2H0BA

Crystal structure of the second lns/lg domain from neurexin 1 alpha
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
181
Chain Sequence
EEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Second LNS/LG Domain from Neurexin 1{alpha}: Ca2+ binding and the effects of alternative splicing
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion
molecule keywords Neurexin-1-alpha
total genus 39
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h0bA00
4FPKA 2DVAA 3PMEA 2ZHNA 1AXYA 4YGCA 5E8AA 3AP4A 1FYUA 2DUPA 1DIWA 1G86A 1V6MA 3AFKA 2D44A 3O0XA 4LBQA 1QOTA 4UW3A 1W6MB 3UJQA 2D6PA 3NV3A 1PZ9A 4DPNA 2ZGRA 3MW3A 3MEPA 1MS4A 1N1YA 5IK8A 1LULA 1ONAA 1GSLA 5GJ6A 3UJOA 4XJ9A 2CL2A 2GDFA 2PHUA 4GKXA 2D6OX 1W6OB 1MZ5A 1WW6A 3OY8B 3ENRA 1DQ6A 3VKNA 3TAYA 1U0AA 4LBOA 3VKMA 2A3WA 1LOFC 1YO8A 2W68A 2GN7A 1AVBA 4Q1RA 4ATFA 2VW1A 4PQ9A 4R9AA 5L73A 2EIGA 2D6LX 3HMYA 2ZGKA 4BM8A 2DU0A 5DZFA 4JRAA 4YZ1A 3IKWA 1I3HA 1ULFA 1LOCA 3NV2A 3SISA 2W08A 4XJAA 4XMAA 3VUOA 1UN1A 3C2UA 3WZ1A 5JVVA 1WLCA 1DQ0A 4Q1PA 2AGSA 3T2TA 2Z42A 3NV1A 4FQ4A 3VV1A 4R9BA 2JE9A 4ATEA 1S0CA 1VIWB 1V6OA 1KITA 3A0KA 4YLZA 3FBYA 4YW5A 2DTWA 5JOYA 4WZFA 1IS6A 1DFQA 2VW0A 3SITA 1YRZA 1UX6A 1V6LA 3AJYA 2OUHA 1BKZA 1HDKA 5EYYA 1V6KA 3WOGA 5IK7A 1MS3A 4ISRA 1JHNA 4R9CA 1GNHA 4YM0A 2OUJA 1LOAA 3LSDA 4Y1YA 3OYWB 3WG2A 3RSJA 1QU0A 4FQZA 1LODA 2DUQA 2ZZJA 3V64A 2UU8A 4LBLA 1DQ5A 3WDYA 2WSUA 2D43A 4XJWA 2GMMA 3V0AB 1W6NA 2E51A 3FFZA 1V6JA 4GKYA 4BLIA 2R0FA 1CPNA 1G8WA 1GYKA 3RRDA 1BQPA 2C5DA 1KJRA 1W6OA 2ZGOA 5CB7A 1G9CA 3LCPA 1N1TA 1S0EA 1AXZA 3WHUA 1SLAA 4PCRA 4DRRA 2B7YA 1ULGA 1UZZA 3VKOA 3D6EA 4Y22A 1CPMA 3ILRA 3M3OA 2VY0A 1CVNA 1ULCA 1MS9A 2DURA 2V5YA 1D2SA 3AZZA 2JKBA 3O5SA 3JU9A 2E53A 3M3EA 1UAIA 4M00A 3WDWA 1OFSA 3POSA 3WDVA 2EF6A 5GLZA 1GV9A 4YZ3A 2AR6A 3AX4A 1QNYA 1C57A 1JOJA 2I2SA 3KQRA 5LK5A 3WDTA 4GWNA 1H9WA 1HLCA 4XXPA 1V6NA 2DVFA 1BZWA 3TB0A 5EXOA 1S0IA 2VU9A 1KRIA 5IT6A 3AZVA 3O0VA 1VALA 4PBOA 4XOGA 5JOZA 1ENSA 4P9YA 1LOBA 5H9SA 5T54A 4AGRA 3ZXKA 4FPGA 2YXSA 3ZVXA 1RITA 1KJLA 1S1AA 4BQ1A 1OKQA 2OVUA 2DYCA 3BODA 3WV6A 2WT0A 4DFSA 1XQNA 1MVEA 1LGBA 4YW1A 2YROA 1AX2A 3WG4A 1AJOA 1F31A 4YM3A 4Y1XA 1O4YA 2VUAA 5CNAA 3RMXA 4AVVA 1HQLA 3LSEA 5CBLA 4LBJA 2GNTA 4Y20A 4YZ4A 2ZMNA 1W6NB 3AYEA 4GA9A 2DWRA 2YZ4A 1QNWA 2UWCA 1MS8A 3AYAA 5H9QA 3M2MA 3DUIA 3ZSKA 4K1ZA 5H9PA 4ISQA 3RQ0A 5HCAA 2W39A 2A6YA 4XJ8A 2ZGQA 2A5ZA 1G9FA 2W52A 1Q8VA 1OQ1A 2R49A 4LBQB 1QOSA 4YG6A 4ZKTB 3I4IA 1WW5A 1QOOA 2JDZA 3WG3A 4XTMA 4YZ5A 1A3KA 1UPSA 2D6KA 1DZQA 1KQRA 3N7KA 4WVVA 3ZXLA 3W59A 2NM1A 1MACA 3T1MA 1VLNA 2GNMA 4BMBA 1G9DA 2A3XA 2P3IA 3AYDA 3N36A 4XDQA 3B3QE 1SLBA 4FPHA 2AREA 4Y26A 3T1LA 4M01A 2ZGSA 5F9TA 2GMPA 3PVEA 1R1ZA 1WW4A 4UW5A 4YFZA 1IOAA 3POWA 1BXHA 3HN1A 1DQ4A 1FNYA 1GBGA 3B01A 1QGLA 1GLHA 1W6PB 1UZYA 2E6VA 1V6IA 3PVNA 3WG1A 4YGBA 2WJSA 1Y7BA 1N3OA 2NMNA 1ULDA 2EXHA 4ITCA 2EXJA 4FOWA 2ZACA 5T5JA 3UL2A 2TEPA 1F5FA 4DQAA 1V00A 1YYNA 1MS1A 4PBPA 4WV8A 2ZABA 3AXDA 5T5LA 3OBRA 1APNA 1CONA 1LOFA 1W6QA 3WCSA 2H0BA 4XIKA 3ZXJA 5GZCA 1UMZA 2DVGA 1IS3A 3QLQA 1CJPA 2FMDA 1FX5A 3M3QA 1DHKB 2A75A 2E7QA 3ZYPA 3USUA 3U4XA 1LENA 4FOYA 5CA6A 2R1BA 3M3CA 3ATGA 5DG2A 2D3RA 3SH4A 3WVJA 2P3KA 1ZM1A 2A7AA 5IUQA 3ASIA 3N3HA 5DG1A 5KXCA 3R05A 4Y1ZA 2D7FA 2GMEA 1ENQA 1LOEA 4Q8KA 5GZEA 4P9XA 2JECA 3IMNA 3SH5A 1SBEA 1MS5A 3AP7A 2ZA9A 4AWDA 2R16A 1I1EA 3R4SA 2NN8A 1MR5A 2PELA 1GZWA 1DYKA 2ZGMA 5T55A 5KXDA 1IS5A 1B09A 2P2KA 3Q9OA 4I30A 4OZXA 5FREA 2PHRA 1LHOA 2UURA 2WLQA 3O0WA 4FPEA 1S0DA 1AZDA 3B9CA 4K21A 5BYNA 1D0HA 5DUVA 2PHXA 5GM0A 5KXEA 4Y1VA 1WD3A 4JCKA 1G7YA 3QCWA 3AP5A 1LEMA 3GALA 1W0PA 2D6MA 2PHFA 3AJZA 1WLWA 2D6NA 3SNMA 2ZHMA 1CR7A 4Y1UA 1DGLA 1DQ2A 3W58A 4BLJA 1VAMA 4NO4A 2YV8A 2CTVA 1FAYA 4Q27A 5E88A 3OBTA 1Q8SA 1BYHA 2P34A 2WSVA 2RHPA 3A0NA 4Q2FA 4WVWA 5GZFA 1JN2P 5DZGA 1URXA 3IPVA 4BOWA 2JD4A 3ZSMA 4BPZA 2R0HA 2XG3A 4U36A 3I8TA 2CYFA 3AP6A 1QDOA 1N3QA 1ULEA 1LESA 4K20A 2ARBA 4ZXKA 2DU1A 3ZXFA 1N3PA 2ES3A 2V73A 1JW6A 3RMYA 1JYIA 1PZ8A 1FV2A 3A4UA 3POYA 1WLDA 3RG0A 1RINA 3PJQA 4YZ2A 3FUQA 1LHUA 3R4UA 1JBCA 1SLIA 4AVTA 3INAA 3M1HA 4R9DA 3AK0A 1Q56A 1JUIA 1WUVA 4YFWA 1TEIA 2ERFA 4XZPA 5E89A 5JOXA 1A78A 4PF5A 1LU2A 5GLWA 3RS6A 2NP0A 1JXNA 1GZWB 5IK4A 1NLSA 3N7JA 3MW4A 1IS4A 2AH2A 2ZMLA 2GALA 3D5OA 1LEDA 4YM1A 4TYSA 4FVVA 1VAVA 1LTEA 3ZXEA 2PHTA 4XIOA 1H9PA 2CY6A 3DGTA 4LBKA 3WCRA 5GZGA 3BIWE 3WUDA 2VH9A 4MYEA 1G9AA 5HCBA 2CWSA 1FNZA 3N7LA 4XHXA 3SH3A 3V65A 4BMEA 4M3CF 3NV4A 4CZSA 3OPZA 3AZYA 3VKFC 2XB6C 5HCFA 1AX0A 1IKQA 1LHNA 3WNXA 1Q8PA 2OW4A 3HR9A 4FPOB 3IM0A 4RA0A 1QF3A 2KM2A 4P14A 1W0OA 4XYXA 2CWMA 5CAZA 4Y24A 1Z78A 1SACA 4W65A 4XILA 2EALA 1LHVA 4XE9A 3WDXA 2ZGTA 4GWMA 4HL0A 1LOGA 1BJQA 2HYKA 3OY8A 4KBBA 1SLTA 1AXKA 2GNBA 3PVOA 2A6WA 4NOTA 5T5OA 3FLRA 4UW4A 2ZGNA 4AGVA 4AYUA 4YW3A 5GLTA 1LGNA 2YY1A 1YI7A 1DYPA 1LGCA 1WCSA 3BTAA 3ZSJA 3SLIA 1GANA 2R1DA 2DVBA 1X50A 2A6XA 4P9WA 5DUWA 1YXWA 1O4ZA 1SCSA 1S0GA 4L8QA 4XXAA 1DLLA 4UW6A 2ZBJA 4XMIA 5DUUA 4FOQA 2YMZA 1GZ9A 3B00A 3D4KA 4DRVA 5JDBA 4YW2A 1PZ7A 