1QJZA

Three dimensional structure of physalis mottle virus : implications for the viral assembly
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
179
structure length
179
Chain Sequence
KQASIPAPGSILSQPNTEQSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN
publication title Three Dimensional Structure of Physalis Movirus: Implications for the Viral Assembly
pubmed doi rcsb
total genus 14
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qjzA00
1Z7S2 2WZR1 5CFCA 1RUH2 1HRV1 1F2NA 1CD3G 5CFDC 1RUJ1 1WCDJ 2HWB1 3ZFGC 4GMP3 1PIV3 4Q4W2 5ACA2 4IV1A 3ZFFB 1RUE1 5DDJ1 4GB31 1QJU3 2PLV3 1K5MC 5BNOB 1RUI1 3NAPB 1AL23 1QJX2 4IV3A 1C8M1 5JZGC 1ND2A 1PO22 3VDDC 3M8LA 1POV1 1AYM3 1NA1C 1VBA1 1NY71 4RR3C 1RUC2 4LLFA 3ZFEA 5C9AB 1R082 1PVC2 1EAH3 1VBD3 2R043 1FOD2 3VBHC 1DDLA 2R073 4FTBA 2WFF3 1VBC3 4IV3B 3ZFGB 1BBT1 5ABJC 3VBOC 5C4WC 1B35C 1GFF2 3CJIB 1R093 4CEWB 1VRH1 3FBMA 2WS91 3J8F1 4CDWC 4Q4Y3 4Q4V2 1ZBE1 1OHFA 1HXS3 1ZBA2 1RUG2 4N53A 4EJRA 3VBRA 5FOJB 4CDQC 4QPGC 5A32A 1AR91 2RS13 4CDXA 4N43A 3ZXAC 1ND3C 1NCQB 1VBE2 1RUH3 3TN91 2RS31 4Q4X3 5ACA3 3VBSA 4Q4W3 2XBO2 2ZTNA 1AR61 4RS5C 1NOVA 1FPN1 1BEV2 2IZWA 4N53B 2HWD3 3VBRB 2HWC1 1HX6A 5ABJB 1QJX3 2X5IA 4Z92B 1RHI2 2RR12 1AYN1 2RM22 4RHV2 2HWE2 1PIV1 4WM7B 5A32B 4YVSA 1PGW2 1IHMA 1PO23 4N43B 1QJU1 2PLV1 1RUD2 4FTEA 5AC91 1RUC3 1MEC2 1QJY2 1RUF3 4JGYA 1ASJ2 3ZFFC 1RVF2 1HRI1 1R083 4AEDB 1COV1 5BNOC 2RS51 1ND3B 1AYM1 2HWF1 5L7OA 1AL0G 1FOD3 2X5IB 3VBFA 1PO12 4QPIA 1R1A2 2MEV2 5A33A 3S6PA 5K0UA 2BFUL 2DF7A 2R041 5C8CA 1VBC1 3JD71 4JGYB 1TME3 4IV1C 3JBG1 4Q4V3 5C9AC 5D8AB 5GKAC 1ZBA3 4JGZB 2WZR2 2Y26A 1HRV2 3HAGA 4IV3C 4RFT0 1M06G 1V9U1 4Q4Y1 1RUJ2 4QPIB 2HWB2 3CJIC 5A33B 4GB32 4CEWC 1VBE3 5K0UB 4RQPB 1NG0A 1RUI2 4PDWA 2R061 2FZ2A 3ZFEC 1H8TA 2BUKA 1C8M2 1X33A 3LOBA 1BEV3 1OOPB 1BMV1 1RMU1 4WM8A 4CEYA 2XPJA 5CFCB 1AR73 2RR13 4Q4X1 4RHV3 2HWE3 1VBA2 1NY72 4Q4W1 2BPA2 1QQP3 1NCQC 1FMD3 5BNPA 4IV1B 1EV12 1RUD3 1X36A 2HWD1 1MEC3 2GSYA 4PDWB 5CFDA 1RVF3 2RMU2 1W39A 1VBB3 2VQ0A 1MQTA 4N53C 1ND2B 1BBT2 3VBRC 4WM8B 4CEYB 1K5MA 1VRH2 2WS92 4WM7C 1D4M3 3J8F2 1RUF1 1PO13 1R1A3 2MEV3 1AR83 4N43C 1POV0 5JZGA 1R081 3ZFEB 3VDDA 1NA1A 4RR3A 1AR92 4AEDC 3DPRA 1TMF1 1Z7S3 1MQTB 4NWWA 2X5IC 1NCRA 1HRV3 3TN92 2RS32 3VBUA 1RUJ3 1TME1 1AR62 1FPN2 3VBOA 1RUI3 2ZZQA 2HWC2 4JGYC 1AYN2 5D8AC 4GMP1 1C8M3 5FMOL 4CDXB 4JGZC 1F8VA 4YVWA 2WWSA 2PLV2 1NCRB 5AC92 1PGL1 1AL21 1VBA3 4QPIC 5BNNA 3VBUB 4FSJA 3IDEA 1VB4A 3VBSB 1HRI2 1EV13 5K0UC 1COV2 4RQPC 1PVC3 2RS52 1AR71 1AYM2 2HWF2 2RMU3 1OOPC 1QQP1 1FMD1 1PGW1 4YVSB 1BBT3 5CFCC 4GH4A 4BCUA 4GMP0 1RB8G 5LK7B 4YVWB 1VRH3 1EAH1 1VBD1 2WS93 2R071 2WFF1 3JD72 1VBB1 3JBG2 1RUG3 1R091 4PDWC 1D4M1 5L7OB 1AR93 1V9U2 3VBFB 3ZFFA 1AR81 1ND2C 1HXS1 4WM8C 1RUE2 4CEYC 4FTSA 5DDJ2 4GH4B 5BNOA 3NAPA 3TN93 2BFUS 2RS33 2R062 4CDUA 2XBO3 2RS11 1AR63 5C8CB 1FPN3 1Z7S1 1BMV2 1RMU2 1RUH1 1CJDA 2HWC3 1RHI3 4Q4X2 1AYN3 1VAKA 2RM23 5ACA1 1MQTC 5C9AA 1E57A 1AUYA 2HWD2 5AC93 1QJX1 1VB2A 1QJY3 1ASJ3 1OPOA 4CDUB 2BBVA 3ZFGA 1HRI3 2TBVA 1H8TB 1PO21 3CJIA 1COV3 4Y4YA 4CEWA 2RS53 2HWF3 1RUC1 1RUF2 4CDXC 3DPRC 1EV11 1ZBE2 5BNPB 1A6CA 1PVC1 1NCRC 2WLPA 5J98B 2GH8A 3VBUC 1FOD1 4SBVA 3VBSC 2RMU1 3JD73 3JBG3 1HQNA 5CFDB 1NCQA 1TMF2 2WZR3 1K5MB 1V9U3 3VBHA 4Q4V1 1TME2 2HWB3 4YVSC 3JB8A 1RUE3 1RUG1 1ZBA1 1QJZA 5DDJ3 5JZGB 4GB33 4YVWC 5ABJA 5C4WA 1B35A 3VDDB 4Y5Z0 5J96B 5BNNC 4WM7A 2R063 4CDWA 1NA1B 4RR3B 1PIV2 3DPRB 1RMU3 1VBE1 1SMVA 1QJU2 5L7OC 1POV3 3VBFC 1PGL2 1AL22 2XBO1 4CDQA 4QPGA 3VBHB 4AEDA 1BEV1 4GH4C 1ND3A 4NWVA 3VBOB 5C4WB 1B35B 1AR72 1RHI1 2RR11 2RM21 4RHV1 5C8CC 2HWE1 4CDWB 4RS5A 1QQP2 1FMD2 5FMOS 2QQPA 1RUD1 1EAH2 2R042 1MEC1 1QJY1 1VBD2 2ZAHA 1ASJ1 3J8F3 2R072 1RVF1 2WFF2 5D8AA 5BNNB 1VBC2 4CDQB 4QPGB 1VBB2 1ZBE3 4JGZA 3NAPC 1R092 3JB4C 1D4M2 1PO11 4CDUC 1R1A1 1H8TC 2MEV1 4Q4Y2 1AR82 1C8NA 4RS5B 1TMF3 1HXS2 4RQPA 2FZ1A 2RS12 1OOPA 5BNPC
chains in the Genus database with same CATH superfamily
4XF4A 1Z7S2 1NXMA 2WZR1 5CFCA 4IEYA 3O0XA 4EN9B 1RUH2 2ZKLA 1Y9QA 3B00A 5FXZA 4Q1RA 3AYDA 4PT6A 3N7KA 3ZR5A 1XOYA 4BMEA 1RUJ1 2FDJA 1QH6A 1WCDJ 2HWB1 2YC2A 3LEIA 4GKXA 3ENRA 4IETA 4IV1A 4CU9A 1GANA 4FPHA 4U36A 2HEVF 2VCAA 3ECQA 1KDKA 3RYRA 4JAAA 1ULPA 4DS0A 2HBTA 4CCEA 5FO9B 2A73B 4HKWA 1QJX2 1GP4A 3OUJA 3M3IA 4XPVA 2EIEA 2ILMA 4IV3A 4RFRB 4ZXEA 3SHRA 4FT8A 3ZSEA 3P1IA 1JOBA 2FCTA 1FXZA 2BGPA 4M4PA 5JZGC 3RZHA 4FPGA 5KC5A 4XVHA 3VDDC 1ZRDA 5DZFA 1D0HA 5L19A 3A22A 3IM0A 4A45A 4C0HA 4CU7A 2BNMA 4MGTA 1UIJA 4MVTA 4RR3C 3DCQA 1ZRIA 2D6NA 2GP5A 3W58A 3ROUA 5J36A 2WZPP 5IVFA 1W9TA 2W94A 2VCCA 2W47A 3ZFEA 2Y6HA 1A8MA 3NSTA 3FX3A 4JQTA 4JQRA 1LHVA 1H6YA 1GQHA 1FV3A 3IB3A 1GNZA 3AYEA 1FOD2 2NM1A 2WSUA 1HW5A 1Z0HA 5E16A 5F5AA 4HBNA 1VBC3 5A80A 2Q8CA 3UJOA 4Y4RA 4YRDA 4CCMA 4MGIE 3ZFGB 4K1YA 5ABJC 3VBOC 3AFGA 1H9WA 3FHQA 3SMHA 3CJIB 1Y9GA 2DFBA 1YHFA 4LHLA 3K3NA 2RE9A 4M0NA 3FLPA 5F39A 1KJLA 4Y33A 1N1TA 1ZZBA 3ZDVA 2P6CA 4GJZA 5FP8A 2WNVA 1SLAA 1LOAA 1OA2A 1GP5A 2CGNA 2ZACA 4IE7A 5IAXA 3ETQA 4ASLA 4Y24A 