2H0BA

Crystal structure of the second lns/lg domain from neurexin 1 alpha
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
181
Chain Sequence
EEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Neurexin-1-alpha
publication title Crystal Structure of the Second LNS/LG Domain from Neurexin 1{alpha}: Ca2+ binding and the effects of alternative splicing
pubmed doi rcsb
source organism Bos taurus
total genus 39
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h0bA00
2DURA 4Q8LA 3I4IA 3A4UA 3ZSJA 2A6XA 5FRAA 1JYCA 1MVEA 5GZFA 1F9KA 1AX2A 1W6NB 2C5DA 4YW3A 3MEPA 1LHWA 3L2YA 4XMIA 3AJYA 4YZ3A 1Q8OA 3BODA 4FQ4A 3ZXKA 1FNZA 1S0CA 4GALA 5GM0A 2E6VA 3SH4A 1SLLA 5GZGA 2P37A 3WG2A 1GNHA 4CRQA 4Q1PA 1O4ZA 2W08A 1GSLA 3R4SA 3WOGA 2XG3A 4H55A 3OJBA 1KRIA 5EXOA 3W58A 2DVBA 2XB6C 1GZ9A 1Z0HA 3O0WA 3POWA 5LK5A 4WZFA 2ZGPA 4C1WA 2DV9A 3AX4A 2E7TA 5JOWA 1PZ9A 4GA9A 3M1HA 3WDVA 3D6EA 5JLVA 2VH9A 3B01A 1LCLA 1I3HA 5E88A 4C1XA 4UW5A 3MPPG 2JDZA 2ZGQA 1V6OA 1N3PA 1LOBA 1UKGA 2W68A 5CAZA 1KITA 2SLIA 3IPVB 2JKBA 1AXYA 2GNTA 1APNA 3WG1A 4I30A 1SACA 1GNZA 1WBFA 4FOQA 3VKNA 3ZSMA 2D43A 2ZMLA 4M00A 1AJOA 2EXIA 1DQ2A 5BYNA 2DVGA 2VU9A 1MS5A 4XHBA 1IS6A 3IN9A 2GDFA 4YZ4A 3O5SA 2D6MA 4FP2A 1RINA 4YZ2A 1BXHA 2AYHA 1SLCA 2DU1A 2P3IA 1LOFA 2A6YA 2VXRA 4WVWA 4YM0A 1UAIA 1LU1A 5L73A 4DFSA 2OVUA 1ENRA 1UMZA 1IKQA 2CWMA 4XBQA 1H9WA 4GXLA 3OBTA 4M3CF 1AX0A 1YI7A 1ONAA 3V0AA 3AXEA 2KM2A 1SBEA 3ZPYA 1QNWA 5HCFA 1JN2P 3UJOA 1CN1A 1Q8VA 3WZ1A 5T5PA 4AWDA 2H0BA 2PHXA 5DUVA 4BPZA 2FHRA 4AVTA 3IM0A 4MYEA 5DZFA 4XBLA 4PBOA 3GNEA 4LBQD 2P3KA 5EYXA 1WCSA 3N35A 3AP9A 1PZ8A 1WLDA 2VY0A 3AYDA 3M3OA 4XE9A 1KDKA 3ENRA 5AVAA 1FX5A 4LBNA 1DIWA 4Y1UA 4FPYA 1DQ1A 1V6JA 4FPCA 4BMBA 2EXHA 1AXKA 3C2UA 5GLUA 1MZ6A 3MW4A 3LSEA 2ZBJA 4Q1RA 3WHUA 4XJ8A 3WDYA 1YIFA 2ZGNA 3B9CA 1YYNA 2A6ZA 1DBNA 2EAKA 4Y1YA 5DG2A 5JVVA 1W6OA 3UJQA 4BLIA 4CTEA 2P3JA 2ZGTA 1BQPA 1OKQA 2YROA 2ZACA 1GYKA 3D5OA 1AF9A 1UZZA 1JOJA 4PBPA 4R9DA 4TYSA 3WCRA 3ZXJA 1MACA 1G9BA 3JUUA 1MS3A 2D7FA 1CIWA 1FATA 1LOCA 4YM3A 4M3CE 2D3SA 2YMZA 1HDKA 3AP7A 3AZVA 2PHTA 2WT0A 2ZGOA 1S0JA 4M01A 1UZYA 2E53A 4R9CA 5CBLA 1TEIA 4GWNA 3MW3A 1DYPA 2DVAA 4ZXKA 3ZVXA 4JCKA 5JOXA 5GLVA 3AZZA 5T54A 4R9BA 1H30A 1WD4A 3O12A 4CZSA 1ZM1A 4XOGA 1CPNA 1N3OA 1RITA 2DTWA 3HN1A 4HL0A 4K20A 3VKMA 1NLSA 3HMYA 1CR7A 5KXEA 2CL2A 1JBCA 5CA6A 5DUWA 3OGGA 2NZ9A 2R1DA 4Q8KA 2OW4A 4YG3A 2WLQA 4FPLA 3R4UA 4P9YA 3VKOA 1BYHA 5JMCA 3BTAA 1QOSA 3OYWB 4DQAA 4UW6A 2AUYA 1I1EA 3N7JA 3SITA 4PCRA 1LEMA 4DRRA 4Y1ZA 4DS0A 3ZXFA 1MVQA 1IS4A 1C1LA 3TB0A 1Q8QA 1ULDA 3FBYA 3AZXA 4NO4A 1W6QA 2A6VA 2ZHNA 2ZGUA 5EYYA 2JE9A 5GALA 1SFYA 1GV9A 4WVVA 5F5QA 2R16A 3N7MA 1LENA 4YW4A 2PHRA 5GLZA 3SNMA 2JJ6A 3USUA 3QLQA 5DG1A 4FPGA 3AP5A 1N1YA 4Y22A 4YM2A 2WQZC 4XJ9A 2GN7A 2DUPA 1WUVA 2D44A 2ZABA 1HQLA 1W6QB 2D6LX 2W52A 3V0BA 1MS1A 4K1ZA 3M3CA 2WKKA 3NV2A 1V6MA 1Q56A 2P34A 3FLPA 3POSA 3AP4A 1YXWA 1FV3A 4XILA 5CB7A 3USUB 1WLWA 4DRVA 1WW4A 2D6PA 4FP3A 3WCSA 1D2SA 5IUQA 3TAYA 3WHTA 4XTMA 1QDOA 5DZGA 4AGGA 2GMMA 4GKXA 4Y26A 1C1FA 1UN1A 4Q26A 5JOZA 1G9AA 3ILRA 4BOWA 1HKDA 1N1VA 4FPOB 5E89A 4XJAA 2LALA 5IK7A 1EPWA 4Y1VA 1SLAA 1VAVA 3U4XA 1A3KA 4XTPA 1MS4A 1MS0A 4U2AA 4XJZA 5SV8A 3ZYPA 1F31A 3POYA 2D6KA 2GMEA 3A0NA 3ATGA 4RA0A 3RSJA 5JOYA 2ZMKA 2A75A 2JD4A 4AVVA 1KQRA 4M3CA 1WW7A 4P14A 2ARBA 3RG0A 4XDQA 2VW1A 2P2KA 2EXKA 4K1YA 4Y24A 1LJ7A 2W39A 4XYXA 3GALA 2PHWA 4AGRA 1GICA 4FQZA 5HCBA 2PHUA 1BKZA 1W0PA 2A6WA 1JHNA 5T50A 2GNBA 4PF5A 4UW3A 3RRDA 4YG0A 1SLBA 2WT2A 4M3CB 3ZSLA 5F9TA 1WBLA 4RL7A 2NM1A 4K21A 4P9WA 5T52A 1AJKA 1IS3A 2LTNA 3N3HA 1JXNA 3O0XA 1ULGA 3OY8A 3V0AB 3KM5A 3H0OA 4YZ5A 1KJLA 4FPFA 2ZGRA 2ZHLA 3N7KA 3WDWA 2D3PA 4JRAA 1V6NA 2G4IA 3T1LA 2YXSA 3V65A 2HYKA 1LU2A 1NXD1 2A3XA 2VW2A 3ZSKA 2GALA 1QOOA 2ZGKA 3IKWA 1ENQA 2BQPA 2UWBA 2ARXA 4DPNA 3RMXA 2ZZJA 4OZXA 5DZEA 3APBA 1AZDA 1UL9A 2YV8A 1UPSA 2AREA 1GBGA 4HANA 3BIWE 4W65A 4YGEA 5IK5A 3AZWA 3AYEA 4Q2FA 1Z78A 1CQ9A 1DZQA 1URXA 2TEPA 2ZGMA 1Y7BA 3UK9A 1SBFA 4SLIA 4LBOA 4IQPA 4XHXA 3WDXA 3PVOA 1MS9A 3AZYA 3WV6A 4LBMA 5GJ6A 4XZPA 2V5YA 1ZA4A 1N47A 1W6OB 1AVBA 3AYAA 4XJWA 2UWCA 1N1SA 3NV4A 2VUAA 2YY1A 1G9DA 1DHKB 4XXAA 2WT1A 2E7QA 2JE7A 5FREA 1DLLA 4XBNA 2R49A 5IT6A 4BLJA 2D6NA 2CY6A 3B3QE 3M3QA 1LHVA 2PELA 4Y20A 5H9SA 2WJSA 1V6KA 3VKLA 5CNAA 3Q9OA 3WG3A 1MZ5A 4AVSA 3WLUA 3M2MA 5T5OA 2VW0A 3RQ0A 4F83A 1Q8SA 1GANA 1SLTA 1G8WA 2A7AA 5GLTA 4R9AA 4Y20B 3RMYA 1C57A 4ISQA 4AYUA 1WLCA 4XIKA 2DYCA 1VLNA 4LBLA 3MW2A 1QDCA 3FLRA 4FVVA 3DGTA 3R05A 4YW5A 3VUOA 1FYUA 5GZDA 3A0KA 5HCAA 2D6OX 3WDTA 1IKPA 1WD3A 3PMEA 2ZMNA 1LULA 3PVNA 2GNDA 1LGCA 1VALA 3O0VA 2Z42A 1LEDA 3VKFC 1KJRA 1LGBA 2V73A 1FAYA 3SH5A 5H9RA 1HQWA 1S0FA 1MS8A 4Q27A 1RIRA 1WW5A 1BZWA 2WNEA 4BMEA 1DQ5A 3ZYRA 2DVDA 1AX1A 2ZHMA 2C9AA 2ZGLA 3KQRA 5EWSA 1LOGA 1IOAA 4Y22B 1CVNA 2ZHKA 1SBDA 4NOTA 2JECA 2OUHA 2DWRA 2RHPA 3DUIA 1CPMA 3PVEA 1YO8A 3WG4A 1N1TA 3V0BB 5DUUA 2NYYA 1S0BA 2CYFA 4FPKA 1C4RA 3B00A 3I8TA 1S0GA 3IPVA 1B09A 4FOWA 1GKBA 3T2TA 1FV2A 1N3QA 1U0AA 2A70A 3WUDA 1XQNA 3WUCA 1PZ7A 