2H0BA

Crystal structure of the second lns/lg domain from neurexin 1 alpha
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
181
Chain Sequence
EEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurexin-1-alpha
publication title Crystal Structure of the Second LNS/LG Domain from Neurexin 1{alpha}: Ca2+ binding and the effects of alternative splicing
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion
total genus 39
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h0bA00
1LESA 2TEPA 1Q8OA 1KJRA 1V6IA 1CPNA 3MW2A 4XYXA 2RHPA 1DYPA 3WHTA 3UJQA 1YRZA 1DQ5A 2D6KA 2ZGKA 3NWKA 3ILFA 1OQ1A 2ENRA 3IM0A 3NV2A 3R4SA 4XILA 5CNAA 4FOWA 2WT2A 2W08A 3O12A 4YW4A 2GMEA 5DUVA 2ZGQA 1IS4A 1G9BA 5JOWA 2YXSA 4U36A 4AGGA 5SV8A 3WDTA 3AZXA 2C5DA 4YZ3A 5CA6A 3ZYPA 4W65A 4K1YA 1W6NA 3AP9A 4HANA 5H9SA 4NOTA 1F9KA 1S1AA 4M3CA 5IK7A 5KXDA 4FPYA 1AF9A 3ILNA 3ZSMA 3ZXJA 2PHWA 3JUUA 1SBFA 2EXJA 2ZABA 4R9DA 1V6LA 4FPKA 1ZM1A 2A6VA 4XJUA 5L73A 3OY8B 3ZXKA 1BQPA 2Q5TA 1JN2P 3JU9A 4XBLA 5T5LA 5LK5A 4FQZA 1CIWA 1ULFA 2UWBA 1LHNA 4ZKTB 1URXA 1HQWA 4YG6A 3ATGA 1AJKA 1IS5A 1GKBA 1G9CA 2A7AA 3RG0A 4CTEA 2CTVA 5JMCA 5HCBA 3KQRA 4BMBA 2D44A 2DVDA 1ZA4A 4YG3A 4PBOA 3ENRA 2WT1A 2NZ9A 4Y1UA 3OPZA 5GJ6A 4M3CE 3SLIA 3AYCA 4XIOA 1GYKA 4XJWA 5DZFA 1AXKA 3O0WA 4CZSA 1S0JA 1QDOA 1AZDA 2WLQA 3WDWA 1S0IA 5GLUA 1WBLA 1GBGA 2NMNA 1DLLA 1N1YA 2CL2A 3FFZA 3IPVA 4HL0A 1GSLA 2G4IA 4YFZA 1BKZA 1AVBA 4XXPA 1LGNA 5JOXA 3VKMA 3BIWE 1CONA 1PZ7A 2W52A 3HMYA 1CJPA 1N47A 2D6NA 1LOAA 1MS5A 1W6QB 3PVEA 3W58A 4Q1PA 2V73A 1AJOA 4YZ4A 3V65A 4YFWA 5KXCA 2ZMLA 2ZHKA 3ZVXA 4DPNA 1MR5A 1G9FA 1WLDA 1WW5A 2DVAA 4PQ9A 4FOQA 5E8AA 3RQ0A 3WG3A 2DU0A 1LTEA 4FPFA 4MYEA 4XHXA 5BYNA 1CQ9A 4ASMB 1I1EA 3ZSJA 2DURA 4P9YA 1QOSA 5IUQA 2JD4A 1Z0HA 5HCAA 1N1SA 3UK9A 1KQRA 1G7YA 4XIKA 3ZXFA 1YXWA 2D7FA 4GWMA 2EXIA 1O4YA 2A6WA 4XDQA 3UJOA 2YV8A 4FPOB 4LBLA 2AUYA 4BOWA 2DUOA 1UZZA 1ENSA 3LCPA 2GNBA 5JLVA 5DZGA 4AGRA 2D6MA 3R4UA 5KXBA 1MS8A 5DZEA 1F5FA 2ERFA 4Z8BA 4F83A 3FLPA 3APBA 1SLLA 1V6MA 1U0AA 2WJSA 4TYSA 1QF3A 2ZGNA 4FP2A 2VUAA 4NO4A 2UU8A 3ZXEA 3WG1A 1EPWA 3OBTA 4YM0A 4PBPA 2GDFA 3O5SA 1MS4A 1NLSA 4IQPA 5GLWA 2LTNA 1ENQA 2ZGPA 5DG1A 4PF5A 1MS3A 1GZWB 4DS0A 4XBNA 1Q56A 1MZ5A 1S0DA 3IMNA 1W6QA 2OW4A 1FV2A 3RSJA 1GICA 2D6OX 1ULCA 3POSA 4PCRA 1APNA 2ZHMA 3FUQA 1SCSA 1R1ZA 3NV3A 1UL9A 2PHUA 3M3OA 4BLJA 5CBLA 4RA0A 2BQPA 3B01A 4FPEA 1C1LA 3WDVA 4FOYA 2E51A 1SACA 2DU1A 3INAA 3N7KA 3AP4A 1SLIA 1CN1A 1Q8VA 3POWA 2ZGOA 1DIWA 1F31A 2ARXA 1LGCA 3AJYA 1GV9A 3M3EA 4M00A 4ATEA 4JC1A 4YGDA 4FP3A 5T52A 4C1WA 1CVNA 2V5YA 3AYAA 1ULDA 3FLTA 4GXLA 1LU1A 4FPJA 3TB0A 4U2AA 1FNZA 1FV3A 2DWRA 1MACA 2OUJA 2PELA 1S0EA 2PHFA 3OJBA 2P3KA 2E7QA 4UW6A 4ATFA 5T5OA 2P3JA 4RL7A 3V64A 4XZPA 1W6OB 2C9AA 2ZACA 4Q27A 2A70A 2A75A 2UURA 5E88A 2JDZA 4GWNA 3N7JA 3RS6A 3ZYRA 4YM2A 2NP0A 1BJQA 1LOFC 1YI7A 2NYYA 3C2UA 3PVOA 4Q1RA 1GZWA 1GNZA 2GALA 1W6PA 1LHVA 1LJ7A 3GALA 3I4IA 2A3XA 1TEIA 4XMIA 2EAKA 2CNAA 4Y22A 1AX0A 3UL2A 1GZCA 4ZXKA 1FYUA 1S0FA 3FLRA 2GMPA 4LBQB 2DYCA 1DBNA 3OBRA 1GANA 1LENA 1DQ4A 5FREA 3WV6A 1GNHA 2R1BA 1YYNA 5DUXA 4XMAA 4UW3A 2YY1A 4AVTA 3WZ1A 1DQ0A 1YIFA 4R9BA 3V0BB 2DVBA 4H55A 4DFSA 3SH5A 3I8TA 3FUOA 2R0HA 4FOVA 3HN1A 3M1HA 4AYUA 1SLTA 4K20A 2UWAA 3ZSLA 4WVVA 1SFYA 5AVAA 5T5PA 3AP7A 4FPHA 2NN8A 3OYWB 4Y1ZA 5GZFA 1MVQA 2VW1A 2A6XA 3WCRA 2ZHLA 2AREA 3BTAA 3N3HA 2JECA 1LU2A 2DTWA 1SBEA 2A6YA 3VKNA 1GZ9A 4C1XA 1VALA 1WW6A 1W6MB 2AGSA 3BODA 3VKOA 4FPCA 3AZZA 1DQ2A 1UN1A 2A6ZA 1FNYA 1LCLA 1PZ8A 4FQ4A 3WCSA 3BOPA 1W6OA 2ZMKA 2YMZA 2ZGMA 1WUVA 4XE9A 4XJZA 1WBFA 1A8DA 1JBCA 3ILRA 1AX2A 1RIRA 1D2SA 4XTMA 5DUWA 3OY8A 2ES3A 1FATA 4KBBA 1RITA 4Y26A 5F9TA 4LBQA 1QDCA 3WDYA 3V0AB 3MEPA 4DQAA 5CB7A 2VW0A 3OGGA 4AVVA 3IN9A 4YZ2A 2OVUA 1VLNA 2ZGUA 3HR9A 3VKFC 1DHKB 3KM5A 3V0BA 3T1LA 2A3YA 4YZ1A 2ZGRA 3M3CA 2P34A 1LOGA 4BQ1A 4Q26A 1JUIA 1WD3A 4YW3A 1Q8PA 1IS3A 1QKQA 1UMZA 1AX1A 2VH9A 4K21A 5IK8A 1UZYA 1D0HA 5JDBA 2DV9A 4LBOA 1FX5A 1UX6A 4DRVA 1LHOA 1S0CA 2JKBA 1DQ6A 3WVJA 5E89A 4BPZA 1KDMA 1Q8QA 3N7LA 5H9QA 3WNXA 5GZEA 5T50A 3SNMA 5GZCA 4JCKA 2A5ZA 3M3QA 4LBMA 2EIGA 5GLTA 1DFQA 1JHNA 2R49A 2LALA 4FPLA 2ZHNA 5EXOA 1N1TA 2DVGA 4P9WA 3D6EA 5JOZA 2DUPA 3A0NA 2P2KA 3AZVA 1DZQA 3RMYA 4YGBA 1ULEA 2D6LX 1HDKA 4YW2A 1H30A 1V6KA 2YZ4A 3RMXA 4XJAA 4Y20B 1V00A 2B7YA 1C4RA 2D3SA 1IOAA 1V6OA 1WCSA 2CY6A 4XTPA 4R9CA 1S0GA 3A4UA 1KRIA 2XB6C 5GLZA 3WDUA 4LBKA 2WKKA 3N7MA 3AX4A 2AH2A 4ISQA 2DVFA 4M3CB 1A78A 2ZAAA 1O4ZA 4JRAA 1OFSA 1SLAA 3R05A 4YM1A 1ONAA 3W59A 5FRAA 3WG2A 4XXAA 1KITA 2R16A 3LSDA 3AFKA 3B69A 4XOGA 4WVWA 2Z42A 4XHBA 4XJ8A 1WD4A 3SH4A 2KM2A 1LEDA 2ZMNA 1W0PA 4LBJA 1IKPA 1HKDA 3AYEA 3MW3A 5IK5A 2ZGTA 3WOGA 1Z78A 1LHWA 1SLCA 1BYHA 2CYFA 2PHRA 3GNEA 3QLQA 3A0KA 4P14A 4AVSA 1CESA 3D4KA 3AP6A 1LGBA 4YG0A 4YGEA 4CRQA 3VKLA 1G9AA 1NXD1 3WUCA 1AXZA 1JXNA 3AP5A 2E53A 3B00A 2H0BA 3AJZA 2OUHA 2A71A 5GZDA 4GA9A 1DYKA 2D3PA 3VV1A 1QOTA 1FAYA 4Y20A 5DUUA 2ZZJA 5DG2A 3B9CA 2JE7A 1PZ9A 3TAYA 1WLWA 5DXDA 4AGVA 3N35A 3IPVB 1LOBA 3B3QE 3AZYA 5H9RA 4K1ZA 5T54A 1UAIA 2D6PA 