1 1L3JA 2HWB1 3KCYA 2MHFA 5HBAA 4ATFA 1S4CA 2RDRA 4XXAA 3IKWA 3WF2A 2PELA 1NG0A 1XRUA 1X9PA 2WZR2 1W0PA 4NIIA 2Y6JA 2ZGNA 2WNVB 2PQSA 2GN7A 1QU0A 1UXXX 2VNRA 3MW2A 3O1TA 1GOHA 1RHI2 3AMMA 5DXDA 1M4WA 1MVQA 1UOBA 2PLV3 1O8SA 5FYHA 4FFIA 4ZY9A 1S0BA 5A3TA 3I2GA 2NP0A 1XNKA 1A8MA 1XNAA 3ZIXA 2XBO3 4AQ6A 2C26A 2D6KA 2F6BA 1PGL2 1Y9GA 3SMHA 2O1QA 4BIFA 4GH4C 2ZGQA 4RHV2 4XFAA 4WM8C 5LA2A 1GR3A 1YQ8A 3GYDA 4CCDA 5IVEA 1WBLA 2VZSA 2XQRA 3Q9OA 1JOPA 4XCBA 1OFNA 4GALA 2RDSA 2RM22 2ZAHA 3K4ZA 1UKRA 1TE1B 3WDXA 2D6LX 5LK7B 5ANQA 2PFWA 4UF0B 5LBCA 4IUGA 1WGPA 3OOXA 1OKQA 4A4AA 2V4VA 2Y6FA 4DMIA 1N1VA 2XUEA 2GC1A 2G1MA 2ZHMA 2PHXA 4D6RA 2DCYA 1UY0A 1FATA 5FZMA 2TBVA 1QJU3 2E51A 3AMHA 2CGNA 2VQAA 3U14A 5HXMA 3O0VA 1ZZ6A 3OEBA 1QOTA 3TEYA 4AI9A 1RVF2 2LW8A 1UPIA 2RS32 3LSDA 2OPWA 2CL2A 3KGZA 1W3XA 4NPRA 1FV3A 4PI0A 1GQPA 1UYZA 4YZ1A 4Y24A 2D3PA 1FV2A 3LFIA 3JU9A 3SH4A 5DAQA 4XCAA 4AEMA 1OFSA 1VLNA 3VBUA 4GMP3 2PHWA 1OF4A 3T0AA 1UY4A 1N3PA 1VB2A 3DF0A 5LWBA 3P3NA 2C4XA 4KG8A 4CEYA 2HWF2 3E5QA 1SEFA 4HG6B 5APAA 3NKGA 4AOCA 2WO1A 4UAPA 1D4VB 4IGOA 3GNEA 5FY1A 1D7PM 3D0JA 4Q8LA 3LE0A 3UV9A 1SLAA 4NR1A 5KHGA 5A1FA 1JHNA 1VRH3 4PJYA 3LDRA 1IS3A 3BPZA 5FKBA 2D93A 4LBQB 5LATA 4YGCA 1RHI1 4BMBA 1U5ZA 2ZPXA 2IXIA 4WZFA 2V09A 3SH5A 1W8UA 5I8YA 5FP3A 1JZ7A 2F17A 2HKXA 3IMNA 4IE4A 3RZMA 4CDUA 4AEKA 4EZ4A 3LDBA 4IV3A 1PGL1 3M3IA 1EV12 4CP0A 3WINE 5FZ7A 1SDWA 2ZEXA 1XB9A 4JQTA 4XJUA 2DU0A 4YM0A 4CU6A 2VOWA 1UZ0A 5JIAA 4D6SA 2JXAA 4PCRA 2CAUA 4E2QA 3EJKA 5CIRA 3GZEA 2XR4A 4JGYA 4OUSA 5C71A 3C7EA 1JZ2A 1G9DA 1LAJA 1ZREA 2EA7A 4KNCA 2MEV1 4Y3OA 4K40A 2W0XA 3NNFA 2H0BA 4PF1A 3HQUA 5IK5A 4OQ8A 3IAQA 4CDWA 4WVVA 4LKFA 3I54A 4I0BA 4QKBA 1GP6A 2ARAA 2XHNA 3FLRA 1SLCA 2YPJA 3NQHA 3BB6A 1UYXA 4Q4V2 5FOJB 4XQ4A 1CX1A 5TSWA 1BMV1 4KU7A 1QJU2 1UOGA 1VB4A 2W52A 4LBKA 4P5YA 4TSVA 1H9WA 4EWEA 4NPLA 1FNYA 3K77A 1ND3B 2J7MA 1N47A 1V6MA 2WNOA 1ND3C 5K0UA 3T0BA 2E7QA 3DN7A 2JDHA 5KHKA 2NQYA 4LMFA 4CDQC 2W95A 1H1AA 1YUDA 5F32A 4Q0VA 3IM0A 4Z2WA 1OLRA 2A5ZA 2R16A 4AZZA 4D69A 4MG2A 3NJZA 1DYOA 4U36A 3VD5A 2NM1A 5FZ4A 4EQVA 4OI2A 1LECA 1LGCA 1W9YA 3I7DA 3K75B 4ES9A 5C7GA 1W6MA 4QXHA 2R0HA 4I3GA 4AVCA 4Y22B 3J7NA 3I59B 4H3WA 2ADDA 2YY1A 4FPOB 3VZNA 2PQQA 4ISQA 4CCMA 5F8PA 1MS4A 5A3NA 2NMNA 1UYPA 3B9CA 4Q27A 4EN8B 2A1XA 1DP0A 1ZZBA 3OPZA 4Q0QA 2QFEA 2VD7A 2VTXJ 5B4XA 2ZX1A 1CZSA 1Q43A 1OOPA 1KJLA 1WW6A 4SLIA 2QDRA 4HVRA 1YC61 2R062 2WNVA 3BUCA 2FD8A 2B8MA 2WYFA 3ZXFA 4DUXA 4D94A 1UCXA 3TWIA 3PUQA 4QQOA 3HQXA 4JTOA 1FMD1 1MPXA 2OPKA 3TEXA 4S2GA 1RUG2 5CFCB 1SLLA 2VCAA 2JKBA 5FMCA 1AYM1 2ZGLA 4KWLA 4HN0A 4RQPA 1XC6A 4CUGA 2HWD2 1W8ZA 5JUVA 3VDDB 1JI6A 4XJZA 1E5HA 4EROA 2JG8A 4K1YA 5LA1A 2VM9A 4FPLA 5BNNA 5FWEA 3APBA 4JRLA 2JDAA 3PURA 1POV0 1AR82 3AZXA 4MHUA 2RV9A 4N9IA 3WQ1A 4BXSV 5J48A 4D8MA 4OI0A 1XYPA 4GD4A 2Q0AA 1RGSA 4ZHNA 3AM2A 3POWA 1ZZ9A 3N7JA 4XHBA 2BQPA 4LBNA 3UL2A 4BU2A 2ZGUA 1B35A 3CJXA 5T54A 1Q8PA 2BYVE 2YROA 1OOPB 2P5BA 3AKPA 4ISRA 4JKLA 4XW3A 2X8KA 3H50A 3NNMA 3PLQA 2WWSA 3JZVA 3TEWA 1S0JA 2IWGB 4IETA 1W99A 4Q1PA 1FI2A 2ZZQA 3RPQA 1UQXA 1S0DA 2D5FA 2XJTA 4IEQA 4YVSC 5FZHA 4EV0A 1RUNA 3OUHA 3E5XA 4CEWC 2A6WA 3AL5A 4N7IA 4YZ2A 4Q0PA 1RUE3 1N3OA 2K9ZA 1ND2C 2Y6LA 1AZDA 1LGNA 4LOSA 2HWC1 1VAVA 4XBNA 2R32A 4D3WA 4IDZA 4O61A 2GH8A 1VR3A 4AQSA 4OHVA 1LCLA 3N9NA 4Z07A 4BWOA 3ZMNA 1RUE2 1XNCA 5F1RA 1SLIA 4MXVA 1Z78A 5I93A 2I74A 4QPIC 4E8DA 2IC1A 5KXBA 3UGHA 3K3OA 4ZS3A 4JKMA 4K3UA 1VBA1 4CP9B 3POJA 2Y34A 1OH3A 2A6YA 1NCQB 3EYPA 2KM2A 2HYKA 1W8FA 