4XTPA 3AZXA 1UL9A 2VW2A 1GICA 2WKKA 4YM2A 1AJKA 1MVQA 3BOPA 3ZYRA 2JJ6A 5DXDA 2NYYA 4LBNA 5FRAA 5DUXA 1AX1A 3WLUA 1NXD1 2AUYA 3ILNA 3MPPG 1LECA 3H0OA 3GNEA 4FPFA 4CTEA 2ZKNA 4ASMB 5H9RA 1MZ6A 1S0BA 4FPCA 4YGEA 3WDUA 1DBNA 2D3PA 2EXKA 1ZA4A 2ZGLA 2G4IA 4Z8BA 1Z0HA 3AZWA 4Y22B 2LALA 3WHTA 2A70A 3MW2A 2UWAA 2EAKA 2AENA 5EWSA 2ZGUA 2ZHLA 2ARXA 2A6VA 2WT2A 3OJBA 4C1XA 2UWBA 1AF9A 1QMJA 4FPJA 1H30A 1N1SA 1W6QB 4YG0A 5T52A 2LTNA 1GZCA 1LHWA 3O12A 4SLIA 4CRQA 3FLPA 3N35A 5SV8A 2SBAA 4HANA 1FV3A 1MS0A 2AYHA 2WT1A 1KDKA 4FPYA 1WW7A 3APBA 5JMCA 1N1VA 1WBLA 3AYCA 2P37A 3AXEA 4XHBA 2WQZC 3IN9A 4XBNA 3ZPYA 3ZSLA 4YG3A 1Q8OA 2GNDA 4JC1A 2ZAAA 2CNAA 1IKPA 1Q8QA 4F83A 4C1WA 1LCLA 4FPLA 2ENRA 4YW4A 2Q5TA 4Q26A 2FHRA 5AVAA 1F9KA 3WUCA 2ZHKA 3ILFA 4DS0A 2VXRA 2A6ZA 4XBQA 1WD4A 1QDCA 4FP3A 4FP2A 2ZGPA 4LBQD 4M3CA 4K1YA 1G9BA 3NWKA 4FOVA 3OGGA 3KM5A 4H55A 5F5QA 1YIFA 1C1FA 2DTYA 4IQPA 3VKLA 2C9AA 1CN1A 2BQPA 5GZDA 5KXBA 3V0BA 4TZDA 1QKQA 1A8DA 5GALA 4D69A 1SFYA 5DZEA 4LBMA 4AVSA 1CESA 1JYCA 3V0AA 1J1TA 3IPVB 4XJUA 2A3YA 1ENRA 2WNEA 2GN3A 2E7TA 2P3JA 1LU1A 2ZMKA 3AP9A 1C4RA 1LJ7A 4Y20B 3USUB 1HQWA 4Q8LA 5JLVA 2DVDA 1SBFA 5T5PA 2DV9A 1CQ9A 1SLLA 2PHWA 5GLVA 3N7MA 1S0FA 1FATA 1RIRA 1WBFA 3CNAA 1EPWA 2JE7A 4M3CB 1SBDA 4XBLA 5IK5A 1GKBA 4GXLA 4U2AA 1S0JA 1GNZA 3OYWA 3UK9A 2SLIA 3V0BB 4XJZA 2D3SA 1N47A 2NZ9A 3JUUA 4GALA 1UKGA 4AGGA 3B69A 1SLCA 4M3CE 5EYXA 3L2YA 1DQ1A 3FLTA 1W6PA 4YGDA 5T50A 1HKDA 2EXIA 5GLUA 1C1LA 5JOWA 1W6MA 2A71A 1SCRA 3FUOA 1KDMA 2DUOA 1CIWA 4RL7A 2NMOA
chains in the Genus database with same CATH superfamily
5FMOS 3SQOA 3FZ3A 2FBEA 2RMU1 2D44A 4JKKA 3ZDSA 4ARYA 1BLZA 4DPNA 1XSQA 3ELNA 4DY3A 3DL3A 3BCWA 2LS6A 3MEPA 1N1YA 5BNPA 5C70A 2XQRA 4URTA 1ZZ6A 4IDZA 1J58A 3K75B 4XJ9A 3T08A 2TUNA 2GDFA 4RN5A 3VKNA 3MZHA 1W6OB 1MZ5A 2VUDA 3ENRA 1DQ6A 3LE0A 3U1XA 2LW8A 4HG6B 1LOFC 3OGJA 2VG9A 4ATFA 1X8EA 2VW1A 5FZ8A 1RUD1 2EIGA 1BMV2 3RFRA 3UGFA 2CV6A 1AR83 3ALQA 4JRAA 4X8PA 5DZFA 2ORXA 3NV2A 4YZ1A 3AMHA 1LOCA 5J36A 4COZA 1H6XA 1QY4A 3WZ1A 1UOGA 3H42B 3WQ7A 1CZTA 2QQUA 1NUKA 4IEUA 2JE9A 5JI9A 4HN1A 1VIWB 1X33A 1V6OA 3F95A 4GJZA 3WNNA 5L7OC 1WZXA 1XNBA 2X29A 3FBYA 4BQXA 4CVUA 1NZIA 2Y60A 3LOBA 1DFQA 4P5HA 3UKNA 4JRLA 4LA2A 1UX6A 4DMIA 2OUHA 3KCYA 3UNPA 2BTVC 3CF6E 5FZ0A 2ORZA 4CDXC 4AK3A 2E7AA 3QBQA 3WY6A 3U37A 4WM7A 4PLNA 1GNHA 2VTFA 3QACA 4CP9B 1UXZA 3VD7A 5IVFA 1JYVA 1C8NA 3RSJA 4P9IA 5FPZA 4QKBA 3SXWA 4FQZA 4EROA 1C28A 2DUQA 3CBNA 4PF1A 1CAWA 4NIIA 3E6CC 1DQ5A 2BGOA 2WLPA 1FXZA 3J26N 3RJ2X 3POFA 4YVWB 2D43A 4BU2A 5IVBA 2JG9A 4UFIA 1W6NA 5LZ6A 1GWKA 4E8DA 3IDEA 1UOFA 4Z82A 3H1MA 4Z2WA 3KVBA 5FCCA 4ARXA 2VZRA 3VZLA 3ZSEA 5LA2A 2FDIA 4JGYC 5KHIA 2ZGOA 4W50A 1MEC3 5CB7A 1M06G 4HZFA 1N1TA 1UZ0A 1AXZA 2Q1ZB 3WHUA 3S0MA 4KWLA 4Y33A 2FZ1A 1QJU1 1ULGA 5C8CA 4OHWA 3VKOA 3J7NA 3D6EA 2DFBA 1RUJ1 2ZOEB 5CFDB 3ILRA 4RS5C 1AR73 4LOSA 5FFOC 2B39A 2VY0A 1CVNA 1W39A 1VBA3 4WM7B 1MS9A 2DURA 4V2VA 5JI7A 1PVXA 2V5YA 2WS93 3LAGA 2E53A 3VDCA 4ZHNA 3RYPA 3UESA 3T2QA 1HJGA 1XE8A 1RMU1 3WDWA 4MGSA 1H2NA 1NCQA 1C3HA 1MQTB 3VBRA 3ZYHA 1QJZA 2RG4A 3ZN6B 5EV7A 3MHZA 3K48A 4Q29A 2OPWA 2D98A 1ND2B 3SEEA 5CIRA 4EWEA 1IGOA 3B02A 5FO7B 4RSUA 1HXS1 1W8NA 4HVQA 4CU7A 3BB6A 1QJY1 4FXGB 3H8OA 5IT6A 3AZVA 4QGLA 3ZO0B 1VALA 3ME2A 3THDA 5FZGA 5H9SA 2F17A 3N9NA 1KJLA 1FMD2 2OVUA 1COV1 2DYCA 2QKDA 3AM2A 3WV6A 5FMCA 5LA9A 3WG4A 4E27A 2ZAHA 1UY3A 2C9KA 2QQMA 4Y1XA 2QQLA 1XB9A 1XC6A 3PU3A 4ES8A 2FDFA 5FY0A 2VO5A 1W9FA 2AEYA 4AI0A 3EHKA 2XJTA 1V9U3 2HEYF 2YZ4A 3LIGA 2W1SA 1UXXX 1KFXL 3RI9A 5BNOC 3C3VA 1V70A 4ISQA 2A6YA 5LY1A 5CFDC 2ZGQA 1XXNA 3H3ZA 2A5ZA 1W2AX 3OUHA 4YPJA 1G9FA 4YWAA 5FLJA 1Q8VA 3USSA 3PIGA 2R49A 3H7JA 4GMP1 4Q0VA 2W3JA 4ZKTB 3TNPB 5A3LA 4B7EA 2D6KA 3N7KA 4QQPA 3M4FA 4BMBA 1MACA 3T1MA 2GNMA 1XOYA 2A3XA 2P3IA 3A7QA 2WFPA 3CDZB 3B3QE 3ST7A 3WP3A 4BIOA 4JGZA 3T1LA 1O5UA 3O1SA 2E33A 1YFXA 1QJU3 3PJYA 5FAXA 4P9JA 4BQ5A 4XW3A 5JCTA 4CXXA 1HV0A 2RMU2 4UW5A 3RYKA 2J1SA 4YFZA 4BXSV 2IC1A 1QGLA 1GLHA 2VBBA 2XJVA 4KG8A 2QQIA 2YFUA 1V6IA 3B9IA 4YGBA 5FLHA 3J7HA 2NMNA 4JAAA 3OBZA 2EXHA 2Z2SB 2EXJA 1SDWA 3MLLA 5T5JA 2C1FA 3H8UA 3LIHA 2XPJA 1LKNA 1F5FA 3FX3A 4MVTA 3BTXA 4NIDA 4DQAA 1KGYA 2IXHA 3PL0A 2LROA 1V00A 4RYDA 3KVAA 1W9WA 4GZ9A 3GZEA 5FXWA 4CP1A 5T5LA 1W6QA 1CONA 1DZRA 1LOFA 3N9LA 3VBFC 3ZXJA 3ETPA 4LR4A 1ZBA3 1TNRA 4RFRB 2FMDA 1WA6X 2XONA 2E7QA 3USUA 3U4XA 5IAVA 4FOYA 2JICA 2O8QA 4LE3A 3U75A 1EV12 2C6SA 5DG2A 3KWVA 3SH4A 1OHFA 3VHRA 1ZM1A 3WVJA 2A7AA 5A3UA 2Z4FA 2PTMA 1W8WA 3N3HA 3WF1A 1CAUB 4XDOA 5EQUA 1RUG3 4BHPA 1OSGA 2GC2A 1ENQA 1LOEA 5I8TA 1PO13 3KHBA 5FKCA 3VHOA 3IMNA 1DP0A 4C0BA 5FOJB 5E16A 3AP7A 2P5BA 4IESA 4CDUB 4EN6B 1ND2A 2NN8A 2PELA 5C4WB 4YVSB 1VAKA 1LNSA 2RVAA 3GDBA 1EY2A 4BYYA 3LEKA 4CDWB 3T30A 1EV13 3HEIA 3VD5A 1GP4A 1LHOA 1O91A 2WLQA 4WM8C 3B9CA 2KR2A 1JZ2A 1D0HA 1DGRA 2PA7A 4IV3B 4N8MA 1TMF2 5C3RA 4OHZA 4NIAA 2OXBA 4Y1VA 5CEHA 1SPPB 5F8PA 4IE0A 4YVSA 1W0PA 2PHFA 3I7DA 4LLFA 3NMBA 3JQXA 3I49A 1QJX1 3O1OA 2ZHMA 4Q4W1 5ABJC 1DQ2A 2RDNA 3W58A 3M70A 2CTVA 3MIGA 1FAYA 3ES4A 1LB2A 