2VXRA 2AENA 3VUOA 1MS9A 3ZXLA 1LOFA 2JJ6A 4P9XA 3SH3A 1V6JA 5CAZA 4OZXA 3M2MA 1QNYA 1W0OA 1BZWA 1LECA 1QNWA 2JE9A 1H9PA 2WSUA 3ZSKA 2FHRA 1AXYA 1ENRA 3MW4A 2CWSA 1VAVA 2FMDA 3SISA 1H9WA 4FVVA 2EXHA 2GNMA 1GLHA 1QU0A 2W68A 3USUB 3CNAA 2PHXA 1LODA 1UKGA 1Y7BA 3L2YA 1CPMA 5KXEA 1N3QA 1LOCA 4YW1A 3RRDA 1MVEA 5IT6A 1A3KA 2WSVA 4Q2FA 3WDXA 1JOJA 5GM0A 4WZFA 4YM3A 5JOYA 2GNTA 4Y1VA 3LSEA 4D69A 4L8QA 1LOEA 1MZ6A 2P3IA 3NV1A 4LBNA 1N3PA 2GMMA 3AXEA 4XJ9A 1LHUA 1WLCA 1X50A 2VW2A 3T1MA 4M3CF 1XQNA 1JYIA 2E7TA 2UWCA 2ZA9A 2D43A 3PJQA 3AYDA 3POYA 3WUDA 4M01A 1KJLA 2WT0A 5IK4A 2GN7A 4Q8LA 2NMOA 3FBYA 4WV8A 2HYKA 1LEMA 1RINA 2D3RA 1JW6A 5JVVA 3O0VA 1Q8SA 3AZWA 3N36A 1I3HA 4I30A 1IKQA 3PVNA 3SITA 1MS0A 1QGLA 2E6VA 1HQLA 2P37A 4BM8A 1HLCA 1LULA 4R9AA 4TZDA 3ASIA 4YLZA 2PHTA 2CWMA 3WHUA 4DRRA 1VIWB 3DUIA 4Q8KA 2EXKA 4YW5A 3OYWA 2W39A 3ZPYA 3U4XA 3USUA 3T2TA 4ISRA 4Y1XA 1QOOA 1B09A 2ZKNA 5EWSA 1WW7A 1SBDA 5EYYA 5GLVA 1W6MA 2AYHA 5T55A 2GNDA 3IKWA 1QMJA 4UW5A 2DTYA 2YROA 5F5QA 1DGLA 1V6NA 3QCWA 5GZGA 3O0XA 3WLUA 2ARBA 2WQZC 1C57A 4GALA 2A3WA 1SCRA 1DQ1A 1N3OA 2NM1A 4GKXA 2I2SA 3AXDA 2EALA 1J1TA 4UW4A 1BXHA 2XG3A 5H9PA 1VAMA 2VY0A 4Y1YA 3AK0A 3NV4A 1W6NB 3Q9OA 3V0AA 2R1DA 2SBAA 3DGTA 1S0BA 4Y24A 1ULGA 4BLIA 2VU9A 4AWDA 2WNEA 1C1FA 1MS1A 1IS6A 3D5OA 4ITCA 3WG4A 5HCFA 1W6PB 4YGCA 2GN3A 2SLIA 4SLIA 4Y22B 5GALA 1OKQA 1G8WA 2ZGLA 1SLBA 1G9DA 2R0FA 1YO8A 2DUQA 1G86A 2AR6A 5T5JA 4YZ5A 1CR7A 3H0OA 2EF6A 2ZBJA 4GKYA 4LBQD 3PMEA 4XBQA 4BMEA 1N1VA 1JYCA 3MPPG 1KDKA 2ZGSA 1UPSA 4FPGA 1WW4A 5EYXA
chains in the Genus database with same CATH superfamily
4CEWC 3WX5A 1LESA 3PVBB 3K2OA 2PA7A 3O14A 4AEMA 3UJQA 4LORA 4CU8A 4ES9A 1VBC3 3RPQA 3NWKA 3R4SA 5CZKA 3RGBA 2DBIA 2ENRA 3JQWA 3KZ4C 3NV2A 4HPKA 4LTAA 3W21A 4OHXA 5I8SA 3JBG1 4FOWA 4YVWA 1H4HA 5LCWL 4UWDA 2V5DA 2W08A 1OBNA 4SBVA 5D8AB 1W04A 5DUVA 3RFRA 2PFWA 1PGL2 4AGGA 3WDTA 4YZ3A 2C5DA 4W65A 3POEA 3NJXA 1JZ2A 2HWC2 1VBB3 3U07A 3ZOIA 5IK7A 1F9KA 2Y6GA 4M3CA 5K0UA 1HXS2 4BIOA 1WCKA 4GIQA 2PHWA 1BCXA 3KLSA 2WNVC 1IZ3A 3N9PA 5FZDA 4R9DA 2ZEZA 4Q0VA 4QPYA 1IQDC 1UPIA 3OY8B 1BVVA 1NE6A 4QQHA 1BQPA 5LY1A 3K75B 3GZAA 3I59B 4JKKA 4TLGA 2HWE3 1LHNA 1S2KA 1PGW1 1E5HA 1RUI3 2Q1MA 2RG4A 1H2NA 5CYYA 1IS5A 1GKBA 3A22A 2CTVA 5BNPA 4CDUB 5JMCA 3MBWA 3ZN4A 4Q4W2 4FTBA 4QD2A 1A6CA 4BISA 2WT1A 1SHWB 1QJY2 5JZGB 5A7PA 2NZ9A 4MADA 2K9ZA 3AYCA 4RR3C 4DXTA 2VMCA 4XIOA 3GJAA 1VB4A 4CZSA 5C8CA 1AZDA 2WWSA 1N1YA 4IESA 1EUUA 3VDCA 1GSLA 1E57A 4HETA 3HQUA 5A3MA 4M4RA 1HRV2 5DDJ3 1CONA 1ZRRA 3HMYA 3UYJA 5A3WA 1N47A 1US3A 2HBTA 2D6NA 1MS5A 1W6QB 5F2WA 2X5IC 5FY0A 4Q1PA 1AJOA 1NXMA 4RHV2 1W3VA 2BVVA 2B42B 4FAGA 2E33A 1MR5A 1G9FA 2RM23 4PIYA 4UOJA 5FZLA 4FOQA 4DPNA 2DU0A 4FPFA 4HMZA 4MYEA 2BFUL 2GP5A 4QKFA 2WS91 4E4ZA 4MHUA 4P9YA 2PAMA 2WUHA 1DGRN 2WFF1 1Z0HA 5IUQA 3UK9A 1H1IA 2VQAA 4XIKA 4LOSA 1YXWA 2R042 1O4YA 4BWOA 4CU7A 2A6WA 5FYSA 4FPOB 1XE7A 4WM7A 1UZZA 1T6BX 5JLVA 4AGRA 4NRPA 4L99A 1MS8A 2F17A 1X8MA 2ERFA 3NKGA 2R32A 1AYM3 2RS12 2WQ8A 3CDZB 4TYSA 4N43A 1QJZA 1S55A 2VUAA 1AR92 4FP2A 4LK7A 4LUMA 4XABA 2GDFA 2GSYA 3O5SA 5LA0A 2E7AA 4XAAA 4Q4Y1 1GUIA 4NAMA 2O14A 3NMBA 5FYBA 4AFCA 1NUKA 2R30A 5DG1A 4B7EA 2ORXA 2PXJA 1OURA 5EP9A 4V1PA 4BHPA 3LA2A 2FZ2A 5FY7A 3KGZA 2WL1A 3DXUA 3VZNA 1ULCA 2W2IA 1APNA 2ZHMA 4KBZA 2E63A 1ASJ3 1RUD2 5E1RA 5C3QA 1YQ6A 2PYTA 4X6QB 1SCSA 5FY4A 4FBFA 1R1ZA 4YARA 3NNLA 5A3UA 3HJRA 3A21A 2VECA 4JGZB 1UKRA 2RMU1 1NA1C 1ZNPA 3B01A 4NHMA 1C1LA 1XNKA 3KCYA 3WDVA 2P6CA 1AHSA 2ZS6B 3B94A 1VR3A 2VL4A 3INAA 4IERA 4RQPC 5LZ6A 1SLIA 5M0TA 5LASA 1R091 4B4PA 2ZGOA 2AEZA 4JDOA 1LGCA 3M3EA 2HH9A 4M00A 2OXBA 3S57A 4F8AA 1QJX1 2C9KA 2WDBA 1ULDA 3FLTA 2RS31 1LU1A 2YB7A 3TB0A 5JUVA 1Y4WA 4GB31 5FZ6A 3H3LA 4ONUA 3E6BA 1FV3A 1QQP2 2DWRA 2PELA 2PHFA 2WIIB 1BBT1 3OJBA 1FPN1 2P3KA 4HBNA 4I0WB 4ASKA 1SQ4A 2ZXQA 4FO9A 3VBOC 4Q27A 2A1XA 2ZACA 3R4DB 3RNSA 1O59A 3DKQA 4DUWA 5JXHA 5IVFA 4RR3B 4IUGA 3OUHA 3RZZA 3C2UA 3DXTA 1TVGA 4H2AA 4QXHA 4RYDA 1PIV2 4CXYA 2GALA 1PO22 3GALA 3WQBA 3WF0A 5LWBA 4KGGA 1UY4A 3WNNA 5FXZA 2YU2A 3BUCA 1XB9A 2GMPA 5FR3A 5IATA 1GANA 2ORZA 3WV6A 5DUXA 4R52A 3NSTA 2Z5WA 4XMAA 2ZX1A 3DPRA 4UW3A 1YUDA 2YY1A 1X9TA 5FY5A 3KWVA 2CU5A 1YIFA 2VZVA 4HLTA 3WZ1A 2DVBA 5FKBA 4HVQA 1HXS3 2QJVA 3TN91 1JZ4A 2RVAA 4WZCA 2BERA 1JYVA 3FUOA 2R0HA 5EFUA 3EJKA 2JDNA 1S2EA 2QQVA 1IHMA 4K20A 3ZSLA 4WVVA 5FZ3A 4BB3A 5AVAA 2BBAA 5I8YA 4CE8A 2WNUB 3AC0A 2VVDA 4FPHA 3CIHA 4AR2A 1EV12 2Z2SB 3VDDB 3VBHB 3POIA 5EJ1B 1SFPA 2VW1A 5FLJA 2W92A 1POQA 1XBFA 4Y5SA 2AREA 3GZEA 4CCDA 1KEXA 1W9WA 3ACGA 4JAAA 1JZ6A 3CZJA 2XBO3 4COWA 4YWAA 3CL1A 4D6QA 2D98A 1SG3A 4LKEA 2DF7A 3VHOA 4XFCA 2P4EA 2Z69A 1W6OA 5ANNA 4BQWA 3LEKA 3UKTA 4D3WA 4EWEA 3U11A 2PLV1 2ZX0A 5JSPA 2XL7A 3DN7A 1A8DA 5FUIA 1L7RA 1ZX5A 1B35C 5FP8A 3H7JA 1EAH2 2ZZQA 1JYXA 1FATA 4KBBA 2HKXA 4Y26A 5F9TA 1QDCA 3AKTA 3V0AB 2WZR3 3IIAA 1RHI3 3NW4A 3OGGA 3IN9A 2YGLA 4AW7A 2ZGUA 1HRV3 3HR9A 3KM5A 3EXUA 4BA6A 4JRLA 3AKRA 1C5HA 5A32A 3O1TA 2V72A 2XJUA 4QPWA 1H6YA 4Q26A 5ACA3 1WD3A 3POJA 5JI7A 3ES1A 1PM7A 1IS3A 4K21A 1AX1A 