1QJZA

Three dimensional structure of physalis mottle virus : implications for the viral assembly
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
179
structure length
179
Chain Sequence
KQASIPAPGSILSQPNTEQSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three Dimensional Structure of Physalis Movirus: Implications for the Viral Assembly
pubmed doi rcsb
molecule tags Virus
molecule keywords COAT PROTEIN
total genus 14
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qjzA00
1VBE2 4FTSA 4YVSA 1NCRB 4RHV2 4CDUB 1HRV2 1R1A1 4YVSB 1RUE3 1CD3G 2RM21 3NAPB 1FPN3 1OOPA 4CDXA 4CEYC 2RS33 2HWF2 2RS51 5A33B 1TMF1 1ZBE2 2RM23 1EAH1 1HXS1 2R063 4CEWB 3J8F3 2HWE3 5FMOL 2Y26A 3VBOB 5FOJB 1VBE3 1FPN1 1AR82 5LK7B 1ND3A 1DDLA 4WM8A 2ZTNA 1AR73 1RHI1 1PO22 1ZBA3 1MEC3 2XBO3 5C8CC 1ZBE1 1FMD3 1RUD1 1AR71 1NCRA 1VRH1 1AR92 1HRI2 3VBSC 3ZFEC 1HRV1 1PVC3 2RM22 1FMD2 5A33A 2HWF3 3VDDB 1MEC2 4QPIA 1RUC1 1IHMA 3VDDA 4Y4YA 1OHFA 4Q4W1 4GB31 1ND3B 4Q4V2 2HWB2 1R082 3VBSA 1RUD2 1AYN1 5K0UA 2QQPA 4JGZB 2HWD3 1NCQC 2HWD2 1WCDJ 4JGZA 1NOVA 1OPOA 1R083 1RUF3 2HWB3 4Q4V3 3IDEA 2RS32 5C8CA 1OOPC 4CDXC 1FPN2 1RUE2 4Q4V1 1HRI3 5BNOB 1H8TA 4GH4A 2PLV3 1PVC1 1FOD2 3NAPC 1COV1 4AEDB 1PO23 1NY72 3VBUA 4RQPA 1AR72 4CDUC 5K0UB 4CDQB 4RR3C 1ASJ1 1MQTA 1RUJ3 1QQP1 2RR13 4FTBA 1BMV1 4YVWC 3J8F1 3HAGA 1PGW1 1AR83 4JGYA 1A6CA 5ABJA 1VBA3 5C4WC 4RR3A 2HWE2 3J8F2 4JGYB 2R062 1ZBE3 3CJIA 4NWWA 4RR3B 5DDJ3 2R043 2BBVA 2RMU1 5BNPC 3TN91 1X33A 5D8AB 3DPRB 2WFF2 4N53B 1HRV3 4RHV3 1AL0G 1RVF1 4GH4C 3VBFA 3ZFFB 2HWF1 5JZGB 5CFDA 2RMU3 1K5MA 5C9AA 1B35A 1QJX3 5ACA1 1COV2 5CFCB 3ZFGB 4N43A 4RHV1 3JBG3 4Q4X3 2HWC2 2MEV3 5A32B 1VBB2 1QJX1 5ACA3 5A32A 2R071 4RFT0 4GMP0 1VRH2 2ZAHA 4PDWA 1B35C 4N53C 1AL23 1AR62 3ZXAC 5ABJC 2VQ0A 1QJU3 1EAH3 2R061 2X5IB 5JZGC 1RUI3 2RS53 1VBC1 5D8AA 3DPRA 1PIV3 3JB4C 3JB8A 1RUI1 1QQP3 2WS92 1QJY1 1TME1 4RQPC 4CDUA 1PIV1 5JZGA 1D4M3 5CFDB 3M8LA 1AR81 1NG0A 4BCUA 1QJZA 1QJY3 1TME3 5CFCA 1RUH2 1K5MC 5C9AC 1MEC1 1HRI1 4Q4W2 1MQTC 1Z7S1 5BNNC 4Q4Y3 3JBG1 4Q4X1 1FOD1 4PDWC 1F8VA 2MEV1 1NA1B 5BNPA 1RVF2 3VBRA 1AYM2 4JGZC 2R073 2R041 4WM8C 1R092 5GKAC 1ZBA1 2XBO1 5J96B 1PO13 1PGW2 5AC92 1AYN2 1VBC3 1EV12 3VBFC 2HWD1 1RHI3 5L7OB 5C4WB 3CJIC 5DDJ1 1ASJ2 1AYM1 1BBT3 5C4WA 3ZFEA 1HXS2 1R1A3 2WLPA 4IV1A 1Z7S2 1PGL1 5K0UC 3VBOA 4AEDC 2TBVA 1BMV2 3VBSB 4QPGC 1W39A 1M06G 3VBHC 4YVWA 4QPIC 4WM7B 1BEV2 4Z92B 4YVWB 4WM7A 4CEWC 1RUG2 2WZR1 5J98B 1H8TC 2RS11 1TMF3 3TN92 4CDQC 1Z7S3 1C8M3 1RMU2 1AR91 1C8NA 2WZR3 4WM7C 5FMOS 1OOPB 2RS12 4CDXB 2HWE1 5BNOA 4GB32 1RMU1 4CEWA 1RHI2 2BFUL 3ZFGC 4QPIB 1POV3 2XPJA 2DF7A 1V9U2 1AYN3 4IV1C 1AR61 1RUG1 1VBD3 2WZR2 4EJRA 1C8M2 1RMU3 1ND3C 1TMF2 1NCRC 4IV3B 4RS5B 1VAKA 3JD72 4IV3A 4RS5A 1V9U3 1RUC2 1BEV3 1PO21 4FTEA 3CJIB 4Q4Y2 5C8CB 4SBVA 