5JZGA 2WUHA 3OBTA 2RMU3 4COYA 3D82A 3MIFA 4I0AA 2UY8A 5GZFA 2RHPA 3AKSA 3W21A 5A33B 1YWKA 5DZGA 3BI3A 5FP3A 5CADA 4P9LA 2BPA2 1SFNA 2VNGA 3IPVA 2JD4A 5FZ7A 4GMP0 3ZSMA 3ACFA 1S2KA 2EIDA 2W9XA 4I02A 1OFNA 4IE6A 4U36A 2WL1A 2CYFA 1ULEA 1ZRRA 4K20A 5AFEA 4HSLA 1HRI3 1S2EA 2IFWA 3I3EA 3O1MA 1JYIA 1I9RA 3A4UA 2VJXA 2R043 3PJQA 4AFCA 1LHUA 3R4UA 1JBCA 1D2QA 3WF2A 4ZPIA 4G9SB 2ET1A 1V0AA 4MGKE 2ERFA 4XQWA 3KMHA 2D97A 2X5IC 2NP0A 1LU2A 5FZBA 1JXNA 1NLSA 1UO9A 1DZTA 1IS4A 1ZNPA 1W2OA 2GALA 5I91A 1LEDA 4QX8A 2EIEA 3JQWA 4V1PA 1JOBA 4GIQA 4KU8A 3E5XA 1BMV1 1OF3A 2PHTA 2VZQA 2JB8A 1A8MA 4CDQB 1ULPA 3O14A 5A7NA 3VDDB 4IUGA 4B4QA 1SDDB 5IK7A 3T2PA 5HCBA 1OH4A 1OUXA 5FQ0B 3V65A 1F15A 5C9AC 3P1IA 1UWWA 2CU5A 2HWF1 5FZ9A 2QUOA 1VMJA 1AX0A 2VTXA 3E1F1 5HCFA 3OGSA 3WNXA 4EE2A 3DCQA 4AAPA 3C8XA 1YQ5A 3IM0A 4MGZE 3ZIXA 4RA0A 5LBBA 1QF3A 1ZZ7A 3WINE 4P14A 1WMFA 2XKOA 3HQXA 1VJ2A 4W6XA 1J1LA 3U4SA 2CWMA 3MFCA 4JGZC 4AOCA 1W3VA 1SACA 4OI1A 4W65A 3RJRA 3DKWA 4S2FA 3TYJA 4URAA 4NHKA 4NRQA 4J1WA 3PVOA 4LHSA 3T4VA 4Y4RA 4IETA 5L9VA 5FYZA 1HIXA 4YSFA 1YI7A 1LGCA 3J4UH 4MUVA 4OLLA 3VBUC 3ZSJA 3DYOA 1SFPA 1GANA 5B4XA 1UMHA 1X50A 3KGZA 4RS5B 4P9WA 3L2HA 5DUWA 4CDXA 2YC2A 5A7OA 4GH4C 4HKLA 4UW6A 4XMIA 5F2WA 3PUAA 3NSTA 4Q0PA 4H7MA 4DRVA 4QXCA 5K0UB 4MSVA 4IEWA 2RM22 4DY5A 4JKMA 3FWEA 4KBZA 1UL9A 2VW2A 2WKKA 4QQLA 5EJ3A 2RS33 3F2ZA 1AJKA 1MVQA 4XF1A 3ZYRA 1VP6A 5FRAA 2QBXA 1RUNA 1IQDC 2XWJB 4UFHA 2AUYA 3ILNA 3BALA 1AHSA 2V09A 2CGOA 1UKRA 1S0BA 1AYM1 1GMMA 2C4XA 2N7GA 4YGEA 1QJEA 4NUBA 4Q4W2 2ZGLA 1ZA4A 3L9JT 1PK6C 3DV8A 2G4IA 4Z8BA 5A6ZA 4MLOA 3ZLIA 5ERLA 3CJIC 1OD3A 1HV1A 1WWYA 3HBZA 2UWAA 3IAQA 4XC9A 2AENA 3PUSA 1Y9MA 5FPVA 5JSRA 2DCTA 3WNOA 1RHI2 1QMJA 1H30A 4LT5A 2PQSA 1QXRA 3OSDA 4HKWA 2HWE1 1LHWA 2AACA 3ZMOA 4R8HA 3N35A 3K3NA 4R4ZA 2SBAA 4N53A 4CXYA 4FPYA 1KDKA 1FOD2 1PMHX 4PJYA 2VMCA 1DYOA 2BRTA 3S7EA 4P02B 2ZKLA 1WBLA 4Q4W3 4AHZA 4YVWC 5J09A 3NNJA 1CIYA 4LIVA 4NHYA 3WSOA 2ZS6B 1FPN3 1PO23 2GNDA 5BXXA 4LHLA 3I3MA 3NNFA 2CNAA 1Q8QA 2AZ5A 2HEWF 2WIIB 3HJRA 2QQVA 4IL7A 3SHRA 2G9GA 4XFGA 2YC0A 1TG7A 1XU2A 1K5MA 3WXPA 5K0UC 2XLAA 5FPXA 1PGL1 4XBQA 3SC7X 4FP2A 3WQBA 3OGGA 4C0HA 3KM5A 3POEA 4XDPA 3U11A 4YW6A 2GC0A 3VLBB 5LWBA 2GH2A 4DEQA 5ISLA 4AQTA 5A32A 5KXBA 4DINB 3DF0A 2J1RA 1PMIA 3MLKA 4CP0A 4Y4YA 3CJXA 2CSGA 1J1TA 3IPVB 1W99A 3ACIA 4QDQA 1NX9A 4A6OA 1AR61 2WNEA 2W1UA 3JBG2 2E7TA 4DO0A 1YQCA 1DGWX 1LU1A 2ZMKA 3EBRA 2BEOA 3AP9A 1REEA 2R062 1SBFA 2BBVA 2QQNA 5I0UA 3N7MA 4I3GA 1UF2C 1RIRA 4BWOA 4BQ3A 5FKBA 2GAUA 3AKQA 2J1EA 5I8SA 4LEJA 3N4MA 3ZYJB 2BDRA 4B1MA 3FBMA 3Q8FA 3LD8A 4HK8A 4XJZA 3JUUA 2ARAA 4GALA 4AAXA 4AEDC 3RZKA 4AQ6A 2BW8A 3C7OA 1JODA 3D3AA 1SLCA 4CCNA 3R6SA 1W05A 5DDJ3 4XF9A 3DXUA 5IYYA 2VCCA 4IEZA 4L11A 1C1LA 2A71A 2PN5A 1SCRA 2WDBA 1KDMA 4HK9A 2DUOA 1NAEA 2B5HA 2FCTA 2DCJA 4IV3A 4OUMA 4RQPC 4LO8A 4MV2A 4W6YA 5D21A 1RUI2 4MX3A 1RUC1 2MNGA 4LBQA 2EICA 3IBMA 3KT7A 1RUH3 4UW3A 5EJ1B 5HBAA 1EUTA 1W6MB 2D6PA 3MW3A 3IIIA 2BFUL 1QJX3 1UYXA 5IK8A 2Q4SA 4NPLA 4HKOA 5KHHA 5GJ6A 1O8SA 1D0GA 1W9YA 5GKAC 4GKXA 2HWC2 1MZEA 1W2NA 2BFUS 5LRRA 2A3WA 5C8WA 2GN7A 4D6RA 3UGHA 3ECQA 2RV9A 4Q1RA 3UT0A 3VD4A 4R9AA 1F2NA 3AL5A 4CDWC 3VDDC 2P4EA 2D6LX 3HMYA 1RUF2 5L19A 3LWCA 2FMYA 2LM3A 3GCXA 5LA0A 4LOTA 3IKWA 1I3HA 1ULFA 2W92A 2Q30A 4ES9A 5FP4A 2XXZA 5FY1A 2FCVA 4HN0A 4XJAA 3WNMA 4B3NA 5K0UA 5C33A 5KHJA 3VUOA 3CO2A 1KXGA 1Y9GA 1O3QA 5DAVA 1WLCA 4QB2A 3THTA 1BVP1 1DQ0A 1RC6A 3JBG1 5D8AB 1FPN1 2Z42A 4FQ4A 3VV1A 2I07B 2HWC3 3ACGA 1KITA 1NG0A 2BP6A 4CPBD 5B4NA 5K7PA 4YW5A 2DTWA 2VGDA 2KA3A 4QQ2A 5J96B 3ZYFA 3MI8A 5SV5A 1V6LA 3SMHA 1BKZA 1HDKA 5EYYA 1V6KA 5FZIA 1CAUA 4MG2A 3Q8BA 5JAXA 1YFYA 2F4PA 1VRH3 3GZTB 3VBRC 1BBT1 2O0OA 4DB5A 1M4WA 2JB4A 5JR2A 4N43C 4YM0A 5C4WC 5G05L 3JD72 1GQHA 4UFLA 5C3QA 5C8CB 1F5JA 1HN0A 1VB4A 3SEPA 2JD9A 5DDJ2 3V64A 4CU9A 4QKDA 3WDYA 2J1AA 2WSUA 4AQ2A 4XJWA 1PGSA 3C7GA 2GMMA 2P3YA 4Q4V3 1EPZA 1R082 3V0AB 3OEBA 3VD3A 4KWKA 2VULA 3DPRB 5FK8A 3GJBA 5C8CC 2R30A 1CZSA 3FFZA 3DYMA 4BLIA 4ZXEA 1CAXB 1GYKA 1BQPA 2HWE2 2OIIA 3OTFA 5FZLA 4AEDA 1G9CA 1OA3A 4AR2A 3TEZA 4OMCA 1DLCA 4DUXA 1SLAA 4DRRA 2C26A 1UZZA 5HCHA 3UV9A 5FK7A 4JVAA 5D1IA 1CPMA 4N9IA 4CP9A 4I2OA 2NPIA 4QX2A 1GQGA 1OC1A 1GFF2 4LORA 3TWIA 3AZZA 4NVPA 2JKBA 3E6BA 4DXZA 3TBDA 1UAIA 3VZMA 4UT5A 1SPPA 3S57A 5A6XA 3TN91 4E9KA 5IFPA 1DDLA 3DYPA 4KWUA 3MIDA 4LKSA 5FZFA 1BK0A 1JZ4A 5F32A 1QNYA 1OPOA 1VBB1 1OQDA 2I2SA 3AKTA 3KQRA 4S2GA 3NAPA 5A80A 3UYJA 1H9WA 4LLOA 4XXPA 3WDTA 5CISA 4HVOA 3E5UA 2WQ4A 3PIJA 5EXOA 5FPAA 1KRIA 4HXCA 2JE8A 1QJY2 1GQPA 5IHRA 1W8FA 1EAH1 1UCXA 5CVRA 2HWC1 5EIYB 3I59B 1O59A 4D7SA 4FPGA 2R042 3HQUA 5FZHA 2VD7A 2F4LA 1PX3A 1XQNA 3J7LA 1MVEA 3R4DB 4H14A 2YROA 1AX2A 2RJLA 1AJOA 2QDNA 4KQ7A 4I3PA 5A1AA 1CAVB 4DOUA 1DGRN 4YM3A 4AVVA 3K2OA 4GB31 4NR1A 1KFUL 1VMHA 1JMUB 1OVPA 4LBJA 4Y20A 4AEMA 4CEYC 1ZRDA 1H2KA 3AYEA 5CFDA 3O1VA 3UGGA 1QNWA 2ADEA 5FY4A 1GWLA 3HIFA 3M2MA 1QHDA 2WWJA 5H9QA 1LAJA 4NN0A 2UYBA 4OQ9A 3TEWA 3BKZA 3I2OA 4IV1B 2JG9C 3EJKA 2XLGA 3H1WA 5BNPC 4YG6A 1QXJA 1WW5A 2JDZA 