1GOHA 2OZJA 1GOFA 1UZYA 2LRPA 5JDBA 5IK8A 2XMLA 1FX5A 2WZEA 1RUH1 2XVKA 4KWKA 3I49A 1KFXL 3I7DA 1C8M1 5HBAA 2XLGA 3HD8B 1GMMA 3ABZA 1YJKA 2JE8A 4BPZA 5TSWA 3ZYGA 1UOFA 2G19A 3OOXA 3M4FA 3N7LA 4AVBA 5C4WB 4I09A 4IEVA 1VRBA 4XUNA 5FV3A 5T50A 5GZCA 1POV1 4NWVA 1DFQA 4QPGB 4EYUA 1NZIA 4FPLA 1RVF1 4IV3B 4A42A 1WZXA 5FOBB 1VBE3 5J48A 1DZQA 3Q8AA 3RMYA 1ULEA 3ZFEA 2YFUA 1VBC1 1FMD2 2WINB 2VQTA 2H6CA 1J58A 3RMXA 4HVRA 4XJAA 4Y20B 1V00A 3O1RA 3UGHA 2ATFA 2LS6A 3PMSA 5FMBA 4AEDC 3KMHA 3WP6A 2P1BA 3A4UA 3LE0A 3I3BA 3WDUA 2WKKA 4UFLA 2AH2A 1FOD3 4DY5A 3RWNA 2DVFA 4XC9A 4M4PA 5FPZA 4M3CB 5K0UB 4EN8B 2EIEA 2W1SA 1VBB1 2ZAAA 5FRAA 1GQPA 3WG2A 1JTZX 3LF7A 3DCQA 1W99A 2H0VA 3LSDA 3B69A 4UI9L 4FFFA 5IVEA 3H8RA 4KU8A 4XHBA 2BWCA 3SH4A 4NUBA 2IC1A 4ZU5A 5FPBA 4LBJA 5F37A 1IKPA 2QFEA 3I3MA 5IK5A 3GDBA 2B45X 2HWE1 3VD3A 5FP4A 1LHWA 4WM8A 4CUCA 5A3TA 4R4XA 5C3RA 3LEMA 1RUI1 3IDCB 5BNPB 3WNKA 1TG7A 4BIFA 1QHDA 3VHRA 1O5UA 1XC6A 4P5YA 2DCZA 3H7YA 1JZ8A 3AJZA 2OUHA 4CPBA 3N4MA 5GZDA 1RUJ3 3U14A 2D93A 2D3PA 4EN6B 3CJIC 3VV1A 4C8DA 2XH6A 1QOTA 3NNMA 3TEYA 5BPXA 4QB6A 1PVXA 1QQP3 4OHWA 1JZ5A 1PZ9A 3TAYA 3C7OA 4AGVA 2HJIA 3T0DA 3ZYIB 4MO3M 4QHZA 3B3QE 1ODMA 1W05A 2BNNA 5T54A 1UAIA 2VXRA 2BUKA 3PU8A 4YYOA 2AENA 3VZMA 1YLLA 1LOFA 2UY9A 2GC0A 2E9QA 2CDPA 2IFRA 4OCTA 4QPIC 3UETA 3NL1A 5DDJ1 3HWJA 1PO23 2O8QA 2YBPA 5FYUA 2HYXA 2GC1A 2IXHA 3RYKA 3T4VA 3ZSKA 1JYWA 2FHRA 4JTOA 5E6HA 4BQYA 1VAVA 3SISA 4FVVA 4QQLA 1OF4A 4K6BA 3NAPC 4RGKA 1VP6A 2ZEXA 2PHXA 2X53S 2RM21 2VNGA 4WVMB 1RUE3 4YW1A 4CVUA 2B8MA 2WSVA 4QHOA 4ZY9A 3THDA 5FZ9A 5GM0A 4OI2A 5JOYA 4XVHA 5FZIA 4QKBA 5LK7B 3RZLA 3B5LB 3IDAA 3KSCA 4Q0QA 1TZOA 3GF6A 1EV13 4P9IA 2JDMA 3VBUC 3LDBA 4M3CF 1XQNA 2WO3A 3E5XA 3PJQA 3AYDA 3SKJE 1KJLA 4IEXA 3LB9A 1AYM1 1ENXA 5EPAA 4G4FA 4MX3A 4XW3A 5IK4A 4I2OA 4MOAA 2DBNA 5F32A 4F7ZA 3OCPA 3ACHA 3N36A 3AZWA 2WZPP 2NP0A 4I30A 3X29B 1VPHA 5FY9A 5LATA 3JB8A 2QCSB 1EUTA 1CZTA 1UOGA 2BEOA 3MUZ1 3OD0A 5DAQA 5EZWA 3W9AA 4XFBA 3KVAA 1RMU3 5IFPA 5CG9A 1ULPA 5GKAC 1Y9GA 3D8CA 1ST8A 1CAUA 2V4AA 4H14A 3UKNA 4ARXA 3HQRA 4Q8KA 4YW5A 3ZPYA 3OYWA 3KVBA 4EZHA 2RDNA 2VTFA 4ISRA 1LR5A 1QOOA 2ET7A 3CQOA 1ASJ1 4PJYA 1SBDA 1VRH3 3HEIA 4QGLA 2PAKA 3IAPA 2VBDA 2AYHA 4XUPA 4CDXC 5KC6A 2GNDA 4XF1A 2FBEA 1DGLA 1V6NA 2BWAA 1JS9A 3I2DA 2O8OA 2B9VA 1UD1A 1KD7A 4BQ4A 3I2IA 5JMOA 2BJSA 2ARBA 1OVSA 2WQZC 4AFAA 1UOJA 5C9AC 3ALQA 1O7FA 3OSDA 5FXWA 1JU4A 2V4VA 1WLTA 2YC4A 1JZ3A 3OUIA 1SPPA 5DAPA 4NPRA 3MZHA 1CGPA 1J1TA 1BXHA 4PIXA 1PM4A 2GH8A 2CV6A 1AYN3 1VAMA 5H9PA 4CCLA 4Y1YA 2E31A 2WZ8A 3ZO0B 3VZKA 1O4TA 3Q8FA 2R1DA 4LK6A 4HZFA 4CEYA 2IWGB 1S0BA 4Y24A 3ZN6A 1C3HA 1ULGA 4BLIA 4AWDA 3CEWA 3LIHA 1FMD3 1PO12 2WBKA 4D0QA 1MS1A 1UMHA 4GMP3 1JOBA 4ITCA 4LEJA 1CAWB 1MQTC 2Y64A 4SLIA 1CAXA 5GALA 3WXPA 4E9KA 1UZ0A 1YFXA 4XCBA 4CDQC 1G9DA 3RZMA 2R0FA 4PHZA 3LOBA 1V70A 1H8TB 2AR6A 3NKTA 4YZ5A 2YGMA 2EF6A 4KI5M 3S30A 5ABJA 1PGL1 5FPXA 4BMEA 3ZSEA 4A2UA 1N1VA 3HPNA 2Q8OA 1ZRFA 4FSJA 4IE0A 4W50A 4FPGA 1WW4A 4B8EA 5A7WA 3ZFFC 4Q0PA 1HXS1 5C5TA 4PLNA 2XL9A 1V6IA 2J7MA 1HB3A 1RUOA 1DYPA 3WHTA 3RZHA 3NAPB 1O91A 1DQ5A 3VBSA 2XJSA 2Y60A 2EIDA 2VUJA 3OUJA 5CNAA 3TBDA 1O5LA 1OF3A 2WT2A 3I2FA 3IBMA 5BNQA 4I02A 5FK7A 2IXJA 3L9JT 2GC3A 2R062 4N53B 5L7OC 5D1IA 4YW4A 5HV4A 2W1WA 3MI8A 1XYOA 3K4DA 3WT3A 3J7LA 3N9NA 4CEWA 2XBO1 4G9SB 4U36A 5CA6A 2RDRA 3ZYJB 3VBUB 1W6NA 5H9SA 1QXJA 1BK0A 5FLHA 2JX9A 4Q4X2 2OX0A 1S1AA 1OI6A 1AL21 2GAUA 5KXDA 1AF9A 1UX7A 1UXXX 3T3YA 5FZFA 1GNYA 3JUUA 3V56A 1BMV1 2MNGA 2Y8KA 1COV2 4KMQA 4FPKA 4P9LA 1UW8A 2XJRA 3MDPA 4PDWC 1FI2A 2Q5TA 1ND3A 1H2KA 3JU9A 5T5LA 5ISLA 4OMCA 1DZTA 3H9AA 1AR82 1SDDB 1CIWA 2MEV1 2UWBA 1HRI3 4MGKE 4ZKTB 1DGWX 5FFOC 4A3XA 4HONA 4CCMA 5BNOA 4LXLA 2WZR1 4MGYE 5AVPA 4YG6A 1RHI1 3ZYRA 3LQCA 4C0BA 3QH6A 2W3JA 5FCCA 1G9CA 1HRV1 1UWWA 4PLOA 3OBAA 1EPZA 5D8AC 5LRSA 4COZA 1M4WA 2K0GA 5HCBA 4XACA 5FZKA 4BMBA 1K5MC 1TNRA 5ACA1 4LHSA 3I97A 1RJ8A 1BEV2 1NCQB 4FI9A 5FP9A 3OPZA 1D0GA 4M3CE 1ZRDA 3SLIA 4DO0A 1MEC3 1XPWA 5IAXA 1VMHA 5J36A 3E6DA 3POBA 3GZTB 4XJWA 3O1PA 2QQIA 1AXKA 1J59A 1QDOA 4FCAA 1CZVA 4EWDA 4NPLA 3WDWA 1S0IA 1HV0A 1NLQA 1WBLA 5C5UA 3FFZA 4HL0A 1ZYBA 4LKDA 4HOOA 1FT9A 2G4IA 3ZMOA 1W8WA 5C9AB 4ZXEA 1LGNA 2X05A 2C1FA 3VKMA 3BIWE 2VZRA 4H7MA 4I0BA 3E97A 1W8UA 3WINE 1VBE1 3DF0A 2KA3A 4NROA 4NR1A 5IAVA 4NHXA 4CP9A 1A34A 1PVC2 1PNGA 2V73A 2WWJA 3R0RA 3H1YA 4LHKA 4CDUC 4YFWA 5KXCA 4H3WA 3WG3A 1WW5A 2DVAA 4IE7A 5CKQA 5JI9A 4IEPA 2UYAA 2VMFA 4XHXA 3JXSA 3RQ0A 5JZGC 5DQ0A 1GP6A 3OPTA 3N9LA 4HSJA 2RJLA 1FOD1 2JD4A 2WWUA 2YU1A 5J96B 1G7YA 1MZEA 2EXIA 3IZOA 1H8VA 1LNSA 4NIHA 2YV8A 1AR72 5F1RA 3AMMA 2WA3A 1W03A 3I54A 1F5FA 2VOKA 5FPVA 1YFWA 4Q4V2 2WYFA 2QQPA 5LBFA 5CKMA 4Z8BA 3FBMA 1OH4A 2QVSB 5HXVA 2WN3A 3FLPA 3TNPB 1SLLA 2VOXA 4WM8B 2WJSA 4QQ2A 3NVCA 2QQUA 2RDQA 4LITA 3WG1A 4X8PA 4L9BA 4YM0A 2RJ2A 2V09A 5JR7B 4A3ZA 1PNFA 4OVEA 4ES8A 1NLSA 1OPOA 4AAXA 3CZUA 2LTNA 1UYXA 3OGVA 1W2TA 4BQ3A 3JD73 4RGGA 2W1QA 3E1F1 1UNBA 2W46A 2WRAA 3ZFGA 4JDNA 1UYYA 1QXRA 1RUJ1 3HBZA 1MZ5A 1S0DA 1DP0A 4UF0A 1FV2A 2FQPA 1GICA 3POSA 