1VJ2A 1CX4A 5T50A 2P34A 3M8LA 3B9IA 1DFQA 2WWUA 5I0RA 4R8HA 2VH9A 1VBB1 1BJQA 2HWC3 2V4AA 2V5YA 1BZWA 2WDBA 3GXUA 3D8CA 3R05A 2W2IA 4J1WA 3VBRA 5JWPA 3CU7A 3OSDA 1KEXA 4KWUA 3RMXA 5FZ3A 4AXOA 1RUG1 1UKGA 1V6KA 2GALA 1LOEA 2W68A 3I2IA 2JKXA 5FBZA 3ZN5A 3BU0A 5JZGA 5FXWA 2PHDA 2FDJA 3MLLA 4M4PA 3CZJA 4IXLA 1DBNA 4WM7B 1UU6A 2HWD1 1UW8A 2HYXA 3ILNA 3MF6A 4XMIA 2OQ6A 3DXUA 3S7EA 5ABJB 4JGZB 4BDVB 5EJ3A 3TEZA 1YNAA 1G7YA 2X5IC 1W28A 2AEYA 2ZA9A 5A3PA 5DAWA 3TYJA 1JU4A 4YARA 1RUG3 2B5HA 4OMDA 1IHMA 2VNOA 2WZ8A 3DGTA 2BWAA 2DWRA 5E6HA 2VTXA 3DYPA 1VBE2 5HI0A 4PBOA 4BYYA 3MIEA 1QNWA 2VZVA 1RUH1 4HXCA 5EYXA 5A32A 5IJRA 2ET1A 5FYTA 2DUOA 2R063 2PN5A 3WG4A 1R091 3B93A 2DFCA 2ZZJA 4GWIA 2Q1FA 4OVEA 3WLUA 4JRAA 4UW3A 1VBC1 5FYBA 5ACA2 1HDKA 1HN0A 2Y6GA 1CR7A 3JXSA 4XIOA 1Y9MA 5FLIA 2RVAA 5DDJ2 4DUWA 2NPIA 1H1MA 2D98A 1NZCA 5DAPA 3NW4A 4YVWA 2ZHLA 1DYKA 2AENA 5DPNA 1TMF3 2J42A 4ZKTB 3QLQA 4LBJA 3IZOA 5DG1A 3WUDA 2UWCA 4G9SB 3T2OA 4FPCA 2FZ1A 4XOGA 1NE6A 1IS5A 5GZCA 2W94A 3AP6A 4P9WA 2AC1A 5FCCA 4DINB 2ZX3A 2BERA 1AX1A 1BBT2 4BLJA 2JB8A 1AVBA 2E9QA 1DQ0A 4UFHA 5AFEA 2ID4A 3W59A 1WW5A 2VQ0A 5JXIA 1ZBA1 1ND3A 1QJX2 2OXBA 3FHQA 3HMYA 4XPVA 3WF4A 5C6CA 5K0UC 3S0MA 5EV7A 4EE2A 5FPVA 4AVBA 5IVJA 1MQTA 4KGQA 4XQWA 1A8DA 1W90A 5GZEA 1W39A 1H4GA 3U78A 2VR4A 3USSA 1H8TA 1S55A 2CWMA 2NN8A 2X5IA 4FSJA 3VHOA 2XKOA 1T6GC 2V5DA 5JZGB 5AFBA 1QY4A 2EICA 3UKTA 2I07B 4AFMA 1WCDJ 2WUHA 1R083 2BW8A 4Y1ZA 5FZKA 4AFAA 1RMU2 2VVEA 3ME2A 3ACFA 1WLDA 2BNMA 1YJLA 4NUBA 1O59A 1PIV3 5LEJA 1PZ9A 1UU4A 2Z2SB 5IWFA 2XVKA 3KGLA 4XFBA 4M0HA 4CU7A 5A32B 1RUC2 1HRV3 2WYSA 1FOD3 1WLWA 5GKAC 3VKFC 4CXXA 4YGEA 1DG6A 1FMD3 4EJRA 1K5MC 1W9WA 2LUWA 3WD5A 2EIBA 5LEKA 1OPMA 1PO21 1W6PB 4HVOA 1HRI2 4HZFA 2CAVA 3NV2A 4QPGC 3J7MA 5FYSA 3I2FA 5FIXA 5CZKA 1LULA 3O1UA 5A33B 4BH9A 2E32A 3M4FA 1NZIA 3E5UA 1YFXA 1MS5A 2ZEWA 3BTYA 4IEYA 2XL9A 5GZDA 4TYSA 1LRHA 3MPBA 4D7YA 4XUQA 1GZWA 2VOVA 2ZGKA 1ULCA 3POIA 2Q8EA 4XFGA 2W5FA 2D43A 4R9DA 1NA1C 5FPAA 1RITA 3WDTA 3MGUA 4Q4W3 5I8TA 4QDQA 2ARBA 2BRTA 5JOWA 1PHMA 5FDBA 5SV8A 1IGOA 1W9FA 2XOMA 3OUIA 4IE7A 3WW3A 2XPJA 1YQ6A 1EV11 3AB0A 2ZKNA 2RG4A 2PHFA 4XE9A 4XJ9A 1EPWA 1IG0A 5FZIA 5J7MA 1GUIA 4NROA 4KMQA 2VOKA 1X8MA 3IPVB 1W6OA 1DGRN 4IV1A 3K2OA 4AK3A 3DPRC 2XVLA 1NT0A 3ZKYA 2IFWA 4QDSA 1CD3G 3ZSLA 1PO13 1PK6A 3BTAA 1MZ6A 3KSCA 1C8M1 4YVWC 1UO9A 4Y33A 4RFT0 3T09A 4A7YA 1OLQA 2ZS6B 2Y8KA 3VV1A 4NOTA 1UPSA 3BN6A 4C91A 1ZRDA 4YLZA 2MEV3 1HV0A 5DMYA 4CU9A 1GNHA 3RZJA 1EV13 3LPFA 4XDOA 2AYHA 4XDPA 3T1MA 1RUC1 1L7LA 1PK6C 3ALQA 1DQ1A 3PJQA 4IEOA 1PO12 1OVPA 1KDMA 4HPKB 5LBBA 3VDCA 3ZFFA 1RUJ1 4P9GA 4UI9L 4L97A 1U5YA 1WA6X 2W1SA 3KMHA 4U2AA 3KV6A 4HL0A 5FXZA 1PVC2 1D0GA 3MEPA 4ZPIA 3ZXLA 3WV6A 1BEV1 3V0AA 1I5ZA 3ZYPA 2B45X 2QQIA 4FOQA 1IPJA 1LESA 5C8WA 1S2KA 1XPWA 3N7KA 4DXSA 4Q8KA 3RGBA 2PLV2 4COZA 1RHI3 3I2HA 4H14A 5BNPA 1XSRA 5KC5A 3SNMA 2A6VA 5IT6A 1S0IA 5EJZB 1VRH1 2PAEA 4DNYA 4N43A 1I3HA 4NRQA 4AI3A 1TMF1 4K6BA 3O1RA 4RS5C 2YPDA 5FMBA 4LO7A 3ZM8A 1OKOA 4CP2A 1S0CA 2Y0IA 3IDBB 1GNYA 1Y3TA 4L11A 1Z0HA 1VMHA 3RWNA 3ZFGB 1Q8QA 2V73A 4URAA 3H8OA 3PUIA 5GLTA 3VBHC 1F5FA 3FLPA 4PF5A 3OY8B 3SCFA 4A6SA 2EAKA 5A33A 4AHXA 4BCUA 5CFDC 3B94A 3K51A 3BTXA 1S0EA 2XGXA 3E6CC 1ASJ3 1ZNPA 5C5UA 4XZUG 4CVUA 4CDWB 5DN2A 4FQ4A 1H2NA 5C3OA 1MS1A 1FXZA 3OD0A 3OPWA 1QJFA 4Y1YA 4YW3A 2UY9A 4W6XA 1DZQA 5KBFA 4QAWA 4PHZA 3I3QA 3H8RA 4CP1A 2R49A 4NHLA 3KVAA 1WCQA 4CDUC 4COUA 2VXJA 1RMU3 2ZHKA 3S5AA 2WFF2 5A70A 1JH5A 3LQCA 4RHV3 4LIVA 4C1WA 3Q8EA 