2VOKA 5APAA 5A70A 4QB1A 2QVSB 5ACA3 3ZXLA 1DZQA 1KQRA 4HVRA 3HNBM 2NM1A 4UFJA 1G9DA 4PIZA 1AR71 1SLBA 3KQ4B 2E32A 2Z5WA 4TXWA 5F9TA 4UBGA 3PVEA 4EN0A 1G6NA 4AI8A 4WZCA 2B9VA 3B01A 1GBGA 5HV0A 4LTAA 3URFA 4MGYE 2QQWA 3PVNA 5I93A 1UY2A 2P1BA 1RUE1 3LFIA 1ULDA 2WNOA 2VXJA 3LZZA 2J1TA 5FMBA 4FOWA 4Q4Y2 3MIBA 3SKVA 5FZAA 5I0RA 3WW2A 2TEPA 2NQYA 3H7YA 2XBO1 1A34A 2VZVA 3EQEA 1YYNA 1MS1A 1H8TB 2ZABA 3AXDA 4QHBA 4WV8A 1APNA 3E5QA 2BV4A 3LQCA 1NOVA 2H0BA 1RUOA 2PYTA 3I2FA 1FMD1 1CJPA 1YIPA 2RJKA 4BQ2A 1RYYA 2W47A 2RM23 1NT0A 3ACLA 2R1BA 2Q8EA 5CA6A 4LKDA 3M3CA 1K42A 4FI9A 3ATGA 2D3RA 5EFUA 2P3KA 3PNAA 3UKTA 1ND3A 5IUQA 2VMDA 2VOVA 3ASIA 4CCLA 2RS12 3N9PA 1XBFA 4JKLA 2MEV3 4Y1ZA 4KI5M 3RZZA 4AFAA 3GXUA 1NA1C 1NCQC 3BYWA 3DPRC 5GZEA 2Y34A 4O61A 4P9XA 4B4RA 5LBCA 2WRAA 3SH5A 3HT2A 1UY0A 4ZU7A 2Q1FA 2ZA9A 4AWDA 2R16A 1I1EA 3SCHA 1MR5A 3CEWA 4BK5A 3NAPC 2WN2A 1GZWA 4RHV3 1NA1B 5T55A 5KXDA 4FXKB 5I8YA 1IS5A 2ZEYA 1B09A 4I30A 4M4RA 4PLMA 1NKGA 1SMVA 4S2HA 2ZX4A 5FREA 2I45A 4EYUA 4QHZA 3LEIA 4FPEA 1S0DA 4WM7C 1AZDA 1QEXA 1RUG1 3NJXA 5F5CA 5FP8A 1J3PA 5BYNA 5FWJA 5K4LA 2EA7A 2PHXA 2P6CA 4FTEA 1ALYA 4IGPA 3ON7A 1WD3A 4JCKA 1G7YA 2R063 3QCWA 5FYYA 3AP5A 1LEMA 3GALA 5FBZA 1OA2A 3AJZA 1RUI1 1RMU3 1DGLA 4NO4A 4NPRA 2WS91 1L3JA 4QMAA 4PIYA 4Q4X1 5E88A 3VBOC 1Q8SA 4WVMB 1D4M2 4EJRA 4N43B 2HWD3 2WABA 1BYHA 2P34A 3CMGA 4Q2FA 4BE3A 3TEYA 4MHUA 4CCCA 3OF1A 2VUCA 3JCIA 4FFGA 4OCTA 4RD7A 1JZ6A 3VD9A 1KS4A 5KBFA 4BPZA 2VZPA 4I09A 1R64A 2Y64A 3LA2A 3AP6A 3WQ1A 1K12A 1LESA 4XQ4A 2DU1A 1PGW2 2V73A 4Y5SA 1PZ8A 4ORFA 1NXMA 1W9SA 2VZ3A 3POYA 2W94A 2CGNA 1RINA 4YW7A 1VR3A 5FYUA 5JR7B 4LKFA 3AVSA 5BNOB 1EUUA 4R9DA 3AK0A 4F3JA 3A21A 4YFWA 4E2QA 3OG2A 5E89A 4XF4A 5JOXA 4NE9A 3RS6A 1D4M3 5IK4A 3C7FA 3N7JA 1W8ZA 5JPMB 3NO8A 4YM1A 5C3OA 1VBD2 4TYSA 4QPGC 1V9U1 3ZXEA 3ZR5A 2XJSA 4XUTA 4D6QA 4CUCA 4XIOA 1UIJA 4X6QB 3DGTA 4LBKA 2VTXJ 3WCRA 4D7YA 2YHJA 5BNQA 5IVVA 5JWPA 2VH9A 1TMF1 2HYXA 2K46A 4LULA 1BCXA 1G9AA 1DGWA 1FNZA 1PM7A 4XHXA 4NIHA 3SH3A 1ND3B 5D8AA 3KV6A 3NJYA 4MGTA 5FZDA 3VKFC 3VL9A 2QTWB 2YU1A 4AQSA 1ND2C 1W2TA 3GBFA 3KS7A 5FXXA 4ET7A 1POQA 1WA4A 5EP9A 1CJDA 3ZXDA 4CDQC 2ZX1A 5BY5A 4XFCA 2V5DA 4EV0A 4G4FA 3PUIA 1AR81 4FCAA 4QXHA 3VN4A 1JYXA 4NIGA 2VZ1A 4XILA 3WDXA 4KWJA 1FOD1 2WR9A 1NCRA 1NE6A 1VBB3 2ZGTA 4HL0A 5L9BA 3S30A 4JDNA 2HLEA 2XWBB 4KBBA 4L92A 3ZN4A 2A6WA 2Y6FA 1JOPA 3FLRA 4AYUA 2HWF2 1XYPA 5GLTA 3OPTA 1AR72 1LGNA 3WP6A 2EIBA 3WW1A 3VZJA 5LY2A 4WBBA 4JZRA 4DUWA 4PLOA 1SCSA 1S0GA 2GH8A 2O1QA 4L8QA 1OXCA 5FYBA 2JIJA 1GZ9A 2OA2A 2HWE3 3B00A 3CLPA 3D4KA 3AB0A 4PQQA 1NY71 1PZ7A 4E4DX 3BTYA 1VBD1 3AZXA 4B4PA 4DXSA 4YM2A 2J1UA 5DXDA 4LBNA 2ILMA 1OLQA 4MXVA 2DF7A 4QPGB 3WLUA 5FMOL 1ASJ1 1YQ2A 4FPFA 3GNEA 5EPAA 2FD8A 5LA1A 3VDBA 3JB4C 4XFFA 1JZ3A 4MH0E 4K7JA 3D0SA 4LKEA 1DBNA 3LB9A 2EXKA 4AL9A 4EWAA 2WFF3 2J42A 1RVF1 1UYYA 2Y6KA 3DECA 3D0JA 4GB32 3KCXA 4MGQA 5FUPA 2PXJA 2GU9A 5FIXA 4XETA 4CCOA 5CZKA 2ZGUA 2ZHLA 2A6VA 3MFAA 3GBWA 2UWBA 2X8KA 4FPJA 1VBD3 1N1SA 3LF7A 2CAVA 2LTNA 5BNNA 3I2KA 2O8OA 3VBHA 2OYZA 4XUNA 4CUGA 2XJUA 1FV3A 2VQTA 1MS0A 2G1MA 2H6BA 3AKPA 3FHQA 1WW7A 2DFCA 2RS52 4KGGA 4NWWA 3ZN6A 3KV5A 4OZOA 4LA3A 1JZ8A 2W46A 3IMMA 1E5RA 5FYIA 1RMU2 4CEWC 3ROUA 3IN9A 5JIAA 1MQTC 4XBNA 3ZPYA 1D7PM 1MPXA 1Q8OA 2WZ8A 3VDDA 2E9QA 4UF0B 2W0XA 4AVBA 3MV01 5KHGA 2ZZQA 4OVEA 2BNOA 2GC1A 3T09A 2WZPP 1RUH2 4FPLA 2ENRA 4YW4A 2Q5TA 5AVAA 2FHRA 3WUCA 3ZYIB 3I3DA 3K46A 4LO7A 3VBUA 4QX3A 4DS0A 3JB8A 2Q8DA 3H1YA 2RS11 1WD4A 2X05A 5FUNA 2AEZA 2BGPA 3PUHA 4K1YA 4FOVA 4M3CA 4OQ8A 1EV11 4H55A 4BK4A 2C9AA 2VCMA 4OFGA 4XFBA 1J84A 1QKQA 4IV1A 1B35C 1YC61 5GALA 3UKVA 1Q43A 1JYCA 2JG9B 2YPDA 3NNMA 4AG4A 2PHDA 2P3JA 4D6SA 4IE7A 4LUKA 2XBO2 1C4RA 1GUIA 2QDRA 3USUB 1TVGA 1HQWA 4Q8LA 1VE0A 2DVDA 3LDRA 5T5PA 2DV9A 2WS92 3ZXGA 1Q3EA 5GLVA 2VQUA 4ASLA 5DMYA 4V2WA 4OUSA 4CUBA 1WBFA 4MXWA 4CCKA 2WO1A 4RGGA 4M0HA 4XBLA 5JXGA 4RGKA 4PDWA 1GKBA 5IK5A 2IXLA 2ZX0A 2VVDA 4QWNA 2PAEA 2SLIA 5A32B 2JX9A 2XMLA 1UOJA 2VOTA 2IVJA 3LFMA 4ZZ5A 3VB9A 3BU0A 3BPZA 1UPIA 1W04A 3FLTA 5A6YA 1E57A 2EXIA 2GC3A 4DUVA 1C5HA 3NJVA 4LITA 3N9QA 2XBO3 1WCUA 2VCBA 5JOWA 2WINB 2JXAA 4R52A 5DABA 4NRPA 4Q4X2 2IUWA 3JD73 1VMFA 4PI2A 4CDWA 5J37A 3K51A 2W1WA 4RL7A 4XEZA 2OKXA 4C8DA 2FDHA 3K4ZA 3IB3A 3KT1A 3CU7A 4FAGA 4QU1A 1SQ4A 2ZHNA 5CKMA 1BEV1 1AXYA 4YGCA 3ZFFC 3AP4A 1FYUA 1R083 4XUPA 1DIWA 1V6MA 4CXWA 5JIUA 1VBC2 2FDJA 1QOTA 1H8VA 3BN6A 4LJHA 4NWVA 3OGRA 3CL1A 3AKRA 2PFWA 3PLQA 4P5YA 2JDHA 2ZGRA 4HONA 1AL0G 2BZDA 5ACA1 1OF4A 2D5HA 4DNYA 5LEKA 1PVC1 3WF0A 5IATA 1ONAA 3HNYM 3NVCA 3RZMA 3RDIA 5ANNA 3ZDVA 2CL2A 3QOPA 2PHUA 4N43A 2D6OX 3GBGA 4AEDB 2RDSA 3TAYA 3IDAA 5FPLA 3J9SA 5JZGB 2W68A 2XJPA 4B8EA 5TSWA 1ZYBA 2GP5A 1IG0A 1HRI2 1O8PA 4PQ9A 1HXS2 2JDMA 5ABJA 1TNFA 5L73A 4BDVB 1SEFA 5BNPB 4CEYA 3OD0A 4F8AA 2Y26A 1AYN1 1FPN2 4EQVA 1US2A 4HT1T 2WZR1 3ZFFB 5CKNA 1RL3A 3WP5A 1JYWA 4XMAA 1UN1A 3IWZA 5JVVA 1HX6A 2XJQA 4BQWA 1LRHA 4XCBA 5FXZA 5A6QA 1NCQB 4B7KA 2AGSA 1BEV2 1HB2A 2H0VA 3PHMA 3U14A 2WNUB 3OD4A 4R9BA 2Q8OA 3THPA 4ATEA 4W4ZA 3U10A 