2H0BA

Crystal structure of the second lns/lg domain from neurexin 1 alpha
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
181
Chain Sequence
b'EEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurexin-1-alpha
publication title Crystal Structure of the Second LNS/LG Domain from Neurexin 1{alpha}: Ca2+ binding and the effects of alternative splicing
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion
total genus 39
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h0bA00
2A75A 2ZGRA 3RQ0A 4XBLA 3ILRA 3V65A 4ISQA 3AYCA 5KXCA 1R1ZA 4LBMA 3SNMA 4AVTA 1N3OA 4WVWA 5CNAA 3VKNA 2D3PA 1C57A 1DQ2A 5EXOA 1WLCA 5KXDA 1WUVA 2D44A 3GALA 3ILNA 4AVSA 1PZ7A 2VW0A 2ZZJA 3D5OA 2EAKA 4R9CA 4TZDA 2YZ4A 3U4XA 4BLIA 4NOTA 4XBQA 5GALA 3AP9A 2DVFA 4DRRA 2A6WA 1JN2P 5JOZA 3HR9A 4FOVA 3OBTA 3B01A 4YM0A 1W6NA 3B9CA 4ITCA 3AJYA 1G7YA 1QDCA 2JKBA 1LJ7A 1HQWA 2LALA 3IMNA 3VKLA 5EWSA 1GNZA 4CTEA 3OYWA 1Q8PA 2DUOA 4DQAA 4FPOB 1LULA 3ZPYA 5H9RA 1UZZA 3IPVB 5GLUA 2ZHMA 5CB7A 2C5DA 2HYKA 1HKDA 3AZXA 4LBJA 3WDYA 3RMXA 2E7TA 2C9AA 1UX6A 4PBPA 1DQ6A 4Y22A 2WSVA 1SBDA 3AZWA 1ZM1A 3PMEA 2NMNA 2GMEA 5FREA 1UAIA 1QKQA 1Q8QA 2VW2A 5DZFA 3OBRA 1WW6A 1LODA 3SH3A 1N3QA 3AXDA 1SLAA 4BMBA 1W6PB 3POYA 1GNHA 1X50A 3BTAA 1FNYA 3WDTA 1LGCA 3USUB 1VLNA 1Y7BA 1DBNA 4I30A 1V6LA 1YYNA 4M00A 2FHRA 1MS5A 2OUHA 3V0AA 1GV9A 2E51A 3ZYRA 1MACA 1PZ9A 2P3KA 2ARBA 1ZA4A 3AZVA 4FPJA 1S0GA 3JU9A 1IKQA 1G9FA 1OFSA 3ZYPA 4L8QA 1Q8SA 2A6XA 3PJQA 1QGLA 1LHWA 1JHNA 1LOEA 4XOGA 1QU0A 2YY1A 4FPLA 4YZ2A 1UKGA 1DLLA 2GALA 1ULFA 4YM1A 2UWBA 3AX4A 3N7JA 4R9BA 4U36A 3PVEA 2P34A 4UW5A 1QNWA 2NMOA 2YROA 5DG1A 4TYSA 3VKOA 3WCSA 1MR5A 3SH5A 1SBEA 4GALA 1AJOA 1D0HA 2AUYA 2EXIA 4Q8LA 1GANA 1KITA 1V6NA 2W68A 3ZXLA 2KM2A 1LHVA 3R4UA 2PHRA 1LCLA 2E53A 2FMDA 4YZ1A 1GZWA 1JOJA 4YW1A 3BODA 2GNMA 1CR7A 1CVNA 1Q8VA 3ILFA 4M3CE 1WW4A 5IUQA 1CIWA 3M3OA 4BOWA 1LOGA 3GNEA 2NYYA 2DU0A 5DUXA 1C4RA 1HLCA 4LBNA 3AFKA 2AR6A 1YO8A 4Y26A 1N1SA 3W59A 4BPZA 2DUQA 5T5LA 4SLIA 1QF3A 4PCRA 1GZ9A 1IS6A 2BQPA 2SLIA 2D7FA 3O0VA 5HCBA 1SLLA 3HN1A 3T2TA 3AP4A 5CA6A 3W58A 3I8TA 1LOFC 1NXD1 4FPEA 5JDBA 5GZFA 4RA0A 4C1XA 4Y20B 2PHFA 2W52A 3N7KA 5T5PA 2WSUA 1AZDA 1H9WA 3B69A 3UJOA 2A6ZA 4XJAA 1RIRA 1MS3A 4NO4A 1V6OA 5JMCA 2ZABA 3IKWA 1MS9A 3WG1A 1CONA 4Q1RA 4UW4A 2ZKNA 3JUUA 3OGGA 1AXKA 1C1FA 1I3HA 1G86A 4GWMA 4Y1ZA 3RSJA 1AXYA 2VW1A 4DPNA 4ZKTB 5T55A 1SBFA 1A8DA 1JYIA 2A3XA 3OY8A 1DYKA 2YV8A 4F83A 3OJBA 2WT0A 4FPFA 4FVVA 1MS1A 1FATA 2UU8A 4XYXA 4YW2A 2ZGQA 4XHXA 1ULDA 2RHPA 3AP7A 4PF5A 4GKYA 4JCKA 2PHWA 4AYUA 1H9PA 3AYEA 1BJQA 2AH2A 4FOYA 3H0OA 4GKXA 1TEIA 4Q1PA 4FPYA 2ZMKA 1W0OA 5T54A 3T1MA 3T1LA 5CAZA 1KJLA 4XHBA 4P9XA 4XXAA 1OQ1A 3AZYA 2A6YA 3AYAA 2A71A 2R16A 3ENRA 2ENRA 1WBFA 5SV8A 1AX2A 2GNBA 4R9AA 4XJ8A 1W6MB 5KXEA 2H0BA 1WLWA 1GLHA 4GXLA 2D6LX 4DFSA 1LOAA 3ATGA 1CESA 1V6IA 2PHTA 4ATEA 4D69A 1WW7A 1LOBA 2JDZA 3NV1A 4M3CA 1WD4A 1SCRA 1QMJA 1MVEA 3WVJA 1CPNA 4MYEA 1Q8OA 2CYFA 1S0BA 3KQRA 1Z0HA 4AGVA 2DVBA 5GLZA 4YZ3A 4FQ4A 4DS0A 3WDWA 1RINA 1S0DA 1KDMA 2UWAA 4XBNA 5EYYA 5EYXA 5GLWA 1A78A 4YZ5A 3V0BA 4Q27A 5GLTA 2ZGUA 1QOSA 1UPSA 2WQZC 2SBAA 1F31A 4LBQA 5E89A 1Q56A 3LSDA 2ZHKA 2JE9A 3IN9A 4M01A 2ZGLA 1FX5A 3WDVA 1N3PA 2JE7A 3SITA 1BYHA 4CZSA 5GLVA 1W6NB 2ZGKA 1AVBA 4FPKA 1FV3A 3PVNA 4XTMA 1WW5A 1LECA 5F5QA 1ULEA 4BLJA 4YW5A 3OYWB 4YG3A 2DTYA 5JOWA 4IQPA 2DTWA 1AJKA 2G4IA 2B7YA 1N47A 5GZDA 4AGRA 1KRIA 4YM3A 5DUWA 4AVVA 3N36A 4ZXKA 2ZGNA 3ZXKA 3VUOA 1BKZA 4GA9A 1V6MA 4BQ1A 5IT6A 3PVOA 4OZXA 4Y22B 2WNEA 3I4IA 2TEPA 4LBOA 2D3SA 1W6OA 4FPHA 4KBBA 1LTEA 5H9QA 5FRAA 2OUJA 3D4KA 1S0IA 3V0BB 1QNYA 2AGSA 1SLCA 2ZGMA 2DURA 4XMIA 1DZQA 1LGNA 4LBQB 2A3WA 1G9AA 5JVVA 1KJRA 2DUPA 2GNDA 5KXBA 3UL2A 3FFZA 3DUIA 3BOPA 4RL7A 2D6PA 5T52A 3WNXA 1APNA 2EXHA 2GDFA 3FUQA 3O0XA 5HCAA 3MW4A 2JECA 2VUAA 1HDKA 1SCSA 1ENQA 2XB6C 3QLQA 4K1YA 3V0AB 1UN1A 1FNZA 3HMYA 3RMYA 1LHUA 2ZGPA 2D6MA 1FYUA 1IKPA 2PELA 1BXHA 3POWA 5GM0A 2WT1A 3M2MA 3TB0A 1N1TA 1O4ZA 3N3HA 3WCRA 1JW6A 3Q9OA 3VKMA 2CTVA 2E6VA 2EF6A 3ZSKA 1VALA 2ZACA 1CJPA 4ISRA 5E88A 2ZA9A 4LBKA 3RRDA 3TAYA 1GYKA 4BMEA 1DQ5A 1JBCA 2OVUA 1B09A 1FV2A 1GSLA 1IOAA 1W6QA 1G8WA 2P37A 4R9DA 3QCWA 4XILA 4CRQA 2CNAA 5JLVA 4XZPA 5DUUA 1SACA 1ENRA 2D6KA 4WV8A 3WDXA 1LHNA 3NV2A 2A3YA 2UURA 3B00A 4Y1VA 2R0HA 3WUCA 1AX1A 2WKKA 2OW4A 3AXEA 3ZSLA 2ERFA 4WVVA 1GZWB 3SLIA 1UZYA 3D6EA 2ZGSA 1OKQA 2NN8A 1LU2A 1QOOA 4AWDA 1Z78A 4HANA 3NV4A 1YI7A 2Z42A 1GICA 5IK4A 2JJ6A 2EXJA 3WLUA 1N1YA 3M1HA 5IK8A 3OPZA 1S1AA 2P3IA 1GZCA 2WJSA 2XG3A 2EIGA 3AP6A 1C1LA 1PZ8A 4YZ4A 1CN1A 1DHKB 1YRZA 3VV1A 5T50A 1G9CA 3MW2A 2DYCA 2P3JA 1GKBA 3ASIA 1A3KA 3ZXJA 4WZFA 3VKFC 2A70A 4XIOA 4XJZA 2D6OX 4P9YA 1V6JA 4XXPA 4XDQA 1DQ0A 4PQ9A 4YG0A 2P2KA 4FPCA 2WT2A 1N1VA 1VAVA 2ES3A 3M3QA 1KDKA 1LGBA 1ULGA 2CY6A 1S0FA 3AYDA 1IS5A 3FLPA 2D43A 4K20A 1S0CA 5L73A 3WHTA 2JD4A 4Q2FA 2VH9A 5IK5A 2NZ9A 1JUIA 5AVAA 3KM5A 4XE9A 1DIWA 1V6KA 1SFYA 2DWRA 2ZHNA 4XJUA 4YGBA 4Q26A 2E7QA 1W6PA 3MPPG 3AJZA 3OY8B 3SH4A 1MZ6A 3MEPA 5H9SA 3WG2A 3WHUA 2ZGTA 2WLQA 3USUA 4Y24A 4DRVA 