4H55A 1UL9A 5JMCA 5FO7B 3HPNA 4D6QA 5IHRA 1UZYA 1UIKA 3PVOA 2XUMA 4XJWA 1DGRA 4ZU5A 3VD7A 4E2SA 3RZHA 1AR92 1CAVA 3ACGA 4EN6B 3O1SA 1AXZA 2WS91 2B9UA 4ZS2A 3LOIA 3Q8BA 3SH3A 2WZR1 2VCCA 2ZMNA 1Y7BA 1W6MB 1W0NA 3UESA 2CY6A 1LHWA 3P6BA 1W2AX 4IV1C 2FQPA 5DAVA 1SDDB 5DZGA 5F5QA 2A3WA 4BQWA 4I2OA 1HXS3 1PMIA 3AKSA 1SQ4A 1NXMA 2XL7A 4CU8A 2CTVA 2CYFA 1ULPA 2PLV1 4QGLA 4NIGA 5I0DA 4KI5M 4CDXC 2DV9A 1RJ8A 2FBEA 5EYYA 4HMZA 5BNPB 1HLCA 1ZYBA 5IW0A 1J84A 4LE4A 1SFNA 2VMIA 4TLFA 3IAPA 3T08A 1ZRCA 1G9BA 4M01A 2OT7A 1TMF2 1U5XA 3Q8FA 5HPOA 2BVVA 1O6UA 2A3YA 3WXPA 3VDDC 5F7UA 5IFTA 2WN2A 3AYEA 3G7DA 2WO7A 4NAMA 2C0ZA 3VBFA 4ET7A 4BQXA 3WNMA 4AR2A 4AQ2A 1WWYA 5JR7B 3LF7A 4AFCA 5ACA3 2JICA 5ABJC 3A7QA 1BMV2 4QKDA 2KA3A 1JOBA 2WSUA 2BZDA 3WY6A 4XMAA 2VBBA 2IXJA 3KZ4C 2R071 2VZ3A 4OULA 3JD72 2D44A 3GGLA 2D6OX 2SBAA 3B01A 2JG9A 1DQ6A 3KV9A 4GWMA 3URFA 3T2PA 3MLKA 5I0SA 3AJYA 4TWTA 3DEMA 3HJRA 2GSYA 5FO8B 1QEXA 2BFUS 2DURA 2BGOA 2VZPA 4XEZA 2DBIA 1SLTA 2OW4A 4JZRA 2WT1A 4BPZA 1UZVA 2ARCA 4I09A 4X6QB 3RJ2X 2BGPA 4AFDA 1AR83 3BGAA 1VBE1 2VZ1A 3MIGA 2VUAA 4OHXA 4YW4A 2XMLA 5FP9A 5FZGA 2PHUA 4OQ9A 4CDUB 5C8CA 4NWVA 3JBG2 1GU3A 5JAXA 5K8SA 5FUPA 1ZM1A 4AQTA 5FYCA 2QQVA 1R092 3J8F3 5T52A 3WP6A 1HB1A 2DVGA 3I8TA 3THTA 3SKVA 5JI9A 3WSOA 3ZYIB 3D3AA 4JDNA 1ND2A 1OLMA 1YWKA 3AZZA 2QQLA 4DPNA 2ZGMA 3WVJA 4TLGA 2J1SA 3HR9A 4RA0A 4XJAA 3RRDA 1W9TA 1V6NA 4BIOA 5A6ZA 4Q29A 1SCSA 2CSGA 3U1XA 4FFFA 2BU9A 1C5IA 3AYDA 5KXDA 3VN4A 2ERFA 2XJUA 1QXJA 1VMJA 5M0TA 5CBLA 3PTYA 5DUWA 3WHUA 4ZZ8A 1MS0A 4ATEA 1NCRC 1CPNA 4UFJA 4NO4A 1GP4A 4YNIA 1D4M3 1NCRB 5EWSA 2JEMA 5BUVA 1JZ3A 1F5JA 1RUI1 2J1RA 2JG9C 3D5OA 3A21A 1CAVB 1VIWB 4X8PA 4QM9A 1C57A 2BVBA 1LJ7A 5KHHA 5A7QA 1ZBA2 2JDNA 2DYCA 4BQ3A 2X10A 2VOXA 1ALYA 5J1XA 1GZTA 1ENQA 4FXGB 4JC1A 4DRRA 1B35C 3POEA 1VP6A 4Y5Z0 1PO22 2EF6A 4GZ9A 2JD9A 1L7QA 4LLOA 4N9HA 2LTNA 4XFFA 4F3JA 2FCVA 3ORJA 1A6CA 4GB31 5FKCA 2J1VA 2VZTA 5FZ9A 1W05A 3EHKA 4Q1RA 4CZSA 3HN1A 5FR3A 1DQ2A 3IWZA 2XB6C 4NN0A 4BQ1A 1JTZX 2A6ZA 3B02A 3LEMA 3MI8A 4UBHA 4LO8A 5AVAA 2P6CA 2WWJA 3GCXA 3ENRA 2ZABA 4GH4B 4O65A 3P3PA 3POFA 2RS13 3VBUC 2YGLA 1PMHX 4YVSB 1JBCA 3MUZ1 4IEZA 4P9XA 4C90A 4LO4B 1B09A 2WRAA 5F6KA 4A44A 2Z5WA 3ZFGA 4NIDA 4YW2A 1LR5A 2E31A 2W1WA 4Z1VA 4A7KA 3RSJA 2P6HA 3H7JA 3MDPA 5LK5A 3I49A 1W03A 4FFGA 1UMIA 4XF4A 3CQOA 1AUYA 5FTTC 2G9GA 1O3RA 1HQLA 1ZX5A 4MSVA 3USUA 5J37A 3WT3A 3IBMA 4IL7A 4AW7A 1L7RA 5L7OC 2ZTNA 4RN5A 2WBKA 2ORXA 1UNBA 2GMMA 1RJ7A 2VZRA 4PT6A 4CDQA 4H7LA 1O3TA 1HRV1 2YFZA 5JZGC 1X7NA 5HCAA 2ILMA 1NX9A 2Z4FA 3KLSA 2X5IB 1OQEA 1NAEA 4ZXKA 1DQ4A 3WX5A 3NSTA 2XQXA 4KBZA 4LKSA 3PL0A 2D7FA 4N53C 4GWNA 1NLSA 3CDZB 3V0BB 2FDKA 4HBNA 4LUMA 1F4AA 4UWDA 3JQWA 1UY3A 2Q5TA 5FYMA 2VVFA 3R4DB 1PNFA 1EAH1 3K4DA 2Y26A 3D4KA 3OUJA 5F5CA 4ARXA 3I3EA 3LGRA 4ONUA 4E4DX 1QXRA 1W6QB 4TN7A 1EP0A 3O12A 1GOGA 5IYYA 5E88A 1AR71 2VPVA 3OB8A 2JIGA 1DLCA 5FYVA 1XXNA 1AYN2 3RWKX 5T5OA 2VW2A 3WNNA 2VZUA 2GC2A 3ZSJA 5A7SA 3VDBA 1QH7A 1WLCA 2YV8A 4MUVA 1ZBA3 2JD4A 2IXCA 4D0QA 2TEPA 2YC0A 3U37A 3NMBA 1F35A 3PU3A 3MIDA 4EZHA 4MYEA 1WMFA 1PGW1 4SBVA 2E6VA 1HB4A 4ASLA 3U0ZA 1W0OA 2DCJA 1GQGA 4QGMA 4XJ8A 1VRH2 4META 3FX3A 4I01A 1OA4A 2B42B 1ZRIA 2C1FA 4Y20B 3ZYFA 1OQDA 2VBPA 2XDVA 2IXKA 4HK8A 2R7EB 5L9BA 1AJOA 4QU1A 5FY0A 4ASMB 4FCAA 2YB7A 3ACHA 1O5UA 3QH7A 4Y5SA 4CEYB 2EXJA 1BBT1 3DUIA 1PNGA 1RL3A 2E26A 5LCWL 3IIAA 2W47A 3LCPA 1LOBA 3KV4A 4YM2A 1N3QA 3N9LA 2CU5A 1UYYA 2QBXA 1KQRA 1R093 3BCWA 5LY2A 1W8TA 2IFRA 2O14A 5FUIA 1AX0A 4FFHA 4RSUA 