3WD5A

Crystal structure of tnfalpha in complex with adalimumab fab fragment
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
152
structure length
152
Chain Sequence
RTPSDKPVAHVVANPQAEGQLQWLNDRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Tumor necrosis factor
publication title Comparison of the inhibition mechanisms of adalimumab and infliximab in treating tumor necrosis factor alpha-associated diseases from a molecular view
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wd5A00
2R32A 4KGGA 1O91A 2WNUB 1JH5A 4OUMA 4EN0A 1D0GA 2E7AA 1TNFA 2WNVC 2WNUA 4MXWB 4G3YC 1PK6B 1KXGA 4DB5A 2AZ5A 4MXWA 1S55A 2KA3A 3TWIA 2HEVF 2HEWF 4QPYA 3QD6A 1PK6A 2RJKA 4E4SA 4KGQA 1DU3D 2JG9B 2OIIA 1OQDA 1RJ7A 4QQ2A 2JG9A 1PK6C 5KC5A 1IQAA 5KC6A 2TNFA 3ME2A 3FC0A 2JG9C 2ZJCA 1RJ8A 4N90A 5L19A 2TUNA 4G4FA 4OUSA 3B93A 4F3JA 1TNRA 1DG6A 3AB0A 2WNUC 1U5XA 2Q8OA 1A8MA 2Z5WA 5HBAA 2ZPXA 1GR3A 5BNQA 1WCKA 1U5YA 4TSVA 3V56A 2JG8B 3L9JT 3URFA 5L36A 1JTZX 2JG8A 4QQLA 1C3HA 4NN0A 2R6QA 3K48A 1D4VB 1OQEA 3B94A 4TWTA 4MXVA 3MI8A 2WNVA 1D2QA 3ALQA 4HT1T 4KG8A 3TYJA 2O0OA 2JG8C 2HEYF 4QQPA 5CIRA 4J6GA 4RSUA 2QE3A 1C28A 1KD7A 1XU1A 2RJLA 1OSGA 1I9RA 2X29A 5KWRA 3LKJA 2RE9A 3K51A 3B9IA 4QQHA 2WNVB 1ALYA 4OULA 4QQOA 1U5ZA 3IT8A 5TSWA 3WD5A 2R30A 4DOUA 2Q1MA 4D7YA 4GIQA 1XU2A 2QDNA 4MSVA 4E4DX 3QBQA
chains in the Genus database with same CATH superfamily
4YW2A 4PHZA 2BGCA 4XJWA 3AXDA 4Z2WA 5FOJB 3ECQA 2RS51 1H2MA 2PA7A 4XHBA 2O8OA 4B7KA 3WDXA 1Y3TA 3ATGA 3HD8B 2JJ6A 5FXZA 1MS1A 1QNWA 2PAMA 2UWAA 4AFAA 2BTVC 3BPSA 3MICA 4ASKA 2HEWF 2Y38A 4GQ7A 1REEA 2H6BA 2GC3A 5C71A 1GP6A 4PLMA 3KS7A 4KGQA 1VRH1 3OJBA 4Z1VA 2BDRA 3ZR6A 3HJRA 3M1HA 4XACA 4A4AA 3RI9A 5ERLA 4A6SA 1OPOA 4MYEA 4GAZA 4CU8A 3ZSJA 1JODA 3CF6E 3MHZA 4HKLA 4YGCA 1A3KA 2GAUA 3U75A 2E51A 2R071 3UKNA 5EQUA 3UESA 2A70A 1NXMA 3TB0A 2JICA 4DQAA 3I8TA 1V6OA 5T50A 4Y24A 2ZMLA 2Y0IA 1IQAA 2TNFA 1ND3A 3PIJA 4QX2A 3V0AA 4FPJA 1TMF3 5L7OC 5I0TA 1OLQA 4FAHA 1RUG1 3WNXA 5LA0A 3H9AA 4S2DA 4U36A 3VBSA 3Q9OA 4BQ4A 2J7MA 1AYM3 1EV13 4LKDA 4A42A 3KT7A 3ON7A 5FMCA 5CFCA 1ACCA 3CDZB 1QJY2 2YGLA 3SXWA 1MEC1 3GHMA 5BY5A 1KGYA 3OGRA 4IERA 2HJIA 1EAH3 2XH6A 2ZX4A 5FY4A 1F4AA 3POFA 5LB6A 4GH4A 1YJLA 2YPDA 4HN0A 3DPRB 4NPMA 3VLBB 4LBOA 1ULGA 4XBNA 4K9SA 3T30A 4PIYA 3VBRB 3VBHC 1JHJA 4URTA 1SBDA 5FPBA 2J1SA 3UGFA 3H1YA 2QTWB 2R6QA 3LE0A 1C8M2 2I2SA 4LT5A 1OQEA 4LHSA 4MXVA 2XXZA 3A21A 3WQBA 4SBVA 5FREA 2A6VA 4P5YA 3J8F1 5FZCA 3T2PA 1JU4A 5DZEA 4MGYE 1UWWA 3VZLA 3POJA 4CCKA 1HRV2 4QB1A 5C3PA 5J3UA 2BERA 3BOPA 1RUC3 2V4VA 3G6JB 4RSUA 4JX0A 3ZN6A 4XXPA 5A32B 2EAAA 2OA2A 3AL6A 4CUCA 3LOBA 5FYBA 1FNZA 2VUDA 4COVA 2ZGTA 4XFBA 4FT8A 4CSWA 1CESA 2BOIA 2VXJA 4XUQA 5HCHA 4Y22A 4A3ZA 1YIFA 3H7JA 3B9IA 4CCOA 3NAPA 5C4WC 1AR91 1OLMA 1MZFA 3N9OA 1KJLA 1MR5A 4LO8A 1BCXA 1AZDA 2A6WA 1WMEA 3MFCA 4TZDA 2WINB 4MHRA 1RHI1 1W9YA 1ZM1A 1J1LA 1GZWA 1H9PA 4LULA 5EWSA 1CX4A 2QZ2A 1CAWB 3QH7A 2WRAA 1JOPA 2DBIA 3OY8A 4D0QA 2PMWB 4BMEA 4UI9L 1UXXX 2Y26A 2NLRA 3BTZA 4XFAA 4W4ZA 3KF5A 3R05A 3WX5A 2PLV2 1F31A 3TRSB 2VOVA 4AEJA 4GXLA 2E7TA 4ISQA 2CYFA 4H7LA 3NJVA 4C8DA 1W8HA 2WNUA 4Q4V3 4JZRA 4AI8A 5GM0A 2PXJA 4N53A 1Y43B 2FBEA 3SMHA 4N9HA 3TWIA 2KD7A 4NPRA 4AHXA 5CAZA 3BPZA 1R1A3 1C5IA 4JHTA 1H30A 2B39A 3N4MA 4A7YA 1KQRA 3CNAA 4LIVA 5C3OA 1OVPA 4AEDC 1DU3D 2ATFA 5H9SA 4N8MA 1COV2 5JWPA 2EIDA 3AVSA 4CDXC 2RHPA 3ZYGA 1KS5A 3AJYA 1LNSA 1QU0A 3U10A 1H1IA 3KZ4C 5T5OA 1R082 1FMD2 5JPNB 1UOBA 1X8EA 1ASJ3 2RVAA 2VNGA 1RUD2 1VBA1 1GLHA 4LBQA 5K0UA 3HEIA 1LKNA 4IV1C 4YGBA 1GICA 5FZ3A 4GZ9A 3NNMA 1QXRA 4ZKTB 1AX2A 1BBT3 1HN0A 2VJXA 1AYN3 1BLZA 3U07A 1OOPB 3ZYIB 3EQEA 2WZPP 1AX0A 1DYOA 2C24A 1DZQA 1NUKA 2NQYA 3CKHA 2EXJA 5IT6A 4FFFA 2ARAA 1UOFA 1WD3A 2FZ1A 4X8NA 5T3NA 4E4HA 2V09A 2VECA 2GP5A 2VBDA 3WDYA 4CP2A 5CNAA 1FNYA 2ZOEB 5FYIA 1US3A 4XILA 1ZBA1 3M4FA 2WO1A 5DDJ3 2WA3A 3RNSA 2F17A 1UZVA 4CEWC 5JCTA 2BOJA 2ARCA 2ZGLA 3VB9A 1D4M3 1HQNA 3INAA 5KXCA 3HBKA 4V1PA 3EJKA 4UFKA 3V0AB 2YBKA 1KEXA 1JMUB 1HJFA 4RN5A 4DEQA 2AR6A 2V5DA 3TBDA 2VOXA 1X82A 3ZYFA 1AF9A 3VBSB 5BNOB 1J3PA 5T5LA 4HMZA 4CTEA 1OI6A 5F5IA 1UU4A 4JQTA 4AHWA 5CFCB 3ALQA 1DCSA 1C57A 3AYCA 4KG8A 3SNMA 4JQRA 1IG0A 3WP3A 3BYWA 1PMJX 1LENA 5FQ0B 1YQCA 4GH4B 2C6SA 5CKQA 3VD9A 3OYWA 2CSGA 1T6GC 1OFNA 2VULA 3D8CA 3PMSA 3POYA 4XW3A 5LY1A 3WY6A 3UETA 5CFDA 3GF6A 3JD71 1GUIA 4W50A 2KR2A 3ZDVA 3M3OA 4DPNA 4JGYA 1AR82 5IVFA 2DCYA 2QBXA 3Q8EA 2GH8A 4NHMA 1NA1C 3WP6A 3B00A 3FUQA 4Y20A 1UYPA 1H8TC 5TSWA 1W05A 5AC92 1OURA 5J37A 3CJIA 2Q1MA 4GKXA 3W9AA 3ZN6B 1O7FA 3BGAA 2XBO1 4DXTA 1MS8A 2E9QA 3QBQA 1K3IA 3O1OA 4AGVA 4AVBA 3U11A 1NCRB 3PUHA 1X8MA 3ITQA 4CYDA 1Y4WA 1MQTA 4Y22B 1EAH1 4KH9A 4CP0A 3NAPB 5BNPA 1LJ7A 2DFCA 3AXEA 2V73A 5J7MA 4META 4XF3A 3ZFGA 1QOOA 1PK6A 2X09A 2VUAA 4E4SA 1RUH2 3RJRA 5FYMA 2RM22 2JG9B 1WW5A 2WT2A 4UXAA 5GZFA 2ZGSA 1NY71 5F9TA 1GZTA 1QJU3 3DYPA 3KF3A 5DAWA 2CGNA 2ZKLA 3NKTA 2XMLA 1APNA 4N43A 1OD3A 2XUMA 1NZCA 1RUI3 2RDRA 5FUPA 4EE2A 5KC5A 4EQVA 1RITA 3MGUA 1G6NA 3AYEA 2WZR1 2A71A 2WC2A 4LO4B 5H9RA 