3B69A 5H9QA 4YGBA 1A8DA 1DQ4A 2ENRA 5T5LA 5E8AA 3WNXA 1KDMA 1O4YA 1DYKA 4LBQA 5T5JA 2R0HA 3FFZA 2A3WA 3AFKA 3N7LA 2CNAA 1UX6A 2CTVA 1LOAA 2WSUA 1GLHA 2ZKNA 1CJPA 4BM8A 1LHNA 4Z8BA 1CONA 1CESA 1R1ZA 1H9PA 2NMNA 1QKQA 1S0DA 5DXDA 2D3RA 1YRZA 3V64A 4XIOA 1S1AA 3ILFA 2ERFA 1G86A 4YM1A 5GZCA 5IK4A 1G9FA 2DUQA 4FPEA 1G7YA 2B7YA 2AENA 1IS5A 1V6LA 4LBQB 3W59A 2AH2A 3BOPA 2ZAAA 1A78A 3CNAA 1VAMA 2ES3A 3ASIA 2DUOA 1SLIA 3ZXEA 2A3YA 2EALA 4YG6A 1DQ6A 2WSVA 2YZ4A 5T55A 1QOTA 1QU0A 2NP0A 4JC1A 5GZEA 4LBKA 2ZA9A 3NV1A 4BQ1A 1LGNA 3OPZA 4GKYA 3AXDA 4KBBA 1Q8PA 1F5FA 1OQ1A 2DTYA 3HR9A 4FOYA 3N36A 4FPHA 4ZKTB 2UWAA 4XMAA 2EIGA 2R0FA 2CWSA 3QCWA 1W0OA 4YLZA 4AGVA 3IMNA 1S0EA 4UW4A 2NN8A 1JW6A 4PQ9A 3OY8B 1W6PA 3FUOA 5KXBA 1HLCA 5KXCA 1JYIA 1AXZA 1QGLA 4GWMA 4P9XA 3SISA 3WVJA 4L8QA 1LHOA 1GZWA 1LOEA 2UU8A 1QNYA 2DVFA 1G9CA 1D0HA 1W6MA 3FLTA 2NMOA 3FUQA 1J1TA 4LBJA 3NWKA 4YW1A 2I2SA 3T1MA 2Q5TA 3LCPA 3JU9A 4XJUA 4FPJA 3INAA 4ISRA 1W6PB 5H9PA 2R1BA 4D69A 2FMDA 2EF6A 4ATFA 3UL2A 4ASMB 4FOVA 3LSDA 1GZWB 4XXPA 3SLIA 4TZDA 3D4KA 4YGDA 1DQ0A 1W6MB 1DGLA 1JUIA 4WV8A 1FNYA 1LESA 2ZGSA 2SBAA 1LOFC 4U36A 4Y1XA 4YZ1A 5KXDA 1SCSA 4YGCA 3M3EA 2EXJA 1X50A 3VV1A 3ILNA 4YFWA 3PJQA 4YFZA 4YW2A 1LODA 1VIWB 1MR5A 2AGSA 3RS6A 1OFSA 2OUJA 3AJZA 2A71A 4ATEA 1DFQA 4ITCA 5JDBA 1V00A 1ENSA 3WDUA 2GMPA 3AK0A 1SCRA 2UURA 1ULCA 1WW6A 5GLWA 2AR6A 2E51A 3AYCA 3OBRA 1BJQA 1QF3A 1W6NA 1ULFA 1LHUA 2GNMA 5DUXA 2GN3A 5IK8A 1QMJA 1V6IA 3SH3A 2PHFA 1LECA 3OYWA 1ULEA 3ZXLA 3NV3A 1GZCA 1S0IA 1LTEA 3AP6A 2DU0A 2A5ZA
chains in the Genus database with same CATH superfamily
5BV6A 1BMV2 2O8OA 2VZ1A 1AL22 4Q8LA 3H1YA 4XFCA 2YBKA 3A4UA 4CDQB 4JKMA 3HPNA 2ILMA 1EV12 1JYCA 1OKOA 1F9KA 1WCQA 5GZFA 4DZGA 2QQPA 4HSJA 4E8DA 2PQSA 4GH4C 4BQXA 1WMFA 4XUOA 2X09A 5C4WB 3VBRC 3ZXKA 5DAVA 2YC0A 1FNZA 1OOPC 4GALA 3SH4A 1SLLA 4ONUA 3WG2A 4EN0A 3JD72 2GH2A 2R042 3KT7A 4NE9A 2WZR3 3R4SA 2UYAA 3ROUA 3ZFFA 3VHPA 4K6BA 5CKMA 1BVVA 2DVBA 5BNOA 2Y6HA 4BQ4A 2RS51 3I3DA 1Z0HA 4Y5Z0 4NPMA 4O61A 4OQ8A 2DV9A 2C0ZA 2RR12 1AL23 1VBE1 1WZXA 2E7TA 5FZ6A 2Z5WA 4MHUA 3Q8FA 3GBFA 3SCHA 2DCTA 4QQOA 1MEC2 3ZFGA 2VCMA 1RMU2 4EV0A 5A7PA 3FHIB 4HKLA 1I3HA 1IZ3A 1RC6A 1GZTA 1CX1A 2ZGQA 3ZFEA 1U5XA 3M70A 4N43A 4G9SB 2W68A 1XSQA 4IE7A 4LOTA 4CSWA 3JD73 1JMUB 3CMGA 4FCAA 2R043 5FUPA 1GNZA 4MGKE 1QJZA 4O7XA 4S2GA 1RUC1 2XWJB 1NOVA 3VBHC 5BYNA 1LR5A 2RDSA 3DF0A 2VU9A 2J1VA 1ODNA 1QH6A 4YZ4A 2GDFA 2VO5A 4YW7A 3VBOC 1J83A 3O5SA 1O8PA 1RINA 4FP2A 5FP7A 1JYNA 2VNRA 1GUIA 5FYUA 4AFCA 2RR13 1V9U2 4JHTA 4ARXA 4CCJA 1LOFA 1CAWA 1QXJA 2VXRA 4PT6A 4UXAA 3ZN4A 4B3NA 4AEKA 2C9KA 3OEAA 1OLMA 1MEC3 2QNKA 2W0XA 1RMU3 1TZOA 5FOBB 2RDQA 1IKQA 3LF7A 1H9WA 4LE3A 5LWBA 3ZYHA 3NJZA 2QDRA 1IQAA 1KFXL 2PTMA 3S30A 1ONAA 2VZ3A 2G9GA 4RR3B 2QQLA 2P6HA 2Q1FA 5FZEA 2J22A 2RMU2 1CN1A 1Q8VA 2D5HA 4J1WA 5T5PA 1ZZ9A 2PHXA 1O3QA 4L99A 4JQTA 2FCUA 4A7ZA 1C28A 4IV3A 3MUY1 3IM0A 4MYEA 2YBPA 4XBLA 3ZR5A 4AHWA 3GNEA 1HB1A 5CKQA 2P3KA 4AI2A 3DYMA 1K5MA 2FBEA 3M4FA 2JG9A 1AR63 4LPLA 4MG2A 1WLDA 2ZX2A 4FAGA 1VRBA 1FX5A 4Q4Y3 5DN2A 1MZFA 4Y1UA 2HWD3 2K9ZA 2VUCA 2ZCWA 3I97A 4DO0A 1AXKA 3C2UA 5I8TA 2BBVA 3MW4A 4W6WA 2BOIA 2CGNA 3WDYA 3B9CA 2ZGNA 5FWEA 3T08A 5L7OC 5LY1A 3RZLA 3ZX7A 1PM4A 2RJ2A 3ACGA 4Y1YA 5JVVA 2YC4A 2WABA 4WM7C 2RMU3 3WF4A 4V2VA 1O4TA 4E9KA 2ZACA 4CDXA 4JVAA 3D5OA 4B1MA 2KD7A 1H8TB 3S5QA 1RUI2 1K5JA 2D7FA 1CIWA 5FXXA 1O3SA 3CQOA 4LLOA 3AZVA 1OQDA 1S0JA 1UNBA 3ELNA 2XUMA 1TEIA 1UMIA 3MW3A 4QPGA 5A6QA 1DZTA 4LE4A 2DVAA 2W9XA 5FPZA 4PLOA 4IEWA 1GQPA 4QPYA 1U5ZA 5J09A 5GLVA 3MV11 2O14A 3VBSB 4AXOA 5D21A 4D0QA 3BPSA 1BMV1 1VBC3 5HPOA 2PAEA 1PMIA 1EV11 4LO6B 3J8F3 2HWE2 1DGRN 5CA6A 5DUWA 3OGGA 2OW4A 2QZ3A 4CP2A 4FPLA 4P9YA 3VKOA 1C8M2 1W9WA 3OYWB 1QOSA 4DQAA 2R6QA 1FXZA 4NAMA 4PCRA 1LEMA 1RUI3 1E5RA 1RUE2 4YNIA 4D7YA 1YNAA 3GZEA 3ZXFA 3LAGA 3NKGA 1MVQA 2VQUA 1IS4A 2R041 3VGIA 1C1LA 1ZX5A 3C7FA 1O3RA 2OPWA 1Y4WA 5FWJA 2IXKA 1VPHA 3IDBB 3I3BA 3AZXA 1BK1A 2P6CA 3S0MA 4P9GA 1GQGA 1HRV3 1C5IA 1WKYA 2ZGUA 3NL1A 1CZVA 4KU8A 2JE9A 5EYYA 5FYYA 3K4DA 5CU1A 3OOXA 2Y6KA 5JZGC 2R16A 3HJRA 4JGZB 1LENA 1Y43B 5GLZA 1NAEA 3SNMA 2QQIA 1F35A 1OSGA 2RR11 1XNBA 2JG8C 2VCBA 5DG1A 4YVSC 1XE0A 3AP5A 2WQZC 5BY5A 2JIGA 5FXZA 5CFCC 3KGZA 1NZIA 2XPJA 1CZTA 1SG3A 1RMU1 1U5IA 4IGPA 4O9EA 3ZKUA 4A42A 4BISA 3LEMA 3S5AA 1C8M3 4WVMB 3NV2A 2VCAA 3EO6A 3M7AA 3FLPA 3VLBB 3AP4A 1UMHA 2XJVA 5CB7A 4A3ZA 4DRVA 1PK6B 3VZNA 4IEZA 5CEHA 3ECQA 3T09A 3HBZA 4E4HA 3T0DA 3TAYA 3PUQA 4XTMA 1QDOA 2XGXA 3J7LA 5DZGA 3WP3A 4AGGA 2IVJA 1ZBE2 2J1SA 5JOZA 3TNQA 3TWIA 4FPOB 1US3A 4XJAA 2LALA 5IK7A 1YQ8A 2VVDA 2CU5A 3AL6A 4Y1VA 1NQDA 3AKQA 5I8YA 1L7QA 1V9U1 1H2LA 2AEZA 4CDUC 1H2NA 2V72A 3ACHA 1F31A 4A6SA 4JGYA 1ZNPA 1PM7A 4AVVA 3WW4A 4M3CA 4DXRA 2VOWA 1A8MA 5E6HA 1DLCA 4EN6B 2EXKA 4K1YA 4Y24A 2PHLA 2E33A 4PDWC 4RQPC 4LTAA 2IXLA 3MHZA 3KCYA 5F6LB 5L7OA 1GP5A 1BKZA 4DOUA 1O5UA 1H2MA 1W0PA 2A6WA 2RMU1 2X5IC 5T50A 4UW3A 3RRDA 2YGLA 4YG0A 3ZSLA 5F9TA 4ES9A 2VTXJ 1WBLA 4RL7A 2XBO2 5F5CA 3LZZA 1ALYA 4D6SA 1AJKA 4URTA 4CEYB 2JIJA 1JXNA 1YUDA 