2H0BA

Crystal structure of the second lns/lg domain from neurexin 1 alpha
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
181
Chain Sequence
EEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurexin-1-alpha
publication title Crystal Structure of the Second LNS/LG Domain from Neurexin 1{alpha}: Ca2+ binding and the effects of alternative splicing
pubmed doi rcsb
source organism Bos taurus
molecule tags Cell adhesion
total genus 39
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2h0bA00
1ULDA 1DQ0A 2VUAA 4Q27A 4CTEA 4DRRA 1DIWA 2ZZJA 4DQAA 2ZMKA 1N1TA 1S0BA 5DUUA 4AVVA 1G7YA 3R4UA 1LEMA 4LBKA 1LGBA 2FMDA 4Z8BA 2EF6A 3ZSJA 4FPHA 3BOPA 5IK4A 1AX0A 5F5QA 5EYXA 2ZHKA 1DQ1A 1S0IA 2A75A 4UW3A 4WV8A 2YXSA 4GWMA 2NMNA 4XE9A 4P9WA 3VKOA 1ULFA 2ARBA 2JECA 2ZGUA 4FPGA 1Z0HA 1W0PA 2ZHNA 1FNYA 2DVDA 1PZ8A 1KJRA 2JE7A 5KXBA 2D6OX 4TYSA 2NP0A 3PVNA 3FLRA 5LK5A 2OUHA 3KM5A 2SLIA 3WG2A 3ZSMA 1CQ9A 4PF5A 4XILA 5CBLA 1ENSA 5FREA 2A70A 2UWAA 2ZMLA 2A6ZA 2JE9A 1QMJA 3D5OA 1DBNA 1BJQA 1F9KA 1KITA 1G9FA 2A7AA 1LU1A 1VAMA 1YI7A 3NV4A 1LHNA 1MS1A 2YV8A 1Q8PA 5BYNA 1N47A 1MS5A 1GLHA 1JW6A 4BM8A 4YGEA 1GSLA 2DVBA 2DYCA 2WSUA 3AJYA 4BQ1A 5CAZA 1G9DA 3OBRA 2ZGPA 4ISQA 4R9BA 4YZ3A 4XJUA 3I4IA 3OBTA 1FNZA 1HQLA 2C5DA 3USUB 4YW5A 5DG1A 3N7JA 4M3CA 5JMCA 1UN1A 2VY0A 1G9AA 1RITA 2VW2A 1UL9A 4R9DA 3AFKA 4U2AA 1A8DA 2CWMA 1OKQA 2AGSA 4XXAA 4M3CB 3RRDA 4Y1XA 1IKQA 1MVQA 4ZKTB 2DUPA 2E6VA 4R9AA 2ZKNA 1ULEA 1Q8QA 1S1AA 2P3IA 3WNXA 1QDCA 3WHTA 3LSEA 4XYXA 3N3HA 4YW1A 3WCSA 1DGLA 1LOBA 4FPOB 1DQ5A 4PQ9A 5T50A 3OPZA 2R1BA 3RMXA 3OY8A 4UW6A 2AREA 4YGDA 4ASMB 4K21A 1LU2A 1FYUA 5JVVA 2YY1A 5GLVA 2D44A 3OY8B 2ZGLA 3OGGA 1QU0A 1PZ7A 3AP7A 4BPZA 3L2YA 5GJ6A 1Q8OA 2R0HA 1AVBA 2CNAA 2WLQA 4XBNA 2A6WA 3GALA 5KXEA 3ZSKA 2DU1A 4ATFA 2WQZC 1FX5A 1JBCA 4Y24A 5GZEA 1MZ5A 1HKDA 3UK9A 5HCAA 1CESA 3ZYRA 1GNHA 1UAIA 3AP9A 4GWNA 1IKPA 1D0HA 1LGNA 3UJOA 1GKBA 3AZYA 4NOTA 4XOGA 3W59A 3APBA 4M3CF 3WV6A 3AP4A 4XHBA 2E53A 4LBQB 1LJ7A 4XMIA 4YM2A 3V65A 1V6LA 4XTPA 1YIFA 5T5PA 5IUQA 1N1SA 3JUUA 3LSDA 1ONAA 3V0AA 1UKGA 2NM1A 1AXYA 3AK0A 4LBOA 2R0FA 2DVAA 3IM0A 1MZ6A 2BQPA 4Y26A 1LOFC 2WJSA 2HYKA 2C9AA 4Q8KA 1BXHA 3V0AB 1FATA 2D43A 1S0CA 2ZGSA 4M00A 4XBQA 3TAYA 5IK8A 3C2UA 1A3KA 4YGCA 4TZDA 5IK7A 2B7YA 1AF9A 1SLTA 4Y22A 2D6NA 2UURA 3UL2A 2KM2A 1U0AA 1YXWA 1GZWA 1LOEA 4Y22B 3ZXEA 3UJQA 5AVAA 1KQRA 3D6EA 4P9YA 1WW7A 4XIKA 1FV2A 5SV8A 3N7MA 3R05A 4R9CA 3ZYPA 1MS4A 5JOYA 1V6MA 4Y1YA 2ZA9A 5JLVA 2SBAA 1KDMA 4HL0A 4DFSA 4WZFA 3AP6A 3T1LA 2ZGNA 1CONA 3WG1A 2P3KA 4FOWA 1DYKA 4AYUA 3OJBA 1I3HA 4BMBA 2DTYA 2ZGKA 4XXPA 2CYFA 1PZ9A 2NMOA 3ZVXA 3PMEA 1UMZA 3D4KA 4GXLA 4M3CE 3WDVA 3M3CA 3IKWA 2ZBJA 3TB0A 2ZGQA 4CRQA 1WW5A 3B9CA 2AENA 3SNMA 3RS6A 2GMEA 5GZCA 3V0BA 5GZDA 5T52A 2EAKA 2XB6C 1LCLA 2PHXA 2D3PA 4GKYA 1W0OA 1FV3A 4LBNA 4XDQA 1G9CA 1SCRA 2PHTA 4Y1UA 2PHUA 1GZCA 1JXNA 2Z42A 1LEDA 3VUOA 4JRAA 3AYDA 1QNWA 3NV2A 1N1YA 1MS0A 2GDFA 3NWKA 4ISRA 3MEPA 1W6OB 1S0FA 3ZSLA 4JCKA 1O4YA 4AGRA 1GBGA 1BKZA 3WDTA 1W6PA 1C1FA 2GALA 2GNDA 3IN9A 3MPPG 3N7KA 1WLWA 2UU8A 1QDOA 1IOAA 2DVGA 4Y1ZA 3WG4A 3WLUA 4BLJA 5KXCA 1G8WA 1W6PB 4WVWA 3MW2A 4FOQA 1CPMA 4ATEA 4UW4A 3AYCA 3USUA 3T1MA 4AGVA 1WW4A 1LECA 1GYKA 5DG2A 3WUCA 4Q1PA 1DFQA 4LBMA 3WDUA 4Y20B 3WVJA 5DUVA 3PJQA 1DZQA 3N7LA 5T55A 1V00A 5DXDA 3JU9A 1UZZA 4C1XA 1CJPA 1DHKB 1Q56A 2W39A 3NV3A 1FAYA 5E88A 1RINA 2AYHA 3O0WA 1I1EA 3WHUA 2ZACA 1DQ2A 2V5YA 1KRIA 1C1LA 3FFZA 3ZXJA 1X50A 5HCFA 1YRZA 4C1WA 1AXZA 1LESA 1GANA 5IK5A 1H9PA 2E51A 4MYEA 5GM0A 4Y1VA 1KDKA 5GLUA 4LBJA 4YFWA 4FPFA 1MVEA 3WDXA 4XJ9A 4CZSA 4XJAA 1WW6A 1QGLA 3AZVA 1SFYA 2EIGA 4FPJA 3T2TA 2R49A 1ZM1A 5IT6A 2A5ZA 4FQ4A 3O0XA 3INAA 3POWA 1MS8A 4YW2A 3O12A 3PVOA 1A78A 3N35A 2GN7A 4PBPA 5DUXA 2VW1A 5DZFA 5GALA 4AGGA 5JOWA 2JKBA 2JJ6A 3HN1A 4IQPA 1S0JA 4YZ4A 3FBYA 1SBDA 1LGCA 5CB7A 1ULGA 2A71A 2DUQA 3CNAA 2DWRA 4FP2A 2PHRA 4LBQA 2A3YA 3M3EA 1WUVA 1V6IA 1DYPA 1SLCA 1AJKA 1DQ6A 3B01A 1W6MB 3SH4A 2P2KA 3U4XA 1AJOA 1V6OA 3ATGA 3SH5A 4AWDA 2G4IA 1Q8VA 2P3JA 3AX4A 2NZ9A 4DS0A 4DRVA 1JUIA 1LULA 1VLNA 5GZGA 1SACA 1Z78A 1R1ZA 3VKLA 2ZGOA 3BTAA 2AUYA 2D6PA 3M3OA 3M2MA 1IS5A 1DQ4A 3DUIA 4YG0A 3LCPA 2AH2A 1N3PA 2ERFA 3N36A 5E8AA 3O0VA 3SLIA 4Q1RA 3FUQA 4JC1A 2GMPA 1J1TA 1LENA 3POSA 1CPNA 4GKXA 3WG3A 3AXEA 3SISA 2CY6A 1LOGA 1IS6A 4FPYA 1N3OA 4P14A 1V6NA 4YGBA 3W58A 1BZWA 1C4RA 2PHFA 1NXD1 1H30A 3AXDA 3QCWA 1DLLA 4SLIA 3ASIA 1IS4A 4LBQD 1GNZA 2VXRA 1JYIA 1CVNA 2CTVA 3I8TA 2AR6A 3FLPA 4YZ2A 1UZYA 1CN1A 5H9PA 2WKKA 1LODA 2GNBA 5GLWA 3DGTA 1AZDA 2D6KA 3BIWE 5H9SA 4RA0A 3O5SA 2YROA 3RG0A 1WCSA 3ILFA 1QOSA 2H0BA 5JOZA 3WDYA 3WCRA 1CIWA 2EXKA 1VIWB 1WBFA 2EXHA 2YMZA 3AZWA 5JDBA 1SLLA 3V0BB 1LHVA 4NO4A 2W68A 5CA6A 3VKNA 2P37A 1W6OA 2DU0A 4YW3A 4XIOA 3OYWA 4YZ1A 2ZGMA 1QOTA 4ZXKA 4PBOA 4HANA 4BMEA 4F83A 5DZGA 1OQ1A 3NV1A 1EPWA 4KBBA 4YM1A 4YG6A 2ES3A 2DURA 3OYWB 1VALA 3B00A 4LBLA 4YZ5A 1RIRA 3ENRA 3MW4A 1WBLA 5JOXA 4FPKA 4DPNA 3IPVA 4FPEA 1GICA 4UW5A 2W08A 2ZGTA 1ENQA 3ZXLA 3ZPYA 3R4SA 1AX1A 1URXA 2GNTA 3GNEA 3IPVB 2A3WA 4FVVA 3H0OA 3RSJA 