3MGUA 5B2GB 1QQP1 3ETQA 1IPSA 2ET1A 2LUWA 3FUQA 1UCXA 5JIAA 4PI0A 2PHUA 3ZYFA 5CFDB 4JGYA 4D7YA 1PO13 4RA0A 2BQPA 5BXXA 1H4GA 1UQXA 3KV9A 3UGGA 4PDWB 3U75A 3N7KA 3AP4A 3E5UA 2N7GA 1OOPA 3L2HA 1W0NA 1PO21 4J25A 5FPAA 1L3JA 1ZA7A 4EZ4A 5JPMB 1ZBA3 4AQSA 3ZLIA 5JAXA 4OQ8A 2OPWA 4YGDA 2G1MA 3LDRA 3VL8A 2ZPXA 1RUG2 1UIKA 5LW9A 4UYBA 1JYNA 5IW0A 4AK3A 1NA1A 3HVDA 3PJYA 1CAVB 1RUE1 3U1XA 3POGA 4KG0A 1K5MB 1QJFA 2P3JA 2UYBA 4QGNA 4YNIA 3THTA 5FXVA 3TEXA 4XZPA 2ZX4A 2VNRA 2ZX3A 5FBJA 2ZEWA 1QY4A 2UURA 5FDBA 2JDZA 3N7JA 3MLKA 2X09A 3PVOA 4JGZC 1EV11 3RZKA 1GZWA 1W6PA 1YEWA 1LHVA 1RUC2 3I4IA 4NAOA 1WMEA 4Y22A 1W9TA 2J42A 5JXGA 1GZCA 1OLRA 4ZXKA 1FYUA 3H42B 4QB1A 1GNHA 2R1BA 3BU0A 1W06A 1ZZ7A 3V0BB 3BPZA 4B1LA 4QKNA 3K77A 3Q8BA 4H55A 4DFSA 2XONA 3BALA 3I2KA 4HVOA 3SH5A 4DZGA 2DCKA 4E8CA 1QJU2 4V2WA 2RS52 1QH7A 3ON7A 4AZZA 1SFYA 5FYHA 3O1VA 3ZIXA 3OD4A 3AP7A 3ZYBA 5FIXA 1CAUB 1A8MA 1RMU1 4OHVA 3JCIA 4LMFA 4CSWA 3OYWB 5GZFA 4N90A 4XETA 2BYVE 3RI9A 3I2OA 2A6XA 4NIIA 3WCRA 2EVXA 4Z2AA 4PF1A 1LU2A 4OUEA 4OI0A 2B4KA 4EE2A 3LFMA 1WW6A 4LA2A 1VRH1 2R7EB 3AZZA 2PHLA 1UN1A 1LRHA 1FNYA 3MUY1 1LCLA 4BCUA 3BOPA 3ETPA 1BHGA 2NQYA 1X82A 3HQXA 2OT7A 1OXCA 5F39A 3S5AA 1JBCA 1AX2A 2PN5A 4CCJA 2Y0OA 4XFHA 1D2SA 3VN4A 2F4PA 4XTMA 2HEYF 1XNAA 1O8SA 4GQ7A 5BNNB 2WNUC 1RITA 3PIJA 5F3IA 4LBQA 4B1MA 3VBRA 4MV2A 2BNOA 2GC2A 1AYN1 3O7OA 3VDDC 4Z07A 3VBHC 3B02A 1W2AX 3ZN6B 4AI2A 1WWYA 1VBD3 2W1UA 3T1LA 4YZ1A 4CP2A 2JIGA 4RD7A 1B35A 1LOGA 1IPJA 1FMD1 1ZRIA 2IVIB 2W47A 2WA4A 1PVC3 3OG2A 4GMP1 4LKFA 4UFKA 3BU7A 4GWIA 1QKQA 1PMHX 3KHCA 2KXLA 2XUMA 4IV1A 4R8HA 1D0HA 1UX6A 2JG9A 1TQ5A 5FZGA 3WVJA 5E89A 5FKCA 3FE5A 4CCNA 4OI1A 4LR4A 5FQ0B 4OYUA 4L92A 5B4XA 2FDKA 2YPJA 3UNPA 4JCKA 1PK6B 1TMF2 1JHNA 2LALA 1ZZCA 2ZHNA 1N1TA 3P5BA 4BU2A 3A0NA 3PNAA 4CCCA 5IVYA 3VBSB 3VGIA 1POV0 1HDKA 3VD5A 4YW2A 3DYMA 3GBWA 4N7UA 4UT5A 5DMYA 3AMNA 3O1UA 1GQGA 2YZ4A 3J8F2 2P3YA 3M3IA 3MF9A 1GZTA 3T0BA 3WD5A 3ZXAC 1PHMA 2B7YA 2BU9A 1S4CA 2CAUA 3QBQA 3WF1A 2XKPA 5AC93 5C3OA 3MIDA 1V6OA 1WCSA 2CY6A 3FHQA 3KV4A 4XTPA 4OUSA 2MPFA 5GLZA 2EA7A 2J1EA 2R072 4K8RB 1V0AA 3N7MA 2B9UA 4JKMA 4JRAA 5C4WC 2EICA 1OFSA 1SLAA 3CBNA 1HJGA 3W59A 1Y3TA 3HT1A 4XXAA 4QPGC 1W8HA 3GBGA 4LHLA 1XYNA 2R16A 4E2GA 2VBBA 1XXNA 1ZBE2 2VBPA 4WVWA 1F35A 4IV3C 3C7FA 2VG9A 3AVRA 5CFCB 2C24A 1W0PA 2ZMNA 1Q5OA 4FXKB 2RR13 1UMIA 4BXSV 4CUGA 1HRI1 2Q4SA 1Z78A 4GWJA 4LE4A 1BYHA 4P14A 4YVWC 3GNEA 5A33A 3A0KA 3A23A 3RDIA 1CESA 3OBZA 3H50A 2ZOEB 4ARYA 4CRQA 4YSFA 2G9ZA 5DAXA 1GOGA 3B00A 4DY3A 4N7IA 4W6WA 2H0BA 4DUVA 5K0UC 3LDKA 3LEIA 1RUG3 2VUDA 4DB5A 4OHYA 5A7QA 1FAYA 2JEMA 1MEC1 1UXZA 1DGRA 5IVCA 1R082 3VD4A 1J84A 2JE7A 4HK9A 4AXOA 1Z7S2 4E2SA 2HWC3 2ZCWA 1LOBA 4L97A 2JDHA 3RYPA 2XUEA 4BK5A 4CU6A 3TOJA 4K1ZA 2HWB2 2AACA 3GYDA 3R6SA 4FTEA 1OUSA 1MS9A 4XQDA 4P9XA 5ERLA 5CAZA 2VCCA 3KB5A 4OZXA 3M2MA 1QNYA 1LECA 2WO1A 4OI4A 3CJIA 1JHJA 3GXUA 5F7UA 5BNPC 1DZRA 1AXYA 1ENRA 3ITQA 2CWSA 5FMDA 3BTZA 2FMDA 5J98B 2W68A 1QU0A 3JBG2 3AVSA 3IDEA 3CNAA 1D4VB 3P3PA 1LODA 3L2YA 5EV7A 1CPMA 3OB8A 1NG0A 1LOCA 2DCJA 4QPIA 4AVCA 3GBFA 4IGQA 3T2QA 5C8CC 4WZFA 2WO7A 4O9EA 5A6QA 2RS53 3LSEA 4MGSA 2FZ1A 1GWLA 4Q4W3 1JOPA 2QQLA 2YUEA 1QJY3 4L8QA 2BRTA 2W9XA 1MZ6A 2YG0A 2FDGA 1N3PA 4XJ9A 3T1MA 1LHUA 1X50A 1UU6A 4FAHA 1NCRA 1NY71 5KHGA 1JYIA 2LROA 2E7TA 3BVCA 4YVSA 1OSGA 4QQPA 3H1WA 2YFZA 3B93A 3POYA 4RFT0 5FY8A 4XUTA 4KWUA 1U5ZA 2RV9A 4DMIA 5I0TA 1K3IA 4QXCA 1UYPA 1NT0A 2Z79A 3I3QA 5JVVA 5HXMA 3O0VA 4OULA 5L36A 1W90A 2OQ7A 1I3HA 4O9GA 3SITA 1RXFA 2P37A 3ZFGB 4BM8A 1LULA 3JD71 1E5IA 1REFA 3QOPA 4RHV3 5I91A 4ZONA 2VE1A 1X33A 1WCQA 2PHTA 4ORFA 4A45A 5IYYA 2BOIA 4NPMA 2CWMA 3ACIA 3WHUA 4QX1A 5AFBA 5L19A 2PAEA 2C6SA 2VQ0A 4N9IA 3USUA 1VB2A 1VAKA 4Y1XA 1F4HA 5A7OA 3T2TA 2ZKNA 3FZ3A 4AI8A 2Y6FA 5EYYA 1V9U2 2JB8A 5FYZA 1HB1A 1F8VA 1W6MA 1H1AA 1PO11 2R043 2VOWA 3EQEA 5D21A 4N43C 3W5MA 2DTYA 3VBFA 5F5QA 5A80A 2VZOA 3ZYHA 4DUXA 2FDHA 2WAAA 4HPKB 4IE5A 3WLUA 4IETA 4BXFA 3PLQA 3C8XA 1C57A 4Q0SA 2JDYA 4GALA 4YVWB 1ZBA1 2A3WA 4EROA 1SCRA 2RS13 3WSOA 5C8WA 3ZKYA 5FWEA 5JSOA 4QAWA 1N3OA 4GKXA 5A7NA 2O1QA 1HJFA 1AR93 1RYYA 2JG8A 1OA3A 3AXDA 3ES4A 4UW4A 2XG3A 4CDXA 1K12A 1UY1A 2IFWA 2VMIA 5CEHA 3RI8A 3I3DA 3T0AA 5FMOL 2Q0AA 2WR9A 3T08A 4L0PA 4NRQA 5K4LA 4W4ZA 2WAOA 2WFF2 1ZZ6A 3WNMA 3PIGA 1R64A 1IS6A 3D5OA 2VMEA 3AL6A 1W6PB 5FXXA 2XXZA 4Y22B 4LT5A 3ZR6A 1OKQA 1G8WA 2ZGLA 4PIZA 2RE9A 1C28A 3DYOA 1YO8A 2W5FA 3KF3A 2AZ5A 1RUD3 1YC61 2ID4A 3U0ZA 3H8XA 2XHNA 1ND2A 4GKYA 3PMEA 4MG2A 1Q3EA 3FX3A 1JYCA 3MPPG 4ZU7A 5JWPA 1L7LA 1R1A2 4FFIA 3VZJA 2IXCA 1NAEA 3AKPA 4S2GA 4EWAA 1RC6A 3KT1A 3AB0A 1IQAA 1Q8OA 2Q1FA 2TEPA 1CPNA 4XYXA 2FCTA 2KR2A 2C26A 4CDQA 4D7TA 1ZBE3 1UO9A 4Q4Y2 5A6ZA 3PDQA 2D6KA 1W3XA 2WFPA 2ZGKA 1OQ1A 3ILFA 3IM0A 4IEOA 4XILA 4LOTA 4JTNA 2BGPA 3O12A 4IDZA 4M0NA 5C8CB 4E4SA 4Y3OA 4AHZA 5FK8A 2GMEA 1G9BA 3RWKX 5JOWA 2YXSA 5JXJA 3AZXA 1H8TC 4I3GA 3ZYPA 4K1YA 4HANA 1AR62 4UFHA 4NOTA 2RMU2 1W2OA 3ILNA 1PIV3 1SBFA 2ZABA 1QJEA 3B7MA 1V6LA 2BFUS 2JICA 2KD7A 5L7OA 1ZM1A 2WO2A 4XJUA 3BOWA 3OGSA 