1R1A3 1EAH2 4KH9A 1QJY3 1QWRA 3A0KA 5JOYA 1HXS3 2JG8B 1NLQA 3LPFA 4PHZA 2CAUA 2VW0A 1KEXA 1R091 4XF3A 1YRZA 1OPMA 1PMJX 4FT8A 2HEVF 2WO3A 2BWAA 1O6UA 1HN1A 4QQHA 4LK7A 2O14A 4UYBA 4MXWB 1RHI1 4F7ZA 4R9CA 3KHCA 4NHMA 5C5UA 2CDOA 1C8M1 2YYOA 3HQRA 2XUMA 3R0RA 2OUJA 3LSDA 1H4GA 2JENA 4Y1YA 4AVCA 3WG2A 3B93A 2VMFA 3I2IA 4QPYA 3H8XA 1LODA 1VBE1 4LBLA 2JDPA 3KV4A 3MUZ1 2ATFA 1PIV1 1Z7S2 2J22A 4GJYA 5L7OA 3WX5A 1QJX2 5DQ0A 4B1LA 3O1TA 1RXGA 4A7ZA 3RG0A 4TN7A 5IVCA 1ZBE2 2E51A 2R0FA 1CPNA 4UI9L 3VBFA 3RRDA 5L36A 2YGMA 5C7GA 2VCAA 4IV3C 1S0EA 3HOBA 1ZX5A 4PCRA 3O1PA 1RUG2 1K5MB 4AVAA 2B8MA 4Y22A 4I0WB 1J3QA 3UETA 3M3OA 1U5ZA 3BIEA 4XF0A 3DN7A 1H1AA 1PIV3 1GOHA 3JZVA 3NNGA 4Q4X3 3O5SA 3A23A 3FL7A 3M3EA 4CUAA 2R7EB 5F5AA 3H3LA 3MYXA 2VMEA 2W2IA 1F35A 2PAMA 2EF6A 1C8M3 1HB4A 2FCUA 2VOXA 5GLZA 3WDVA 4BQYA 1VRH1 2R061 1KS5A 4IW3A 2AR6A 3AX4A 5J7MA 1YQ8A 4O65A 1C57A 1JOJA 3GHNA 4AE2A 2HKXA 4GWNA 1WGPA 5F5IA 1MZFA 4ZS3A 2DVFA 4N9HA 5FOBB 1TME1 3E97A 5JXHA 4OUEA 1S0IA 1ZRIA 2K9ZA 1QJFA 2IXKA 3NRUA 3P5BA 2Y38A 3VBRB 5LRSA 2VR4A 4XOGA 4EN9B 5JOZA 4AGRA 2JKXA 4YARA 3LA3A 1POV1 1RITA 1S1AA 1YJLA 1OKQA 3BODA 2OZJA 2WT0A 1S4CA 1PVC2 4L97A 4CCEA 1F8VA 1LGBA 4YW1A 5AC93 1EAH3 2VVEA 3BVCA 2IZWA 1O4YA 2D93A 3IAPA 3RMXA 2WZR3 4OI0A 1HQLA 5CBLA 5HI0A 2J1VA 1PO11 4QB6A 1JU4A 2E31A 4CU8A 1W8TA 2ZMNA 1XNDA 2BVVA 2YPJA 1W0NA 4MGIE 2UWCA 3AYAA 1PHMA 2XUEA 4K1ZA 2B9UA 1IPJA 2W39A 1X36A 4XJ8A 4ZU4A 4LO4B 4DXTA 2CHHA 3ITQA 3TN93 1WKYA 1Q5OA 4W6WA 2FQPA 4RR3A 3GF6A 3HN3A 1WCQA 4LBQB 1QOSA 5FZEA 2ZXQA 5C9AB 1PVC3 3WG3A 5CFCC 4XTMA 1A3KA 1UPSA 2Y6HA 3W59A 1XRUA 2YC4A 3POBA 1OT5A 4XDQA 4CDUA 5FBJA 2AREA 1RUJ3 3M7AA 4Y26A 4NMIA 5K8SA 1RUH1 2ZGSA 3POJA 4D0QA 4XZUG 1R1ZA 1WW4A 4NROA 4UXAA 3VBOB 3J8F1 1DQ4A 1FNYA 3I54A 1W6PB 3AMMA 3CZUA 1UZYA 3BGAA 2DCKA 4QAWA 3WG1A 2XOMA 2WJSA 4XAEA 1N3OA 5C9AA 3AMQA 1XSRA 4ITCA 1OMIA 1PK6A 1UU4A 4O9EA 4QXBA 5FY8A 4LO6B 5FJKA 2WAOA 3WW4A 1H4HA 3JXSA 5IVEA 1VBE3 4J6GA 3WR0A 3WCSA 1O7FA 1UMZA 1IS3A 3QLQA 2XQXA 2ZEZA 3M3QA 3CIHA 1FX5A 1H2MA 4HMZA 2A75A 4QD2A 5DN2A 1B35B 3ZYPA 5F6LB 3MIEA 4PIXA 3PURA 5K9YA 1JH5A 2TNFA 1J59A 3S5QA 4FBFA 5C3PA 5KXCA 4TSVA 3R05A 3VBSB 2Y6GA 2D7FA 3C7EA 4H2AA 2JECA 1VBA2 4DXRA 4AHYA 4RGAA 5J98B 3W5NA 1L7LA 1I5PA 4RHV1 1RUD2 3R4SA 4XFIA 4NAOA 3I2DA 3WQ0A 2WWUA 1DYKA 5FYTA 3GZAA 1ZREA 4ZONA 1POV3 3Q9OA 2CDPA 3I2HA 1QXPA 2UURA 4BB3A 4CDXB 3I3QA 4K21A 4QPIB 4YYOA 3WNKA 2BNMA 3S5AA 3BUCA 1R092 1P8JA 3OOXA 2VBDA 5C5TA 4PDWC 4XUOA 4FSJA 1JTZX 5CFCA 4HFSA 2D5FA 5FYCA 2IXJA 3O7OA 3Q8CA 4RR3C 1UIKA 3RGBA 4CPBA 4DZGA 3HNMA 1CR7A 4Y1UA 3PMSA 4BLJA 1VAMA 1W2UA 3I3BA 2YV8A 2F6BA 1U5YA 2XHKA 4UFKA 4MADA 5I0DA 5FZ3A 3RYRA 3S7IA 3OPWA 1CD3G 4EWDA 1HB3A 3ZR6A 4AXOA 3A0NA 1AR82 2WSVA 1BVVA 4QKFA 4WVWA 3IIAA 1JN2P 5JXJA 3M8LA 1L7RA 1UZVA 5FV3A 3AL6A 4BOWA 5FO9B 4O7XA 3ABZA 5E1RA 2R0HA 2PAKA 4XFAA 2K2SA 1W9TA 3GJAA 3ZFEB 2JEMA 1H0BA 1YFWA 5A3WA 5L7OB 1GP6A 4ZXKA 1RUJ2 3QH6A 1N3PA 3K77A 3RMYA 3EMRA 1ZA7A 5FZ6A 4Q4V1 1WLDA 2QCSB 1PGL2 2E63A 4YZ2A 1FI2A 2WNVB 1Y43B 3PUQA 4AVTA 1SLIA 4META 3INAA 1ASJ2 1Q56A 1JUIA 1PK6B 1QQP3 2XDVA 5A7WB 1H1MA 1MQTA 4CYDA 5D8AC 2IVIB 5GLWA 2K0GA 5A3OA 4JGZB 4DEVA 1RUC2 3GZUC 3MW4A 3KT4A 1POV0 3ES1A 4S2DA 3ZYGA 4GULA 4FVVA 4GH4A 1VAVA 1LTEA 4IEQA 3FHIB 1H9PA 2XVLA 2CY6A 4A3ZA 5GZGA 1YEWA 1AR91 4CU6A 3WUDA 3U78A 2WNVA 5IWFA 4GB33 1YCIA 2W91A 4BH9A 2CWSA 3FMGA 4FFFA 4MO3M 3NV4A 3AZYA 3NKGA 2YFZA 4CA9A 3EYPA 1OH3A 2XB6C 3LDBA 1IKQA 1LHNA 1YQ6A 4X8NA 3ORJA 2RDQA 4OI4A 5C3SA 2ZTNA 2X09A 3AMNA 2KM2A 4XYXA 4QGMA 3T3YA 1PIV2 1Z7S1 4AZZA 1UX7A 5KHKA 2PQQA 3T0AA 4MHRA 4AI3A 2VPVA 4K8FA 4RHV2 4AEKA 4XE9A 1ACCA 4GWMA 1RUD3 1LOGA 5IVYA 1BJQA 2WZEA 3T0DA 4EZ4A 2HYKA 3OY8A 1SLTA 2GNBA 5DAWA 5J48A 1C8M2 4UW4A 5T5OA 2ZGNA 1H1IA 3DEMA 4YW3A 1OBNA 1OLMA 1TE1B 2YY1A 2BGCA 1DYPA 1F4AA 3B7MA 2XJRA 3VZKA 3RZHA 3MDPA 3HAGA 1IZ3A 2DVBA 2R1DA 3PDQA 3H50A 1O4ZA 1AR92 5DUUA 4NHXA 2ZBJA 4QGNA 4FOQA 3M3IA 1XE0A 3QD6A 2FZ2A 5FZOA 5JDBA 4YW2A 3SCGA 3H8RA 1JU3A 2QJVA 2R073 1HW5A 4COVA 2MHFA 1GICA 2X5IA 3G6JB 3Q8EA 3VGIA 1OOPA 3BOPA 1UD1A 2UY9A 2JJ6A 2GSYA 1VPHA 2W1QA 2W5FA 4UOJA 5DUXA 1AX1A 1VRH2 4GD4A 3RWKX 3GYDA 3VZNA 1NYWA 4ZZ8A 1CX1A 3MPPG 1LECA 3VBHB 2BWCA 2ZKNA 1XNTA 4ASMB 3BTZA 5H9RA 4CEYB 1AYM3 4RQPB 1UYZA 2ZEXA 3FFQA 1PNFA 4K6BA 2D3PA 3SCFA 1BK1A 5EJZB 5DDJ1 2D40A 3FC0A 3WDUA 1ASJ3 1QQP2 3ZXAC 1FT9A 2DCYA 3AZWA 2P6HA 3CHXA 4Y22B 4QDRA 2DCZA 2LALA 1ULOA 3WHTA 3MW2A 1I5ZA 4ONUA 4D8MA 2ARXA 3OJBA 5FO8B 1AF9A 4WM8B 4IEXA 1RHI3 4YG0A 5T52A 4COUA 3O12A 4SLIA 5ANQA 3NL1A 4HBNA 5F1RA 5FZ1A 4HANA 4QPGA 1JZ5A 2VVFA 1NQJA 4INDA 4BISA 5HPOA 3AYCA 1DCSA 1JI6A 5M0TA 2P37A 3AXEA 4RS5A 3NAPB 5FWEA 1O3TA 5F2SA 1X9PA 1QH6A 1F4HA 2VMIA 4YG3A 2JDNA 2YDEA 1KD7A 1W3XA 1YHFA 1XE7A 2ZAAA 3VBOA 1O3SA 4DIQA 1IKPA 2ARCA 3FE5A 2HWB1 4XABA 2XH6A 4C91A 5FPUA 2ET7A 3QH7A 3K4DA 4Q26A 4FO9A 2ZHKA 3O1RA 2TBVA 3ILFA 4J25A 2VXRA 4AFMA 1QDCA 4LBQD 2ZGPA 2WFF2 2B45X 1NY72 2HBTA 3ZKYA 3A22A 5F5QA 4Q0SA 1YIFA 2JG8C 1C1FA 2DTYA 4IQPA 4Z2AA 2XHNA 1CN1A 2BQPA 2VAUA 4QDSA 4H7LA 