1JHNA 2A3XA 2D3SA 3MW3A 3RQ0A 1F5FA 2CWSA 2DUOA 4L8QA 4Y20A 4FOYA 2GNMA 1YO8A 3HMYA 1BYHA 1VAVA 4RL7A 1W6QA 4GA9A 2R1DA 1LOFA 2RHPA 4Q8LA 3AZXA 1TEIA 1F31A 1MS3A 1W6QB 3IMNA 1SLIA 4K1YA 4Q2FA 1D2SA 1NLSA 1SBEA 4P9XA 4XMAA 5CNAA 4YM0A 2NN8A 1G86A 2D6MA 2EXJA 4I30A 4XTMA 3SH3A 4AVSA 4K20A 2EALA 2ZAAA 3WDWA 4FPLA 5T5LA 2VW0A 2ZHMA 2JDZA 4M01A 3A0KA 4YFZA 1G9BA 2EXIA 2WT1A 1S0DA 1LOCA 1LOAA 2PHWA 4D69A 4W65A 1V6KA 1W6NA 4GALA 3B3QE 3SITA 1B09A 2V73A 1QF3A 1HQWA 1QOOA 1BQPA 2NYYA 2D3RA 2Q5TA 4YM3A 1W6NB 4AVTA 1LHWA 1Q8SA 1MR5A 3A4UA 2YZ4A 3VKMA 1V6JA 3HR9A 3QLQA 3BODA 1W6MA 3M1HA 2JD4A 1S0GA 4PCRA 1QKQA 1JN2P 5EXOA 3PVEA 3WOGA 4YW4A 1H9WA 3WUDA 2D6LX 1HLCA 4YLZA 2P34A 1APNA 3AYAA 5T5JA 3A0NA 2UWBA 4WVVA 2ZMNA 3FUOA 1LTEA 1GV9A 2TEPA 2A6VA 1LHOA 5E89A 5GLTA 1S0EA 3VV1A 2PELA 2E7TA 1ENRA 2D7FA 2R16A 2VH9A 2ZHLA 1WLCA 5L73A 5T5OA 2ZGRA 5EYYA 5F9TA 4BOWA 2LALA 1CR7A 2A6XA 2OW4A 3FLTA 3WZ1A 1KJLA 2UWCA 1QNYA 5T54A 5GZFA 1MS9A 1GZ9A 4XJWA 2W52A 3POYA 5EWSA 1C57A 1ZA4A 2I2SA 2ENRA 1WLDA 1ULCA 4YG3A 3AYEA 5FRAA 3KQRA 4XHXA 3ILRA 4FPCA 1N3QA 1UX6A 2FHRA 2XG3A 3AZZA 2OUJA 3ZXKA 2E7QA 4XBLA 2WT2A 5GLZA 1SCSA 3AP5A 4XZPA 4BLIA 4XJZA 1YYNA 1WD3A 1SLAA 2DV9A 1JOJA 2DTWA 2LTNA 3VKFC 2GN3A 1IS3A 1O4ZA 1LHUA 1UPSA 3M3QA 4K1ZA 4Q26A 3AJZA 3Q9OA 5DZEA 4U36A 5H9QA 1XQNA 3ILNA 1OFSA 1HDKA 1AX2A 1MACA 1SBFA 2OVUA 3V64A 1JYCA 2ZABA 2DVFA 1Y7BA 4FQZA 1N1VA 2GMMA 2A6YA 1WD4A 5H9RA 4FOVA 1GZWB 2VU9A 1AXKA 2WSVA 4XJ8A 2WT0A 4OZXA 4FP3A 4H55A 1SLBA 2ARXA 4ITCA 5DUWA 3RMYA 2WNEA 5HCBA 5KXDA 2CL2A 3ZXFA 3B69A
chains in the Genus database with same CATH superfamily
5FZLA 1PGW1 1OMIA 1RUC2 3LEMA 4DRRA 1YQ2A 5A70A 2ZZJA 2NLRA 4XEZA 1N1TA 1S0BA 3IIIA 1CAXA 3M4FA 5HI0A 1AL23 1LEMA 4K40A 5FMDA 4FI9A 2ZX0A 4I2OA 5KBFA 5L7OA 4XUQA 1QXJA 2C6SA 3AKRA 1VMFA 3H9AA 2WN3A 3CJXA 3VKOA 3N9MA 4BK5A 2VECA 5F8PA 5F7UA 2ZHNA 2WUHA 4EYUA 1UOBA 2K9ZA 2R32A 2D6OX 2DCJA 5I0DA 1AYN3 3KCCA 2BEOA 3ITQA 4KGGA 4N7IA 4Q0QA 2SLIA 1TME3 3ZSMA 3EBRA 2AZ5A 3K2OA 4B8EA 2A70A 2UWAA 3BPSA 4D6RA 5KHKA 2ZMLA 3TN93 1W28A 1QMJA 4DY3A 2R6QA 1F2NA 2YU1A 1BJQA 3KV5A 1F9KA 3MLLA 4QU2A 2QNKA 5FR3A 2RE9A 2VTXA 1ASJ3 1RVF3 5BNNC 2XVLA 5FQ0B 3THDA 2ZX3A 2WNUA 5BYNA 1N47A 5FLHA 1JW6A 4QB2A 3NRUA 1GSLA 1REEA 5DDJ2 1UYYA 3JXSA 1SFNA 3OBRA 4P00B 1UIKA 4JDOA 1L3JA 4KG8A 1MPXA 3USSA 4AI3A 5FY1A 1RUF2 5LY1A 4QDRA 2JX9A 1Z7S1 4W50A 2VW2A 2WZR2 2VGDA 2JWPA 2VPVA 2MNGA 2AGSA 4XXAA 3RRDA 2MEV1 5A7NA 3RI8A 2C9KA 3K4DA 2TUNA 2DUPA 2VCCA 4HG6B 4R9AA 3WNLA 4C90A 2FDHA 4CDQA 2ZKNA 1S1AA 1F5JA 5C6CA 1QDCA 1UZ0A 3CBNA 1AL21 4YW1A 3WCSA 1IPSA 1PVC3 1XE7A 5LBFA 1LOBA 5A7WB 1RUJ1 4PQ9A 3H3ZA 2AREA 4YGDA 2V4AA 1JUHA 4LULA 1FYUA 2D44A 3OY8B 4INDA 4CCCA 2ZGLA 2W2IA 3I2KA 3AKSA 3AP7A 1EP0A 3L2YA 4AI8A 5A3OA 4EQVA 1AVBA 1XB9A 4KMQA 2VBBA 3UT0A 4E2SA 2QZ2A 5FZGA 5JZGC 2ZTNA 1FX5A 3LIGA 1AYN1 1JBCA 4AK3A 5BNQA 5GZEA 1RUH1 5CZKA 1HKDA 2B9VA 3UK9A 5LEKA 4CDXA 1TME1 1UAIA 1VBD3 3AP9A 3WF0A 1IKPA 2WLPA 4BWOA 5IVCA 5CFDB 4XACA 1W2OA 2XQRA 3IAPA 2WYFA 4HKLA 1UD1A 4CEWC 3VBSB 1V9U2 3PDQA 4NHYA 5J36A 2Y6JA 1RUE3 2E53A 2JDPA 2LRPA 2R073 1RVF1 2ZEYA 4LBQB 4XMIA 1V6LA 3V65A 5FO8B 1X9PA 1YIFA 2P6HA 1A6CA 3UGGA 2HWB2 3LSDA 3PU3A 4E9KA 5C8WA 1B35A 1UKGA 2NM1A 3VBUA 2HYXA 3PL0A 2VMIA 2ID4A 2Y6HA 2YU2A 1PGW2 4WZCA 2OA2A 2HYKA 2C9AA 4KI5M 3QH6A 5FMBA 4XFCA 4AQ6A 1S0CA 4M00A 4XBQA 4Q8KA 3VBHB 4JQRA 3C2UA 4KL1A 4Q4W3 4AEKA 3WQ0A 4JX0A 5BNPA 4Y22A 1IHMA 3ZFEA 1R1A1 2HWE3 3RVHA 4IE0A 4QXCA 2KM2A 1U0AA 5A3PA 2C1FA 3CO2A 5FJHA 4DO0A 4PDWB 4LPLA 1W0NA 1NQJA 2VOVA 3D6EA 4HPKA 2BVVA 5D21A 4O9GA 4CCMA 5FPLA 4XIKA 5SV8A 1HQNA 2QQMA 3RGBA 3GM8A 1NCRB 4Y1YA 2QVSB 1KDMA 1YC61 1UKRA 1VBB1 3AP6A 3VDAA 3LEKA 2ZGNA 3SEPA 1CONA 3WG1A 4JRLA 4MXWB 2E32A 2BBVA 1D4VB 1DYKA 5FWJA 1I3HA 3Q8BA 4BMBA 2DTYA 1VPHA 4FO9A 2W94A 4CEYC 1OHFA 3ZVXA 1VAKA 4HK8A 3PLQA 1OURA 1WGPA 1NY71 1UMZA 4GXLA 2QE3A 2W1WA 4M3CE 4C0BA 5C33A 1Y43B 4JGYC 3S0MA 3GZTB 4CUBA 1WW5A 1IG0A 2AENA 3O14A 5L36A 2VVDA 4JGZB 4IEVA 1PIV1 4B29A 5EFUA 2GMEA 3PJYA 1X8MA 3RS6A 3THCA 3V0BA 5GZDA 1W99A 3RJRA 1P8JA 1KS4A 4QKFA 5FV3A 1RUE1 1LCLA 1HRV3 2QKDA 3ZXDA 3OCPA 4A3XA 4YWAA 1G9CA 5LBEA 2PHUA 1GZCA 1NXMA 1Z7S2 2RJ2A 3R4DB 4AZZA 1LEDA 2BV4A 3VUOA 4JRAA 3NV2A 4XW3A 5FK8A 2D93A 2MEV2 4R4ZA 3AMNA 4UWDA 2VOKA 1U5YA 4UFMA 4JCKA 4DB5A 4AGRA 1PK6C 4D7YA 1D7PM 1C1FA 2GALA 5A3UA 1PNFA 5FZHA 3R6SA 1ND2C 1R091 3JD73 1AL0G 1RUJ2 1G8WA 3MW2A 2CHHA 2OT7A 4ATEA 4JZRA 1UOJA 2XR4A 4L0PA 3T1MA 1LECA 3LD8A 4OYUA 4YVSB 5F3EA 4W8JA 2ZS6B 2R043 4NRMA 1DFQA 3LEIA 4Z2AA 5ISLA 3DKQA 5F39A 1H4GA 1RUG1 1DZQA 2ZEWA 2XQXA 4P5YA 1V00A 2XBO1 2RV9A 1XXNA 5T55A 4C1XA 4D3WA 2ADDA 2MPFA 1IG3A 3POEA 1RUH2 2W39A 3NV3A 1BCXA 1RINA 3O0WA 4HOOA 5E88A 4WVMB 5FPUA 3CLPA 3T2QA 2O1QA 1X50A 2RDSA 5IK5A 1AR63 1H9PA 2E51A 4MYEA 1Y9QA 4OI4A 1ZRCA 3NJVA 4OFGA 5FYIA 4S2GA 2BP6A 4XJAA 5I0TA 5KWRA 3L2HA 1SFYA 2EIGA 5IT6A 1H1MA 2R49A 3KHBA 5E16A 5AFBA 5DQ0A 4IETA 2A5ZA 4FQ4A 3RFRA 4EN0A 5J1XA 1QJZA 3O12A 3SEEA 3R0RA 5JOWA 5GALA 2VW1A 1HRV1 4QKDA 4AFCA 2UY8A 3OG2A 1JZ2A 5CFDA 3FBYA 