1RUH1 1V9U1 2RS13 1NA1C 4Q4W3 1QJU1 1ND2B 2WS91 1ND2A 1RUH3 1QJY2 1TME2 2IZWA 1RB8G 4GH4B 5AC91 4CDWC 2WWSA 2BPA2 3FBMA 2WS93 1SMVA 3ZFGA 2FZ1A 4LLFA 1RUC3 4N43B 1R081 3JD73 3VBUB 4WM8B 5AC93 4RQPB 3S6PA 4CDQA 5BNOC 1QJU2 1MQTB 1HQNA 1VBA1 1AL21 1VBD2 4CEYB 1HXS3 1R1A2 3VBHB 1X36A 4CEYA 1CJDA 1VB2A 3VBHA 1ASJ3 1RUJ1 2RR11 2X5IA 1VBE1 2MEV2 1C8M1 1F2NA 4GB33 3JBG2 4Q4X2 1H8TB 1EV13 1COV3 3LOBA 4N53A 1HX6A 4QPGA 3TN93 3VBFB 3ZFFA 2GH8A 2PLV1 1R091 1RUG3 4QPGB 1EV11 1QQP2 1AUYA 2R072 3VBRC 4Q4Y1 1AYM3 1RVF3 2R042 2BFUS 2RS52 1EAH2 1AR63 1AL22 1VBD1 2GSYA 5ACA2 1RUJ2 1BBT2 2RR12 1D4M2 1PGL2 2HWC1 4CDWA 3ZFFC 1VBC2 5D8AC 1PIV2 1RUF1 5L7OA 1K5MB 5C9AB 2RMU2 1RUI2 1NCQA 5CFCC 5CFDC 2PLV2 1PO12 3VBOC 4AEDA 3ZFEB 1R093 4GMP3 2WFF3 4IV1B 2HWB1 1VBB3 4GMP1 3DPRC 3VBUC 1NY71 2HWC3 2X5IC 5ABJB 1RUF2 3JD71 4JGYC 1VBB1 2FZ2A 2ZZQA 1FMD1 1RUD3 1D4M1 4CDWB 1RUE1 1POV0 1POV1 5L7OC 4N43C 1BBT1 1NCQB 1FOD3 3NAPA 1ND2C 5DDJ2 5BNNB 1B35B 2BUKA 1PVC2 5BNNA 1E57A 1VBA2 4NWVA 1AR93 1VRH3 3VDDC 2WFF1 1PO11 1NA1A 5BNPB 3VBRB 1ZBA2 2XBO2 2RS31 4IV3C 4PDWB 4RS5C 4FSJA 1VB4A 1BEV1 4Y5Z0 4YVSC 1QJX2 1GFF2
chains in the Genus database with same CATH superfamily
4XUOA 4YARA 2MHFA 3OGJA 1MS1A 4BQYA 1JUHA 2DBIA 3VKNA 3ZSJA 2Y34A 4YG0A 4RN5A 3OBZA 1HRV2 1Q56A 5FYIA 1R1A1 3WX5A 4HVQA 5E6HA 1CD3G 3WDXA 2VG9A 4CDXA 1W2AX 2RS33 2RS51 1CIYA 2XR4A 4MYEA 2R063 1HXS1 1YFWA 2JJ6A 2A6ZA 3A22A 2HWE3 3J8F3 5A7OA 3BU7A 3KSCA 4CTEA 2C5DA 2CGPA 4UT5A 5FOJB 1STMA 1FPN1 2JIGA 3U4XA 1FV2A 2BU9A 1UW8A 4P9XA 2VOWA 5SV5A 3X29B 1C28A 1OVSA 1SBDA 5FPXA 2DVDA 4XHXA 2VCCA 2CAUA 2EAKA 2YPJA 5AFEA 4FPGA 3RI9A 2O1QA 1X9PA 2IWGB 1AR73 5F3CA 4EZHA 1US2A 2XLFA 4YPJA 2I07B 1C5IA 4MGYE 2XBO3 5C8CC 1BJQA 2JXAA 4AQSA 3DCQA 1LTEA 1RUD1 5IAXA 2ERFA 1NCRA 5IYYA 1AR92 2RHPA 2K46A 3VLBB 1IS4A 2FCUA 2SBAA 3KV5A 3POEA 4B4PA 5FYTA 4BB3A 2VULA 1WGPA 4KU7A 4AFAA 3IKWA 1W3XA 1FV3A 2RJ2A 5A33A 1V70A 1H0BA 3ZN6B 2YBSA 3EMRA 3VDDA 2PHUA 3WNKA 2GC3A 1G9AA 3DF0A 4Q4W1 2EIEA 1O4TA 4PF1A 1SCSA 3HN3A 3LFMA 4I0AA 5A1FA 5JPNB 1VAMA 2UWCA 4Q4V2 3ZKYA 1VIWB 5ERLA 1XYNA 1R082 2Y6JA 2E7AA 4FPJA 2A3XA 4QHZA 1JTZX 2FDIA 4OZOA 1WCDJ 5FYYA 1BK1A 3RVHA 1OPOA 1EY2A 4EV0A 5IVBA 1JZ8A 1S0JA 2YZ4A 5KC6A 3ES1A 3WNXA 4S2DA 4FP3A 4D6RA 1WCKA 5C5TA 1S4CA 1TEIA 3WDYA 2OS2A 2W5FA 2PQQA 1QGLA 3VZLA 1RUE2 3O12A 2FQPA 3ZMOA 1ENSA 2RDSA 5FZOB 3ZN4A 1QY4A 1VE0A 5BNOB 2DUPA 4Z2AA 4MGIE 4GH4A 2R0HA 3PHMA 4Z07A 1KQRA 2XOMA 1PVC1 5F6LB 1FOD2 2ZAAA 5J48A 2OPKA 2AENA 4LR4A 3V0AB 1KXGA 2H6BA 3ZXKA 5FQ0A 5H9SA 1YQCA 2XB6C 4XFBA 3VBUA 3MGUA 2EAAA 4HK9A 4CDQB 2I45A 1BMV1 3FHQA 2JDAA 2KXLA 1UX6A 4LO4B 3GDBA 1AJKA 4HT1T 4MGKE 1UU5A 3I2GA 3NVCA 1S2BA 2WO7A 3KQRA 3HQUA 4GD4A 4KWUA 2WT1A 3E5XA 2C26A 4OHVA 4ATFA 4MV2A 4GXLA 3VDAA 2CY6A 2YGLA 3LWCA 4L8QA 3HJRA 4NWWA 5I0TA 