1ULCA 1URXA 4YGEA 5T5JA 1J1TA 3M3EA 5GJ6A 2AENA 4K1ZA 2V73A 3N7MA 1NLSA 1YXWA 1MS0A 1LEMA 4BM8A 5DZEA 1O4YA 4YGCA 1UL9A 4YG6A 5F9TA 4XJWA 2CL2A 4YFWA 2VU9A 1BZWA 1UMZA 3CNAA 5JOXA 1LU1A 2DVAA 2W08A 3NV3A 4M3CF 3UJQA 3V64A 2V5YA 1G9BA 1F9KA 3A0NA 2W39A 1DFQA 2ZMLA 5DUVA 4PBOA 1SLIA 3MW3A 1FAYA 1QOTA 3B3QE 1W0PA 3DGTA 3RS6A 1MVQA 4FP2A 4ASMB 3WUDA 1LENA 1LHOA 1MZ5A 5GZEA 1ENSA 4UW6A 1D2SA 1AF9A 2EXKA 2D6NA 1ONAA 3WOGA 4JRAA 4M3CB 4XJ9A 5LK5A 2D3RA 3WG4A 4P14A 4Q8KA 3N7LA 4YLZA 3WZ1A 1F5FA 1VAMA 2A7AA 2YXSA 1BQPA 3ZXEA 2GN7A 2LTNA 4Y1UA 3WV6A 1MS4A 2CWSA 2GMPA 2R1BA 2YMZA 3FBYA 2DV9A 4FOQA 3UK9A 3ZVXA 1XQNA 3L2YA 2A6VA 1H30A 2ARXA 2PHUA 4UW3A 5DZGA 1HQLA 1AX0A 2CWMA 2ZBJA 3A0KA 3O12A 1U0AA 2R1DA 4FQZA 3SISA 1CPMA 3RG0A 4AGGA 3ZSJA 3FLRA 5BYNA 2UWCA 1LOCA 1QDOA 1VIWB 4W65A 4C1WA 2R49A 5GZCA 3WG3A 3AK0A 1DYPA 2VY0A 4XTPA 4Y20A 5JOYA 1JXNA 4YFZA 1DQ4A 2GN3A 4K21A 2ZAAA 1WCSA 1G9DA 1WLDA 2EALA 2NM1A 3FLTA 1IS4A 1EPWA 2DVGA 3ZXFA 3WDUA 1LEDA 4LBLA 4GWNA 3AZZA 3FUOA 1GBGA 1W6OB 2R0FA 2VXRA 2ZGOA 4LBQD 2DVDA 4H55A 4JC1A 3C2UA 3NWKA 3M3CA 3A4UA 3POSA 4YW4A 1CQ9A 5GZGA 3LSEA 2NP0A 2Q5TA 3ZSMA 1I1EA 1SLBA 4HL0A 1WD3A 3N35A 4Z8BA 2GNTA 5H9PA 5DXDA 4XIKA 5IK7A 3INAA 1DGLA 5E8AA 2AREA 1DQ1A 3O5SA 1IS3A 5DG2A 1V00A 2PHXA 2ZMNA 1LESA 2A5ZA 2ZHLA 4U2AA 5CBLA 4FP3A 3R05A 2DU1A 4YGDA 3O0WA 4YM2A 5T5OA 5HCFA 4XMAA 2I2SA 3APBA 3LCPA 1S0EA 4Y1YA 4FOWA 1JYCA 4ATFA 4P9WA 1RITA 1KQRA 1W6MA 1YIFA 1SLTA 2GMMA 3IM0A 1LOFA 1AXZA 3R4SA 4Y1XA 1S0JA 3BIWE 3IPVA 2AYHA 1W6QB 3AP5A 4FPGA 1WBLA 1MS8A 4YW3A
chains in the Genus database with same CATH superfamily
2X29A 3RJ2X 3I2GA 3RQ0A 4XBLA 4E27A 1QQP1 3WF4A 3WW2A 5LWBA 1NLQA 1R1ZA 1H8TA 3MO4A 3WINE 4CEWC 3MV01 4AVTA 1XNKA 4NPLA 3HBZA 1R082 2ET7A 1WLCA 2JB4A 3MZHA 2RG4A 5FMDA 1PZ7A 2XVKA 3D5OA 5JMOA 4RSUA 1C8M3 4R9CA 1UU4A 3POJA 4G4FA 5AC91 4TZDA 2FZ2A 2XLFA 5B4XA 1DG6A 1GWLA 3AP9A 5A3NA 2MEV1 1OI6A 3D82A 3HWJA 4JGZC 2J1EA 4YM0A 1W6NA 2DCKA 4HVRA 1JYNA 4ITCA 4XUNA 2K9ZA 1AYM2 2BTVC 1KFXL 3ZR5A 2JICA 3AJYA 2JKBA 4W4ZA 3VKLA 1BMV1 1GNZA 5CFCB 4QMAA 5T3NA 3U75A 2GH2A 3KCYA 4F3JA 5H9RA 3IPVB 1AL22 4Z2AA 5I0TA 5IVYA 2ZHMA 1JUHA 2FD8A 1W2OA 3PHMA 5FZLA 3NMBA 3SQOA 4AEDB 2WNVB 4CU7A 1YFYA 5FLJA 3AMQA 4W6WA 2E7TA 2C9AA 3ZFGC 4PBPA 3E6CC 3DPRC 4JKMA 3WF0A 3KV6A 4KI5M 1ODNA 4P9GA 2PMWB 3ZFFB 1XE8A 2P6CA 3OBRA 2VO5A 3ECQA 2WO1A 1L7QA 3BB6A 2XKPA 5LY2A 4AVCA 4D7YA 1N3QA 2QDRA 2K46A 3WEZA 2WS93 2OS2A 5C4WB 1H8VA 2P5BA 3AKTA 4D6SA 1HN0A 5IVJA 3W5MA 1S2BA 1MQTA 4K7JA 1VBC2 4XUPA 3SEPA 3WF2A 5LZ6A 4LEJA 1RUG3 2XUEA 4CEWB 4OZOA 2BP6A 4JTNA 4LT5A 4I30A 3TEWA 2UY9A 2VZ1A 4P9LA 5FP8A 3M70A 4R4XA 1BEV2 5FPVA 4DOUA 2FHRA 2RM21 3EJKA 3PIJA 2OUHA 4V2WA 1H6YA 4XF0A 3ZYRA 2P3KA 2ARBA 1ZA4A 3U11A 1S0GA 1G9FA 1Q43A 4QGNA 1CIYA 2RVAA 5A7NA 5FBJA 4M0NA 1WCKA 4KGGA 4JKKA 1UKGA 1DLLA 1RGSA 3EMRA 3E6BA 2GALA 4KG8A 4O61A 3RWKX 3SCFA 3VHOA 3X29B 4U36A 3VGIA 4CCDA 3WCSA 3ST7A 1W8HA 1Y9QA 4CUBA 1AJOA 1XNAA 5FZBA 5BNPC 1JODA 4KG0A 4DY5A 2YGMA 2H6BA 2JG8A 1VRH3 1IHMA 2Z79A 1QJEA 1LCLA 2E53A 2D98A 2QBXA 3R4UA 3ZFGB 2FMDA 1A34A 4JDNA 2Y6GA 2YHJA 4X8NA 4YW1A 5A3OA 1IPSA 2BVVA 3IAQA 1W04A 1JS9A 1CR7A 1RUC3 3ILFA 5IUQA 3M3OA 4BOWA 3TEZA 1RUF1 2FCUA 2WNUA 4NPMA 3C7OA 1DLCA 1HLCA 1ULOA 5DUXA 2FCVA 2AR6A 1YO8A 3GXUA 2VTXA 3L9JT 1HIXA 1UU6A 2WABA 5T5LA 4IETA 1TG7A 1QF3A 4IGPA 4PCRA 4MXWA 4Q4V2 1WLTA 1NQJA 2BQPA 4XQDA 5I0UA 2D7FA 2HWE2 4CCMA 4AZZA 4D3WA 4LE3A 5AC93 5CA6A 3O1OA 1ODMA 1LOFC 1XBFA 3IT8A 1NXD1 4NHLA 3ZIXA 5FR3A 4Z82A 1ZBE1 2R061 4RA0A 2PHFA 1RUE1 4WM8C 5FZ9A 2WZR1 4XURA 4XFAA 4S2HA 4DIQA 5I0DA 2Q8DA 1A8MA 2QQNA 3SXWA 5LY1A 4R8HA 4Q4Y2 2WZ8A 3UJOA 2A6ZA 1AHSA 1HRV3 1PVC3 1RUJ1 2FBEA 3IKWA 4QGLA 1MS9A 4RHV3 5FZKA 5BXXA 3ZN4A 4B7EA 1EV12 1VB2A 3JUUA 3OGGA 1I3HA 1C1FA 4GWMA 1G86A 3ACHA 2K2SA 1OA3A 3NSTA 4UBHA 5I8TA 4AR2A 3TOJA 4QPGA 1XYPA 4GJYA 3ACGA 4X6QB 4D7TA 2Z2SB 2JDUA 5CZKA 1SBFA 2A3XA 3LKJA 3OY8A 5BNPB 2YV8A 5B4NA 3OJBA 4FPFA 1O8SA 4FVVA 5F32A 2UU8A 1XE0A 4YW2A 2ZGQA 3KV9A 4XHXA 2RHPA 4COWA 4CU9A 1XNBA 3ZO0B 4AVAA 2FDKA 4JCKA 4S2FA 4YARA 1ZZCA 1Z7S1 2Y6JA 3VV1A 2RJ2A 4SLIA 4FOYA 5JZGC 4W50A 3T1MA 4DUVA 2Q8EA 3T1LA 2VR4A 1D2QA 1AR62 1WMXA 4Y3OA 4QX7A 2WA3A 1BCXA 4XXAA 4MXVA 4JGYA 1POV0 1L7LA 1ZRRA 2RM23 1QJY1 2WC2A 3OG2A 1UIJA 5SV8A 1AX2A 2ZEWA 4QM8A 4R9AA 2CDPA 3MIEA 4QXCA 3KS7A 4HBNA 2D6LX 2I07B 4AI1A 4DFSA 3QBQA 5A3PA 3ATGA 1CESA 2HBUA 2VNRA 4URTA 4WM8B 1RUG2 2PHTA 5K9YA 1LOBA 4QHOA 5ABJC 3J26N 5C33A 1MVEA 2VOWA 4B1LA 3RZGA 1RUNA 1HB1A 3F95A 1Z0HA 3VHPA 2WFPA 4L0PA 4DS0A 2C6SA 1RINA 1S0DA 1KDMA 5EYYA 3RDIA 3HQXA 1A78A 4GMP0 1WMDA 4HVQA 2ZGUA 1QOSA 1UPSA 4RS5C 2WQZC 1US2A 1KEXA 1Q56A 2CU5A 2XBO1 1ULPA 5ERLA 1N3PA 4IEZA 2QVSB 5J96B 3IIIA 3EBRA 1NZCA 4FPKA 1FV3A 3SC7X 3WR0A 5K8SA 4HONA 4XTMA 3NL1A 1LECA 5F5QA 3U4SA 3OYWB 2OX0A 2XKOA 3JXSA 4A6OA 5JOWA 4HKOA 2DTWA 3HQRA 4AVBA 1JZ4A 3SKVA 1N47A 4QD2A 4AGRA 4RR3C 4LO4B 4AVVA 1QQP2 4ZXKA 4GH4C 2ZGNA 4B29A 4COYA 3ZXKA 3A22A 1BKZA 2VG9A 2WZR3 1BVVA 2O8QA 3VBOC 2VCMA 3H50A 4QX2A 5FYMA 4LBOA 4AI0A 2D3SA 3A23A 1W6OA 2RS11 