3ROUA 1DFQA 2K46A 4EV0A 1PIV2 1C8NA 1GQPA 3BODA 3FLPA 1V6LA 1AVBA 1IPSA 4L97A 2R062 4FQ4A 4CXXA 1SFYA 3LDBA 3ZYHA 5IAVA 1DG6A 2JD9A 3VHNA 1ND3C 3GBFA 1VBC2 2XDVA 5DZGA 3M7AA 3VV1A 4OHXA 4QT6A 4D3WA 2CDPA 3RWNA 5GLTA 4LBQB 4A44A 4GA9A 3A0NA 4GJYA 5IUQA 4D6RA 1S0JA 5BNQA 5HXMA 5K0UB 1RYYA 3M3QA 4XPVA 2IUWA 1DYPA 4Y1XA 3URFA 1S4CA 1YJKA 4Q4X3 4YZ5A 2VMDA 3DKQA 4ZONA 3RJ2X 1AL22 2QFEA 1QDOA 2Q8DA 3ES4A 3PTYA 2NMNA 2EIBA 5JZGA 3M3EA 4Q4V1 4RYDA 2EALA 1QOSA 1XYNA 4FQZA 1RUH3 5ABJC 5FJKA 2HYKA 1R1A1 2RM23 4PI2A 3VBOC 1GNZA 2VNVA 3AKRA 4M0NA 3H50A 4LMFA 5C6CA 1KD7A 1SEFA 4FPYA 3ZSKA 2YFZA 5DPNA 1R093 5FPAA 1ZZBA 3AMMA 2W47A 4A41A 3NV3A 4LJHA 5FYVA 4FI9A 4GB32 2XOMA 3VD4A 5A80A 5FZDA 4AZZA 5FZKA 4QQHA 2OQ7A 4B3NA 1I6XA 2UY8A 1W6OA 3RMYA 2GNDA 2KXLA 1L7QA 4L11A 4CP9B 3WG2A 1AYN1 1V9U3 2MPFA 1BKZA 1GANA 3E6DA 3S7IA 3SH3A 1U5ZA 3WG3A 1NKGA 3RYKA 4U2AA 2RR13 4KI5M 2W5FA 1YC61 3MW2A 1ZZ8A 5T5JA 4OZOA 5DMYA 3OYWB 3LIHA 2PHTA 2R32A 3VDDC 3HAGA 2FDJA 1O91A 4RGGA 3B7MA 2A6XA 4OUMA 4WM8C 2PHWA 2QQNA 3BI3A 4OVEA 3WV6A 4QPGA 4OHYA 2A75A 3FWEA 2DWRA 1Y9GA 1ZRRA 2C4XA 2VVDA 3FFQA 4M3CE 3S5QA 3WDUA 3H0OA 5KXDA 1LOGA 4JGYB 5F5CA 1VIWB 3ABZA 2A7AA 4W6YA 1CJDA 1W6NB 2W46A 2X5IB 5FRAA 4YFWA 2ZEWA 2WO3A 4K3UA 5BNNB 1J58A 2WO2A 4Y20B 3WDWA 1BEV3 1FOD2 1VMFA 3FZ3A 1NLRA 1SBEA 1OQDA 5A7SA 1OA3A 1TVGA 4XJ9A 4B1LA 2GNMA 5GZDA 4ES9A 3CEWA 3DCQA 4YVSB 4AK3A 1F5JA 1FV2A 3KT1A 4N53C 4OLLA 3ZYJB 2ORXA 1BJQA 4IEWA 1NAEA 1QQP2 1LEDA 3JBG3 4CDWA 5ANNA 4H7MA 2D6PA 2HWC1 3I2JA 2ZGOA 4QKBA 5D2AA 2QQLA 3KSCA 5H9QA 5A3NA 2AH2A 2W95A 2RS33 4G4FA 3OBRA 1UIJA 2ZHNA 2Z69A 1VBE3 3ZSMA 5FYZA 3THPA 3CO2A 4KWJA 4Y26A 2XHKA 4FSJA 2DYCA 3ZPYA 4F7ZA 2JD4A 4AHYA 3SCHA 1C5HA 4OFGA 1VBB3 2NZ9A 3DYMA 5I93A 2JIGA 4FP2A 3SH5A 1LU2A 4I30A 2XL7A 1SLAA 4HVRA 2DVAA 1W8ZA 1W9SA 4N7IA 2HBTA 2VMFA 1H2NA 1Q8SA 3JQWA 3P3NA 4OZXA 1PX4A 2VCCA 1SDDB 5FKCA 2VG9A 3KGLA 4XUNA 5FOBB 4XTMA 1YFWA 5FZFA 2MEV3 4P9YA 1FATA 5F32A 3BTXA 1PMIA 4XUTA 4Y1UA 2E53A 4XVHA 3TNPB 3KT4A 4TLGA 1DBNA 5FZ4A 4ZHNA 1DQ5A 4P08A 3CHXA 3WT3A 4BXFA 2XVKA 4A7ZA 1S1AA 3PL0A 3PUAA 2QE3A 3PUIA 4JHZA 4YM0A 5LA2A 4JV4A 1DGWX 2XR4A 5IVEA 4I2OA 1RUG2 1O3TA 4ATFA 1AR72 2ZGPA 1SFNA 4KMQA 4BQYA 3I2IA 5SV5A 1CX1A 4A6OA 1H1MA 3AC0A 1MS9A 5FP7A 3JUUA 1MEC2 1O8PA 4QDRA 3ZXDA 1AX1A 5FZBA 5E16A 5JR2A 3D0JA 2CL2A 3ETPA 2G9ZA 2PFWA 4IE7A 3QACA 1H1AA 1QKQA 5DUUA 3MLKA 4NWWA 4QX3A 3WW2A 4QHOA 3VD7A 1W6QA 1N3PA 3ZFFC 5A1AA 4PBOA 4PIXA 5I8SA 4AFMA 4IEXA 3NL1A 2B8MA 3J8F2 3VDBA 2DCZA 2LUWA 3JQXA 5IYYA 5EP9A 4GALA 5CVRA 1F8VA 2V72A 3CJIC 1WCUA 5AVPA 4LLFA 5FLIA 1G9CA 1O3QA 2YY1A 4CCNA 4LUKA 2VOKA 1RL3A 1PO12 5F39A 3L2YA 4QD2A 2VGDA 4XJUA 2ADDA 1CD3G 2ZZJA 3A23A 3ZKYA 3KQ4B 5F5AA 2ZAAA 1MQTC 4CA9A 4BQ2A 5KXBA 5FXVA 4HLTA 2VCBA 4Y5Z0 4HBNA 2GU9A 2OPWA 2P3JA 2YFUA 5LATA 3ZFGC 5L9VA 4UFHA 4YG3A 1PK6C 3N9QA 4IEVA 2P17A 5EYXA 1BVP1 4QPGB 1DQ2A 5FBJA 4NRQA 4Q4W3 1QJX3 3MO4A 1EPZA 2JDNA 1R091 1RHI2 2W08A 4B4QA 4ARXA 1JZ2A 2ZJCA 1RJ8A 2EICA 4YW3A 3GBWA 4RL7A 1SMVA 1QEXA 2RS13 4ZZ8A 4H14A 1UL9A 3VZMA 4N43C 4PDWC 4DINB 4R9BA 1UX6A 3VZKA 3VDCA 4R9AA 5K8SA 3IDBB 1JYNA 4H2AA 5CG9A 4COUA 1WW7A 3IN9A 3N9NA 4FOWA 1DDLA 3CBNA 3SHRA 2VUJA 1WGPA 1PO23 2E6VA 2XJQA 1H4GA 4MO3M 3K3OA 4CDWB 2RR11 3OB8A 2RDNA 4OHWA 4P9GA 2IVIB 4YVWA 3GZUC 4C0BA 1HRI1 1SLCA 2QKDA 2WSVA 3DPRA 3IDCB 5T5PA 2RDSA 2GMEA 3VBRA 3J7NA 1W6MB 1LOBA 2Y6LA 4HONA 4TWTA 1TME3 2PHRA 3ZKUA 3X29B 4AQ2A 5J48A 2HWE3 1W0NA 5SV8A 5LY2A 3K46A 4CDQB 1XB9A 2HWD3 1RXGA 2W0XA 5GZEA 3THDA 1JZ3A 3VKLA 2HEYF 1HV0A 1CJPA 1REDA 2WL1A 2WFF1 1RMU3 4EWDA 5JZGC 3P1IA 2D6NA 1I5ZA 1Q8QA 2B5HA 2BW8A 3GZAA 3UT0A 1Z7S3 4N7UA 2Y6JA 3MIBA 5A7NA 1JZ8A 1HXS1 2P2KA 3R0RA 4UW6A 3I49A 5I91A 5GLZA 2JDHA 4P9XA 4RGKA 1UMHA 3JBG1 3CU7A 4LO7A 3PU8A 3T4HB 4J1XA 3AP6A 1ULEA 2W94A 3VGIA 2D97A 4LKFA 1RVF1 4QQOA 1A8DA 1LOAA 1VR3A 1RUE3 4AAXA 5B4NA 5C8CB 5G05L 4LR4A 3ZM8A 4RR3C 3LEGA 5A3UA 5A7OA 5JDBA 2R30A 2VW0A 2VTXJ 2ZEYA 2AGSA 1E5HA 2Q1ZB 5D1IA 5FZAA 3NRUA 5FBZA 5A33A 4RHV3 3TN91 1JW6A 4E2SA 4XCAA 1GNHA 4ASMB 4GKYA 5AVAA 2XJSA 1VBD1 2VE1A 3UJQA 2VBPA 4JGZC 4LOTA 3AYAA 3BN6A 1DF0A 3LGRA 3I4IA 3FMGA 1KDKA 3ENRA 3RI8A 1CZSA 1W2OA 1WBLA 2YU1A 3AZZA 5K9YA 3GJAA 2WIIB 3O7OA 3O5SA 3OGJA 3OOXA 4GMP3 4C1XA 1BYHA 1FPN3 3ACGA 4BLJA 2OW4A 4XDPA 2D6KA 5K4LA 1XYOA 3MPPG 4SLIA 1ZA4A 1DGLA 5JI7A 4Y5TA 1UMZA 3VL8A 1WWYA 2TEPA 1UXZA 2Y0OA 4WZCA 1WLTA 1OMIA 2I74A 4OI2A 4HZFA 5HCAA 1CN1A 2VQTA 3JD72 3P3PA 1UF2C 5F2SA 1N1VA 1PM4A 3AYDA 3LZZA 2C5DA 1GNYA 4LXLA 4YM1A 5ACA3 4XMAA 3TEXA 5KC6A 1MS0A 2BEOA 4OI1A 4BIFA 5CADA 2BVBA 2YG0A 3O14A 4GD4A 1MS3A 1W8OA 2J1AA 1DYKA 1GWMA 4H3WA 4IEUA 2XWBB 4Q2FA 4XJAA 3W59A 3N9PA 1OOPA 2K2SA 2XBO2 2Q8EA 3B93A 4GULA 4AG4A 1S0BA 2WS91 4EN9B 5IFTA 3WP4A 4ZPIA 1NCQB 2ID4A 3I97A 5FY7A 2PHDA 4CRQA 3ZR5A 1GU3A 2QQUA 4CDUC 5A1LA 1F9KA 5I8TA 3VBFC 3A22A 3GHNA 3KVAA 4XQDA 2R0HA 3U1XA 4L99A 5BYNA 3N7JA 4AR2A 1YXWA 3D6EA 2Q1FA 2B7YA 4Q29A 5LBBA 2VMIA 3UGGA 5AFEA 3PURA 1I3HA 2ZX0A 3T09A 2F4PA 3I59B 1NY72 2OKXA 4AQSA 2VZQA 4Q0SA 1UOJA 5EJZB 4UFIA 4WM7B 1SCSA 