3H1YA 1EUTA 1GV9A 1PIV1 3AKRA 3RYKA 4YW7A 5HXVA 3QH6A 1UWWA 3MIFA 3SXWA 3UK9A 4XYXA 1HW5A 4B1LA 1GICA 4XTMA 5CAZA 2RDQA 5F37A 1ZZ7A 4S2HA 3AXDA 1PMJX 2P2KA 1RMU1 4QB6A 2CDPA 2GU9A 3A0KA 1SLBA 1W8HA 1QJU1 3RJRA 2VC9A 1J1TA 1MZFA 4NHYA 3WF3A 3FLTA 4X8NA 3NJXA 3NV1A 3CMGA 1AR63 2W91A 2IUWA 4XACA 3ES1A 4XDQA 1AYN1 1J3RA 2WS92 1JS9A 1UMZA 3OBAA 2QCSB 3MV11 3QOPA 5IATA 3FMGA 2RS53 3PJYA 1J83A 4EN0A 4HANA 2IZWA 1FYUA 3ON7A 3O0XA 4HKWA 5IK8A 1K5MB 4L9BA 1DGWX 5D21A 4JGZA 3LIHA 5FAXA 3VUOA 3QD6A 3J26N 4DO0A 1TQ5A 4RQPB 1S2BA 1YQ5A 2YU2A 2GAUA 3INAA 1M06G 4YG3A 1K42A 3MF9A 1H9PA 4NHKA 1NY71 4XTPA 3W20A 2VG9A 2KD7A 2XBO1 4GXLA 5CKNA 2WZR3 4AHWA 1Y9QA 5A6QA 4M00A 2WQ4A 1D2SA 4JDOA 3MIBA 1O7FA 4PBPA 4M3CE 1ULFA 2VUJA 4Q4X2 4MGQA 4PIXA 4QX2A 4Y1VA 4MGTA 3IB3A 4MOAA 4WBBA 4CE8A 1DF0A 1XNBA 3GZUC 3NL1A 5IVVA 1CAXB 4OUMA 5FZAA 5CU1A 3PU8A 4YVWB 4CPBA 4CDWC 5C9AA 3A0NA 1DYPA 1NE4A 1V70A 3GCWA 1VMFA 2WT0A 3AP4A 2JDKA 4P9IA 1Z7S2 3UJQA 3CZUA 4QPIA 3VBHA 4JGYC 4KGGA 4Q2FA 1IPKA 2WFF3 1XYNA 4GKXA 3VBSB 2BGCA 1AR62 3I3BA 4LULA 2WAAA 1MEC3 2Y64A 3PVEA 1F31A 2BEOA 5FP7A 4JCKA 4Q4Y1 3RS6A 2H6BA 3MO4A 3AP7A 1AR73 3Q8AA 2JB4A 5DUVA 3UKNA 1DU3D 2YUEA 5F39A 3KQ4B 5T3NA 1EAH3 1QWRA 4KH9A 2JE8A 1C8NA 1PO11 1SMVA 2FMYA 4QQLA 5FYZA 4JV4A 1XJAA 3HVDA 3ZVXA 4CP9A 1YI9A 2OZJA 1Q56A 5ABJA 2A6XA 2D3RA 4NWWA 5D8AC 4OI4A 4YFZA 1LHVA 1YXWA 4HK9A 4LKEA 4NJ4A 1O91A 4IEUA 3RZZA 4Q4X3 2A73B 3C7FA 1SBDA 3NRUA 3OGRA 4XBLA 3FE5A 4V1PA 1VBD1 4MHRA 4FXKB 2YXSA 5IUQA 1PZ8A 2HWC2 3VBOC 1QDCA 1RYYA 2UY8A 3ZYJB 3M70A 3IMMA 3VBOB 2BOIA 3MUY1 2XONA 4RS5B 3BIWE 1MQTB 5DAXA 2IVJA 1WMDA 4CDXB 4XURA 1RUE1 3H3ZA 1EY2A 4QD2A 3OYWA 5FQ0A 2W39A 3CL1A 1FAYA 5A7WB 4IGPA 3WOGA 2O8QA 3J8F2 4XUPA 2AREA 2OKXA 3VKNA 2Q30A 3M2MA 1IPSA 5DDJ3 5FP4A 3U11A 1CZTA 1CESA 2JDPA 1IKPA 1QJY1 3TN92 5JXJA 1COV1 4MLOA 3DV8A 3AZYA 1G8WA 2ZHNA 5JSPA 5LZ6A 1GWLA 2OS2A 3BKZA 2Y6KA 4HLTA 3WG2A 4NE9A 3E97A 3J9SA 1W6PA 2VXRA 1QNYA 4I0WB 4Y5TA 3VBHB 3VLBB 1UIJA 2IVIB 3F95A 1H2KA 1RINA 4B29A 1S2EA 1DHKB 1FX5A 1QKQA 4HKOA 3RZLA 1PGSA 4LO6B 4QQHA 4UT5A 4Y4YA 5D2AA 5D1IA 1OMIA 1ACCA 2BNNA 5T5PA 3UETA 5KC6A 3UYJA 2DCKA 2NLRA 1W3VA 4QDRA 5EP9A 5F2WA 5K9YA 1UN1A 1Y43B 2WL1A 3HNBM 2VUDA 1V9U3 1ZBE3 2ZGRA 5K4LA 3I2JA 3AP9A 3W5MA 3HBKA 3WEZA 2B39A 3I97A 3M3QA 3FHIB 1JYNA 2XLGA 3WQ0A 1RB8G 5FPBA 5L36A 1CJDA 3GHMA 5FLJA 4CEWA 3WCRA 2WNUC 4FPYA 5DUXA 3UNPA 1COV3 2PHRA 2WNUB 3I59A 3A22A 1OA2A 4QPIB 1UMHA 4DZGA 1FNZA 2XLAA 4H2AA 4R9AA 4W6YA 5FZCA 4P9YA 3M3EA 2AEZA 1J3QA 2A75A 2RJ2A 2DU1A 1Q8OA 1NYWA 1OSGA 4AFBA 5C8CB 4A3XA 1SPPB 1X82A 5IFPA 2OQ7A 1RUD2 3E1F1 2HBTA 1RXFA 4XIKA 3SKJE 3ZR5A 2ORZA 3ZO0B 5BPXA 3SQOA 1LU2A 1AL22 4F7ZA 1WUVA 3I4IA 1FPN2 3KV5A 4BZ4A 2JDZA 4K7JA 3KCXA 4WV8A 4QB1A 4FQZA 1TNRA 1FT9A 4LUKA 1LOAA 1ZBE1 3KB5A 1LNSA 2R1DA 4LTAA 1OBNA 3KT4A 4XF1A 4BXFA 2FDHA 4Y1UA 2DDUA 2Q8CA 5BNNB 1EAH2 3V0AB 4YZ3A 5FY9A 5C3QA 1QJX1 2J1EA 3UGGA 5CFCC 1PVXA 2F4LA 1QJY2 1V6JA 1R1ZA 2I2SA 2WLPA 5JI7A 2QQJA 1BHGA 5FV3A 3ZX7A 4L8QA 4AI0A 3TNPB 5KXCA 1O5LA 1HIXA 4TXWA 3RDIA 4WM7C 2JE9A 5IK7A 2N7GA 2XG3A 3P5BA 4Q4V1 1TME2 1V6LA 2HWB2 4KQ7A 4B3NA 4COWA 5JSRA 5A7WA 3ZFEC 5B2GB 4Q26A 4QPGB 1D4M1 1R082 4YSFA 1QJY3 4AVVA 1SHWB 1MEC1 4QHZA 1GNZA 1NLQA 3CNAA 3ZXGA 1ODNA 1MS9A 2YZ4A 1I9RA 4G3YC 4MX3A 2HWD3 2H0VA 3O7OA 1A34A 1SPPA 1QHDA 3LA7A 3AYAA 5GLZA 2QDNA 3GM8A 2J1AA 4CDXA 3JBG1 3I3DA 4ZZ5A 1MZEA 2WKKA 5BNOA 1UU5A 1LOFC 2XWBB 1UOJA 5JIUA 4Y26A 1PZ7A 3S7IA 2VNVA 4WVMB 3ZKUA 1ULDA 4P02B 2P17A 4AL9A 1PGW2 5FZ0A 