5FQ0B 1UY0A 3GZTB 5CFDA 3ZDSA 3ZN6B 4LKFA 5JXJA 3UETA 4GJZA 5H9QA 1RUJ3 1YEWA 5DABA 4CP0A 3IDEA 3A7QA 1ZZ6A 3J4UH 1QNYA 3V0BB 1J1LA 2QCSB 5AC92 3VBSC 5ABJB 1O3SA 5FZ8A 2WRAA 1CAXA 1REDA 4K6BA 2BERA 4IEYA 2MEV2 4GIQA 4W6XA 1O7FA 4IGOA 4MX3A 5FY1A 5JVVA 3ZMNA 3UL2A 5JIUA 2WO7A 2LW8A 2IVJA 1OH4A 3DUIA 1HV1A 2QQVA 4RL7A 5T52A 3WNXA 3H8UA 5F3CA 3LB9A 3FUQA 4WM7C 2JG9A 3MW4A 1XXNA 2JECA 2VUAA 2GAUA 2HWB1 3LOIA 3OPTA 1JU3A 1JYWA 1W8NA 4Q0UA 4S2DA 2YUEA 1LHUA 3LDRA 4HLTA 1OQDA 1YQCA 1YQ2A 1Z7S3 4RS5B 4CCLA 2RE9A 1RHI3 1R093 4XDOA 1MEC3 5JSRA 1UOGA 2E31A 2ZX3A 3POBA 5DPNA 5FYHA 5IW0A 5LW9A 1PM7A 1CJPA 1W8OA 5SV5A 3K75B 5I91A 5J09A 3TAYA 3GZEA 3OGRA 1ASJ3 1GYKA 2F4LA 4QPIB 4TTGA 1B09A 4R9DA 3AMHA 1IOAA 1W6QA 3NO8A 3UYJA 3ZXGA 4FT8A 2CNAA 5JLVA 5FYUA 4XZPA 2VMCA 5CIRA 2VBDA 4RR3B 2JIJA 5FMOL 1X82A 1RXFA 2HWF3 1E57A 4GH4B 4L9BA 4Y1VA 1AR93 4YRDA 5FUIA 5FBZA 5FWEA 3GBFA 3ZSLA 2IFRA 4WVVA 3VBOB 4P00B 4IE5A 2ZGSA 5DAQA 2VOTA 2NN8A 1M4WA 1X36A 4I3GA 3VB9A 4BIOA 1Z78A 2RM22 5CISA 3J8F1 4SBVA 4D6QA 1VJ2A 4BJ0A 5IK4A 3NNFA 2JJ6A 3VBSB 4JKLA 4GB33 2WJSA 3AP6A 2EIGA 2W1UA 3PUAA 3IWZA 4AE2A 4YZ4A 1DHKB 5LBBA 4DY3A 1R1A1 1W39A 1WCDJ 1YRZA 4LPLA 3MW2A 2P3JA 4COZA 3FX3A 4WM7B 5CFCA 1SHWB 1A3KA 3THDA 2VE1A 1WA4A 3HN3A 1VB4A 2A70A 3J7NA 4XIOA 1K5MC 1DQ0A 1GP5A 4AEDA 1W2AX 2ES3A 2WNVA 3T2QA 4B1MA 4BYYA 1KDKA 3LDBA 3E6DA 3AYDA 3MYXA 4BIFA 4ZXEA 3FLPA 2D43A 3AVSA 3B7MA 3WHTA 4KL1A 3WSOA 2ET1A 4NIGA 3ZFFA 2NZ9A 3JQWA 2WA4A 4PHZA 3DL3A 4PI0A 2Y26A 5ACA3 1RUF2 2EICA 2ZHNA 5C4WA 4XJUA 5KWRA 3MPPG 1TME3 4IV1C 1G6NA 1OURA 1LR5A 4JV4A 1U5ZA 2IUWA 3ON7A 4CEWA 4PDWC 3VDDB 4CDUB 4AW7A 4YSFA 2TNFA 5T5JA 4LK7A 4BCUA 3AKQA 1VMFA 3M3EA 2ZEZA 1ZBE2 2R062 5IVCA 2V73A 5D2AA 2WZR2 1O59A 2WWUA 1VBE1 3S7EA 5F9TA 2ZX4A 3Q8CA 1PGL1 5L36A 3EQEA 3KCXA 5FK7A 4Y4RA 5JOXA 1LU1A 1RUJ2 4IERA 4M3CF 2VOVA 1FMD3 1HXS3 1DFQA 1OF4A 3MW3A 5A3WA 1FAYA 1QOTA 4Y4YA 1W0PA 2R043 3CDZB 4AAXA 1UOBA 4PIYA 3ACIA 4BISA 2ARAA 3MUY1 4OMCA 3WUDA 5FFOC 1US3A 1NE4A 1K5MB 4DEQA 3FHAA 1K45A 2JD9A 3A21A 2D6NA 1ONAA 3KCCA 4N9HA 4F8AA 5FXXA 3WOGA 1UOFA 3ZFGA 4Q8KA 4CUGA 3O7OA 4YLZA 2WFF1 1VAMA 1UPIA 1BQPA 4EE2A 2LTNA 1Z7S2 1ZX5A 2QUOA 1MS4A 2OPKA 2YMZA 3UK9A 1YI9A 2DV9A 4UF0B 1XQNA 3HOBA 5BNNC 2PHUA 2WBKA 3FBMA 4UW3A 5DZGA 1QEXA 3WP4A 4E9KA 2ZBJA 5FPUA 5A1AA 4IV1B 2ZOEB 3SISA 4AGGA 4XAAA 3FLRA 1QJY2 4PIXA 3J8F3 5FXWA 1IQAA 2UWCA 3GJBA 4PDWB 1F4AA 1JYXA 2WQ8A 3W20A 5GZCA 5FIXA 1ZRIA 1DYPA 1ZZ7A 2HWF2 1JXNA 4PT6A 1R1A3 1ZREA 2Q1ZB 4QPWA 2HWD3 3ZXFA 2E63A 1EPWA 4QB2A 3PUIA 4CP2A 1LEDA 5IVVA 5M0TA 4LBLA 3AZZA 2PQQA 3PDQA 1UKRA 2L9LA 2RV9A 3MI8A 4IEOA 1RXGA 2R0FA 1EY2A 4LBQD 2BW8A 4INDA 4GB32 2XWJB 3TN91 4H55A 5FMBA 2QDNA 1O5LA 1R64A 3NWKA 3POSA 1K3IA 3MIFA 5BNPA 2G9GA 2Y34A 3I3DA 3RGBA 1W8FA 4CP9B 2XJUA 5H9PA 1AR71 1YHFA 5E8AA 4DXRA 2VPVA 4EN7B 1TQ5A 2JEMA 2PHXA 3MUZ1 2W2IA 5FYSA 4I2OA 5JXHA 4Q4W1 4K9SA 3IDCB 2XONA 4QQPA 5BNNB 5CBLA 3R05A 4KNCA 1TNRA 4E2SA 3RZKA 2DU1A 3FWEA 5A7PA 2I45A 2RS31 2X05A 1DYOA 2R073 4AQSA 2WNOA 2KA3A 1VBE3 2H6CA 2XMLA 5F2SA 4AFCA 1MZFA 5A32B 5C7GA 1LOFA 1JOBA 1CZTA 2RS12 3ETQA 3VZJA 3KD4A 3R4DB 2XPJA 4FPGA 3ZFEC 4QWNA 4WM8A 5FLIA 4A4AA 4MUVA 1QHDA 2ZGRA 5CEHA 5C6CA 3ILRA 5KXCA 4N8MA 2XLGA 3AYCA 2BNOA 2E9QA 3NKTA 2VQUA 5IYYA 2HWC1 1N3OA 1YFWA 2QZ2A 5KXDA 1WUVA 4OUEA 2D44A 3GALA 3ILNA 3CMGA 2HWB2 4GAZA 2VW0A 2ZZJA 3AM2A 4LLOA 2XR4A 4CEYC 1BHGA 2WFF3 3M4FA 4Y5TA 4NOTA 1I5ZA 4HVOA 5J7MA 2JENA 4FI9A 3LPFA 1GR3A 4J6GA 3VBHC 2DVFA 3VBRA 2A6WA 3W21A 5EJZB 4UFKA 5JOZA 3HR9A 1J3QA 1W9FA 1K5JA 3B9CA 4QQOA 4TXWA 1NCRC 2LALA 2V09A 1S2KA 2ZX2A 3OYWA 1AR83 1TMF1 4ZZ5A 3TEXA 4FPOB 3BU7A 4D8MA 3P3PA 2WINB 2HYKA 3ME2A 1HKDA 1JHJA 4QM9A 1PM4A 5L7OC 3ZXAC 5HV4A 3WY6A 2W47A 4E2QA 2WSVA 1SBDA 1BVP1 4GQ7A 4PLOA 2Q0AA 1ZM1A 3UESA 1JU4A 2NMNA 3ZN6A 2YB7A 5C8CC 4XQ4A 4BQWA 5FQ0A 1QKQA 1Q8QA 4GWJA 2DBIA 1OLME 4MVTA 4QXBA 1WW6A 1W9SA 3ZFEB 1LODA 3J8F2 3SH3A 3ZR6A 1O4TA 1YLLA 3AXDA 1W6PB 1OF3A 4JTOA 1X50A 4YVWC 3TN93 1C8M1 3WDTA 1IQDC 5E1RA 1R1A2 4BXFA 3I2DA 3BUCA 1VLNA 4P9IA 2HWD2 1DBNA 3OB8A 1V6LA 1YYNA 2UYBA 4BQ3A 5D1IA 2E7AA 2B46X 2BFUL 4AHXA 2PN5A 3OTFA 2WUHA 3AZVA 4CEYB 4RS5A 2YC2A 4FTSA 3JU9A 3VBHB 1UX7A 3LA7A 3ZYPA 3U10A 3GCWA 1Q8SA 2A6XA 4YYOA 1JHNA 3AKPA 3VDAA 1LOEA 1SMVA 1Y43B 1U5YA 2YY1A 3K2OA 2BUKA 5FY5A 1ND2C 1QH7A 2WIIB 2B5HA 2GH8A 1NCRB 1ULFA 4YM1A 1X9PA 4EN6B 2Y64A 1NYWA 4QPIA 2RS33 1QNWA 4L11A 3QH7A 2OPWA 1SBEA 2PHDA 5KR7A 2DCZA 4QXKA 5KHKA 4R4ZA 5D8AC 3U78A 5A6XA 4RR3A 4KWUA 1DCSA 3Q8AA 3RVHA 4GH4A 5L7OB 1IZ3A 4UI9L 2RJLA 4LKDA 2WS91 3VBOA 2JB8A 5F7UA 1WKYA 3O1RA 1EP0A 2GNMA 1U5XA 4DNYA 5C8CB 1Q8VA 1YUDA 3T4VA 1WW4A 1D4M1 2FDHA 3ZPOA 2CHHA 3CKHA 1GQGA 1RVF1 2QQWA 2DU0A 2XUMA 1Q3EA 3CF6E 1C5IA 1OT5A 2VM9A 1VBE2 1VBB1 1N1SA 3VBSA 4BPZA 3B94A 2DUQA 1PGL2 4A44A 4YVWB 4MOAA 3AP4A 2QTWB 5FP9A 2Y6HA 5GZFA 1WWYA 2GC1A 2Z69A 3FHIB 4IW3A 1NOVA 2ARCA 2D5FA 2W52A 3QACA 4P9JA 4RGAA 5F1RA 1W8WA 5T5PA 4MH0E 4DUWA 5G04L 5EHDA 1ACCA 2JXAA 4JX0A 2YFUA 1JZ5A 2BPA2 1TMF3 1OLMA 1V6OA 5FPZA 3WG1A 1CONA 4Q1RA 4WZCA 2WFF2 1ND2B 