2JG9C 5DDJ3 2BBVA 1LECA 5LZ6A 2RMU1 4AWDA 5FV3A 3EBRA 3JU9A 4FPHA 3TN91 5D8AB 2HYXA 1SLCA 1JU4A 1PVXA 4MGSA 1CR7A 2WNVB 4N53B 3VD5A 1XE7A 4RHV3 3WUCA 4NIAA 3DL3A 4XVHA 3VBFA 1D4VB 4XFAA 4YSFA 4M3CA 4NR1A 4M0NA 3UV9A 2GAUA 2FDFA 3R0RA 3VD7A 4M3CB 4HK8A 4AFMA 1W8WA 2LRPA 2QVSB 2WZPP 5TSWA 1GNZA 3WQ0A 3U75A 3LPGA 4Q4X3 4AGVA 1FAYA 1LULA 3CDZB 3E6DA 2UY9A 2A70A 5HI0A 3PTYA 4Y20B 5A32B 3NV4A 3IN9A 1G9DA 1V6IA 1W8OA 5IVEA 1PNFA 1YC61 2DCKA 4IE6A 1WMXA 3FUQA 4PDWA 4CCMA 2OUHA 3EB7A 5JIUA 5KHJA 4OULA 3ACHA 2IXIA 4ZONA 3ZXAC 4HPKB 4JVAA 1FNYA 3VZNA 1QXJA 1J58A 2WFPA 1KS4A 2VC9A 1RUI3 1QMJA 5BXXA 1XYPA 1VBC1 4FPKA 5GZDA 2QNKA 4P9IA 3GF6A 1UIJA 4I3PA 2JE9A 2EXIA 2VZQA 1RUI1 3AKQA 2Z2SB 4XJWA 1QQP3 4CDUA 3RSJA 1YNAA 2JDYA 3T2OA 1D4M3 5CFDB 5SV8A 2QQVA 2ZXQA 3M8LA 3KT1A 4Y1ZA 4KGGA 1NLRA 1WMDA 3ZSLA 1ENQA 3AP5A 4Y1UA 5CFCA 5FO9B 3PLQA 3SH4A 5IW0A 4ARYA 4JHTA 2X09A 1BHGA 4JRLA 3MLKA 3APBA 3VKOA 2V73A 2RDNA 3RZGA 5HV4A 4ZPIA 4XW3A 2VZSA 1KJRA 3J9SA 2VCMA 4A7ZA 4OMDA 5DABA 2IFWA 2Z5WA 2EICA 2JG9A 1WLWA 3VHPA 3BIEA 1SDWA 2PAMA 5J96B 2XBO1 4KWKA 1SFYA 3MHZA 4P9WA 4CCEA 2FBEA 5CKNA 4S2GA 4UFIA 4DZGA 2UURA 3ZYRA 3O0XA 4TXWA 1G9CA 3RZJA 3OG2A 3ZO0B 4CXXA 3WW4A 4E8CA 5L9BA 4U2AA 2XKOA 5FP3A 1SLLA 2Q30A 4XJZA 3O5SA 4YGCA 3N9PA 4XQDA 3WQ1A 5F9TA 1QF3A 3OUJA 5E8AA 3CJIC 5C4WB 2VVFA 4KH9A 1OUSA 3IMMA 4JTOA 5JXGA 1BBT3 3FC0A 3ZFEA 3ZN6A 1XE0A 1UOJA 3W5MA 1LESA 2WKKA 4K9SA 4OI0A 2E9QA 4AI1A 5A3NA 2VVDA 5EHDA 3AXDA 5T5OA 1RXGA 3TB0A 1QXPA 5C3RA 3AZVA 3NMBA 4R8HA 5GM0A 2MNGA 3VBHC 4YVWA 2W3JA 4WM7B 1BEV2 1JXNA 3ACLA 2D6KA 3AVSA 4UW4A 4XURA 1LODA 2K2SA 4YM0A 4AK3A 5DQ0A 4C0BA 3HEIA 4YNIA 3KGZA 4XF4A 1H9WA 1RUG2 3FBYA 4QKNA 2J1EA 5LCWL 1CPNA 1FYUA 4AHWA 1LHVA 4FVVA 2R0FA 3DXUA 1Z7S3 3Q9OA 1C8M3 4LLOA 4XDPA 2J1VA 4UWDA 4WM7C 4BPZA 4JQTA 4JDOA 3ABZA 1TNRA 2RS12 5EFUA 2OPWA 2HWE1 4UW3A 4H14A 4AFCA 2EXJA 3BPSA 1AX0A 3CIHA 2V5DA 2W2IA 1RHI2 4Y3OA 4P9LA 2BFUL 3USUA 4BIFA 2BNMA 4NHXA 2C1FA 1RGSA 1MS4A 4XAAA 3MLJA 1J3PA 1K12A 3DN7A 5J1XA 1UZYA 2G9GA 1VBD3 1RUG1 4Z2WA 3PUAA 4EJRA 4YG6A 1C8M2 5FZMA 3PMSA 2B45X 4XJAA 3AZWA 4NAOA 4Y24A 4R4ZA 1APNA 3HMYA 1NCRC 2R1DA 2YC0A 4RS5B 5I8SA 3N7JA 1DLLA 1VALA 5DG1A 1W6QB 2HEVF 2O8OA 3NSTA 4K1ZA 4RS5A 4P02B 5FPVA 2WYFA 1BEV3 2CGNA 4NRMA 1W0OA 1PO21 2ZMNA 3K77A 4B7KA 2VR4A 2B46X 3ZR5A 4LQRA 2LROA 3QH6A 3D82A 1LRHA 3DXTA 5FPZA 4L11A 3C7EA 2QQOA 3IZOA 4KG8A 1V9U1 4CE8A 5IK4A 3I59B 4XUQA 3M3IA 2AGSA 1CJPA 3OPZA 4UF0A 1YQ5A 1LENA 3I59A 1LOCA 5JOYA 2UU8A 1KS5A 2Q8DA 1I6XA 1GICA 3PUSA 1WD4A 2VQTA 4GH4B 3AP6A 4P08A 3MIGA 2JKBA 3VB9A 4DXZA 4D7TA 4QXBA 4LBJA 4Q5OA 1OMIA 3W9AA 5ISLA 2Z4FA 3PJYA 4N43B 4AEMA 4BE3A 3KS7A 4YZ1A 2X53S 3JD73 1YXWA 5JUVA 3BOWA 2IVJA 5FPAA 4JQRA 4Q0UA 5FPBA 2P3YA 2E26A 4UOJA 5FYCA 3S6PA 3TYJA 2FDKA 3HWJA 4X8PA 2VOTA 1HQNA 4XJ8A 