1ULGA 2Z4FA 2VOKA 3GZAA 4GAZA 1UZ0A 5B4NA 3E5UA 4QPIB 4QPWA 5C3QA 1DDLA 1OURA 5D8AB 5HBAA 2VZQA 3DXUA 5A3PA 1UYPA 2RM23 4QT6A 5DQ0A 4Q4X2 1BCXA 2G4IA 1W8HA 2YXSA 5F1RA 4XQ4A 1YFXA 1POV1 1ULOA 1NA1C 4B7EA 2A3XA 4FTBA 4WM8C 5FZCA 4KMQA 1J3PA 4A2UA 2ZGKA 4OHWA 1YHFA 3JBG2 4FTEA 1RB8G 4I09A 3QH7A 3RMXA 1XU1A 2VE1A 3NMBA 4W65A 1UL9A 2YV8A 2AREA 4HONA 5KWRA 2DCJA 3VZOA 1DZRA 2YU2A 1HRI3 5FYZA 3RI9A 2XBO3 1OBNA 1URXA 1OD5A 2BOJA 2TEPA 4IGOA 4LA2A 4R52A 1SBFA 4ZXEA 3WDXA 5BNNB 2WN3A 1QWRA 3ALQA 4AAXA 5BNQA 4IE5A 3KT4A 1OOPB 2WWSA 5GJ6A 1N47A 1W6OB 3AYAA 4YWAA 3WQBA 3NV4A 1L7RA 4EQVA 2VOXA 3WINE 3KV9A 1DHKB 5IFPA 5EPAA 4Q4X3 1LB2A 3AMMA 2JE7A 5FREA 2DF7A 2H6BA 4NIGA 2R49A 2EIBA 3H3UA 4BLJA 2D6NA 2CY6A 3B3QE 3D8CA 3M3QA 3ZXAC 1L3JA 2O0OA 1S2EA 2WJSA 2HWE1 4QHZA 5CNAA 1H6YA 3B5LB 5FJKA 4MGSA 1MZ5A 4AVSA 1ZREA 1RUG2 2VW0A 3LGRA 4F83A 1OLME 3POBA 1HN1A 4PIZA 3K51A 3VD3A 1RUE1 3ZYIB 4QGLA 2BERA 2XJQA 3VHOA 2BEOA 2EIDA 3J7HA 4R9AA 4LT5A 3T0AA 1X8MA 4Y20B 4ZS2A 3RMYA 3ZYBA 4K9SA 4XIKA 5ISLA 4MGYE 2JDAA 5C4WA 1VLNA 3O1RA 3FLRA 3DGTA 4HETA 3VUOA 1NY72 3LE0A 2WNOA 3G6JB 1XJAA 2HKXA 1D4M1 5AFBA 5HCAA 2IC1A 2WWJA 4META 3WDTA 3PMEA 3FFQA 4DXTA 4JDMA 5A3WA 3FHAA 1LULA 3PVNA 4HVQA 2GNDA 5FZAA 3O0VA 2LW8A 5JPNB 4SBVA 5TSWA 3E6DA 4XFAA 3ZN6B 4AR2A 1U12A 2V73A 1HB3A 1ZRDA 4NRQA 5H9RA 1S0FA 1YWKA 4Q27A 1RUG3 4C91A 4AEJA 2WNEA 2ZOEB 4MXWA 4BMEA 3E6BA 4KG8A 2DVDA 4XEZA 1AX1A 3WF3A 2VMGA 3VD5A 1BEV2 2IVIB 2HEYF 1OHFA 4Y22B 3GM8A 1JZ2A 1QJY3 1RUJ1 3DUIA 2AZ5A 3OCPA 1ZBE1 1SFNA 3FN9A 1N1TA 3V0BB 2NYYA 3CDZB 3IWZA 2ZX0A 3MDPA 1C4RA 3FMGA 1DG6A 1B09A 2BVVA 1GKBA 4KWKA 3T2TA 2V4AA 1N3QA 2VBPA 5FZ0A 4CCCA 2YUEA 4XC9A 2E31A 4HT1T 1DQ4A 1KDMA 1DYKA 3VD9A 2A3WA 3KVBA 4QU1A 4CCLA 2CTVA 2WSUA 4IEXA 5LK7B 5C9AB 5J7MA 2JEMA 5FZHA 1LHNA 4FTSA 1Q5OA 5L9BA 3V64A 1QKQA 1S0DA 4ZY9A 4MOAA 3CZUA 3SCFA 1S1AA 4C90A 5GZCA 1HJGA 1VBD2 5FY8A 1BEV3 2P1BA 1JI6A 3B9IA 4B4QA 5BXXA 2WRAA 1V6LA 5A6YA 4NAOA 5L7OB 3I2JA 4INDA 3BTXA 3BN6A 2ZAAA 1E57A 1G6NA 4I3PA 4WM7B 2DUOA 1SLIA 2B4KA 3ZXEA 3RZMA 4RR3A 4AE2A 4XUPA 2WZEA 5K8SA 2D40A 4JAAA 2WA4A 3DKQA 1I6XA 3RZJA 3QD6A 5LASA 4COYA 5C8CB 2BWAA 3RGBA 2E9QA 1NZCA 1W8NA 2B42B 2Q1ZB 4NROA 3ZXDA 2VL4A 2GP5A 1COV3 3QBQA 4KBBA 1Q8PA 4Q4X1 4LNVA 1O6UA 1UW8A 5I91A 2EIGA 1W28A 4YLZA 2CWSA 5ERLA 4AGVA 3OBZA 4YVWC 4GB33 3S6PA 1UU4A 1S0EA 5D2AA 4PIYA 4IERA 3K4ZA 4Z1VA 3JBG1 4TTGA 2WNVB 1HLCA 1SEFA 5C71A 1VBD3 1QGLA 5CADA 1EUUA 2VBBA 5A32B 3OGVA 4P9XA 1AHSA 3WVJA 4NIDA 1LOEA 1I5ZA 1QNYA 1G9CA 1QHDA 2XXZA 1W6MA 3B7MA 3FUQA 2WFF1 1XPWA 2I2SA 4YW1A 1C5HA 2Q8CA 3LCPA 3JU9A 5KC5A 1RVF2 5A7NA 5H9PA 4D69A 3DKWA 1MQTA 2HLEA 4Z07A 5JUVA 3ZDVA 1MPXA 1WMEA 4LHSA 3BALA 4ATFA 3SEPA 3O1OA 2J42A 1PO23 2F17A 4TZDA 4MV2A 2W95A 1EAH2 4KWUA 5A6XA 4EROA 1OF4A 1JUIA 2DCYA 2OZ6A 2YPJA 3A22A 4B4PA 4KG0A 1RJ7A 5BNPC 3ACFA 1X50A 5BUVA 4MH0E 5FZKA 4DXZA 2JDPA 4CPBD 4YFZA 1LODA 3HT1A 4R4XA 1CAUB 2ATFA 1U5YA 2OUJA 4JQRA 5J98B 2A71A 3IDCB 3CJIC 2JG8B 4GIQA 4YVSB 3VBSA 1RUG1 1GMMA 3HOBA 1V00A 4UFLA 5DAQA 2BRTA 5CFCB 2GMPA 3POGA 2HEVF 2Q8OA 3E1F1 2MEV1 2Q8EA 1ULCA 5FZMA 4UT5A 1WW6A 1RVF3 3N9LA 1ZBA2 3BVCA 5FY1A 3HQRA 3J7MA 1QF3A 2ZEYA 1LHUA 3O7OA 2E63A 5DUXA 4AI1A 1QMJA 2R30A 2BYVE 2WAAA 2PHFA 3OYWA 1ULEA 2XJUA 3ZXGA 2F6BA 1STMA 1NY71 4XF3A 1FMD3 3Q8BA 2DURA 4TN7A 5JWPA 2RDNA 3I4IA 2A6XA 2EIEA 5FRAA 1MVEA 1SQ4A 3T30A 4Y3OA 4H7LA 1OUXA 4IE6A 4I0AA 3EXUA 3MEPA 4L92A 4QQHA 3L2YA 3H42B 2XJPA 4XMIA 5FY5A 5FXWA 3UYJA 2Y6LA 4YZ3A 2BGOA 2Z79A 1Q8OA 4FQ4A 3VBUB 4CDUB 1S0CA 4BCUA 4JGZA 2PAMA 5GZGA 4RHV3 1TME3 1XNTA 2WYSA 1GNHA 2FZ1A 3MIBA 1POV0 3I2IA 4OCTA 4XACA 4S2FA 1GSLA 1WLTA 4AEDA 1UD1A 3C7GA 4N9IA 4BK4A 1AR82 5A33B 1JH5A 4GMP3 2LROA 4RQPB 4PDWB 3OJBA 3WOGA 4CCNA 2KR2A 3RJ2X 5EXOA 2BFUL 3W58A 1QQP2 2QQKA 2VOVA 3MGUA 4P9JA 3RZHA 3GF6A 3PVBB 2X5IB 3J4UH 2ZS6B 1UXZA 3POWA 2ZGPA 4LK7A 4WZFA 3AX4A 5J37A 5F3CA 1UY2A 1PZ9A 2Y33A 5JSOA 3D6EA 3I7DA 1W03A 3ORJA 5SV5A 1JODA 4YARA 5E88A 4UW5A 2FQPA 3MPPG 5FMOL 1N3PA 3VDDC 4FAHA 4MX3A 1UKGA 4GULA 1PX4A 4PI2A 4COUA 3USSA 2JKBA 1O8SA 4OZOA 1SACA 1EY2A 1OUSA 2B8MA 4FOQA 3VKNA 3VD7A 5A6ZA 2ZMLA 4M00A 4WM8B 5FLJA 4BQWA 4BXSV 2DCKA 5C6CA 1RUC2 3UV9A 1YJLA 4PLNA 3I2GA 4AQ6A 2EICA 2CHHA 4E27A 1ZRCA 2RS53 4S2DA 4Y4RA 3ZMNA 4YZ2A 3W5NA 3KT1A 2AYHA 1SLCA 2DU1A 1VBE3 5DMYA 3PUIA 1R092 4AI9A 4X6QB 3LA7A 5JPMB 4CEWC 1OI6A 3IMMA 2FCVA 4XF0A 1B35C 4M3CF 3TEWA 5FAXA 1VMJA 3H7YA 4L11A 2ZZQA 3GZTB 1YI7A 4QPIA 1XSRA 2ETEA 2OX0A 2DFCA 4HK9A 5FKBA 5D8AA 4QXKA 5IFTA 1DGWX 3UJOA 4AWDA 2H0BA 3CZJA 4QM8A 1GWKA 4BPZA 2FHRA 1Y9QA 4HPKA 5FY0A 4AVBA 1RUC3 1PIV2 4PBOA 4IE4A 1OVPA 2CSGA 1H4GA 1WCSA 2ORZA 5JXJA 5CVRA 4IUGA 5C33A 5FYIA 1RVF1 1UX7A 2CAUA 2X53S 2VY0A 3M3OA 2OYZA 4LA3A 1KDKA 5AVAA 5F2SA 3D82A 3VZJA 4LBNA 1DIWA 3KV5A 3S7IA 5E16A 1V6JA 1EAH1 3JZVA 3LOBA 5FO9B 3HNMA 5BNNA 3R6SA 2YDEA 4Q1RA 1ASJ2 3WHUA 1GWMA 3THTA 4LHNA 5DG2A 5FPLA 2ADEA 4AEMA 1W6OA 3HNYM 4E4ZA 2WNUC 4RS5B 2P3JA 1PVXA 5FP8A 2ZGTA 1BQPA 4LK6A 1RUNA 1GYKA 2XOMA 1OC1A 1BBT2 3WCRA 1JOJA 2HBUA 1F5JA 3KF3A 2WAOA 3ZXJA 1MACA 1PIV3 