2OS2A 4KL1A 3VBFB 1NCRC 2C24A 3V0BA 5CG8A 1A8DA 4D69A 1SFYA 4LBMA 4OHXA 4A41A 4AVSA 5E6HA 3TEXA 4XJUA 1PO21 2Z69A 3V0AA 2A3YA 4FFIA 1AR93 1BHGA 5FMDA 4JDOA 4OHVA 1LJ7A 4Y20B 5L9RA 2MEV1 1XYNA 1SLLA 2PHWA 3EO6A 4Q0UA 1S0FA 1BBT2 1FATA 4E2GA 1DF0A 4QX5A 4UFMA 4JHZA 2JE7A 4M3CB 1ODNA 2IFRA 2V72A 2RR12 4QT6A 3WNLA 3J8F2 3KLSA 4GXLA 3AMPA 2RM21 3OYWA 5D2AA 5DAPA 3UK9A 3LDKA 1ZBA1 4AGGA 1YJKA 2R32A 3T2OA 1TME2 5JLVA 1O3RA 2VMGA 3HPNA 4M3CE 1DQ1A 2WFF1 1RJ8A 4P08A 4YGDA 4Z07A 5EYXA 3S6PA 5KWRA 1JYNA 4QHOA 1DU3D 3RZJA 5GLUA 5LBFA 2JWPA 4G3YC 2DBIA 3RZLA 1JUHA 1W6MA 2YBPA 5BPXA 5FY9A 1RB8G 2WC2A 3D8CA 4COWA 2PHLA 1CIWA 4A7KA 3B69A 4FPKA 2DBNA 2DVAA 2QQJA 3PMEA 3J8F3 5C4WA 1ST8A 2QNKA 3ZFGA 4LO5B 4UWDA 2DUPA 2VUJA 5E8AA 1G86A 3AFKA 3O0XA 4N7IA 4ZU5A 5LB6A 5FPBA 5FZMA 5ABJB 5DAXA 2RS51 2C0ZA 3NV3A 1PZ9A 3UJQA 1QIQA 5FP9A 1ZBE3 4CCDA 1NCRB 5BNNB 1MS4A 2G9FA 1LULA 3EXUA 2ZX3A 5LBEA 1GSLA 4L99A 3UJOA 4Z92B 4GMP3 1I6XA 3KB5A 1WW6A 1OVSA 3OY8B 5JSPA 1EYBA 5A7SA 4TLFA 1U0AA 4FFHA 4LBOA 3VHPA 1YO8A 5FZKA 1QH7A 3VKMA 3DKQA 4A4AA 1CGPA 1CWPA 1AVBA 2Q0AA 4HLTA 2RR11 1VBC1 1RUF3 2PLV3 4EZHA 5CG9A 4IGOA 2ZGKA 4BM8A 3HD8B 2DU0A 3KD4A 5A1LA 4E2SA 2VE1A 1REDA 4N7UA 3SISA 2W08A 4RFT0 1HQNA 2JDYA 3C2UA 2IXCA 1JHJA 2OX0A 2VQAA 2ZJCA 1OD5A 5FZCA 5C71A 4Q1PA 2X5IB 3MGUA 4JX0A 1CAWB 5FYHA 3T2TA 3NV1A 4BCUA 1COV2 1W8HA 3EB7A 3ZX7A 1S0CA 2ZEWA 3WNPA 1UYPA 2VNVA 4YLZA 4E8CA 4WZFA 1IS6A 4L0PA 4O9GA 3SITA 4A7YA 4OYUA 1IQAA 2BOJA 2PMWB 3ETQA 4NAMA 3HWJA 3AJYA 5HXVA 4IERA 1TQ5A 1W28A 2QZ3A 3VHNA 2OPKA 3WOGA 2B46X 2LRPA 2RE9A 1OURA 5AC92 1MS3A 4ISRA 5LCWL 1GWMA 1JHNA 2B4KA 3POGA 4K9SA 5LATA 2HWD2 4YNIA 1LOAA 1D4M1 4Q4Y1 3VZOA 1FMD3 3OYWB 3LA7A 5JPNB 4A3XA 4CDUC 3I97A 4D7TA 1QU0A 2ZPXA 4C90A 1US3A 4H3WA 1QQP1 1RVF3 2WAAA 2ZZJA 2UU8A 4P9GA 5J3UA 4AFDA 1ZZ8A 1VBA1 2Y8KA 3HBKA 1GU3A 4J1XA 4I0BA 1HRI1 5FYVA 1OKOA 5AVPA 1T2XA 2OZ6A 4A2UA 1X7NA 2A73B 2WNVC 4XACA 1E5HA 1V6JA 1RUE3 4GKYA 3TRSB 3ZFFA 3KV9A 4E4ZA 4KG0A 1G8WA 3MBWA 1AYN2 2C5DA 1ENXA 3KGLA 1KJRA 1W6OA 4XVHA 4K3UA 1UZWA 4D3WA 2QZ2A 3LCPA 1O4TA 4OI2A 1PX4A 4JQTA 2UYAA 2B7YA 3ZFEC 1SG3A 3IDBB 3TOJA 3VBUB 2R071 5JSOA 2VMHA 3SKJE 3LEGA 1W90A 4CEWA 5CFCB 1ZBA2 1ULCA 3MF6A 1OLME 3MO4A 4BA6A 1AL21 1D2SA 1MEC2 3AVRA 3B94A 4IEVA 3JU9A 4GQ7A 2Y6JA 2WNUA 1AUYA 3MLJA 1W8UA 4M00A 1OFSA 2IXIA 1PNGA 1WCKA 2Y6LA 2V4AA 3POSA 2YG0A 3ZIWA 4FTSA 1BBT3 3KF3A 1J83A 1GV9A 1UOBA 1IPKA 3P3PA 4XQDA 1XYOA 4YZ3A 5FXVA 1XU1A 5F3CA 5LK5A 1A6CA 2Z79A 3ZMNA 2VQ0A 1HLCA 2EVXA 4JTNA 3W5MA 3GCWA 1V6NA 2BU9A 1BZWA 1RTVA 1Z7S3 5LASA 3TB0A 2VECA 2VU9A 3DXTA 3IT8A 4NRMA 3ZFEA 1OLRA 3O0VA 4PBOA 1ENSA 3I2JA 1LOBA 4P9YA 5I0TA 5T54A 4M4PA 3ZXKA 2YXSA 3ZVXA 4BQ1A 1COV3 1H6YA 2VNOA 4TWTA 1NQDA 3JBG3 4DFSA 4CCMA 3ZKUA 2YU2A 1HRV2 4YRDA 5F39A 4OHYA 4HETA 4AI2A 1J3RA 4WVMA 1XNAA 4Y5TA 2ADDA 1F31A 5FJHA 2HWB2 5FP7A 2VUAA 5CNAA 3TN92 4YVSC 1YI9A 3LSEA 1OA4A 5T3NA 3GHMA 2GNTA 4PT6A 5FLIA 2VZOA 5JUVA 5A7PA 2Y0OA 4YZ4A 1W6NB 4NPMA 2VM9A 4GA9A 5AFBA 2DWRA 1RUF1 4N53C 1MS8A 2L9LA 3DUIA 3ZSKA 1NE4A 5H9PA 1CAXA 3RQ0A 5HCAA 2IWGB 2XKPA 2HH9A 3VBSC 4ZY9A 3I2GA 3OUIA 2W52A 4AI9A 1OQ1A 1K5JA 1LR5A 4AEJA 4CP2A 5LEJA 3I4IA 1QOOA 1PO22 1XNKA 5FTTC 4YZ5A 4A42A 1AL23 4WVVA 2R041 5ACA2 2FDGA 1VLNA 4Q5OA 3NNLA 2LUWA 3AYDA 3N36A 1YFUA 3NW4A 4FPHA 4AHXA 4N90A 4M01A 5BNNC 2PLV2 4JGYB 2Q8CA 1UQXA 4AI1A 1R081 2OQ7A 2GMPA 3LPGA 4LHNA 5FZ4A 5BV6A 4LIUA 3AC0A 1IOAA 3POWA 5BNOA 1BXHA 5C6CA 3HN1A 5FR3A 3K3OA 3RI8A 2E6VA 4Y5Z0 1IHMA 1Y7BA 5DPNA 1S55A 5J1XA 4FAHA 3JD71 2ZACA 2HWD1 2VZSA 5FYSA 3UL2A 1E5IA 4RR3B 2WZR2 1D4VB 4Q0QA 1HB1A 3VBSA 1RJ7A 4Y3OA 3DPRA 4PBPA 1GZTA 3OBRA 3RWNA 4KGQA 4XIKA 5GZCA 1JZ7A 2DVGA 1EP0A 2RS32 3GM8A 1RUI3 2R6QA 1DHKB 4LUMA 5EHDA 4HSJA 4IE5A 5F3IA 3X29B 4KNCA 2R072 1LENA 4E4SA 1IG3A 3PTRB 5A33A 1WMXA 4XFHA 1STMA 5DG1A 1U5XA 2YBSA 4BXFA 1VRBA 2ZCWA 1VBB2 2GMEA 2MEV2 4IGQA 4Q8KA 2GZWA 5A3NA 4SBVA 5FY7A 1OUSA 1AR63 2BOIA 1SBEA 2YUEA 4L2NA 2WYSA 1MS5A 5A3TA 4RQPA 2JIGA 1OOPB 2YGLA 4LMFA 3MV11 4QXKA 1GR3A 2ZGMA 1WMEA 4NHLA 3H3UA 4BQ4A 4HOOA 2P2KA 3J7MA 4OULA 5A7QA 1UU5A 1RGSA 1PO12 4OZXA 4QPWA 2ID4A 4QX7A 3WF4A 4PI0A 1AYN3 1XPWA 2PHRA 3ZOIA 3O0WA 5LW9A 2XL7A 1WMDA 2JDUA 5KC5A 2RR13 4K8RB 2BYVE 2W95A 5DUVA 4XCAA 2QE3A 1CZVA 4TTGA 4HPKA 3LGRA 5GM0A 5KXEA 4EN7B 1S2BA 5B2GB 1T6BX 5FDBA 4QU2A 1H2LA 3KSCA 1UMIA 2D6MA 2JDKA 3OCPA 4JQRA 4MOAA 1CAVA 3KF5A 1WLWA 2D6NA 3SNMA 2X10A 4QX0A 3WD5A 5KC6A 2WWSA 2Q1MA 3LEMA 3OB8A 2RS53 2VNRA 3VBHC 2BVBA 4Q27A 4R4XA 4IEPA 4ASKA 2BJSA 2QQOA 5JMOA 5DAQA 2WBKA 2YB7A 3PVBB 4GWJA 5A3PA 1BEV3 3BU7A 4KMQA 5IFTA 4YVWA 1URXA 3CKHA 3OUJA 1R1A2 5F7UA 2XG3A 1DG6A 1AL22 1MEC1 1L7QA 3NQHA 3OEAA 2HBUA 3I8TA 4P00B 4XUQA 3Q8AA 1QDOA 1N3QA 4QPIC 4CCJA 4IEOA 2ARBA 3RZGA 3CJIB 4IE4A 1HRV3 3ZFGC 3ZXFA 2ES3A 1JW6A 1NA1A 1ODMA 2KXLA 1FV2A 4GWIA 4QPIA 2J7MA 3FUQA 3FHAA 5F6KA 4IV1C 3MIHA 3M1HA 5I0SA 1WUVA 2H6CA 3PTYA 1WCDJ 1TEIA 5IVJA 4XZPA 3AFGA 1YLLA 1ZRFA 1A78A 4PF5A 5A3MA 1ZZCA 1GZWB 1JYTA 1C5IA 2XGXA 2AH2A 4GAZA 2ZMLA 3D5OA 3NJZA 2BERA 4BZ4A 2G9ZA 5FYMA 1R093 1REFA 