1KXGA 3LSDA 1F4HA 1JI6A 3LGRA 4IERA 4LOSA 3VBRA 5FOJB 2ZEXA 1F15A 4XF3A 4XJAA 5M0TA 1AF9A 1KS5A 2VMHA 3C7FA 3IDAA 4IEQA 3BVCA 4CDXA 2RS13 3E5XA 4AHZA 1NLRA 1J83A 4GD4A 2RV9A 2QE3A 5A3WA 4D6QA 2V72A 3ZDSA 4O9GA 5DAVA 1VBE2 5F37A 4YW4A 1LCLA 2A3WA 4KNCA 5IUQA 2CYFA 2OW4A 2DCZA 1W8HA 4AVVA 3SLIA 5JSPA 2CGOA 5K8SA 1AR61 3NKTA 1UPSA 2C6SA 2P17A 2VW2A 3FHAA 1O6UA 4D7TA 3GF6A 1QOTA 1F5JA 3SQOA 1UMHA 3ILNA 4MHUA 1OFSA 3HN1A 2HWD3 4WVMB 2HWC1 1HX6A 5C3QA 3LSEA 3OEAA 1FV2A 3WG4A 4Z92B 5I0TA 3IIIA 1AYN1 2J1SA 2VPVA 3PVBB 4RHV2 2QQOA 3TAYA 1S0JA 2MHFA 2JE7A 5F3GA 2NMNA 2WNOA 2HYKA 3AB0A 4IUGA 1PGW2 4QX8A 1I9RA 3MZHA 4ZHNA 1RUD2 4FOVA 3OTFA 3D3AA 3NV1A 2YHJA 5EXOA 4GWNA 1RUC3 5AFEA 1RUF3 1XE0A 2CWMA 2DTWA 1UPIA 5IK8A 4Y5TA 1R083 5DG1A 2LTNA 3UT0A 2MPFA 2YFZA 4OHYA 3LFMA 4EN8B 1AL0G 3GGLA 1DZTA 3DYOA 5C7GA 4Y20A 4Q0VA 3WG3A 1YXWA 1BK0A 5FPZA 1WLWA 2ZGPA 5A33A 3T08A 4CCJA 3J7NA 4P14A 4AFCA 3S5QA 1UN1A 2BFUL 2GZWA 2R7EB 3KT1A 4JTNA 3O0WA 5FUIA 2E63A 3NMBA 2EICA 3WP4A 2YBSA 4JGYB 1TME3 3JBG1 5F3EA 4D0QA 1JZ6A 4XCAA 4CVUA 2O8OA 2I07B 2R30A 5GKAC 5IAVA 3WQBA 3HN3A 1UZZA 4FFFA 1ZZ6A 2NQYA 5FYYA 3DF0A 4IEZA 1LOEA 5H9RA 4LBNA 3KHCA 4NUBA 1RJ8A 5G04L 4BK5A 1OD3A 1UYPA 4Q4Y1 3CKHA 3OGSA 4QHZA 4QPIB 3ZN6B 4UF0A 1HJFA 5JXJA 1UYYA 2P3KA 5KXDA 4GB32 3VKOA 1UAIA 2QKDA 1W8TA 4HANA 2PHWA 4QPYA 2WKKA 4CEWC 3RYKA 1XYNA 1QHDA 3ZPOA 4DUXA 2R061 1J3RA 2XJVA 1N3PA 1T6BX 1UO9A 3T0AA 2WYFA 2VQUA 5C3SA 1JZ8A 3WDTA 1C8M2 2JG8B 1E5IA 3ZYBA 1PM4A 4CEYA 5JR2A 5CFCB 2VZ1A 1LKNA 3H1WA 1AR73 1W3VA 4XABA 3R4UA 4EN6B 3ZXEA 4XJ9A 1VBA2 3SEEA 2BPA2 5FY8A 1NCQC 2WT0A 4IV1B 3UYJA 4HVRA 2VOXA 3H42B 2RHPA 3POBA 4XILA 1MEC3 4RL7A 2HYXA 2FQPA 4CUCA 4N53C 3SC7X 3RI8A 1QIQA 2VW0A 1BBT2 1SBDA 5FZ0A 1ST8A 2E7QA 3O7OA 4BXFA 1M4WA 1BVP1 1O3TA 1G9FA 1D4M3 1PO13 5A6YA 5FZ6A 3TNQA 2C24A 3PIJA 1FNZA 5DZEA 2CDOA 1JYWA 4BQ4A 1AR83 4N43C 2ZA9A 2BTVC 1POV0 5CAZA 5F2SA 1D2QA 3USUB 3ZFEB 5FY9A 1W8FA 3PUIA 3IIAA 1JU3A 4E4DX 5LCWL 2ADEA 3AYAA 5FP4A 4XUTA 1KRIA 4R9AA 1DZRA 3GCXA 2Z5WA 3KHBA 2E9QA 3BIWE 2GMPA 4DEQA 4KGQA 4RA0A 2Y8KA 1N1VA 3RMXA 1Q3EA 1CONA 2DCJA 4LXLA 2VH9A 4QKBA 4Y1VA 3WHUA 5BPXA 5L73A 4M3CF 4AL9A 1MZFA 3HEIA 1HRV3 1N3OA 4LPLA 2ZGNA 3TN92 2W52A 3TEWA 1W9WA 4SLIA 1XU2A 1AJKA 2EVXA 2OUHA 3BODA 3GCWA 2CU5A 3K3OA 3AYCA 1H1IA 4DO0A 2GNTA 4QQ2A 4LBQD 2WNVB 4XIOA 4PIYA 1UOBA 1AX0A 2VM9A 2VUJA 2YXSA 5A3LA 4CUGA 3D6EA 5FK7A 4ARXA 1CIWA 4GULA 4FAGA 2AREA 4Q8KA 4LEJA 1RITA 5SV8A 4W8JA 4AHXA 4A7YA 1QF3A 2J1AA 5D8AC 5FZBA 1CX4A 4QX5A 4Y1ZA 4CDXB 1LRHA 4JGZC 4MO3M 3T4HB 1OLQA 1F8VA 4C91A 4MXVA 5JMCA 4QGMA 4ZY9A 4QX0A 1J3PA 1GOFA 2VNOA 1H1MA 3ZMOA 2X29A 5EJZB 1GU3A 1GWKA 2WFPA 4IGOA 4YYOA 4FSJA 3IDEA 1DQ0A 3SKJE 1NE4A 2CSGA 3KV6A 1HRI2 4XACA 1EV13 5FZEA 3KSCA 4RQPC 4F8AA 1NZCA 5A7PA 5F1RA 3B9IA 4FPCA 4IEUA 5FY4A 2GC1A 3ZKUA 2QUOA 4BOWA 5JSRA 2R1DA 4B1LA 1FMD1 1PGW1 5FP9A 3M3QA 2DU0A 2PTMA 3C3VA 3LDRA 2OKXA 4AHWA 4N9IA 4BCUA 1RB8G 5LK7B 4LQRA 3THTA 1UIKA 2XUEA 2WS93 3CBNA 5FZGA 3VD3A 3MIDA 2B45X 1PVXA 2PELA 1VBB1 4LHSA 4Z1VA 3WHTA 2ZPXA 4MXWB 4XJUA 1RUG3 1V0AA 4L92A 3KT4A 3AKRA 4DZGA 3LDKA 2FCUA 1PZ7A 2H6BA 4PDWC 3CU7A 4I0WB 3V56A 1JZ5A 2ZEYA 4FPJA 1YFXA 1ZA4A 5IFTA 1AR93 3LA2A 4Y20B 3NJZA 1ND2C 3KV5A 4LA3A 1W9YA 4CZSA 4WM8C 1JW6A 3CF6E 1IS5A 2ZCWA 3F95A 1S55A 3NAPA 4AI8A 2N7GA 5FFOC 1QDOA 4Z82A 2BFUS 5LB6A 3ES1A 2LM3A 4GXLA 4ZKTB 4CDUA 3BTZA 2RS11 3BB6A 1OLRA 3B93A 1MACA 4KBBA 1KFUL 1BMV2 3WUCA 2Q1ZB 4DUWA 1YIFA 4K9SA 1VAKA 3BPZA 4A3ZA 2HBUA 1JU4A 3VDBA 3NJYA 2QQLA 4NRQA 1ODMA 2UY8A 3RRDA 4UF0B 3TNPB 5LBEA 4A3XA 1XJAA 3ACHA 1HB4A 3P6BA 3BU0A 2CGPA 4KU7A 1J3QA 1E57A 4OQ9A 1SLLA 2J1UA 5CADA 2IXIA 5CG8A 2OQ6A 4XZPA 1VAVA 1XNBA 1O91A 2EA7A 2XB6C 2A75A 4LO4B 4YGDA 2OZJA 1ASJ3 4K8FA 1KQRA 1OPOA 2F4PA 3FL7A 2O1QA 3NL1A 2Q8EA 1DLLA 3KVBA 1COV3 3UKTA 2BW8A 2RS53 2BNOA 3IT8A 5AFBA 2HWF3 4Q5OA 1IPKA 4HZFA 1CAVA 1SBEA 1YNAA 1DYOA 3NQHA 4LMFA 1RUC1 4A2UA 4QPWA 5FLJA 2NN8A 1LULA 1HV1A 2XWJB 4NIHA 1UY0A 4OMCA 4XHBA 1NT0A 3LIHA 2RDQA 1Q5OA 3LQCA 3NV2A 1NCRC 1YC61 4FOYA 1EUUA 4P9GA 5IVBA 1XNDA 2E7AA 3ZYGA 3JD73 3A23A 3ZO0B 1HN1A 3KB5A 4LE4A 5DUWA 3D0SA 2P3JA 2E32A 4ZZ8A 3ST7A 1JUHA 1GYKA 4MGQA 2WZR3 1W8NA 2J1TA 1WCQA 1R64A 4FI9A 4XJ8A 2NMOA 4Q2FA 4YZ4A 1NE6A 3SH5A 2VZPA 4OLLA 1ENRA 4FFIA 4XUOA 1H2MA 3KWVA 5A1FA 1V9U3 1K42A 1AX1A 3HVDA 2HWB3 2Z2SB 4K40A 4R9BA 3AL6A 4UI9L 5CB7A 4NIDA 3AKTA 3POGA 1B35A 4GQ7A 2BQPA 2OX0A 4JCKA 4KWLA 4Q0SA 5J96B 5LEJA 4WM7A 4AEJA 2BWCA 4XMIA 2WL1A 4AXOA 4ZS2A 4U2AA 4XTMA 4UFHA 5T5OA 2XLGA 2B39A 1QJU2 5JLVA 2V4VA 1BK1A 3VBFC 1PGL2 3MDPA 1AL22 2BU9A 4PLNA 1NQDA 2XBO1 4E8CA 1ULOA 2NYYA 4BIOA 5FDBA 1DG6A 3J7HA 5FUNA 4AEDA 5A1AA 1ULGA 2VXRA 4TYSA 4XJWA 4GH4C 1T6GC 2QNKA 3I2OA 1SG3A 4UWDA 3PVOA 3ZLIA 4DOUA 1QMJA 4UOJA 2VTFA 1RHI1 3O1VA 3SISA 3ZSKA 4UXAA 5C8CC 3ACFA 1YJKA 4CDWB 4QU1A 3I2DA 3LPFA 2FDKA 2Q1MA 2VZUA 1GZ9A 1N1YA 4YGEA 3OPTA 5IFPA 2IXJA 3FWEA 5CKNA 3OPWA 3VL8A 3QACA 2R042 1MEC1 1QJY1 3UETA 1BXHA 1QOOA 3VB9A 4BQXA 2R072 3K48A 2WFF2 4D3WA 5F32A 1PM7A 1Y4WA 2YBKA 5T52A 3HQUA 1OKQA 3MPBA 