1R1A2 4BQ2A 3FL7A 3AKQA 4D7TA 3CNAA 4LBQA 2PHRA 1WUVA 1V6IA 1KFXL 1SLCA 1QEXA 3PIJA 2OPWA 1JYVA 4JVAA 2D5FA 4QPGB 1V6OA 4GH4C 3ATGA 3ME2A 4K6BA 3JD71 4AXOA 3S5AA 4AWDA 2BBAA 4META 4FFFA 2WO7A 4IGPA 1XU2A 4QQ2A 5GZGA 1VBB2 3H1YA 1SACA 1W05A 1OH4A 1Z78A 1J1LA 1R1ZA 1QJU3 1Y4WA 2ILMA 4XAEA 3ZN5A 1QXPA 2BZDA 2QQOA 4AF9A 3BTAA 3M2MA 3DUIA 5LCWL 1CAUA 5FFOC 2UYBA 2RDRA 1NA1A 4OHVA 1NY72 4HMZA 4IEZA 1RUD3 3SLIA 4Q1RA 4QWNA 2GP3A 3GZUC 4MLOA 5BNOB 1J1TA 1LENA 2PQSA 3WG3A 2VZTA 2WINB 1J3PA 3IWZA 1PIV2 1IS6A 2VUDA 1V6NA 3U11A 5A3MA 2J42A 3HD8B 5T3NA 2XJTA 5A1FA 3KB5A 2W47A 2HBTA 4MXWA 3WEZA 4GULA 4AFAA 3ZFFC 5FZ1A 4SLIA 5EJ3A 1IS4A 3POFA 4LBQD 1AR83 1IZ3A 2GC1A 3QBQA 4URAA 3I8TA 3VHNA 3FLPA 4YZ2A 3LKJA 2Y34A 2Y38A 5H9PA 5C3RA 2A1XA 2JICA 3DGTA 1BVP1 4XF3A 1VMJA 1ZZCA 4OLLA 2HWF2 1R092 3WW1A 4CCJA 2ET7A 2ZJCA 3HPNA 3RG0A 4IV3B 2H0BA 3WCRA 4N53B 4YVWC 1XNKA 2EAAA 3WP6A 5JDBA 1K5MC 3WP5A 1OPMA 4NRQA 3PTYA 2IC1A 4NO4A 3VD9A 3F2ZA 2P37A 5A7SA 2DU0A 3VKNA 3VZNA 1TMF3 3ORJA 3EMRA 3OYWA 4Q0VA 3UNPA 1RUG2 2PYTA 1UZVA 2ZOEB 2XBO2 3MIBA 1OQ1A 4HONA 1EPWA 4NIGA 2VZUA 2DURA 5C9AB 4QX7A 3VBSC 3GYDA 5IFPA 3MW4A 4IEPA 1D4M3 2WAOA 4A2UA 4FPKA 3NO8A 4IUGA 1FMD1 4NE9A 3ZXLA 1AX1A 1URXA 3GNEA 5B2GB 3IPVB 2VCBA 1JHNA 1OLRA 3MW3A 3RQ0A 1F5FA 4IV1A 1E5HA 3E5QA 4FOYA 2VMGA 1NUKA 2QQLA 3I7DA 1BYHA 1VAVA 2IVJA 2XWJB 4QXBA 3VBHC 1AR73 3OBAA 4IE5A 1LOFA 3DXTA 1E57A 3DYOA 5FUIA 3N9PA 4FFHA 2PLV2 4GMP0 3IMNA 5FP4A 1ZBA3 1SLIA 2CU5A 1JZ7A 3HNBM 3CQOA 4K1YA 1ZRIA 4Q2FA 3HJRA 3LWCA 4ZU5A 1NLSA 1SBEA 4PDWC 3ES4A 4YM0A 3RZJA 4RHV2 1G86A 3D82A 4I30A 4J1XA 2B8MA 1OXCA 5BPXA 2XJRA 5T5LA 2VW0A 4CP9B 1PO13 4M01A 2C0ZA 4CDUC 5C8CC 2O14A 3A0KA 3BUCA 4COYA 4AEMA 1VE0A 5LASA 4BIOA 1COV3 1LOAA 5A3TA 3FE5A 3OGRA 2OQ6A 4I0BA 4DEQA 3E5UA 5FY0A 3B3QE 2DBIA 1QF3A 1QOOA 4K7JA 3G7DA 4YM3A 1ZRFA 1LHWA 1JYNA 3A4UA 3VKMA 2YZ4A 1HB1A 1V6JA 3QLQA 2YFZA 1T6GC 1UY2A 4MGYE 1OUXA 2IVIB 4PCRA 5CIRA 5ABJA 1JN2P 2ARAA 1UW8A 3WD5A 2HWD1 2IFRA 3K51A 1H8TC 2LS6A 3WUDA 2BNOA 2VE1A 4CU7A 1DGWA 2ZAHA 1CAVA 3NVCA 5FP3A 1RJ7A 4WM8B 4WVVA 3WX5A 3ZMOA 1EAH3 3MUY1 3KWVA 1LHOA 1O4TA 2HWC3 4LKSA 3MPBA 4NHXA 5E89A 2IXCA 2OXBA 1TNRA 5GLTA 4L97A 3VV1A 3X29B 2ZHLA 2R16A 1WLCA 1VBE2 2YYOA 3AL6A 5JAXA 4LXLA 3UGHA 5I8YA 3OPWA 2LALA 4NRPA 4LLOA 1OLME 3POJA 2X5IA 5D8AB 4OCTA 4XJWA 4NROA 1GOHA 3POYA 1ZA4A 5BNOA 4NIAA 3BB6A 3MO4A 1ULCA 5FRAA 1YI9A 1I5PA 3KQRA 3NSTA 1HV0A 4FPCA 1N3QA 1QH6A 2BYVE 2VNVA 5I0RA 1S55A 2FHRA 3CIHA 4LR4A 3ZXKA 3RZMA 3DPRC 1YYNA 5CFCC 1GWKA 3O1SA 1VRBA 2IUWA 3CZJA 4E4HA 2GN3A 1BLZA 3ACLA 3S57A 1LHUA 4Q26A 4K1ZA 1MQTA 1NLQA 3Q9OA 4U36A 4KU8A 3ILNA 4JDMA 4B4QA 2XPJA 1AX2A 2XONA 1MACA 2J1EA 4FFIA 2W95A 3V64A 4DEVA 4DOUA 2ZABA 3CHXA 3SC7X 2DVFA 1C8NA 2Y0OA 2FDIA 3H8UA 3U14A 4N9HA 2ZKLA 1CX4A 3LF7A 2G9ZA 2VU9A 5C3QA 4OZXA 1FMD2 4NAMA 4ORFA 4V1PA 1SHWB 1SLBA 2VOWA 5HCBA 3SKVA 3GJAA 2EIEA 2E31A 1ZZBA 4K3UA 5IK4A 4BK4A 3B69A 4AQSA 1CD3G 1KS5A 1ULDA 4LMFA 1QQP1 2JEMA 4Q27A 1AR92 1OPOA 4GJYA 2VVFA 1DIWA 4AAXA 4BZ4A 5DUUA 5FY9A 4AVVA 1G7YA 3DN7A 2WL1A 4ARYA 3ZSJA 4FPHA 4CP2A 3BOPA 2WZEA 3JQXA 1AX0A 4RSUA 5F5QA 2Y8KA 5EYXA 4L9BA 5FXVA 1OOPC 1SPPA 2VXJA 3AL5A 4UW3A 4WV8A 1ZRRA 2TNFA 2YXSA 2BUKA 5L7OB 4NPLA 4QPGC 1OVPA 4XE9A 4P9WA 4QX2A 2JIGA 1JZ6A 1ULFA 2JECA 1REFA 5FP7A 3KGLA 1W0PA 1U5ZA 1RGSA 3AKTA 2DVDA 3UESA 4A7ZA 3WP4A 3GBFA 3IIAA 5KXBA 3TEZA 4XUNA 4M4RA 4TYSA 3P6BA 4YARA 4LO6B 4NAOA 3KVBA 4ZS3A 1BK0A 5LK5A 3VHRA 5KHJA 3MF6A 1DDLA 2OUHA 4LKEA 2OS2A 3WG2A 4E8CA 5J96B 1BEV3 4XILA 3IZOA 1DG6A 2OKXA 3VBOB 3ZIXA 1ENSA 4RS5C 4I09A 5FREA 5J7MA 3SQOA 4NIDA 1UOFA 3O1MA 3HT2A 5A1AA 1DBNA 5C71A 4EWDA 4F7ZA 1J59A 1KITA 1G9FA 3QACA 4QMAA 3TOJA 4QQLA 5A3NA 4AFMA 2XUEA 2JDMA 4XQ4A 3NV4A 4BQYA 1DGWX 4FTSA 3VZKA 2X8KA 2WO3A 4IE7A 4MSVA 4E4DX 5CKNA 2YHJA 1MS5A 1GLHA 3CU7A 5FY5A 4CP9A 5FOBB 1E5RA 1GUIA 2DVBA 2DYCA 3AJYA 4QAWA 4BQ1A 4ZZ5A 5AC91 5BUVA 3N9QA 4JAAA 4YZ3A 2HWD2 4ISQA 2VO5A 4XJUA 1OQDA 3OBTA 3C7HA 5FXXA 3WNNA 4COWA 2C5DA 2XLAA 2QJVA 3N7JA 1UN1A 2VY0A 4PLMA 1RITA 4KWLA 5A32B 1G9AA 3QH7A 3AFKA 2IWGB 2CWMA 4AOCA 4BH9A 2FDJA 5G04L 4M0NA 4MX3A 5FZ0A 2RR13 1ULEA 1H4HA 1H2KA 1SDWA 3S6PA 3WHTA 3UV9A 3LSEA 2BW8A 1DGLA 4IV3C 4CDQB 1DQ5A 3T0AA 3VHOA 4QM9A 1OF4A 5F5IA 3BU7A 4N53C 4RQPA 4ASMB 1XE8A 1JU3A 1DF0A 2YY1A 4WM8A 2BJSA 5I0UA 4PQQA 3WF3A 5A6QA 2DCYA 4BXFA 2B45X 1L7RA 1QU0A 1STMA 2QQPA 3WW3A 5JWPA 1Q8OA 1S4CA 2CNAA 2WLQA 3JCIA 3MV11 4XBNA 4ZHNA 1WMEA 3W21A 4ATFA 2XXZA 3WW2A 2HEYF 2JDHA 3FC0A 5FWEA 1V70A 1OT5A 4I0WB 5IATA 5D8AA 2WAAA 5HCAA 3A21A 1GNHA 4ASKA 4GWNA 4C91A 2CV6A 4UBHA 4Y4RA 3O1OA 2WNVC 4MH0E 5FZEA 2FZ2A 1LGNA 1RUOA 1GKBA 4CDXB 4DXSA 4M3CF 5FYHA 4NIHA 3ZN6B 4XHBA 3HWJA 4YM2A 5FP8A 4BQ3A 2RS33 5JI9A 1IQDC 3KQ4B 5IUQA 2J22A 5CU1A 3W5MA 3J26N 4P02B 4D0QA 3AK0A 4QGLA 1T6BX 1QQP2 3IM0A 1MZ6A 2BQPA 4LUKA 1S2EA 2WRAA 4Y26A 2C24A 1BXHA 3RYRA 2ZGSA 3J7MA 3VBUB 5C9AA 3KD4A 1RHI1 1J58A 4XDPA 4YGCA 3S7IA 1ZYBA 4KWKA 3AMMA 1AF9A 1PGSA 1SLTA 1X36A 2D6NA 2J1AA 1HW5A 1NE4A 2RS51 4DUWA 1F8VA 1QJX3 2ADEA 5BNPB 3O1TA 1LOEA 4Y22B 3ZFEB 2I45A 