3JUUA 5LA0A 1EUTA 1MS3A 1H1AA 1FATA 1LOCA 1REEA 3H8UA 3LOIA 3QH6A 4L9BA 4YM3A 2YMZA 2Y60A 5A3MA 5LA1A 1JYTA 2GAUA 2LS6A 4CDWC 3B93A 3PTRB 1ZBA1 2H6CA 1W06A 2I45A 3H50A 4GMP1 4GWNA 2QKDA 3LKJA 1O59A 3RZKA 3LFMA 3UETA 4KGGA 2W3JA 4L2NA 3F95A 5T54A 5FZOB 4R9BA 3RI8A 1WD4A 3VBFC 3BB6A 3O12A 5FO7B 1ZM1A 1RXGA 2E26A 3HQXA 3PNAA 1N3OA 2AACA 2DTWA 4HL0A 3VKMA 4COVA 1MZEA 1QXRA 3C7OA 4NN0A 4UFMA 3LFIA 4NJ4A 5KXEA 3SXWA 1JBCA 4X8PA 1CJDA 1YFUA 1OF3A 4K40A 5FYBA 3U11A 4Q8KA 4YG3A 2WLQA 5C3OA 3R4UA 1BYHA 1JZ4A 4UW6A 4LUKA 1ZZ8A 2AUYA 1I1EA 4HK8A 4J25A 3SITA 3N9QA 4IEVA 1PMHX 2W1SA 3DYOA 2VZRA 4BQYA 4QXBA 3IDEA 3ZN6A 4B1LA 1AR81 4IEOA 1T2XA 3VB9A 5ANNA 1ND2A 2A6VA 2ZHNA 4E2SA 3DCQA 1QQP1 4NHYA 5GALA 4CE8A 2JB8A 3WD5A 1J3QA 2BP6A 5FZ4A 3K77A 4YW4A 1ST8A 1D4VB 5CFDC 4AW7A 4Y22A 4OHXA 4BXFA 3PHMA 4CCEA 5L19A 2GN7A 3K4AA 3BTZA 1EV13 5K0UC 1W6QB 4KBZA 4LJHA 2QBXA 5HV0A 5A7WA 3V0BA 2JDYA 4UAPA 3I3QA 2Z69A 4QWNA 4PJYA 2P34A 4ZONA 2VMCA 4XILA 1YXWA 3CO2A 1PNFA 3WNOA 1W2TA 4DUWA 4ZS3A 1WLWA 4AFDA 4BU2A 1BLZA 4XCAA 4YRDA 5EV7A 3WHTA 4YVWB 3P1IA 1X8EA 2GMMA 3ETQA 5EIYB 1XE7A 3L9JT 4LEJA 5C9AA 3GXUA 1G9AA 3ILRA 5FUIA 4BOWA 3I59B 5FZFA 3H9AA 2ZEZA 1GOFA 5M0TA 2OIIA 4XFFA 4OHZA 4Z92B 4OHVA 1VAVA 2G9FA 3U4XA 4XTPA 3NNJA 1MS4A 4U2AA 4FXGB 2ZEWA 3NJXA 2E32A 1UOJA 5SV8A 3DPRA 2DDUA 2IZWA 2D6KA 3A0NA 3ZYPA 4CU8A 4RA0A 3RSJA 4CCDA 2ZMKA 1R091 4NVPA 2A75A 2CAVA 4ZZ5A 1KQRA 1WW7A 2WDBA 5IATA 4WM7A 5I0UA 1HJFA 3NAPA 5A3UA 2OS2A 3GALA 4LO5B 2PHWA 1GICA 1PGL1 2PHUA 4QMAA 2ZJCA 5C8CA 3KV6A 5FXVA 4FBFA 2QQJA 1AUYA 2GNBA 5T3NA 5BNPB 2WT2A 5J3UA 3N9NA 1RL3A 5HI0A 3PIJA 4YSFA 4K21A 4P9WA 5T52A 1PIV1 3PIGA 3N4MA 3N3HA 3O0XA 3CJIB 5AVPA 1OPMA 1K42A 3E6CC 2WNVA 2QQNA 5BNOC 3V0AB 3KM5A 1YQ6A 4CVUA 2ZGRA 1V9U3 2D93A 2O8QA 2ZHLA 3WW1A 4IEYA 1OQEA 2HJIA 5IVBA 2VPVA 2D3PA 2FZ2A 3T1LA 1W99A 2O1QA 5FZ7A 2VQAA 3UKNA 2ZX3A 3ZSKA 3RYKA 2VW2A 3ZFGC 4QKBA 1ASJ1 2GALA 5GKAC 1ENQA 2XH6A 2TNFA 4BH9A 4DPNA 4PI0A 5FBZA 2ZZJA 4IESA 5DZEA 1SPPA 3ZFEC 1AZDA 5IWFA 3BUCA 4YGEA 4N43C 3BIWE 4HXCA 3AZWA 3AYEA 4N7UA 3CHXA 3KHBA 1BBT1 3FC0A 4LHLA 1DZQA 4FO9A 3W9AA 2ZGMA 1VMHA 4I0BA 4LBOA 4IQPA 3PVOA 4OMDA 1MS9A 1HB4A 3WP5A 4YW6A 4CP9A 3WV6A 2JWPA 2CDOA 2HEWF 2V5YA 3S7EA 4MGIE 1AVBA 4XJWA 2UWCA 1N1SA 3IZOA 4YVSA 4EJRA 5KBFA 4IXLA 3AKSA 4XXAA 5L9RA 1S2KA 4PHZA 1AL0G 1DU3D 2VZPA 5IT6A 3KS7A 1POV3 3NJYA 4YPJA 2ZPXA 2PELA 2FDIA 5FYMA 2OPKA 4QB6A 2PHDA 4HBNA 2MHFA 4WVZA 1V6KA 3Q9OA 3E5QA 4AVAA 2VNVA 1TG7A 4A3XA 4CCOA 4EWAA 3WLUA 5T5OA 2VAUA 1VBB2 2P3YA 3W5MA 3WNNA 4ZU5A 4FFFA 4QX1A 3VL9A 5K7PA 3OUHA 4HVOA 1C57A 3I49A 4XDOA 1K5MC 1WCDJ 3VDDB 1UF2C 2DFBA 2OA2A 2JG9C 2RG4A 3VBUA 4CDUA 1TQ5A 4ZHNA 1QDCA 2XONA 4NUBA 4F7ZA 1FYUA 4D94A 1IPSA 1IKPA 1WD3A 1D4M2 4IEQA 5A33A 1VBA2 2VNGA 1JHJA 4LIUA 2W94A 4RQPA 2EVXA 2PMWB 1A6CA 1LEDA 3LPGA 3ON7A 4GQ7A 3ZR6A 4I2OA 4GD4A 1CX4A 1FAYA 2HWE3 3VL8A 2BUKA 3B02A 4I01A 4RFT0 4W4ZA 5A70A 1BHGA 1HIXA 2ZHMA 2VZVA 2VR4A 4IGQA 1RUE3 2VZTA 4CEWB 1ND3C 2WBKA 2ZX4A 1B35B 3VZMA 2WS92 2N7GA 4NOTA 2JECA 3MYXA 2OUHA 2RHPA 1CPMA 1RUJ2 2FDJA 2PAKA 5IYYA 5DUUA 4AHYA 3MICA 4QPGC 4NIIA 3B00A 3I8TA 3IAQA 1D4M3 1FV2A 3WUDA 2OKXA 3RYRA 2VJXA 3WP4A 5T5LA 3WNXA 1SHWB 4RSUA 3IIAA 1UIKA 4GMP0 3ZMOA 3N7LA 4N53B 2CNAA 2ZKNA 4C8DA 4A4AA 1W8ZA 2NMNA 5DXDA 4BIOA 2HWC1 4QD2A 2ID4A 4XIOA 2J1TA 3KV4A 4YM1A 1DGRA 1XC6A 5IK4A 4ASKA 4ASLA 3GZUC 2VTXA 4OYUA 1IS5A 4LBQB 2A73B 4CXYA 3NVCA 3AKRA 3WX5A 3H1MA 3BOPA 4BQ3A 1RUJ3 1A78A 1YEWA 3ASIA 1ZBE3 2JX9A 3AMPA 4DEQA 1DQ6A 4XF4A 4NHMA 5CISA 2RVAA 3D0SA 1IQDC 4JC1A 2QFEA 1W05A 3N9OA 3THDA 2WFPA 3OG2A 4XUNA 4BQ1A 4IDZA 1JTZX 3THCA 1VE0A 3MIGA 4KU7A 4DNYA 1YI9A 3UGHA 3HQUA 2DTYA 1F5FA 1OQ1A 4FOYA 4CDWB 1HW5A 5HV4A 3WQ1A 4K3UA 2R0FA 2FMYA 3DYPA 3IMNA 3LPFA 5FYSA 2AC1A 1M06G 4A41A 5IVVA 3UESA 3KB5A 4W8JA 1W6PA 1JYWA 3VBFB 5IHRA 1JYIA 1LHOA 1GZWA 1ZVFA 3K3OA 5K9YA 1DGWA 2YHJA 1D0HA 3FLTA 2EAAA 1ACCA 4Q4V2 4CUCA 4LBJA 4LOSA 1IGOA 3TBDA 1UXXX 2CDPA 1ZYBA 2WFF2 4FPJA 4ISRA 1JOBA 3L2HA 4UI9L 1PO11 4GH4B 5FTTC 1JZ5A 4RS5A 5JIAA 3VBRB 3RPQA 3CLPA 3T3YA 4FOVA 4ASMB 3HD8B 4JV4A 4LO8A 1UOGA 4UFKA 4YGDA 2B46X 2C1FA 4WV8A 1AYM1 2V09A 4JGYC 1LESA 4UF0B 2SBAA 4Y1XA 1S2BA 2Q30A 3FE5A 5F2WA 1SCSA 3M3EA 1W3XA 2EXJA 2I74A 3CEWA 4FXKB 4H14A 3ZN5A 3H3LA 3ILNA 4AZZA 1DF0A 1VIWB 5FLIA 2BW8A 3JBG3 4JTNA 1OFSA 1GQHA 1UZWA 5FQ0B 4ATEA 2FDFA 4ITCA 5FZOA 5JDBA 2Y26A 1VBB1 1ENSA 1CAVB 4N8MA 1QJX2 5ABJA 4Q4V3 5C70A 2ADDA 5K0UB 2FDGA 3UGFA 1YQCA 1WCUA 2WFF3 2MEV2 3TN92 4CDQA 3OBRA 2E51A 3AYCA 5AC92 3CJXA 1UY0A 2FDKA 5IK8A 2GNMA 3HNBM 3NW4A 4ES8A 1V6IA 2DBNA 4AI0A 1J59A 3RFRA 3NV3A 3T4VA 1GZCA 1XB9A 4N7IA 5LZ6A 1LTEA 5FBJA 1FOD1 2W1UA 3MLJA 2A5ZA 1RUOA 4MUVA 1S4CA 5DDJ1 4AHXA 4W50A 2D97A 5G05L 3VBHB 1VBA1 3ES4A 2LRPA 5FK7A 1AX2A 1W6NB 2C5DA 4FI9A 3POIA 1LHWA 1I5PA 3VBOB 2XJSA 3BODA 2XKOA 5EJ1B 1UOFA 2GSYA 5GM0A 2E6VA 1RUH1 4OULA 2P37A 5LBEA 1V0AA 4Q1PA 3UGGA 1O4ZA 2W08A 3FL7A 2MEV3 3KD4A 3MF9A 4QM9A 1IG0A 2QQVA 2YGMA 4IV1C 2B39A 2XG3A 2WS91 4H55A 4LULA 3TRSB 1KRIA 2XJRA 1R081 1K3IA 3USUA 4XVHA 1GZ9A 1OH3A 