1R092 3PUAA 5IJRA 1JN2P 3J7NA 5LB6A 1CX1A 4XBLA 4A6SA 1KGYA 5LK5A 4FQZA 4CDWA 1O6UA 1ULFA 1QJX2 4GH4A 4IEUA 4XEZA 5FZHA 2RS32 2HWB3 2Q8CA 1URXA 4AHYA 4FXGB 3C7EA 3WR0A 1HQWA 2XJQA 3ZXDA 3Q8CA 3ATGA 5FZ8A 5I0UA 2A7AA 1BBT2 4IE4A 1FPN2 4N53C 2BGOA 3SEEA 4CTEA 4XQ4A 1XSRA 1VBD1 5EQUA 5I0DA 3B9IA 2VCAA 4XUQA 2BV4A 4WM7B 5KHJA 3KQRA 3BTYA 4IV1B 1ZA4A 1PVC1 3HIFA 2JG9B 5JIUA 2VVEA 3I2GA 5FYMA 5A3NA 1JH5A 1VJ2A 2PQSA 1F15A 1GYKA 2WC2A 4HFSA 2BTVC 2ARCA 5DZFA 4N43B 5HPOA 3BTXA 1X7NA 2OIIA 1S0JA 2JIJA 5D8AA 2Y38A 3GCXA 5GLUA 3O1OA 2BNMA 2CL2A 3AM2A 1XNTA 1BKZA 1OA2A 4YFZA 5B4NA 4XXPA 3TN92 3IIIA 4IW3A 5KHHA 2TBVA 1CJPA 3BGAA 2VOVA 4AFBA 1OVPA 4C91A 2QBXA 1LOAA 3W58A 1EAH3 4I0AA 3LA7A 1O3SA 4YZ4A 1W8NA 2ZHKA 2YDEA 5FBZA 3ZVXA 5AC91 2VOTA 4PQ9A 4IEQA 2VC9A 1NCQC 4CYDA 1LTEA 2W91A 4E4DX 1YFYA 4ASMB 5C71A 3ZSJA 4CA9A 4Q29A 4QXKA 4Q5OA 3ZM8A 5HCAA 1KFUL 1N1SA 1KQRA 3ZXFA 5IVVA 2D7FA 3CU7A 5F6KA 4H7LA 4XUOA 1OH3A 3NNJA 4XDQA 1F4AA 3UJOA 1NLRA 4CDUA 2AUYA 3OPWA 4BOWA 3LCPA 1TE1B 2GNBA 2PLV2 5DZGA 3R4UA 5KXBA 5CU1A 1JYTA 3PHMA 3VLBB 4AG4A 5JZGA 2E32A 2XJVA 3FJSA 3APBA 4AEJA 2RR11 1UOBA 1V6MA 1V9U3 2ZEYA 5IWFA 3U4SA 4Z1VA 3KGLA 4DNYA 4L2NA 2UU8A 3ZXEA 4KG8A 5EHDA 1T6GC 4PBPA 4P9JA 5DAWA 3ECQA 1DLCA 1MS4A 4OLLA 3H3ZA 1E5SA 1QEXA 4IQPA 1UY3A 1QWRA 1ENQA 1E5RA 5D2AA 4NHYA 4PF5A 1XU1A 2VZTA 4EQVA 4XF4A 3AKSA 5IVBA 2VZUA 1RUG1 3IMNA 4QKDA 4W6XA 1W6QA 5A1AA 3SQOA 2XOMA 4LO4B 3RSJA 3VB9A 1OLMA 4LJHA 3VZOA 2VZ1A 3SC7X 3NJVA 3DPRB 4L11A 2HWD2 4KQ7A 4CUBA 3NV3A 4DXRA 2HWC1 4XF0A 2W95A 2WFF3 2J1TA 2ZAHA 3KT4A 4WM8C 4Y5TA 3FHAA 4FOYA 5L9RA 5BY5A 2E51A 1XE8A 2DU1A 1RVF2 2GH2A 3FL7A 1F2NA 4KGQA 1CN1A 3POWA 4URAA 2ARXA 2VQUA 3AJYA 3LZZA 3U4XA 1VBC2 1XRUA 4JC1A 5T52A 2HBUA 4C1WA 1CVNA 1STMA 2V5YA 4G3YC 5LEJA 4ASLA 4GXLA 3ZX7A 1I5PA 1R1A3 4RS5A 2DDUA 4U2AA 1FNZA 1MACA 4ATFA 3HN3A 2E7QA 3SHRA 4GJYA 1YNAA 2PMWB 2Q1ZB 2QKDA 3N9MA 3V64A 1UZWA 1W6OB 2C9AA 4DXSA 4TXWA 2A70A 1J83A 4Q4Y3 2QQMA 1LB2A 1YIPA 2RS51 2FDFA 4Q4W1 3MLJA 2IXLA 4CCEA 3WW1A 1VBB2 2J1RA 4QU1A 4R4ZA 1X9PA 1QJY1 3PUQA 4XPVA 4YM2A 1BJQA 1LOFC 1RJ7A 2NYYA 2HLEA 1RUF2 4Q1RA 4YVSB 3IT8A 5DABA 2VAUA 4RSUA 2EAKA 2CNAA 1AX0A 3UL2A 4MGTA 1S0FA 3FLRA 2DYCA 1DBNA 3OBRA 4AQTA 1LENA 3ZPOA 1YYNA 3C7GA 4CCOA 1AR63 3EBRA 4J1WA 2HWE2 2VZQA 4AVTA 3PTRB 4R9BA 5C7GA 5A32B 2J1VA 2WNVA 1RUI2 4BK4A 4FOVA 3HN1A 1SLTA 1DGWA 1ZZ9A 2UWAA 2OZ6A 1OKOA 2FDIA 3H8UA 4RHV1 4DINB 2OPKA 2NN8A 2VXJA 2Y26A 4QX8A 5LBEA 3ZMNA 4INDA 3HNBM 2DCYA 4ZHNA 2CSGA 3UESA 2CDOA 4CP1A 1VBA2 3BTAA 1XOYA 1WMXA 2FMYA 1SBEA 2A6YA 4C1XA 1GZ9A 1GP4A 4XFFA 1K45A 1NQDA 1W6MB 3M8LA 4FPCA 2DCTA 4Y5Z0 2A6ZA 3H1MA 3ZDSA 3VBFB 1C5IA 2R041 3WW3A 4FQ4A 2QQWA 1W8OA 1X8EA 2YMZA 2ZGMA 2ZMKA 3ZFEB 3I2HA 1JU3A 1WUVA 3J4UH 1IG0A 4XE9A 2NPIA 4XJZA 2Q30A 4RR3A 1WBFA 3ILRA 3MFAA 4FT8A 4MSVA 4XURA 5DDJ2 1OT5A 2J22A 2LM3A 3WQ7A 2VMDA 2RS11 5FMOS 1P8JA 3U37A 1HV1A 4Y4YA 3SMHA 2ES3A 5FO9B 1H2MA 1AR91 4DEVA 3MF6A 4JX0A 3MEPA 4DQAA 5CB7A 5L9VA 2VW0A 4AVVA 2VM9A 3BN6A 1RXGA 3W5NA 3TN93 3O1MA 3NNFA 1DHKB 4NE9A 1W28A 2Z4FA 3M3CA 3EYPA 4CXXA 2X5IA 3TEZA 4CCKA 3AFGA 4YW3A 2BPA2 2Y6LA 4DRVA 1LHOA 1S0CA 2Y0IA 4HXCA 1RUD1 1W39A 1X36A 3VDDA 3VBHA 4B7KA 1KDMA 3D0JA 1Q8QA 4AF9A 1XYPA 2XGXA 5H9QA 5GZEA 3WNXA 1AYM2 4B4QA 5EJZB 3M3QA 1WMDA 2C0ZA 2EIGA 4LLOA 1GU3A 5F3EA 5GLTA 3SCFA 3THPA 5BNNC 2ZKLA 5JOZA 2XDVA 1OA4A 4KWJA 4LA3A 3S7IA 4YGBA 1ZBE1 2JD9A 3D0SA 4XZUG 5A3PA 3WNLA 2AEYA 2BVBA 4QDRA 5FZ7A 1C4RA 5CG8A 4TSVA 2D3SA 1IOAA 3LPGA 2OYZA 4O61A 5FZCA 5J1XA 1S0GA 4AI3A 4D6SA 2HWF2 1KRIA 4BE3A 4LBKA 4TTGA 2VNOA 4KU7A 1ASJ2 4ISQA 2IXIA 4XFGA 1A78A 2XJPA 4QX2A 5LEKA 1NOVA 2GU9A 4GZ9A 4OQ9A 3D82A 5IHRA 4YM1A 2BW8A 1I5ZA 5FWJA 5IVJA 1PIV1 1W9FA 1PK6C 1KITA 3KS7A 3MFCA 4S2FA 2P6HA 4XJ8A 1ULOA 4ZZ8A 1AL0G 4CDWB 2KM2A 4LQRA 2GP3A 3BB6A 5G05L 2OKXA 2HWD3 3VBSC 3AYEA 4QX0A 3KV5A 3USSA 2VNVA 1KXGA 2ADEA 3WOGA 1Q43A 2Y6HA 3EHKA 2HWB1 3QLQA 4YGEA 5FPLA 1EY2A 2JWPA 1HB4A 1QXPA 3DL3A 1TME2 1UZVA 3WP3A 4RQPA 1LGBA 4YG0A 4E8DA 4AVAA 2XR4A 3KQ4B 3VKLA 5EIYB 3MV01 1NXD1 3WUCA 4COVA 1G9AA 1AXZA 3QACA 1JXNA 4IV3A 2E53A 3BYWA 5JXIA 2XHKA 5K7PA 2R063 5ANQA 4Y20A 5DUUA 3ZIWA 4BQ2A 1L7QA 4DOUA 3B9CA 4BQ5A 2Y6KA 4FFGA 3OTFA 1WLWA 2W0XA 2D5HA 2WLPA 5DXDA 3VBOA 1ND3C 3VD7A 3N35A 1IGOA 4HKOA 3WF3A 3AZYA 4Q4X3 5CFCC 2YC0A 2D6PA 3THCA 3AMHA 3ST7A 3VUOA 1O3QA 1ZVFA 1J1LA 3ZXLA 2VMGA 3SH3A 1V6JA 5BNOC 1BZWA 1COV3 1REEA 1RUF3 3I2JA 3S0MA 1H9PA 2WSUA 1WCDJ 2IZWA 3F2ZA 4QX3A 2C4XA 3MIBA 1DDLA 3H8OA 3WQ1A 4S2DA 1EAH1 1WGPA 2LW8A 1AR83 2QTWB 2CGPA 2XJTA 1TNFA 5FUPA 5FZAA 3KCCA 3W20A 5FO7B 3RYRA 3FFQA 1N3QA 2JENA 3RRDA 3OF1A 5IT6A 1A3KA 4A6OA 5EJ3A 4GAZA 3U10A 3WDXA 1JOJA 2VVFA 1EYBA 2XBO2 4YM3A 2GNTA 4Y1VA 3MO4A 4XF3A 4XDPA 1BEV3 3NO8A 4B29A 1LOEA 2QZ2A 2P3IA 1AL22 4LBNA 1WLCA 5JR2A 1BMV2 4UBGA 1VBA3 2YBSA 5KWRA 1SPPB 4LKSA 1HB2A 4M01A 5G04L 2WT0A 4QHBA 3HBKA 4IL7A 1OD5A 2I45A 5FYVA 2P17A 3IDBB 1D4M2 1V9U1 3HT2A 4M0HA 2MEV2 3S5QA 4Z92B 4CEYB 2HYKA 4URTA 2WZR2 3P1IA 1H6XA 1PMIA 1Q8SA 1DYOA 1RHI2 4JQTA 1IKQA 2WABA 1H2LA 1QGLA 2E6VA 2PHDA 1CAXB 