3BIWE 4WVZA 3LOIA 4MYEA 1ZZ9A 4IXLA 1PM4A 2P17A 3N7LA 3O1UA 1R1A1 5JXIA 4BMEA 4CZSA 2VL4A 4M3CF 5AC91 1PGW1 3CJIA 3OPZA 4X6RB 4BIFA 1NLRA 1H8TA 2Y0IA 5IW0A 3IZOA 3RVHA 1Q8PA 1TZOA 2OW4A 1ZRCA 3HR9A 1X82A 1Y9QA 3TNQA 2WA3A 4FPOB 5IJRA 3IDCB 5HXMA 5BUVA 1W0OA 2RS13 2HJIA 1TME3 1SZBA 3POIA 4UAPA 2GP3A 4L9BA 2JDAA 4CE8A 4LPLA 1Z78A 1OI6A 4Y24A 3RNSA 3ZYBA 2FDKA 2WO7A 2EALA 1LHVA 4LK6A 3CQOA 3VDAA 3WF3A 3P6BA 3ZN5A 3VL8A 5F37A 2W87A 4JDMA 3N9MA 4QKNA 4NOTA 5FUIA 1AXKA 2JG8A 2CGPA 2HWF3 4AF9A 5A7WA 3MUY1 2QFEA 4AGVA 2OQ6A 2XL9A 3FJSA 4XURA 3BTAA 1WCSA 3ZFGB 1K5MC 3ZM8A 3SLIA 3FN9A 2KD7A 2E26A 1UY1A 5JZGC 4M0NA 2A6XA 1YXWA 4XXAA 1DLLA 3OGVA 1UU6A 1UW8A 1W03A 1X8MA 2YMZA 3OBAA 4UF0A 1K3IA 1ND3C 4A6SA 3GGLA 4XTPA 4TLGA 1VB2A 2VZUA 4LHKA 2XR4A 1RUC3 1GP5A 2A1XA 4JHTA 5IAXA 2NYYA 1T6GC 1RXFA 4FTBA 2OT7A 1NXD1 2QQKA 1RUE2 4LQRA 3T4HB 4CEWB 5A1FA 1UY4A 3LKJA 2XLFA 3H0OA 1ZVFA 2AC1A 3PU8A 4CTEA 2WA4A 1Y3TA 2VOWA 3T0BA 2ZX2A 1MZ6A 4FPCA 4Q4V2 5CYYA 2V4VA 2B42B 1HRV1 2WQ8A 3BPSA 2I74A 2QQPA 1VBE2 2Y33A 3G7DA 1GNYA 1YUDA 3KCCA 1Z0HA 1IPSA 4LXLA 3I59A 2RJ2A 2RDRA 2A70A 2WYFA 4PDWB 3ACHA 2EAKA 2NLRA 1QJU2 2RS31 4NJ4A 4Q4Y3 5EWSA 2WT2A 2XVKA 3BOWA 3HVDA 4XAAA 4BJ0A 2BUKA 1U12A 1XJAA 4C1XA 1W6QB 3E6DA 1SHWB 4QQOA 5EZWA 1GZCA 4CRQA 5FQ0A 2WNUC 3HT1A 3FLPA 2BBAA 4QM9A 4B29A 5SV8A 3U0ZA 3ZPOA 2AYHA 2WT1A 1GOFA 1XNCA 3C7HA 3APBA 1H8TC 5JMCA 1N1VA 1V9U2 2WO2A 4AW7A 1OOPC 3MF9A 5KR7A 2VC9A 4XHBA 2VZTA 4IEYA 3W9AA 4K40A 2WQZC 3ZSLA 5G04L 1OQEA 4LNVA 2YBKA 4A44A 4JC1A 2MPFA 4F83A 4QM8A 4D94A 3WT3A 1FOD3 4C1WA 1LCLA 4Z1VA 5HV4A 3WP4A 1F9KA 3MICA 2A6ZA 5LK7B 4FP3A 4QX1A 4UBHA 1G9BA 3NWKA 3VKLA 1HJFA 1VBC3 2PLV1 1W06A 3K4AA 2BNNA 5F3GA 1ZZBA 2EAAA 2X53S 5FY5A 5GZDA 3NKTA 1GOGA 4TZDA 4W8JA 3W20A 2HWB3 5CU1A 5DZEA 4AHWA 1CESA 4JTOA 4XPVA 1X9TA 1ENRA 4WM8A 1K45A 1TMF3 2GN3A 1AYM2 4EN8B 5F3EA 3B5LB 1U5IA 3WW3A 3U07A 1B35A 1ZBE1 1NZCA 1JS9A 1CQ9A 1WLTA 4AFBA 1CX4A 1AR62 3CNAA 1EPWA 4MZUA 1SBDA 4A45A 4U2AA 1S0JA 3CZJA 1GNZA 1O5LA 4JV4A 3MPBA 5CAZA 2G19A 1Y4WA 4CDQA 3V0BB 2D3SA 1N47A 2NZ9A 1YNAA 3V56A 1UKGA 4JGYA 4E4HA 2XVGA 4GH4B 4CSWA 4LE4A 2WN3A 1E5SA 3P3NA 3L2YA 3RPQA 4ZS2A 1W6PA 4I01A 5T50A 1HKDA 3WEZA 4KU7A 3KZ4C 2DDUA 2ETEA 3H9AA 5CKQA 3FUOA 5FZOB 3N9OA 1W8OA 4OMDA 3THCA 2VBPA 1UNBA 4HPKB 4N53B 2NMOA 1RVF2
chains in the Genus database with same CATH topology
5FMOS 3FZ3A 2FBEA 2RMU1 2D44A 3ZDSA 4DPNA 3ELNA 4DY3A 3DL3A 3BCWA 3MEPA 1N1YA 5BNPA 4URTA 1ZZ6A 1J58A 4XJ9A 3MZHA 2TUNA 2GDFA 3VKNA 1W6OB 1MZ5A 3ENRA 1DQ6A 1LOFC 3OGJA 2VG9A 4ATFA 1X8EA 2VW1A 1RUD1 2EIGA 1BMV2 2CV6A 1AR83 3ALQA 4JRAA 4X8PA 5DZFA 4YZ1A 3NV2A 3AMHA 1LOCA 4COZA 1QY4A 3WZ1A 3WQ7A 4IEUA 2JE9A 5JI9A 4HN1A 1VIWB 1X33A 1V6OA 5L7OC 1XNBA 2X29A 3FBYA 3LOBA 1DFQA 4P5HA 3UKNA 4JRLA 4LA2A 1UX6A 4DMIA 2OUHA 3KCYA 2BTVC 3CF6E 4CDXC 4AK3A 2E7AA 3QBQA 3WY6A 4WM7A 4PLNA 1GNHA 3QACA 1C8NA 3RSJA 4P9IA 5FPZA 3SXWA 4FQZA 1C28A 2DUQA 1CAWA 3E6CC 1DQ5A 2WLPA 3J26N 1FXZA 3RJ2X 4YVWB 2D43A 2JG9A 1W6NA 3IDEA 4Z82A 4Z2WA 3H1MA 5FCCA 3VZLA 3ZSEA 4JGYC 5KHIA 2ZGOA 5CB7A 1MEC3 1M06G 4HZFA 1N1TA 2Q1ZB 1AXZA 3WHUA 3S0MA 4KWLA 2FZ1A 1QJU1 1ULGA 5C8CA 4OHWA 3VKOA 3D6EA 2DFBA 1RUJ1 2ZOEB 3ILRA 4RS5C 1AR73 5FFOC 2B39A 2VY0A 1CVNA 1W39A 1VBA3 4WM7B 1MS9A 2DURA 5JI7A 1PVXA 2V5YA 2WS93 3LAGA 2E53A 3RYPA 1XE8A 1RMU1 3WDWA 1H2NA 1NCQA 1C3HA 1MQTB 3VBRA 1QJZA 3ZN6B 5EV7A 3K48A 4Q29A 2D98A 1ND2B 5CIRA 4EWEA 1IGOA 3B02A 5FO7B 4RSUA 1HXS1 4HVQA 3BB6A 1QJY1 4FXGB 5IT6A 3AZVA 4QGLA 3ZO0B 1VALA 3ME2A 5H9SA 1KJLA 1FMD2 2OVUA 1COV1 2DYCA 2QKDA 3AM2A 3WV6A 3WG4A 4E27A 2ZAHA 4Y1XA 4ES8A 4AI0A 3EHKA 2XJTA 1V9U3 2HEYF 2YZ4A 1KFXL 3RI9A 5BNOC 3C3VA 1V70A 4ISQA 2A6YA 5CFDC 2ZGQA 1XXNA 3H3ZA 2A5ZA 3USSA 1G9FA 5FLJA 1Q8VA 4Q0VA 2R49A 3H7JA 4GMP1 4ZKTB 3TNPB 5A3LA 4B7EA 2D6KA 3N7KA 4QQPA 3M4FA 4BMBA 1MACA 3T1MA 2GNMA 2A3XA 2P3IA 3WP3A 2WFPA 3ST7A 3B3QE 4BIOA 4JGZA 3T1LA 1O5UA 1YFXA 1QJU3 3PJYA 5FAXA 4P9JA 5JCTA 4XW3A 4YFZA 1HV0A 2RMU2 4UW5A 3RYKA 2IC1A 1QGLA 1GLHA 2XJVA 4KG8A 1V6IA 3B9IA 4YGBA 5FLHA 2NMNA 4JAAA 2EXHA 2Z2SB 2EXJA 1SDWA 3MLLA 5T5JA 2C1FA 3H8UA 2XPJA 1LKNA 1F5FA 3FX3A 4MVTA 4DQAA 2IXHA 1V00A 4CP1A 5T5LA 1W6QA 1CONA 1DZRA 1LOFA 3ZXJA 3VBFC 4LR4A 1ZBA3 1TNRA 2FMDA 2E7QA 3USUA 3U4XA 4FOYA 2JICA 2O8QA 4LE3A 1EV12 5DG2A 5J36A 3SH4A 1OHFA 3VHRA 1ZM1A 3WVJA 2A7AA 2PTMA 3N3HA 1CAUB 1RUG3 4BHPA 1OSGA 2GC2A 1ENQA 1LOEA 5I8TA 1PO13 3VHOA 3IMNA 5FOJB 4C0BA 5E16A 3AP7A 4CDUB 4IESA 4EN6B 1ND2A 2NN8A 2PELA 5C4WB 4YVSB 1VAKA 1EY2A 4BYYA 4CDWB 1EV13 1LHOA 1O91A 2WLQA 4WM8C 3B9CA 1D0HA 1DGRA 2PA7A 4IV3B 1TMF2 4OHZA 4Y1VA 4YVSA 1W0PA 2PHFA 3I7DA 4LLFA 3JQXA 1QJX1 2ZHMA 4Q4W1 5ABJC 1DQ2A 3W58A 3M70A 2CTVA 3MIGA 1FAYA 3ES4A 1LB2A 5JZGA 3OBTA 2RMU3 4COYA 3D82A 3MIFA 4I0AA 2UY8A 5GZFA 2RHPA 3AKSA 5A33B 1YWKA 5DZGA 5CADA 4P9LA 2BPA2 1SFNA 2VNGA 3IPVA 2JD4A 3ZSMA 4GMP0 1S2KA 4I02A 1OFNA 4U36A 2WL1A 2CYFA 1ULEA 1ZRRA 4K20A 5AFEA 4HSLA 1HRI3 2IFWA 1JYIA 1I9RA 3A4UA 2R043 3PJQA 4AFCA 1LHUA 3R4UA 1JBCA 1D2QA 4G9SB 2ET1A 4MGKE 4XQWA 2ERFA 3KMHA 2D97A 2X5IC 2NP0A 1LU2A 1JXNA 