5JAXA 3O0WA 5LK5A 3QACA 3MIHA 2VUJA 4UFJA 3JQXA 4C1WA 3KWVA 5LBFA 3OUJA 5JSPA 4GA9A 1FPN2 3M1HA 3PLQA 4QKFA 4AFAA 1RHI2 3Q8EA 3MZHA 1Z7S2 2JD9A 2VH9A 1LCLA 3B01A 1D0GA 1VB4A 5B2GB 2JDZA 4CP1A 1JU4A 1V6OA 1QJU3 5CAZA 2VD7A 5CKNA 2SLIA 3IPVB 1AR71 1J84A 1AXYA 2GNTA 3IB3A 4QXHA 1E5HA 4I30A 5FKCA 3WG1A 1XRUA 3KCCA 3ZFGB 3ZSMA 1AJOA 1DQ2A 1JS9A 5FZ1A 3SKVA 2ET7A 5IAXA 1MS5A 4LMFA 3IN9A 4LKEA 3ZFEB 4N43B 5FZIA 3T2QA 1X33A 5C4WC 1OMIA 1YJKA 1BXHA 3H7JA 2OT7A 2P3IA 5FMBA 4LORA 2A6YA 1GP4A 4BQ2A 1WMDA 5C5UA 4WVWA 4YM0A 4J1XA 1LU1A 1VRH2 5L73A 5JMOA 2OVUA 5C3PA 4XQDA 5KHJA 1UMZA 2CWMA 4XUTA 1CGPA 4GXLA 1RGSA 3H8RA 3CJIA 2GC2A 1AX0A 5CYYA 3V0AA 3A23A 3AXEA 1W2UA 2VGDA 1SBEA 4GWIA 3ZPYA 2Y64A 5HCFA 4CUBA 1F15A 4UBHA 3I3MA 1JZ7A 5DUVA 3PJYA 3MFCA 4XQWA 3J7NA 4AVCA 3WF1A 4QDQA 3RJRA 4LBQD 5EYXA 3H3ZA 4Q4V1 4I0WB 5FR3A 1XYPA 5FZDA 1PMJX 5A7OA 4A44A 3ABZA 5KHIA 1SDDB 2UY8A 1PZ8A 1W8FA 4UOJA 2V5DA 3ENRA 1D2QA 3ES1A 4NIAA 1ZRIA 1JYXA 2UY9A 1DQ1A 3JQWA 4LR4A 1JZ6A 1LRHA 1H8TA 3OBAA 4PQQA 5GLUA 1DYOA 1REFA 1K5MB 3KVAA 2ZBJA 2RS31 4XJ8A 4C0BA 1YIFA 2JG9B 1YYNA 2A6ZA 2QDNA 2EAKA 4QQLA 1OA3A 1F4AA 5JZGB 3N9MA 2B9UA 4PBPA 4R9DA 4KWJA 2Y8KA 4CA9A 1G9BA 1QJX1 3ZOIA 1SFPA 2HWF1 4M3CE 2D3SA 4AQTA 1TE1B 3AP7A 1TNFA 3TN91 4UBGA 2ZGOA 3OPTA 5FCCA 4B29A 4YYOA 2E53A 5AC91 5CBLA 4UFIA 1NX9A 3IT8A 1DYPA 4ZXKA 2W2IA 3URFA 5JOXA 3ZIXA 2JDHA 1ND3B 3AZZA 3GCWA 3P5BA 1H30A 5FV3A 4QX2A 4JRLA 3OD4A 1EAH3 1RITA 4R4ZA 3UKVA 5L9VA 3DXTA 1NLSA 3HMYA 1VB2A 2WQ4A 2DCZA 1GNYA 3PDQA 4HOOA 4AI3A 3VDDA 1JOPA 2CL2A 3EYPA 1LKNA 1ZZ7A 2NZ9A 5DAXA 1PNGA 4Y5SA 4KL1A 2XVKA 5FPAA 3RYPA 4KQ7A 5JMCA 3BTAA 4QDRA 3UKTA 3MF6A 3WNPA 3P3NA 4EN7B 4XFIA 5ACA2 1PX3A 4DRRA 2D98A 4MLOA 4Y1ZA 4DS0A 1GOGA 3R4DB 4LLFA 3TB0A 4QX3A 2C24A 1Q8QA 1ULDA 5KHKA 2VMEA 4OUEA 1ZBA3 4NO4A 3LIGA 3WW2A 4JDOA 1MQTC 1OH4A 1GV9A 4WVMA 3SQOA 2NPIA 2W5FA 1NLQA 4EN9B 1ZZBA 2PHRA 4CEWA 2JJ6A 1I9RA 1PK6A 4FPGA 4AOCA 5KC6A 1B35A 1CAXB 1YFYA 4XAAA 1FPN1 5FPXA 2JDUA 1RHI1 1WUVA 2D44A 1XNDA 1Z7S1 3P3PA 2VVEA 5FYTA 3M3CA 2WKKA 1W9YA 2E7AA 3NQHA 1V6MA 3AC0A 4K8RB 4LHKA 4P9LA 4CYDA 1P8JA 2QQUA 5ACA3 1FV3A 2BTVC 2JB4A 2I07B 3USUB 4R8HA 3VBSC 2D6PA 3WCSA 3TEYA 1E5IA 1ENXA 2J1EA 2KXLA 4ORFA 4W6XA 5F32A 5IUQA 1W3VA 1X82A 4N53A 1AR83 1NA1B 1XNCA 3TEZA 4Y26A 4Q26A 5LA9A 1HKDA 2K0GA 5JI7A 1Y9GA 1QQP3 3PU3A 1FI2A 2DBIA 1SLAA 2QVSB 3GBGA 4BE3A 4DUVA 2IXIA 4TLGA 3U4SA 3ZLIA 4XFGA 4AI8A 4OLLA 5LRRA 2B5HA 2VQTA 1IPKA 1ZZCA 5JOYA 1F4HA 1VRH1 2JD4A 1HB2A 2R072 4KWLA 3RG0A 2G1MA 2XQXA 4NRPA 5DPNA 3AVSA 2W39A 4CEYA 3PTYA 2P17A 4AGRA 2VCCA 4CU9A 5HCBA 2X10A 1PGL2 2JENA 2VG9A 4QX8A 3WNMA 5JIUA 1SLBA 3LEIA 3JXSA 4M3CB 5DAWA 1RUD1 1IG3A 4Q0VA 4AEDC 1UY3A 2WWUA 1UYYA 4AAPA 3OUIA 5LCWL 4CPBA 1IS3A 2LTNA 4E4DX 4A7KA 3BU0A 1OXCA 2VMHA 3AM2A 1UQXA 2P4EA 1X7NA 4IE0A 1KJLA 3SEEA 4YZ5A 1RUF2 4AK3A 5IVCA 3N7KA 4QB1A 2OQ7A 3LEGA 3NSTA 4KH9A 3WDWA 1R093 4JRAA 1UU6A 4ZPIA 4I3GA 3WXPA 4OI4A 1LU2A 1NXD1 3CU7A 3EB7A 1UKRA 4GH4A 2B45X 2BJSA 3IKWA 2UWBA 3AFGA 3VBRA 1OOPA 2XVLA 4MGQA 1GU3A 4QX5A 4OZXA 5F6KA 2XDVA 3APBA 1W8OA 2XL7A 4BQ5A 4HANA 1KFUL 3AKPA 4Z82A 3BGAA 5J96B 2YFZA 1W0NA 1OVSA 2WN2A 3UK9A 4Q4W1 1AR92 2RJKA 2W91A 3DECA 2VZOA 5I0RA 3AZYA 4LBMA 4DUXA 4XZPA 3BYWA 1XXNA 2Y38A 3VDCA 2YC2A 4P9IA 2EA7A 4NIHA 3ZYGA 2YY1A 3ACIA 1QJU2 1G9DA 3LQCA 1HXS2 1CAVA 4MXVA 1AYN1 3KZ4C 5IVYA 2LUWA 5K0UA 4IV1B 5FUNA 3T2OA 4XBNA 4OUSA 2K2SA 4ZU4A 5F3GA 2QUOA 2VMIA 4QU2A 1ASJ3 1KS5A 4Y20A 1VJ2A 3EQEA 5H9SA 4AQSA 3VKLA 4I02A 3WG3A 1NCQC 5F5IA 4NHKA 1VAKA 3M2MA 3LB9A 2R061 1PVC1 4D6QA 1BBT3 3MV01 5ACA1 1NXMA 1QJEA 1SLTA 1G8WA 2QE3A 2R7EB 5GLTA 3VBHA 2WZR2 3K48A 5FO8B 3DEMA 5J36A 3AB0A 4XURA 2WQ8A 3GJBA 4AYUA 4IEUA 5EFUA 1WLCA 2W1WA 3VBOA 2DYCA 1NCRC 2VMFA 4LBLA 3U0ZA 3CF6E 3MW2A 4B4RA 1RTVA 3T2PA 2MPFA 3FZ3A 3R05A 4OI0A 1H1IA 4EN8B 3EBRA 1GOHA 5FZBA 2D6OX 4FFIA 3POFA 2ZMNA 4AG4A 3ZYJB 3OPWA 5JCTA 4BK5A 1ZRFA 2GZWA 1XNAA 4BJ0A 1LGCA 2VZSA 3KGLA 5BNNC 4MADA 1UOBA 4UFHA 3AL5A 4F8AA 5KR7A 3HN3A 3MLLA 3ZPOA 4M0HA 1RIRA 4XUQA 3VZLA 3I2KA 1WA4A 2WYFA 3KF5A 5B4XA 5AFEA 2Z2SB 2C9AA 4B8EA 3VDBA 4EE2A 5FZ3A 1IOAA 5C7GA 2ZHKA 1GWLA 1SBDA 1NKGA 2DWRA 1W8WA 4AFBA 3WG4A 5FOJB 4MXWB 3OB8A 1S0BA 2QJVA 3UNPA 2YPDA 3IPVA 4DINB 1OA4A 4N90A 3A21A 4LKDA 4XETA 1U0AA 2A70A 1XQNA 3WUCA 1PZ7A 5H9QA 2WL1A 4YGBA 5C3RA 1A8DA 2RS12 2QCSB 3I2DA 2W87A 3HVDA 1O4YA 1PGSA 4Y5TA 5EHDA 2R0HA 3FFZA 3AFKA 1IHMA 2R071 1Q43A 1UX6A 1LOAA 3G7DA 4E4SA 1CJPA 3ZSEA 3E5XA 1KS4A 1R1ZA 4YZ1A 1W04A 5A3TA 4RGGA 1VMFA 2D3RA 1YRZA 2VM9A 3J26N 4GJZA 3ILFA 2PLV1 2HWC2 5A3OA 4BDVB 5A3NA 4CXWA 1W2OA 4E8CA 2W47A 3NNFA 1G9FA 4FPEA 4QHOA 2B7YA 2AENA 4LKFA 2TUNA 1ZA7A 3CNAA 4MO3M 3AMHA 4EYUA 3EJKA 1HN0A 2Y6FA 1AR62 2A3YA 2EALA 1ND2C 2YZ4A 1QOTA 1QU0A 3ZFFC 4H3WA 4JDNA 2NP0A 4CXXA 3NJVA 3HT2A 4Q4Y2 2X8KA 3MLKA 2PN5A 2YB7A 5CG8A 1RUF1 3NV1A 2RS13 4XCBA 5A1LA 5A32A 2IUWA 2HWD2 1JU3A 4K8FA 3OPZA 1W8TA 4JKLA 3THPA 3HR9A 3R0RA 4FPHA 4EZ4A 4BHPA 5JXIA 3WY6A 4O65A 1W0OA 3RWNA 2NN8A 2WR9A 1JW6A 4PQ9A 2HWC3 1UCXA 3OY8B 2JE8A 2YG0A 3FUOA 3KLSA 5KXCA 3SISA 