4ZU5A 4BLJA 1KS4A 1OA3A 4ZZ5A 3EMRA 3LZZA 2ARCA 1SLTA 3BTXA 1ENQA 3E5UA 1R092 5F5QA 3JB4C 1NZIA 4ZONA 1B09A 4HVOA 1W2TA 1PO11 1PX3A 5A7SA 4GA9A 5A1LA 1F35A 1HIXA 1C1LA 1H8TC 1T2XA 4EN0A 3GM8A 1ZRFA 4RS5B 1QU0A 4TZDA 1LR5A 3IAQA 1HXS2 1PMJX 1W3XA 4NHLA 4XUPA 2E33A 3PVEA 4P02B 3ZYPA 3A7QA 4MOAA 4L0PA 3EYPA 4XC9A 3USSA 1IOAA 3ATGA 4ATFA 4WZCA 1LENA 1SDWA 2XVKA 2BYVE 5KBFA 1SPPA 4NOTA 2D43A 1ZZ8A 4CCCA 1HRV1 2JDHA 1U5YA 2PXJA 3NNGA 1YCIA 1F2NA 1CD3G 1KFXL 3AMHA 3ZFGC 5ACA2 5FZDA 4Q4W2 4AVSA 3C7GA 1REEA 5BNQA 3GHNA 1K12A 2B9UA 1K5MC 1S0CA 4COYA 4CU8A 3J4UH 1MZEA 3BGAA 3NAPB 1QXRA 3GNEA 5C5UA 1X8MA 3HJRA 3OUHA 1SLBA 4XIKA 1OH3A 4N9HA 4ZS3A 5A7NA 1RXGA 3THDA 4YG6A 2JX9A 1IQAA 1LODA 1W6QB 1PO22 4TLGA 1PK6B 3ZN5A 5GZGA 3I97A 1Q8SA 2VNVA 4NMIA 4PQQA 4ES9A 3IPVA 4XF9A 3AJZA 2W3JA 5LBFA 1NY71 1RIRA 4IDZA 4H55A 5FZMA 3DXUA 4EWAA 1W9SA 3MW2A 2B46X 4NVPA 2PQQA 5A3NA 1X7NA 2QVSB 3OD0A 3R4DB 4HT1T 5FYHA 5B4XA 5BYNA 4JV4A 4AFDA 1QDCA 3VZNA 1W8UA 1UKGA 2J22A 2P2KA 1PVC2 3AK0A 4AI2A 3RZJA 2FDIA 2ZJCA 5C6CA 1EAH3 2AZ5A 2XOMA 5FJKA 3VZJA 3KQRA 4AQ6A 3VBHC 2XVGA 4FTBA 1QXJA 3N9MA 4ASMB 2G4IA 3PTYA 1CAUA 2K2SA 4S2GA 4AF9A 1A78A 1Y9MA 1ODNA 2WJSA 3I3QA 4J1XA 3K46A 4W6WA 5A7WA 5C4WC 1XYOA 1ZA7A 3IBMA 3TB0A 2FCVA 5I93A 5JAXA 2WS91 3VHOA 4NRMA 4IGPA 5DAQA 4Q4Y3 2CY6A 3N9LA 4KWKA 2D7FA 5EYXA 1GZTA 2D6LX 4B3NA 2HJIA 5IVEA 2JG9B 2F6BA 2E51A 3ITQA 3TEXA 1ZBA2 2JDKA 1YQ2A 2G1MA 4LBOA 1OURA 4PLOA 4WVMA 2QQVA 2E53A 3K75B 2PA7A 4UFLA 4CDQC 4QPGC 3MPPG 2BBAA 1AR91 2D97A 4FPYA 2XWBB 2C26A 1ZX5A 4GWIA 5FQ0A 1JYXA 4Z2WA 4I3GA 4QQPA 1RUH3 3VD9A 5F6KA 1MPXA 4ASKA 5FY5A 3WF0A 4IXLA 3VBSA 4YM1A 2ZTNA 2VXJA 5EP9A 3N3HA 1XBFA 1BEV2 3FHIB 1LHWA 2IZWA 2YMZA 3ZYJB 5B2GB 4LBKA 3TRSB 4COUA 4J1WA 1CPMA 1QJX3 4UT5A 1A8DA 1IQDC 2RM22 3LA3A 3BIEA 4WM7B 2ZHKA 4E2GA 3TYJA 1WMEA 2QQKA 4CCKA 4QKNA 2VMEA 1IHMA 2EIDA 1QJU1 2PLV1 1H2NA 3ZIWA 1AXZA 4YSFA 4JRAA 4M3CA 4LORA 1UYZA 4FTEA 1OT5A 4KG8A 5JXGA 2ARXA 4JGYA 2V09A 3ZFFC 4ZU7A 2IXCA 2XL7A 4QKDA 1BLZA 2J1VA 3KZ4C 3QCWA 1COV1 4PCRA 4QXBA 4W65A 4AEDB 5BNOC 3AC0A 1X8EA 2RS51 1AYM1 1OKOA 2HWF1 4JHZA 5L7OA 3WW2A 2FMYA 1FOD3 4I01A 2WQ4A 2UYAA 2X5IB 2XL9A 2JDZA 1W2OA 2DVDA 4Q29A 4QPIA 4YZ3A 5KXBA 4MV2A 1R1A2 2V5DA 2MEV2 2UURA 1KITA 4H3WA 3THCA 3U78A 4BH9A 5J3UA 3GJBA 1WWYA 2A6WA 3ILFA 3I2JA 3MLJA 3AVRA 3U4SA 2R041 2GDFA 3WQ7A 2OPWA 3FLTA 3P3PA 3PMSA 2Q5TA 3JD71 5CYYA 4KMQA 4IV1C 5JMOA 1H1AA 5C9AC 2NP0A 2V5YA 2QFEA 4XW3A 3CLPA 4LK6A 3VLBB 3VD5A 2C5DA 1S1AA 4IL7A 3DUIA 4FPFA 4OI1A 2WZEA 3RI9A 2Y26A 3H1YA 2IXLA 2Y6FA 3H7YA 2DVBA 2Q0AA 1XPWA 2EALA 3U11A 2VVFA 3HAGA 4IV3C 2W08A 4RFT0 4OHXA 4YWAA 1V9U1 3LE0A 1M06G 3OPZA 2E7TA 1AX2A 1VP6A 2A6ZA 5EZWA 2QZ3A 2BP6A 1VBE3 2EAKA 4LK7A 5I8YA 5K0UB 2CV6A 4MADA 4BQ2A 4HVQA 5FV3A 1QGLA 4FVVA 1RUI2 4F7ZA 2XJPA 2AC1A 2VTXJ 3ZSJA 4NRPA 4BQ5A 4K1ZA 1DGRA 3ZFEC 1FATA 5DQ0A 1CWPA 2VO5A 3BUCA 3TEYA 1W8ZA 1SPPB 5A3OA 4PJYA 4O9EA 4QXKA 3SCGA 3RJRA 5DUUA 4A6OA 1NAEA 4Q4X1 3QLQA 1MS8A 4RHV3 3POFA 3KM5A 3ZMNA 3GYDA 3N9QA 3QH7A 4Q4W1 5KC6A 1PMHX 2IXHA 3W20A 1FYUA 4B4QA 4N8MA 3AP4A 3PJQA 3LF7A 1FMD3 3OG2A 1ULDA 3USUA 3WG2A 5BNPA 2ZOEB 4A7KA 4YZ1A 3W5MA 1RUD3 1V6NA 1YFYA 2W91A 2Y34A 2VY0A 4META 4KBZA 3DECA 1UU4A 2CHHA 3PJYA 5FZFA 3H8XA 4AI1A 5LWBA 1GP6A 2RMU2 5FMDA 1W39A 5FBZA 1CZVA 1VBB3 2VQ0A 3ACIA 3VBRC 1LOBA 1OXCA 4Q26A 2VMCA 1VRH2 5G05L 3IPVB 3S7EA 2UWAA 3J8F2 2EXIA 2LROA 5IWFA 5KWRA 5HCFA 4ES8A 1N47A 5H9QA 2GC0A 2LUWA 3MBWA 5EWSA 3I2KA 3RWNA 5JZGA 1V6LA 3ABZA 3ZM8A 2ZX0A 3VDDA 4MGYE 4XXAA 3U14A 1UY3A 4B4RA 1I6XA 3VKLA 4B8EA 4XQWA 2ZGOA 3B3QE 4QMAA 4RR3A 5DZGA 1DFQA 3DPRA 3FN9A 3V0AA 5FAXA 3LEGA 4UYBA 3ZOIA 4LKFA 1CAUB 1MQTB 1EP0A 5A7WB 5JI7A 4NWWA 2WO3A 2V4AA 2A1XA 4A7ZA 3KV4A 2FBEA 3ZR6A 2GNBA 3T2OA 1CPNA 2RS32 4LR4A 5J48A 5JI9A 5FP7A 4B1MA 1FPN2 4IE0A 3HNYM 3FMGA 5F9TA 1EUTA 3P5BA 4EWDA 3VBOA 1OQDA 2RDSA 2A6VA 3TOJA 3MHZA 1UMZA 3MF6A 4MH0E 5HCAA 1DDLA 2WNEA 3LD8A 4IEPA 4F3JA 1W6NA 4Z8BA 2CDPA 2VC9A 1DYPA 3N4MA 1C8M3 5FMOL 1HKDA 1OLME 3B69A 5FPAA 2OS2A 4R9DA 4IQPA 5FQ0B 2JWPA 2R1BA 4NR1A 5AC92 3KMHA 3NWKA 1UX7A 1VBA3 1VLNA 3VBUB 4O65A 4UFKA 1NYWA 1OUXA 2UY9A 4LKEA 1XC6A 4PHZA 1VB4A 4MXWA 3VBSB 5JDBA 1JOJA 5TSWA 5FYMA 3B94A 4CUAA 4F83A 2WA3A 3N7JA 3A0KA 4L2NA 4XCBA 1AZDA 2D3PA 2ZGMA 1O7FA 2UU8A 1OOPC 1QQP1 4COZA 2EF6A 5DN2A 3EBRA 1BBT3 4V2WA 5LASA 3DKQA 4Y22B 4YVWB 3AZYA 1EAH1 1UY1A 1OSGA 4K20A 1A3KA 1BJQA 4JDOA 4M3CB 1CGPA 1LGCA 2ZABA 4C1XA 5HBAA 5JOWA 2CTVA 2OIIA 3DGTA 3CHXA 2VZSA 1US3A 1ENSA 3N35A 3VZOA 3G6JB 3FZ3A 1RYYA 4W6YA 2OZ6A 2WBKA 4QX1A 2Z79A 1QWRA 1O5UA 2VZTA 2Y64A 5L7OB 3T30A 4DXSA 4AFAA 3MUY1 5T50A 2JB8A 2K9ZA 1RUE2 3GZTB 4KG0A 3AZWA 3NJVA 4TLFA 4KI5M 2ZKNA 2JENA 5FIXA 4CEYC 2Y6LA 5IK5A 3LPGA 3W5NA 1ZM1A 3TN93 3S5AA 2P3YA 4DNYA 1LHOA 1AJOA 3MIGA 4COVA 5A6ZA 3F2ZA 2XBO3 3FFQA 3HNMA 3I49A 1Z7S1 2WNUA 2X8KA 3BALA 2B7YA 1S4CA 5E8AA 2L9LA 1RMU2 1RUH1 3RNSA 3FJSA 1RHI3 2LW8A 1U12A 4HL0A 2ZMNA 3WLUA 1W6PB 4OZOA 4IESA 2ZGRA 4IE5A 2ARAA 2ZHLA 1GSLA 5DAWA 5GJ6A 3P3NA 1H9PA 1O8PA 2SBAA 3RDIA 1AUYA 1RJ7A 2HWD2 5FR3A 