5TSWA 1VRH1 1DF0A 1AXYA 4RYDA 4DPNA 4JRLA 1GQHA 1YFXA 3FL7A 1NAEA 4QQ2A 3GDBA 4LJHA 1RUC1 3OSDA 5D8AB 4F83A 1ENXA 4UFLA 3SHRA 1J84A 3VL8A 2VZ3A 5L9BA 1MS1A 4XYXA 5GKAC 3UKNA 4PF5A 4GKYA 3VDDA 1ZA7A 4BK4A 4CDUA 2B8MA 1Y9GA 2Q8CA 3MLJA 1XYOA 2AH2A 1TEIA 4MV2A 4ZHNA 2HBTA 1FI2A 4NIHA 2FCTA 4OHYA 4EWEA 2DDUA 4QAWA 3USSA 1YJLA 2QQKA 1NX9A 4IE6A 1SZBA 1W2NA 4CA9A 1PMIA 3CQOA 2HYXA 4MGIE 4OFGA 4ONUA 4WBBA 2VUCA 2R16A 3ENRA 4OI2A 2ENRA 2XJSA 3VLBB 1W6MB 1H6XA 4LO5B 3JZVA 2H0BA 4Q0PA 3BIEA 4GXLA 5FKBA 2JIGA 1HRV1 1PVC1 1ZZ8A 3N9PA 4RHV1 5FZCA 3TN92 2RR13 1WMEA 3MIGA 4TSVA 4D69A 2N7GA 1K5MA 4DINB 3IMMA 2J7MA 1UU5A 4N43C 1C28A 1EPZA 1W3XA 2F17A 2J1SA 2R6QA 2VNGA 4LIUA 4IE0A 4RFT0 1WD4A 4ZS2A 1QMJA 3AMNA 4KU7A 4N7IA 3WVJA 5FK8A 4MYEA 4CDXB 1H2KA 1S0BA 1YQ6A 1ZZ9A 2CYFA 2LM3A 1OUSA 3KT4A 2X5IC 2Z5WA 1AR72 4N90A 4YZ3A 3RZLA 2D5HA 2PTMA 2O1QA 3LWCA 1J59A 4IEVA 4UF0A 4YZ5A 1PNFA 1C5HA 4Q27A 4Q4W2 1Y3TA 2AEZA 2YFZA 4AI2A 1PIV1 2SBAA 5E89A 4FXKB 4IV1A 2JE9A 3LA2A 1D4M3 1QIQA 1FX5A 1H4HA 2RS32 2ZGLA 2JE7A 2XQRA 4L97A 1BYHA 5AVPA 1RVF3 5GLVA 1NT0A 3SITA 4CZSA 4EWDA 1AVBA 5I8SA 3PVNA 1VBB3 4MLOA 3KF3A 2O14A 2GP5A 1ULEA 2XVGA 4YW5A 4YG3A 1OH3A 4CXYA 2G4IA 1OHFA 1DZRA 3O14A 4ZZ8A 5LA1A 4CCJA 5C3QA 3KV4A 4IEPA 3N36A 3ACFA 2VD7A 3OUHA 3PURA 4JGZB 4CU8A 5C5UA 3MFCA 3PVOA 4Y22B 2HWC2 4W6YA 3UT0A 3I4IA 4UT5A 5FYIA 1NQDA 1V0AA 3KWVA 2VVDA 2WZEA 4IXLA 4KBBA 3VBFC 1NG0A 5FRAA 4IESA 2XXZA 2UY8A 1SLCA 2ZGMA 4V1PA 4XMIA 1QXRA 1JMUB 4EN0A 4LBQB 5FOBB 2A3WA 4CP9A 2DUPA 2Y0IA 4IDZA 4IV3C 2R7EB 3K4ZA 3DPRB 2XVLA 3VL9A 3UGGA 5FZ4A 3O0XA 4RQPC 5J98B 5BNOC 1PK6C 4K1YA 3AKRA 5FZOB 1TMF2 3FJSA 4OQ8A 1UN1A 1J3PA 1W06A 3LGRA 5KXBA 3BOWA 1JZ3A 5BNNA 2ZGPA 5HCHA 1FYUA 1IKPA 1UWWA 1BXHA 2PELA 3HQUA 1UXZA 5GM0A 1AYN3 2FDGA 4D94A 2KXLA 2IXHA 2ETEA 1N1TA 4A3XA 5LEKA 3WCRA 3Q9OA 2YBSA 2EF6A 3URFA 3ZYIB 1VALA 4NR1A 5FZAA 2BYVE 5A32A 3RRDA 3EYPA 4LA2A 3I3EA 2PYTA 4YW6A 4AOCA 4BMEA 5FZ7A 2OVUA 1FV2A 2EA7A 5AFBA 4YVSC 1JOPA 1UIKA 2W95A 4WV8A 5F2WA 4BQ2A 2CGNA 3NV2A 1GP4A 2A3YA 3QH6A 4CVUA 3WUCA 1AX1A 1OFNA 2ZS6B 1C8M2 2OW4A 3EO6A 2ERFA 1GZWB 1S2EA 3ZSEA 4V2VA 1PGW1 2OQ7A 3AMPA 4ARYA 2XJRA 4CXWA 4HANA 4QKDA 4NWVA 4XF4A 3VBFB 1WZXA 3BVCA 1E5HA 2GC2A 2EXJA 3LD8A 3M1HA 3OPZA 1S1AA 2XG3A 1VBA3 1XNTA 1C1LA 1PZ8A 3H3ZA 2RJKA 1JZ8A 3I2OA 2W46A 4MGYE 3N4MA 3T2PA 5FXZA 1PMJX 3WNPA 5BY5A 1UY1A 1PIV3 1R091 1RHI1 2DYCA 4Q29A 5C70A 1MEC1 3HAGA 4RQPB 3ASIA 5BNOB 1PK6B 5B2GB 3VKFC 1YQ5A 4JHZA 1V6JA 4XDQA 3U0ZA 1ASJ1 3F2ZA 2P2KA 1U5IA 2WT2A 3FFQA 5HXVA 1N1VA 1FOD3 4XCBA 2HKXA 1TE1B 3M3QA 1S0FA 2TBVA 1O8PA 1IS5A 2WS92 2AZ5A 3CU7A 3GHMA 3LPGA 2XOMA 5L73A 1S0CA 4A7KA 1O6UA 4EN8B 2HWF1 1D0GA 1H2NA 2B9UA 2VH9A 1AR91 2E32A 5FY0A 4OI1A 1RB8G 1D4M2 2BWAA 4YVSB 1V6KA 1RVF2 4QX8A 3WP5A 5LA2A 1W6PA 5EZWA 1RUI1 2YC4A 3KGLA 1VBB2 5FZ6A 5DAPA 2Y33A 4FXGB 3ZOIA 4AEJA 2C0ZA 4PQQA 3MFAA 2OT7A 4GB31 1J1TA 3KSCA 2GC3A 3NKGA 3TYJA 5A6ZA 1COV1 4K1ZA 4UFIA 1NLSA 5JUVA 1MS0A 3THCA 4BM8A 4CEYA 5DZEA 5JSOA 1VBD3 4YGCA 1YCIA 1HB4A 4NVPA 1NA1C 4XJWA 5JAXA 1X9TA 4Z1VA 2PFWA 4NAMA 1UMZA 4QDQA 1PHMA 2DVAA 3UJQA 1UMHA 1JZ2A 3A0NA 2W39A 1W0NA 1NCRA 2WWJA 4HKWA 5JZGB 2D97A 2ADEA 1VRH2 5IVEA 5AFEA 3DGTA 3T0BA 1H2LA 4MHUA 3KVAA 4FP2A 4ZU5A 3B02A 3ZMOA 3BTZA 1MZ5A 4L92A 5GZEA 5KC5A 1RMU3 1GNYA 2Q1MA 3JQXA 1D2SA 2VZPA 4Y5Z0 1RUC2 4HFSA 4M3CB 4EROA 4XJ9A 1CAVB 1DZTA 3LIGA 5LK5A 5ACA1 3G6JB 4IUGA 5C8WA 5L7OA 3N7LA 4AFMA 4AL9A 2A7AA 1F5FA 1TME1 1QXJA 3JD71 4KBZA 5C8CA 1W90A 4Y1UA 3VD7A 3E5UA 3WV6A 5KBFA 2CWSA 2R1BA 4FOQA 4MADA 3ZVXA 5A3MA 1UYYA 2Q30A 4LO8A 1UXXX 1XB9A 2G9FA 3UGHA 2IXJA 4FO9A 3A0KA 1D7PM 4LHKA 4FQZA 1YJKA 2Y60A 1WGPA 4YVWA 4CDQC 3PU8A 3Q8FA 1O3QA 4D0QA 1TNFA 4DEVA 1DDLA 2VY0A 1HRV2 1PVC2 4RHV2 4XABA 4YFZA 2E33A 4K21A 1FMD1 1CAUB 1HXS1 2ZAAA 2DBNA 1WLDA 1LB2A 3BPZA 2DVGA 2R041 2Y6KA 1NA1B 4E8CA 4XF1A 5C3PA 5APAA 1GBGA 1ND2A 1ZZBA 3KQ4B 1KGYA 2W92A 1JZ6A 2VNOA 2ADDA 5FZ0A 3UNPA 1STMA 4Q4X1 1MPXA 1RTVA 1E5RA 3M3CA 3MICA 2NP0A 1PIV2 5D8AA 3ZSMA 1I1EA 1REEA 4OUSA 3N35A 1CX1A 3WW3A 4Z8BA 2OZJA 3MIBA 2GNTA 3RJRA 2EIEA 4XETA 3TEYA 3INAA 1RUI3 1DGLA 2ATFA 2AREA 3K51A 4Q0SA 5FTTC 3O5SA 5F6KA 1FOD2 3BYWA 4FFHA 3P5BA 2PLV3 4FP3A 4K3UA 3SCHA 4C8DA 3MIDA 2AEYA 4YGDA 4Q0VA 4K8FA 1ND3C 2Y8KA 5IVBA 3H7JA 1H8TC 1COV3 4MGSA 2HWD1 4QQLA 4Y1YA 1XNDA 4ATFA 2BDRA 4P9WA 2VZUA 1U12A 1RITA 4BQ5A 1KQRA 1W6MA 3ZN5A 1SLTA 5F37A 2G19A 4LR4A 4ZS3A 3IPVA 1QWRA 1OFSA 1KFUL 1A6CA 3H7YA 4A45A 3ALQA 4ASLA 1X7NA 3V65A 3VD9A 2GU9A 1W8ZA 2D93A 2QQMA 3C7HA 3I54A 5A3LA 2VUJA 4CDXA 4XC9A 5G05L 4AQ2A 4WVWA 5HPOA 1E5SA 5LB6A 3VKNA 3BGAA 3NNLA 5FJHA 1C57A 1DQ2A 2F4PA 2LROA 3EHKA 5EXOA 3Q8BA 4O7XA 2V72A 4AK3A 2H0VA 2X53S 4AVSA 5KC6A 4NMIA 4FFIA 2VCAA 3OGSA 5FJKA 4QB6A 2YZ4A 3U4XA 3P1IA 2B39A 3JD73 1OPMA 5F6LB 3S5AA 4DRRA 1JN2P 2YBPA 4PLNA 4FOVA 3OBTA 2CV6A 2WR9A 1B35C 4OHZA 1BBT3 1QDCA 2BGPA 1LJ7A 1HQWA 2J1TA 3HNYM 4N9IA 5E6HA 2JKXA 3NAPC 4G9SB 1Q8PA 2R071 2BVBA 2KR2A 1DP0A 4OCTA 3ZKUA 4DQAA 3ZPYA 3K48A 1UZZA 1XRUA 5LA9A 3LFMA 3TWIA 5DDJ3 4OMDA 5FYYA 4BDVB 5CB7A 1POV1 2C5DA 2VCCA 