3FBMA 4L8QA 2GH8A 3PUSA 2DVFA 2FDHA 1XOYA 2IWGB 4LITA 2NMOA 3D3AA 5JSRA 1XYNA 2JXAA 4NHLA 2QQMA 3IBMA 4HVRA 4ARYA 3O1VA 2Q5TA 4G3YC 1AR91 2WO1A 2V4VA 3DN7A 4HG6B 3INAA 5C9AC 5LW9A 5FJHA 5JZGA 3O1SA 2FMDA 1PO12 4MSVA 2IFWA 4V1PA 1CAUA 4XXPA 4NWWA 3SCGA 3SLIA 2J1RA 1DQ0A 1QJU1 2JG8A 2HWB2 1HXS1 1W6MB 3LWCA 1DGLA 3DPRC 3Q8CA 1VBC2 4L0PA 2ZGSA 3ZDSA 1LOFC 2XLFA 4U36A 1AYM2 3IDAA 5CFCA 5IVFA 5KXDA 1S55A 3SHRA 4YGCA 5FFOC 3J8F2 1MQTB 4IEPA 4YFWA 4YW2A 3NAPC 4TWTA 1WWYA 2HBTA 1CWPA 4P02B 1ND3A 3S57A 5C8CC 4RD7A 3WDUA 5F7UA 1EYBA 2XLGA 3AK0A 4OUMA 2Y6JA 3K75B 1SCRA 2UURA 2Y6GA 2IXJA 3SKJE 4XFHA 3ZM8A 2F4LA 2WZR1 4Q29A 1BJQA 4IV3C 1PO13 1HRV2 1ULFA 3RDIA 1YQ2A 1LECA 2WNVC 3TNPB 5J48A 1T6BX 3KHCA 2HWB3 3NNMA 3AP6A 2H0VA 4YG6A 3POJA 2Y0OA 5FZGA 1CD3G 1FOD2 1AL21 1AYM3 3BKZA 3GYDA 5EQUA 4KI5M 5DDJ2 3ZSJA 3POEA 5F8PA 4YW3A 4PDWA 3WNKA 1OFNA 3AJYA 3CKHA 3MUZ1 4X8NA 5FP3A 3W21A 3TYJA 1VBB3 1UIJA 4EWEA 1OT5A 1YFWA 2X5IA 1RUH2 3JD71 4NMIA 4CRQA 3HEIA 4QX7A 1CAXA 4XW3A 3OF1A 4D7SA 4CDXC 3WQ7A 3OGJA 1D7PM 4A45A 4MGTA 4P5HA 2LM3A 5ANQA 1PHMA 3C7HA 4FT8A 2XB6C 1R082 2ZAHA 2XVGA 2BGCA 1W9FA 4DMIA 1ULPA 1FOD3 5JOWA 5DDJ3 4AEDB 2BNMA 3WDVA 4DEVA 1MEC1 3OSDA 1NLRA 2RS11 1NA1A 1VBA3 4WM8A 5JLVA 3O1MA 2YYOA 4C1XA 2BWCA 3HIFA 3U75A 2C6SA 2Y34A 4D8MA 2UYBA 1LOBA 3QOPA 4QX0A 1RUH3 1KITA 4LKSA 4ZZ8A 1APNA 1AR72 3K3NA 3PUHA 4TLFA 3C7EA 2NLRA 4QKNA 1WBFA 4BZ4A 3D0JA 1O7FA 3PMSA 2D43A 4QHBA 2NQYA 2EXIA 4CU6A 2DVGA 2WS93 4FSJA 1GR3A 1F8VA 1R083 4XHBA 1IS6A 5JR2A 4UWDA 1AR61 2D6MA 1NYWA 2VNOA 3OEBA 2WNUB 2VUDA 4XAEA 4CUAA 3H8OA 3VBUC 3GCXA 3MIEA 3AMQA 1KXGA 4RYDA 1UYXA 2BVBA 5A1FA 1JUHA 4Q4Y1 4N9HA 2XWBB 3WP6A 1UAIA 1J58A 2RM22 3I2OA 3KSCA 4DFSA 4Y33A 2JKXA 2WUHA 1ENRA 2HWD1 1J3RA 3MIDA 5CZKA 5C3SA 4XBQA 4MGZE 1WGPA 3FX3A 3OBTA 3T0BA 4M4PA 5F39A 5FIXA 2KM2A 5FYCA 3TEXA 2WZPP 1QNWA 3U78A 1AR73 4QQPA 1JN2P 3WZ1A 2W1QA 1REDA 5FK8A 1H2KA 1HRI2 1T6GC 4HMZA 3VZKA 4AVTA 5LRSA 4OI1A 3M8LA 4CP0A 3H8XA 5DZFA 5A7SA 1NQJA 2W92A 2XHNA 2RJLA 3N35A 1NCQB 1W39A 3AP9A 2QQOA 3PURA 3AYDA 4XE9A 4IL7A 5IVJA 4Q0UA 3I2HA 5FYVA 4COZA 5CIRA 4FFHA 2BDRA 2GC0A 4JX0A 4HPKB 4FPYA 3AMNA 4W6YA 4FPCA 2Q4SA 2BV4A 3P6BA 4BMBA 1GP6A 2HWB1 2EXHA 2WO3A 4A7YA 2JICA 1VBC1 1MZ6A 3LSEA 2XKPA 1NCRB 2WINB 5FLHA 5FY4A 1QXPA 2RS32 4CCMA 1DBNA 5LATA 2XR4A 3FJSA 3J8F1 1WMXA 4XPVA 3LDBA 1C8NA 3UJQA 4BLIA 4G4FA 4CTEA 2B9VA 4Z2WA 1OKQA 2BZDA 2YROA 1X36A 4URAA 4HKOA 1AF9A 1UZZA 4P08A 1RUI1 4IV1A 4TYSA 5CFDB 1JZ3A 3WNLA 2Y0IA 2XJTA 3HWJA 4XDPA 2OQ6A 1HV0A 3LDRA 4XZUG 1HDKA 3I54A 2PHTA 2WA3A 2HWF2 2ORXA 2WT0A 5EJZB 3A7QA 1UZYA 2WO2A 4M01A 4R9CA 1O91A 1XBFA 1HRV1 3FHQA 3GHNA 3ZVXA 1HX6A 4JCKA 1UYZA 4IW3A 3BPZA 2BNOA 1UY1A 2P5BA 4CZSA 4XOGA 1CPNA 3BTYA 2D5FA 3ETPA 3MFAA 5HXMA 3HN1A 4K20A 1JYVA 3LIHA 3O1UA 2RS33 5IJRA 3BU7A 5FP4A 1CR7A 1O5LA 2QQWA 1RXFA 2IFRA 2K46A 2R1DA 2XLAA 1JZ8A 5LY2A 1OLQA 1C8M1 1UY4A 2WLPA 1OD3A 1NT0A 5FZLA 1DCSA 3CBNA 4UYBA 4HFSA 3LA2A 1ODMA 3LA3A 3N7JA 5I93A 3K2OA 4WBBA 1QJX3 3V56A 5KHGA 4NR1A 1NUKA 1SDWA 2HWF3 1QJY2 2W46A 2VMDA 2IXHA 3VN4A 3TN93 3FBYA 1R1A2 4D3WA 5AC93 1W6QA 3MBWA 4RS5C 3ACLA 1SFYA 5F5QA 4WVVA 1WA6X 3N7MA 1UZVA 2JDKA 2ZX1A 1X9TA 4PLMA 1OA2A 4OHYA 3QLQA 4HLTA 5FZ9A 4DIQA 1N1YA 4YM2A 2WIIB 4BA6A 4XF1A 4XJ9A 4Q0PA 2DUPA 1EP0A 2ZABA 1HQLA 1ND2B 5EP9A 1RYYA 1VR3A 2D6LX 2Q0AA 4YVWA 4JZRA 2W52A 4H7MA 3WT3A 4P00B 3ZFFB 1MS1A 4K1ZA 4TSVA 5BNOB 3I59A 1Q56A 3BIEA 3POSA 4OI2A 4AF9A 2RE9A 1WW4A 5BPXA 1H6XA 4FP3A 5D1IA 1D2SA 5FPBA 2R32A 4Q0QA 3U14A 5ABJC 3KMHA 4OQ9A 3N9PA 4MHRA 3ZYFA 1YLLA 4X6RB 1R1A3 3U10A 4GKXA 4IETA 5A7QA 5A7WB 5IAVA 4QB2A 1C1FA 1UN1A 4CDQC 4BIFA 1N1VA 5E89A 2VULA 4NPRA 1EPWA 1Q3EA 1A3KA 3MIFA 1V70A 3CIHA 5F37A 4XJZA 1MS0A 5FPVA 4LXLA 2WO7A 3POYA 5I0DA 2GMEA 1POQA 5C8WA 3ATGA 1COV2 4E2GA 2RM21 2XL9A 4QAWA 1FPN3 5G04L 5A3LA 1RHI3 2VTFA 5BNPA 4XFBA 1Z7S3 2Q1MA 3PL0A 2ARBA 4P14A 4GB32 4XABA 2VW1A 2P2KA 4XDQA 3GHMA 3X29B 5LBBA 4DY5A 1LJ7A 4XYXA 4C0HA 2TBVA 4EZHA 2MNGA 3GDBA 3PUAA 4Z2AA 4FQZA 4J6GA 3DPRB 4LO4B 3DV8A 3TOJA 1JHNA 1XE8A 1CAWB 3VHRA 4F3JA 4GZ9A 4PF5A 4EWDA 1HRI1 5CG9A 2XBO1 5K4LA 3OD0A 1Y9MA 2CGOA 1RUD2 2NM1A 3HAGA 5FDBA 3NAPB 2VVFA 2YFUA 4JTOA 4CU7A 5HXVA 4AL9A 4FFGA 4QDSA 3OY8A 3H0OA 4FPFA 1PO22 5C5TA 4QQ2A 3MO4A 1LAJA 4GWJA 3U37A 3JB8A 3JCIA 5FP9A 1QEXA 1V6NA 1VRH3 3WSOA 4O9GA 3GGLA 1UO9A 4IV3B 3V65A 5EZWA 2HYKA 1IPJA 4HSLA 1RJ8A 4LO7A 1R64A 1QOOA 3NRUA 4OFGA 4D7TA 3BI3A 2BQPA 3J9SA 1W2NA 4AQ2A 2ARXA 2JDNA 2WZ8A 4DXSA 1XU2A 3WF2A 1UPSA 4PF1A 1GBGA 2VOTA 4AFMA 5IK5A 3K46A 4Q0SA 4Q2FA 1Z78A 1HQNA 1CQ9A 2BBAA 2PXJA 1RUD3 2QTWB 1Y7BA 4HKWA 3NNLA 1J1LA 1YCIA 4SLIA 4XHXA 4Q4W2 2FD8A 4COWA 4WZCA 5I0SA 4XF9A 1QIQA 3RWKX 1SPPB 1ZA4A 3RZGA 5I0TA 1KD7A 2GU9A 1ZRRA 2VUAA 3U07A 4E2QA 3LDKA 2VECA 1FMD2 4RR3C 3RNSA 4CDXB 2J1UA 3W20A 2WT1A 2E7QA 1AYN2 4RGAA 1DLLA 1NE6A 4GJYA 5APAA 2XHKA 3ZKYA 4ZU7A 2OZJA 1LHVA 4CCKA 4CP9B 2C4XA 3T4HB 2Q8DA 1BVP1 3LEKA 4QPGB 2VQ0A 5JI9A 3RQ0A 4RHV2 1TME2 5IW0A 1F2NA 1PGW2 2YU1A 2R062 1Q8SA 5FYHA 1GANA 4S2HA 1QH7A 1PVC2 1HV1A 2A7AA 3EHKA 4Q4W3 5FPUA 