3MV01 3VGIA 5HV0A 3WQ7A 5HXMA 2J7MA 4LKDA 3NQHA 5C3SA 2JB4A 4QDSA 3BGAA 5A3LA 3GBWA 3N7MA 3R05A 3ZYPA 1OF3A 4QX8A 4QPWA 4HPKB 3ZXAC 1MEC3 2ZA9A 4NUBA 2IXHA 3ECQA 4HKOA 2CGNA 2P3KA 2WZ8A 3M8LA 4OUMA 5K4LA 4QPIB 5C3OA 1CJDA 3ZR5A 2VQ0A 5IVVA 4DIQA 4NPRA 2CYFA 2NMOA 5FYYA 3OGSA 2V72A 3PMEA 2GH2A 2DDUA 3FWEA 1H1IA 5APAA 4CRQA 2ZX2A 3CJIB 3J7HA 1TG7A 1QJY3 1C8M1 5GZCA 5AC92 5JMOA 5K0UB 1BMV1 1UCXA 3WNOA 2BFUL 2PHXA 5A33B 1W0OA 4NMIA 3VBOA 1SCRA 1H6YA 2RS31 4Y1UA 5B4NA 1JXNA 2QQWA 5FPAA 5FMOL 4GIQA 1VMHA 3I3QA 4QX0A 1ZZ6A 1QNWA 4O65A 5J98B 1MS0A 5FZ8A 3D3AA 4WM7B 1HRI3 5I8TA 1R083 3ZSLA 2WDBA 4AHYA 4DNYA 4NHMA 5ANNA 4CXYA 3P5BA 3FHAA 3O7OA 1GBGA 1BKZA 2JG8A 5DAWA 3RZKA 1W6PA 1FOD3 1XE0A 2BERA 3N7KA 2FCUA 2VULA 3OD4A 4LKFA 3EQEA 3WG4A 3HN3A 5JCTA 4QD2A 1M06G 2RMU3 1JH5A 4FOQA 4KG0A 4LK6A 2G1MA 4IESA 4TTGA 5FY7A 4BDVB 1WW4A 2GSYA 1GYKA 5DG2A 3LA7A 5A32A 1SQ4A 3LA2A 3WUCA 3ZDSA 5ACA3 2W1SA 4LBMA 2YGMA 3PTRB 4OHYA 3WVJA 3H1WA 4QHZA 3ZFGC 1UZZA 5EZWA 2D97A 1I5ZA 4XFHA 2AYHA 1DQ2A 2ZEXA 1JHJA 1C1LA 1OC1A 1UU6A 4C1WA 1YRZA 2RS13 1AXZA 1LESA 2BNNA 1GANA 2VD7A 4ET7A 3WY6A 2DCTA 2PFWA 3IBMA 3K77A 4M0HA 2VVEA 1KDKA 5DAXA 1VBC3 3OEBA 4RGGA 2QCSB 4IW3A 4LBJA 3S5QA 1EYBA 4YFWA 1MVEA 1POV3 4XJ9A 5HBAA 4FBFA 2HJIA 3K4AA 3VD4A 4IEYA 1QJY1 3PUSA 3K4ZA 3WNPA 5EQUA 1WA4A 3LPFA 1JOPA 1SG3A 3INAA 1LAJA 3MYXA 5FYVA 1A78A 4S2DA 4URTA 4QXHA 5DUXA 4EV0A 3B02A 3KSCA 4XC9A 2JKBA 2Z79A 1RHI2 1CIYA 4JV4A 2YG0A 5L7OC 5FXWA 2WS93 2JG9C 2FDKA 4COVA 2P17A 2RS52 3ZN6A 2A71A 4ES9A 2VTXJ 1K12A 2A3YA 1HXS3 3ALQA 3TN91 5K7PA 2HH9A 4JKMA 1AJKA 1DQ6A 3B01A 2I74A 4HK9A 2VOXA 3GHNA 3SH4A 1ASJ1 1AJOA 3C7OA 4HVOA 3SH5A 1UYZA 3RZHA 2VCMA 3CKHA 4LE3A 2G4IA 4OI0A 5SV5A 3AX4A 4AG4A 3IMMA 5JXHA 1PM4A 2Q0AA 5F3CA 4YNIA 4HLTA 4H14A 3VKLA 3AKPA 4KU7A 5DAQA 2D6PA 2JE8A 2WYSA 3M3OA 4ZONA 2AH2A 3IB3A 5HPOA 2VMCA 5JSRA 3VBRA 2XKOA 4LLFA 2WNUC 1ND2A 4CP0A 1ST8A 1CAUB 3KGZA 2P1BA 1NA1B 3GZEA 4CP1A 4E27A 1CPNA 2CGOA 1JU4A 2VNGA 1DZRA 3CL1A 2WFF3 2CY6A 1POQA 1C8M2 1LOGA 1PVC1 1OKOA 4FPYA 3V56A 2FBEA 4P14A 1BMV2 1NXD1 5GKAC 1H30A 2XDVA 3L9JT 3QCWA 2W9XA 2P6CA 3ASIA 4QPIA 4FAHA 3HQXA 5FP9A 1SDDB 3NAPC 2Z2SB 3POGA 2VXRA 4LO7A 4FTEA 2BDRA 2P3YA 1CVNA 2ZEZA 4EWAA 2AR6A 3TBDA 4AI1A 1YFUA 1UZYA 2Q1ZB 1ODNA 5FZ6A 1OBNA 4XF1A 4XVHA 4LNVA 1LODA 2GNBA 4GB33 3Q8EA 4L11A 1JZ3A 3CJIA 4XQWA 4LQRA 5H9SA 3EXUA 2WS91 3M3IA 3O5SA 1VBD1 1WCSA 5FZDA 1QOSA 5K0UA 3U0ZA 4A3ZA 2KXLA 5A33A 4AI9A 2IXKA 1HXS1 1OD5A 4XF0A 2R071 5I91A 2JKXA 5K8SA 1GR3A 5FZ3A 5DAPA 4WM7A 4XIOA 3BPZA 1QOTA 2X29A 3LIHA 4ZU4A 2EICA 4GMP3 3PU8A 4F83A 3DL3A 1NT0A 3NV1A 4IEQA 1E5IA 4KBBA 3DF0A 4XUOA 4P08A 5FYZA 3OYWB 4CDXC 4LBLA 4YZ5A 5FZ4A 4DUXA 3ENRA 2J1VA 4Q0UA 4AL9A 5JOXA 4Q4W1 1AL22 4UW5A 2W08A 1HJGA 3OUIA 4ASLA 2HWE1 1GWMA 4COZA 3HNMA 3RJ2X 4FVVA 2FDFA 2IZWA 2A3XA 3H3UA 1OA4A 2CWSA 1B35C 4L8QA 3VBUC 4IERA 4RL7A 5KC6A 2YC2A 1OVSA 4IV1B 4LOSA 4HBNA 2Y33A 3VDBA 1BHGA 1TEIA 3I2OA 1F31A 1W8UA 3VZLA 1PHMA 5FZOA 5JSPA 4DINB 2WA4A 3LEGA 3ZFEC 1AYN2 1YFXA 4G9SB 3AC0A 3H8OA 1GQPA 2RM23 1WCKA 5CNAA 4XMAA 4QU1A 4S2HA 1TME2 2PAMA 1MZEA 2XGXA 1U12A 5FBJA 3TEXA 1LNSA 2YPDA 4K20A 3TN92 5LRRA 1AYM3 1PO23 3MUZ1 1ASJ2 1RVF2 4Q0PA 2EXIA 5CADA 3ZKYA 1S0DA 2IXLA 2VBDA 3HOBA 4LO4B 4CDWB 1V6KA 1PM7A 1W6NA 3AMQA 4GALA 4GZ9A 2V73A 1RXFA 3LPGA 1HQWA 1BQPA 4QHOA 3T09A 3AMPA 3DKWA 4D94A 1JS9A 1L7LA 3O1RA 4AVTA 4TXWA 1AUYA 1MR5A 3J7LA 5IVYA 4N90A 4J25A 4Y5TA 3KT1A 4BJ0A 3BODA 2UY9A 4BU2A 5FZIA 3BTZA 4XETA 3H3LA 3C7EA 3PVEA 4L2NA 3WOGA 4YW4A 1H9WA 4HKWA 3T4HB 5ABJB 2P34A 1POV0 1APNA 1BK1A 1ZA7A 1PVC2 3MIHA 2ZMNA 5FMCA 3FUOA 2FD8A 1LTEA 4AEDB 2A6VA 1CAVB 3POIA 2J1SA 3T08A 4LHSA 2VQAA 4RGAA 5IYYA 2VH9A 4EZHA 5LWBA 2YB7A 3DYPA 3OGJA 5F9TA 2R041 4ES8A 1J84A 4GWJA 4JKLA 3WZ1A 5FYSA 3RYPA 3GHMA 5FZ9A 4RFRB 4FFGA 2VNOA 4TWTA 3TEWA 2JIJA 3PUIA 4N43A 2J1TA 2PA7A 1OUSA 1WCQA 2ENRA 1WLDA 2A73B 2X5IB 3KZ4C 2VR4A 1J3RA 2VAUA 3RI9A 3VZJA 4BCUA 2AC1A 3ZO0B 2BGCA 3JQWA 1UXXX 1VBD2 1XU1A 3WR0A 1RTVA 2DBNA 3AZZA 2OUJA 1HB4A 2E7QA 2WT2A 1AR61 2EA7A 2CAUA 1KFUL 2W87A 3HQRA 4XZPA 2QTWB 1PO21 1XRUA 3VBFB 2D40A 1ODMA 1RUE2 3VKFC 2JENA 2R072 2RVAA 2W1QA 1IS3A 1JYWA 1UPSA 2QQUA 1U5IA 1JOBA 3AJZA 3VDDB 3KF3A 1SMVA 1OFSA 4AHXA 1W3VA 2Y0IA 4JTNA 1SBFA 2OVUA 3QOPA 1MQTB 1RC6A 2HBUA 4PIXA 4Q4X3 3VD7A 2ZX1A 5H9RA 4Q4W2 4XJ8A 3FFQA 4A7KA 3B7MA 4FP3A 4H55A 1W9YA 5EHDA 1BVVA 2HWE2 5DUWA 2GAUA 2WNOA 4CCOA 4X6QB 3NL1A 4B3NA 2XJQA 1NQDA 1ND3B 2VUJA 4LIVA 2WA3A 4ZS2A 1YCIA 3ZYJB 4NHKA 4CTEA 4DXRA 5BY5A 3ACGA 3NKTA 2BRTA 3BU0A 2ZMKA 2F17A 3R4UA 4KWUA 1JZ8A 1XBFA 4Y5SA 5CFDC 1ZZ8A 3BVCA 1ENXA 2D98A 1W2UA 3ACHA 2ZHKA 3I2IA 1DQ1A 1S0IA 2GP5A 2A75A 4RR3A 3T4VA 5IHRA 1QJU1 4GWMA 4QQPA 2NMNA 2Z4FA 5IW0A 1SPPB 3WNMA 1H8TA 2C26A 4G4FA 1PZ8A 4LOTA 2JE7A 2EVXA 3URFA 1RUD1 4EROA 3J8F3 2NP0A 3FLRA 2LW8A 3ZM8A 4CU8A 2VZQA 4LO8A 3KM5A 5KC5A 4LT5A 2ZX4A 4PF5A 4AEJA 1T2XA 5CBLA 3PUHA 1JI6A 4KBZA 2W46A 1HRV2 3VD3A 5I8SA 4BB3A 1RYYA 3JBG3 2P5BA 1LU1A 1VAMA 4W6XA 4UBGA 1AR81 1NA1C 1LHNA 2XL7A 4OQ9A 2YV8A 2WO1A 4XZUG 3C8XA 5C4WA 4YGEA 1UY3A 