5T3NA 2WAOA 3ZSMA 3SMHA 3NV2A 4OMCA 4LE3A 5EP9A 2W68A 1R1A2 1RYYA 4G3YC 4MZUA 2DBNA 3RYKA 1CJDA 1VMHA 1DYPA 3VBHA 4FPFA 2X5IA 2MEV2 4J1XA 1F2NA 1C8M1 1N3OA 1IPJA 2XL7A 3BPZA 1EV13 3O0WA 4RSUA 5EXOA 2VE1A 4CCCA 4N53A 2P34A 4DB5A 4Z1VA 3R05A 1HX6A 1I3HA 4AGRA 1N47A 2TUNA 2GC1A 2XVLA 3ME2A 1O7FA 2A3WA 3OF1A 3P5BA 3TEXA 1W8ZA 2NMNA 1HLCA 2ZGMA 4QGLA 1DZQA 1U5YA 3VBRC 4YZ3A 2ZMLA 4I01A 3PL0A 1ZZ9A 3CO2A 4HKLA 2R042 4QKDA 3AFGA 1EAH2 2GDFA 1W2UA 4AQTA 4AXOA 1T2XA 2TNFA 1AL22 3N7KA 1EUUA 3POIA 1D0GA 1WBFA 4ET7A 4YW3A 2PQSA 2WR9A 3T2TA 2OIIA 4DNYA 5FWEA 3AYAA 4HPKA 5ACA2 1W0PA 3UGFA 3AMPA 3PTRB 3M2MA 3RNSA 5C70A 2DVAA 3WW2A 4DY3A 2BDRA 3ZR6A 1LR5A 3ORJA 4NPMA 2WC2A 3AMQA 4LOTA 4CUGA 4QQHA 2VUAA 2XVGA 3ZFFC 2QUOA 4F83A 4FPYA 5FZCA 1OFSA 4R9CA 3BIWE 1RITA 5E16A 2J22A 1SQ4A 2ZGRA 5L7OA 1XBFA 2ETEA 4JC1A 1SHWB 3OOXA 4E2GA 5CFCC 5CFDC 2PLV2 1POQA 4YG3A 4AEDA 4CZSA 1WLTA 2ZGNA 5FQ0B 3ZFEB 2VZVA 2XG3A 4L9BA 2J42A 4Y5SA 3WCSA 3ZX7A 5C6CA 2W92A 3U1XA 2VW2A 3AYCA 4Y5TA 2ZGKA 3ROUA 2B42B 2KD7A 1CAVA 1NY71 1JBCA 2AH2A 2RJLA 2X5IC 4FPOB 4PQQA 4QX2A 5DXDA 4CCKA 3MLLA 1PNGA 1W8TA 4JZRA 4W65A 3H1YA 4XIKA 3ZIXA 4NAMA 4FFFA 3IB3A 3N9OA 2AC1A 4JGYC 5I91A 1VMFA 4MHRA 5F5IA 2XJPA 3ZMNA 4A2UA 4DEQA 1UMIA 5LB6A 4QD2A 5AFBA 1AX2A 4QX8A 1FMD1 1D4M1 2C24A 5J36A 3WG4A 4CDWB 3PIJA 2VU9A 3LFIA 3K3NA 4HZFA 1JS9A 4B1LA 5LK5A 1GWMA 5M0TA 4HETA 1D2QA 1NE6A 5JSOA 2JDMA 3WR0A 1FOD3 5CBLA 5LEKA 3RZMA 2O8QA 4LKFA 4RGKA 1E57A 1VBA2 2PAEA 4BQ2A 1OC1A 4NWVA 4AI8A 2PFWA 3WW1A 1TZOA 5KHIA 4BOWA 3HNMA 5F3IA 4MVTA 5A7SA 1PO11 4PT6A 5BNPB 2VCBA 5FZ7A 2DUQA 3LDBA 1I9RA 2RDRA 4BK4A 1CZVA 2NMOA 4EYUA 5CAZA 3NJZA 1AXZA 5JSRA 2BVBA 3NKGA 3NO8A 1BEV1 2AR6A 3I2JA 1QWRA 5JOWA 1GOHA 2JG8C 3CZUA 3QLQA 4Y5Z0 3RMXA 2A6YA 2ZX1A 1F4AA 5HPOA 3ZXDA 3I3MA 3POSA 1QJX2 2OX0A 2E53A 2ZGPA 3NL1A 2JDHA 2WO3A 1G7YA 3NJYA 4Y1XA 3RZLA 5B4NA 2VMIA 3CHXA 4IE5A 2PHWA 4AE2A 1MS9A 1YYNA 4OQ8A 2Y6KA 1K3IA 4GJYA 1UKGA 4Q29A 2QDNA 3VZKA 4LKSA 1SPPB 2VM9A 1FPN3 1OOPA 4XFCA 1RUNA 3POJA 1H1AA 3E1F1 2HWF2 2R49A 4QGNA 1XOYA 5A33B 1WLCA 4DUVA 1RC6A 1ZBE2 1DQ4A 3RDIA 4J1WA 3RQ0A 3FX3A 4K6BA 1W05A 2Y26A 3POFA 3M3OA 2WWUA 3ASIA 1VBE3 1LGBA 1NLQA 5FZHA 2VZOA 3OB8A 1PK6A 3B3QE 4KU8A 3KCCA 1DZRA 3O1OA 3T08A 3PMEA 3JUUA 3H42B 1SLAA 1IPKA 4MXVA 2FMYA 4LBNA 4Q0QA 4OUMA 3GZTB 4DIQA 5IFTA 1W6QA 5JMCA 1JYVA 5BV6A 1PO22 3THDA 2C9KA 1YQ2A 1MEC3 1URXA 1YJKA 1ZBE1 3OD0A 1FMD3 2GMEA 2P6CA 2Z79A 2G19A 1AJOA 4FAGA 4HN0A 4AVAA 4OI2A 3WNPA 1XYOA 4CP9A 3K48A 1GU3A 1LOFC 2BV4A 2WSUA 4YW2A 3J7LA 4O61A 1I1EA 1PVC3 1ZVFA 4X8NA 1LNSA 2VBBA 3PUQA 3VZJA 1R1ZA 2HWF3 5F7UA 3ATGA 3W59A 5CKQA 2WA3A 4JKLA 4XF9A 1W6MA 4QPIA 1IHMA 2LALA 5H9QA 4NPLA 1OHFA 4FBFA 4ATEA 1ODMA 4BU2A 2K0GA 1UX7A 1OFNA 4GB31 1OD5A 1ND3B 1GOFA 2HWB2 3UK9A 3OUIA 4AVCA 1UKRA 2JX9A 2Y6LA 4ASLA 