3APBA 4ZS2A 5CEHA 4XIKA 4C1WA 4G9SB 1OLRA 1OPMA 2WNVA 2E26A 2Y8KA 1CAXB 4NAOA 1VPHA 5BNOA 1DQ4A 3T0AA 3PTRB 2WA4A 2ZX2A 4DFSA 2WT1A 2WZR2 4AVVA 4Q8KA 5CIRA 1PVC3 4HKWA 2XQXA 1D7PM 1AJOA 2R043 3HN3A 2VU9A 4JDNA 2FCVA 2P3IA 1UIKA 5FQ0A 5JI9A 4YVWB 5HCFA 1I9RA 3AL5A 3MLLA 5HI0A 4Z82A 2YC2A 4OMCA 1OC1A 5FPLA 2BNOA 3RZHA 1RUOA 4WVMA 5FZMA 1OHFA 4BCUA 3ILFA 3M8LA 1QJX1 1QJZA 1ULCA 1VAVA 3R4DB 4OHZA 1RIRA 1W06A 2Q4SA 5I0SA 2ZTNA 4OULA 3TAYA 4RS5B 1JZ4A 3IPVB 1SDWA 4QM9A 4Z8BA 5LZ6A 2GALA 2HWB1 2LTNA 2W68A 1Q8VA 2Y60A 2XJUA 4B1MA 3BIEA 2VAUA 3LWCA 5HPOA 1TEIA 1F4HA 4QPIB 2XWJB 2XQRA 1MACA 1Z0HA 2ZGMA 2Y6GA 4K7JA 5FPVA 2P1BA 3VZJA 5LCWL 4PLOA 2P3YA 4HPKB 1XE7A 3IKWA 3H1WA 4Q0QA 1QXPA 5FZOB 4BE3A 4LOSA 4CUGA 1PO21 1NCRA 1XNKA 2B4KA 2NN8A 4J1WA 4XFIA 2VMCA 4HSLA 1HQWA 2GNTA 2JECA 3WUCA 5F6KA 2HEVF 5FY5A 1XSRA 3ZFEC 1Y7BA 4OCTA 5GZGA 4OI0A 1JBCA 2WNEA 2YZ4A 3K77A 4QU2A 2QDRA 2Z42A 4XXAA 4YGDA 1JUIA 4NOTA 1TME1 5GKAC 2YMZA 2PHUA 4MX3A 5A33B 3LFMA 2GNBA 4NIHA 4CZSA 1LHOA 2JG9A 2B9VA 2ZGUA 1BMV1 1QJY3 1FI2A 2UWCA 1HQLA 2HWD1 2E33A 1A78A 5FXXA 3FFZA 1HKDA 2W92A 3IWZA 1M06G 2VPVA 3VN4A 3B69A 4RD7A 4IDZA 4QAWA 1LAJA 3UL2A 4YZ2A 3ST7A 3K4ZA 2OX0A 3FC0A 1E5IA 2HH9A 3LFIA 2WZ8A 3ZIWA 2P6HA 3SITA 4N90A 1S2EA 3WQ1A 1F35A 5FMOS 1C8M3 5GLVA 5BPXA 4EN6B 3ZLIA 5FYTA 1NXD1 4RFRB 4CEYB 5JLVA 1DQ0A 2AREA 3HNBM 4PJYA 4BQWA 1XJAA 4XURA 1CONA 4XYXA 4BOWA 5LRSA 3KVBA 1ULOA 2VMHA 4CCJA 3LB9A 2GMMA 1HRV3 2CV6A 4XF4A 5A3PA 1JYVA 2HWF1 1SLIA 1PNFA 4JAAA 4FXKB 4UFJA 4BJ0A 5T52A 4D94A 4ZXEA 4LO5B 4BLIA 1RTVA 3BIWE 1WMXA 4COYA 4Q27A 1GZ9A 2CWSA 1JTZX 5FY1A 3K48A 2FQPA 1IS4A 1ZX5A 1XXNA 4COZA 2AYHA 3PDQA 5GZCA 1WCDJ 3C8XA 3VZOA 2H6CA 4DXRA 5D8AC 4KG0A 1IS3A 1K5JA 2WWSA 4IXLA 1C1FA 1N3QA 5J1XA 3LA3A 5DG1A 2HBUA 3IB3A 1R1ZA 3J7HA 1BZWA 2IFWA 4QMAA 4LK6A 4YZ1A 1LRHA 1PGW1 4PLNA 2B45X 5A6QA 3V0BB 4TYSA 1EUUA 2HWC2 3POIA 1PMHX 4HL0A 4I0BA 1C28A 5EV7A 2ZGKA 3VBRC 1DGRA 5LW9A 4O9EA 1O59A 1ZYBA 4BHPA 3WR0A 3VKOA 1LULA 2PLV3 2FD8A 1XPWA 4NRMA 3AMQA 2RE9A 4LBNA 4UF0A 1W04A 3UYJA 3OSDA 1SQ4A 2GZWA 2WSUA 1E5SA 1QF3A 3UKTA 1K42A 5CB7A 2YC4A 3MDPA 2WNVB 3ORJA 1T6BX 1ODNA 2FDKA 4CP9A 4NRPA 5JAXA 4L2NA 4NIDA 3ZXJA 3OGGA 4XFHA 4GWIA 1COV3 3N9LA 3ZMNA 1AR62 1Q3EA 1N1TA 4MGSA 4BQ5A 1WCSA 4MSVA 2VXRA 3O1PA 4IQPA 4M3CA 3BU7A 2JDYA 4KGGA 2VUCA 1R083 3ZN5A 1GOHA 1FMD3 2BNNA 1UPSA 5FYCA 4AFDA 5C33A 3W58A 1S0CA 3I2HA 1MPXA 1RUD3 2E7AA 3O0XA 1SG3A 4PI0A 3ZYPA 4WVMB 1JZ7A 4M4RA 3WQ0A 3PHMA 1LR5A 3I3EA 3O1RA 1W8NA 2CU5A 1B35A 5FY8A 2QQOA 5E89A 5K7PA 4LITA 1VJ2A 3LD8A 3ZDSA 3GZEA 3N7LA 1W2NA 3GXUA 1TMF1 1OD5A 1OH3A 1W6NA 1RUF2 2X5IA 4NR1A 2JKXA 2YHJA 1H6XA 4FFIA 3VL9A 3JB4C 4NMIA 4O61A 4UW3A 3VBUB 3WOGA 5BNNA 3AP4A 3NV2A 1JI6A 2VL4A 2R1DA 1POV3 4LBLA 1K5MB 4XZPA 3RWKX 5ABJB 1DLLA 1AYM1 1EV11 3KGZA 4D7SA 3VBOB 4YVSA 1XQNA 3A0KA 4Y4YA 2OVUA 5L9BA 2R041 3NJZA 1CAUB 1IKQA 3C2UA 3ZIXA 3TEYA 3HQXA 3Q8FA 5FWJA 3JXSA 2CHHA 1YFYA 3LQCA 3IBMA 2XHNA 4UWDA 2F6BA 2H0BA 2RJ2A 4OUSA 4NIIA 4AVTA 1EP0A 1WZXA 2XKOA 1M4WA 4QGNA 4DUWA 5F3CA 2J22A 3LOIA 3S6PA 3T1LA 4F3JA 3I2DA 3LPFA 1W28A 1DP0A 2VZ1A 4MZUA 4CCLA 3Q8BA 5LBCA 1PNGA 2ZMNA 3V64A 2A5ZA 3RG0A 4BK4A 2XGXA 1MZ5A 3FJSA 1NLSA 1TE1B 1CIWA 1OOPC 2MHFA 4BIOA 2D7FA 1OUSA 1RUC1 3OGSA 2ZACA 1VB2A 1RINA 3Q8AA 1X9PA 3AZYA 2WLPA 2E63A 1I5PA 5FP3A 4YZ3A 1QOTA 5C9AB 2P37A 1TQ5A 5IK8A 1WCQA 2WYSA 4A2UA 1G86A 1UZ0A 2PYTA 3ACIA 4Q4Y2 5DUXA 2PQSA 1AR83 1QJEA 1ZRFA 4E2QA 1GQHA 5GLWA 3FBYA 1Q56A 2CGOA 3I2OA 4OI4A 4AFBA 2ZCWA 4CCEA 1L3JA 1LU1A 1OBNA 2WNOA 4J6GA 4UBHA 4EWEA 5AC93 3LAGA 4KWLA 1YQ8A 1PM7A 2A73B 5FK8A 2D98A 3MYXA 1YHFA 3T08A 2IVJA 4UFMA 2FMYA 1QJY1 1ND2B 2DCJA 1LOFA 3VBSC 1NQDA 4GJZA 5BNOC 4JVAA 4M01A 2DUQA 4XC9A 5C3SA 1UY3A 5CFCC 3ETQA 1D0HA 1OH4A 4YNIA 4CVUA 5IK5A 4PCRA 4BMBA 3GBGA 4CPBD 3O1UA 1OF4A 3IAPA 3I3BA 4GH4C 2IFRA 3ES1A 1IOAA 1VMHA 2ARBA 4I0WB 3FX3A 1LODA 2LM3A 4YSFA 3FHAA 1HRI2 3NO8A 1BXHA 3T3YA 4FOYA 1XU2A 2L9LA 4FO9A 5L73A 5FP8A 2QNKA 2DFBA 1ULDA 2ZEZA 3ZXGA 4D8MA 3USUA 4AEMA 2V5YA 2W1WA 3TEWA 4UF0B 5IJRA 2JX9A 3L2HA 4B29A 1G9FA 3N3HA 1ASJ1 1B09A 3RQ0A 1KXGA 5LRRA 2R16A 2P4EA 4IGOA 5C5UA 1LGNA 3HPNA 1PIV3 2BP6A 3NSTA 3IDEA 3QD6A 2HLEA 5LA9A 5FPUA 1OFSA 2WFF2 4HVQA 4KNCA 1BBT1 2PTMA 2RMU2 4BQ3A 3LSDA 3CJXA 4BQXA 4LHLA 2R063 2VW2A 4QX8A 4AF9A 4C0HA 2FZ2A 1RXFA 2EVXA 2XUEA 1X7NA 4QKFA 3A7QA 1NCRC 2JXAA 3ELNA 2VC9A 1HXS2 4URAA 2BZDA 2YDEA 4M3CB 1VBC3 1ZRCA 1C4RA 3AP9A 3NAPC 4LBMA 1RUJ2 1NT0A 5IK7A 3B02A 2ETEA 1RVF2 5LK7B 4UOJA 5LEKA 4DY5A 3MF9A 2J1EA 3H7YA 4IETA 4NWVA 1B35B 5DDJ1 4B4RA 2D3PA 2JG9C 3AK0A 3OGVA 1AL23 1XNCA 1RUNA 2NM1A 1D4M1 3TN92 2VZUA 1O4ZA 2VZSA 4K20A 3WNNA 1NLQA 2KM2A 2G9FA 4LUMA 3MEPA 3WF3A 4JDOA 2OT7A 4DIQA 5EIYB 2W87A 5LK5A 5BV6A 3RDIA 5HV4A 2ZX3A 5A7QA 2WNUC 4NVPA 2Q8OA 4YGEA 4V2VA 4CUBA 2FCUA 3H8OA 5F37A 2Z2SB 4P9LA 1COV1 4XETA 5KXEA 1QGLA 1CAVA 3ZFFB 3O1SA 2JG8B 3MPBA 5IWFA 4QM8A 4NO4A 5DXDA 1J83A 4JTOA 1QH6A 1R081 3GYDA 4B4PA 4GB33 1W2TA 1LHWA 2C1FA 4NIGA 4E8CA 4EZ4A 3B94A 1UNBA 3N36A 2G4IA 1W6MA 3DL3A 1ZBE2 2VCMA 2WQ8A 4DY3A 4QB2A 