2CGOA 4LBJA 2Y38A 1ND3B 2VOXA 1C8NA 1SQ4A 2QKDA 2B9VA 4JGZA 1UX6A 3RMXA 1GWKA 2VVFA 3C7FA 4Y22A 1DQ6A 3AZWA 3V0AB 2NQYA 1J83A 2GMEA 5FREA 1PGW2 3DV8A 4Z92B 5FUNA 1M06G 2AACA 5DZFA 4D6RA 5IHRA 1XC6A 4XW3A 4DUXA 3O1UA 4GULA 3D3AA 5KHIA 4BMBA 3POYA 4FCAA 4O9GA 2VUDA 1GNHA 3OF1A 4MGKE 1K42A 1XSQA 2TUNA 1FNYA 2VC9A 4UFHA 4Q4X3 3NJYA 4JQTA 3USUB 3DPRA 5FO9B 4IEQA 3LEMA 3ZM8A 2WYFA 3KMHA 3PMSA 1RHI2 1R092 5FYVA 4LE4A 1RC6A 1MEC2 1JI6A 3LA3A 3U14A 3WNKA 5FZOA 1C3HA 3I3MA 3SCGA 1MS5A 4YW7A 3KT1A 2IFWA 2XL9A 1GV9A 3HT2A 4LHSA 1PZ9A 4MZUA 5FO7B 5C9AC 1XSRA 1ASJ2 3WQ0A 5BNQA 1AR81 1SPPB 1IKQA 3HJRA 2F6BA 1QGLA 3T4HB 3RPQA 4COUA 5A6YA 1B35B 4FPLA 2YPJA 4Y33A 2DCJA 4CUAA 2P34A 3S5QA 1Y4WA 3NAPB 1AR92 1LKNA 2YROA 4CPBA 4LQRA 2KD7A 4RN5A 3C8XA 4TYSA 1MR5A 2RS53 3HT1A 3SH5A 1D0HA 1F8VA 2QQPA 2P17A 2E26A 2EXIA 1GANA 1KITA 1RUI2 3NNGA 2W68A 3ORJA 4Q8LA 2KM2A 4HN1A 2ZTNA 3K46A 1GZWA 4YZ1A 1IPJA 5DQ0A 1SEFA 1UY2A 2X10A 5FPAA 4FFGA 4M3CE 4DZGA 3K3OA 2MPFA 5FZGA 3VBFA 1LOGA 3GNEA 3MDPA 3GZUC 1COV2 3PUQA 2VZQA 1C4RA 3M7AA 4LBNA 3AFKA 4Y26A 3IDBB 1G9AA 4XVHA 5IAVA 4TLGA 1H4GA 4CCCA 5CKNA 2FDIA 1IS6A 5KHGA 3RFRA 5F8PA 3T2TA 1SLLA 4R52A 4F7ZA 4QQHA 3C3VA 3I8TA 1IGOA 3ZYGA 4FPEA 4RQPA 2Y6FA 1PK6A 2DCYA 4ZPIA 4E4HA 1ALYA 1UD1A 1I5PA 4X8PA 4HETA 3NQHA 1AZDA 5C9AB 2BGOA 1H9WA 2YYOA 3POEA 5K0UC 3MIHA 3RZHA 1RIRA 4NO4A 5JMCA 4ARXA 5ACA2 2VMGA 3CJIC 1VP6A 3ABZA 1QXPA 4UW4A 3WX5A 2ZCWA 2ZKNA 1TME2 1POV3 2W9XA 3RSJA 3ZIWA 1HV0A 3JD72 2IXIA 3J9SA 1RYYA 2VW1A 1BK1A 3ZYHA 5T55A 3GYDA 1P8JA 4I09A 4AF9A 2QQLA 4YVSA 1PMHX 3LAGA 4HG6B 4CE8A 3NJZA 4A6SA 1DYKA 3OD0A 3AC0A 2WT0A 1FATA 1ULDA 4HKLA 2J1VA 3VD5A 4XDPA 2NLRA 5LCWL 1JYVA 1H9PA 3WD5A 3AYEA 1BJQA 2J42A 2VQ0A 3H0OA 4MGZE 4Q1PA 4UYBA 4FPYA 4XFGA 5T54A 4E4SA 5A6QA 3D0SA 3CBNA 5CAZA 1OLQA 2JDNA 1FMD2 1HXS2 4P9XA 2JWPA 4XHBA 1X8EA 4BE3A 1OQ1A 2DFCA 4CCNA 3CIHA 2R042 4JAAA 2A71A 2VMEA 2RMU1 3AL5A 4GMP3 4B8EA 4ZU7A 1UCXA 1WBFA 2V5DA 4LTAA 4M4RA 2JX9A 2VZTA 4XJ8A 2PAMA 1WLWA 1GLHA 4BB3A 5JZGA 3MF6A 2OXBA 3JB8A 1RUD3 1DGRN 1LOAA 4LKEA 2IXKA 3ZYBA 2QQJA 4DXZA 4Q4X2 4ATEA 4NJ4A 1WW7A 4NN0A 2ZJCA 4CCOA 2VOKA 5K0UB 4M3CA 1CAVA 1FPN3 2WDBA 1YFUA 1DGWA 3HD8B 1CPNA 5FY4A 4NROA 5FY7A 4CDWC 1Q8OA 3UGFA 3S0MA 3VDBA 2W1QA 1AL0G 3CJIB 4AGVA 4QX3A 4J1XA 4KMQA 5GLZA 3RYRA 3H9AA 2VXJA 3I2HA 4DO0A 5J48A 1ZYBA 1XOYA 1CGPA 4XBNA 5KHHA 3CZUA 3E97A 4K8RB 2HEVF 4YWAA 5EYXA 5LBEA 3V0BA 5ABJA 1ZBA1 5GLTA 2BEOA 1R083 3GCXA 1KD7A 2B4KA 3LSDA 5FP4A 2ZHKA 3IN9A 3ES4A 3WDVA 1TVGA 5EPAA 3RI8A 4J1WA 3CHXA 1QJU1 2B45X 5CADA 2IZWA 4RGGA 4UOJA 2LUWA 3RZJA 5HI0A 5JXIA 5CFDC 4BLJA 1QJFA 2DTYA 5DN2A 1AJKA 4QPYA 1CAUA 1QY4A 2B7YA 5K7PA 4QKFA 4IL7A 3PIGA 1AYM3 5GZDA 4YM3A 1KRIA 5FZMA 3BPSA 4Z07A 2RR11 1NA1A 1VE0A 4JVAA 1CAWB 3VUOA 5FMOS 1NKGA 4OZXA 3LEGA 1AL23 2MHFA 4AHWA 2VZVA 1NCQC 4AFDA 3OGJA 2JG9C 4CXXA 2UYAA 2HEWF 4UAPA 5HV0A 4LHLA 4I3PA 4P08A 1NY71 2OUJA 2RDSA 3D4KA 2ILMA 2AGSA 4P5YA 3BU0A 1IG0A 3AL6A 1LGNA 1TZOA 5BPXA 2CSGA 2GNDA 3U37A 3BOPA 2D6PA 4CDWB 1UY4A 2EXHA 4YPJA 3LDKA 4IEXA 4N53C 2VBBA 2IWGB 5FY9A 1HDKA 3QLQA 5FPLA 1EAH3 2R072 4HPKB 3POFA 1H1IA 3HMYA 4NHYA 1H0BA 3GJAA 5LBFA 4AI8A 5JR2A 3POWA 3DEMA 3M2MA 3VZMA 4CDQB 5EJ1B 4HT1T 1O4ZA 1UF2C 3N3HA 1BEV3 3T2OA 3LIHA 1QJZA 4CDQA 4A7YA 2EIDA 4NE9A 2ZACA 3CZJA 3DYMA 4UBGA 5FV3A 1HB3A 4ISRA 4WM7A 3U1XA 2ZA9A 4URAA 4AEKA 1DQ5A 1JBCA 2EVXA 2VNVA 4A7ZA 4OYUA 4XILA 4CRQA 5A3TA 3DYOA 2RMU3 3MF9A 1KS4A 3OEBA 3QCWA 4GD4A 4NHXA 3WP6A 3UV9A 5DUUA 1O5UA 1SACA 1XE7A 3AFGA 3DXUA 3N9MA 4LOTA 5IAXA 2D6KA 4DXTA 3H3LA 3SEEA 2R0HA 3LF7A 3FC0A 3AXEA 1OQEA 5FZFA 3SLIA 1UZYA 5JCTA 4HK9A 1NCQB 3DN7A 3VZOA 3O1SA 3WW4A 3AKSA 2JDYA 3NV4A 2WO2A 2VGDA 2Z42A 1GICA 1XU2A 3WLUA 1N1YA 3H8RA 2P3IA 2HLEA 1AR82 4AEDC 1WA6X 3GHNA 1RUD2 4I0WB 2VAUA 1AYN1 1ZBA3 2ZKLA 4BXSV 2PHLA 5A7WB 4WVMB 2A73B 4N53B 1GKBA 5FO8B 1GMMA 5BV6A 2QZ3A 3ZFFC 3ZXJA 4XFFA 3OUIA 4EN9B 5L9VA 5I8YA 3MLKA 5IATA 1F2NA 2HH9A 1QJU3 2D6OX 4P9YA 1MZEA 4XJZA 4E8DA 4LITA 5LBCA 4AI3A 3KT7A 1S4CA 1NUKA 4NIIA 1ND3A 1ULGA 1LGBA 2CY6A 3CL1A 4FBFA 3WQ1A 3PTRB 4E4DX 2O8OA 4Q2FA 4Q4Y3 3ZLIA 5AVAA 3KM5A 4XE9A 1DIWA 5FDBA 1QH6A 4Q26A 4KWJA 1EV13 3SH4A 1MZ6A 3POIA 1BLZA 4CU6A 3R0RA 2FQPA 3WHUA 2ZGTA 3AB0A 2WLQA 3USUA 3O1MA 1W2UA 2DF7A 1L7RA 4AQ6A 1VBA1 5F3IA 1AUYA 2C26A 1NE6A 2OA2A 2W91A 4O65A 3N7MA 1YXWA 1LEMA 2VECA 2J1RA 3VN4A 2W1WA 1O4YA 1OA2A 4LUMA 4XEZA 4QKBA 1SPPA 1UL9A 4YG6A 5FZEA 3I3BA 1X33A 2WO3A 2CL2A 4YFWA 1V70A 1BZWA 4EQVA 4PDWA 4BU2A 2A1XA 1AR63 1B35A 3NV3A 4XFIA 3V64A 2ZMLA 5CU1A 1FOD1 4PBOA 1SLIA 3B3QE 4KGQA 3NAPA 3RS6A 1V9U3 2ZAHA 4H2AA 2LS6A 4BQ4A 1LENA 1LHOA 1PO11 5JIAA 3K4AA 2ZEXA 4MGQA 3T09A 5KHJA 2FDJA 4CSWA 2VZRA 4JRAA 2D3RA 3EXUA 3FE5A 1EAH2 2Y0OA 4NUBA 4C0HA 4DMIA 2BZDA 3WZ1A 3KVBA 4LO7A 1I9RA 1IG3A 4OQ9A 4EWAA 4FAGA 2GN7A 3ZYFA 3OUJA 3FBYA 2YPDA 3I49A 1PX3A 1YNAA 4BZ4A 1WMFA 2A6VA 2ARXA 1BK0A 2BRTA 1NXMA 4N43B 5LRSA 1AX0A 2CWMA 2WLPA 1NLRA 1U0AA 2R1DA 2VQTA 1JZ7A 5FY8A 3E1F1 3ZSJA 1VPHA 2VTXJ 2RMU2 1CWPA 1W9YA 1HRI1 4W65A 2X5IB 1VBD1 4OI0A 3NVCA 3GGLA 5FYBA 2R49A 