5EWSA 1LGCA 3K3OA 3O14A 4N8MA 2QQPA 2HWD3 2PTMA 3EJKA 1NCQC 4YWAA 2YPDA 2HWD2 5FMDA 1YQ6A 5JI7A 3WQ7A 5C3PA 1Q5OA 3NNLA 1DGRN 1NOVA 3BTAA 3KV6A 2JWPA 2XQRA 4XXPA 5J7MA 2HWB3 2TEPA 5F5QA 2OXBA 3ZYHA 1JI6A 3UJOA 2GC2A 1F5JA 3JQWA 5C8CA 2YFZA 3ZXFA 4XDOA 4I0BA 3BI3A 1ZRFA 4UF0B 5CU1A 5A6ZA 1SLIA 3B94A 1S0EA 3OBTA 1YRZA 3L2HA 3C8XA 1YFXA 1OLME 1H8TA 2G4IA 1NQDA 1ALYA 2D5HA 2PLV3 4PBPA 5A6YA 4AI2A 4AGGA 2AUYA 3WW3A 2Y33A 5A7WA 3IDBB 2PHTA 4FPCA 3MF9A 1PO23 2YC2A 1UQXA 5FZGA 4AQ2A 2V4AA 5A3UA 4XF0A 3N35A 3UYJA 4CDUC 2PXJA 4BISA 1BKZA 5HXMA 2BOIA 4RR3C 1OA2A 1ASJ1 1O6UA 4QQ2A 2ILMA 5I0SA 1DCSA 1JOJA 3CKHA 3HAGA 3Q8EA 5A70A 2YFUA 1GV9A 1AR83 1UAIA 1DGRA 2ZKNA 5H9PA 4JGYA 4NPRA 3P3PA 4R9AA 1W6OB 3KF5A 3A4UA 4LEJA 1HN0A 5C4WC 4MO3M 3LGRA 4QXKA 4TN7A 4UW6A 3RRDA 1ZBE3 4A7KA 5F1RA 2Q8EA 2VW1A 4RR3B 4F8AA 2R043 4XFIA 1MZ6A 2JE7A 2H6CA 2XONA 2B9UA 1X33A 4IETA 5KWRA 2D93A 3LA7A 4YGDA 4CUAA 3WF3A 3OGRA 5ANQA 2XHNA 3TRSB 1AL0G 1RVF1 5B2GB 5EIYB 3B69A 1Y3TA 5FKCA 1CX4A 1YQ8A 2HWF1 2W46A 3ZFFB 5CFDA 4H7LA 4I30A 4P14A 2QQWA 2QQLA 1SLTA 3QACA 1U0AA 3OTFA 5CFCB 4LIVA 5J09A 5A3PA 4MADA 4P9GA 5FYBA 4ES9A 4ZU4A 2H0BA 1FNZA 3M4FA 2HWC2 2W1WA 4YZ2A 2BEOA 3DYMA 3TEZA 4MXWB 2C4XA 1Q8OA 4META 1QJX1 4KNCA 5ACA3 3ILNA 3OGVA 1LU1A 4DY5A 4OCTA 4ASKA 1VRH2 2V09A 1B35C 5F2WA 4JDNA 1BLZA 1AL23 5C3SA 1JYTA 1JU3A 3SCGA 5FYUA 5K8SA 4LMFA 1N3QA 4GULA 1EAH3 1KEXA 1DYKA 4BQ3A 3DYPA 4I0WB 5JZGC 1DBNA 2RS53 2E31A 3P6BA 5CVRA 4PIXA 1JZ3A 1Y4WA 2ET7A 1PIV3 3K75B 4O65A 1XQNA 3JB4C 1H1MA 4IE0A 4IDZA 1GMMA 3W5NA 3JB8A 2YBKA 3C2UA 3DKQA 1JHJA 4CYDA 3BVCA 5FZFA 5FYMA 1PIV1 5FP8A 2DV9A 4JKMA 5FMCA 2VECA 5FXWA 3AMMA 5FXXA 4Q26A 1WMFA 1NG0A 3RPQA 1QJZA 3KGLA 4LTAA 4E2QA 1JUIA 2Y6FA 1RUH2 4CP2A 1K5MC 5C9AC 1ZRIA 5IK7A 3E6CC 2QE3A 3MUZ1 5DMYA 2ZX4A 5F32A 5L9RA 1NLSA 4Q4W2 4LORA 5BNNC 4QDRA 1W8UA 1JZ7A 2W47A 1IG3A 2ZS6B 1S0BA 1F8VA 1F35A 2MEV1 5BNPA 2YGMA 1QDCA 4NJ4A 2NPIA 3ZYIB 3T2QA 4CCLA 2DCJA 5CADA 2R073 5EJ3A 5FUPA 5C3QA 4KGQA 1LEDA 1V0AA 2JB4A 3DKWA 4WM8C 5FXVA 5FZAA 1XNAA 2VJXA 2WIIB 1ZA4A 2D6NA 5T5PA 3ILFA 4CPBA 1NQJA 5DUUA 2UWBA 4DO0A 1UPSA 4QU2A 1YUDA 3G6JB 3RG0A 4CU8A 2BW8A 1LJ7A 4BQ1A 1H2LA 3GBFA 2P4EA 1LCLA 1RHI3 2WT2A 4XFGA 5L7OB 2GNBA 2VZPA 5FZEA 1AYM1 4URAA 1TVGA 1JODA 2E6VA 2ZKLA 4YW1A 2VL4A 1A3KA 4Y33A 4D3WA 1A8MA 1Y9MA 5BPXA 1UMHA 2WLPA 2WNEA 2B39A 2YBPA 2D6LX 3CBNA 5EV7A 1PGL1 3O1SA 5K0UC 5FP9A 4NRQA 4O7XA 2TBVA 4ZXEA 4AF9A 1Z0HA 1V6KA 4QPGC 3IBMA 3MW4A 1LOGA 1W39A 4LXLA 5F3EA 1DQ2A 3B9CA 4J25A 4LA3A 4D69A 1XNKA 2OYZA 4NVPA 3M1HA 2Q1MA 5FZ1A 1VRBA 4IEUA 4IEZA 4FFIA 3I3DA 4Z82A 3WP6A 5FR3A 4CEWC 3ETPA 3RZKA 4F3JA 5J98B 3K4ZA 4BXSV 3BN6A 3OYWB 2ZGQA 3RZZA 3U10A 2FDHA 3FFQA 4QXCA 1C1LA 3I54A 3WDVA 2VCAA 1GQPA 4Q8LA 1OOPB 4OI1A 5BNOA 5DUXA 4GB32 5A3OA 2CYFA 1PMJX 3WNLA 4RD7A 1BVP1 