2RMU3 2O1QA 2LRPA 5K0UC 4QXKA 5KHHA 2D43A 5CISA 3DV8A 1KFXL 1NX9A 1YFXA 4UW5A 4CDQA 2RS52 4XHXA 2XJTA 4DUXA 5A3TA 4W8JA 2G19A 4L92A 1XRUA 1UAIA 2FMDA 4QGLA 4K8FA 3J4UH 1W90A 1RUJ3 3CQOA 4IE6A 2CAUA 4UFLA 3MIHA 2LALA 2GSYA 4RFT0 1YQ2A 2R49A 3KV4A 4P14A 5F5QA 4IESA 5L9RA 2A6YA 1YI9A 4AEKA 3S5AA 1JYTA 2WS92 3K51A 1VRH2 1OQ1A 3PVBB 4YRDA 1J1TA 2BRTA 1ENQA 4WBBA 4D6QA 2BPA2 3IDAA 3WNKA 2DCKA 4ISRA 5A3MA 1YQ5A 1ALYA 1GKBA 1KDMA 2R072 4Q0UA 1WA4A 4FOVA 4FPGA 3SLIA 1JOJA 1FOD3 4XFFA 4Q0VA 1YFUA 5C8CA 2YYOA 2PHFA 4PDWB 3CL1A 3TOJA 3NKGA 4Y3OA 1O4TA 4CE8A 4BB3A 4JRAA 2IXHA 3B01A 1VE0A 2I45A 2ILMA 2P6CA 2PAEA 2Y64A 4YM2A 5A3WA 1QJU1 4XUOA 1GBGA 1J59A 3PLQA 4Z92B 4ZU5A 4X6QB 3RMXA 3DF0A 3VHRA 4IE4A 1QQP3 4IEOA 1Z78A 4LE3A 4MXWB 4G3YC 2VNRA 3NJYA 1RUI1 4K21A 4P00B 4YPJA 1H2KA 5JXJA 4RQPB 1PVXA 3BVCA 1F15A 4OHVA 1VMJA 4DEVA 3AM2A 2RJKA 4FFHA 1GMMA 2J1UA 4GWNA 1O8SA 2YBSA 3SH4A 4AI1A 4LLOA 1O5UA 4E2GA 4FOQA 5GLUA 5T55A 3DKWA 4S2FA 3O1VA 2XLAA 1GZCA 1N47A 2RS53 5DZFA 1JS9A 3C7EA 5FZEA 5BXXA 5LASA 3RFRA 4X6RB 4HKOA 5LBFA 3USUB 4AE2A 5CFDC 4QKNA 2CY6A 1U0AA 1LB2A 4JGYC 3P5BA 1O3RA 5FMBA 3SC7X 2X5IC 4IEPA 4KWKA 2W3JA 4KU8A 3VHPA 5BNNC 3M2MA 2HKXA 2AENA 1VRH3 3EB7A 5F3IA 5JSPA 2HWB2 5JMCA 3VD3A 1PGL1 4BU2A 2GC0A 3DUIA 3I3DA 1XNDA 4Q4X1 3BU0A 4YVSC 2XLGA 1E57A 2R073 4LBKA 5DUVA 4AI2A 5JOZA 3WW3A 4MGKE 3POSA 1QJFA 1U5XA 3UKVA 5BNPC 2Z5WA 1KITA 2SBAA 1NCQA 1RUH1 5IFPA 2RM21 4MGIE 1AR92 2WT0A 3V56A 4ET7A 2ZS6B 4GMP0 4K1ZA 3RPQA 1UN1A 1FX5A 1RUG3 2GC2A 3OBAA 1AR73 4JCKA 2DU0A 2JDZA 2E7QA 5EFUA 2JDUA 3U78A 1HDKA 4YW1A 1MZEA 5GJ6A 1H6YA 1BMV2 2WDBA 4LKSA 3I59A 4MUVA 4UW4A 2J1TA 1XNBA 2WQZC 1MEC3 3HVDA 1FAYA 4ES8A 4WM7A 3ZOIA 2QQIA 2CAVA 4IE0A 1PIV1 3T0BA 5FZGA 3PUSA 1V6IA 1TZOA 1CAXA 3HOBA 3TYJA 3KD4A 4P5HA 4IV3B 3TEZA 1V9U1 4D6SA 4CXYA 2PELA 2VNOA 2X05A 1CAVB 3EHKA 4AEDA 1FT9A 2RJLA 4N9IA 3O1MA 1VBC1 1LHNA 1WKYA 3J8F3 1AUYA 3G7DA 4Q1PA 4I01A 1BHGA 1GOGA 2YROA 4JDMA 4MOAA 3ZMOA 3WF4A 2HWF2 4IE5A 3MZHA 4XMIA 3N7KA 2YPJA 3E6BA 5DAPA 3C7FA 2HYXA 3HWJA 4IV1A 1PO13 1Q5OA 5FZ1A 4YG0A 1AL21 5JPMB 2CGPA 1LOFC 2IXIA 1O5LA 2DVGA 1VBA2 3IT8A 4RS5A 1KS4A 3IPVA 4YG6A 3T2QA 3VZNA 5FMDA 2BVVA 4GIQA 4XAAA 4ATEA 4E4ZA 1RB8G 4L9BA 1BEV1 1XSQA 3FBMA 2YV8A 4QPIA 1ENSA 1K45A 2GN3A 2VW1A 2Q5TA 5FLJA 1GYKA 4M3CF 4CDUB 4O7XA 4LIUA 5APAA 3MIDA 4BQ1A 1HB1A 4HPKA 5FZOA 1A34A 3ZXLA 2ZX1A 1RHI3 5FYSA 2JDKA 3UGHA 2BFUS 2OZ6A 1GP5A 1IGOA 3LDKA 4IGQA 2ZGNA 4XJZA 5F3EA 5FY0A 4YW6A 3IM0A 4GB31 4PBPA 5L7OB 5FV3A 1ZBA2 3RZZA 4DMIA 2J42A 3R4SA 1GSLA 3KV9A 1YLLA 2RS31 1E5RA 2JB4A 1VBE1 4HFSA 3KWVA 4PF5A 1JOBA 4LTAA 2P3KA 2X8KA 1UY0A 3NNJA 1W3XA 3Q8CA 2ES3A 3LPGA 3HMYA 1VBB1 4CPBA 2VOWA 2IZWA 4NJ4A 3HQRA 1STMA 4C90A 2G1MA 1YUDA 4YW5A 1SACA 1V6JA 2NYYA 3ME2A 5F8PA 5LBEA 3BUCA 3UV9A 1KJRA 1W3VA 2P34A 4LA2A 3ASIA 4QX7A 4XFGA 3RZGA 3AMPA 3SCGA 3J7LA 4QX1A 5IATA 2C0ZA 1NOVA 3VBHB 4QX5A 4R8HA 1WW4A 1KFUL 2MEV1 3CZUA 4CEYA 4DXSA 3N9MA 2IXKA 5FYUA 3RGBA 5C7GA 2Q0AA 4NIAA 3NNFA 3ACHA 4QPGC 4FTBA 2DUPA 5A7PA 1ZRIA 5DABA 1YYNA 5HBAA 1GR3A 2ADEA 2BU9A 2QQWA 5JSOA 1UD1A 3WZ1A 1FOD1 1SFPA 4TSVA 3RZKA 1JYCA 4P9JA 1S0EA 1YQ6A 4NHYA 4QB6A 4A7KA 3H8XA 4XIOA 4MV2A 4EZHA 1W2AX 2JIJA 4Y1YA 2OUHA 4XUPA 2A3YA 2O8QA 1ZREA 1IHMA 3K75B 4OUEA 3LEKA 3OPWA 4C91A 2ET1A 3EO6A 2B9UA 2WABA 4ZZ5A 1XOYA 2JEMA 3AKQA 3KHBA 3MI8A 4XJ8A 1AYM2 2D44A 5EZWA 3AMNA 3SEPA 3T4VA 5FYHA 3KHCA 2LW8A 1D2SA 2IXCA 5C4WB 5DUWA 1ZBA3 1CPMA 4CDWC 4CCCA 2EF6A 1VALA 3MBWA 1JU3A 2XL9A 1HJGA 2XJPA 3I2KA 4QQPA 1EAH2 5FPZA 1EY2A 4LHKA 4AHZA 1V6NA 1UU6A 2Y34A 4I3PA 5E8AA 3V0BA 3R4UA 4YYOA 4FVVA 4GWJA 1PHMA 1SLBA 1OSGA 3WG1A 5FZ6A 2X29A 3CLPA 3LKJA 2DVDA 1VLNA 3WCRA 2MNGA 1NZIA 3HT1A 4FAGA 5CG8A 1LESA 3GNEA 2W52A 5JIAA 4ORFA 4CDQC 4JKMA 5J98B 1SLLA 4LQRA 4QDQA 4BXSV 3NMBA 3M70A 2XG3A 5I0RA 4L0PA 3GCXA 2C26A 1MVEA 2CNAA 3B9CA 4LEJA 5FXWA 2ZEXA 4CU7A 3AKTA 5JOYA 1SBFA 2VZRA 4LO6B 5IVJA 1RUC2 1SLTA 1HB2A 5LWBA 1UOGA 1PZ8A 3KV6A 3N35A 3ZPOA 4YLZA 1REFA 1ENXA 2EAKA 3OUHA 4LNVA 1JXNA 1OA4A 4AEDB 1IPJA 4XF1A 2XVGA 5FZ0A 4P9WA 5J36A 1OUXA 4KWUA 3JD73 4CDXB 3KV5A 3OEBA 4NUBA 4UBGA 4YWAA 1IS6A 3NW4A 1C1LA 5KR7A 3DEMA 2VO5A 4ITCA 5C8CC 5EJ3A 1LOCA 2W1QA 2QQJA 5BUVA 2J1VA 1AR71 2VTXA 3D5OA 4HETA 4QPYA 1UY1A 4IV1B 4Q4W1 2VH9A 5FDBA 2ENRA 2XBO3 1S0FA 2GP3A 2OIIA 4BK5A 3H8UA 2XJRA 4QHZA 2RS11 2Y6HA 4QQ2A 1ULPA 3DYOA 3K2OA 5D8AB 1GWLA 4QPWA 3VBUA 4AL9A 3I54A 3H3UA 2ORZA 2JWPA 4XCBA 5JR7B 5DQ0A 1V0AA 2PQQA 1K5MA 3KB5A 4M00A 5FP4A 5ABJA 1R64A 4Q4V2 1MVQA 3OD4A 3AKSA 3VBOA 4DUVA 4FCAA 2QQVA 4NHXA 2D6OX 3KM5A 4WVZA 4XAEA 3WEZA 5FKBA 2GH2A 1G8WA 4XZUG 4Y5SA 1R1A2 3S0MA 1CAUA 3RZLA 4CEWB 1IQDC 2BBVA 2Z4FA 4Y4RA 4ZU7A 4MGZE 3MIEA 2IC1A 3PU3A 3PVOA 3KCCA 1S0DA 4ZY9A 1X36A 3H42B 4QXBA 3SISA 1YNAA 1UYYA 1UZWA 2IWGB 3VKFC 4ZS3A 1AXYA 1GQGA 5EYYA 2OUJA 3B3QE 1ZRDA 4HK9A 3AB0A 3O0WA 2V4AA 1CQ9A 4TXWA 3ZX7A 1PO11 2HWE1 2WAOA 2WZR3 2BBAA 3QH6A 4CCMA 1ASJ2 3NV4A 2ZPXA 4DZGA 2JE9A 1DLCA 1H4HA 1XC6A 3SQOA 3ZN4A 1WCKA 2BQPA 4LE4A 1JUHA 3PVEA 3THTA 2D3RA 1BBT2 1DZRA 1AYN2 1RMU1 4EJRA 3GALA 3K3NA 