1QJX1 2WN3A 2ZGQA 4AOCA 3E5QA 4CRQA 3H50A 1QJY3 4H2AA 3H8UA 5DG2A 2Y6GA 1HRI3 2TBVA 1I3HA 1SFNA 4GJYA 4HXCA 3HQRA 1ZVFA 2F4LA 4Y4YA 4CP2A 2VZOA 3PTRB 4IEWA 4CEWA 4QXHA 3PNAA 2EXJA 4AFBA 2XVLA 2IXKA 4JHTA 1GQPA 2QDNA 4YM0A 1RUF2 5F6LB 3GZUC 3JU9A 4AGGA 5EJ1B 3RG0A 3O1OA 4LLOA 1HV0A 2XHKA 1XNAA 1ZBE2 2JKXA 2P34A 5BNPB 1WW5A 3KGLA 1C5HA 4Y26A 2WLPA 1YO8A 3MIHA 5J98B 3CO2A 1FOD1 4SBVA 3W21A 2RMU1 1GOHA 4LO7A 3DKWA 2OT7A 1W2AX 1NCQA 2ZGTA 4XDOA 4UW6A 4A6SA 4BQ1A 1TMF2 3CMGA 1IG3A 3C8XA 2VOKA 4OVEA 1O5LA 5T5LA 3T2TA 5CISA 1QJFA 1UU5A 4URTA 5F2WA 4AK3A 4AI3A 2GAUA 2W5FA 5A7QA 1SFYA 4XFGA 4CTEA 1TME2 3WDXA 4YVSC 4QXCA 4C90A 3VD4A 1Q8VA 5JZGB 3O14A 1HJGA 1QOSA 4O7XA 1G7YA 4I0AA 5AVPA 5I0UA 1IS4A 3VDDB 3ORJA 4Y5Z0 5JCTA 3VUOA 2FDHA 1QH7A 4CDWA 4QX7A 2FMDA 4X8NA 3H9AA 4RR3B 1UD1A 1PIV2 3GHMA 4P00B 3DPRB 3V0AB 1VALA 3HT1A 3SKVA 3W59A 1VBE1 4QM9A 1H0BA 1H2KA 4ARYA 1DP0A 1VJ2A 4YW3A 5HXMA 5KXEA 4LUKA 5FCCA 1LHNA 5KHIA 4P9YA 3VZLA 3WOGA 1AHSA 1ND3A 3MFCA 3OBAA 1GOGA 2UYBA 4Q0UA 1OF3A 3VBOB 5DMYA 2CNAA 1AR72 2HKXA 4K3UA 4HN1A 4RHV1 4BPZA 5JXHA 3IZOA 1JODA 2WT1A 2ZMLA 4RS5A 1W6NB 5FMOS 2QQPA 3D5OA 4CSWA 1H4HA 2YU1A 5JXIA 2C9AA 3ZN4A 1RUD1 5BY5A 3HMYA 2JKBA 5JVVA 4BIFA 2W2IA 3RWKX 4I2OA 1VBD2 1RTVA 3WW3A 4FQZA 5HPOA 2YC4A 5D8AA 5L9RA 5JOYA 4HFSA 1UY2A 4JGZA 5KXCA 1K45A 3C7EA 1P8JA 2AEZA 2TEPA 3NAPC 1JZ3A 1MS3A 1W0NA 4Q0QA 5FMCA 4UAPA 1GZCA 4CXWA 4JKKA 3UV9A 1D4M2 1WLDA 4YW6A 1DCSA 4CDUC 1JTZX 1WCUA 3V64A 1YI9A 1YQCA 2WWUA 4N7UA 2Q8OA 5A3MA 1AR82 4HKOA 3K51A 5C71A 2W68A 1VMJA 3LWCA 4AEMA 1WA4A 5FZLA 3ZYFA 2NLRA 2PYTA 4R8HA 4RYDA 2P37A 5ISLA 4RQPA 4N7IA 3OB8A 4CXYA 3RZLA 1CJPA 3KS7A 1LOGA 2AYHA 5T54A 5C3PA 2QBXA 3B7MA 1W6QA 5C70A 1JBCA 4EZ4A 1PK6A 4LKDA 1FT9A 2J1RA 4QDSA 1HN0A 1TQ5A 4KU8A 1OA4A 3KCCA 4G3YC 1G8WA 1O4TA 5CFDC 2X10A 1ULEA 4GMP3 3B01A 3AP9A 2DUOA 4P9WA 1V6IA 1RUE1 4EROA 2A3YA 4XJZA 4GB31 5J09A 4ISQA 2EAAA 4UW3A 3N9PA 2RJKA 1NX9A 1QJU3 2PLV3 4KL1A 4BWOA 3KGZA 3HQXA 4X6QB 4YGCA 3WSOA 2FD8A 3POJA 1YQ5A 1AL23 1FNYA 2GMEA 2IVJA 2JXAA 2D5HA 4NHKA 1GWLA 1PZ8A 5FY0A 1C8M1 3ZSMA 3UJQA 2D6OX 1ND2A 2ZEZA 5FO8B 3UNPA 3JZVA 1WKYA 2WNUB 2E31A 4CYDA 3MV01 5FPBA 1R1ZA 2F17A 3M8LA 1GQGA 5LATA 1POV1 1AYM3 1FX5A 3I2GA 1AXYA 1NA1C 4BHPA 2ET7A 1VBA1 1C4RA 1RC6A 3Q8BA 5FZ4A 4GIQA 1J59A 1L3JA 1LGNA 2JG9A 3L2HA 4D6RA 2GMMA 2ZBJA 3HBKA 5T55A 4OHVA 1WCSA 3RS6A 2XJUA 4HONA 2W87A 1ZZCA 2R043 3AKPA 3HT2A 5LBBA 1WUVA 2PAMA 2W92A 2R073 5GLTA 2WFF3 1KGYA 2IFRA 3LA7A 4JDNA 3WDWA 4E4ZA 3V0BA 2RDRA 4AI9A 2VAUA 3DYPA 1GBGA 5IVVA 3VZKA 1BBT1 4LBQA 5L36A 1UOGA 1B35C 1S0FA 1GFF2 2PHLA 2VQTA 2QQWA 4NO4A 4XHXA 1R093 4V2VA 3LB9A 4CEWB 3FBMA 2VBBA 3WZ1A 2Y6JA 1DBNA 2JB4A 1DYKA 3RZKA 5LA1A 4UBGA 4Q4V2 2AGSA 4XTPA 4YW7A 3IAPA 1W6OB 1ZBE1 1BHGA 1MS1A 1OHFA 3WDVA 1HXS3 1RUG2 2PN5A 4X6RB 4EJRA 2YY1A 2PHUA 3AL5A 4YW5A 2ES3A 2IC1A 2OPKA 3AX4A 4QWNA 3T1MA 1CVNA 4C0BA 3AMPA 4XUNA 1WLCA 1W90A 2VZRA 4XXPA 3OBTA 4BK4A 1LNSA 3E6BA 3HR9A 1J58A 1DGWX 2G9FA 3J7MA 4NJ4A 4RGGA 4D6SA 2A6XA 4W6XA 5FZ3A 1NCQB 5FPXA 3OY8B 4INDA 3HD8B 5CIRA 1F5FA 1E5HA 3FFZA 3N9NA 3TN91 4BXSV 4M00A 1WMDA 2WWJA 4Q4X3 4GAZA 5LA2A 3DV8A 2JDPA 5FREA 1IPSA 4Q4W3 4BZ4A 5ACA3 1NOVA 2YG0A 3LEKA 4P9XA 4COWA 1PHMA 1CR7A 2VUDA 4N53B 2VOTA 5JOZA 2X5IA 1WGPA 1GV9A 4A44A 1XSQA 2RR12 4Q1PA 3CNAA 5A7OA 4XETA 1NLSA 3GDBA 4PF1A 2HWE2 4S2DA 1PIV1 2ZGKA 1REFA 1EYBA 3B9CA 1LECA 3OD4A 5FLHA 5A32B 4HK9A 5FYZA 1PO23 3TWIA 4N43B 2RJLA 3ZVXA 1LU1A 3GBWA 3J26N 4ZXKA 2Q1FA 4FPEA 2WQ8A 4XBQA 5FXVA 2WA4A 3EJKA 3M3CA 4JTOA 2VBDA 5FPVA 3WDYA 2BEOA 2YDEA 5LA0A 4LNVA 4MSVA 4HSLA 1DQ5A 1ASJ2 2GALA 3WF2A 4LBLA 5CVRA 2XKOA 1H4GA 1RVF2 2QQJA 2C9KA 1HRI1 1CX1A 5B4NA 5LA9A 3M3OA 2YZ4A 1ND3B 1US2A 1KDMA 4E8DA 2EXHA 4X8PA 3E97A 5JPMB 3VBFA 2C4XA 4QQHA 4LA2A 4LBMA 2Q30A 4JKMA 1UKRA 5D1IA 3Q9OA 5JUVA 1U0AA 1XE8A 1XU1A 5T3NA 1NQJA 3LDBA 5K0UA 1PZ9A 3ZXLA 3KCXA 3U75A 5FZKA 4P9JA 3WG1A 2LS6A 5FXXA 4P9LA 5C8CA 2JIJA 3I8TA 5BUVA 2OVUA 2Z42A 5FZ7A 5D8AB 4AE2A 1ZBA3 1ZRRA 1VAMA 4JGZB 2WZR2 3G7DA 1O3QA 4EN7B 3RSJA 1POQA 4N90A 4OMDA 3KD4A 5L9BA 5GZCA 1W03A 3ZX7A 1L7RA 4BE3A 3KCYA 1RUJ2 2HWB2 1V00A 5F7UA 3Q8CA 3VDCA 1MS9A 2JDAA 3CJIC 5C5TA 3H3UA 3MIBA 1C3HA 4OUMA 3WF4A 4BM8A 2XUMA 3NNJA 3WCSA 2MNGA 1ULFA 4RQPB 1NG0A 2R49A 2JJ6A 3TBDA 4MG2A 2YROA 3AKSA 4NIAA 4CPBD 2QQNA 3N7MA 1CAWB 1H8TA 2BUKA 2DUPA 2EXKA 2B42B 3LOBA 4TXWA 5FTTC 1BEV3 4QM8A 5JPNB 1BMV1 2W39A 4QHBA 2E26A 4DPNA 2XPJA 2PHDA 3NW4A 4CP1A 1TE1B 5F5CA 4NE9A 4YZ5A 2WC2A 2BV4A 3MO4A 4XQDA 5DAXA 3C7OA 3PL0A 1QQP3 2XH6A 3ALQA 2GN3A 3AP7A 2VMFA 5IYYA 1GR3A 2ZX1A 4E4SA 3W9AA 2DBNA 1W28A 1OVPA 2VBPA 4PDWB 5J7MA 4MGZE 3IN9A 1SCSA 4YLZA 2QQUA 2G9ZA 3MI8A 3HBZA 1WBLA 4KGGA 5AVAA 4HSJA 4DUVA 2VCBA 5HI0A 2D93A 1MQTA 3ZSLA 4XDPA 5JOXA 2A5ZA 3AKQA 1ND2B 1UZ0A 4WM8B 3SXWA 2BZDA 2ZHMA 1K5MA 1DU3D 5CEHA 1MS0A 2XHNA 2HH9A 1OF4A 4I0BA 4QGLA 3NV4A 1Y3TA 1R1A3 2MEV3 2W1QA 4MGKE 3VHRA 2OA2A 1CN1A 1V6MA 3X29B 4MHRA 2P6HA 4QDQA 3AZVA 1OH4A 3PUQA 3VDAA 4QQLA 3MF9A 2PHFA 1W0OA 1H8VA 3CZUA 1LESA 3VHPA 1JZ4A 3VKNA 3AP5A 2ZS6B 1UCXA 