5FMDA 1UU5A 3B94A 3VD4A 4D6RA 1QJY1 4ISQA 5J1XA 2X29A 3MPBA 4BWOA 4NPLA 1R1A1 4TXWA 5L36A 5F3EA 1YIPA 2HH9A 2PQQA 4FVVA 2L9LA 4YW5A 4DY3A 5GZDA 1FT9A 3A0KA 1AYN3 1TMF2 2VZUA 4Q5OA 2CGPA 2J7MA 1UWWA 1WCKA 1VALA 1H8TC 2RDRA 2Z42A 3VKFC 1KJRA 1LGBA 4KNCA 5FZ8A 5LEJA 1US2A 2QZ2A 1NE4A 4NWVA 1H4HA 1HQWA 2ZKLA 3SH5A 1MS8A 3ZO0B 1YC61 1WW5A 1BZWA 3OGSA 1DQ5A 2R063 1W8UA 3GBWA 3LD8A 3I3EA 4HN1A 5DAPA 3VDAA 1NG0A 3ZYRA 1PVC3 5FMCA 4BB3A 2BPA2 1BEV1 3KCXA 2ZGLA 2BGPA 3KQRA 2ARCA 5EWSA 1LOGA 5HCHA 3SC7X 1CVNA 2ZEXA 2F4PA 3CL1A 2ARAA 3PVEA 1BK0A 1H0BA 1YO8A 5EJ3A 3U1XA 4BYYA 2RS52 4AHZA 4CUGA 3M3IA 2CYFA 4FPKA 1TMF3 1S0GA 3C8XA 1K45A 2BFUS 1QY4A 4FOWA 1W9SA 3O1PA 1VBE2 2BU9A 2ET1A 2J1AA 3AKTA 3IIIA 3B69A 5DABA 3HBKA 4RN5A 2ENRA 1W90A 2G9ZA 5E8AA 1COV1 4JKKA 3O1TA 4OMCA 5A1AA 1X9PA 4LBQA 1H8VA 4NHXA 2FCTA 2GC3A 2ZTNA 5T5JA 4BM8A 1GLHA 2CV6A 1YQ5A 4GB31 1O3TA 5A80A 2WNUA 1CONA 4PIXA 1CESA 4JHZA 4Z8BA 1H9PA 3C3VA 3OGRA 2WC2A 4ET7A 2ERFA 1G86A 1VBD1 4L97A 5FMOS 2PLV2 3PU8A 1L7LA 1GFF2 2DUQA 1E5SA 5FY9A 2PYTA 1G7YA 5KHHA 4JGZC 4JGYB 5LBCA 3W59A 1C3HA 1TVGA 2AH2A 2G19A 3ME2A 3FWEA 4CDWA 1VAMA 4KGQA 2ES3A 1SZBA 1QJFA 3GJAA 3Q8AA 4Y4YA 2WSVA 5LB6A 5T55A 3ITQA 4K7JA 3AVRA 1KGYA 4DB5A 3NKTA 5GZEA 2A1XA 4A6OA 4B7KA 3F2ZA 4LBKA 4RGKA 3VBFA 1PO21 2OXBA 2ZA9A 1LGNA 3IAPA 4OVEA 5LA2A 3WQ0A 4GKYA 1PK6C 1H1MA 3AXDA 3N36A 4ZKTB 2UWAA 2R073 4LIVA 2JDMA 4XMAA 1DP0A 1NCQA 3QCWA 2VC9A 5F5AA 2XUEA 4UW4A 5JXHA 5JXGA 4QGMA 4QGNA 4LUMA 4QXCA 5KXBA 3VHNA 1OPOA 2PLV3 3RZZA 3WR0A 1AXZA 3WF0A 4GWMA 3KQ4B 2C26A 4V2WA 3NNGA 4P5YA 2UU8A 3WW3A 1A34A 3SMHA 1ZZ6A 3MI8A 4UF0A 1J1TA 1NCRA 5F3IA 3NWKA 1XNKA 3OTFA 3T1MA 5IVEA 4N53C 4XJUA 3ZIWA 4HN0A 2YBSA 2XMLA 1W6PB 2R1BA 4LQRA 3JB4C 1SMVA 2BNNA 2GC1A 4MVTA 2EF6A 1K12A 3UL2A 3LSDA 1GZWB 5FQ0A 1RUF3 1TNRA 3D4KA 1W9TA 4H2AA 2GP3A 4MZUA 5CFDA 1FMD1 1Y3TA 1CIYA 2ZXQA 1FNYA 1M4WA 5E1RA 2VXJA 4NRMA 1EPZA 5LEKA 1LNSA 3VV1A 3BCWA 3WEZA 2PFWA 2XQRA 3NO8A 3PJQA 5FY7A 3EMRA 1MR5A 2AGSA 1KEXA 3RS6A 3ST7A 3AJZA 4CEYC 1VP6A 3H1WA 5JR7B 1DFQA 4M0NA 1OLRA 2KA3A 4HZFA 1W2AX 1TME1 3DL3A 4QPIC 1PGW1 4RHV1 5D8AC 2X05A 2RV9A 3RVHA 5GLWA 4RFRB 3E97A 2AR6A 1AR93 4QKDA 1UPIA 1W6NA 1XYOA 4M4RA 2GN3A 3O14A 3SH3A 2AEYA 3BOWA 3ZXLA 2VBDA 3I2FA 2HYXA 5I8SA 1S0IA 2IXCA 1CZSA 3UT0A 2DU0A 5ABJB 1HXS3 2PA7A 1TMF1
chains in the Genus database with same CATH topology
5BV6A 1BMV2 2O8OA 1AL22 4Q8LA 3H1YA 4XFCA 3A4UA 4CDQB 5A3MA 2ILMA 1EV12 1JYCA 5GZFA 1F9KA 4DZGA 2QQPA 4HSJA 4GH4C 1WMFA 5C4WB 3VBRC 3ZXKA 2YC0A 1FNZA 1OOPC 4GALA 3SH4A 1SLLA 4ONUA 3WG2A 4EN0A 3JD72 2GH2A 2R042 3KT7A 2WZR3 3R4SA 2UYAA 3ROUA 3ZFFA 3VHPA 4K6BA 1BVVA 2DVBA 5BNOA 2RS51 1Z0HA 4Y5Z0 2DV9A 2C0ZA 2RR12 1AL23 1VBE1 2E7TA 2Z5WA 3GBFA 3SCHA 2DCTA 4QQOA 1MEC2 3ZFGA 1RMU2 4EV0A 3FHIB 4HKLA 1I3HA 1IZ3A 1RC6A 2ZGQA 3ZFEA 1U5XA 3M70A 4N43A 4G9SB 2W68A 3JD73 4FCAA 2R043 1GNZA 4MGKE 1QJZA 4S2GA 1RUC1 2XWJB 1NOVA 3VBHC 5BYNA 1LR5A 3DF0A 2VU9A 1QH6A 4YZ4A 2GDFA 3VBOC 3O5SA 4FP2A 1RINA 2VNRA 4AFCA 2RR13 1V9U2 1LOFA 1CAWA 1QXJA 2VXRA 4UXAA 3ZN4A 4B3NA 4AEKA 1MEC3 2QNKA 2W0XA 1RMU3 5FOBB 1IKQA 1H9WA 4LE3A 3NJZA 2QDRA 1IQAA 1KFXL 2PTMA 3S30A 1ONAA 2G9GA 4RR3B 2RMU2 1CN1A 1Q8VA 2D5HA 4J1WA 5T5PA 1ZZ9A 2PHXA 1O3QA 4L99A 4A7ZA 1C28A 4IV3A 3IM0A 4MYEA 4XBLA 4AHWA 4AI2A 3GNEA 2P3KA 1K5MA 2FBEA 3M4FA 2JG9A 1AR63 1WLDA 2ZX2A 4FAGA 1FX5A 4Q4Y3 1MZFA 4Y1UA 2HWD3 2K9ZA 2ZCWA 5I8TA 2BBVA 1AXKA 3C2UA 3MW4A 4W6WA 2CGNA 3WDYA 3B9CA 2ZGNA 5L7OC 3ZX7A 4Y1YA 5JVVA 4WM7C 2RMU3 1O4TA 4E9KA 2ZACA 4CDXA 4JVAA 3D5OA 1H8TB 1RUI2 2D7FA 1CIWA 1O3SA 4LLOA 3AZVA 1OQDA 1S0JA 3ELNA 2XUMA 1TEIA 3MW3A 4QPGA 1DZTA 4LE4A 2DVAA 5FPZA 4PLOA 4IEWA 5J09A 4QPYA 1U5ZA 5GLVA 3VBSB 1BMV1 1VBC3 2PAEA 1PMIA 1EV11 4LO6B 3J8F3 2HWE2 1DGRN 5CA6A 5DUWA 3OGGA 2OW4A 2QZ3A 4CP2A 4FPLA 4P9YA 3VKOA 1C8M2 3OYWB 1QOSA 4DQAA 2R6QA 1FXZA 4PCRA 1LEMA 1RUI3 1RUE2 4YNIA 4D7YA 1YNAA 3ZXFA 3LAGA 3NKGA 1MVQA 1IS4A 2R041 3VGIA 1C1LA 1ZX5A 1O3RA 2IXKA 3IDBB 3AZXA 1BK1A 3S0MA 4P9GA 1GQGA 1HRV3 1C5IA 2ZGUA 3NL1A 4KU8A 5EYYA 2JE9A 5JZGC 5CU1A 2R16A 4JGZB 1LENA 1Y43B 5GLZA 3SNMA 4AXOA 1OSGA 2RR11 3SHRA 1XNBA 2JG8C 5DG1A 4YVSC 3USUA 3AP5A 2WQZC 5BY5A 5CFCC 3KGZA 2XPJA 1U5IA 1RMU1 4O9EA 1C8M3 4WVMB 3NV2A 3EO6A 3M7AA 3FLPA 3VLBB 3AP4A 2XJVA 5CB7A 4DRVA 1PK6B 3VZNA 4IEZA 3ECQA 3HBZA 3TAYA 4XTMA 1QDOA 2XGXA 5DZGA 3WP3A 4AGGA 1ZBE2 5JOZA 3TNQA 3TWIA 4FPOB 4XJAA 2LALA 5IK7A 2VVDA 4Y1VA 1NQDA 3AKQA 5I8YA 1V9U1 1H2LA 4CDUC 1H2NA 1F31A 4JGYA 1ZNPA 1PM7A 4AVVA 3WW4A 4M3CA 2VOWA 1A8MA 4EN6B 2EXKA 4K1YA 4Y24A 2PHLA 4RQPC 4PDWC 4LTAA 2IXLA 3KCYA 5F6LB 1BKZA 4DOUA 1O5UA 1H2MA 1W0PA 2A6WA 2RMU1 2X5IC 5T50A 4UW3A 3RRDA 2YGLA 4YG0A 3ZSLA 5F9TA 4ES9A 1WBLA 4RL7A 2XBO2 3LZZA 1ALYA 1AJKA 4URTA 4CEYB 1JXNA 1YUDA 1ULGA 3GZAA 2VOKA 3E5UA 4QPIB 1DDLA 5D8AB 5HBAA 2RM23 4QT6A 4Q4X2 1BCXA 2G4IA 2YXSA 5F1RA 4XQ4A 1YFXA 1POV1 1NA1C 4B7EA 2A3XA 4FTBA 4WM8C 4A2UA 1J3PA 2ZGKA 4OHWA 1YHFA 3JBG2 4FTEA 1RB8G 4I09A 3QH7A 3RMXA 1XU1A 4W65A 1UL9A 2YV8A 2AREA 5KWRA 2DCJA 3VZOA 1DZRA 1HRI3 3RI9A 2XBO3 4R52A 1URXA 1OD5A 2TEPA 