1RGSA 3E1F1 3MW3A 4YW4A 3GCWA 1C3HA 1LGCA 1Z7S1 4WZFA 1J84A 1ODMA 4RA0A 1WMDA 3VDDA 4HSJA 4K1YA 1NCQC 1POV0 3J26N 1QY4A 3WSOA 5C9AA 4WM8A 1SPPA 1AJKA 3KLSA 4E9KA 2NP0A 5FAXA 1UX7A 4AGRA 3NVCA 4HT1T 3QLQA 2VM9A 1URXA 3F2ZA 1ZZ7A 4R9CA 5FO9B 1Q8OA 3NV1A 5FZ9A 1ZNPA 2ZHMA 5C3RA 4IL7A 1NYWA 3C7GA 1X33A 5DDJ2 1NA1B 1RUE1 1EPWA 3T2TA 1H8TB 1D4M2 4HXCA 4XBQA 2WKKA 4ONUA 1BVVA 4WM7C 5KWRA 3RZJA 5FWEA 2W1UA 4RHV1 1QXJA 3J9SA 2D6MA 1ND2A 3UNPA 2X10A 3ZVXA 1WLWA 2E31A 1UY2A 2VVFA 4DRVA 3VKMA 4H55A 4NROA 1GWKA 1U12A 4XOGA 3U0ZA 2PHLA 4CU6A 4HVOA 1YWKA 4FPHA 1JN2P 2EIEA 4YVWC 2DCTA 3DPRC 2OZJA 3I2FA 4MVTA 4GMP1 1FPN1 3ILRA 4F83A 3E5XA 1VB4A 3OD0A 4JKLA 1LEMA 2B42B 1X50A 2WWJA 1XYPA 3I3QA 1UKRA 4DO0A 1CGPA 5JXIA 3HIFA 3HT2A 3U4SA 3LDRA 2VD7A 2XONA 2QCSB 4RS5C 3BTAA 3VD5A 4XDQA 4S2GA 2D93A 3DECA 4P02B 2YXSA 3W21A 5ACA1 4FPLA 1X9TA 1UKGA 4MLOA 1QWRA 4QPIC 5IVYA 4MGTA 2WUHA 3NJXA 2DVBA 2DV9A 3HNYM 3NQHA 3N7MA 2Y33A 4Q8LA 2JDPA 3W5MA 1UY4A 1G9DA 2DTWA 4AQTA 5M0TA 2WN3A 2QVSB 4X8PA 1ND3B 3WINE 5CKNA 5JOWA 1LECA 3SKJE 3E6CC 3S7EA 1XE0A 2EIGA 1G9BA 3SCFA 1UZYA 3OF1A 2D3SA 5F7UA 3NNLA 3OBZA 3DXTA 3F95A 4PQQA 4W65A 5I8YA 3PVNA 3O12A 1QJU2 4TN7A 1QHDA 2TBVA 5FZLA 5FR3A 1N1YA 2ET7A 3IMMA 3BCWA 2C9KA 1CZVA 4NE9A 4AOCA 1A8MA 1ZVFA 1RUI2 1VP6A 2HWC3 2DURA 4AI0A 4IEQA 2FCTA 4AI9A 3AFGA 3EXUA 2D40A 4UT5A 1MS5A 3HNMA 2N7GA 3DN7A 1PVC1 3ZXKA 4XQ4A 4M0HA 1O6UA 3FE5A 2GMPA 4CEYC 3ZFFA 2JG8A 1XBFA 4AYUA 1SCRA 3D3AA 3WNOA 3C7HA 1UCXA 1PGSA 3MF6A 2FDIA 4QDSA 3FN9A 1TG7A 2OPKA 4YZ4A 2PAKA 4LK7A 3MW4A 3VHOA 1S0GA 3MIGA 1W8WA 5KHJA 2VQAA 1BK0A 3WDTA 3CIHA 2O0OA 2Z79A 2YU2A 4WV8A 2UY9A 1WUVA 3POBA 1UQXA 1AR63 1UZZA 3PJQA 2Y6FA 1XU1A 2RV9A 4V2WA 1PGL2 1JZ6A 1W6PA 4Q4X2 2FDFA 1W99A 1OA2A 4B7EA 2VZVA 4TLFA 2D6LX 5IK4A 2NPIA 3T0DA 4YARA 4EN8B 2XVLA 2G9GA 3VDDB 2YUEA 1L7LA 3ACFA 5FY9A 1RC6A 1UU5A 1SPPB 1ONAA 4WM8B 3RYPA 4CP1A 2WR9A 2A1XA 2VR4A 1PZ7A 4FPEA 3EMRA 1UMIA 1UO9A 1GZWB 3ZXAC 2QZ3A 3AZWA 2BGOA 2EA7A 1VRBA 2YB7A 2JDAA 1OLME 4XEZA 1IPKA 3OY8B 1RUF3 3ZXEA 4E8DA 4LKEA 4CUAA 1J3QA 3OBTA 4AGGA 5JXHA 3AFKA 4IEZA 1R092 1PX3A 3EYPA 4PDWA 3MUY1 2R7EB 2WYFA 3BALA 2R1BA 3LF7A 3POWA 5A3OA 5C8WA 5FO7B 2WNUB 4EN0A 5E88A 4YM3A 1D0GA 1IZ3A 1HX6A 1N1SA 2QQKA 1SZBA 2UU8A 2WNVC 3I7DA 4N53B 3ZXFA 3FHQA 3IMNA 4PT6A 5FUNA 3C3VA 4XDOA 4MXWA 5FZIA 1GV9A 1S55A 1W8TA 2D5HA 2EXIA 2QJVA 3GM8A 4Q5OA 4MADA 3TNQA 1V9U2 2EXHA 2K0GA 4RQPA 3WP5A 2OXBA 5FZHA 2XPJA 5J09A 2IXLA 4NPLA 5CZKA 2RR12 3RRDA 1RJ7A 1C8M1 2VVEA 2DVFA 1H0BA 5CA6A 5GALA 2UYBA 1V6MA 1AHSA 1S2KA 4XE9A 2ZHKA 2UURA 4Z07A 5AFBA 4I0AA 5A6YA 1LCLA 3H1MA 5A7WA 4QXHA 4KU7A 1HRV1 2JE8A 2UWBA 2JKBA 2QQMA 5DN2A 1FYUA 4DXZA 2Q30A 4INDA 1W2UA 3OTFA 5JVVA 1YO8A 2DUOA 3WHTA 3QOPA 3PJYA 1W9TA 4PF1A 3O1TA 3LIGA 5H9PA 2BJSA 5FIXA 5L19A 3VBUC 1DGWA 2TUNA 1CR7A 2AC1A 4XF0A 4BZ4A 2FDHA 1VAMA 1DQ6A 2SLIA 1BEV2 2BUKA 2ZZQA 3ZO0B 4BWOA 5B4XA 1K5MC 1P8JA 4O9GA 1YEWA 4I02A 4Q4Y3 3OG2A 1US2A 3WCSA 3EBRA 4KBZA 2CWMA 2FDGA 3FLTA 4D69A 2CTVA 3MFAA 3LEIA 1AXKA 3IIAA 4OQ8A 2VBBA 1S2BA 1YIPA 1YI7A 4Z2AA 1J3RA 2PN5A 1ULFA 1VAKA 3JBG2 5CBLA 3IAQA 2XLFA 2Q8CA 4RR3A 4BPZA 4FXGB 4W6WA 5FYYA 1EYBA 1S0IA 3WUDA 1CZTA 4AXOA 3KMHA 1WD4A 4FFGA 5IW0A 3OEAA 4AFCA 1OVSA 2YBPA 2RS32 4NAMA 2NMOA 5IHRA 1VBE2 2PLV1 4Y33A 1CVNA 1YRZA 5CYYA 4JGZA 3GGLA 1JYXA 2F4LA 4IEYA 2E32A 1H9WA 1VBB2 2W1SA 1VBD2 1NQJA 2J1RA 5FZ7A 4MG2A 2O14A 3QCWA 1WA6X 3WF1A 1HRI3 2WJSA 4BH9A 2D5FA 5I0DA 1POQA 4IV3A 1LTEA 3WW4A 3BKZA 5C9AC 3U14A 2BFUL 1UYXA 3GJBA 3SKVA 3AVRA 4FP3A 4QX0A 2FHRA 5CFDB 3FUOA 2MEV2 5DAVA 1QIQA 4D7TA 5JUVA 1FMD1 2I07B 3RVHA 2WBKA 5HV0A 3S57A 1RUD1 1JZ5A 1U5IA 5FJHA 4F8AA 2Y6KA 4XF9A 2VMGA 3P6BA 2VY0A 1N3OA 2BV4A 1XNAA 2WFF3 5IVBA 1DHKB 1OKOA 3CJIB 2A6ZA 2OYZA 3THCA 1I1EA 4YFZA 2ZA9A 1NE4A 1LOEA 1ND2C 1V70A 4Q1RA 3HN1A 2BNMA 1W0OA 4O65A 1NE6A 1HXS3 5FO8B 4E4DX 1FV3A 1W6PB 2DBNA 3LA2A 3KCXA 4HK8A 1MQTB 4XBLA 1F2NA 1OKQA 2EXKA 1JH5A 3OCPA 5A6ZA 5B2GB 4BDVB 5BNPB 1POV1 1TNFA 1GFF2 2JDMA 2XB6C 4RGAA 3WNMA 1Y9QA 2CDOA 1RVF3 4QXCA 3ZFGB 4A45A 4CDUA 1PK6B 3D4KA 3VBFA 2AZ5A 1HB3A 4LA3A 4BISA 4DB5A 5F1RA 4OMDA 3U4XA 3MV01 5IVCA 1MS4A 3TN93 1YCIA 5JOXA 4Y1ZA 2VZTA 1QDCA 1G9AA 1K12A 4Q26A 3WW1A 2DF7A 1V6KA 4ARYA 1VBD3 5T54A 5L7OA 1HN1A 3I2GA 4MGQA 5FPXA 4N43B 4AWDA 4XABA 5A70A 4QHBA 1ZZCA 4LPLA 4KBBA 3JZVA 4COWA 1O4YA 4UAPA 1H2LA 1WW6A 3NNGA 4M4PA 1AR61 3PMEA 3VDAA 3E5QA 3KCYA 4AVSA 4I09A 2W39A 3C7OA 2ARXA 3IZOA 3K4DA 4HN1A 4R52A 2BWCA 3ZYRA 3BOWA 4NHKA 1HIXA 1IKPA 3AP5A 4JTNA 4W6XA 3BB6A 3VBHA 2WZEA 1W8UA 1TNRA 1ZBE3 3FL7A 4FPCA 3POGA 4B8EA 2X53S 3DXUA 4K8RB 5FK7A 1AR81 1W03A 5A7WB 5E6HA 4K6BA 1W9WA 3B5LB 1B35C 1RUF1 2AACA 4MH0E 1JHNA 4CXWA 3HQUA 3HBZA 1DQ1A 1QJX2 4Q4W2 5KHIA 1O3SA 1PZ9A 3L9JT 2VZ3A 5AC91 5L36A 3ZSLA 1QMJA 4LBJA 5JZGB 2DTYA 1FXZA 3D82A 3ILNA 4JRLA 1BK1A 2RS12 2WS93 1QNYA 4E27A 1ST8A 2AEZA 1D4VB 2RG4A 3IIIA 5A1FA 4NHLA 2YC0A 4EYUA 4FTEA 4GWMA 1W8FA 4FPKA 3AKPA 2VTFA 2R0FA 2BWAA 4YW7A 2PHXA 5JXGA 3JCIA 1BQPA 4XQWA 4OQ9A 2LROA 3WLUA 3O0VA 4ZU4A 5KHGA 2A3WA 1UYZA 4CU9A 5C4WA 2JG8C 