5FY5A 4NMIA 3MFCA 4COVA 2WA3A 1UAIA 3AFKA 5F5IA 5GLUA 2FDIA 4OCTA 4I02A 4YPJA 2J1UA 3FL7A 3RNSA 4UFLA 5GZFA 3E6DA 3WG1A 1UXZA 3TB0A 4DIQA 2K46A 3VBRB 3PDQA 1C5HA 1GQHA 4C1XA 2JG9B 1XU2A 1OT5A 3J7LA 1FPN1 2LM3A 3CBNA 4CYDA 3LDKA 4JTNA 4UW6A 4A42A 2ZEYA 3K48A 1JYCA 1US3A 2P1BA 2Y6HA 4AE2A 5A3UA 5FBJA 3TOJA 2JECA 2X09A 1R1A3 1TEIA 1V9U2 4LBQD 5C3RA 1TME3 2HWB3 3K4AA 2WQZC 4GMP1 4W50A 4PDWA 2JWPA 3RFRA 3WDUA 2XJVA 4FAHA 1O3QA 3JB8A 3LOBA 1YJKA 1XE7A 5FK7A 5CVRA 4W4ZA 4W6WA 2VUCA 3CF6E 2K0GA 2GNTA 1CAWB 4V2WA 3KHCA 3ES4A 3KF3A 2GP5A 2XVGA 4AI1A 5C9AB 1XBFA 1MS3A 4CCNA 1UY1A 3PHMA 2HWF1 3THCA 4NVPA 4XETA 3AMPA 1JZ4A 4O9EA 2ZGSA 1DGLA 4Q4V3 1AF9A 2VW0A 3AFGA 3LWCA 4LT5A 1WKYA 4CA9A 4B7EA 3T2QA 2VW1A 2QZ2A 3HT2A 4BQYA 4AI8A 2RMU3 4BMEA 4I30A 4OHYA 1YO8A 1ZVFA 5FXVA 1ST8A 3EB7A 4W8JA 4FI9A 4OZXA 5C4WB 2WABA 3H9AA 5F3EA 1G9CA 1E5IA 3MW3A 3SITA 1AL23 4PLOA 3VDDA 2BV4A 2BWCA 2VMDA 1KRIA 4CUBA 2VECA 3F2ZA 3OGSA 5EIYB 3S57A 2QQWA 3T1LA 1I1EA 3OCPA 3CKHA 3ZYRA 5CB7A 4IEPA 3BALA 5E89A 4XF3A 4UW4A 5FZBA 4PDWB 3OTFA 5E8AA 2XJRA 3LZZA 4JAAA 4A6OA 3FBMA 4GQ7A 1GANA 2VMGA 3WG3A 3ZSEA 1N1YA 4AVAA 3UGFA 4LHKA
chains in the Genus database with same CATH topology
3JBG3 3GZAA 4LO5B 4AVSA 2WA4A 5BXXA 3ZFFC 2RS51 4HSLA 5C33A 1DIWA 3B5LB 3B69A 4Z82A 3HBZA 3DPRB 4RHV1 5DG2A 3WUCA 1PM7A 5JOZA 1AR61 3AZWA 1IZ3A 1YLLA 1IOAA 1BVP1 4G4FA 3WCSA 2OIIA 2LALA 4MGIE 1JUIA 2YMZA 4X6RB 5J98B 4RGGA 5LRSA 2BUKA 1REFA 1FOD2 1WCSA 4K20A 1RUC3 5C4WA 4DXZA 1ULEA 3HAGA 3L2HA 3GBWA 3BODA 4YW1A 1RUI2 1RIRA 1O4YA 3MIHA 2Y38A 3AJZA 1CAUB 2WNVC 2VVDA 5J96B 1W6NB 1Z7S3 3VHNA 4BE3A 5BNQA 2IXLA 5FMOL 2K2SA 1ASJ2 4FPGA 2NZ9A 3ETQA 4FBFA 2QUOA 2JE7A 2E63A 5CFDA 3VKLA 3GHNA 4OHZA 3S30A 2P3JA 1A78A 2ET7A 3B3QE 1S1AA 4Q4W2 1SFYA 3CLPA 1DZTA 5AC91 1S0FA 3L9JT 4R9CA 5JVVA 5DDJ1 5L19A 3LAGA 4ZU7A 3LB9A 3OBTA 1DLLA 4ES8A 4URTA 2CV6A 2OZ6A 2CGOA 1AR93 3VKMA 4QX5A 4LEJA 3B7MA 3T2TA 2GMEA 3VBSA 5AC93 3ST7A 1QQP1 1OHFA 1RUF3 1MZ5A 3H7YA 3NAPB 3VBFB 5I8SA 4HT1T 3N35A 1MVEA 3AMQA 1OQ1A 1PO23 1KXGA 3MYXA 3OBRA 3ZFGC 4KU8A 3WQ7A 5BV6A 1RUF2 2QZ3A 3TN91 3H3UA 4HPKA 4IEXA 2MEV2 1RTVA 1V6IA 4HSJA 1LOFA 3RI8A 5CNAA 4E27A 3ZN6A 1DZRA 4FAGA 1ZRRA 3JQXA 4AEJA 1LEDA 3POSA 5K7PA 2EXIA 3C2UA 2ZOEB 5SV5A 1MS8A 2R1BA 4Y1XA 3D0SA 4R9BA 3FUOA 1XQNA 1RUI3 2I45A 4K21A 3EO6A 4MXWA 4YGDA 5E1RA 3RYRA 5KHIA 1HRI1 4H7MA 3DKWA 4PLMA 1H1IA 3POYA 3WDYA 1KFUL 5GLWA 4UW5A 4Q0SA 4N7UA 3X29B 3ACLA 2YYOA 3S6PA 3DPRA 2AUYA 3EXUA 1DDLA 1WMEA 2RS11 1IS6A 3ATGA 2DTYA 2UYAA 2ZX0A 3MZHA 5FOBB 4Q4X1 1PVC3 2D40A 4QU2A 1QH6A 3IN9A 1EYBA 1RUD1 3CJIC 4L92A 3WP3A 1VBD3 2WIIB 2R041 1AJKA 3WW1A 1QOSA 3NAPC 1BYHA 1Z7S1 3WR0A 3H1WA 2DUPA 3EQEA 1WA4A 1VBC3 4Y20A 4B4RA 2XKPA 2FHRA 4AWDA 1K5MA 3LA2A 4AGVA 1FMD2 2Q4SA 4GH4A 1NCRA 3JD73 4LE3A 4LHNA 2FMDA 1RUH3 2Z69A 3TAYA 4FPEA 3ZIWA 4LNVA 4CDQB 4M3CF 3MFAA 5F9TA 3FFQA 1H2LA 5HCFA 3WDVA 3SCGA 1POV1 1LHOA 3ZN6B 4EN9B 2B46X 4GB32 1RVF3 1E57A 2RS33 4HVQA 4MH0E 2A70A 5A3MA 5ACA1 1KS5A 1LEMA 3WP5A 2AH2A 4BLIA 2SLIA 4D7SA 4FOYA 1MQTC 1CVNA 1F2NA 2ZKLA 4WVZA 5C8CC 1O4TA 3KT1A 3MICA 2NMOA 3HT1A 2JX9A 1YHFA 3ZN4A 4YVSA 2PHTA 3G6JB 2TUNA 1ENXA 4GKYA 3AP5A 1Q8SA 2RM23 3UKVA 3OGGA 1BEV2 2ZAAA 1OA3A 1ZRFA 1VBA3 4K1ZA 3VL8A 3FC0A 2RS12 1HXS1 4ORFA 5BNPC 3M3CA 1OI6A 4P14A 1NCQA 3M3OA 4LR4A 3VL9A 5FO9B 2RMU1 1CIWA 2JG8C 2XBO2 4L2NA 4RGAA 2BFUL 1AYN3 2GZWA 5FPXA 1MR5A 4I0AA 2RHPA 4AHZA 1HRV2 4WZCA 1AXKA 5CG9A 4Y22A 3D6EA 2QQPA 3NKTA 3WP4A 2RR12 2HEWF 3U4XA 3V0BA 1F9KA 5BNNC 4R4ZA 5T55A 