4LA2A 1SBFA 3WDXA 5BNNB 1QWRA 3ALQA 5BNQA 3KT4A 1OOPB 2WWSA 5GJ6A 1N47A 1W6OB 3AYAA 3NV4A 2VOXA 3WINE 1DHKB 1LB2A 4Q4X3 3AMMA 2JE7A 5FREA 2DF7A 2H6BA 2R49A 3H3UA 4BLJA 2D6NA 2CY6A 3B3QE 3D8CA 3M3QA 3ZXAC 1L3JA 2O0OA 2WJSA 2HWE1 5CNAA 3B5LB 1MZ5A 4AVSA 1ZREA 1RUG2 2VW0A 3LGRA 4F83A 4PIZA 3K51A 1RUE1 3ZYIB 4QGLA 3VHOA 2XJQA 2BEOA 4R9AA 4LT5A 1X8MA 4Y20B 3RMYA 4K9SA 4XIKA 4MGYE 5C4WA 1VLNA 3FLRA 3DGTA 4HETA 3VUOA 1NY72 3G6JB 5HCAA 2HKXA 1D4M1 5AFBA 2IC1A 4META 3WDTA 3PMEA 3FFQA 4JDMA 1LULA 3PVNA 4HVQA 2GNDA 3O0VA 5JPNB 4SBVA 5TSWA 3E6DA 4XFAA 3ZN6B 1U12A 2V73A 5H9RA 1S0FA 1YWKA 4Q27A 1RUG3 4C91A 4AEJA 2WNEA 2ZOEB 4MXWA 4BMEA 3E6BA 4KG8A 2DVDA 4XEZA 1AX1A 2VMGA 1BEV2 2HEYF 1OHFA 4Y22B 1QJY3 1RUJ1 3DUIA 2AZ5A 3OCPA 1ZBE1 1SFNA 1N1TA 3V0BB 2NYYA 3IWZA 2ZX0A 3MDPA 1C4RA 3FMGA 1DG6A 1B09A 2BVVA 1GKBA 4KWKA 3T2TA 1N3QA 2YUEA 4HT1T 1DQ4A 1KDMA 1DYKA 2A3WA 5LK7B 2CTVA 2WSUA 4IEXA 5C9AB 5J7MA 2JEMA 4FTSA 1LHNA 1Q5OA 3V64A 1QKQA 1S0DA 3SCFA 1S1AA 4C90A 5GZCA 1VBD2 1BEV3 3B9IA 4B4QA 5BXXA 5L7OB 1V6LA 4INDA 2ZAAA 1E57A 1G6NA 4I3PA 4WM7B 2DUOA 1SLIA 3ZXEA 4RR3A 4AE2A 5K8SA 2D40A 4JAAA 2WA4A 1I6XA 3QD6A 4COYA 5C8CB 2BWAA 2E9QA 1NZCA 2B42B 2Q1ZB 3ZXDA 3QBQA 1COV3 4KBBA 1Q8PA 4Q4X1 4LNVA 1UW8A 5I91A 2EIGA 4YLZA 2CWSA 4AGVA 4YVWC 4GB33 3S6PA 1UU4A 1S0EA 4PIYA 4IERA 4Z1VA 3JBG1 2WNVB 1HLCA 1SEFA 1VBD3 1QGLA 5CADA 5A32B 4P9XA 1AHSA 3WVJA 1LOEA 1I5ZA 1QNYA 1G9CA 1QHDA 1W6MA 3B7MA 3FUQA 2WFF1 4YW1A 2I2SA 1C5HA 3LCPA 3JU9A 5KC5A 1RVF2 5H9PA 4D69A 3DKWA 1MQTA 4Z07A 1WMEA 4ATFA 3BALA 1PO23 4TZDA 4MV2A 1EAH2 4EROA 1JUIA 2DCYA 2OZ6A 2YPJA 4B4PA 4KG0A 1RJ7A 5BNPC 1X50A 5BUVA 4MH0E 4DXZA 4YFZA 1LODA 3HT1A 4R4XA 1CAUB 2ATFA 1U5YA 2OUJA 4JQRA 5J98B 2A71A 3IDCB 3CJIC 2JG8B 4GIQA 4YVSB 3VBSA 1RUG1 1V00A 5CFCB 2GMPA 2HEVF 2Q8OA 2MEV1 1ULCA 1WW6A 1RVF3 1ZBA2 1QF3A 1LHUA 3O7OA 2E63A 5DUXA 4AI1A 1QMJA 2R30A 2BYVE 2PHFA 3OYWA 1ULEA 2XJUA 3ZXGA 2F6BA 1NY71 4XF3A 1FMD3 2DURA 5JWPA 3I4IA 2A6XA 5FRAA 1MVEA 1SQ4A 4H7LA 4L92A 4I0AA 3EXUA 3MEPA 4QQHA 3L2YA 2XJPA 4XMIA 4YZ3A 2Z79A 1Q8OA 4FQ4A 3VBUB 4CDUB 1S0CA 4BCUA 4JGZA 2PAMA 5GZGA 4RHV3 1TME3 1GNHA 2FZ1A 3MIBA 1POV0 4S2FA 1GSLA 1WLTA 4AEDA 1UD1A 5A33B 4N9IA 1AR82 1JH5A 4GMP3 4RQPB 3WOGA 4PDWB 3OJBA 3RJ2X 5EXOA 2BFUL 3W58A 1QQP2 3MGUA 2VOVA 4P9JA 3GF6A 3PVBB 2X5IB 3J4UH 2ZS6B 3POWA 4WZFA 2ZGPA 5J37A 3AX4A 1PZ9A 5JSOA 3D6EA 3I7DA 5SV5A 4YARA 5E88A 4UW5A 2FQPA 3MPPG 5FMOL 1N3PA 3VDDC 4FAHA 4MX3A 1UKGA 4GULA 4COUA 3USSA 2JKBA 1SACA 1EY2A 2B8MA 4FOQA 3VKNA 2ZMLA 4M00A 4WM8B 5FLJA 2DCKA 5C6CA 1RUC2 3UV9A 1YJLA 4PLNA 4AQ6A 4E27A 1ZRCA 2RS53 4S2DA 3ZMNA 4YZ2A 3KT1A 2AYHA 1SLCA 2DU1A 1VBE3 1R092 4X6QB 3LA7A 5JPMB 4CEWC 1OI6A 4XF0A 1B35C 4M3CF 5FAXA 3H7YA 4L11A 2ZZQA 3GZTB 1YI7A 4QPIA 2ETEA 2DFCA 4HK9A 5D8AA 4QXKA 1DGWX 3UJOA 4AWDA 2H0BA 4QM8A 4BPZA 2FHRA 1Y9QA 4HPKA 4AVBA 1RUC3 1PIV2 4PBOA 1H4GA 1WCSA 5CVRA 5C33A 1RVF1 2CAUA 2X53S 2VY0A 3M3OA 2OYZA 4LA3A 1KDKA 5AVAA 3D82A 3VZJA 4LBNA 1DIWA 3S7IA 5E16A 1V6JA 1EAH1 3JZVA 3LOBA 5FO9B 5BNNA 3R6SA 2YDEA 4Q1RA 1ASJ2 3WHUA 3THTA 4LHNA 5DG2A 4AEMA 4E4ZA 1W6OA 2WNUC 4RS5B 2P3JA 1PVXA 2ZGTA 1BQPA 1RUNA 1GYKA 1BBT2 3WCRA 1JOJA 3ZXJA 1F5JA 1MACA 1PIV3 3JUUA 1MS3A 1H1AA 1FATA 1LOCA 1REEA 3H8UA 3LOIA 3QH6A 4L9BA 4YM3A 2YMZA 2GAUA 4CDWC 3B93A 1ZBA1 2H6CA 2I45A 3H50A 4GMP1 4GWNA 2QKDA 3LKJA 4KGGA 4L2NA 3RI8A 5T54A 4R9BA 1WD4A 3VBFC 3BB6A 3O12A 5FO7B 1ZM1A 3HQXA 1ZRDA 3PNAA 1N3OA 3VKMA 2DTWA 4HL0A 4COVA 1MZEA 1QXRA 4NN0A 5KXEA 3SXWA 1JBCA 4X8PA 1CJDA 1YFUA 3U11A 4K40A 4Q8KA 4YG3A 2WLQA 3R4UA 1BYHA 4UW6A 4LUKA 1ZZ8A 2AUYA 1I1EA 4HK8A 3SITA 4IEVA 3IDEA 3ZN6A 1AR81 4IEOA 1ND2A 2A6VA 2ZHNA 4E2SA 1QQP1 5GALA 3WD5A 1J3QA 4YW4A 1D4VB 5CFDC 4AW7A 4Y22A 4OHXA 5L19A 3PHMA 2GN7A 1EV13 5K0UC 1W6QB 3V0BA 2Z69A 4PJYA 2P34A 4XILA 1YXWA 3CO2A 1PNFA 1WLWA 4AFDA 4YRDA 5EV7A 3WHTA 4YVWB 1X8EA 2GMMA 3ETQA 1XE7A 3L9JT 4LEJA 5C9AA 1G9AA 3ILRA 4BOWA 3I59B 3H9AA 2OIIA 4XFFA 4OHZA 4Z92B 4OHVA 1VAVA 2G9FA 3U4XA 4XTPA 1MS4A 4U2AA 4FXGB 5SV8A 3ZYPA 3DPRA 2IZWA 2D6KA 3A0NA 5L7OA 4RA0A 3RSJA 2ZMKA 1R091 4NVPA 2A75A 2CAVA 1KQRA 1WW7A 4WM7A 5I0UA 3NAPA 3GALA 4LO5B 2PHWA 1GICA 1PGL1 2PHUA 4QMAA 2ZJCA 5C8CA 4FBFA 1AUYA 2GNBA 5T3NA 5BNPB 2WT2A 5J3UA 1RL3A 5HI0A 4YSFA 4K21A 4P9WA 5T52A 1PIV1 3N4MA 3N3HA 3O0XA 3CJIB 5AVPA 1OPMA 3E6CC 2WNVA 5BNOC 3V0AB 3KM5A 2ZGRA 1V9U3 2D93A 2O8QA 2ZHLA 3WW1A 4IEYA 1OQEA 2HJIA 2VPVA 2D3PA 2FZ2A 3T1LA 2O1QA 2VQAA 3UKNA 2ZX3A 3ZSKA 3RYKA 2VW2A 3ZFGC 1ASJ1 2GALA 1ENQA 2XH6A 2TNFA 4BH9A 4DPNA 5FBZA 2ZZJA 4IESA 5DZEA 3ZFEC 1AZDA 4YGEA 4N43C 3BIWE 3AZWA 3AYEA 4N7UA 1BBT1 3FC0A 4LHLA 1DZQA 4FO9A 3W9AA 2ZGMA 4I0BA 4LBOA 4IQPA 3PVOA 1MS9A 3WP5A 3WV6A 2HEWF 2V5YA 3S7EA 4MGIE 1AVBA 4XJWA 2UWCA 1N1SA 4YVSA 4EJRA 5KBFA 4IXLA 3AKSA 4XXAA 1S2KA 1AL0G 1DU3D 5IT6A 3KS7A 1POV3 2ZPXA 2PELA 2OPKA 2PHDA 4HBNA 2MHFA 4WVZA 1V6KA 3Q9OA 3E5QA 4AVAA 4A3XA 4EWAA 3WLUA 5T5OA 1VBB2 4ZU5A 3VL9A 5K7PA 4HVOA 1C57A 1K5MC 1WCDJ 3VDDB 1UF2C 2DFBA 2OA2A 2JG9C 3VBUA 4CDUA 1TQ5A 1QDCA 4F7ZA 1FYUA 4D94A 1IKPA 1WD3A 1D4M2 4IEQA 5A33A 1VBA2 2VNGA