1HB3A 4XTMA 4C91A 4IGOA 2D43A 1W9TA 4XABA 1IQDC 2E51A 3ZFGC 3CL1A 4MHUA 2GNMA 1GNHA 2BYVE 3V56A 2Y6HA 4IV1C 4O9EA 3VDCA 5A6QA 1HB2A 3KMHA 1CAXB 1ND3C 1TMF2 1GQGA 2NN8A 3LEKA 3WHTA 1W03A 4XXAA 4IV3B 5LW9A 3ST7A 1ST8A 3NQHA 3WUDA 3OBAA 1VAKA 2ZGLA 1V9U3 4UFLA 2VOXA 4E4DX 5C7GA 3POWA 5FYHA 4DUXA 4TZDA 5DAPA 2Y0IA 2D6OX 1ULDA 2DCYA 2ARCA 4L0PA 4YM3A 1OKQA 1QOTA 1D0HA 1OKOA 2VNOA 1PHMA 5KHGA 1V6NA 4E4SA 5A3MA 3I49A 4AI3A 1RUH1 2JECA 3E5QA 3FLTA 5FCCA 1Y7BA 4Q4W3 1BQPA 3BTYA 5CG8A 1QJU1 1ENRA 1OURA 1UXZA 5C8WA 2AACA 5FY9A 2OW4A 4GZ9A 5FKBA 2WAAA 1RUH3 3NJXA 2IXKA 1PM4A 3J7MA 1BYHA 4XHBA 5T5JA 4HXCA 1DQ5A 2O0OA 3GZUC 4HVRA 2BBAA 3VV1A 4CXYA 4CU7A 1ZA7A 2BPA2 4Y4RA 5KXEA 5C33A 4AFBA 3T0BA 2EXKA 2W1QA 1SEFA 3EHKA 4AVTA 5C5UA 1SG3A 4RQPB 2ZOEB 1YIFA 1G86A 5FFOC 1O8PA 2JKXA 4NMIA 3MIDA 1LOEA 5L19A 1MZ5A 4HONA 3CEWA 2WRAA 3M3EA 4KMQA 2VOVA 1AL21 3VDBA 1O3QA 1CZTA 1XU1A 3WP4A 1HXS3 3VBHB 4BH9A 2IXHA 4CEYA 2A7AA 2DCTA 4A44A 1WWYA 5KXCA 1RUJ1 2RR11 3SNMA 1CX1A 1NE4A 4MG2A 1QH7A 1Y9QA 2JIJA 2Y0OA 4Y22A 3GM8A 4ITCA 3LKJA 4GB33 2BTVC 4Q4X2 3J7NA 1DU3D 1LU2A 3WG2A 4GKYA 1JZ2A 5DZFA 1YIPA 2HKXA 2QZ2A 2D6PA 3LDRA 1SLBA 4IGQA 1W6NA 5CNAA 3U0ZA 4FFGA 3ZFFA 2PLV1 3GCWA 4FAHA 1RUG3 1W2NA 4A4AA 3GBGA 5C71A 3ZYPA 1UY2A 1QQP2 5F37A 4BMEA 1DGWA 5FYZA 4W6WA 5DUWA 1HQWA 2Q8CA 4N7IA 3K4AA 4DS0A 2G1MA 4IEVA 3KB5A 1W06A 1HIXA 1NXMA 2WN2A 1G9FA 5LRSA 1S0GA 4RFRB 3WG3A 2NLRA 4XTPA 2KM2A 2X29A 2V4VA 3FLRA 4XMAA 4XPVA 3DYOA 4LIUA 3ZKUA 5FOBB 1PMHX 4Y22B 1O8SA 2DU1A 2DYCA 3JZVA 2WNUA 4RA0A 1RINA 1ZNPA 3WZ1A 2WNVA 2W1SA 3FLPA 3WF2A 3UKVA 1XC6A 3KCYA 1GZWA 4IE4A 4KQ7A 5FY5A 2ZZJA 1W8FA 2VQUA 1PIV2 4FOVA 4UBGA 4DRRA 3B9IA 2PMWB 1K5MB 3SH3A 2RMU2 5C9AB 4Y26A 2WO1A 3RJ2X 1X7NA 4GWIA 3VBOC 3D4KA 4CCNA 4LPLA 1UYYA 3T09A 4C8DA 2J7MA 3MFCA 2DWRA 2DDUA 2RG4A 3ZLIA 1F31A 4JRAA 5EYYA 1UOGA 3URFA 4Q27A 2W94A 3KQ4B 3A23A 3DPRC 3HBZA 4WV8A 4YZ4A 4UBHA 3OEBA 4WVWA 2HWC3 5F3GA 2Q1FA 3UNPA 3FL7A 5HXVA 4BJ0A 3HPNA 5ABJB 5DPNA 3ZXEA 4AOCA 5A1AA 4NIIA 3U07A 5GZCA 5IJRA 2ZABA 1WZXA 2ENRA 2GU9A 3VZMA 4A3ZA 5IK5A 4OHYA 1EPWA 2R1BA 1SBFA 1ZRDA 1FX5A 1POV0 2XGXA 4LHSA 5L7OC 4FPLA 1WCQA 4QWNA 5CZKA 5HV0A 2FDJA 3SCHA 2PHDA 4BM8A 4N43C 4HSJA 2A6XA 3KWVA 1NCQB 2B5HA 3UETA 4M00A 3C7HA 4JDMA 1ZRRA 4NOTA 2W08A 1UNBA 1PVC2 3L2YA 4LBLA 2UYAA 5FBZA 4M3CF 5CKMA 2XJRA 5G05L 1UMZA 3IT8A 4PIZA 3D0JA 4QX1A 1AR93 1REEA 4LHLA 5I8YA 1GP5A 1VRH3 2PN5A 4IEYA 4XBQA 1WCUA 1SFNA 2VTXA 3MPPG 2PHLA 2WFF1 4AHXA 3UESA 5A7PA 5FAXA 1OH4A 3VBRB 2CU5A 1IPSA 4XOGA 3V64A 3DV8A 2RS31 3FFZA 4RS5C 4PDWB 5FYSA 4FSJA 2ZGUA 1JYIA 1O4YA 2Z69A 4OLLA 2BNOA 2XVKA 4N9IA 4XCBA 2DU0A 1LB2A 5I8TA 2E63A 2ZGSA 4JX0A 3NV3A 4K21A 1V6MA 3KZ4C 3ZIWA 4BXFA 2HEWF 1MS5A 4I3GA 3LEGA 4HN1A 3H7YA 1GFF2 3TNQA 1ACCA 4B4QA 1VBE2 2GALA 1Y43B 3AB0A 4FTSA 4YVSA 1NCRB 