1AL0G 2A3XA 3CMGA 2XKPA 1PO22 3ZSEA 3ZFEA 2VZOA 5E1RA 3W5NA 3HR9A 4RR3B 1GOFA 3PUQA 4A3XA 1W0PA 1UW8A 4R4ZA 1ENRA 1WLCA 4EROA 2H0VA 4PQ9A 3RYRA 2W2IA 5FUIA 1GP4A 4L8QA 2WLQA 1W6OB 1TME2 4HG6B 1HV1A 5F2WA 1ZZ6A 3USSA 4AI3A 4LBQD 4DS0A 3MV11 3SEEA 1Q43A 2HWE2 3AX4A 4JGZB 5EPAA 3M3CA 1CPNA 2HWD2 2W9XA 3J7MA 2DDUA 3LEMA 3OPTA 1L7RA 3LSEA 5A3LA 4KL1A 1V00A 1RMU2 3LCPA 2WO7A 3UK9A 5F6LB 1DIWA 4IUGA 4Q4Y1 1SHWB 2YGMA 3T1MA 2R061 1Z7S2 3R6SA 2WAAA 4IGPA 2JENA 3E5UA 4KQ7A 5F3GA 5ISLA 1CWPA 1T2XA 1HLCA 4FBFA 4AVCA 2VOTA 4JKKA 4CDXA 4LHNA 2OS2A 2WQ4A 3AZXA 4FPFA 5EJ1B 4QWNA 3WQ7A 5I0UA 2KA3A 2ZAHA 4FTSA 2ZXQA 2HWB3 5JIUA 1UPIA 2ZMKA 3BTYA 1F5FA 1DZTA 1RUE2 4AAPA 3H8RA 2GN7A 2ZHLA 4I3GA 5LA1A 3MUZ1 1HB4A 3WVJA 4J25A 1LHUA 3GZTB 3WXPA 5FCCA 4XFCA 4RHV2 2OQ6A 4EN7B 4HANA 5D8AA 3W20A 4TTGA 2K9ZA 4RQPC 4CCDA 3D0SA 3AZVA 3OUIA 3WNPA 5C70A 2VMEA 2BGPA 5FMOL 5G04L 5EXOA 1Q8PA 1A6CA 1AR93 2WN2A 2QQPA 2UYAA 4WVWA 3OUJA 3H3ZA 5EHDA 3VBFB 5KHKA 2ZGQA 4PIZA 3UJOA 3VKNA 3RZMA 5D21A 4EWAA 1LHVA 2WFPA 1PGW2 1FPN2 3S30A 3H3LA 4Y1VA 4BYYA 4CEWA 1OXCA 1WMFA 3WNLA 3AJZA 4WVVA 3I3MA 1ZA7A 3FHIB 5HCBA 3ZYBA 5HXVA 3M3IA 5FZ8A 3V65A 4AQ6A 3JB8A 1AXZA 5DAXA 5IAXA 4QU1A 3PIGA 1HW5A 4MHUA 2RMU1 5C3QA 1WBFA 5JSRA 5ACA2 5A6XA 2JB8A 4ZXKA 3WF2A 4UYBA 5A32A 1U5YA 1Y9MA 2QUOA 2JE7A 3JU9A 5FTTC 2XJVA 3GDBA 1XE8A 2LS6A 5FP9A 4BA6A 1LGBA 2B46X 3FLRA 3KQRA 4QQLA 3LA7A 5DG2A 4NN0A 4Q0PA 5LEJA 1RUJ1 4DNYA 3WHUA 2HWF3 5DAQA 3PNAA 4HOOA 2BYVE 4R9DA 1D2QA 1OT5A 2ERFA 2AEYA 2C9AA 4QKDA 5C5TA 4IW3A 1H8VA 5FFOC 3OPZA 1VBA3 1JYIA 1CAWA 3RS6A 3WG4A 3T2OA 3MIFA 4AVAA 4S2HA 1NG0A 4P9IA 3A4UA 5CKMA 1JYWA 4BM8A 2ZBJA 2ZGRA 2AUYA 4FPOB 5ANQA 1NA1A 2GC1A 5KBFA 3U37A 2VCAA 1KRIA 5JMOA 1H8TA 1W9FA 1W39A 1XNTA 3E97A 2VQ0A 1G7YA 1IG3A 3POEA 4R4XA 3MLJA 5FLHA 4AW7A 1OF3A 1TMF2 3VUOA 2VQUA 1DGRN 1QH7A 2VZPA 5IVVA 2ZABA 5CU1A 2W91A 1QQP1 3K4AA 4QGMA 1EUTA 3RSJA 3CZJA 4IV3C 2WWUA 3AMHA 4LORA 4ASLA 1EV12 2DU1A 1CIYA 1W6QB 2ZKNA 3DGTA 4OYUA 4XTPA 3ACLA 2GDFA 3WF0A 5J96B 1ZZ9A 1PVC2 3WD5A 2P5BA 3WDVA 4JC1A 4DOUA 3AP7A 2RDQA 3ZFEB 4D7YA 4DRRA 2R042 2IXJA 1IS5A 2QDNA 1WLDA 3NWKA 4K40A 1ZBE1 1MZ6A
chains in the Genus database with same CATH topology
4YW2A 2BGCA 4XJWA 3AXDA 4Z2WA 5FOJB 3ECQA 2RS51 1H2MA 2PA7A 4XHBA 2O8OA 4B7KA 3WDXA 1Y3TA 3ATGA 3HD8B 2JJ6A 1MS1A 1QNWA 2PAMA 2UWAA 4AFAA 2BTVC 3MICA 2HEWF 2Y38A 4GQ7A 1REEA 2H6BA 2GC3A 4PLMA 3KS7A 4KGQA 1VRH1 3OJBA 3M1HA 3RI9A 1OPOA 4MYEA 3ZSJA 3CF6E 4HKLA 4YGCA 1A3KA 2GAUA 2E51A 2R071 3UKNA 2A70A 1NXMA 3TB0A 2JICA 4DQAA 3I8TA 1V6OA 5T50A 4Y24A 2ZMLA 2Y0IA 1IQAA 2TNFA 1ND3A 3V0AA 4FPJA 1TMF3 5L7OC 5I0TA 1OLQA 4FAHA 1RUG1 3WNXA 3H9AA 4S2DA 4U36A 3VBSA 3Q9OA 1AYM3 1EV13 3KT7A 5CFCA 1QJY2 2YGLA 3SXWA 1MEC1 3GHMA 5BY5A 4IERA 2HJIA 1EAH3 2XH6A 2ZX4A 4GH4A 1YJLA 4HN0A 3DPRB 3VLBB 4LBOA 1ULGA 4XBNA 4K9SA 3VBRB 4PIYA 3VBHC 4URTA 1SBDA 3H1YA 2R6QA 1C8M2 2I2SA 4LT5A 1OQEA 4MXVA 4SBVA 5FREA 2A6VA 3J8F1 5DZEA 4MGYE 3VZLA 1HRV2 5J3UA 3BOPA 1RUC3 4RSUA 3G6JB 3ZN6A 4XXPA 5A32B 2EAAA 2OA2A 3LOBA 1FNZA 4COVA 2ZGTA 4XFBA 4FT8A 1CESA 4Y22A 1YIFA 3H7JA 3B9IA 5C4WC 3NAPA 1AR91 1MZFA 1KJLA 1MR5A 4LO8A 1BCXA 1AZDA 2A6WA 1WMEA 3MFCA 4TZDA 2WINB 1RHI1 1ZM1A 1J1LA 1GZWA 1H9PA 4LULA 5EWSA 1CX4A 2QZ2A 1CAWB 3QH7A 3OY8A 4BMEA 2Y26A 2NLRA 4XFAA 3R05A 3WX5A 2PLV2 1F31A 3TRSB 2VOVA 4AEJA 4GXLA 2E7TA 4ISQA 2CYFA 4H7LA 2WNUA 4Q4V3 4AI8A 5GM0A 4N53A 1Y43B 2FBEA 3SMHA 4N9HA 3TWIA 5CAZA 4NPRA 4AHXA 3BPZA 1R1A3 1C5IA 1H30A 2B39A 3N4MA 4A7YA 1KQRA 3CNAA 4AEDC 1DU3D 2ATFA 5H9SA 1COV2 4CDXC 2RHPA 3ZYGA 1KS5A 3AJYA 1QU0A 3U10A 1H1IA 3KZ4C 5T5OA 1R082 1FMD2 5JPNB 1X8EA 1ASJ3 2VNGA 1RUD2 1VBA1 1GLHA 4LBQA 5K0UA 1LKNA 4IV1C 4YGBA 1GICA 1QXRA 4ZKTB 1AX2A 1BBT3 1AYN3 3U07A 1OOPB 3ZYIB 3EQEA 2WZPP 1AX0A 1DZQA 2NQYA 5IT6A 2EXJA 1WD3A 2FZ1A 4X8NA 5T3NA 2V09A 2VECA 3WDYA 4CP2A 5CNAA 1FNYA 2ZOEB 4XILA 1ZBA1 3M4FA 5DDJ3 2WA3A 3RNSA 4CEWC 5JCTA 2ZGLA 5KXCA 1D4M3 1HQNA 3INAA 4V1PA 3EJKA 3V0AB 2AR6A 3TBDA 2VOXA 1X82A 1AF9A 3VBSB 5BNOB 1J3PA 5T5LA 4HMZA 4CTEA 1OI6A 1UU4A 4AHWA 5CFCB 3ALQA 1C57A 3AYCA 4KG8A 3SNMA 4JQRA 3WP3A 1LENA 5FQ0B 4GH4B 3OYWA 1T6GC 1OFNA 2VULA 3D8CA 3PMSA 3POYA 4XW3A 3WY6A 5CFDA 3GF6A 3JD71 3M3OA 4DPNA 4JGYA 1AR82 2DCYA 2GH8A 4NHMA 1NA1C 3WP6A 3B00A 3FUQA 4Y20A 1H8TC 5TSWA 5J37A 5AC92 3CJIA 2Q1MA 4GKXA 3W9AA 3ZN6B 1O7FA 2XBO1 1MS8A 2E9QA 3QBQA 4AGVA 4AVBA 3U11A 1NCRB 4CYDA 1X8MA 1MQTA 4Y22B 1EAH1 4KH9A 4CP0A 3NAPB 5BNPA 1LJ7A 2DFCA 3AXEA 2V73A 5J7MA 4META 4XF3A 3ZFGA 1QOOA 1PK6A 2VUAA 4E4SA 1RUH2 3RJRA 2RM22 2JG9B 1WW5A 2WT2A 4UXAA 5GZFA 2ZGSA 1NY71 5F9TA 1QJU3 2CGNA 2ZKLA 3NKTA 1APNA 4N43A 2XUMA 1NZCA 1RUI3 5KC5A 1RITA 3MGUA 1G6NA 3AYEA 2WZR1 2A71A 2WC2A 4LO4B 5H9RA 3ROUA 1DFQA 1PIV2 1C8NA 3BODA 3FLPA 1V6LA 1AVBA 4L97A 2R062 4FQ4A 1SFYA 1DG6A 3VHNA 1ND3C 3GBFA 1VBC2 5DZGA 3M7AA 3VV1A 4OHXA 4QT6A 4D3WA 3RWNA 5GLTA 4LBQB 5BNQA 4GA9A 3A0NA 5K0UB 5IUQA 1S0JA 3M3QA 4XPVA 3URFA 1DYPA 4Y1XA 1YJKA 4Q4X3 4YZ5A 3RJ2X 1AL22 2QFEA 1QDOA 3ES4A 3PTYA 2NMNA 5JZGA 3M3EA 4Q4V1 2EALA 1QOSA 1XYNA 4FQZA 1RUH3 5ABJC 