4D69A 3A4UA 2A70A 3V0BB 1J84A 1Z7S3 2WAAA 4OYUA 2YGMA 4YM3A 3PURA 4LBQB 4DEVA 1VMHA 2DDUA 3AMNA 4C1WA 2XJTA 4QU2A 2TNFA 3BOPA 5EQUA 3VBUA 1LB2A 3POSA 2ET1A 2CL2A 4EQVA 1UL9A 1S0IA 3BU7A 4R52A 1AR62 1YRZA 4PLMA 2C1FA 2BJSA 3MUZ1 4BQYA 4TTGA 5LK5A 2VNRA 3FUQA 2B9VA 4OI2A 3UL2A 2G9GA 1RUI3 2HWC2 4JGYC 3OGGA 1DF0A 1AYN2 2VECA 5LBCA 3SEPA 4GMP1 1QNWA 2ZX4A 2R0HA 4H7LA 3ACLA 3WV6A 3PUSA 2YUEA 5EIYB 2YBPA 3A21A 3Q8AA 4XFCA 1DGWA 3M3EA 5FO7B 1JZ2A 1ONAA 3LKJA 4Y22A 4YVWA 4J25A 3OYWB 4A42A 1VPHA 4DB5A 2PHRA 1XB9A 2ARBA 1NCRB 3WXPA 1PGL1 1AL21 2W1WA 4H7MA 4QPIC 3K77A 5BNNA 1YEWA 3LAGA 4CU6A 1CZSA 3DEMA 2QCSB 2DCTA 3HNBM 3S0MA 2D3RA 3PVNA 2IUWA 1UNBA 4YPJA 3WNLA 5KR7A 1CAXB 2RG4A 4XFBA 4O61A 1VE0A 3ZIXA 4LTAA 2Y60A 3VN4A 1PNFA 4LUMA 1VIWB 2RMU3 3N9OA 2JG8C 2ATFA 2XJRA 2JDUA 5KHGA 4FFHA 5CFCC 3OJBA 2YPJA 2J42A 1HB3A 5GM0A 1G86A 3RJ2X 2OYZA 3D8CA 1VRH3 2Y38A 5IVYA 3CZJA 3B5LB 3VL9A 1W9FA 1XXNA 2R071 4EYUA 2WFF1 2VCMA 1H2LA 5JWPA 1XSRA 4I09A 3O1MA 4P08A 3GBGA 3JBG2 5A3PA 1ZRCA 1OD5A 3GJAA 3WW1A 3I3MA 1JYTA 4XFHA 3ZXGA 2IWGB 3T09A 1R091 3O5SA 4XBLA 3OOXA 3IMNA 4QX3A 4KWUA 1W6PA 2DVFA 1QKQA 3DYMA 2BVBA 3VBFB 3ZFFA 3WF1A 4UFJA 5A3TA 3UGGA 2VG9A 3DXTA 2V73A 1HXS1 3UGHA 3VHNA 4FOWA 3ASIA 4GH4B 4XE9A 5DDJ2 3U07A 5BNOA 3U4XA 3ETPA 4YFZA 3SCFA 1LOFA 2RS33 2Y0IA 1G9AA 4XYXA 2YB7A 4BJ0A 2R062 3RVHA 4TSVA 3LOIA 5GZFA 5FZAA 5C8CB 1FPN3 1W8WA 1ENXA 1YUDA 2ZHNA 2JDYA 2B4KA 4QD2A 5T5JA 1JZ7A 4PBOA 3H3LA 5I8TA 1CJDA 1UY4A 1OQ1A 3D82A 4HETA 2P5BA 4BLIA 1KJRA 1S2BA 2D6PA 1WD4A 2PHXA 5HXVA 5ACA1 1MS4A 1UZYA 2PQSA 4DY3A 2CAVA 5C9AA 4ZPIA 4Y5SA 3O1PA 3APBA 1STMA 3NKGA 5C33A 3RZMA 1JN2P 4NAMA 2XONA 2WINB 2WQZC 2DCYA 5AC93 2R0FA 5IVCA 1V6JA 1S0GA 3WF3A 1VB2A 3PU8A 1GKBA 3EQEA 2WNVC 3I59B 3FBYA 2BBVA 1E5SA 5A6XA 3TEZA 2O14A 4IGQA 1EPWA 3H0OA 1H8TB 3QH6A 1LGBA 1PO21 4RGAA 2A71A 5GLVA 1SBFA 4QB1A 1HB2A 1G9CA 2WABA 3U0ZA 4GKYA 3T2PA 1W06A 2NZ9A 1XQNA 5L9VA 4E2SA 3RZGA 3OGJA 3R6SA 2VMDA 4AW7A 4CDXC 3DPRC 1H30A 2RDNA 4JDMA 5A6QA 3WNPA 4Y1XA 3IDCB 1IGOA 3O1SA 3I7DA 1AVBA 1A6CA 3OGVA 4XQ4A 1PVC1 1RUOA 4QB2A 1LEMA 1TZOA 5IW0A 1WD3A 1JS9A 2W0XA 5GZEA 3IDBB 2JECA 4BYYA 1IKPA 1HQNA 2D5FA 4PBPA 4CP0A 2ZGSA 3ZXJA 3HIFA 3MIEA 3T2QA 3CQOA 4Y3OA 3I4IA 5LZ6A 1WLTA 3RFRA 1K5MB 4HMZA 5K4LA 1L7QA 2BVVA 5H9PA 3EHKA 3MYXA 4LO6B 1RUE3 1ZBA1 2VVDA 4TWTA 2FDGA 1QJZA 4AVAA 4GB33 4CXXA 5ABJA 2PHTA 4LE3A 1KEXA 2Y0OA 4OHWA 4QGNA 1Q8OA 4MZUA 4RGKA 1X9TA 3GXUA 4YFWA 4WZFA 2XQXA 3RMYA 1DQ4A 2JEMA 2WAOA 4PQ9A 4FAHA 4NIGA 3CL1A 3KLSA 4B7EA 3I2FA 2VJXA 2ZXQA 2AEYA 5FK8A 1ZREA 1RMU3 1MVQA 1SMVA 3FE5A 1VMFA 2KM2A 3WR0A 1POV3 2WO2A 3Q8FA 4UW4A 2X05A 3VBHB 2JDNA 2R16A 3OBZA 3SNMA 4S2FA 1BEV1 3ELNA 5KHHA 5HV0A 5F8PA 1CESA 5FYCA 5C4WB 1VR3A 2GN7A 3CEWA 1UW8A 2RM21 2CAUA 3O1RA 1OMIA 2GH2A 3JQXA 4AEKA 1EY2A 1FMD2 4LKSA 1OFNA 3K2OA 4FPOB 3FLRA 5H9SA 4MLOA 1KD7A 2D44A 2ENRA 4QDRA 5CKQA 3BKZA 1BYHA 1PNGA 5ANQA 3WP6A 1MS5A 2D40A 1HLCA 3IMMA 2ZAHA 1W04A 1F4AA 1O4ZA 2OQ7A 5DUVA 5BNNB 3MLLA 1VBC2 4CDQB 4QPGB 1VBB2 1J1LA 1ZBE3 2I74A 1DQ2A 4P5HA 3WT3A 3EXUA 4XOGA 3QOPA 1C1FA 4DXRA 1UOJA 3BPSA 4GALA 2PFWA 2ZMKA 4ONUA 2D98A 3JUUA 1R1A1 4HLTA 2MEV1 1JYCA 5FYSA 2VU9A 2WNUC 3BCWA 1RXFA 4CE8A 2DTYA 1TMF3 3EO6A 4LBJA 3M4FA 4QQOA 4XUQA 1Y7BA 4ITCA 5CZKA 4BMBA 1PGSA 3OGRA 1LU2A 4DFSA 3BI3A 1V70A 4NAOA 1RL3A 3KVAA 1IG0A 1OUSA 5FYIA 2IFWA 2FZ1A 1XYPA 2QQIA 3NNFA 3VGIA 4ET7A 3KF3A 5FOBB 5I0SA 2RS12 4IEVA 1OOPA 3ACGA 5FZIA 5FPUA 4BISA 4DRVA 2VULA 3NV3A 1LAJA 2WR9A 3VD7A 1UYXA 2LALA 1NXD1 1ZYBA 4LO5B 1PIV3 1YFUA 3PMEA 3M2MA 1HQLA 4LITA 3ZFFB 4BQWA 2R6QA 5DDJ1 4PI0A 3PUAA 4A4AA 4YZ2A 3NVCA 1UF2C 2VE1A 1IKQA 5BNOB 1RUI1 2QZ2A 1LJ7A 4B29A 1URXA 3ME2A 3ZKYA 1W2NA 4LOTA 1CZTA 4CCNA 1OVSA 1W6MA 4MUVA 5HCBA 4AG4A 1SLCA 2ZX3A 1WBFA 5FBJA 3U1XA 2DWRA 4BA6A 2WZ8A 2H0BA 4KWJA 3HOBA 1AXKA 2LRPA 1LEDA 3WUDA 3RGBA 4CP9A 1FI2A 1SDDB 4JKLA 3UK9A 3CDZB 3H7JA 1RUC2 5BV6A 3I2IA 3PDQA 3ZXKA 1W6OA 4LLFA 5EHDA 4B7KA 3UKVA 2Q8DA 5C9AB 1R082 1W8OA 4QT6A 3MICA 2H0VA 3ZYIB 4AFMA 3SH4A 1VBD3 4AQSA 1Q56A 4CCOA 4MYEA 4IV3B 2DYCA 1MVEA 3KQ4B 4AGRA 2DCKA 2BERA 1SACA 3OY8A 5IVJA 4HOOA 4AYUA 5E6HA 3T3YA 3R05A 4W4ZA 3H3ZA 1SZBA 3IKWA 4UFIA 2YV8A 5FYBA 1VRH1 3SH3A 3J8F1 1CIYA 5GLWA 1QEXA 1PMIA 4GWMA 1DGRN 4CDWC 2Z4FA 3K4ZA 4DRRA 2X09A 2ZX2A 4R4ZA 4OUSA 1DHKB 3U10A 1JH5A 4N53A 4WVWA 4LJHA 1PX4A 2VUAA 3L9JT 4JVAA 1NLQA 4JRLA 4XMAA 5A32A 3ES4A 5JR7B 4N43A 3ZXAC 1ND3C 4LIVA 2ORZA 2VZVA 1GZWA 4L99A 2UWCA 2ZGLA 1JHJA 3J9SA 2BOIA 4FBFA 2RS31 5LRSA 4YW1A 1GNHA 2OXBA 1I5PA 1H6XA 1BQPA 4I30A 1WMFA 2XBO2 4RS5C 4YW2A 1FPN1 2BOJA 4OFGA 5CNAA 3WVJA 3FUOA 1GICA 5DAPA 3VBRB 5ABJB 4K6BA 1XE7A 4NPMA 5GALA 1RHI2 2W1SA 2X53S 1DLCA 3WDUA 3OUIA 3DL3A 4HPKA 4AAPA 1G9DA 4YVSA 3O1UA 5K9YA 3AZXA 2WLQA 2DURA 3OF1A 4ZU4A 5FJHA 5FRAA 5FYUA 3S7IA 4AQ2A 5LY1A 1GMMA 3RYPA 4YM2A 5I8SA 2D6MA 5AC91 2ZGUA 4R4XA 3WQ1A 4BQ3A 2WUHA 5DUXA 1MEC2 1QJY2 1DQ6A 2D6KA 3AVSA 5LY2A 2DUQA 1GUIA 2AENA 4NIIA 3WQ0A 3NNMA 1S2EA 4NN0A 3E1F1 5F5IA 2JIGA 5ERLA 3R4SA 5DPNA 4OI0A 4D7SA 4UBHA 1PO12 1J1TA 3OCPA 4XEZA 3BYWA 