5CAZA 2G9FA 4R8HA 1NCRC 1NCQA 5F1RA 1ZBE3 2Y6FA 1V0AA 3MGUA 1HQLA 4CDWA 3USUB 3CMGA 4JTOA 4YW5A 4LHLA 4I02A 4M3CA 4MGSA 2R063 3CDZB 3JD72 1RMU3 1UL9A 3AVSA 4R9DA 4U2AA 4OI2A 5LB6A 3P1IA 3TRSB 4E2QA 1EUTA 2QUOA 3K75B 1C28A 4Y1XA 1FXZA 1Q3EA 4W6YA 2AEZA 2E6VA 3BCWA 4BISA 4NIIA 4D6QA 2R042 1Q8QA 4LA2A 5FJKA 1BBT3 4FTBA 4HT1T 3FZ3A 3N3HA 1TMF1 5DMYA 4ZY9A 4FPOB 4JGZC 3OPTA 1CAWA 3RMXA 4UW6A 3U10A 4KWJA 5FLIA 3JZVA 3JB8A 4K21A 1LU2A 4XDOA 2GC3A 5JVVA 5GLVA 4MV2A 1D4M1 4RQPB 5FPBA 1PX4A 4UYBA 3A7QA 4AEDA 1AR62 2X05A 5GJ6A 1EV13 1FPN3 2A6WA 2X09A 3GALA 4XAAA 3ZSKA 4DXTA 5F37A 5KXEA 2WQZC 3LOBA 5LA1A 3OTFA 4Y24A 2GU9A 1MZ5A 1GP4A 1UX7A 1X33A 2PTMA 1AR71 1CESA 1VBA3 2VBPA 4XCBA 3ZYRA 4ARXA 1OOPA 1GOFA 2QDNA 2VJXA 1WMXA 5FY4A 1XC6A 3RWNA 1CWPA 4NOTA 4XOGA 5F3GA 3W59A 1C5HA 1ZBA1 3APBA 4CU6A 1RUI3 1DGRA 1UO9A 3EO6A 4YVSC 1VRH3 1GOGA 4XTPA 2VC9A 5T5PA 4D7SA 4KNCA 4NJ4A 2ORXA 3VBFA 3JUUA 4TLGA 4EWEA 3I97A 1DP0A 1UMHA 4GD4A 1DU3D 3V0AA 1AXYA 4LBOA 2R0FA 3VDDA 1LOFC 1PO11 2WJSA 1FATA 2D43A 4Q4V3 2OZJA 3MI8A 5IK8A 1DYOA 4Q4Y3 3WF2A 4TZDA 5IK7A 1COV1 3KV9A 3I2GA 4OHZA 2UURA 1HX6A 4CCEA 1ULPA 2XLFA 3I2HA 1YXWA 3ZXEA 1Q5OA 1XNBA 5FY8A 2W3JA 3B5LB 1QJU2 3CEWA 3FX3A 4QB6A 1KQRA 1RUC3 1HV1A 1UY0A 3H7YA 4P9YA 1WW7A 3FN9A 1ND3A 4R9CA 1UY4A 1OA2A 3MIDA 4A41A 4UXAA 4BYYA 5JOYA 1V6MA 1YJKA 2PQQA 4CU9A 5LEJA 1RUD2 2D5HA 5EJZB 5JLVA 2SBAA 4UI9L 5KHIA 2AEYA 1JODA 2QBXA 3VLBB 4XFAA 2VOTA 1C3HA 2YC4A 4QQHA 3NJXA 5JXJA 1JTZX 4AYUA 1PMIA 3OJBA 1KEXA 1EAH1 2VTFA 2ZGKA 1EV11 2PN5A 3KF5A 3ON7A 2HWC1 1PZ9A 3UETA 4HETA 4CUGA 3Q8AA 4XFBA 2DCZA 1VR3A 5J09A 3DV8A 3M3CA 1W2TA 4DXZA 1AR82 1W9FA 3TB0A 1ZX5A 2ZGQA 2Y6KA 3SNMA 1QIQA 1GQGA 5I0SA 2XJSA 5KR7A 5DPNA 5F3IA 1W9WA 2XB6C 3BKZA 1RUI1 3KS7A 4O61A 3LB9A 4XDQA 2D3PA 4LBNA 4XUTA 4H3WA 1QHDA 2PHTA 4O7XA 4Z82A 2O0OA 3UYJA 4QKNA 3NWKA 4ISRA 4TLFA 1US2A 2DF7A 2ET1A 2ORZA 1S0FA 5DDJ3 5JZGB 4O9EA 2Q8OA 2X5IC 4XUPA 1W39A 3P3NA 4Q4V1 5DN2A 1O8SA 3IN9A 1RUF3 4J6GA 3WNKA 1TMF2 2UU8A 5BNOC 5KXCA 2DVGA 4BLJA 2JG8B 1NAEA 2RDNA 1W6PB 2WZR3 4E8DA 3PVBB 2Y6LA 4CEWB 1NE6A 4UW4A 3USUA 3ZKUA 1EPZA 4AGVA 5FYMA 1D4M2 1RUC1 4YYOA 4Q1PA 4YPJA 2WN2A 3EHKA 1HIXA 3LA3A 1W9TA 5DUVA 4PIZA 3D0JA 1H2NA 4LJHA 1MQTC 3PJQA 3KCYA 3N7LA 2PAKA 1RB8G 1W8WA 2XJVA 2GZWA 3JU9A 4G3YC 1CJPA 4NN0A 4TN7A 1DHKB 3RZLA 3P3PA 4CE8A 1S2KA 5FUNA 1YIPA 1I1EA 2ZACA 2V5YA 1AR72 1TQ5A 3FFZA 3ZXJA 2Q1FA 2W1UA 2VZOA 1NZCA 2F4PA 5GM0A 4Y1VA 1ZBA2 2CSGA 4I0AA 5GLUA 1LR5A 2B46X 4WBBA 4Y5Z0 5BXXA 5A1LA 5A7PA 3DEMA 4P9IA 3WDXA 4CZSA 1WW6A 2VG9A 4B7EA 2XHNA 3AZVA 4E4SA 4XF4A 1C5IA 4FPJA 1DCSA 2RG4A 4PI0A 3J7NA 3HVDA 5CYYA 4IGOA 4OUEA 1O5LA 4PBPA 1OFNA 1PO12 2GN7A 3N35A 5DZFA 3ZX7A 4W6WA 1F4HA 4AGGA 1V9U3 2JJ6A 3U75A 3LDKA 4P5HA 1TNFA 2XJUA 4CUAA 1COV2 1BEV1 4AI2A 2HWB3 4NWVA 5E1RA 4FAGA 5CB7A 1HB2A 4CEYB 2DUQA 3T2OA 2DWRA 3KMHA 2WABA 3HT1A 3H8RA 3M3EA 1HN0A 4Y3OA 4D8MA 1DYPA 1YEWA 3SCHA 4NVPA 4JGYB 1GWLA 1W3XA 4BA6A 3U4XA 5C5UA 2OIIA 3DCQA 3ZYFA 2HLEA 1UZWA 2HEVF 4YRDA 3E97A 5I93A 1H0BA 3J9SA 4AW7A 2NZ9A 4DS0A 2G19A 3AVRA 3IDEA 2J1UA 1JUIA 1VLNA 2Q30A 2Z69A 5LK7B 3VZMA 4UFHA 5AFEA 2WR9A 2ZGOA 5A7QA 1NKGA 2V09A 5CG8A 1EAH2 4ZPIA 1IS5A 1DQ4A 2E9QA 1O3RA 2HWC2 5BNNA 4DUVA 4CCDA 3FUQA 5F6LB 5JXGA 1TZOA 1OH3A 2GMPA 2RR11 3VBRB 2DFCA 5IVJA 1ND2B 3AXEA 3H8XA 1XNTA 1Y3TA 3SISA 3ZYHA 3ETQA 4HSLA 1GQHA 2JDAA 1VB2A 1YFWA 4YGBA 4AAPA 5A7OA 1BZWA 3LFIA 1ZVFA 1C4RA 2Q8CA 1RUI2 1DLLA 2PHDA 3A23A 1Y9MA 1OA3A 4IDZA 4KH9A 4MGQA 1JYIA 1GMMA 2JDYA 1WKYA 3PMSA 4PJYA 1KGYA 4AHWA 3MICA 4HVQA 1CN1A 1LRHA 4BQ4A 5FO9B 3OUJA 3HBZA 2C4XA 5GLWA 3M7AA 4H7MA 5JIAA 5EJ1B 2VZSA 3O1VA 1AZDA 2D6KA 3BIWE 3OOXA 4RQPC 3DECA 1A8MA 1Z7S3 4AVCA 3ILFA 4XABA 4WM8C 2G9GA 3WDYA 1F35A 3U78A 4AQTA 2MEV3 3TWIA 1YJLA 1KD7A 2VMEA 1OLMA 1VIWB 2EXHA 4OQ8A 4XPVA 1SLLA 2TBVA 4RN5A 4P9JA 2W68A 3WW4A 4BE3A 5CA6A 5JZGA 2CDPA 2ZGMA 4ZXKA 1RUJ3 4QKBA 4HANA 3G6JB 5D8AC 4BMEA 3HNYM 5DZGA 4YG6A 2H0VA 2JG9A 4YM1A 4UT5A 3C3VA 3B00A 3TNPB 4UFLA 4AR2A 1RIRA 4LUMA 1X7NA 3T2PA 4FPEA 4A6SA 2VZRA 4CEWA 3I3DA 4PLNA 3R4SA 2GNTA 2YFUA 1PX3A 1QJX1 1VP6A 2PXJA 1UQXA 5TSWA 4GQ7A 3RSJA 1GP5A 4NPMA 5IVEA 2DUOA 3I54A 2F4LA 2K0GA 1RUH3 4IXLA 4GH4B 1YO8A 3HMYA 2FCTA 2XH6A 5JXIA 1W6QA 4GA9A 3ZXGA 2R1DA 2RHPA 3FHIB 1VJ2A 4Q8LA 4MGZE 5C9AC 2LM3A 2BU9A 1MS3A 5JUVA 5IWFA 5C70A 1MEC1 4H7LA 1DZTA 4BIFA 2ATFA 2BWCA 2IXIA 1H2MA 1YUDA 4MGTA 5FZOB 2BFUS 1BEV2 2NN8A 2EXJA 4IE6A 2JDKA 4AVSA 1ULOA 5FMOS 1TE1B 1PMHX 3SXWA 5FKBA 3WINE 2ZHMA 2JDZA 4E2GA 1O3SA 2B5HA 1G9BA 1PNGA 2WT1A 5CKMA 2IFWA 1OQEA 1LOCA 2PHWA 4Q0SA 3NJYA 1R1A3 2OX0A 3SITA 1B09A 3RYKA 5CG9A 3NAPA 3ZFFB 2NYYA 3U07A 2D3RA 1TVGA 2Q5TA 4UFIA 1W6NB 3U37A 4QGNA 1YQ8A 3ZIWA 3BOWA 4S2FA 2CAVA 4CEYA 1YHFA 4CUCA 3VB9A 4MUVA 3MBWA 5L9BA 1WCDJ 4JGYA 5IVBA 3JB4C 2JD4A 3M1HA 1HRI1 2Y64A 4MG2A 1QKQA 1R081 5F32A 5EXOA 3KT7A 1VBB3 3T3YA 2RR12 3HAGA 1FOD1 2D6LX 1HLCA 3CZUA 2HEWF 4LK7A 4UFKA 1Q43A 4YLZA 1XNCA 3AYAA 3A0NA 4OI1A 4IEUA 1IGOA 3VBOC 5FZKA 2RMU1 1GV9A 3MDPA 4YVWB 4A7YA 1XYNA 1JMUB 1K5MB 4FCAA 1AHSA 4QX5A 2D7FA 5FPXA 2R7EB 5JI7A 