2HYKA 1R1A1 2RM23 3VBOC 1GNZA 3AKRA 4M0NA 3H50A 5C6CA 1KD7A 1SEFA 4FPYA 3ZSKA 1R093 1ZZBA 3AMMA 3NV3A 4GB32 4QQHA 4B3NA 1I6XA 2UY8A 1W6OA 3RMYA 2GNDA 2KXLA 4L11A 3WG2A 1AYN1 1V9U3 2MPFA 1BKZA 1GANA 3E6DA 3S7IA 3SH3A 1U5ZA 3WG3A 3RYKA 4U2AA 2RR13 3MW2A 1ZZ8A 5T5JA 3OYWB 2PHTA 2R32A 3VDDC 3HAGA 1O91A 4RGGA 3B7MA 2A6XA 4OUMA 4WM8C 2PHWA 4OVEA 3WV6A 4QPGA 4OHYA 2A75A 3FWEA 2DWRA 1ZRRA 3WDUA 5KXDA 2VVDA 3FFQA 4M3CE 3H0OA 1LOGA 4JGYB 1VIWB 2A7AA 4W6YA 1CJDA 1W6NB 5FRAA 2X5IB 4YFWA 4K3UA 5BNNB 1J58A 4Y20B 3WDWA 1BEV3 1FOD2 3FZ3A 1NLRA 1SBEA 1OQDA 1OA3A 4XJ9A 2GNMA 5GZDA 4ES9A 3CEWA 4YVSB 4AK3A 1F5JA 1FV2A 3KT1A 4N53C 4OLLA 3ZYJB 1BJQA 4IEWA 1QQP2 1LEDA 3JBG3 4CDWA 4H7MA 2D6PA 2HWC1 2ZGOA 3KSCA 5H9QA 2AH2A 2RS33 4G4FA 3OBRA 1UIJA 2ZHNA 2Z69A 1VBE3 3ZSMA 3THPA 3CO2A 4KWJA 4Y26A 2XHKA 4FSJA 2DYCA 3ZPYA 4F7ZA 2JD4A 4AHYA 3SCHA 1C5HA 4OFGA 1VBB3 2NZ9A 5I93A 4FP2A 3SH5A 1LU2A 4I30A 2XL7A 1SLAA 4HVRA 2DVAA 4N7IA 4Z1VA 3JQWA 1H2NA 1Q8SA 3P3NA 4OZXA 2VG9A 3KGLA 5FOBB 4XTMA 1YFWA 2MEV3 4P9YA 1FATA 1PMIA 4Y1UA 2E53A 3TNPB 3KT4A 1DBNA 1DQ5A 3WT3A 2XVKA 4A7ZA 1S1AA 2QE3A 4YM0A 4JV4A 1DGWX 4I2OA 1RUG2 1O3TA 4ATFA 1AR72 2ZGPA 1SFNA 5SV5A 1H1MA 1MS9A 3JUUA 1MEC2 3ZXDA 1AX1A 5E16A 3D0JA 2CL2A 2PFWA 3QACA 1H1AA 1QKQA 5DUUA 3MLKA 4NWWA 3WW2A 1W6QA 1N3PA 3ZFFC 4PBOA 4PIXA 5I8SA 4AFMA 4IEXA 3NL1A 2B8MA 3J8F2 2DCZA 2LUWA 3JQXA 4GALA 5CVRA 1F8VA 3CJIC 5AVPA 4LLFA 5FLIA 1G9CA 1O3QA 2YY1A 4LUKA 2VOKA 1RL3A 1PO12 3L2YA 4QD2A 2VGDA 4XJUA 1CD3G 2ZZJA 2ZAAA 1MQTC 5KXBA 4HLTA 4Y5Z0 4HBNA 2GU9A 2P3JA 3ZFGC 4YG3A 1PK6C 4IEVA 2P17A 5EYXA 1BVP1 4QPGB 1DQ2A 4Q4W3 1QJX3 1EPZA 1R091 1RHI2 2W08A 4B4QA 2ZJCA 1RJ8A 4YW3A 3GBWA 4RL7A 1SMVA 2RS13 4H14A 1UL9A 3VZMA 4N43C 4PDWC 4DINB 4R9BA 1UX6A 3VZKA 4R9AA 5K8SA 3IDBB 4COUA 1WW7A 3IN9A 4FOWA 1DDLA 3SHRA 2VUJA 1WGPA 1PO23 2E6VA 2XJQA 1H4GA 4CDWB 2RR11 4OHWA 4P9GA 4YVWA 3GZUC 4C0BA 1HRI1 1SLCA 2QKDA 2WSVA 3DPRA 3IDCB 5T5PA 2GMEA 3VBRA 1W6MB 1LOBA 4TWTA 1TME3 2PHRA 3X29B 4AQ2A 5J48A 2HWE3 5SV8A 4CDQB 2HWD3 2W0XA 5GZEA 3VKLA 2HEYF 1HV0A 1CJPA 1REDA 2WL1A 2WFF1 1RMU3 4EWDA 5JZGC 2D6NA 1I5ZA 1Q8QA 2B5HA 2BW8A 3GZAA 1Z7S3 4N7UA 3MIBA 1HXS1 2P2KA 3R0RA 4UW6A 5I91A 5GLZA 4P9XA 3JBG1 3CU7A 4LO7A 4J1XA 3AP6A 1ULEA 3VGIA 2D97A 1RVF1 4QQOA 1A8DA 1LOAA 1VR3A 1RUE3 5C8CB 4LR4A 4RR3C 5JDBA 2R30A 2VW0A 2AGSA 2Q1ZB 5D1IA 5A33A 3TN91 5FBZA 4RHV3 1JW6A 4E2SA 1GNHA 4ASMB 4GKYA 5AVAA 2XJSA 1VBD1 3UJQA 4JGZC 3AYAA 1DF0A 3LGRA 3I4IA 3FMGA 1KDKA 3ENRA 3RI8A 1WBLA 3AZZA 5K9YA 2WIIB 3O7OA 3O5SA 3OGJA 4GMP3 4C1XA 1BYHA 1FPN3 4BLJA 2OW4A 2D6KA 1XYOA 3MPPG 4SLIA 1ZA4A 1DGLA 5JI7A 1UMZA 3VL8A 2TEPA 2Y0OA 4WZCA 1WLTA 1OMIA 2I74A 4OI2A 4HZFA 5HCAA 1CN1A 3JD72 3P3PA 1UF2C 1N1VA 3AYDA 3LZZA 2C5DA 4YM1A 5ACA3 4XMAA 5KC6A 1MS0A 2BEOA 4OI1A 4BIFA 5CADA 2BVBA 3O14A 1MS3A 1DYKA 4H3WA 4IEUA 4Q2FA 2XWBB 4XJAA 3W59A 1OOPA 2K2SA 2XBO2 3B93A 4GULA 4AG4A 1S0BA 2WS91 4EN9B 3WP4A 1NCQB 2PHDA 4CRQA 4CDUC 1F9KA 5I8TA 3VBFC 3GHNA 4XQDA 2R0HA 4L99A 5BYNA 3N7JA 1YXWA 3D6EA 4Q29A 2B7YA 5AFEA 2VMIA 1I3HA 2ZX0A 2F4PA 3I59B 1NY72 4AQSA 4Q0SA 4WM7B 1SCSA 3APBA 4XIKA 4C1WA 4G9SB 1OLRA 1OPMA 2WNVA 5BNOA 1CAXB 1DQ4A 2WA4A 2ZX2A 4DFSA 2WT1A 2WZR2 4AVVA 4Q8KA 5CIRA 1PVC3 4HKWA 1AJOA 2R043 2VU9A 4JDNA 2P3IA 1UIKA 5FQ0A 5JI9A 4YVWB 5HCFA 1I9RA 3MLLA 5HI0A 4Z82A 2BNOA 1RUOA 4WVMA 1OHFA 4BCUA 3ILFA 3M8LA 1QJX1 1QJZA 1ULCA 1VAVA 3R4DB 4OHZA 1RIRA 2Q4SA 5I0SA 2ZTNA 4OULA 3TAYA 4RS5B 3IPVB 1SDWA 4QM9A 4Z8BA 2GALA 2HWB1 2LTNA 2W68A 1Q8VA 2XJUA 3LWCA 1TEIA 4QPIB 2XWJB 1MACA 1Z0HA 2ZGMA 4K7JA 3VZJA 4PLOA 4HPKB 1XE7A 3IKWA 3H1WA 4Q0QA 1QXPA 4BE3A 1PO21 1NCRA 1XNKA 2NN8A 4J1WA 4XFIA 4HSLA 1HQWA 2GNTA 2JECA 3WUCA 5F6KA 2HEVF 3ZFEC 1Y7BA 5GZGA 4OI0A 1JBCA 2WNEA 2YZ4A 4QU2A 4XXAA 2QDRA 2Z42A 4YGDA 5GKAC 1JUIA 4NOTA 1TME1 2YMZA 2PHUA 4MX3A 5A33B 2GNBA 4CZSA 1LHOA 2JG9A 2ZGUA 1BMV1 1QJY3 1FI2A 2UWCA 1HQLA 2HWD1 1A78A 3FFZA 1HKDA 3IWZA 1M06G 2VPVA 3VN4A 3B69A 4RD7A 3UL2A 4YZ2A 3ST7A 3FC0A 3ZIWA 3SITA 4N90A 3WQ1A 5FMOS 1C8M3 5GLVA 5BPXA 4EN6B 1NXD1 4CEYB 1DQ0A 2AREA 4PJYA 4BOWA 5LRSA 1CONA 4XYXA 2VMHA 3LB9A 2GMMA 1HRV3 2CV6A 4XF4A 2HWF1 1SLIA 1PNFA 4JAAA 4FXKB 5T52A 4D94A 4LO5B 4BLIA 1RTVA 3BIWE 4COYA 4Q27A 1GZ9A 2CWSA 1JTZX 3K48A 1IS4A 1ZX5A 2FQPA 1XXNA 4COZA 2AYHA 5GZCA 1WCDJ 3VZOA 2H6CA 5D8AC 4KG0A 1IS3A 2WWSA 4IXLA 1C1FA 1N3QA 3LA3A 5DG1A 1R1ZA 1BZWA 2IFWA 4QMAA 4YZ1A 5IK8A 1LRHA 1PGW1 4PLNA 2B45X 3V0BB 4TYSA 2HWC2 5EV7A 3VBRC 4HL0A 4I0BA 1C28A 2ZGKA 1DGRA 4O9EA 1ZYBA 4BHPA 3WR0A 3VKOA 1LULA 2PLV3 3AMQA 2RE9A 4LBNA 1SQ4A 2GZWA 2WSUA 3UKTA 1QF3A 5CB7A 3MDPA 2WNVB 5JAXA 4L2NA 3ZXJA 3OGGA 4XFHA 1COV3 3ZMNA 1AR62 1Q3EA 1N1TA 1WCSA 4MSVA 2VXRA 4IQPA 4M3CA 3BU7A 4KGGA 1R083 3ZN5A 2BNNA 1FMD3 5C33A 1UPSA 4AFDA 3W58A 1S0CA 1RUD3 2E7AA 3O0XA 3ZYPA 4WVMB 3WQ0A 3PHMA 1LR5A 1B35A 5K7PA 5E89A 1VJ2A 3ZDSA 3N7LA 1TMF1 1OD5A 1W6NA 2X5IA 1RUF2 4NR1A 2YHJA 3VL9A 3WOGA 5BNNA 3JB4C 4UW3A 3VBUB 3AP4A 3NV2A 2R1DA 1POV3 4LBLA 1K5MB 4XZPA 5ABJB 1DLLA 1AYM1 1EV11 3KGZA 4D7SA 3VBOB 4YVSA 1XQNA 3A0KA 4Y4YA 2OVUA 2R041 3NJZA 1CAUB 