3VKMA 1YQ6A 3WW4A 1PK6C 2ZAAA 3S6PA 4PIZA 4P5YA 4L8QA 3I54A 5IJRA 4FXGB 3UGFA 2DF7A 4H14A 1WW6A 2YGLA 3WINE 2D3SA 5EYYA 1VBC1 1CAWA 4Q4V3 4D8MA 3N36A 4NHXA 1DZQA 5IK7A 1VRBA 3R0RA 4XAEA 2VOVA 1ZZ9A 3JQWA 1MZ5A 2ERFA 2RJ2A 2WT2A 3N7LA 1W2UA 4NPRA 1HRV2 1IS3A 5GZDA 4ORFA 4L9BA 1LHUA 2KR2A 4DIQA 1UZWA 5FZOA 3WCRA 1K5JA 1S0BA 4OUEA 4QX2A 5A33B 1C5IA 5EJ3A 5HV4A 5E1RA 4NPLA 3FC0A 5FZ1A 4LT5A 5I0DA 3OSDA 4S2HA 4PDWA 5C8WA 2FZ2A 4M01A 3BTYA 2JG9C 2VTXA 4E2QA 1F31A 3WP5A 1X33A 3AJYA 1OOPB 2RVAA 3K4AA 3NRUA 5IK4A 4QHOA 3PUHA 1RMU1 3KV9A 4WM8A 2VMGA 3T0BA 4K21A 3S57A 1UXXX 5LRRA 1XNKA 3PLQA 2RR13 1Q43A 3THPA 2PAKA 4CUBA 1UQXA 2HWE3 4M3CE 1NY72 1OLMA 3JXSA 1QNYA 4AZZA 5KHJA 2JICA 4QB6A 2CWSA 1EV12 2YYOA 2B5HA 3KF5A 1X36A 4Y1YA 2BNNA 2HWD1 1F9KA 1GNYA 3M1HA 2K0GA 4YGBA 4V1PA 3OBRA 4UFMA 1BZWA 1S0DA 1RINA 2GSYA 2O0OA 2JE8A 4LO8A 4Z07A 5CFDA 4DXZA 1RVF3 1E5RA 2HEWF 1YQ8A 5FKCA 5JSOA 3I3BA 2W1UA 1W6MB 1SFPA 2XGXA 3J7LA 1CQ9A 1SLIA 3WD5A 4CA9A 4YNIA 1N3QA 3RZZA 2J7MA 4CEYB 1BKZA 4HN0A 4XFIA 1QY4A 2WS92 4WM7C 1RUF1 1O59A 4CP9B 2XJQA 4NHMA 3KT7A 5FZHA 5EFUA 1O8SA 2XXZA 3C7HA 2BGOA 1R081 5FZ8A 1HQWA 4XDQA 1IPJA 4EE2A 1JHNA 1C57A 2AACA 1OC1A 5D21A 1XNCA 3CIHA 1NA1A 3VKFC 3ZYRA 2JDMA 4FPLA 4IE6A 1AR92 4AEDC 4E9KA 2ADDA 2E6VA 1NKGA 1TMF1 2YPDA 4RD7A 4RN5A 4D7YA 5CA6A 2XKPA 3I3DA 3QBQA 3OYWA 4MGSA 1U5ZA 2X5IC 1NCRA 2G19A 1U5IA 2XR4A 3LCPA 4NHYA 5E88A 5E89A 3UESA 4ATEA 1RUJ3 1TME1 1C28A 1SQ4A 5J37A 2KA3A 1W05A 5CKMA 2A6YA 1CAXA 2DVGA 1G6NA 3LEMA 2ORXA 3WNXA 2P3IA 2ZZQA 2ZEWA 1YLLA 4FP3A 4FPKA 3HWJA 1K3IA 2KXLA 2PAEA 2XG3A 3BN6A 1SCRA 2YU2A 1DGLA 4D94A 1OBNA 4HK8A 3ZXDA 2VOWA 3B02A 1JXNA 2WWSA 2PLV2 1GZWB 4AHYA 2OUJA 1SEFA 3E6DA 3NO8A 5JIAA 4GZ9A 4EZHA 2AR6A 5I91A 1Q8PA 5KHKA 3POYA 3WNNA 3AZZA 5K0UC 3LFIA 3A0NA 3O0VA 1COV2 2WIIB 1PVC3 2BGCA 2RS52 1AR71 4TN7A 5D2AA 1I1EA 1AYM2 2HWF2 4XFAA 1D2SA 4DINB 2R32A 2Y6KA 4IE4A 5FZ9A 4AGVA 5CG9A 3SCHA 2K46A 4Q0PA 3Q8EA 3GZAA 1WCKA 4HPKB 3E6CC 3BTAA 4YVSB 1TNFA 4FQ4A 4GH4A 4GMP0 3T4VA 3AXEA 2H6CA 4L97A 3URFA 4OHZA 1VBD1 2XJSA 1WW7A 4PI2A 4DQAA 5LW9A 1TEIA 1D4VB 2UWBA 3HPNA 3JCIA 3JD72 4LULA 4XFFA 1V6OA 4XF0A 4AVTA 2WN2A 4WVVA 1RGSA 3ON7A 3D0JA 1D0GA 2P1BA 1Q8QA 1LOCA 2EIBA 3PIGA 3S30A 2WYSA 3WEZA 4W50A 4ISRA 1D4M1 4BDVB 5FXWA 3BOWA 4DXTA 1ZZ7A 1V9U2 5FWJA 4AI0A 1AR81 4IW3A 4YG0A 5ANNA 5BXXA 5F3IA 5FYVA 3UKNA 3H8OA 5APAA 5FUPA 1IZ3A 4FTSA 3RPQA 5T5PA 4B4PA 1FAYA 1YIPA 5A70A 5IT6A 1L7LA 1NUKA 2KD7A 2QJVA 4URAA 1DQ1A 3I59A 4DY5A 4PF5A 1AR63 4XBNA 3ZXFA 4A41A 1WW4A 4YARA 2HEYF 2VZQA 4Y1UA 1OQEA 2ETEA 2Q4SA 1S0EA 2BDRA 1Y43B 3GZEA 4QAWA 4BU2A 4I02A 4I3PA 2HWC3 4FOQA 2VUCA 3VV1A 5DXDA 4GWJA 4Q4X2 1AYN3 2RM23 3I3EA 3SITA 5C3RA 1XRUA 4EV0A 2J1EA 4LHNA 1TNRA 2VGDA 1MQTC 3AXDA 4OQ8A 5FYTA 5FZOB 2ID4A 3MV11 1QXPA 4E27A 3INAA 1JYIA 2QDRA 1SHWB 1BCXA 3PHMA 5SV5A 2XLAA 4UW5A 4XF1A 5EV7A 3AFKA 3I2HA 3ZPYA 1O4YA 2JE9A 4CDUB 3ZFGA 1DIWA 1YI7A 4YG3A 4WVZA 5K7PA 3D4KA 1I5ZA 3CJIA 1O3SA 1JOPA 1LTEA 1W99A 4AVBA 1S2KA 4KH9A 2Z69A 3MFAA 4G4FA 2WO1A 1EPZA 2XLFA 1OPMA 2IVIB 3M70A 3PU3A 3NJXA 3MGUA 2QQMA 1N1SA 1V6KA 1UX6A 4G9SB 2WSVA 5FP3A 4WBBA 3POEA 2HLEA 2WO7A 3T1LA 4WV8A 3EB7A 4Q27A 5CBLA 2PMWB 1EV11 4XURA 4AR2A 2VL4A 4LHKA 4PIXA 5FWEA 1G9BA 2Y33A 2FDFA 5DABA 1UZVA 4MX3A 3LIGA 2QTWB 3OEBA 3WNKA 2GH8A 3VBUC 1UOFA 1QJEA 3VBSC 4C8DA 1WZXA 4XZUG 4AWDA 3U37A 3GALA 3JBG3 4RSUA 3O12A 5CFDB 5J1XA 4CCLA 1X82A 3WY6A 5A3UA 3WNMA 1D7PM 4BB3A 3POIA 4R9CA 4JX0A 4M0HA 1RUNA 4KQ7A 4J6GA 1UU6A 1CAVB 2GC3A 1X9PA 3VBHA 1WMXA 4Q4V1 4Q8LA 3JB8A 1UXZA 1RUG1 5FY7A 2DFCA 5C3OA 3H8RA 5DDJ3 4XAAA 4YVWC 1O3RA 2VZ3A 3CJXA 1MZ6A 3DN7A 5C4WA 1MR5A 5FKBA 4AAXA 4JZRA 4IEOA 3QD6A 1ULCA 5I0RA 5BNNC 3MW3A 2R063 2NPIA 1NA1B 2FHRA 1GLHA 2AUYA 2W95A 2GNMA 5JIUA 2B8MA 3O1TA 1ZNPA 4CCDA 2A7AA 3WP3A 5F3CA 2YFUA 2WDBA 1YFWA 4FFGA 4NROA 4OZXA 2I45A 5L7OC 3WNOA 1A34A 5LEKA 1REDA 2VMIA 1WA6X 1JMUB 2GP3A 3IWZA 4QPGA 4CDQA 2O8QA 2VNGA 5HCHA 5GLZA 5IATA 4HKLA 2SLIA 1OI6A 2EIGA 3POWA 4NWVA 3ILRA 4IEXA 4E4HA 1B35B 5GLUA 2RR11 4FP2A 3WX5A 2A3XA 2GU9A 2HWE1 2JD9A 5CU1A 2DVAA 4K7JA 4OCTA 5FY1A 2BRTA 1QQP2 2GNDA 2GC2A 1U5XA 5FLIA 4LIUA 5EPAA 3RQ0A 1TG7A 1YWKA 2YC0A 3GBFA 4P9IA 3VZMA 4QKFA 2TUNA 4FXKB 2DV9A 3ZYHA 1X50A 1UMIA 3V65A 2ZZJA 1EAH2 1Z78A 1HB1A 3J8F3 3M7AA 4HG6B 1ASJ1 3MEPA 4JC1A 1JUIA 1UWWA 2VR4A 1RVF1 2XMLA 3AM2A 2WRAA 4OI4A 3K4DA 2XDVA 4M4RA 5FZCA 3AMQA 2VW1A 1TVGA 2VVEA 4K8RB 4AVCA 1XNTA 4Z2AA 1JYNA 2AH2A 1LOFC 4FCAA 4EWEA 2W46A 2P4EA 3ZN6A 4OULA 2BWAA 3L2YA 3MLKA 2DBIA 1APNA 4Q4Y2 4CPBA 1HDKA 1ALYA 1IS6A 1C8NA 2C0ZA 2JD4A 2W9XA 3MW4A 3AP6A 3MIFA 1ACCA 2XQRA 1GWMA 2DU1A 4DMIA 1JYVA 1YJLA 2VD7A 3NNLA 3H1MA 5FMBA 4AQTA 3C2UA 4FO9A 3AMMA 1BVVA 1YYNA 2VQAA 4L11A 5FPLA 5IHRA 2I2SA 2JG8A 3T0DA 1W0PA 5BNPC
chains in the Genus database with same CATH topology