2OYZA 1UYXA 4RD7A 5ACA1 2ZGRA 4LTAA 3VN4A 2XVGA 4CCLA 4BOWA 3GZAA 4IE4A 1CR7A 2A6XA 2OW4A 2XL9A 2ZXQA 3FLTA 1ACCA 1KJLA 2JG8C 2UWCA 1PIV3 1PK6A 1FT9A 4WVZA 1GZ9A 5GZFA 2ETEA 3ZMNA 1X8EA 2PAEA 1OI6A 1RJ8A 5FDBA 4CCKA 3WQ1A 5EWSA 1C57A 2I2SA 4J1WA 3ZYGA 1DGRN 3O1UA 3ILRA 1O7FA 4ZZ8A 5L9RA 4N43B 2FCVA 2B42B 1XOYA 3U4SA 2RS11 3VDCA 1UY1A 4OMDA 4XBLA 3N9LA 1SCSA 2FZ1A 3AP5A 3WF4A 2E63A 1WWYA 3K48A 4ZU7A 1VBC1 1VB4A 2XJPA 5F6KA 3W9AA 1JOJA 2LTNA 2VZVA 2VQUA 4EE2A 3I3MA 4PHZA 1O4ZA 2RS32 3M3QA 1NG0A 1POV1 2K2SA 5H9QA 1XQNA 2HWF3 3LOIA 1R093 1HDKA 4UAPA 4XF9A 3BN6A 3ABZA 4AFBA 3I2FA 1NX9A 4CDQC 4B4PA 3FMGA 1Y7BA 3RDIA 4EN7B 4FQZA 4EJRA 5EV7A 2L9LA 2WWUA 5IAVA 5J3UA 2GMMA 2A6YA 3J4UH 2WWSA 4FOVA 1XSQA 5FZBA 4FXGB 1GZWB 3ACFA 3GCXA 5HXVA 4RFT0 3SHRA 1M4WA 2WT0A 2R30A 4ITCA 1UYPA 3OGVA 5KXDA 1RUG3 1QJX2 3E5XA 2CL2A 3ZXFA 2XBO3 5FYUA 3KT4A 3THPA 3GXUA 4NHLA 1DQ0A 2VUAA 4CDUB 3K3NA 3PURA 3VZOA 4DZGA 2QQJA 5C8CB 1K42A 4XURA 2I07B 2O8OA 4DQAA 3K3OA 2XHKA 3HIFA 1D2QA 4LBKA 1LGBA 2FMDA 2OPKA 2W5FA 2EF6A 3H7JA 1W2AX 3OF1A 5FTTC 3WT3A 4Z8BA 5LRSA 3ELNA 1K5JA 1MEC2 4P9LA 1RUNA 2PHLA 5JSOA 3HBKA 4QPYA 1WCUA 3AFGA 1QH7A 4RR3B 2ARBA 1XNDA 1XPWA 2ZGUA 4FPGA 1Z0HA 4OVEA 4QXKA 5C7GA 3IT8A 1FNYA 3Q8CA 4K8RB 1KJRA 2PLV3 4GH4A 5HV4A 1RXGA 2XMLA 3QD6A 1W8ZA 1H8TB 3WQBA 3ZLIA 3PVNA 3N9OA 3ZN4A 1W8OA 5M0TA 3A22A 4RHV3 4E4ZA 1CQ9A 2JXAA 2WFF1 1QJY2 3ES1A 3F95A 4F8AA 2Y60A 2O8QA 4YW7A 2A6ZA 2JE9A 3D5OA 5FQ0A 3TNQA 5BNPC 4GJZA 4MGIE 1W04A 1CZTA 5G05L 2A7AA 2E26A 2WBKA 1YI7A 2Y6GA 2VM9A 2HWF1 3KCXA 3VBRC 4OZOA 1MS1A 5LA2A 2YC0A 1Q8PA 1HN1A 3WF1A 3MFAA 4BM8A 2NQYA 1HRI2 2WSUA 5F2SA 1R082 1YLLA 5A6ZA 1G9DA 2ZGPA 4R9BA 2BVBA 1E5SA 4GB31 3I4IA 4KGQA 1I6XA 5C4WB 1FOD2 4YW6A 1FNZA 1X82A 1O8PA 5DG1A 1NCQB 5JMCA 1GZTA 1LKNA 5ANQA 3BIEA 3GBGA 4MVTA 1A8DA 2RMU2 2WC2A 3ZFFA 3DPRB 4QPIC 1OKQA 2V4VA 5CFCB 4M3CB 3PHMA 4UF0B 4ZXEA 5J37A 1IKQA 1MVQA 1GP6A 3H50A 4MOAA 4ZKTB 4Z1VA 4OUSA 3W5NA 5A7WA 5ACA2 1SEFA 3TEYA 2P3IA 1UPIA 3WNXA 2K46A 3MF9A 3WP3A 4XYXA 1X9TA 4OULA 2VZ3A 3H42B 5T50A 3CJIC 5FCCA 3LE0A 3OPZA 4GMP1 2R1BA 4R4XA 1GU3A 3OY8A 4LITA 1JYXA 1D0GA 2GC2A 5K0UC 1CAWB 1VBE3 4BHPA 2BGOA 3ACIA 4V2WA 4YVWA 2DCKA 2VQTA 3GDBA 2RS12 3OGGA 4B7KA 3NNGA 1K5MA 1PZ7A 4BPZA 1QY4A 4N9IA 4AI0A 2R0HA 3EJKA 1ZZ7A 3IDBB 2PLV1 1VBC2 4WM7C 3KHCA 2DU1A 2GC0A 3ZYIB 4HN0A 3E6CC 1W9SA 4RHV1 4PLOA 5EP9A 1UIJA 1D0HA 3VBSA 2VMHA 3MLKA 3T0BA 3UJOA 3E6BA 3AZYA 3KLSA 5LW9A 3KV6A 3UKVA 3WV6A 1OOPB 3AP4A 3SKJE 1W2NA 4BQWA 2VMFA 2ZZQA 2FMYA 1LJ7A 2H6BA 2MHFA 2RM21 1JZ4A 3GGLA 1W90A 2WS92 3ETPA 1OSGA 4LORA 5BV6A 1N1SA 5FPVA 1ONAA 3S7EA 3UKTA 1LB2A 2V5DA 1HXS2 5FUPA 1AYM1 4P9GA 2DVAA 1OLQA 3VBHA 5LBBA 2XUMA 4NWWA 4FT8A 3I59B 3V0AB 3RNSA 2QQNA 2GH8A 5DAVA 3TAYA 2BWAA 1A3KA 4PIYA 2KR2A 2B7YA 4RS5B 1FMD3 3MZHA 3N4MA 4L92A 4JDNA 5JPMB 4AQ2A 4PDWA 3VD5A 3UL2A 4UOJA 1GZWA 2WFPA 2LROA 3KV4A 3UJQA 1ZZ9A 5AVAA 1AR93 3GCWA 2BOJA 1O91A 1O3TA 4LE4A 1NCRA 3OEAA 3UGFA 1FV2A 2WWJA 3THTA 4CDUA 5C8CA 3PUQA 1WZXA 1MS4A 4K8FA 3OB8A 2CDOA 5IFTA 1XSRA 2W92A 4DFSA 4HL0A 4WZFA 3T1LA 1VBE1 4A6OA 4FOWA 2WFF2 2XLGA 2VL4A 4XXPA 4OHWA 4Q5OA 3MFCA 1NYWA 3D4KA 3WDVA 4JGZA 4TSVA 4AVBA 1A34A 3IKWA 3N9NA 2ZBJA 1YFYA 2QFEA 3B9CA 1F15A 1NOVA 4LO5B 3VHPA 5JR2A 3LZZA 5T52A 2N7GA 3GJBA 2EAKA 5F2WA 1W8FA 4GB32 4XFIA 4GKYA 2JDNA 5CISA 1FV3A 2WQ4A 1K3IA 4LIUA 1ZREA 2YBSA 3NMBA 1UU4A 1I9RA 1QJEA 4R52A 2Z42A 1UNBA 3MIEA 4AFDA 4MZUA 3AYDA 1N1YA 2GDFA 3OD0A 5A80A 3MEPA 1W6OB 4N7UA 3NNLA 1H1AA 4LEJA 4OMCA 2HWD3 1O4YA 2ZPXA 3WDTA 5B4XA 2GNDA 3MPPG 5LY2A 4N43C 1WLWA 4JHTA 2Q1MA 1QDOA 1IOAA 2OZ6A 2WNVB 4FXKB 4Y1ZA 3WLUA 3BTYA 4WVWA 3T0DA 1O6UA 2JD9A 4Y4YA 1DLCA 3BYWA 4YVSA 2QQIA 1CPMA 4Q4X1 3AMHA 4QX1A 4V2VA 5F5CA 3AYCA 4AHZA 5FBZA 1AR91 2YPJA 2VMDA 2W91A 4EZ4A 3DPRA 4UFJA 4EN8B 5CFCA 5EIYB 3WDUA 4UF0A 4Y20B 1UU5A 1YQ5A 1R64A 2WZPP 1W8HA 1W06A 4QB1A 4WVMA 5DXDA 5FO7B 1ALYA 5CKQA 3TYJA 1Q56A 5FZAA 2WO2A 5LATA 1FAYA 1FI2A 5L9VA 2YGLA 3WHUA 1KRIA 5LA9A 2VZPA 5HCFA 4LHNA 1U5XA 2OQ7A 4NR1A 4MHUA 2ARCA 5A6YA 3OBZA 1UWWA 2RM22 1WA6X 2B9UA 4FPFA 4EN9B 5HCHA 1EUUA 1QGLA 3FBMA 4RGKA 5J48A 3T2TA 3LDRA 1ZM1A 1QJFA 5FZCA 3O0XA 1AYM2 1PO22 1ZNPA 2XWBB 1MS8A 3LAGA 3POWA 3PVOA 5CVRA 4YW2A 3RZZA 2QQVA 4PI2A 1GNYA 3HN1A 3J8F1 5FIXA 4IQPA 4ONUA 1S0JA 3VL9A 3ZDVA 4YZ4A 3IDAA 4RR3C 5IJRA 1SBDA 4Q29A 1LGCA 4QX3A 1ULGA 4IEWA 2Q8DA 4FP2A 4QPGA 1W8NA 1QQP3 2KA3A 1W6MB 3JBG1 4IGQA 2P2KA 4F3JA 2YBPA 4CXXA 4A44A 2YBKA 4Y33A 1YNAA 2VCAA 3NNMA 4IV1C 3I59A 1Q8VA 2P3JA 5FZMA 1QWRA 4KQ7A 4A4AA 3S30A 4DRVA 5FYTA 1LULA 3K46A 2YUEA 3PIGA 1ZBE1 4RS5A 4XCAA 1W8TA 3WXPA 2R061 2PMWB 3MHZA 2AUYA 1RMU1 1Y9GA 4YG0A 2AACA 3LCPA 4B1LA 1N3PA 2ERFA 3H1MA 4QGMA 3N36A 5E8AA 3O0VA 4JC1A 5C4WC 4BQ5A 3GF6A 5BNNB 3ST7A 2JB8A 3POSA 5EPAA 4GKXA 1NCQC 1BBT1 2J1RA 2RJLA 2W0XA 1O59A 3CF6E 5ERLA 4BQXA 4YSFA 3E6DA 5FOJB 1N3OA 3WSOA 1OD3A 4CDWC 3W58A 2RDQA 2PHFA 2JDUA 1IPJA 3AXDA 1HB3A 3LDBA 3NKGA 1CZSA 5F5AA 1IPKA 4PT6A 5JR7B 1CX1A 1YQCA 4HFSA 1GNZA 1UF2C 5L19A 2YDEA 2CTVA 1IQAA 4HZFA 1MZFA 1UMIA 3ZFGB 4IL7A 1PGL1 1FPN1 2VNRA 