3FZ3A 3QACA 1VAMA 4BA6A 2ZMKA 1JYIA 2A3XA 5CADA 1R1A1 4S2FA 4QMAA 3KQRA 2HEVF 3KT7A 4A7ZA 1ND2B 3QCWA 2XH6A 2RR13 5FMOS 1FPN3 2P3IA 5L73A 5JCTA 1LENA 2RE9A 1CQ9A 2GMPA 4YGBA 2DVAA 1C1LA 1G9FA 1OOPC 5CA6A 2DTWA 4MGYE 4HETA 3KCCA 2C5DA 1C28A 1VBC2 2E53A 5BY5A 1TNFA 2XWJB 3TBDA 1HQNA 4XZPA 1NCQC 2GC3A 3LA3A 5HCBA 2NYYA 1U12A 1VBD2 2BTVC 1U5IA 4FTSA 4MVTA 3DL3A 2X29A 2DVFA 3V56A 3JB4C 4YG6A 2GNMA 1RVF1 2RS31 5EXOA 2GN3A 4XXPA 3OGJA 1POV3 5E16A 1WLTA 2ZJCA 3KM5A 4AG4A 3RQ0A 3H1MA 3ZFEB 5LRRA 1KITA 1C1FA 5H9RA 4FT8A 5H9QA 2JG8B 1UX6A 4FPKA 1V6OA 4R4XA 4D7TA 4RL7A 2CGPA 1ASJ1 1COV2 3N4MA 4E9KA 4IQPA 4QPYA 5H9SA 1G6NA 4E4SA 4GB33 5AVPA 2ETEA 1B35B 1KJRA 1SACA 3PVNA 5GJ6A 4AI2A 1NLRA 3FJSA 2WFPA 5C4WC 2QE3A 1IKQA 2WNEA 2DVDA 2OYZA 4XBQA 2VMHA 4XFHA 1IS4A 4LA3A 5BNOC 1ZZCA 3ZSKA 1PVC1 1QXPA 2XJQA 1V00A 4AEDB 4YG0A 2R6QA 2ENRA 4F83A 3WHTA 4AEDC 1H0BA 4C0HA 4WM8B 1LGBA 4YYOA 5GM0A 4BM8A 5CG8A 4AHYA 1U0AA 4Q4W1 1NY72 1X8EA 4M0NA 2HWE1 3GF6A 1AXYA 4MGKE 2C9AA 5L7OB 4XQDA 3ZMOA 4AGRA 1GKBA 5IK4A 1CPMA 1VBB2 4YW5A 1ENRA 2ZMLA 4K9SA 4AYUA 3VBOA 2PTMA 1BVVA 1V9U1 4LLFA 4P9LA 3KD4A 1XNDA 1YCIA 5I0UA 3PNAA 3V65A 4A2UA 5DZEA 1W6OB 3BOWA 1QMJA 4YM1A 2KXLA 2F4PA 3ZFEA 1HX6A 3HD8B 1HQWA 5LK7B 4FP2A 2OVUA 2QVSB 5JOXA 2P3KA 2GDFA 4N53B 1REEA 4WM7A 2O0OA 1JW6A 3TN93 3W58A 4FTEA 2ZBJA 4L99A 4P5HA 1X33A 2BNOA 2CNAA 2JJ6A 5T5LA 1J58A 3B00A 3CO2A 3RYPA 4QPGA 3MW4A 4N43B 3AKQA 1RUF1 2WT2A 4KBBA 2RJKA 4FOWA 2E7TA 1W6NA 4I3PA 4CRQA 1PK6B 2MNGA 3SISA 1AR91 3AYCA 4EWAA 4GIQA 2PAMA 4JDMA 3M1HA 5JPNB 1GLHA 4FPHA 4AGGA 3WNXA 3AX4A 3U10A 1MEC2 4J6GA 3VZJA 1NXD1 1SBEA 2AGSA 1APNA 4WM8A 1ZA4A 2D6NA 4QHBA 3RG0A 3VGIA 1RUJ2 3MPPG 4LBOA 2Q1ZB 3AMNA 5FFOC 4Z8BA 1LB2A 2E7AA 3N36A 4JVAA 2XJSA 1HV1A 3ZYGA 4PDWC 1UZZA 2RS52 1Q5OA 1YIPA 1GFF2 1URXA 1ENSA 2VNGA 3R4UA 3WDWA 1KD7A 2XHKA 5L7OA 4FO9A 4QGNA 2R0FA 1OD5A 4RS5A 2DFBA 1VBE3 1BXHA 1KFXL 3ZPYA 2MPFA 2UWAA 3CEWA 2QKDA 4YRDA 4M3CB 2EXHA 3ROUA 3NV3A 1IQAA 1RC6A 1X36A 3KS7A 5I0TA 1JN2P 3LKJA 1EPZA 1C4RA 1QGLA 2EALA 4E2GA 1GYKA 3VBFC 1XE8A 2ATFA 2R073 4P9JA 5FREA 1YYNA 2XJPA 3GZTB 2PAKA 1YFYA 4LA2A 4PIYA 1WD4A 2A71A 1BK1A 1WBFA 4OLLA 3R6SA 2UWBA 1O4ZA 1AHSA 2B7YA 2Z42A 1AL0G 4XILA 1MACA 1BCXA 1CAWA 1D2QA 5D8AB 1A3KA 4RQPC 1VBB3 5J09A 3ZXEA 3NO8A 1Q3EA 4RD7A 1BKZA 3W9AA 1GSLA 3AXEA 2RM21 2EAAA 4FP3A 1XU1A 2H6CA 2HJIA 2RMU2 5EZWA 2PHLA 5J3UA 4MXWB 2WS93 1I6XA 3AKTA 1NOVA 4ITCA 4R52A 4B7KA 4YZ5A 4YM3A 1KS4A 5KHJA 4DOUA 2R061 4MV2A 3JCIA 2W08A 4DS0A 4PIZA 1X50A 2DCTA 4IEWA 3BOPA 1QQP2 1REDA 3VHPA 2ES3A 1W6QA 4HFSA 3VZMA 4QQPA 2D97A 4QM8A 3WZ1A 2HWF3 2G4IA 1G9AA 4Q4Y2 5FLHA 1OPOA 1PIV2 2Y0OA 3VBSC 1R1A2 1LOGA 1C8M2 1QJZA 1YIFA 4JGYB 2PYTA 4PLNA 3IDEA 3FFZA 3LSEA 4WVWA 3VKOA 2ZCWA 4KWJA 5F6LB 1LHNA 2AR6A 5CFDB 3ZXKA 2P37A 2DVBA 2VULA 3PVBB 2D6PA 2WINB 3VZLA 2ZGTA 4DRVA 1WCKA 1D0HA 5T5JA 2UU8A 3N7LA 3WW4A 1CJPA 3JD71 2YGMA 2WLQA 4QT6A 4EN7B 2IXHA 4GMP0 4FOVA 1GZWB 4N53A 3SHRA 5H9PA 1G86A 3QBQA 4IV1B 1N1TA 1BBT3 1AYM3 3ELNA 4K8FA 2R043 4F8AA 3NAPA 4XF9A 3OD4A 4KL1A 3E6BA 1W2UA 4AF9A 1Q8VA 3CJIB 4IEVA 5A3LA 4INDA 2WJSA 2ZGPA 2DF7A 2QNKA 4XFIA 2ZX2A 3NVCA 4FPFA 5KWRA 4IERA 2VU9A 4QXKA 2HWE3 1HRI3 1NQJA 3AZVA 3N3HA 3C3VA 5GLVA 1RUJ3 1JXNA 2GH2A 3R0RA 3R4SA 4LHLA 5J36A 4FVVA 5JPMB 1ONAA 1VBA2 3ASIA 2R042 3H8UA 1BEV3 1GBGA 4RR3A 4BOWA 3VHRA 4DQAA 3ILFA 2D5HA 4LBMA 5D8AA 4DY3A 1QDOA 4LBQA 1H2MA 3O14A 3I2DA 4XF0A 4C0BA 1XYOA 3ECQA 2A7AA 3V64A 2BPA2 3O5SA 4BHPA 3BU7A 4TZDA 1BQPA 4Q0UA 5BYNA 4QQ2A 3GALA 2DCZA 