1NLSA 1DZTA 1IS4A 1ZNPA 2GALA 5I91A 1LEDA 3JQWA 4V1PA 4GIQA 4KU8A 3E5XA 1BMV1 2PHTA 1A8MA 4CDQB 3O14A 3VDDB 4B4QA 5HCBA 5FQ0B 3V65A 5C9AC 2HWF1 5HCFA 2QUOA 1AX0A 3WNXA 3IM0A 4MGZE 3ZIXA 4RA0A 1QF3A 1ZZ7A 3WINE 4P14A 1WMFA 2XKOA 3HQXA 1VJ2A 4W6XA 1J1LA 2CWMA 3MFCA 4JGZC 1SACA 4OI1A 4W65A 3RJRA 3DKWA 4S2FA 3TYJA 4NHKA 4J1WA 3PVOA 4IETA 1HIXA 4YSFA 1YI7A 1LGCA 3J4UH 4MUVA 4OLLA 3VBUC 3ZSJA 1GANA 1X50A 3KGZA 4RS5B 4P9WA 3L2HA 5DUWA 4CDXA 4GH4C 4HKLA 4UW6A 4XMIA 3NSTA 4Q0PA 4H7MA 4DRVA 5K0UB 4MSVA 4IEWA 2RM22 4DY5A 3FWEA 4QQLA 1UL9A 2VW2A 2WKKA 5EJ3A 2RS33 4XF1A 1AJKA 1MVQA 3ZYRA 1VP6A 5FRAA 1RUNA 2XWJB 2AUYA 3ILNA 3BALA 1AHSA 2V09A 2CGOA 1UKRA 1S0BA 1AYM1 2N7GA 4YGEA 4Q4W2 2ZGLA 1ZA4A 3L9JT 1PK6C 3DV8A 2G4IA 4Z8BA 4MLOA 3CJIC 1HV1A 3HBZA 2UWAA 2AENA 5JSRA 2DCTA 1RHI2 1QMJA 1H30A 4LT5A 1QXRA 4HKWA 2HWE1 1LHWA 3ZMOA 4R8HA 3N35A 4R4ZA 2SBAA 4N53A 4FPYA 1KDKA 1FOD2 4PJYA 3S7EA 4AHZA 2ZKLA 1WBLA 4Q4W3 4YVWC 5J09A 2ZS6B 1FPN3 1PO23 2GNDA 5BXXA 4LHLA 2CNAA 1Q8QA 2AZ5A 2HEWF 2WIIB 4IL7A 2G9GA 4XFGA 2YC0A 1XU2A 1K5MA 3WXPA 5K0UC 2XLAA 5FPXA 1PGL1 4XBQA 4FP2A 4C0HA 3OGGA 3KM5A 3U11A 3VLBB 2GC0A 2GH2A 4AQTA 5A32A 5KXBA 4DINB 3DF0A 3MLKA 1PMIA 4CP0A 4Y4YA 3CJXA 1J1TA 3IPVB 1AR61 2WNEA 3JBG2 2E7TA 1DGWX 1LU1A 2ZMKA 3EBRA 2BEOA 3AP9A 1REEA 2R062 1SBFA 2BBVA 5I0UA 3N7MA 4I3GA 1UF2C 1RIRA 4BWOA 2GAUA 3AKQA 5I8SA 4LEJA 3N4MA 3ZYJB 3FBMA 4HK8A 4XJZA 3JUUA 4GALA 4AEDC 4AQ6A 2BW8A 1SLCA 3R6SA 5DDJ3 4XF9A 4IEZA 4L11A 1C1LA 2A71A 2PN5A 1SCRA 1KDMA 4HK9A 2DUOA 2B5HA 2DCJA 4IV3A 4OUMA 4RQPC 4LO8A 4MV2A 4W6YA 1RUI2 4MX3A 1RUC1 2MNGA 4LBQA 3IBMA 3KT7A 1RUH3 4UW3A 5HBAA 1W6MB 2D6PA 3MW3A 2BFUL 1QJX3 5IK8A 2Q4SA 4HKOA 5KHHA 5GJ6A 1D0GA 5GKAC 4GKXA 2HWC2 1MZEA 2BFUS 5LRRA 5C8WA 2A3WA 2GN7A 3ECQA 4Q1RA 4R9AA 1F2NA 4CDWC 3VDDC 2D6LX 3HMYA 1RUF2 5L19A 3LWCA 2FMYA 2LM3A 3IKWA 1I3HA 1ULFA 2Q30A 4ES9A 4HN0A 4XJAA 4B3NA 5C33A 5KHJA 5K0UA 3VUOA 3CO2A 1KXGA 1O3QA 1WLCA 3THTA 1BVP1 1DQ0A 1RC6A 3JBG1 5D8AB 1FPN1 2Z42A 4FQ4A 3VV1A 2I07B 2HWC3 1KITA 1NG0A 5K7PA 4YW5A 2DTWA 2VGDA 2KA3A 4QQ2A 5J96B 3MI8A 5SV5A 1V6LA 3SMHA 1BKZA 1HDKA 5EYYA 1V6KA 1CAUA 5JAXA 1YFYA 2F4PA 1VRH3 3GZTB 3VBRC 1BBT1 2O0OA 4DB5A 1M4WA 4N43C 4YM0A 5C4WC 3JD72 1GQHA 5C8CB 1F5JA 1VB4A 3V64A 5DDJ2 3WDYA 2WSUA 4AQ2A 4XJWA 1PGSA 2GMMA 4Q4V3 1EPZA 1R082 3V0AB 4KWKA 2VULA 3DPRB 5C8CC 2R30A 3FFZA 4BLIA 1CAXB 1GYKA 1BQPA 2HWE2 2OIIA 3OTFA 4AEDA 1G9CA 1OA3A 1SLAA 4DRRA 1UZZA 3UV9A 4JVAA 5D1IA 1CPMA 4N9IA 4I2OA 2NPIA 1GQGA 1GFF2 3TWIA 3AZZA 4NVPA 2JKBA 3E6BA 4DXZA 3TBDA 1UAIA 3VZMA 3TN91 4E9KA 1DDLA 3MIDA 1QNYA 1OPOA 1VBB1 1OQDA 2I2SA 3AKTA 3KQRA 4S2GA 3NAPA 3WDTA 1H9WA 4LLOA 4XXPA 4HVOA 3E5UA 2WQ4A 5EXOA 1KRIA 1QJY2 1EAH1 1UCXA 5CVRA 2HWC1 3I59B 4D7SA 4FPGA 2R042 1XQNA 1MVEA 3R4DB 4H14A 2YROA 1AX2A 2RJLA 1AJOA 2QDNA 4KQ7A 4I3PA 1CAVB 4DOUA 1DGRN 4YM3A 4AVVA 4GB31 4NR1A 1KFUL 4LBJA 4CEYC 4AEMA 4Y20A 1ZRDA 1H2KA 3AYEA 5CFDA 1QNWA 5H9QA 3HIFA 3M2MA 1QHDA 4NN0A 2UYBA 4IV1B 2JG9C 3EJKA 2XLGA 3H1WA 5BNPC 4YG6A 1QXJA 1WW5A 2JDZA 2VOKA 2QVSB 5ACA3 3ZXLA 1DZQA 1KQRA 4HVRA 2NM1A 1G9DA 4PIZA 1AR71 1SLBA 2Z5WA 5F9TA 4UBGA 3PVEA 4EN0A 1G6NA 4AI8A 4WZCA 3B01A 1GBGA 4LTAA 3URFA 4MGYE 3PVNA 5I93A 1RUE1 3LZZA 1ULDA 3SHRA 4FOWA 4Q4Y2 3MIBA 5I0RA 3WW2A 2TEPA 2NQYA 3H7YA 2XBO1 3EQEA 1YYNA 1MS1A 1H8TB 2ZABA 3AXDA 4QHBA 4WV8A 1APNA 3E5QA 1RUOA 1NOVA 2H0BA 2PYTA 1FMD1 1CJPA 1YIPA 2RJKA 2RM23 3ACLA 2R1BA 5CA6A 3M3CA 3ATGA 2D3RA 5EFUA 2P3KA 3PNAA 3UKTA 1ND3A 5IUQA 2VOVA 3ASIA 2RS12 2MEV3 4Y1ZA 3RZZA 4AFAA 1NA1C 1NCQC 3DPRC 5GZEA 4P9XA 4B4RA 3SH5A 3HT2A 4ZU7A 2ZA9A 4AWDA 2R16A 1I1EA 3SCHA 1MR5A 3CEWA 3NAPC 1GZWA 4RHV3 1NA1B 5T55A 5KXDA 4FXKB 5I8YA 1IS5A 1B09A 4I30A 4PLMA 1SMVA 4S2HA 2ZX4A 5FREA 2I45A 4FPEA 1S0DA 4WM7C 1AZDA 1RUG1 5BYNA 1J3PA 2EA7A 2PHXA 4FTEA 1ALYA 1WD3A 4JCKA 1G7YA 2R063 3QCWA 3AP5A 1LEMA 3GALA 5FBZA 1OA2A 3AJZA 1RUI1 1RMU3 1DGLA 4NO4A 4NPRA 2WS91 1L3JA 4QMAA 4PIYA 4Q4X1 5E88A 3VBOC 1Q8SA 4WVMB 1D4M2 4EJRA 4N43B 2HWD3 1BYHA 2P34A 4Q2FA 3OF1A 3JCIA 4RD7A 1KS4A 5KBFA 4BPZA 4I09A 3LA2A 3AP6A 3WQ1A 1LESA 4XQ4A 2DU1A 1PGW2 2V73A 1PZ8A 4ORFA 1NXMA 3POYA 5JR7B 3RG0A 2CGNA 1RINA 1VR3A 5BNOB 4R9DA 3AK0A 4F3JA 4E2QA 4YFWA 5E89A 4XF4A 5JOXA 3RS6A 1D4M3 5IK4A 3N7JA 5JPMB 3NO8A 4YM1A 1VBD2 4TYSA 4QPGC 1V9U1 3ZXEA 2XJSA 4XIOA 1UIJA 4X6QB 3DGTA 4LBKA 3WCRA 4D7YA 5BNQA 2YHJA 5JWPA 2VH9A 1TMF1 4LULA 1BCXA 1G9AA 1DGWA 1FNZA 1PM7A 4XHXA 3SH3A 1ND3B 5D8AA 3VKFC 3VL9A 4AQSA 1ND2C 3GBFA 3KS7A 1WA4A 1CJDA 3ZXDA 4CDQC 2ZX1A 5BY5A 4XFCA 4EV0A 4G4FA 3VN4A 1AR81 4FCAA 4XILA 3WDXA 4KWJA 1FOD1 2ZGTA 1NCRA 1NE6A 1VBB3 4HL0A 3S30A 4JDNA 4KBBA 2XWBB 4L92A 3ZN4A 2A6WA 3FLRA 4AYUA 2HWF2 1XYPA 5GLTA 3WP6A 1AR72 1LGNA 3WW1A 3VZJA 4WBBA 4PLOA 1SCSA 1S0GA 2GH8A 2O1QA 4L8QA 1GZ9A 2OA2A 2HWE3 3B00A 3CLPA 3D4KA 3AB0A 4E4DX 1NY71 1PZ7A 1VBD1 3AZXA 4B4PA 4YM2A 5DXDA 4LBNA 2ILMA 1OLQA 4MXVA 2DF7A 4QPGB 3WLUA 5FMOL 1ASJ1 4FPFA 3GNEA 3JB4C 4XFFA 4MH0E 4K7JA 3D0SA 1DBNA 3LB9A 2EXKA 4EWAA 2WFF3 1RVF1 3D0JA 4GB32 3KCXA 2GU9A 4XETA 2ZGUA 2ZHLA 2A6VA 3MFAA 3GBWA 2UWBA 2X8KA