4GAZA 4COUA 5AC93 2WKKA 2XOMA 5FYCA 4IV3A 3O1PA 1NLRA 4RA0A 4N53A 4CYDA 2YROA 1VBA1 2FQPA 3C7FA 3LQCA 4CA9A 5ABJC 1O5UA 5JOZA 2X10A 4Q4X2 1REDA 1WLTA 4IEXA 4H2AA 3ZYBA 1CIWA 3NNJA 2NPIA 4QQOA 4AEDC 2EXKA 5FAXA 1WBFA 2YMZA 3C7GA 3AB0A 3AZWA 4GWIA 3V0BB 1LHVA 2VUCA 1VRH1 4XQDA 1CGPA 2F6BA 5A3WA 1W6OA 4YW3A 4B4RA 1EY2A 4YZ1A 1SZBA 1K45A 1NZIA 3DYMA 2QDRA 3MIGA 4PBOA 4XFFA 4AVAA 4D6SA 1CAXB 4M4PA 1JYTA 1XYPA 2ES3A 2BGPA 1VALA 5JIUA 1S2BA 5A6XA 2WNVA 1L7QA 1O3QA 1WBLA 3MLJA 2H6CA 2JG9B 2EIDA 4DPNA 1CZVA 3IPVA 4Q4Y1 2Q4SA 1GICA 2B4KA 1QXRA 1XJAA 4QM8A 4X6RB 2ZGTA 1ENQA 1G6NA 1YWKA 2BOIA 4I3GA 3ZPYA 1GFF2 3M70A 2A3WA 2Q8EA 3H0OA 5LZ6A 3FJSA 3VBFC 2D3SA 2DFBA 3OSDA 5JPNB 4Y20A 5AVPA 3VL8A 1RL3A 2GNMA 4SBVA 4RYDA 4IEOA 1ZRDA 2BPA2 1SFPA 3VDDC 2EIBA 4BXSV 4W4ZA 3AZXA 4AE2A 4B1MA 2P4EA 4MXVA 3DXUA 3ZSEA 1W6QB 5IVFA 4MHRA 1PMJX 2IXJA 3I2DA 1XYOA 3J8F2 3I3EA 3LGRA 3RPQA 1D2SA 4C0HA 1XNAA 3B9IA 4JKKA 4P9XA 4HSJA 2KD7A 3BTXA 2D6MA 4XTMA 3ZPOA 5KHGA 3EYPA 4HXCA 3SH3A 2EALA 2ZAAA 3WDWA 4FPLA 2WNUB 1ND3C 2RJKA 2LUWA 3SCFA 4CCNA 1YQ6A 3JBG2 3D8CA 4YFZA 4Z92B 1RHI3 5KHHA 2ZCWA 2QQKA 3PNAA 4JQTA 3ZOIA 4W65A 3IDCB 2B39A 4D69A 4L99A 4OHXA 2RS53 5LA0A 2FDGA 3OUHA 3PUAA 1WMDA 4QT6A 4C8DA 3HEIA 4DY5A 1ZBE2 2BNMA 3B94A 4X8PA 1WMFA 2BTVC 3Q8FA 5DABA 3I49A 1H2LA 1Q8SA 2R062 3NAPB 2X53S 1RMU2 5D2AA 5C5TA 5CEHA 3EB7A 3HR9A 2HKXA 4JHZA 2Z5WA 3ROUA 2WIIB 1UXZA 4A42A 1W6MA 2XKPA 2XVKA 4X8NA 5DDJ1 1S0GA 3SMHA 4N8MA 4K9SA 4QDQA 5K9YA 5FXZA 1BBT2 3SCGA 1F4AA 1RUF1 5FLJA 5T5JA 2CGPA 4XFGA 2UWBA 2Y26A 2WZR1 2TEPA 3AM2A 3NW4A 3BI3A 4CPBA 3MIFA 3RWKX 3W20A 1KXGA 3KVAA 1S0EA 2PELA 3UKNA 2E7TA 1ENRA 4DMIA 1H8VA 3E1F1 5L73A 5T5OA 4LA3A 3D0SA 5FKCA 5EYYA 5FZ7A 4MADA 2QZ3A 5FZFA 3NJZA 3POBA 2WQ8A 1PGL2 3I3BA 1QNYA 2UYAA 1C8M3 1MS9A 4QHBA 1EV12 5T54A 3ZR6A 1FPN2 3RZGA 3B93A 2VZ1A 2W52A 5D1IA 4I3PA 3NNFA 4YG3A 1PK6B 2E7AA 3AYEA 3HQUA 5E6HA 4XHXA 5FYBA 1VBA2 2E33A 1UX6A 5FK7A 1JZ5A 2XG3A 1J83A 3IAQA 5C3PA 5GLZA 1US3A 4BLIA 4HVRA 4XJZA 1HJFA 4PF1A 4CVUA 1WD3A 2DV9A 1SLAA 1J3QA 1B35B 2DTWA 1VRH2 4MO3M 5DZEA 3ZFGA 3I2JA 4HN1A 1UOGA 4Z07A 3T30A 5LBCA 1JYCA 4EN6B 4MGKE 4I01A 1N1VA 4CXWA 1H6XA 4Q4V2 1WD4A 1V9U1 4LHKA 4A45A 4Q4Y2 4CPBD 2WSVA 1AXKA 4FSJA 3U1XA 1PVXA 4Z2WA 2HWB1 4CSWA 2ARXA 5IAXA 3LFMA 3RMYA 2WNEA 3FHQA 1W03A 5FPZA 3BALA
chains in the Genus database with same CATH topology
1PGW1 1OMIA 1RUC2 4DRRA 2ZZJA 2NLRA 4XEZA 1N1TA 1S0BA 1CAXA 3M4FA 5HI0A 1AL23 1LEMA 4K40A 2ZX0A 4I2OA 5KBFA 5L7OA 1QXJA 3AKRA 3H9AA 3CJXA 3VKOA 2VECA 2ZHNA 2K9ZA 2R32A 2D6OX 2DCJA 1AYN3 3KCCA 2BEOA 4KGGA 4N7IA 4Q0QA 2SLIA 1TME3 3ZSMA 3EBRA 2AZ5A 4B8EA 2A70A 2UWAA 5KHKA 2ZMLA 3TN93 1QMJA 4DY3A 2R6QA 1F2NA 1BJQA 3MLLA 1F9KA 4QU2A 2QNKA 2RE9A 5BNNC 1ASJ3 1RVF3 2XVLA 5FQ0B 2ZX3A 2WNUA 5BYNA 1N47A 5FLHA 1JW6A 1GSLA 1REEA 5DDJ2 1SFNA 3OBRA 1UIKA 4JDOA 1L3JA 4KG8A 3USSA 4AI3A 1RUF2 2JX9A 1Z7S1 2VW2A 2WZR2 2VGDA 2VPVA 2MNGA 2AGSA 4XXAA 3RRDA 2MEV1 3RI8A 4C90A 2TUNA 2DUPA 4R9AA 4CDQA 2ZKNA 1S1AA 1F5JA 5C6CA 1QDCA 1AL21 4YW1A 3WCSA 1XE7A 1PVC3 1LOBA 1RUJ1 4PQ9A 3H3ZA 2AREA 4YGDA 1JUHA 4LULA 1FYUA 2D44A 3OY8B 4INDA 2ZGLA 3AKSA 3AP7A 1EP0A 3L2YA 4AI8A 1AVBA 4E2SA 2QZ2A 5JZGC 2ZTNA 1FX5A 1AYN1 1JBCA 4AK3A 5BNQA 5GZEA 1RUH1 1HKDA 3UK9A 5LEKA 4CDXA 1TME1 1UAIA 1VBD3 3AP9A 4BWOA 1IKPA 2WLPA 5CFDB 4HKLA 1UD1A 4CEWC 3VBSB 1V9U2 5J36A 1RUE3 2E53A 4LBQB 2R073 4XMIA 1RVF1 3V65A 1V6LA 5FO8B 1YIFA 1A6CA 2HWB2 3LSDA 4E9KA 5C8WA 1B35A 1UKGA 2NM1A 3VBUA 2VMIA 4WZCA 1PGW2 2OA2A 2HYKA 2C9AA 4Q8KA 3QH6A 4AQ6A 4XFCA 1S0CA 4M00A 4XBQA 3VBHB 4JQRA 3C2UA 4KL1A 4Q4W3 4AEKA 3WQ0A 5BNPA 4Y22A 1IHMA 3ZFEA 1R1A1 2HWE3 2KM2A 1U0AA 2C1FA 3CO2A 4PDWB 1NQJA 2VOVA 3D6EA 4HPKA 2BVVA 4O9GA 4XIKA 5SV8A 1HQNA 1NCRB 4Y1YA 2QVSB 1KDMA 1UKRA 1VBB1 3AP6A 2ZGNA 1CONA 3WG1A 4JRLA 4MXWB 2BBVA 1D4VB 1DYKA 1I3HA 4BMBA 2DTYA 4FO9A 4CEYC 1OHFA 3ZVXA 1VAKA 4HK8A 3PLQA 1WGPA 1NY71 1UMZA 4GXLA 2QE3A 4M3CE 4C0BA 5C33A 1Y43B 4JGYC 3S0MA 3GZTB 1WW5A 2AENA 3O14A 5L36A 2VVDA 4JGZB 4IEVA 1PIV1 4B29A 5EFUA 2GMEA 3PJYA 1X8MA 3RS6A 3V0BA 5GZDA 3RJRA 1KS4A 4A3XA 1RUE1 1LCLA 1HRV3 2QKDA 3ZXDA 3OCPA 1G9CA 2PHUA 1GZCA 1NXMA 1Z7S2 3R4DB 1LEDA 3VUOA 4JRAA 3NV2A 4XW3A 2D93A 2MEV2 4R4ZA 3AMNA 2VOKA 1U5YA 4DB5A 4JCKA 4AGRA 1PK6C 4D7YA 1C1FA 2GALA 1PNFA 3R6SA 1ND2C 1R091 3JD73 1AL0G 1RUJ2 1G8WA 3MW2A 4ATEA 3T1MA 1LECA 4YVSB 2ZS6B 2R043 1DFQA 1H4GA 1RUG1 1DZQA 5T55A 1V00A 2XBO1 4D3WA 1XXNA 4C1XA 2MPFA 1RUH2 2W39A 3NV3A 1BCXA 1RINA 3O0WA 5E88A 4WVMB 3CLPA 2O1QA 1X50A 5IK5A 1AR63 1H9PA 2E51A 4MYEA 1Y9QA 4OI4A 1ZRCA 4OFGA 4S2GA 4XJAA 5I0TA 5KWRA 3L2HA 1SFYA 2EIGA 5IT6A 1H1MA 2R49A 5E16A 5AFBA 4IETA 2A5ZA 4FQ4A 4EN0A 1QJZA 3O12A 3R0RA 5JOWA 5GALA 2VW1A 1HRV1 4AFCA 2UY8A 5CFDA 3FBYA 1R1A2 3AKQA 4D7TA 3CNAA 4LBQA 2PHRA 1WUVA 1V6IA 1KFXL 1SLCA 4JVAA 2D5FA 4QPGB 1V6OA 4GH4C 3ATGA 3ME2A 4K6BA 3JD71 4AXOA 4AWDA 4META 1XU2A 4QQ2A 5GZGA 1VBB2 3H1YA 1SACA 1Z78A 1J1LA 1R1ZA 1QJU3 2ILMA 3ZN5A 1QXPA 4AF9A 3BTAA 3M2MA 3DUIA 1CAUA 5FFOC 2UYBA 1NA1A 4OHVA 1NY72 4HMZA 4IEZA 1RUD3 3SLIA 4Q1RA 3GZUC 4MLOA 5BNOB 