4XF4A 1Z7S2 1NXMA 2WZR1 5CFCA 4IEYA 3O0XA 4EN9B 1RUH2 2ZKLA 1Y9QA 3B00A 4Q1RA 3AYDA 3N7KA 4BMEA 1RUJ1 4GKXA 1QH6A 1WCDJ 2HWB1 3VKNA 3ENRA 4IETA 4IV1A 1GANA 4FPHA 4U36A 2HEVF 3ECQA 1KDKA 3RYRA 4JAAA 4DS0A 5FO9B 2A73B 4HKWA 1QJX2 3M3IA 4XPVA 2ILMA 4IV3A 3SHRA 4FT8A 3ZSEA 1FXZA 5JZGC 4FPGA 5KC5A 3VDDC 1ZRDA 5DZFA 1D0HA 5L19A 3IM0A 4C0HA 2BNMA 1UIJA 4MVTA 4RR3C 2D6NA 3W58A 5J36A 3ROUA 2WZPP 3ZFEA 1A8MA 3NSTA 3FX3A 4JQRA 1LHVA 1GQHA 1FV3A 1GNZA 3AYEA 1FOD2 2NM1A 2WSUA 1HW5A 1Z0HA 5E16A 1DDLA 4HBNA 1VBC3 3UJOA 4YRDA 4MGIE 3ZFGB 4K1YA 5ABJC 3VBOC 3AFGA 1H9WA 3SMHA 3CJIB 2DFBA 1YHFA 4LHLA 4M0NA 2RE9A 3FLPA 1KJLA 1N1TA 1ZZBA 2WNVA 1SLAA 1LOAA 1OA2A 2CGNA 2ZACA 3ETQA 4ASLA 4Y24A 1KXGA 3LSDA 3VBRA 3LGRA 4IERA 5FOJB 4XF3A 4XJAA 1AF9A 1KS5A 2VMHA 4IEQA 4CDXA 2RS13 3E5XA 4AHZA 1NLRA 2QE3A 3ZDSA 4O9GA 1VBE2 4YW4A 1LCLA 2A3WA 4KNCA 5IUQA 2CYFA 2OW4A 2DCZA 4AVVA 5JSPA 3SLIA 2CGOA 5K8SA 1AR61 3NKTA 1UPSA 2P17A 2VW2A 4D7TA 3GF6A 1QOTA 1F5JA 3ILNA 1OFSA 3HN1A 2HWD3 4WVMB 2HWC1 1HX6A 3LSEA 1FV2A 3WG4A 4Z92B 5I0TA 1AYN1 2VPVA 3PVBB 4RHV2 3TAYA 1S0JA 2MHFA 2JE7A 2NMNA 3AB0A 2HYKA 1PGW2 1I9RA 3MZHA 1RUD2 4FOVA 3OTFA 3NV1A 2YHJA 5EXOA 4GWNA 1RUC3 5AFEA 1RUF3 2CWMA 2DTWA 1UPIA 5IK8A 1R083 5DG1A 2LTNA 2MPFA 4OHYA 4EN8B 1AL0G 1DZTA 4Y20A 4Q0VA 3WG3A 1YXWA 5FPZA 1WLWA 2ZGPA 5A33A 4P14A 4AFCA 1UN1A 2BFUL 2GZWA 3KT1A 4JTNA 3O0WA 2E63A 3WP4A 4JGYB 1TME3 3JBG1 2O8OA 2I07B 2R30A 5GKAC 1UZZA 1ZZ6A 2NQYA 3DF0A 4IEZA 1LOEA 5H9RA 4LBNA 1RJ8A 4Q4Y1 4QPIB 3ZN6B 2P3KA 5KXDA 4GB32 3VKOA 1UAIA 2QKDA 4HANA 4CEWC 2PHWA 4QPYA 2WKKA 3RYKA 1XYNA 1QHDA 2R061 1J3RA 2XJVA 1N3PA 3WDTA 1C8M2 2JG8B 4CEYA 5CFCB 1LKNA 3H1WA 1AR73 3R4UA 4EN6B 3ZXEA 4XJ9A 1VBA2 2BPA2 1NCQC 2WT0A 4IV1B 4HVRA 2VOXA 2RHPA 4XILA 1MEC3 4RL7A 2FQPA 4N53C 3RI8A 2VW0A 1BBT2 1SBDA 2E7QA 3O7OA 1M4WA 1BVP1 1O3TA 1G9FA 1D4M3 1PO13 3TNQA 1FNZA 5DZEA 1AR83 4N43C 2ZA9A 2BTVC 1POV0 5CAZA 1D2QA 3USUB 3ZFEB 4E4DX 3IIAA 3AYAA 1KRIA 4R9AA 1DZRA 2Z5WA 2E9QA 3BIWE 2GMPA 4KGQA 4RA0A 1N1VA 3RMXA 1Q3EA 1CONA 2DCJA 2VH9A 4Y1VA 3WHUA 5BPXA 5L73A 4M3CF 1MZFA 1HRV3 1N3OA 2ZGNA 3TN92 2W52A 4SLIA 1XU2A 2OUHA 1AJKA 2EVXA 3BODA 3AYCA 1H1IA 2GNTA 4QQ2A 4LBQD 2WNVB 4XIOA 4PIYA 1AX0A 2VUJA 2YXSA 5A3LA 3D6EA 1CIWA 4GULA 4FAGA 2AREA 4Q8KA 4LEJA 1RITA 5SV8A 4AHXA 4A7YA 1QF3A 5D8AC 1CX4A 4QX5A 4Y1ZA 4CDXB 1LRHA 4JGZC 1OLQA 1F8VA 4C91A 4MXVA 5JMCA 4QGMA 1J3PA 2VNOA 1H1MA 3ZMOA 2X29A 2WFPA 4FSJA 4YYOA 3IDEA 1DQ0A 1NE4A 1HRI2 1EV13 3KSCA 4RQPC 4F8AA 1NZCA 5F1RA 3B9IA 4FPCA 4IEUA 2GC1A 4BOWA 2QUOA 2R1DA 1FMD1 1PGW1 3M3QA 2DU0A 2PTMA 3C3VA 4AHWA 4BCUA 4N9IA 1RB8G 5LK7B 3THTA 1UIKA 2WS93 3MIDA 2B45X 1PVXA 2PELA 1VBB1 4Z1VA 3WHTA 2ZPXA 4MXWB 4XJUA 1RUG3 4L92A 3KT4A 3AKRA 4DZGA 1PZ7A 2H6BA 4PDWC 3CU7A 4I0WB 3V56A 4FPJA 1YFXA 1ZA4A 1AR93 3LA2A 4Y20B 3NJZA 1ND2C 4LA3A 4CZSA 4WM8C 1JW6A 3CF6E 1IS5A 2ZCWA 4AI8A 1S55A 3NAPA 2N7GA 5FFOC 1QDOA 4Z82A 2BFUS 3ES1A 2LM3A 4GXLA 4ZKTB 4CDUA 2RS11 3BB6A 1OLRA 3B93A 1MACA 4KBBA 1KFUL 1BMV2 3WUCA 2Q1ZB 1YIFA 4K9SA 1VAKA 3BPZA 2UY8A 3RRDA 3TNPB 4A3XA 2CGPA 4KU7A 1J3QA 1E57A 1SLLA 5CADA 2IXIA 5CG8A 4XZPA 1VAVA 1XNBA 1O91A 2EA7A 2XB6C 2A75A 4LO4B 4YGDA 2OZJA 1ASJ3 4K8FA 1KQRA 1OPOA 2F4PA 3NL1A 2O1QA 1DLLA 1COV3 3UKTA 2BW8A 2RS53 2BNOA 3IT8A 5AFBA 2HWF3 1IPKA 4HZFA 1CAVA 1SBEA 1YNAA 4A2UA 1RUC1 5FLJA 2NN8A 1LULA 1HV1A 2XWJB 4XHBA 1Q5OA 3NV2A 1NCRC 4FOYA 4P9GA 1XNDA 2E7AA 3ZYGA 3JD73 3ZO0B 3KB5A 4LE4A 5DUWA 3D0SA 2P3JA 3ST7A 1JUHA 1GYKA 2WZR3 4XJ8A 3SH5A 4YZ4A 2NMOA 4Q2FA 1NE6A 4OLLA 1ENRA 1H2MA 1V9U3 1AX1A 2HWB3 2Z2SB 4K40A 4R9BA 5CB7A 3AKTA 1B35A 4GQ7A 2BQPA 4JCKA 4KWLA 4Q0SA 5J96B 5LEJA 4WM7A 4AEJA 2BWCA 4XMIA 2WL1A 4AXOA 4U2AA 4XTMA 5T5OA 2XLGA 2B39A 1QJU2 5JLVA 1BK1A 3VBFC 1PGL2 3MDPA 1AL22 4PLNA 1NQDA 2XBO1 5FDBA 2NYYA 4BIOA 1DG6A 4AEDA 1ULGA 2VXRA 4TYSA 4XJWA 4GH4C 1T6GC 2QNKA 3PVOA 4DOUA 1QMJA 1RHI1 3SISA 3ZSKA 4UXAA 5C8CC 1YJKA 4CDWB 3I2DA 2Q1MA 1GZ9A 1N1YA 4YGEA 2IXJA 3FWEA 3VL8A 3QACA 2R042 1MEC1 1QJY1 1BXHA 1QOOA 2R072 3K48A 2WFF2 4D3WA 1PM7A 5T52A 1OKQA 3MPBA 4ZU5A 4BLJA 1KS4A 1OA3A 3LZZA 1SLTA 1ENQA 3E5UA 1R092 5F5QA 3JB4C 1B09A 4HVOA 1PO11 4GA9A 1HIXA 1C1LA 1H8TC 4EN0A 1ZRFA 4RS5B 1QU0A 4TZDA 1LR5A 1HXS2 4NHLA 3PVEA 3ZYPA 3USSA 1IOAA 3ATGA 4ATFA 4WZCA 1LENA 1SDWA 2XVKA 2BYVE 5KBFA 4NOTA 2D43A 1ZZ8A 1HRV1 1U5YA 1YCIA 1F2NA 1CD3G 1KFXL 3AMHA 3ZFGC 5ACA2 4AVSA 4Q4W2 1REEA 5BNQA 3GHNA 2B9UA 1K5MC 1S0CA 4COYA 3J4UH 1MZEA 3NAPB 1QXRA 3GNEA 1X8MA 4XIKA 1SLBA 4N9HA 4YG6A 2JX9A 1IQAA 1LODA 1W6QB 1PO22 1PK6B 3ZN5A 5GZGA 1Q8SA 4ES9A 3IPVA 4XF9A 3AJZA 1NY71 1RIRA 4H55A 4EWAA 3MW2A 2B46X 4NVPA 2PQQA 1X7NA 2QVSB 3OD0A 3R4DB 4HT1T 5BYNA 4JV4A 4AFDA 1QDCA 3VZNA 3AK0A 1UKGA 2P2KA 1PVC2 4AI2A 2ZJCA 5C6CA 1EAH3 2AZ5A 3VZJA 3KQRA 4AQ6A 3VBHC 2XVGA 4FTBA 1QXJA 4ASMB 2G4IA 3PTYA 1CAUA 2K2SA 4S2GA 4AF9A 1A78A 5L36A 2WJSA 4J1XA 5C4WC 4W6WA 1XYOA 3IBMA 3TB0A 5I93A 5JAXA 2WS91 3VHOA 4Q4Y3 2CY6A 4KWKA 5EYXA 2D7FA 2D6LX 4B3NA 2HJIA 2JG9B 2F6BA 2E51A 1ZBA2 4LBOA 4PLOA 4WVMA 2E53A 2PA7A 4CDQC 4QPGC 3MPPG 2D97A 1AR91 4FPYA 2XWBB 1ZX5A 5FQ0A 4Z2WA 4I3GA 4QQPA 1RUH3 5F6KA 4IXLA 3VBSA 4YM1A 2ZTNA 3N3HA 1BEV2 3FHIB 1LHWA 2IZWA 2YMZA 3ZYJB 5B2GB 4LBKA 3TRSB 4COUA 4J1WA 1CPMA 1QJX3 1A8DA 2RM22 3LA3A 4WM7B 2ZHKA 4E2GA 3TYJA 1WMEA 1IHMA 1QJU1 2PLV1 1H2NA 3ZIWA 