3H1YA 2XJTA 2B42B 3AK0A 2D40A 3LZZA 4L2NA 4AAPA 1JYTA 5FAXA 1UYPA 3PUHA 1WCSA 2FZ1A 5C9AA 1G9DA 3KHCA 3FLTA 4GWNA 3DF0A 5BUVA 2VTFA 5CG9A 1RMU1 3VD4A 1J3RA 3FUOA 1W99A 3AVRA 3O1PA 2ZGOA 4QHBA 3NW4A 1QQP3 2XJPA 4LHNA 4CP1A 4WVZA 4MSVA 2IXLA 3C2UA 4FAHA 1ZBA2 5GZGA 2Q5TA 5A7SA 1Y9MA 3WF1A 1SLBA 4XUTA 4HL0A 3PJYA 1UQXA 3LFIA 3VHNA 1UO9A 2P3YA 1HX6A 1QJU2 4LO6B 1XNCA 4XIKA 5DXDA 3RYPA 5IK7A 3HBKA 4EV0A 1IS3A 2VVEA 5DG2A 5F5AA 2C24A 4B4RA 2MEV3 1LESA 1GWMA 1WCUA 4HOOA 5JI9A 5FYCA 4U2AA 1VMHA 1Q5OA 3OCPA 2P4EA 3R6SA 3O0WA 2WAOA 3CLPA 4YM2A 3OPWA 5HCFA 4XMAA 2RR12 4IV3B 1UMIA 1S0EA 5FKCA 3B93A 3LEIA 2GMMA 3ELNA 3IM0A 5IFPA 3ZDVA 1S0JA 5C3OA 3MLLA 1POQA 3PNAA 3WW1A 3T0AA 2AYHA 3LE0A 4OHVA 4DXSA 1WBLA 2WQ4A 4YW3A 3VZLA 1NY72 3IDAA 5DAVA 2A75A 3T08A 4S2GA 3PVBB 4QX1A 3J7MA 1E5IA 2P1BA 1OUXA 3IIAA 3PUSA 4ISQA 5K0UA 3T30A 3VBUC 3VBRC 3VZNA 4LBMA 2J22A 3SNMA 3WT3A 1PO13 4HMZA 5CNAA 3CJIA 2VQAA 2D3PA 2W5FA 4PIZA 1RJ7A 1GOHA 4OVEA 1F4HA 1W05A 3ZFEA 2EAKA 2BFUS 3H3UA 4L99A 4BLIA 2I74A 4EZHA 4XBQA 5GALA 5CYYA 1LRHA 1RUH1 4LNVA 1PVXA 4BH9A 1V9U2 3J7LA 3DYPA 3B01A 2G9ZA 2PLV1 2VJXA 1OMIA 1G7YA 3IMNA 3LEKA 4CTEA 5EWSA 3ZKYA 2DUOA 4QHZA 3S7IA 1LULA 3I2KA 3FN9A 1HRI3 5GLUA 3HNMA 3VBHA 4HSLA 3B5LB 3NJXA 1OOPC 3AZXA 1PGSA 3WDYA 1CAWA 2GP3A 1UW8A 4NRMA 3T0DA 1S55A 3I59B 3N9OA 4AG4A 3VDCA 3PMEA 5FLHA 4XQWA 4IGQA 5LK7B 1OPOA 1UAIA 2VW2A 3B9IA 1RUOA 1F15A 5ANNA 2BWCA 3IB3A 3ACLA 3POGA 5IVFA 4I02A 5CG8A 1SLAA 3E5QA 5FZDA 5C5TA 4Z2WA 2RDRA 3BCWA 1LAJA 4OI4A 1LNSA 2XQXA 3BTAA 5FYZA 3VBUB 1GFF2 3VBRB 1LGCA 2HJIA 2CAVA 4CDWA 1RUF3 1AYN2 1Y7BA 5F3EA 4UWDA 5L9RA 4ASKA 4EJRA 4M00A 4QPIC 3PLQA 2VMIA 2ZXQA 2BBAA 4HPKA 3V0AA 4C91A 1BBT1 2VMFA 2E51A 4PJYA 1MACA 1OD3A 5A33B 4FPJA 2PA7A 1RJ8A 5FP3A 5FOJB 1ZRDA 2NPIA 4L8QA 2Q1FA 3PJQA 5EQUA 1LHWA 1ZBE3 2R063 3D8CA 3E5XA 4H7LA 4XOGA 1RUE3 1QU0A 5DDJ1 4YZ2A 1H1MA 3I3QA 5A1FA 2UWBA 3AX4A 3N7JA 4R9BA 1ZRCA 3PVEA 4UW5A 2NMOA 3I2FA 5DG1A 3HEIA 5FZHA 3VKOA 2OKXA 1D4VB 4OHWA 3QOPA 4QDSA 4GALA 3LOBA 1T2XA 2AUYA 5EFUA 5JR7B 4FFFA 5A70A 3ES1A 1V6NA 1L3JA 1SDDB 4BK5A 1OOPB 3ZXLA 1LHVA 2PHRA 5LA0A 3OEAA 2Y6LA 2VL4A 1JOJA 3BODA 1YIPA 3KHBA 4IEUA 3O1TA 1NCQA 1VBA2 1CVNA 3H8XA 3JB4C 4XACA 1BMV2 1CIWA 2V4VA 5DAXA 1HQNA 4UFJA 2NYYA 4KWLA 4LKSA 2XH6A 2XGXA 1HB2A 3W59A 4RGKA 1HJFA 1OXCA 1REFA 1GZ9A 3T3YA 3HNBM 3CJXA 2SLIA 5HCBA 3O0VA 3N9QA 3HN1A 4A42A 3KF5A 3W58A 2ZPXA 4Y5SA 5A7WA 2JDHA 4WVMA 4N53A 5JDBA 4CYDA 1ZVFA 1RUH3 4QT6A 4C1XA 1OVSA 4Y20B 4QU2A 4DB5A 4LLFA 3N7KA 1QJY3 4XZUG 4O9EA 3IBMA 1PO12 2WSUA 3H42B 1KXGA 3B69A 4XAEA 2BBVA 4XJAA 2BV4A 1PNGA 1MS3A 2RS51 4IE4A 2ZABA 4XF9A 4NRQA 1VRBA 3VDDC 1GZTA 4CDUC 3UKVA 1AXKA 4MO3M 1O91A 4Y1ZA 2BOJA 1UY3A 4ZKTB 1UZ0A 1W2TA 4ORFA 3J7HA 3JBG1 2Q4SA 3WNNA 1GOGA 1A8DA 1JYIA 2XJVA 2K0GA 5C3RA 4QX5A 2W1SA 3MV11 3L2HA 4YNIA 3WP3A 4AXOA 4AFAA 3AP7A 1RL3A 4C0BA 4FTEA 2VCBA 1HRI2 1HW5A 2CDOA 1VBD2 2PHWA 3KV5A 4AYUA 4G3YC 4I01A 4GKXA 1XU1A 5D21A 3DECA 2ZMKA 1W0OA 5JXGA 2XBO3 2R30A 1KJLA 4OUMA 5EV7A 3W9AA 2ZZQA 5ANQA 2ZX1A 3AZYA 2A6YA 3AYAA 3ZYJB 4XUOA 3BKZA 5ISLA 1RMU2 2GNBA 4JDMA 5KXEA 4M0HA 4J25A 4QGMA 2XHKA 4I0AA 5K4LA 1V6IA 3LQCA 4B7KA 3DXTA 3GF6A 3N9LA 4ES9A 1XPWA 4LK6A 5C71A 4LULA 2JDZA 1MQTC 1SFPA 3NV1A 2RS13 4TLFA 1SCRA 5CKQA 4B4PA 1H8TB 1K12A 3TNPB 2ID4A 3KQRA 3BI3A 2DVBA 2V4AA 4FQ4A 1W8UA 5HXMA 3WDWA 1NZIA 2UWAA 5GLWA 4HSJA 3P6BA 1W9TA 4D7SA 2BGCA 1RUE2 4N43A 5EP9A 4RFRB 4LBQA 1F31A 3G7DA 4CCEA 4PI2A 1YC61 4EYUA 4M01A 4JZRA 2RDQA 2HWB3 1W9WA 2WZPP 1IPKA 1W6NB 2ZGKA 1WCQA 4H3WA 2X5IA 4Q0QA 2HEYF 4CUCA 1WW5A 5JSPA 5DMYA 3K4DA 1PO21 2GZWA 4GMP1 2VMDA 2BJSA 4IQPA 3DCQA 2WL1A 4BWOA 4E4ZA 2QJVA 3C7EA 1QJX1 4JHTA 4BQXA 5FZ1A 5FP7A 2MNGA 1UNBA 5DUWA 2JG8C 1RUD1 1H2MA 5J3UA 4GA9A 1V6MA 4BQ1A 5IT6A 4B3NA 1F35A 2WYSA 3KZ4C 2WNEA 5LEJA 4KWKA 3IZOA 1ST8A 2TEPA 3WF3A 2PAKA 4LA3A 5FMCA 4FPHA 1FPN1 2QE3A 5LRRA 2YC0A 2R32A 5FYTA 1LTEA 3TRSB 3C7GA 3BN6A 3H1MA 2WNUC 3OBZA 1S0IA 4QDRA 2DURA 4META 1DZQA 5L19A 3GBGA 5F5IA 1MQTB 4K40A 1KJRA 1RUH2 1OSGA 3KLSA 3FFZA 3JBG3 3RWNA 4MHRA 2PLV2 1R081 3BTYA 1APNA 1HN1A 4GZ9A 2GDFA 4RD7A 4AEMA 3BALA 2JDAA 3PU3A 5HCAA 3RZMA 1HJGA 2XB6C 1SCSA 1ENQA 3I97A 1EUTA 3RMYA 1FNZA 1W03A 1W8TA 2WN3A 2XHNA 5I0SA 5DAWA 2D6MA 4P02B 1T6BX 2BOIA 1GP6A 2VZSA 2WT1A 3TB0A 4EZ4A 2DFBA 2JDPA 2Z4FA 1JW6A 4E2GA 3VKMA 2CTVA 2E6VA 1OKOA 4IV3A 2C4XA 3ZSKA 4XPVA 5HBAA 2OZ6A 1AYM1 1W28A 4MGTA 5E88A 5BNOA 2C9KA 4LBKA 2WN2A 4OHXA 2WAAA 4LXLA 5JPNB 3TBDA 5F3GA 5I0RA 1GSLA 4QPGC 2BNMA 1G8WA 2P37A 1AL21 3I2IA 1PX4A 1VAKA 4LIVA 3FMGA 4UXAA 2PXJA 3WNOA 1ENRA 5EJ3A 3WDXA 4LORA 1LHNA 2JG8B 5A7QA 2YBKA 2JDKA 4AHZA 2UURA 3B00A 3VZKA 2WKKA 2XBO2 4M4PA 4ZU4A 3D6EA 3ZX7A 1OKQA 2CGPA 1LU2A 1QOOA 4PF1A 2RDNA 3RYKA 2PQSA 4AWDA 3RZZA 2C1FA 3W5NA 1YI7A 4ZONA 2IXCA 1BBT2 2WNUB 4QX0A 1YWKA 4JGYC 5IK8A 2ZX0A 1EAH1 1GZCA 1VBC1 3U07A 4X6RB 3MBWA 1CN1A 2EAAA 4MXWB 5A80A 4CPBD 2WWSA 2ORZA 1ZNPA 5DDJ2 3N9NA 5C3SA 1CD3G 3M8LA 1G9CA 5T50A 2LRPA 3O1VA 3I2JA 3WQ7A 3ZXDA 3NNJA 3OGVA 3THPA 1BEV1 3EB7A 3HIFA 2CAUA 2GC0A 2XJQA 4LMFA 4XFCA 4JDOA 4WZFA 