1J1TA 1LENA 3WG3A 2WINB 1J3PA 3IWZA 1PIV2 1IS6A 5A3MA 1V6NA 3U11A 3HD8B 5T3NA 2XJTA 3KB5A 4AFAA 4MXWA 4GULA 3ZFFC 4SLIA 5EJ3A 1IS4A 4LBQD 1AR83 1IZ3A 2GC1A 3QBQA 3I8TA 3VHNA 3FLPA 4YZ2A 3LKJA 2Y38A 5H9PA 2JICA 3DGTA 1BVP1 4XF3A 1ZZCA 4OLLA 2HWF2 1R092 3WW1A 2ET7A 2ZJCA 3RG0A 4IV3B 2H0BA 3WCRA 4N53B 4YVWC 1XNKA 2EAAA 3WP6A 5JDBA 1K5MC 3WP5A 1OPMA 3PTYA 2IC1A 4NO4A 3VKNA 2P37A 2DU0A 3VZNA 1TMF3 4Q0VA 3OYWA 1RUG2 2PYTA 2ZOEB 2XBO2 3MIBA 1OQ1A 1EPWA 2DURA 3VBSC 3GYDA 3MW4A 4IEPA 1D4M3 4A2UA 4FPKA 3NO8A 1FMD1 3ZXLA 1AX1A 1URXA 3GNEA 5B2GB 3IPVB 1JHNA 1OLRA 3MW3A 3RQ0A 1F5FA 4IV1A 3E5QA 4FOYA 2VMGA 3I7DA 1BYHA 1VAVA 3VBHC 2XWJB 1AR73 1LOFA 1E57A 2PLV2 4GMP0 3IMNA 1ZBA3 1SLIA 4K1YA 4Q2FA 4ZU5A 3LWCA 1NLSA 1SBEA 4PDWC 3ES4A 4YM0A 4RHV2 1G86A 3D82A 4I30A 4J1XA 2B8MA 5BPXA 2XJRA 5T5LA 2VW0A 1PO13 4M01A 2C0ZA 4CDUC 5C8CC 3A0KA 4COYA 4AEMA 4BIOA 1COV3 1LOAA 3FE5A 4I0BA 3E5UA 3B3QE 1QF3A 1QOOA 4K7JA 3G7DA 4YM3A 1ZRFA 1LHWA 3A4UA 3VKMA 2YZ4A 1V6JA 3QLQA 1T6GC 4MGYE 4PCRA 5CIRA 5ABJA 1JN2P 1UW8A 3WD5A 2HWD1 2IFRA 3K51A 1H8TC 3WUDA 2BNOA 1DGWA 2ZAHA 1CAVA 3NVCA 1RJ7A 4WM8B 4WVVA 3WX5A 3ZMOA 1EAH3 1LHOA 1O4TA 2HWC3 3MPBA 5E89A 2IXCA 5GLTA 1TNRA 3VV1A 4L97A 3X29B 2ZHLA 2R16A 1WLCA 1VBE2 2YYOA 5JAXA 5I8YA 2LALA 4LLOA 2X5IA 5D8AB 4XJWA 3POYA 5BNOA 1ZA4A 3BB6A 1ULCA 5FRAA 1YI9A 3KQRA 3NSTA 1HV0A 4FPCA 1N3QA 1QH6A 2BYVE 5I0RA 1S55A 2FHRA 4LR4A 3ZXKA 3DPRC 1YYNA 5CFCC 2GN3A 3ACLA 1LHUA 4Q26A 4K1ZA 1MQTA 3Q9OA 4U36A 4KU8A 3ILNA 4JDMA 4B4QA 2XPJA 1AX2A 5C9AB 1MACA 3V64A 4DOUA 2ZABA 2DVFA 1C8NA 2Y0OA 3H8UA 4N9HA 2ZKLA 1CX4A 2VU9A 4OZXA 1FMD2 4ORFA 4V1PA 1SLBA 2VOWA 5HCBA 1ZZBA 4K3UA 5IK4A 3B69A 4AQSA 1CD3G 1KS5A 1ULDA 1QQP1 2JEMA 4Q27A 1AR92 1OPOA 2VVFA 1DIWA 4BZ4A 5DUUA 4AVVA 1G7YA 3DN7A 2WL1A 3ZSJA 4FPHA 4CP2A 3BOPA 3JQXA 1AX0A 4RSUA 5F5QA 5EYXA 4L9BA 1OOPC 4UW3A 4WV8A 1ZRRA 2TNFA 2YXSA 2BUKA 5L7OB 4QPGC 4XE9A 4P9WA 1ULFA 2JECA 1REFA 3KGLA 1W0PA 1U5ZA 1RGSA 3AKTA 2DVDA 4A7ZA 5KXBA 3WP4A 3GBFA 3IIAA 4TYSA 4LO6B 5LK5A 3VHRA 5KHJA 3MF6A 1DDLA 2OUHA 3WG2A 1BEV3 4XILA 1DG6A 3VBOB 3ZIXA 5J7MA 1ENSA 4RS5C 4I09A 5FREA 3HT2A 1DBNA 4EWDA 4F7ZA 1J59A 1KITA 1G9FA 3QACA 4QMAA 3TOJA 4QQLA 4AFMA 4XQ4A 3NV4A 1DGWX 4FTSA 3VZKA 2X8KA 4MSVA 4E4DX 2YHJA 1MS5A 1GLHA 3CU7A 5FOBB 2DVBA 2DYCA 3AJYA 4BQ1A 5BUVA 5AC91 4JAAA 4YZ3A 2HWD2 4ISQA 4XJUA 1OQDA 3OBTA 4COWA 2C5DA 2XLAA 2QJVA 3N7JA 1UN1A 2VY0A 4PLMA 1RITA 4KWLA 5A32B 1G9AA 3QH7A 3AFKA 2IWGB 2CWMA 4BH9A 4M0NA 4MX3A 2RR13 1ULEA 1H4HA 1H2KA 1SDWA 3S6PA 3WHTA 3UV9A 3LSEA 2BW8A 1DGLA 4IV3C 4CDQB 1DQ5A 3VHOA 4QM9A 3BU7A 4N53C 4RQPA 4ASMB 1XE8A 1DF0A 2YY1A 4WM8A 5I0UA 2DCYA 2B45X 2QQPA 1QU0A 3WW3A 5JWPA 1Q8OA 2CNAA 2WLQA 4XBNA 3JCIA 1WMEA 4ATFA 3WW2A 2HEYF 3FC0A 1V70A 4I0WB 5D8AA 5HCAA 1GNHA 4GWNA 4C91A 2CV6A 4UBHA 2FZ2A 2WNVC 4MH0E 1LGNA 1RUOA 1GKBA 4CDXB 4M3CF 3ZN6B 4XHBA 3HWJA 4YM2A 2RS33 5IUQA 5CU1A 3J26N 3AK0A 4QGLA 1QQP2 3IM0A 1MZ6A 2BQPA 4LUKA 4Y26A 1BXHA 3RYRA 2ZGSA 3VBUB 5C9AA 3KD4A 1RHI1 1J58A 4YGCA 3S7IA 1ZYBA 4KWKA 3AMMA 1AF9A 1PGSA 1SLTA 1X36A 2D6NA 1F8VA 1HW5A 1NE4A 2RS51 1QJX3 5BNPB 1LOEA 4Y22B 3ZFEB 2I45A 3VGIA 3WQ7A 5A3LA 3GBWA 3N7MA 3R05A 3ZYPA 4HPKB 3ZXAC 1MEC3 2ZA9A 2IXHA 3ECQA 4HKOA 2CGNA 2P3KA 3M8LA 4OUMA 4QPIB 1CJDA 2VQ0A 4NPRA 2CYFA 2NMOA 3PMEA 2GH2A 3FWEA 1H1IA 4CRQA 2ZX2A 3CJIB 1QJY3 1C8M1 5GZCA 5AC92 5K0UB 1BMV1 1UCXA 2BFUL 2PHXA 5A33B 1W0OA 3VBOA 1SCRA 2RS31 4Y1UA 1JXNA 5FMOL 4GIQA 1ZZ6A 1QNWA 5J98B 1MS0A 4WM7B 1HRI3 5I8TA 1R083 3ZSLA 4AHYA 4DNYA 4NHMA 3O7OA 1GBGA 1BKZA 2JG8A 1W6PA 1FOD3 3N7KA 2VULA 3OD4A 5JCTA 3EQEA 3WG4A 4QD2A 1M06G 2RMU3 1JH5A 4FOQA 4KG0A 4IESA 1WW4A 2GSYA 1GYKA 5DG2A 3LA7A 5A32A 1SQ4A 3LA2A 3WUCA 3ZDSA 5ACA3 4LBMA 2YGMA 4OHYA 3WVJA 3H1WA 3ZFGC 1UZZA 5EZWA 2D97A 1I5ZA 4XFHA 2AYHA 1DQ2A 1C1LA 1UU6A 4C1WA 1YRZA 2RS13 1AXZA 1LESA 2BNNA 1GANA 3WY6A 2DCTA 2PFWA 3IBMA 4M0HA 2VVEA 1KDKA 1VBC3 4RGGA 2QCSB 4LBJA 1EYBA 4YFWA 1MVEA 1POV3 4XJ9A 5HBAA 4FBFA 2HJIA 4IEYA 1QJY1 1WA4A 3INAA 3MYXA 1A78A 4S2DA 4URTA 5DUXA 4EV0A 3B02A 3KSCA 2JKBA 2Z79A 1RHI2 4JV4A 5L7OC 2WS93 2JG9C 4COVA 2P17A 2RS52 3ZN6A 2A71A 4ES9A 2A3YA 3TN91 1HXS3 3ALQA 5K7PA 1AJKA 1DQ6A 3B01A 2I74A 4HK9A 2VOXA 3GHNA 3SH4A 1ASJ1 1AJOA 4HVOA 3SH5A 4LE3A 4OI0A 2G4IA 5SV5A 3AX4A 4AG4A 2Q0AA 4YNIA 4HLTA 4H14A 3VKLA 3AKPA 4KU7A 2D6PA 3M3OA 2AH2A 5JSRA 3VBRA 2XKOA 4LLFA 2WNUC 1ND2A 4CP0A 1CAUB 3KGZA 1NA1B 4E27A 4CP1A 1CPNA 2CGOA 2VNGA 1DZRA 3CL1A 2WFF3 2CY6A 1LOGA 1C8M2 1PVC1 4FPYA 3V56A 2FBEA 4P14A 1BMV2 1NXD1 5GKAC 1H30A 3QCWA 3L9JT 3ASIA 4QPIA 4FAHA 3HQXA 3NAPC 2Z2SB 4LO7A 2VXRA 4FTEA 1CVNA 4EWAA 2AR6A 3TBDA 4AI1A 1YFUA 1UZYA 2Q1ZB 4XF1A 4LNVA 1LODA 2GNBA 4GB33 4L11A 3CJIA 4XQWA 5H9SA 3EXUA 2WS91 3M3IA 3O5SA 1VBD1 1WCSA 5K0UA 1QOSA 3U0ZA 2KXLA 5A33A 2IXKA 1HXS1 1OD5A 4XF0A 2R071 5I91A 5K8SA 1GR3A 4WM7A 4XIOA 3BPZA 1QOTA 2X29A 4ZU4A 4GMP3 4F83A 3DL3A 3NV1A 4IEQA 4KBBA 4CDXC 3DF0A 3OYWB 4YZ5A 4LBLA 3ENRA 4Q0UA 5JOXA 4Q4W1 1AL22 4UW5A 2W08A 4ASLA 2HWE1 4COZA 3RJ2X 4FVVA 2IZWA 2A3XA 3H3UA 1OA4A 2CWSA 1B35C 4L8QA 3VBUC 4IERA 4RL7A 5KC6A 4IV1B 4HBNA