4OFGA 1NA1A 4DFSA 4J1XA 1AX2A 1N1SA 2HEYF 1DGWA 3FWEA 3NWKA 4PQ9A 1QJX3 1C8M3 2WC2A 1JOJA 3HIFA 4HN1A 4LBLA 4UBGA 4B4PA 2G9FA 3RI9A 2WZPP 2X53S 1RUD3 2Q1MA 1RUH2 2OUHA 2R30A 1LU1A 4OHWA 4M3CA 3U07A 3ZXAC 3A4UA 3VZKA 3THPA 1QQP3 3GBFA 3FBYA 1SCRA 2EXKA 2HWE2 5GZGA 2BBVA 5JOYA 1ZZ8A 2EIGA 4CEWB 4RR3B 3OJBA 2UURA 3ZDSA 3IPVA 1CAXA 3MLJA 1HKDA 3UJOA 1VALA 1ZBE2 3O0WA 3D82A 2D6MA 2EVXA 4ZU4A 3GBGA 4MZUA 5K0UB 1RUOA 1YRZA 1AYM2 1GZ9A 3USUB 1CAUA 1H30A 3J4UH 3M7AA 3PMEA 3VBRC 5KXEA 1VAKA 1J59A 2ZGOA 1H8TC 3J8F1 4IESA 1YFWA 1ULGA 4JGZC 4UXAA 5JLVA 1LTEA 2QJVA 1AR81 1WW7A 1UD1A 4W65A 2WNUA 4N90A 2RR11 1QF3A 1J1LA 3NV4A 3IT8A 1FOD1 1D4M2 1R081 3H0OA 4FPJA 2FZ2A 2R072 3HWJA 4DY5A 3IDCB 3EBRA 1QOOA 1GZCA 3SCHA 4N43C 2XLFA 2Z79A 4Q4Y3 4AVTA 2CWSA 2GNBA 4IV3C 3ILRA 2ZX4A 1H8VA 2OA2A 3OF1A 4IV3B 4HKLA 3WW2A 5JDBA 1F8VA 1LKNA 1YI7A 2O8OA 4FTBA 4NHMA 4E4ZA 3CJIA 1AR72 4OI1A 3SLIA 3VBUB 4Z92B 3VZOA 5I91A 1KDKA 1NQDA 3OYWB 5FQ0B 2DUQA 3TRSB 3AK0A 3ZXJA 1YFUA 1WW4A 4WVMA 5AC92 3ZFFB 1H4HA 2GC0A 1O3SA 1S0GA 4AEDA 4B8EA 5BNOB 2D3SA 4CEYC 4EWDA 1DQ5A 2WSVA 5DZFA 5CFCA 3N7MA 2VY0A 1WD3A 4COYA 1CGPA 1AL21 4XFCA 4RR3C 2OUJA 3ZSMA 5GALA 4O9GA 2AZ5A 2TNFA 3ZXDA 1C3HA 2ARXA 4GULA 2YHJA 1LODA 5FRAA 1JUHA 2GNDA 3TNQA 1NA1B 5EFUA 5FPZA 2JENA 4CTEA 1HXS2 2RJLA 1CONA 3L2YA 4GA9A 4XHXA 1SBFA 1UF2C 2UYBA 3JUUA 2PA7A 3PMSA 4MGZE 4YZ4A 2ZACA 4KWKA 3FUQA 1CN1A 3RMYA 1J3PA 4B4QA 2VGDA 1H8TB 1LHUA 5DUUA 4KG0A 4JQRA 2WFF1 4YFWA 3OY8A 2YDEA 5JSOA 4S2DA 2Q8OA 1LOCA 5C9AC 1TME1 1L3JA 2HWB1 3KCYA 2MHFA 5HBAA 4ATFA 4XXAA 3IKWA 2PELA 1NG0A 1XRUA 2WZR2 1W0PA 2ZGNA 2WNVB 2GN7A 1QU0A 2VNRA 3MW2A 1RHI2 3AMMA 5DXDA 1M4WA 1MVQA 2PLV3 1S0BA 2NP0A 1XNKA 1A8MA 3ZIXA 2XBO3 4AQ6A 2D6KA 2F6BA 1PGL2 3SMHA 2O1QA 4BIFA 4GH4C 2ZGQA 4RHV2 4XFAA 4WM8C 1GR3A 3GYDA 1WBLA 3Q9OA 1OFNA 4GALA 2RM22 2ZAHA 1UKRA 1TE1B 3WDXA 2D6LX 2PFWA 1WGPA 1OKQA 4DMIA 1N1VA 2GC1A 2ZHMA 2PHXA 2DCYA 1FATA 2TBVA 3AMHA 1QJU3 2E51A 2CGNA 2VQAA 3O0VA 1ZZ6A 1QOTA 1RVF2 2RS32 1UPIA 3LSDA 2CL2A 4NPRA 3KGZA 1FV3A 4YZ1A 4Y24A 2D3PA 1FV2A 3JU9A 3SH4A 4AEMA 1OFSA 1VLNA 3VBUA 4GMP3 2PHWA 3DF0A 1N3PA 1VB2A 3P3NA 4KG8A 4CEYA 2HWF2 3E5QA 1SEFA 3NKGA 1D4VB 3GNEA 4Q8LA 3D0JA 3UV9A 1SLAA 4NR1A 5KHGA 1JHNA 1VRH3 4PJYA 1IS3A 3BPZA 2D93A 4LBQB 4YGCA 1RHI1 4BMBA 1U5ZA 2ZPXA 2IXIA 4WZFA 2V09A 3SH5A 5I8YA 2HKXA 3IMNA 4CDUA 4AEKA 4IV3A 1PGL1 3M3IA 1EV12 4CP0A 3WINE 1SDWA 4XJUA 2DU0A 4YM0A 2VOWA 5JIAA 2JXAA 4PCRA 2CAUA 4E2QA 3EJKA 5CIRA 4OUSA 4JGYA 1ZREA 1G9DA 2EA7A 4KNCA 2MEV1 4K40A 2W0XA 5IK5A 2H0BA 4CDWA 4WVVA 3I54A 4I0BA 3FLRA 1SLCA 2YPJA 3BB6A 4Q4V2 5FOJB 4XQ4A 5TSWA 1BMV1 4KU7A 1QJU2 1VB4A 2W52A 4LBKA 4TSVA 1H9WA 4EWEA 1FNYA 1ND3B 1N47A 1V6MA 1ND3C 5K0UA 5KHKA 3DN7A 2E7QA 2NQYA 4CDQC 1H1AA 1YUDA 4Q0VA 3IM0A 4Z2WA 1OLRA 2A5ZA 2R16A 4D69A 3NJZA 4U36A 2NM1A 4OI2A 1LECA 1LGCA 3I7DA 4ES9A 1W6MA 2R0HA 4I3GA 4AVCA 4Y22B 3I59B 4H3WA 2YY1A 4FPOB 3VZNA 2PQQA 4ISQA 1MS4A 2NMNA 3B9CA 4Q27A 4EN8B 1ZZBA 3OPZA 4Q0QA 2QFEA 2ZX1A 1Q43A 1OOPA 1KJLA 1WW6A 4SLIA 2QDRA 4HVRA 2R062 2WNVA 2B8MA 3ZXFA 4D94A 1UCXA 3TWIA 4QQOA 3HQXA 4JTOA 1FMD1 2OPKA 4S2GA 1RUG2 5CFCB 1SLLA 2JKBA 1AYM1 2ZGLA 4KWLA 4HN0A 4RQPA 2HWD2 3VDDB 4XJZA 4EROA 2JG8A 4K1YA 4FPLA 5BNNA 3APBA 4JRLA 1POV0 1AR82 3AZXA 4N9IA 3WQ1A 5J48A 4OI0A 1XYPA 2Q0AA 1RGSA 3AM2A 3POWA 1ZZ9A 3N7JA 4XHBA 2BQPA 4LBNA 3UL2A 2ZGUA 1B35A 3CJXA 5T54A 1Q8PA 2BYVE 2YROA 1OOPB 3AKPA 4ISRA 4XW3A 2X8KA 3H50A 3PLQA 2WWSA 3JZVA 1S0JA 2IWGB 4IETA 4Q1PA 1FI2A 2ZZQA 3RPQA 2D5FA 1S0DA 2XJTA 