5F39A 4NIDA 2G1MA 4W8JA 4XXPA 1VMJA 5EIYB 5FPXA 1UZWA 4PLMA 4PQ9A 4YG0A 3H1WA 4FPCA 4NRPA 4P5HA 3HPNA 1EUUA 4BQYA 1VAVA 1PO23 3M3IA 4NPRA 3NRUA 3DKWA 2VMHA 3OBAA 4QXHA 1OLRA 1QJX3 3I59A 4K20A 3GBWA 5FWJA 3HVDA 1OBNA 2JD4A 1J58A 3GZAA 4JQRA 5FXVA 5IK5A 2QNKA 1JUIA 4LUKA 4IEWA 4QPGB 2DCTA 1OD5A 1H1AA 4ZY9A 5J36A 1VR3A 3QD6A 2VBPA 1SFYA 2DWRA 3NNMA 3KGZA 4YGBA 5I93A 2W3JA 2E7QA 3AJZA 4NIAA 3KB5A 3OY8B 3MEPA 5H9SA 3IAPA 3WG2A 3WNMA 4GWIA 3VBUA 3V56A 4Y24A 5LATA 4UFMA 1YQ8A 4DRVA 1ULCA 3S30A 4QB1A 1URXA 4YGEA 3UKTA 3MPBA 3P3NA 2VULA 3K77A 5GJ6A 1X8MA 2AENA 3K3NA 3OD4A 5A33A 4NHMA 2QFEA 1DGRA 4AFBA 2XWBB 4JGYB 2BNNA 2ZEYA 2QQUA 4Q4V1 4A3ZA 1SDWA 1SFNA 2VU9A 2RS52 2HWE1 4OLLA 2J1AA 3CNAA 3DKQA 4QKNA 2W08A 3WNLA 1G9BA 1CJDA 1KS5A 2V5YA 1F9KA 1UYXA 5DUVA 5FCCA 2OIIA 4A2UA 3D0JA 1FT9A 2BU9A 1T6GC 1MVQA 2W0XA 5A3UA 4B4QA 4ASMB 1EYBA 3JBG2 1ENSA 4HN0A 2P6HA 4AQTA 4NHKA 4UW6A 2YDEA 1AF9A 2YU1A 2EXKA 2X09A 4Q4Y1 3WQBA 1OOPA 2ORXA 4XFBA 3WG4A 4P14A 4TWTA 2YG0A 2IVIB 4KU8A 1EV11 4XFHA 3THTA 1OA4A 1GU3A 2YXSA 4XF3A 5IFTA 3ITQA 5FUPA 3ZXEA 1JH5A 2W87A 2JE8A 2GMPA 3PL0A 5J37A 4FTBA 3L2YA 4KQ7A 5A1LA 2OQ6A 1I6XA 4HXCA 1H30A 4HZFA 1HQLA 2O0OA 4KH9A 1AR73 3O12A 2EIBA 4ES8A 1CPMA 3RG0A 3VHRA 1FXZA 5BYNA 1LOCA 1QDOA 1VIWB 4Q4W3 2OYZA 4C1WA 5J1XA 1UOJA 3ROUA 1VBC3 3WG3A 3CEWA 3CO2A 5C4WC 4Y20A 4XTPA 5JOYA 1AR61 1OVPA 4TN7A 1DQ4A 5FZ3A 2GN3A 2FDFA 5LASA 2J1UA 4XCAA 5JPMB 1OC1A 2EALA 3VD3A 2NM1A 3BTXA 1IS4A 4C90A 3Q8EA 1CX4A 1V9U1 3WDUA 1O3RA 1GOFA 4CCKA 5FPBA 3SMHA 1UYZA 3RI9A 3WXPA 3ETPA 4OULA 1W6OB 2QQIA 2VXRA 5CFDB 3AMMA 2DVDA 2YU2A 1UZVA 1RUG1 1CZVA 4IE7A 4JC1A 4H7MA 5JWPA 5F5CA 3A4UA 2HWC3 4YW4A 1CQ9A 4COVA 3LSEA 3JCIA 3RNSA 1XJAA 2X8KA 1CAXB 3SKJE 4MG2A 5CKMA 1WD3A 3TNQA 2YGLA 4NAOA 4BA6A 1JTZX 4AI9A 2VZOA 4I0BA 4Q5OA 4BHPA 2Q8OA 3H8OA 1GQPA 5IWFA 1DQ1A 2JG9B 2GSYA 5FZIA 5CFCC 1SG3A 1V00A 2JDMA 2XLAA 4HK8A 1PO22 4QU1A 2ZMNA 5IJRA 1F5JA 5CVRA 2FMYA 2A5ZA 4XUQA 2ZHLA 2AC1A 1DGWX 2W94A 1QJX2 4A41A 1GUIA 3OOXA 2XDVA 2PAEA 3I7DA 2WNVC 5A7OA 1DU3D 1XYNA 3PTYA 5T5OA 3GM8A 4NWWA 2I2SA 3APBA 5E16A 3LCPA 1ZRFA 1CZSA 2IC1A 4FOWA 1JYCA 2QQOA 4LOSA 4AHYA 1O3TA 4CDXC 1YIFA 4ET7A 4H14A 2XL7A 3S57A 3R4SA 1AXZA 3NJVA 4Y1XA 3MHZA 3BIWE 3FHQA 3FZ3A 4N7UA 4Q4V3 1FPN2 5JI7A 3MGUA 1W6QB 2HWE3 3AP5A 3S6PA 1W3VA 1MS8A 4FSJA
chains in the Genus database with same CATH topology
2X29A 3RJ2X 3RQ0A 4XBLA 4E27A 1QQP1 3WW2A 1R1ZA 1H8TA 3WINE 4CEWC 4AVTA 1XNKA 3HBZA 1R082 2ET7A 1WLCA 3MZHA 1PZ7A 2XVKA 3D5OA 4RSUA 1C8M3 4R9CA 1UU4A 4G4FA 5AC91 4TZDA 2FZ2A 2XLFA 1DG6A 3AP9A 2MEV1 1OI6A 3D82A 3HWJA 4JGZC 4YM0A 1W6NA 2DCKA 4HVRA 4ITCA 2K9ZA 1AYM2 2BTVC 1KFXL 2JICA 3AJYA 2JKBA 3VKLA 1BMV1 1GNZA 5CFCB 4QMAA 5T3NA 2GH2A 3KCYA 4F3JA 5H9RA 3IPVB 1AL22 5I0TA 2ZHMA 1JUHA 3PHMA 4AEDB 2WNVB 1YFYA 5FLJA 3AMQA 4W6WA 2E7TA 2C9AA 3ZFGC 4PBPA 3E6CC 3DPRC 4P9GA 3ZFFB 1XE8A 3OBRA 3ECQA 4AVCA 3BB6A 2XKPA 4D7YA 1N3QA 2QDRA 2WS93 5C4WB 1H8VA 3AKTA 1S2BA 1MQTA 4K7JA 1VBC2 4LEJA 1RUG3 4CEWB 4LT5A 4JTNA 4I30A 2UY9A 4P9LA 3M70A 4R4XA 1BEV2 4DOUA 2FHRA 2RM21 3EJKA 2OUHA 4XF0A 3ZYRA 2P3KA 2ARBA 1ZA4A 3U11A 1S0GA 1G9FA 1Q43A 4QGNA 4M0NA 1WCKA 4KGGA 1UKGA 1DLLA 1RGSA 3E6BA 2GALA 4KG8A 3VHOA 3X29B 3SCFA 4U36A 3VGIA 3WCSA 3ST7A 1Y9QA 1AJOA 5BNPC 4KG0A 4DY5A 2YGMA 2H6BA 2JG8A 1VRH3 1IHMA 2Z79A 3R4UA 1LCLA 2E53A 2D98A 3ZFGB 2FMDA 4JDNA 2YHJA 4X8NA 4YW1A 2BVVA 1CR7A 1RUC3 3ILFA 5IUQA 3M3OA 4BOWA 1RUF1 2WNUA 5DUXA 1HLCA 3L9JT 2AR6A 1YO8A 1HIXA 1UU6A 5T5LA 4IETA 4Q4V2 1QF3A 4PCRA 4MXWA 4XQDA 1WLTA 1NQJA 2BQPA 5I0UA 2D7FA 2HWE2 4D3WA 5CA6A 4LE3A 5AC93 1LOFC 3IT8A 1NXD1 4NHLA 3ZIXA 4Z82A 1ZBE1 2R061 4RA0A 2PHFA 1RUE1 4WM8C 2WZR1 4XFAA 4S2HA 1A8MA 3SXWA 4R8HA 4Q4Y2 3UJOA 2A6ZA 1AHSA 1HRV3 1PVC3 1RUJ1 2FBEA 3IKWA 4QGLA 1MS9A 4RHV3 5BXXA 4B7EA 3ZN4A 1EV12 1VB2A 3JUUA 3OGGA 1I3HA 1C1FA 4GWMA 1G86A 2K2SA 1OA3A 3NSTA 4UBHA 5I8TA 3TOJA 4QPGA 1XYPA 4X6QB 2Z2SB 1SBFA 2A3XA 3LKJA 3OY8A 5BNPB 2YV8A 3OJBA 4FPFA 4FVVA 2UU8A 4YW2A 2ZGQA 4XHXA 2RHPA 4COWA 1XNBA 3ZO0B 4JCKA 4S2FA 4YARA 1ZZCA 1Z7S1 3VV1A 4SLIA 4FOYA 5JZGC 3T1MA 3T1LA 1D2QA 1AR62 2WA3A 1BCXA 4XXAA 4MXVA 4JGYA 1POV0 1ZRRA 2RM23 1QJY1 2WC2A 1UIJA 5SV8A 1AX2A 4QM8A 4R9AA 3MIEA 3KS7A 4HBNA 2D6LX 2I07B 4AI1A 4DFSA 3QBQA 3ATGA 1CESA 2VNRA 4URTA 4WM8B 1RUG2 2PHTA 5K9YA 1LOBA 5ABJC 3J26N 5C33A 1MVEA 2VOWA 1RUNA 1Z0HA 3VHPA 2WFPA 4DS0A 1RINA 1S0DA 1KDMA 5EYYA 3RDIA 3HQXA 1A78A 4GMP0 1WMDA 4HVQA 2ZGUA 1QOSA 1UPSA 4RS5C 2WQZC 1Q56A 2XBO1 1N3PA 4IEZA 2QVSB 5J96B 3EBRA 1NZCA 4FPKA 1FV3A 3WR0A 5K8SA 4XTMA 3NL1A 1LECA 5F5QA 3OYWB 2XKOA 5JOWA 4HKOA 2DTWA 4AVBA 1N47A 4QD2A 4AGRA 4RR3C 4LO4B 4AVVA 1QQP2 4ZXKA 4GH4C 2ZGNA 4B29A 4COYA 3ZXKA 1BKZA 2VG9A 2WZR3 1BVVA 2O8QA 3VBOC 3H50A 4LBOA 4AI0A 2D3SA 3ZN6B 1W6OA 2RS11 5FQ0B 5CFDA 3GZTB 3ZDSA 5H9QA 1RUJ3 4CP0A 3IDEA 3J4UH 1ZZ6A 3V0BB 1QNYA 1J1LA 2QCSB 5AC92 3VBSC 5ABJB 1O3SA 1CAXA 1REDA 4K6BA 4IEYA 2MEV2 4GIQA 4W6XA 1O7FA 4MX3A 5JVVA 3ZMNA 5KXBA 3UL2A 5JIUA 3DUIA 3WQ1A 4RL7A 1HV1A 5T52A 3WNXA 3H8UA 3LB9A 3FUQA 4WM7C 2JG9A 3MW4A 1XXNA 2JECA 2VUAA 2GAUA 