1IKQA 3C2UA 3ZIXA 3HQXA 1YFYA 3IBMA 2F6BA 2H0BA 4OUSA 4AVTA 1EP0A 2XKOA 1M4WA 4QGNA 3LOIA 3S6PA 3T1LA 4F3JA 3I2DA 4MZUA 1PNGA 2ZMNA 3V64A 2A5ZA 3RG0A 2XGXA 1MZ5A 3FJSA 1NLSA 1TE1B 1CIWA 1OOPC 2MHFA 4BIOA 2D7FA 1RUC1 2ZACA 1VB2A 1RINA 3AZYA 2WLPA 2E63A 5C9AB 4YZ3A 1QOTA 2P37A 1TQ5A 4A2UA 1G86A 2PYTA 4Q4Y2 5DUXA 1AR83 1ZRFA 4E2QA 1GQHA 5GLWA 3FBYA 1Q56A 2CGOA 4OI4A 4AFBA 2ZCWA 1L3JA 1LU1A 4J6GA 5AC93 4UBHA 4EWEA 3LAGA 4KWLA 1PM7A 2A73B 2D98A 3MYXA 1YHFA 2FMYA 1QJY1 1ND2B 2DCJA 1LOFA 3VBSC 1NQDA 5BNOC 4JVAA 4M01A 2DUQA 5CFCC 3ETQA 1D0HA 4YNIA 5IK5A 4PCRA 4BMBA 3GBGA 4GH4C 2IFRA 3ES1A 1IOAA 2ARBA 4I0WB 3FX3A 1LODA 2LM3A 4YSFA 3NO8A 1HRI2 1BXHA 4FOYA 1XU2A 5L73A 4FO9A 2QNKA 2DFBA 1ULDA 3ZXGA 3USUA 4AEMA 2V5YA 2JX9A 3L2HA 4B29A 1G9FA 3N3HA 1ASJ1 1B09A 3RQ0A 1KXGA 5LRRA 2R16A 1LGNA 1PIV3 3NSTA 3IDEA 3QD6A 1OFSA 2WFF2 4HVQA 4KNCA 1BBT1 2PTMA 2RMU2 3LSDA 3CJXA 4LHLA 2R063 2VW2A 4AF9A 4C0HA 2FZ2A 2EVXA 1X7NA 1NCRC 2JXAA 3ELNA 1HXS2 2YDEA 4M3CB 1VBC3 1ZRCA 1C4RA 3AP9A 3NAPC 4LBMA 1RUJ2 5IK7A 3B02A 2ETEA 1RVF2 5LK7B 5LEKA 4DY5A 3MF9A 3H7YA 4IETA 4NWVA 1B35B 5DDJ1 4B4RA 2D3PA 2JG9C 3AK0A 1AL23 1XNCA 1RUNA 2NM1A 1D4M1 3TN92 1O4ZA 4K20A 2KM2A 2G9FA 4LUMA 3MEPA 4JDOA 5BV6A 5LK5A 3RDIA 2ZX3A 2WNUC 4NVPA 2Q8OA 4YGEA 2Z2SB 4P9LA 1COV1 4XETA 5KXEA 1QGLA 1CAVA 3ZFFB 2JG8B 3MPBA 4QM8A 4NO4A 5DXDA 4JTOA 1QH6A 1R081 3GYDA 4B4PA 4GB33 1LHWA 2C1FA 3B94A 3N36A 2G4IA 1W6MA 3DL3A 1ZBE2 4DY3A 2RMU3 2O1QA 5K0UC 4QXKA 5KHHA 2D43A 3DV8A 1KFXL 1YFXA 4UW5A 4CDQA 2RS52 4XHXA 2XJTA 4L92A 1XRUA 1UAIA 2FMDA 4QGLA 4K8FA 3J4UH 1RUJ3 2CAUA 3MIHA 2LALA 2GSYA 4RFT0 4P14A 2R49A 5F5QA 4AEKA 4IESA 2A6YA 1YI9A 2WS92 3K51A 1VRH2 1OQ1A 3PVBB 4YRDA 1J1TA 4WBBA 1ENQA 2BPA2 2DCKA 4ISRA 5A3MA 1ALYA 1GKBA 1KDMA 2R072 4Q0UA 1WA4A 4FOVA 4FPGA 3SLIA 1JOJA 1FOD3 4XFFA 4Q0VA 1YFUA 5C8CA 2YYOA 2PHFA 4PDWB 3CL1A 3TOJA 3NKGA 1O4TA 4JRAA 2IXHA 3B01A 2I45A 2ILMA 2PAEA 4YM2A 1QJU1 1GBGA 1J59A 3PLQA 4Z92B 4ZU5A 4X6QB 3RMXA 3DF0A 3VHRA 1QQP3 4IEOA 1Z78A 4LE3A 4MXWB 4G3YC 2VNRA 1RUI1 4K21A 1H2KA 4RQPB 1PVXA 4OHVA 3AM2A 2RJKA 4GWNA 3SH4A 4AI1A 4LLOA 1O5UA 4E2GA 4FOQA 5GLUA 5T55A 3DKWA 4S2FA 2XLAA 1GZCA 1N47A 2RS53 5DZFA 5BXXA 5JLVA 5CG9A 4AE2A 3USUB 4X6RB 4HKOA 5CFDC 2CY6A 1U0AA 1LB2A 4JGYC 1O3RA 2X5IC 4IEPA 4KWKA 3VHPA 4KU8A 5BNNC 3M2MA 2HKXA 2AENA 1VRH3 5JSPA 2HWB2 5JMCA 1PGL1 2GC0A 3DUIA 4Q4X1 1XNDA 4YVSC 2XLGA 1E57A 2R073 4LBKA 5DUVA 4AI2A 5JOZA 3WW3A 4MGKE 3POSA 1U5XA 3UKVA 5BNPC 2Z5WA 1KITA 2SBAA 1NCQA 1RUH1 2RM21 4MGIE 1AR92 2WT0A 3V56A 2ZS6B 4GMP0 4K1ZA 3RPQA 1UN1A 1FX5A 1RUG3 2GC2A 1AR73 4JCKA 2DU0A 2JDZA 2E7QA 5EFUA 1HDKA 4YW1A 1MZEA 5GJ6A 1BMV2 3I59A 4MUVA 4UW4A 2WQZC 1XNBA 1MEC3 1FAYA 4ES8A 4WM7A 2CAVA 1PIV1 1V6IA 1CAXA 3TYJA 3KD4A 4P5HA 4IV3B 1V9U1 2PELA 2VNOA 1CAVB 3EHKA 4AEDA 1FT9A 2RJLA 4N9IA 1VBC1 1LHNA 3J8F3 1AUYA 3G7DA 4Q1PA 4I01A 2YROA 4JDMA 3ZMOA 2HWF2 3MZHA 4XMIA 3N7KA 2YPJA 3E6BA 3HWJA 4IV1A 5JPMB 2CGPA 1PO13 1Q5OA 4YG0A 1AL21 1LOFC 2IXIA 1O5LA 2DVGA 1VBA2 3IT8A 4RS5A 1KS4A 3IPVA 4YG6A 3VZNA 2BVVA 4GIQA 4ATEA 4E4ZA 1RB8G 4L9BA 1BEV1 3FBMA 2YV8A 4QPIA 1ENSA 2GN3A 2VW1A 2Q5TA 5FLJA 1GYKA 4M3CF 4CDUB 3MIDA 4BQ1A 4HPKA 3ZXLA 2ZX1A 1RHI3 4EV0A 2BFUS 2OZ6A 1IGOA 4XJZA 2ZGNA 3IM0A 4GB31 4PBPA 5L7OB 1ZBA2 3RZZA 4DMIA 3R4SA 1GSLA 1YLLA 2RS31 1VBE1 4HFSA 4PF5A 4LTAA 2P3KA 2X8KA 2ES3A 3HMYA 1VBB1 2VOWA 2IZWA 4C90A 4YW5A 1YUDA 1SACA 1V6JA 2NYYA 3ME2A 3UV9A 1KJRA 2P34A 4LA2A 4XFGA 3ASIA 3AMPA 3SCGA 2C0ZA 1NOVA 3VBHB 4QX5A 4R8HA 1WW4A 1KFUL 2MEV1 4CEYA 2IXKA 2Q0AA 4QPGC 4FTBA 2DUPA 1YYNA 5HBAA 1GR3A 5JSOA 1UD1A 3WZ1A 1FOD1 4TSVA 1JYCA 4P9JA 1S0EA 4A7KA 4XIOA 4MV2A 4Y1YA 2OUHA 1ZREA 2A3YA 2O8QA 1IHMA 4C91A 2ET1A 3EO6A 2B9UA 2JEMA 3AKQA 3MI8A 4XJ8A 1AYM2 2D44A 5EZWA 3AMNA 1D2SA 2IXCA 5C4WB 5DUWA 1ZBA3 1CPMA 4CDWC 2EF6A 1VALA 2XL9A 2XJPA 4QQPA 1EAH2 5FPZA 1EY2A 4LHKA 4AHZA 1V6NA 1UU6A 5E8AA 4I3PA 3V0BA 3R4UA 4YYOA 4FVVA 1PHMA 1SLBA 1OSGA 3WG1A 2X29A 3CLPA 3LKJA 2DVDA 1VLNA 3WCRA 2MNGA 3HT1A 4FAGA 5CG8A 1LESA 3GNEA 2W52A 5JIAA 4ORFA 4CDQC 5J98B 5CBLA 1SLLA 3M70A 2XG3A 5I0RA 1MVEA 2CNAA 3B9CA 4LEJA 3AKTA 5JOYA 1SBFA 4LO6B 1RUC2 1SLTA 1PZ8A 3N35A 4YLZA 1REFA 1ENXA 2EAKA 4LNVA 1JXNA 1OA4A 4AEDB 1IPJA 4XF1A 2XVGA 4P9WA 5J36A 3JD73 4CDXB 4UBGA 1IS6A 3NW4A 1C1LA 4ITCA 5C8CC 5EJ3A 1LOCA 5BUVA 1AR71 3D5OA 4HETA 4QPYA 4IV1B 4Q4W1 2VH9A 5FDBA 2ENRA 2XBO3 1S0FA 2OIIA 3H8UA 2XJRA 2RS11 4QQ2A 5D8AB 3VBUA 3I54A 3H3UA 5JR7B 2PQQA 1K5MA 3KB5A 4M00A 5ABJA 4Q4V2 1MVQA 3OD4A 3AKSA 3VBOA 4FCAA 4WVZA 2D6OX 3KM5A 2GH2A 1G8WA 1R1A2 3S0MA 1CAUA 2BBVA 4CEWB 4ZU7A 4MGZE 3MIEA 2IC1A 3PVOA 3KCCA 1S0DA 1X36A 3SISA 1YNAA 3VKFC 2IWGB 1AXYA 1GQGA 5EYYA 2OUJA 3B3QE 1ZRDA 4HK9A 3AB0A 3O0WA 1CQ9A 3ZX7A 1PO11 2HWE1 2WZR3 3QH6A 1ASJ2 3NV4A 2ZPXA 4DZGA 2JE9A 1H4HA 3ZN4A 1WCKA 2BQPA 4LE4A 1JUHA 3PVEA 3THTA 2D3RA 1BBT2 1DZRA 1AYN2 1RMU1 4EJRA 3GALA 3MW3A 1RGSA 4YW4A 1C3HA 1LGCA 1Z7S1 4WZFA 4RA0A 3VDDA 1WMDA 4HSJA 4K1YA 1NCQC 1POV0 3J26N 1QY4A 5C9AA 2NP0A 4WM8A 4E9KA 1AJKA 3KLSA 5FAXA 4AGRA 3NVCA 4HT1T 3QLQA 1URXA 1ZZ7A 4R9CA 5FO9B 1Q8OA