4LO8A 4LO6B 4XCAA 3TRSB 5F5CA 4NIAA 5KC5A 1PX3A 4TZDA 3ASIA 4UBHA 4YLZA 4AI1A 3MIEA 1YQCA 5ACA2 2I07B 3M7AA 1SDWA 4IEYA 4X6RB 1JI6A 5ABJB 3DUIA 3GCWA 2EXKA 2Y34A 2W39A 4LIVA 3K4ZA 1B09A 3EO6A 3LWCA 4PQQA 4WVMA 3WF4A 5JSRA 1WW7A 1REDA 2IUWA 3UV9A 5A7WB 3ROUA 3BI3A 4K9SA 2QQNA 1J3RA 3LIGA 3IKWA 1QMJA 2CGNA 3QCWA 1AR73 1CJDA 5GZGA 5FOJB 3J26N 3O0XA 3WNPA 1VBE2 1YFUA 4Q4V3 2YYOA 3ZFGC 4RS5B 1DQ1A 2NM1A 1HX6A 4ZZ5A 3NRUA 4MUVA 1G6NA 5C70A 2EALA 3K3OA 3HOBA 4CEWB 2OQ6A 1R1A1 4NN0A 2J1AA 3AK0A 1UU5A 3J9SA 3NV4A 1W6NB 1BVP1 2GZWA 2SBAA 3DGTA 4LHNA 3T2OA 1HIXA 2W87A 3GHMA 1FOD2 5FMCA 2VD7A 3CJXA 1UYZA 3NNGA 4JGYC 4O7XA 3WG4A 3VD9A 4RGAA 4YGCA 2GN3A 5I0SA 1H0BA 4I01A 1ND3B 4AEDA 4MH0E 1SLBA 2BP6A 1VMJA 1OOPC 2FCUA 2HWF3 1G86A 5T5JA 1CR7A 1RL3A 1W9YA 2ZBJA 4QWNA 3WP5A 5BNOB 4D7SA 5KHIA 1KDKA 1AR61 2ZGSA 1US2A 3CLPA 2WNVB 4BH9A 1UPSA 2VTXA 1AUYA 4N9HA 3KCXA 5A3OA 2VR4A 1MPXA 1KJRA 3MW2A 2RHPA 3EB7A 5LA9A 2VZ3A 1YRZA 4XFAA 5CADA 3WW4A 2O0OA 3ZR5A 1XNCA 3TEWA 3E5QA 1RUJ2 5CIRA 3CMGA 3IAQA 1YQ8A 3HNMA 3LOIA 1TME3 2ZGQA 1IS4A 5IFTA 3RJ2X 4KWLA 5F2SA 5SV8A 2JKXA 1HN1A 3G7DA 3AP9A 4J6GA 4RFRB 3AMPA 4NIDA 5LA2A 1OQEA 4FPYA 1BK1A 3ZSMA 2MHFA 3ZXJA 2DFBA 1OQDA 4A44A 1RUC3 1U5XA 2DFCA 4K40A 4LUKA 4CP9B 2EXJA 3FWEA 3T4HB 1CAWA 2A6VA 5L73A 4A41A 2PQQA 1RUNA 3ZXKA 5F5IA 4AHXA 2ZX2A 2RDSA 1H8TA 1DU3D 3MICA 3KD4A 3D3AA 1YQ5A 1NKGA 4DIQA 5FY1A 1AJKA 5KHKA 1RUE2 3RG0A 1QJU3 1OUXA 2HEWF 2X5IB 1RB8G 4COUA 1WA4A 2D44A 1BLZA 1J3PA 2DVDA 2JDUA 1W2NA 2VCBA 4YG3A 3T2PA 4PBOA 3NAPA 3ENRA 3VHNA 5KBFA 2BGCA 1NX9A 4LNVA 1NQJA 4Y1UA 5GJ6A 4JZRA 3Q8EA 5DAVA 3DYPA 3NQHA 3O0WA 4PI2A 4N53A 3DKWA 2WLQA 3SCGA 4EJRA 4J1XA 4OUMA 1GBGA 2NMNA 1DLLA 1PGW2 3IPVA 3QH7A 3GZUC 3EMRA 1CX4A 4K7JA 3VBRC 1AVBA 4NHLA 4CP0A 3VBUA 5JOXA 1AL23 5J3UA 2XVLA 4CXWA 1PZ7A 2W52A 1OHFA 2JDPA 1XNDA 3I3EA 4NHKA 5A70A 3WNOA 4CPBD 1GQHA 2W94A 2XLFA 1XSQA 2Y6JA 2Y33A 3PVEA 4UF0B 2XLAA 3TYJA 3RJRA 2YHJA 3V65A 1RMU2 4WM7C 2ZMLA 1D4M3 4IV1C 4AQ2A 2MEV3 1WLDA 1PX4A 2QUOA 2JG9C 2QZ3A 3LD8A 5E8AA 4QX7A 1Y9MA 3AMQA 2VPVA 5BYNA 3BCWA 2JDAA 1CQ9A 4JGYB 1HQNA 1I1EA 4NIGA 2DURA 2CGOA 4NRMA 1QOSA 5BUVA 2FDJA 4OHZA 5C3PA 1VRH2 2WYSA 4MHRA 5FLIA 3N9QA 1OOPB 3OEBA 1SEFA 1O3TA 4GWMA 5A3LA 5C6CA 2XKOA 3QD6A 4LBLA 3LKJA 2DUOA 1ENSA 5LRRA 5CFDC 5A1FA 1IG3A 2D6MA 5FO8B 5SV5A 1NCQA 2XWBB 3IB3A 5DZEA 4B3NA 4KL1A 4EN9B 2OA2A 5T3NA 1WMFA 4F83A 1NA1B 4BYYA 2HWD1 1U0AA 1TMF3 2D97A 1ODNA 1QF3A 2ZGNA 4ZPIA 4RQPB 4NO4A 1EPWA 3OBTA 1AYN2 3HNYM 2E26A 2EIBA 2WS92 5FP7A 4E2QA 4LULA 5DPNA 5F6LB 4TWTA 5GLWA 5C9AA 3FC0A 3MLLA 2ZGPA 3J8F3 1MS3A 1GZWB 4UFMA 4XQWA 2XQXA 4DS0A 1KS5A 3CHXA 3JQXA 2EAAA 4XBNA 1Q56A 1K42A 2R061 2P5BA 3ORJA 2OW4A 1JUHA 3IMMA 4MXWA 2R073 2D6OX 3VBOB 5F3CA 3E6CC 4LE3A 1C8NA 4I3PA 4LO7A 4PCRA 4EV0A 3OGJA 1UL9A 3M3OA 3WQ0A 4BLJA 4Q4X1 4OFGA 2VCMA 1QIQA 4AL9A 3T30A 4FPEA 5CBLA 1MQTA 4D8MA 1SACA 1DCSA 1RUF1 1COV1 4QB2A 1XNBA 1Q8VA 2TUNA 2FCVA 3PTYA 4JQRA 3SCHA 1W8ZA 1DIWA 1F31A 4ZS3A 1GV9A 4ATEA 5FZOA 4FP3A 3U78A 3AYAA 1AR81 3NJYA 3VZLA 3FMGA 5I0RA 4OZOA 1DG6A 1OC1A 4FPJA 3TWIA 4HKLA 3ZFFA 2OUJA 1S0EA 4UW6A 2VULA 3M70A 5T5OA 3UT0A 1GFF2 4RL7A 2Q8EA 4A7ZA 2R6QA 1OLME 2A75A 3DPRC 5E88A 1O8PA 1UF2C 5FTTC 4W6YA 1BEV1 3J7HA 4GWNA 4B4RA 4XFIA 4HK8A 1YI7A 1ZREA 5E16A 3POFA 1GNZA 3WW2A 1LJ7A 1UIJA 1TEIA 2A3XA 1R083 4XMIA 1VBA1 2J1UA 1Z7S3 1F5JA 4LBQB 3KT7A 4QXBA 1CIYA 1XE0A 1QH6A 3VBRB 5FREA 1DQ4A 4FTSA 5CKNA 4GB32 5FAXA 4AOCA 3H3UA 1HRI2 4A7YA 1DQ0A 5K8SA 2AC1A 3LFIA 2Q8DA 5CFDA 1B35B 3I8TA 3F95A 3SEPA 3S6PA 3FN9A 3M1HA 4AYUA 1W8TA 3KV6A 4PDWA 4C0HA 3ZKUA 3BKZA 5FYYA 5T5PA 4COYA 5J7MA 4EN0A 5F3GA 3JBG3 2XVGA 4YW6A 1H1MA 3MV11 4JV4A 2X29A 4JDMA 1VE0A 1W9SA 4Y1ZA 4AFMA 4EN7B 1MVQA 5J37A 1M06G 3CF6E 1NCRC 4QGMA 2ZHLA 3N3HA 2JECA 4YVSC 2DTWA 1MEC2 2G9FA 3VKNA 5FZBA 1VALA 2AGSA 3BODA 3VKOA 1CAVA 1DQ2A 3K4AA 4IGPA 1K5MA 4Z82A 1ZZBA 1PZ8A 2G9GA 3GHNA 2VTXJ 3WCSA 4MGZE 3LEGA 1AR71 4QM9A 2JDKA 4AE2A 2YPDA 1GR3A 2VO5A 4Q0UA 2QDRA 3URFA 1GWKA 4Q4V1 1OD3A 2D40A 3GJBA 4GULA 1RIRA 4P02B 5DUWA 3OY8A 4GD4A 3A7QA 4K3UA 2YBKA 2BDRA 3UGFA 2QE3A 1U5IA 2WNOA 1FXZA 3I59A 1OMIA 3VHPA 5HV0A 3WDYA 3VDBA 5FYTA 4YZ2A 2OVUA 1VLNA 3VKFC 4HSLA 1T2XA 3V0BA 3MIHA 4OMDA 2F4LA 4XAEA 2A3YA 3WEZA 3CKHA 2ZGRA 4Z2WA 1LAJA 5A6XA 2P34A 2VUCA 3FHIB 4BQ1A 1J3QA 1JUIA 1Q8PA 2B46X 4AEDB 1UMZA 2VH9A 3VBFC 1W8FA 2WQ4A 3ZN5A 2DV9A 4LBOA 1D2QA 5C33A 1PGSA 4IGOA 3ZFEC 2JKBA 1DQ6A 1NY72 2CAVA 3KF5A 4PT6A 5FZ4A 4AQ6A 2HWF1 3P3NA 5A1LA 2IXKA 2JXAA 5A33B 2JB4A 3K51A 4W8JA 4D6RA 4LO5B 4Y4RA 5JPNB 3SNMA 4ET7A 5JCTA 2A5ZA 4LBMA 2JG8C 2ZTNA 2R49A 4QU2A 4UFIA 3WY6A 2H6BA 5EXOA 1U5YA 2DVGA 4MLOA 3D6EA 4P9WA 2DUPA 4LIUA 2YC2A 2P2KA 3AZVA 2ZJCA 1CD3G 1YWKA 2D6LX 2VMHA 4UFJA 5FZ1A 3RS6A 4BJ0A 4IE6A 4A4AA 1H30A 3JZVA 4WVZA 5CISA 1V6KA 3ACLA 3MHZA 3JD72 2K46A 5FPUA 5A7SA 3K46A 2VZPA 5I93A 2RJKA 1RUH2 1D7PM 1SZBA 5EYXA 3TNQA 1XJAA 1C8M2 4IEWA 4R9CA 1NZCA 4IXLA 1TME1 2XB6C 4K8FA 4AHWA 2WS93 5BNNA 1OLQA 1WKYA 3AX4A 5FUNA 5FYCA 2BBVA 1ND2C 3BIEA 2WN2A 4MXVA 1YI9A 1O4ZA 1MZFA 2QQKA 2VGDA 3CJIB 3R05A 