2WT0A 4RHV2 3VHOA 3WNNA 4CDUB 3NKTA 5LA0A 1QNWA 3LIHA 4NHKA 4XILA 3NNMA 4S2HA 3A0KA 2RM21 3NAPB 5CEHA 4CEYC 3TEYA 3AXEA 3FN9A 3AJYA 3I8TA 1QJFA 1SPPA 4YFWA 3S5QA 5I0DA 1TMF1 2RM23 5D1IA 4IUGA 3MI8A 4CEWB 4BQ5A 1WLDA 1GNYA 5FMOL 4DRVA 4EN8B 1AR82 2PYTA 5LK7B 1DDLA 4LITA 5A3TA 4JTNA 2KA3A 3H9AA 1UYXA 4XUPA 4WM8A 4CUCA 3O1MA 1H1IA 3IM0A 1C1FA 5FK8A 1UYZA 2ZHMA 1JZ4A 2J1RA 2ZTNA 4BLJA 2JB8A 3M70A 3SCFA 4YRDA 2BP6A 4QM9A 3VGIA 3HNYM 1RHI1 1RL3A 4QU1A 3SEPA 3WINE 4L99A 2ZCWA 3CF6E 3I3QA 2Q0AA 4LBQA 1UZWA 3SISA 1LEMA 1WCSA 3T4HB 2Y8KA 2XXZA 3A21A 4CU6A 1UCXA 3ZXLA 4K8FA 1L3JA 2GP3A 3VBSC 3ZFEC 2IVIB 3AKPA 4CUBA 4YGBA 4D8MA 4I02A 5T52A 3HT2A 4QQLA 4D94A 5IVFA 1FMD2 3VDDB 4BQWA 4AVVA 1B09A 2PELA 4JHZA 3C3VA 1MEC2 5G04L 3NW4A 3QBQA 4LO7A 3MF6A 5FZ6A 3SLIA 4D0QA 3MIFA 1TNFA 1OLRA 2CV6A 5KHHA 4DXRA 1O3RA 2UY8A 3K51A 1FI2A 5FYVA 1IKQA 4OVEA 2YY1A 1RUD2 2WNOA 2ZHKA 2YHJA 1L7QA 3OPTA 3ITQA 3LEMA 1Q3EA 2IC1A 5LBEA 4AAPA 3WHUA 3OCPA 1S0FA 2FCVA 4XJUA 3POBA 4H3WA 3B5LB 3VL8A 1RUF3 4FO9A 1DF0A 2PAKA 3QOPA 3ZSKA 4XQWA 5T5LA 4WVVA 4LNVA 2ARAA 1UN1A 3MEPA 2AEZA 3MYXA 1OOPC 1Q8VA 4XFFA 1BVVA 4A6OA 1FPN2 4LULA 4BQ4A 3I7DA 1XSQA 2PHRA 1GOGA 4Q4V1 1VAVA 2IUWA 2OQ7A 4TLGA 4F7ZA 3RJRA 2W9XA 5DUVA 3VKMA 3KM5A 5FZOA 3KCXA 5IFPA 1YHFA 2YROA 1QNYA 4Y1VA 3U11A 4GAZA 3BTXA 4NE9A 4AFDA 2BWCA 1PX4A 1COV1 1GQHA 3OY8A 4FQ4A 3V0AA 3FE5A 1VPHA 1VJ2A 2WQZC 3PVBB 4XACA 1HJGA 4RQPA 3LE0A 2C9AA 4RGGA 5HCHA 2PA7A 3POYA 2AYHA 4M01A 1MQTA 3THPA 2VNVA 4HBNA 4YVWC 5CG9A 4DMIA 1NZCA 4OZXA 4B8EA 2CDPA 1X9TA 4FOYA 5JXIA 1PGW1 2WWJA 3SKJE 1GANA 1OQDA 3ECQA 1W9FA 3BOPA 4QKBA 1A6CA 1Q8QA 1JYWA 2CDOA 4RR3A 1RXFA 1W3VA 3J8F2 4JGYB 1J3RA 5LASA 4AQ6A 2WNUC 4JAAA 2VO5A 1W9WA 1ULFA 4Q8KA 5JPMB 1CN1A 2F4PA 3I3EA 3CZJA 2WFF2 4LA2A 4CP1A 1R64A 1F4HA 2DVGA 3PVNA 3D0SA 2C0ZA 4LO5B 5CIRA 3WY6A 4DQAA 2DFCA 2D5FA 2VD7A 5JZGB 1JW6A 2VMEA 3SKVA 1RUOA 3L9JT 1LHOA 4Q1RA 1QJX3 5ACA1 1W8NA 1ZZ6A 3HN1A 3WQBA 2BNNA 1DZTA 5LEJA 4LHKA 1NXD1 1LKNA 2QDRA 4PLNA 2ZGOA 4E4HA 5JVVA 3HBKA 2P3IA 4R9DA 2LTNA 2MEV3 1GSLA 1PX3A 1RTVA 1DLCA 3RYPA 3SQOA 3B93A 5FREA 4CVUA 2ZBJA 1V6JA 2R071 3KLSA 4GWNA 1OPMA 2BJSA 3D6EA 4GMP0 1UPIA 1CAWB 3AVRA 4O9GA 1OH3A 1D2SA 4HSLA 5FPUA 5F5CA 2CGOA 2D6MA 5ABJC 4G9SB 1WW7A 5FBJA 2R061 2P17A 3ZOIA 3U37A 3ZXJA 1DQ6A 2EIDA 4JV4A 3N36A 3LSDA 1UD1A 3FHAA 1PZ7A 5GALA 2AREA 3WCRA 2ARBA 1GBGA 4AVBA 4XBLA 1G9BA 1JN2P 2ZEXA 5A3WA 2B7YA 5FZ9A 3I2FA 3MV01 3VZOA 5JZGA 1IS3A 3O0VA 1AR81 1LOBA 1W6PA 1O4ZA 2W91A 3GJAA 1QDOA 5FLHA 1HRI1 3JXSA 4ES8A 3WEZA 4J6GA 1MQTC 3C7GA 4MXWA 3WDTA 1C3HA 2R16A 3JBG1 3NRUA 4XUNA 5FZ8A 4ZY9A 1PK6B 1XJAA 4PDWC 4CP0A 3HR9A 2OA2A 2YU2A 2N7GA 4KWJA 2B8MA 2JG9B 5T54A 1LAJA 1W8HA 2XWJB 3VBRA 2QQMA 4MLOA 1S0IA 2XJSA 2WQ8A 5FWJA 2A1XA 3GZEA 2R041 2VXJA 5GKAC 1OI6A 3CMGA 3I3BA 4IGPA 4M4PA 