2HWB1 3LOIA 4Q0UA 4S2DA 2YUEA 1LHUA 4HLTA 1OQDA 1Z7S3 4RS5B 2RE9A 1RHI3 1R093 1MEC3 5JSRA 2ZX3A 1PM7A 1CJPA 5J09A 5SV5A 5I91A 3TAYA 1ASJ3 1GYKA 4QPIB 1B09A 4R9DA 3AMHA 1IOAA 1W6QA 3NO8A 3ZXGA 4FT8A 2CNAA 5JLVA 4XZPA 5CIRA 4RR3B 5FMOL 1X82A 2HWF3 4GH4B 1E57A 4L9BA 4Y1VA 4YRDA 1AR93 5FBZA 3GBFA 3ZSLA 2IFRA 4WVVA 3VBOB 2ZGSA 2NN8A 1M4WA 1X36A 4I3GA 4BIOA 1Z78A 2RM22 3J8F1 4SBVA 1VJ2A 5IK4A 2JJ6A 3VBSB 4GB33 2WJSA 3AP6A 2EIGA 4AE2A 3IWZA 4YZ4A 1DHKB 4DY3A 1R1A1 1W39A 1WCDJ 1YRZA 3MW2A 2P3JA 4COZA 3FX3A 4WM7B 5CFCA 1A3KA 1WA4A 1VB4A 2A70A 4XIOA 1K5MC 1DQ0A 4AEDA 2WNVA 2ES3A 4BYYA 1KDKA 3E6DA 3AYDA 3MYXA 4BIFA 3FLPA 2D43A 3B7MA 3WHTA 4KL1A 2ET1A 3ZFFA 2NZ9A 3JQWA 2WA4A 3DL3A 2Y26A 5ACA3 1RUF2 2ZHNA 5C4WA 4XJUA 5KWRA 3MPPG 1TME3 4IV1C 1G6NA 1LR5A 4JV4A 1U5ZA 4CEWA 4PDWC 3VDDB 4CDUB 4AW7A 4YSFA 2TNFA 5T5JA 4BCUA 3AKQA 3M3EA 1ZBE2 2R062 2V73A 2WZR2 1VBE1 3S7EA 5F9TA 2ZX4A 1PGL1 5L36A 3EQEA 3KCXA 5JOXA 1LU1A 1RUJ2 4IERA 4M3CF 2VOVA 1FMD3 1HXS3 1DFQA 3MW3A 1FAYA 1QOTA 4Y4YA 1W0PA 2R043 4PIYA 3WUDA 5FFOC 1NE4A 1K5MB 3KCCA 2D6NA 1ONAA 4N9HA 4F8AA 3WOGA 3ZFGA 4Q8KA 3O7OA 4YLZA 2WFF1 1VAMA 1UPIA 1BQPA 2LTNA 1Z7S2 1ZX5A 2QUOA 1MS4A 2OPKA 2YMZA 3UK9A 1YI9A 2DV9A 1XQNA 5BNNC 2PHUA 3FBMA 4UW3A 3WP4A 5DZGA 4E9KA 2ZBJA 4IV1B 2ZOEB 3SISA 4AGGA 3FLRA 1QJY2 4PIXA 3J8F3 1IQAA 2UWCA 4PDWB 5GZCA 1DYPA 1ZZ7A 2HWF2 1JXNA 1R1A3 1ZREA 2Q1ZB 2HWD3 3ZXFA 2E63A 1EPWA 4CP2A 1LEDA 4LBLA 3AZZA 2PQQA 1UKRA 3MI8A 4IEOA 2R0FA 1EY2A 4LBQD 2BW8A 4INDA 4GB32 2XWJB 3TN91 4H55A 2QDNA 1O5LA 3NWKA 3POSA 3MIFA 5BNPA 2G9GA 2XJUA 5H9PA 1AR71 1YHFA 5E8AA 2VPVA 4EN7B 1TQ5A 2JEMA 2PHXA 4I2OA 4Q4W1 4K9SA 3IDCB 4QQPA 5BNNB 5CBLA 3R05A 4KNCA 1TNRA 4E2SA 2DU1A 3FWEA 2I45A 2RS31 2R073 4AQSA 2KA3A 1VBE3 2H6CA 4AFCA 1MZFA 5A32B 1LOFA 3VZJA 2RS12 3ETQA 3KD4A 3R4DB 2XPJA 4FPGA 3ZFEC 4WM8A 5FLIA 4MUVA 1QHDA 2ZGRA 5C6CA 3ILRA 5KXCA 2XLGA 3AYCA 2BNOA 2E9QA 3NKTA 2HWC1 1N3OA 1YFWA 2QZ2A 5KXDA 1WUVA 2D44A 3GALA 3ILNA 2HWB2 2VW0A 2ZZJA 3AM2A 4LLOA 4CEYC 2WFF3 3M4FA 4NOTA 1I5ZA 4HVOA 5J7MA 2JENA 4J6GA 3VBHC 1GR3A 3VBRA 2DVFA 2A6WA 5JOZA 3HR9A 1J3QA 3B9CA 4QQOA 1NCRC 2LALA 2V09A 1S2KA 2ZX2A 3OYWA 1AR83 1TMF1 4FPOB 3BU7A 3P3PA 2WINB 2HYKA 3ME2A 1HKDA 4QM9A 5L7OC 3ZXAC 3WY6A 4E2QA 2WSVA 1SBDA 1BVP1 4GQ7A 4PLOA 2Q0AA 1ZM1A 2NMNA 3ZN6A 5C8CC 5FQ0A 4XQ4A 1QKQA 1Q8QA 4MVTA 1WW6A 3ZFEB 1LODA 3J8F2 3SH3A 1O4TA 1YLLA 3AXDA 1W6PB 4JTOA 1X50A 4YVWC 3TN93 1C8M1 3WDTA 5E1RA 1R1A2 3I2DA 1VLNA 4P9IA 2HWD2 1DBNA 1V6LA 1YYNA 2UYBA 5D1IA 2E7AA 2B46X 2BFUL 4AHXA 2PN5A 3OTFA 3AZVA 4CEYB 4RS5A 4FTSA 3JU9A 3VBHB 3LA7A 3ZYPA 3U10A 4YYOA 1Q8SA 2A6XA 1JHNA 3AKPA 1LOEA 1SMVA 1Y43B 1U5YA 2YY1A 2BUKA 1ND2C 1QH7A 2WIIB 2B5HA 2GH8A 1NCRB 1ULFA 4YM1A 4EN6B 4QPIA 1NYWA 2RS33 1QNWA 4L11A 3QH7A 1SBEA 2PHDA 2DCZA 4QXKA 5KHKA 4R4ZA 5D8AC 4RR3A 4GH4A 5L7OB 1IZ3A 2RJLA 2WS91 3VBOA 1EP0A 2GNMA 1U5XA 5C8CB 1Q8VA 1YUDA 1WW4A 1D4M1 1GQGA 2XUMA 1RVF1 2DU0A 3CF6E 1Q3EA 4DNYA 1C5IA 1VBE2 1VBB1 1N1SA 3VBSA 4BPZA 3B94A 2DUQA 1PGL2 4YVWB 3AP4A 5GZFA 2GC1A 2Z69A 3FHIB 4P9JA 1NOVA 2D5FA 2W52A 3QACA 4RGAA 4ES9A 5F1RA 5T5PA 4MH0E 2JXAA 2BPA2 1TMF3 1V6OA 5FPZA 3WG1A 1CONA 4Q1RA 4WZCA 2WFF2 1ND2B 5TSWA 1VRH1 1DF0A 1AXYA 4DPNA 4JRLA 1GQHA 1YFXA 4QQ2A 1RUC1 5D8AB 4F83A 1ENXA 3SHRA 3VL8A 1MS1A 4XYXA 5GKAC 3UKNA 4PF5A 4GKYA 3VDDA 4CDUA 2B8MA 3MLJA 1XYOA 2AH2A 1TEIA 4MV2A 1FI2A 4OHYA 4EWEA 3USSA 1YJLA 1PMIA 4ONUA 4MGIE 4OFGA 4WBBA 2R16A 3ENRA 4OI2A 2ENRA 2XJSA 3VLBB 1W6MB 4LO5B 3JZVA 2H0BA 4Q0PA 4GXLA 1HRV1 1PVC1 1ZZ8A 4RHV1 3TN92 2RR13 1WMEA 3MIGA 4TSVA 4D69A 2N7GA 1K5MA 4DINB 4N43C 1UU5A 1C28A 1EPZA 2R6QA 4RFT0 2VNGA 4AVAA 1WD4A 1QMJA 3AMNA 4KU7A 4N7IA 3WVJA 4MYEA 4CDXB 1H2KA 1S0BA 2CYFA 1ZZ9A 2LM3A 3KT4A 2X5IC 2Z5WA 1AR72 4N90A 4YZ3A 2D5HA 2PTMA 2O1QA 3LWCA 1J59A 4IEVA 4YZ5A 1PNFA 1C5HA 4Q27A 4Q4W2 1Y3TA 4AI2A 1PIV1 2SBAA 5E89A 4FXKB 4IV1A 2JE9A 3LA2A 1D4M3 2ZGLA 1FX5A 1H4HA 2RS32 2JE7A 5AVPA 4L97A 1BYHA 3SITA 1RVF3 5GLVA 4CZSA 4EWDA 1AVBA 5I8SA 3PVNA 1VBB3 4MLOA 1ULEA 2XVGA 4YW5A 4YG3A 2G4IA 1OHFA 1DZRA 3O14A 4IEPA 3N36A 4JGZB 3MFCA 3PVOA 4Y22B 2HWC2 4W6YA 3I4IA 1NQDA 2VVDA 3VBFC 4IXLA 4KBBA 1NG0A 5FRAA 4IESA 2UY8A 1SLCA 2ZGMA 4V1PA 4XMIA 1QXRA 4EN0A 4LBQB 5FOBB 2A3WA 2DUPA 2Y0IA 4IV3C 3DPRB 2XVLA 3VL9A 3O0XA 4RQPC 5J98B 5BNOC 1PK6C 4K1YA 3AKRA 1TMF2 3FJSA 1UN1A 1J3PA 3LGRA 3BOWA 5BNNA 2ZGPA 1FYUA 1IKPA 2PELA 1BXHA 5GM0A 1AYN3 4D94A 2KXLA 2IXHA 2ETEA 1N1TA 4A3XA 5LEKA 3WCRA 3Q9OA 2EF6A 3URFA 3ZYIB 1VALA 4NR1A 2BYVE 5A32A 3RRDA 4LA2A 2PYTA 4BMEA 2OVUA 1FV2A 2EA7A 5AFBA 4YVSC 1UIKA 4WV8A 2CGNA 3NV2A 2A3YA 3QH6A 3WUCA 1AX1A 1OFNA 2ZS6B 1C8M2 2OW4A 3EO6A 2ERFA 1GZWB 3ZSEA 1PGW1 3AMPA 2XJRA 4HANA 4XF4A 4NWVA 3VBFB 2GC2A 2EXJA 3M1HA 3OPZA 1S1AA 2XG3A 1VBA3 1C1LA 1PZ8A 3H3ZA 2RJKA 4MGYE 3N4MA 5BY5A 1PIV3 1R091 1RHI1 2DYCA 4Q29A 1MEC1 3HAGA 4RQPB 3ASIA 5BNOB 1PK6B 5B2GB 3VKFC 1V6JA 4XDQA 3U0ZA 1ASJ1 2P2KA 1U5IA 2WT2A 3FFQA 5HXVA 1N1VA 1FOD3 2HKXA 1TE1B 3M3QA 1S0FA 2TBVA 1IS5A 2WS92 2AZ5A 3CU7A 3GHMA 5L73A 1S0CA 4A7KA 4EN8B 2HWF1 1D0GA 1H2NA 2B9UA 2VH9A 1AR91 4OI1A 1