5HI0A 2L9LA 1ONAA 2UY8A 2QNKA 1RUC1 3S7EA 4MZUA 3AFKA 4XOGA 2Z42A 1JODA 3ELNA 1WD4A 3PUHA 1ZBA2 1LEDA 2X10A 4HN0A 5AFEA 1I6XA 1HKDA 3MW3A 4DEQA 2ZGTA 2X8KA 4QPIB 2CYFA 1O3RA 1SLCA 2PHRA 5FJKA 4AVSA 5FQ0A 4BZ4A 3D4KA 3AP6A 4P9GA 3PUIA 1YCIA 1PK6A 3P6BA 1QJU1 3SXWA 3MIGA 5C3SA 3C7HA 1K5JA 2VJXA 5K9YA 3AP5A 1CWPA 1NCRB 2A71A 4MGQA 4CU9A 4GA9A 4Y33A 1DYKA 3JB4C 4BQXA 2IVJA 3WF2A 2ZZJA 5DG2A 4MVTA 1I9RA 4YPJA 5LBBA 3IPVB 5HCHA 1ZRCA 2XQRA 3RZGA 1WCUA 1WA6X 3OGRA 5H9RA 4FFHA 2RMU3 4GH4C 4A7KA 4CDWC 1HN0A 2QDNA 2JJ6A 4PLMA 1JZ7A 4RN5A 4JGZA 3DEMA 4DXZA 2XPJA 4QX5A 1W0OA 1UU4A 1QNWA 2ADDA 2JE9A 2QQJA 3PU3A 3C3VA 1R093 4CUAA 4E4HA 2B5HA 4LLFA 3VDAA 4JHZA 3MW4A 2BZDA 1YQ2A 1H9WA 1XU2A 1QJX3 2ETEA 2EXHA 2GNMA 3MYXA 1GLHA 1NE4A 2RS33 3PUSA 4JHTA 4JKLA 3USUB 1D4M1 3ZDVA 4GB33 3ZXGA 5CFCA 1UKGA 1Y7BA 2BOJA 4KH9A 4AI9A 5KXEA 1BBT3 5I8TA 1FPN3 1LKNA 1MVEA 1Y43B 5LA1A 5F5AA 2B39A 1KS4A 4Q2FA 4AFDA 5LY2A 4F3JA 5DN2A 4BDVB 4YW7A 3LPFA 3SKVA 3O1SA 4NWWA 3OEAA 2PTMA 4D69A 3T09A 1YHFA 3NV1A 2GMMA 3AXEA 2VW2A 2F6BA 2D5FA 5A6YA 2OS2A 3N9OA 2CHHA 2UWCA 2ZA9A 3LGRA 4V2VA 2D43A 4XDOA 2JG8B 5CVRA 3WUDA 1SFNA 2TNFA 4WBBA 4CDXB 1S2BA 4D94A 4QQOA 1TMF1 2GN7A 4Q8LA 2NMOA 2RM22 3FBYA 3GGLA 4WV8A 1EP0A 3CO2A 1LEMA 1RINA 2D3RA 1JW6A 3AL5A 3IWZA 3G6JB 5FYIA 4C90A 5J09A 3PVNA 3MIFA 4ZS2A 1MS0A 5KR7A 1HQLA 4E27A 1HLCA 1VBD2 4TN7A 4R9AA 3J8F1 3ACFA 3MPBA 1OPMA 1ALYA 5FJHA 3WP4A 2I74A 3RVHA 2WNUA 3AKQA 1W2UA 4LPLA 4MXWB 4DRRA 1VIWB 1ND2B 3HAGA 4GMP0 4QM8A 2R071 3BPSA 4ZU4A 2XWJB 1GWMA 4AEKA 1PMJX 5EWSA 2NLRA 3K3NA 5FZ0A 1MQTB 1CZSA 2QQOA 5GLVA 5T55A 3RZJA 4UW5A 2VZSA 4CDQB 1SMVA 2YROA 4S2HA 1HW5A 1RTVA 2K2SA 2J1SA 5LBCA 4CEYC 2PLV3 3NJZA 5FZOB 4HG6B 4NMIA 1OFNA 2FD8A 1UY0A 4NJ4A 1VMFA 2I2SA 3LA3A 4JVAA 3ZFFB 5APAA 1ZZ8A 1GP5A 3K48A 3LAGA 5AC92 2ARAA 2VY0A 4IEZA 3KHBA 3ME2A 4X8NA 4N8MA 3Q9OA 1U12A 1ACCA 4HN1A 4HT1T 5ABJC 3DV8A 3DECA 1NYWA 4GJZA 4P08A 3UKVA 3V0AA 4UAPA 5FP3A 2VU9A 3GM8A 1Y9QA 2WNEA 4META 4NVPA 1C1FA 1UY2A 3J7MA 4XF9A 4P00B 4YRDA 5HCFA 4QMAA 1YJLA 2SLIA 5L7OB 3PL0A 4UXAA 1RUH3 4TLFA 1C8M3 4QT6A 5FZMA 5BV6A 1R081 4QDQA 2DUQA 4O65A 4GH4B 4HKWA 3H0OA 1Z7S1 4KNCA 4LBQD 1JMUB 4XBQA 1RGSA 4AI0A 1IPKA 1DF0A 2RR12 1POV3 2HEVF 4QDSA 4P5HA 2A73B 2ILMA 4MGIE 5F8PA 5C4WA 4RS5C 3VL9A 5L9BA 5FZEA 3PURA 1RVF3 4AAPA 4QPGA
chains in the Genus database with same CATH topology
4CEWC 3WX5A 1LESA 3PVBB 3O14A 2PA7A 4AEMA 3UJQA 4ES9A 1VBC3 3RPQA 3NWKA 3R4SA 2ENRA 3JQWA 3KZ4C 3NV2A 4HPKA 4LTAA 4OHXA 5I8SA 3JBG1 4FOWA 4YVWA 1H4HA 2W08A 4SBVA 5D8AB 5DUVA 2PFWA 1PGL2 4AGGA 3WDTA 4YZ3A 2C5DA 4W65A 2HWC2 1VBB3 3U07A 5IK7A 1F9KA 5K0UA 4M3CA 1HXS2 4BIOA 1WCKA 4GIQA 2PHWA 1BCXA 3KLSA 2WNVC 1IZ3A 4R9DA 4Q0VA 4QPYA 1UPIA 3OY8B 1BVVA 1NE6A 4QQHA 1BQPA 3GZAA 3I59B 2HWE3 1LHNA 1S2KA 1PGW1 1RUI3 2Q1MA 1H2NA 1IS5A 1GKBA 2CTVA 5BNPA 4CDUB 5JMCA 3ZN4A 4Q4W2 4FTBA 4QD2A 1A6CA 2WT1A 1QJY2 5JZGB 2NZ9A 2K9ZA 3AYCA 4RR3C 4XIOA 1VB4A 4CZSA 5C8CA 1AZDA 2WWSA 1N1YA 4IESA 1GSLA 1E57A 4HETA 5A3MA 1HRV2 5DDJ3 1CONA 1ZRRA 3HMYA 1N47A 2D6NA 1MS5A 1W6QB 2X5IC 4Q1PA 1AJOA 1NXMA 4RHV2 2BVVA 2B42B 4FAGA 4DPNA 1MR5A 1G9FA 2RM23 4PIYA 4FOQA 2DU0A 4FPFA 4HMZA 4MYEA 2BFUL 2WS91 4E4ZA 4P9YA 2PAMA 5IUQA 1DGRN 2WFF1 1Z0HA 3UK9A 1H1IA 2VQAA 4XIKA 1YXWA 2R042 1O4YA 4BWOA 2A6WA 4FPOB 1XE7A 4WM7A 1UZZA 5JLVA 4AGRA 4L99A 1MS8A 1X8MA 2ERFA 3NKGA 2R32A 1AYM3 2RS12 4TYSA 4N43A 1QJZA 1S55A 2VUAA 1AR92 4FP2A 4LUMA 2GDFA 2GSYA 3O5SA 2E7AA 4Q4Y1 4AFCA 2R30A 5DG1A 4B7EA 4V1PA 4BHPA 3LA2A 2FZ2A 3KGZA 2WL1A 3VZNA 1ULCA 1APNA 2ZHMA 2E63A 1ASJ3 1RUD2 5E1RA 2PYTA 4FBFA 4X6QB 1SCSA 1R1ZA 4YARA 2VECA 4JGZB 1UKRA 2RMU1 1NA1C 1ZNPA 3B01A 4NHMA 1C1LA 1XNKA 3KCYA 3WDVA 1AHSA 2ZS6B 3B94A 1VR3A 3INAA 4IERA 4RQPC 1SLIA 1R091 4B4PA 2ZGOA 4JDOA 1LGCA 3M3EA 4M00A 4F8AA 1QJX1 1ULDA 3FLTA 2RS31 1LU1A 3TB0A 4GB31 4ONUA 3E6BA 1FV3A 1QQP2 2DWRA 2PELA 2WIIB 2PHFA 1BBT1 3OJBA 1FPN1 2P3KA 4HBNA 4I0WB 1SQ4A 4FO9A 3VBOC 4Q27A 2ZACA 3R4DB 3RNSA 4RR3B 3RZZA 3C2UA 1PIV2 2GALA 1PO22 3GALA 4KGGA 2GMPA 1GANA 3WV6A 5DUXA 4R52A 3NSTA 2Z5WA 4XMAA 2ZX1A 3DPRA 4UW3A 1YUDA 2YY1A 4HLTA 3WZ1A 1YIFA 4HVQA 2DVBA 1HXS3 2QJVA 3TN91 4WZCA 3FUOA 2R0HA 5EFUA 3EJKA 1IHMA 4K20A 3ZSLA 4WVVA 5I8YA 5AVAA 2WNUB 2VVDA 4FPHA 1EV12 2Z2SB 3VDDB 3VBHB 5FLJA 2VW1A 2AREA 4JAAA 2XBO3 4COWA 3CL1A 2D98A 2DF7A 3VHOA 4XFCA 2Z69A 1W6OA 4EWEA 3UKTA 4D3WA 3U11A 2PLV1 2ZX0A 5JSPA 2XL7A 3DN7A 1A8DA 1ZX5A 1B35C 3H7JA 1EAH2 2ZZQA 1FATA 4KBBA 2HKXA 4Y26A 5F9TA 1QDCA 3AKTA 3V0AB 2WZR3 3IIAA 1RHI3 3NW4A 3OGGA 3IN9A 2YGLA 4AW7A 2ZGUA 1HRV3 3HR9A 3KM5A 3EXUA 4BA6A 4JRLA 3AKRA 1C5HA 5A32A 2XJUA 4Q26A 5ACA3 1WD3A 5JI7A 3ES1A 1PM7A 1IS3A 4K21A 1AX1A 2OZJA 5IK8A 1UZYA 5CG9A 5JDBA 2XVKA 1FX5A 4KWKA 1RUH1 1KFXL 3I7DA 1C8M1 5HBAA 2XLGA 3HD8B 1YJKA 4BPZA 5TSWA 3ZYGA 5C4WB 3M4FA 3N7LA 4AVBA 4I09A 4IEVA 5T50A 5GZCA 1POV1 4NWVA 1DFQA 4QPGB 4FPLA 1RVF1 4IV3B 5FOBB 1VBE3 5J48A 1DZQA 3RMYA 1ULEA 3ZFEA 1VBC1 1FMD2 2WINB 2H6CA 1J58A 3RMXA 4HVRA 4XJAA 4Y20B 1V00A 2ATFA 3PMSA 4AEDC 3KMHA 3WP6A 3A4UA 3WDUA 2WKKA 2AH2A 1FOD3 4DY5A 3RWNA 