4YVSC 4IEQA 4EV0A 1RUNA 3E5XA 4CEWC 2A6WA 4N7IA 4YZ2A 4Q0PA 1RUE3 1N3OA 2K9ZA 1ND2C 1AZDA 1LGNA 4XBNA 2HWC1 1VAVA 4D3WA 2R32A 2GH8A 1VR3A 4AQSA 4OHVA 1LCLA 4BWOA 4Z07A 3ZMNA 1RUE2 1XNCA 5F1RA 1SLIA 4MXVA 1Z78A 5I93A 2I74A 4QPIC 2IC1A 5KXBA 4K3UA 1VBA1 2A6YA 1NCQB 2KM2A 2HYKA 1VJ2A 1CX4A 5T50A 2P34A 3M8LA 3B9IA 1DFQA 5I0RA 4R8HA 2VH9A 1VBB1 1BJQA 2HWC3 3R05A 2V5YA 1BZWA 4HANA 4J1WA 3D8CA 5GLUA 3VBRA 5JWPA 3CU7A 3RMXA 4AXOA 1RUG1 1UKGA 1V6KA 2GALA 1LOEA 2W68A 5FBZA 3ZN5A 5JZGA 2PHDA 3MLLA 4IXLA 1DBNA 4WM7B 1UU6A 2HWD1 1UW8A 3ILNA 3MF6A 4XMIA 3S7EA 5ABJB 4JGZB 5EJ3A 1YNAA 1G7YA 2X5IC 2ZA9A 3TYJA 4YARA 1RUG3 2B5HA 1IHMA 2VNOA 3DGTA 2BWAA 2DWRA 5HI0A 1VBE2 4PBOA 4BYYA 3MIEA 1QNWA 5EYXA 1RUH1 5A32A 2ET1A 2DUOA 2R063 2PN5A 3WG4A 1R091 3B93A 2DFCA 2ZZJA 4OVEA 3WLUA 4JRAA 4UW3A 1VBC1 5ACA2 1HDKA 1CR7A 4XIOA 5FLIA 5DDJ2 2NPIA 1H1MA 2D98A 1NZCA 3NW4A 4YVWA 2ZHLA 1DYKA 2AENA 1TMF3 4ZKTB 3QLQA 4LBJA 5DG1A 3WUDA 2UWCA 4G9SB 4FPCA 2FZ1A 4XOGA 1NE6A 1IS5A 5GZCA 3AP6A 4P9WA 5FCCA 4DINB 2ZX3A 1AX1A 1BBT2 4BLJA 1AVBA 2E9QA 1DQ0A 5AFEA 3W59A 1WW5A 2VQ0A 1ZBA1 1ND3A 1QJX2 3HMYA 4XPVA 5C6CA 5K0UC 3S0MA 5EV7A 4AVBA 1MQTA 4KGQA 4XQWA 1A8DA 5GZEA 1W39A 1H4GA 3USSA 1H8TA 1S55A 2CWMA 2NN8A 2X5IA 4FSJA 3VHOA 2XKOA 1T6GC 5JZGB 5AFBA 1QY4A 3UKTA 2I07B 4AFMA 1WCDJ 1R083 2BW8A 4Y1ZA 4AFAA 1RMU2 2VVEA 3ME2A 1WLDA 2BNMA 1YJLA 5LEJA 1PIV3 1PZ9A 1UU4A 2Z2SB 2XVKA 3KGLA 4XFBA 4M0HA 5A32B 1RUC2 1HRV3 1FOD3 1WLWA 5GKAC 3VKFC 4YGEA 1DG6A 1FMD3 4EJRA 1K5MC 2LUWA 3WD5A 5LEKA 1OPMA 1PO21 1W6PB 4HVOA 1HRI2 4HZFA 2CAVA 3NV2A 4QPGC 1LULA 5A33B 4BH9A 3M4FA 3E5UA 1YFXA 1MS5A 4IEYA 2XL9A 5GZDA 4TYSA 1LRHA 3MPBA 4D7YA 1GZWA 2VOVA 2ZGKA 1ULCA 4XFGA 2D43A 4R9DA 1NA1C 3WDTA 1RITA 3MGUA 4Q4W3 5I8TA 2ARBA 5JOWA 1PHMA 5FDBA 5SV8A 1IGOA 3WW3A 2XPJA 1EV11 3AB0A 2ZKNA 2PHFA 4XE9A 4XJ9A 1EPWA 5J7MA 2VOKA 1X8MA 3IPVB 1W6OA 1DGRN 4IV1A 4AK3A 3DPRC 2XVLA 2IFWA 1CD3G 3ZSLA 1PO13 1PK6A 3BTAA 1MZ6A 3KSCA 1C8M1 4YVWC 4RFT0 4A7YA 1OLQA 2ZS6B 3VV1A 4NOTA 1UPSA 4C91A 1ZRDA 4YLZA 2MEV3 1HV0A 1GNHA 1EV13 2AYHA 3T1MA 1RUC1 3ALQA 1PK6C 3PJQA 1DQ1A 4IEOA 1PO12 1KDMA 4HPKB 3ZFFA 1RUJ1 4P9GA 4L97A 1U5YA 3KMHA 4U2AA 4HL0A 1PVC2 1D0GA 3MEPA 3ZXLA 3WV6A 1BEV1 3V0AA 1I5ZA 3ZYPA 2B45X 4FOQA 1IPJA 1LESA 5C8WA 1S2KA 3N7KA 4Q8KA 2PLV2 4COZA 1RHI3 4H14A 5BNPA 5KC5A 3SNMA 2A6VA 5IT6A 1S0IA 1VRH1 2PAEA 4DNYA 4N43A 1I3HA 4AI3A 1TMF1 4K6BA 4RS5C 4LO7A 4CP2A 1S0CA 2Y0IA 3IDBB 1Y3TA 4L11A 1Z0HA 3RWNA 3ZFGB 1Q8QA 2V73A 5GLTA 3VBHC 1F5FA 3FLPA 4PF5A 3OY8B 3SCFA 2EAKA 5A33A 4AHXA 4BCUA 5CFDC 3B94A 3K51A 1S0EA 2XGXA 3E6CC 1ASJ3 1ZNPA 4CDWB 4FQ4A 1H2NA 1MS1A 1FXZA 3OD0A 4Y1YA 4YW3A 2UY9A 4W6XA 1DZQA 5KBFA 4CP1A 2R49A 4NHLA 4CDUC 4COUA 1RMU3 2ZHKA 2WFF2 1JH5A 4RHV3 4C1WA 4H55A 1UL9A 5JMCA 5FO7B 1UZYA 1UIKA 3PVOA 2XUMA 4XJWA 1DGRA 4ZU5A 4E2SA 1AR92 1CAVA 4EN6B 1AXZA 2WS91 2B9UA 4BQ1A 3LOIA 3SH3A 2WZR1 2ZMNA 1Y7BA 1W6MB 2CY6A 1LHWA 4IV1C 2FQPA 4I2OA 5DZGA 5F5QA 2A3WA 1HXS3 1PMIA 3AKSA 2XL7A 1SQ4A 1NXMA 2CTVA 2CYFA 2PLV1 4QGLA 4CDXC 2DV9A 1RJ8A 2FBEA 5EYYA 4HMZA 5BNPB 1HLCA 1ZYBA 4LE4A 4TLFA 1SFNA 2VMIA 1ZRCA 1G9BA 4M01A 1TMF2 1U5XA 2BVVA 2A3YA 3WXPA 3VDDC 3AYEA 3G7DA 2C0ZA 3VBFA 4AQ2A 5JR7B 4AFCA 5ACA3 2JICA 5ABJC 1BMV2 2KA3A 2WSUA 3WY6A 4XMAA 2IXJA 3KZ4C 2R071 4OULA 3JD72 2D44A 2D6OX 2SBAA 3B01A 2JG9A 1DQ6A 4GWMA 3URFA 3MLKA 5I0SA 3AJYA 4TWTA 2GSYA 5FO8B 2BFUS 2DURA 4XEZA 1SLTA 2OW4A 2WT1A 4BPZA 4I09A 3RJ2X 4X6QB 4AFDA 1AR83 1VBE1 3MIGA 4OHXA 2VUAA 4YW4A 5C8CA 4CDUB 2PHUA 4NWVA 3JBG2 5JAXA 5K8SA