1AXZA 4YSFA 4JRAA 4M3CA 4FTEA 4KG8A 2ARXA 4JGYA 2V09A 3ZFFC 4ZU7A 2IXCA 2XL7A 4W65A 3KZ4C 3QCWA 4PCRA 1COV1 4AEDB 5BNOC 1X8EA 2RS51 1AYM1 2HWF1 5L7OA 3WW2A 2FMYA 1FOD3 4I01A 2WQ4A 2UYAA 2X5IB 2XL9A 2JDZA 4QPIA 2DVDA 4Q29A 4YZ3A 5KXBA 4MV2A 1R1A2 2MEV2 2UURA 1KITA 4H3WA 4BH9A 5J3UA 2A6WA 3ILFA 3MLJA 2R041 2GDFA 3WQ7A 3FLTA 3P3PA 3PMSA 2Q5TA 3JD71 4IV1C 1H1AA 5C9AC 2NP0A 2V5YA 2QFEA 4XW3A 3CLPA 3VLBB 2C5DA 1S1AA 4IL7A 3DUIA 4FPFA 4OI1A 3RI9A 2Y26A 3H1YA 2IXLA 3H7YA 2DVBA 2Q0AA 2EALA 3U11A 2VVFA 3HAGA 4IV3C 2W08A 4RFT0 4OHXA 5JOYA 1V9U1 1M06G 3OPZA 2E7TA 1AX2A 1VP6A 2A6ZA 5EZWA 2QZ3A 2EAKA 1VBE3 5I8YA 5K0UB 2CV6A 4HVQA 1QGLA 4FVVA 1RUI2 4F7ZA 2XJPA 3ZSJA 4K1ZA 1DGRA 3ZFEC 1FATA 4PJYA 4O9EA 4QXKA 3SCGA 3RJRA 5DUUA 4Q4X1 3QLQA 1MS8A 4RHV3 5KC6A 3KM5A 3ZMNA 3GYDA 3QH7A 4Q4W1 2IXHA 4B4QA 1FYUA 3AP4A 3PJQA 1FMD3 3USUA 1ULDA 3WG2A 5BNPA 2ZOEB 4A7KA 4YZ1A 1RUD3 1V6NA 1YFYA 2VY0A 4META 1UU4A 3PJYA 4AI1A 2RMU2 1W39A 5FBZA 1VBB3 2VQ0A 3VBRC 1LOBA 4Q26A 1VRH2 3IPVB 3S7EA 2UWAA 3J8F2 2EXIA 5KWRA 5HCFA 4ES8A 1N47A 5H9QA 2GC0A 2LUWA 5EWSA 3RWNA 5JZGA 1V6LA 2ZX0A 3VDDA 4MGYE 4XXAA 4B4RA 1I6XA 3VKLA 4B8EA 4XQWA 2ZGOA 3B3QE 4QMAA 4RR3A 5DZGA 1DFQA 3DPRA 3V0AA 5FAXA 1CAUB 1MQTB 1EP0A 5JI7A 4NWWA 4A7ZA 2FBEA 2GNBA 1CPNA 2RS32 4LR4A 5J48A 5JI9A 1FPN2 5F9TA 3FMGA 4EWDA 3VBOA 1OQDA 2A6VA 3TOJA 5HCAA 1UMZA 3MF6A 4MH0E 2WNEA 4IEPA 4F3JA 1W6NA 4Z8BA 3N4MA 1DYPA 1C8M3 5FMOL 1HKDA 3B69A 4R9DA 4IQPA 5FQ0B 2R1BA 4NR1A 5AC92 3KMHA 3NWKA 1VBA3 1VLNA 3VBUB 1NYWA 2UY9A 5JDBA 3VBSB 1VB4A 4MXWA 1JOJA 5TSWA 3B94A 4F83A 2WA3A 3N7JA 3A0KA 4L2NA 1AZDA 2D3PA 2ZGMA 1O7FA 2UU8A 1OOPC 1QQP1 4COZA 2EF6A 3EBRA 1BBT3 4Y22B 4YVWB 3AZYA 1EAH1 1OSGA 4K20A 1A3KA 1BJQA 4JDOA 4M3CB 1CGPA 1LGCA 2ZABA 4C1XA 5HBAA 5JOWA 2CTVA 2OIIA 3DGTA 1ENSA 3N35A 3VZOA 3G6JB 3FZ3A 4W6YA 2OZ6A 2Z79A 1QWRA 1O5UA 5L7OB 4AFAA 5T50A 2K9ZA 1RUE2 3GZTB 4KG0A 3AZWA 4TLFA 4CEYC 2ZKNA 2JENA 5IK5A 1ZM1A 3TN93 4DNYA 1LHOA 1AJOA 3MIGA 4COVA 2XBO3 3FFQA 1Z7S1 2WNUA 2X8KA 3BALA 2B7YA 5E8AA 1RMU2 1RUH1 3RNSA 3FJSA 1RHI3 4HL0A 1U12A 2ZMNA 3WLUA 1W6PB 4IESA 2ZGRA 2ZHLA 1GSLA 5GJ6A 3P3NA 1H9PA 2SBAA 3RDIA 1AUYA 1RJ7A 2HWD2 1QJX1 2ZGQA 4CRQA 3E5QA 3H50A 1QJY3 3H8UA 5DG2A 1HRI3 2TBVA 1I3HA 1SFNA 4CP2A 1ZVFA 4Y4YA 4IEWA 4CEWA 3PNAA 2EXJA 4AFBA 2XVLA 2IXKA 2QDNA 4YM0A 1RUF2 5F6LB 3GZUC 3JU9A 4AGGA 3RG0A 4LLOA 1HV0A 2XHKA 1ZBE2 2P34A 5BNPB 1WW5A 3KGLA 1C5HA 4Y26A 2WLPA 1YO8A 3MIHA 5J98B 3CO2A 1FOD1 4SBVA 2RMU1 4LO7A 3DKWA 1NCQA 2ZGTA 4BQ1A 4UW6A 1TMF2 2VOKA 4OVEA 1O5LA 5T5LA 3T2TA 1UU5A 4URTA 4AK3A 4AI3A 2GAUA 1SFYA 4XFGA 4CTEA 1TME2 3WDXA 4YVSC 4C90A 1Q8VA 5JZGB 3O14A 1QOSA 1G7YA 4I0AA 5AVPA 5I0UA 1IS4A 3VDDB 4Y5Z0 5JCTA 3VUOA 1QH7A 4CDWA 2FMDA 4X8NA 3H9AA 4RR3B 1UD1A 1PIV2 3GHMA 3DPRB 3V0AB 1VALA 3HT1A 3W59A 1VBE1 4QM9A 1H0BA 1H2KA 1VJ2A 4YW3A 5KXEA 4LUKA 5FCCA 1LHNA 5KHIA 4P9YA 3VZLA 3WOGA 1AHSA 1ND3A 3MFCA 2UYBA 4Q0UA 3VBOB 2CNAA 1AR72 2HKXA 4K3UA 4HN1A 4RHV1 4BPZA 2WT1A 2ZMLA 4RS5A 1W6NB 5FMOS 2QQPA 3D5OA 1H4HA 2C9AA 3ZN4A 1RUD1 5BY5A 3HMYA 2JKBA 5JVVA 4BIFA 4I2OA 1VBD2 1RTVA 4FQZA 5D8AA 4HFSA 4JGZA 5KXCA 3NAPC 2TEPA 1MS3A 4Q0QA 1GZCA 3UV9A 1D4M2 1WLDA 4CDUC 1JTZX 3V64A 1YI9A 5A3MA 4N7UA 2Q8OA 1AR82 4HKOA 3K51A 2W68A 3LWCA 1WA4A 2NLRA 2PYTA 4R8HA 2P37A 4RQPA 4N7IA 1CJPA 3KS7A 1LOGA 2AYHA 5T54A 3B7MA 1W6QA 1JBCA 1PK6A 1FT9A 1TQ5A 4KU8A 1OA4A 3KCCA 4G3YC 1G8WA 1O4TA 5CFDC 1ULEA 4GMP3 3B01A 3AP9A 2DUOA 4P9WA 1V6IA 1RUE1 4EROA 2A3YA 4XJZA 4GB31 5J09A 4ISQA 2EAAA 4UW3A 2RJKA 1QJU3 2PLV3 4KL1A 4BWOA 3KGZA 3HQXA 4X6QB 4YGCA 1AL23 1FNYA 2GMEA 2JXAA 2D5HA 4NHKA 1PZ8A 1C8M1 3ZSMA 3UJQA 2D6OX 1ND2A 5FO8B 3JZVA 2WNUB 4CYDA 1R1ZA 3M8LA 1GQGA 1POV1 1AYM3 1FX5A 4BHPA 1AXYA 1NA1C 2ET7A 1VBA1 1C4RA 1RC6A 4GIQA 1J59A 1L3JA 1LGNA 2JG9A 3L2HA 2GMMA 2ZBJA 5T55A 4OHVA 1WCSA 3RS6A 2XJUA 1ZZCA 2R043 3AKPA 3HT2A 1WUVA 2PAMA 2R073 5GLTA 2WFF3 2IFRA 3LA7A 3WDWA 4JDNA 4E4ZA 3V0BA 1GBGA 3VZKA 1BBT1 4LBQA 4XHXA 1B35C 1S0FA 1GFF2 2PHLA 4NO4A 1R093 4CEWB 3LB9A 3FBMA 3WZ1A 1DBNA 1DYKA 4UBGA 4Q4V2 2AGSA 4XTPA 1W6OB 1ZBE1 1OHFA 1MS1A 3WDVA 1HXS3 1RUG2 2PN5A 4X6RB 4EJRA 2YY1A 2PHUA 4YW5A 4C0BA 2ES3A 2IC1A 2OPKA 3AX4A 3T1MA 1CVNA 3AMPA 1WLCA 4XXPA 3OBTA 3E6BA 3HR9A 1J58A 1DGWX 2G9FA 4RGGA 2A6XA 4W6XA 1NCQB 5FPXA 3OY8B 4INDA 3HD8B 5CIRA 1F5FA 3FFZA 3TN91 4M00A 1WMDA 4Q4X3 3DV8A 5FREA 5ACA3 4Q4W3 4BZ4A 1NOVA 4P9XA 4COWA 1PHMA 1CR7A 4N53B 5JOZA 2X5IA 1WGPA 1GV9A 2RR12 4Q1PA 3CNAA 4XETA 1NLSA 4S2DA 2HWE2 1PIV1 2ZGKA 1REFA 1EYBA 3B9CA 1LECA 3OD4A 5FLHA 5A32B 4HK9A 1PO23 3TWIA 4N43B 2RJLA 3ZVXA 1LU1A 3GBWA 3J26N 4ZXKA 4FPEA 4XBQA 2WA4A 3EJKA 3M3CA 4JTOA 3WDYA 2BEOA 2YDEA 4LNVA 4MSVA 4HSLA 1DQ5A 1ASJ2 2GALA 4LBLA 5CVRA 2XKOA 1H4GA 1RVF2 1HRI1 3M3OA 2YZ4A 1ND3B 1KDMA 2EXHA 4X8PA 3E97A 5JPMB 3VBFA 4QQHA 4LA2A 4LBMA 2Q30A 5D1IA 1UKRA 3Q9OA 1U0AA 1XE8A 1XU1A 5T3NA 1NQJA 5K0UA 1PZ9A 3ZXLA 3KCXA 4P9JA 3WG1A 4P9LA 5C8CA 3I8TA 5BUVA 2OVUA 2Z42A 5D8AB 4AE2A 1ZBA3 1ZRRA 1VAMA 4JGZB 2WZR2 3G7DA 1O3QA 4EN7B 3RSJA 4N90A 3KD4A 5GZCA 3ZX7A 4BE3A 3KCYA 1RUJ2 2HWB2 1V00A 1MS9A