2DVFA 5FPZA 5K0UB 4M3CB 4EN8B 2ZAAA 1VBB1 5FRAA 3WG2A 1JTZX 2H0VA 3LSDA 3B69A 4KU8A 4XHBA 2BWCA 3SH4A 2IC1A 4ZU5A 4LBJA 1IKPA 2QFEA 5IK5A 2B45X 2HWE1 1LHWA 4WM8A 4R4XA 1RUI1 3IDCB 5BNPB 4BIFA 1QHDA 3VHRA 1O5UA 2DCZA 3H7YA 3AJZA 2OUHA 3N4MA 5GZDA 1RUJ3 2D93A 2D3PA 4EN6B 3CJIC 3VV1A 2XH6A 1QOTA 5BPXA 1PVXA 1QQP3 4OHWA 1PZ9A 3TAYA 4AGVA 2HJIA 3ZYIB 3B3QE 2BNNA 5T54A 1UAIA 2VXRA 2BUKA 4YYOA 2AENA 3VZMA 1YLLA 1LOFA 2UY9A 2GC0A 2E9QA 2IFRA 4QPIC 3NL1A 5DDJ1 3HWJA 1PO23 2O8QA 2GC1A 2IXHA 3RYKA 3ZSKA 2FHRA 4JTOA 1VAVA 3SISA 4FVVA 4QQLA 4K6BA 3NAPC 1VP6A 4WVMB 2PHXA 2X53S 2RM21 2VNGA 1RUE3 4YW1A 2B8MA 2WSVA 5GM0A 4OI2A 5JOYA 5LK7B 3B5LB 3KSCA 4Q0QA 3GF6A 1EV13 4P9IA 3VBUC 4M3CF 1XQNA 3E5XA 3PJQA 3AYDA 1KJLA 4IEXA 3LB9A 1AYM1 1ENXA 5IK4A 4G4FA 4MX3A 4XW3A 4I2OA 4F7ZA 3OCPA 3N36A 3AZWA 2WZPP 2NP0A 4I30A 3X29B 3JB8A 2QCSB 2BEOA 3OD0A 3W9AA 5EZWA 4XFBA 1RMU3 5GKAC 3D8CA 1CAUA 4H14A 3UKNA 4Q8KA 4YW5A 3ZPYA 3OYWA 4ISRA 1LR5A 1QOOA 2ET7A 1ASJ1 4PJYA 1SBDA 1VRH3 4QGLA 2PAKA 2AYHA 4CDXC 5KC6A 2GNDA 4XF1A 2FBEA 1DGLA 1V6NA 2BWAA 3I2DA 2O8OA 1UD1A 1KD7A 2ARBA 2WQZC 4AFAA 5C9AC 3ALQA 1O7FA 3MZHA 1WLTA 1CGPA 4NPRA 1J1TA 1BXHA 4PIXA 2GH8A 2CV6A 1AYN3 1VAMA 5H9PA 4Y1YA 3ZO0B 3VZKA 1O4TA 2R1DA 4HZFA 4CEYA 2IWGB 1S0BA 4Y24A 3ZN6A 1C3HA 1ULGA 4BLIA 4AWDA 3CEWA 1FMD3 1PO12 1MS1A 4GMP3 4ITCA 4LEJA 1CAWB 1MQTC 4SLIA 1CAXA 5GALA 3WXPA 4E9KA 1YFXA 4CDQC 1G9DA 3LOBA 2R0FA 1V70A 1H8TB 2AR6A 3NKTA 4YZ5A 2YGMA 2EF6A 3S30A 5ABJA 1PGL1 5FPXA 4BMEA 3ZSEA 4A2UA 1N1VA 2Q8OA 1ZRFA 4FSJA 4FPGA 1WW4A 4B8EA 3ZFFC 4Q0PA 1HXS1 4PLNA 2XL9A 1V6IA 1RUOA 1DYPA 3WHTA 3NAPB 1O91A 1DQ5A 3VBSA 2XJSA 3TBDA 2VUJA 5CNAA 1O5LA 3IBMA 2WT2A 5BNQA 4I02A 2IXJA 3L9JT 2GC3A 2R062 4N53B 5L7OC 5D1IA 4YW4A 3MI8A 1XYOA 3WT3A 4CEWA 2XBO1 4G9SB 4U36A 5CA6A 3ZYJB 3VBUB 1W6NA 5H9SA 1QXJA 5FLHA 2JX9A 4Q4X2 1S1AA 1OI6A 1AL21 2GAUA 5KXDA 1AF9A 3JUUA 3V56A 1BMV1 2MNGA 1COV2 4FPKA 4P9LA 1UW8A 2XJRA 3MDPA 4PDWC 1FI2A 2Q5TA 1ND3A 1H2KA 3JU9A 5T5LA 1DZTA 3H9AA 1AR82 2MEV1 1CIWA 2UWBA 4MGKE 1HRI3 4ZKTB 1DGWX 5FFOC 4A3XA 5BNOA 4MGYE 2WZR1 5AVPA 4YG6A 1RHI1 3ZYRA 4C0BA 3QH6A 5FCCA 1G9CA 1HRV1 5LRSA 4PLOA 1EPZA 5D8AC 4COZA 1M4WA 2K0GA 5HCBA 4BMBA 1K5MC 1TNRA 5ACA1 1RJ8A 1BEV2 1NCQB 3OPZA 1D0GA 4M3CE 1ZRDA 3SLIA 1MEC3 5J36A 3E6DA 3GZTB 4XJWA 1AXKA 1J59A 1QDOA 4FCAA 4EWDA 3WDWA 1S0IA 1HV0A 1WBLA 3FFZA 4HL0A 1ZYBA 1FT9A 2G4IA 3ZMOA 5C9AB 1LGNA 2C1FA 3VKMA 3BIWE 4H7MA 4I0BA 3E97A 3WINE 1VBE1 3DF0A 2KA3A 4NR1A 1PVC2 1PNGA 2V73A 4LHKA 3R0RA 3H1YA 4CDUC 4YFWA 5KXCA 4H3WA 3WG3A 1WW5A 2DVAA 5JI9A 4IEPA 2UYAA 3RQ0A 4XHXA 5JZGC 4HSJA 2RJLA 1FOD1 2JD4A 5J96B 1G7YA 1MZEA 2EXIA 1H8VA 2YV8A 1AR72 5F1RA 3AMMA 2WA3A 3I54A 1F5FA 2VOKA 1YFWA 4Q4V2 2QQPA 4Z8BA 3FBMA 2QVSB 5HXVA 3TNPB 3FLPA 1SLLA 2VOXA 4WM8B 2WJSA 4QQ2A 3NVCA 3WG1A 4X8PA 4L9BA 4YM0A 2V09A 5JR7B 1PNFA 4OVEA 4ES8A 1NLSA 1OPOA 2LTNA 3JD73 4RGGA 3ZFGA 4JDNA 1QXRA 1RUJ1 3HBZA 1MZ5A 1S0DA 1FV2A 2FQPA 1GICA 3POSA 3MGUA 5B2GB 1QQP1 3ETQA 2ET1A 2LUWA 3FUQA 1UCXA 5JIAA 2PHUA 5CFDB 4JGYA 4D7YA 1PO13 4RA0A 2BQPA 5BXXA 1H4GA 4PDWB 3N7KA 3AP4A 3E5UA 2N7GA 1OOPA 3L2HA 1PO21 5JPMB 1L3JA 1ZBA3 4AQSA 5JAXA 4YGDA 3VL8A 2ZPXA 1RUG2 1UIKA 1NA1A 3PJYA 1CAVB 1RUE1 4KG0A 1K5MB 2UYBA 2P3JA 4QGNA 4YNIA 3THTA 4XZPA 2ZX4A 2VNRA 2ZX3A 1QY4A 2UURA 5FDBA 2JDZA 3N7JA 3MLKA 3PVOA 4JGZC 1EV11 1GZWA 1W6PA 1LHVA 1RUC2 3I4IA 4Y22A 1WMEA 1GZCA 1OLRA 4ZXKA 1FYUA 1GNHA 2R1BA 1ZZ7A 3V0BB 3BPZA 4H55A 4DFSA 3SH5A 3BALA 4HVOA 4DZGA 2DCKA 1QJU2 2RS52 1QH7A 1SFYA 4LT5A 3ZIXA 3OD4A 3AP7A 1CAUB 1A8MA 1RMU1 4OHVA 3JCIA 3OYWB 5GZFA 4N90A 4XETA 2BYVE 3RI9A 2A6XA 3WCRA 2EVXA 1LU2A 4OI0A 1WW6A 4LA2A 1VRH1 3AZZA 2PHLA 1UN1A 1LRHA 1FNYA 4BCUA 1LCLA 3BOPA 2NQYA 1X82A 3HQXA 1JBCA 1AX2A 2PN5A 2Y0OA 4XFHA 1D2SA 3VN4A 2F4PA 4XTMA 2HEYF 4GQ7A 5BNNB 2WNUC 1RITA 4OHYA 4LBQA 3VBRA 4MV2A 2BNOA 2GC2A 1AYN1 3O7OA 3VDDC 4Z07A 3VBHC 3B02A 3ZN6B 4AI2A 1VBD3 3T1LA 4YZ1A 4CP2A 4RD7A 1B35A 1LOGA 1IPJA 1FMD1 2WA4A 1PVC3 4GMP1 3BU7A 1QKQA 2KXLA 2XUMA 4IV1A 4R8HA 1D0HA 1UX6A 2JG9A 1TQ5A 3WVJA 5E89A 3FE5A 4OI1A 4LR4A 5FQ0B 4L92A 2YPJA 4JCKA 1PK6B 1TMF2 1JHNA 2LALA 1ZZCA 2ZHNA 1N1TA 3A0NA 3PNAA 3VBSB 3VGIA 1POV0 1HDKA 4YW2A 3GBWA 4N7UA 3AMNA 1GQGA 2YZ4A 3J8F2 3MF9A 3M3IA 3ZXAC 3WD5A 1PHMA 2B7YA 2CAUA 3QBQA 5AC93 2XKPA 3MIDA 1V6OA 1WCSA 2CY6A 4XTPA 4OUSA 2MPFA 5GLZA 2EA7A 2R072 3N7MA 2B9UA 4JRAA 5C4WC 1OFSA 1SLAA 3W59A 1Y3TA 3HT1A 4XXAA 4QPGC 3GBGA 4LHLA 1XYNA 2R16A 4E2GA 4WVWA 1XXNA 1ZBE2 4IV3C 2VG9A 5CFCB 2ZMNA 1W0PA 1Q5OA 4FXKB 2RR13 1HRI1 2Q4SA 1Z78A 4LE4A 4P14A 1BYHA 4YVWC 5A33A 3GNEA 3RDIA 3A0KA 1CESA 3H50A 2ZOEB 4CRQA 4YSFA 3B00A 4DY3A 4N7IA 4W6WA 2H0BA 5K0UC 1RUG3 4DB5A 1FAYA 2JEMA 1MEC1 1DGRA 1R082 2JE7A 4HK9A 4AXOA 1Z7S2 4E2SA 2HWC3 2ZCWA 1LOBA 4L97A 3RYPA 3TOJA 4K1ZA 2HWB2 3R6SA 3GYDA 4FTEA 4XQDA 1MS9A 4P9XA 5CAZA 3KB5A 4OZXA 3M2MA 1QNYA 1LECA 4OI4A 3CJIA 5BNPC 1DZRA 1AXYA 1ENRA 2CWSA 2FMDA 5J98B 2W68A 1QU0A 3JBG2 3IDEA 3CNAA 1D4VB 3P3PA 1LODA 3L2YA 5EV7A 1CPMA 1NG0A 1LOCA 2DCJA 4QPIA 4AVCA 3GBFA 5C8CC 4WZFA 4O9EA 2RS53 3LSEA 2FZ1A 4Q4W3 2YUEA