5KXDA 1V00A 2HYKA 4WZFA 3RGBA 1AZDA 1UY4A 3AMHA 1EYBA 5AC92 3FJSA 5BNQA 1CQ9A 1CVNA 4RL7A 4IEOA 2RDQA 1U5ZA 1EV12 4MOAA 1NT0A 2KR2A 2FMDA 3VBFC 4XC9A 4HG6B 3H8RA 1O3SA 4FXKB 1GZCA 2GMMA 3MW2A 4A41A 3LA2A 1QEXA 2ZEYA 5EYXA 5C4WA 2E32A 4COYA 3RS6A 1MZFA 1HXS2 2W52A 2WN3A 3Q8BA 1XXNA 4ONUA 2VMCA 4JCKA 4YW4A 4IV1A 4QHBA 1Z7S2 4RYDA 4YGEA 4WZCA 4A3XA 3VBOA 2VUCA 5GJ6A 1BMV2 5CB7A 2D3PA 4BIOA 2W87A 3F95A 4FI9A 1HDKA 1M06G 1X8MA 5FJKA 1MZEA 5L73A 3WP5A 3W21A 4EN0A 3AJZA 1UZVA 3WF4A 4Z92B 4YVWB 4LUMA 4ISRA 2QZ3A 2QQKA 2VY0A 4QX7A 2ET1A 1W04A 2GH2A 3OBRA 2ATFA 4NRPA 2V5YA 1H2NA 2OUJA 2WZR1 4QMAA 4DOUA 4LBQB 1H8TC 3TN92 4V2VA 4CDQC 5HCAA 4GJZA 2P3KA 4NIDA 1DYOA 1RMU2 4FOQA 2EIGA 1X82A 1REFA 1AR91 1C8NA 1X50A 1NKGA 2WZR3 3MFAA 3N9NA 3OGGA 1W9SA 4W8JA 5FMOS 3T1LA 5IVJA 1N1SA 4CDXB 1GP6A 2EA7A 2D7FA 3FHIB 3UL2A 3ILRA 4HKWA 4WVZA 1CWPA 4PQ9A 2GNTA 4QX5A 4U36A 4K8RB 3ZN5A 1HN1A 4CEWA 3AC0A 1EPZA 1HB4A 5C3OA 4ASMB 3MW3A 1W6MB 4QPIB 1YJLA 1POV3 4K3UA 4V2WA 3USUB 1CAXA 1AYN3 1V9U2 2W0XA 2WZR2 3CJXA 1RMU3 4CA9A 3IMNA 4BQXA 1KD7A 1GZTA 4FXGB 4QT6A 2ZX0A 3RZHA 3U78A 3BODA 2P2KA 5FZBA 3I2KA 5IATA 3JD72 5JOXA 1H30A 1NX9A 1RUC2 3O7OA 5B4XA 3ENRA 4NHYA 3LQCA 3UJQA 5E89A 4FTEA 3KF3A 3CJIB 5IUQA 3RWKX 3QD6A 4IEQA 2YUEA 4QM8A 3UT0A 1LOFA 5JXHA 1UY3A 5FXZA 3TWIA 2QBXA 2RS13 1NA1C 1ND2B 1S2EA 5A3LA 4Z8BA 2NM1A 5JR7B 4R52A 2VMFA 4INDA 2DURA 1O5LA 1HQLA 1ODNA 1QJY2 2IZWA 2EALA 2I2SA 1TME2 3N7MA 1RB8G 3PIGA 1W2OA 1YFUA 1XNCA 1DIWA 2WWSA 1WUVA 1N3PA 2WS93 4AW7A 1HB1A 2F6BA 2NYYA 2FZ1A 3R4UA 3MV11 5FO8B 3NNGA 3BTZA 2V72A 4QHOA 3VBUB 4WM8B 3AK0A 5AC93 4UAPA 2ZGTA 4IEPA 2NP0A 3N3HA 4CDQA 5LATA 5EPAA 1A8DA 3NV1A 3R6SA 1MQTB 2YG0A 1D7PM 3IDCB 3ZDSA 3OD4A 5JCTA 1DHKB 1VBA1 2BOJA 3PU3A 1VBD2 1CPMA 3WNOA 2AEYA 3HIFA 2PHFA 2BRTA 3E5UA 1X36A 5A80A 1SBEA 3GYDA 4S2FA 4K7JA 2XDVA 2MPFA 2XWBB 3Q8FA 1VBE1 2IXCA 1DP0A 3FMGA 1CAUA 4MGTA 2B9VA 3U4SA 4N90A 2WNUB 4WBBA 3JCIA 5DZGA 3JBG2 2Q4SA 2EIBA 3TEWA 5IWFA 3KHCA 2OT7A 3W20A 3WVJA 1COV3 2XJVA 1U5IA 1KDKA 4HFSA 3OSDA 5K9YA 1WW6A 3T4VA 5GZGA 3RMYA 3VBFB 1NZIA 3I97A 2GH8A 3D5OA 3TOJA 4QPGB 3ZDVA 4CPBD 4EN6B 5JAXA 1KGYA 3KT7A 5AVPA 1WW5A 1UY0A 2WQ4A 3LD8A 4QAWA 1W28A 2R072 4Q1PA 4MH0E 3PVOA 1DFQA 1JMUB 1T6BX 5HCBA 2JDPA 1HV0A 1ONAA 2BFUS 4EWAA 5I93A 5GLTA 3D8CA 5FDBA 1FXZA 2ADEA 4FP2A 4M0HA 2Q5TA 4UXAA 2YB7A 1NUKA 1PGSA 1AR63 2OZJA 1L7RA 1WKYA 2VZRA 2ZMKA 4R4XA 4C1WA 3T0DA 1CAWA 3MPBA 3KV9A 4AVSA 1QKQA 2GSYA 2QQUA 3R4SA 4XDQA 4N7UA 5DZEA 4BWOA 1FT9A 2ZA9A 1RUJ2 1BBT2 2RR12 4LBMA 1S55A 4QGMA 4P00B 5I0UA 3QCWA 4C1XA 2ZJCA 4AZZA 4H55A 3PDQA 1UOBA 4K20A 4QB1A 3T30A 3G7DA 4CXWA 1GZ9A 4X6QB 2WO2A 3AX4A 4YM1A 2E33A 4Q0SA 2QCSB 3BU0A 3D3AA 3MIHA 1NAEA 5J37A 5JLVA 3I2IA 3HNBM 2IXJA 1R093 1VMJA 4D6SA 3ALQA 3GGLA 4EWDA 2WFF3 1N1TA 1O91A 1S0DA 1AHSA 2HWB1 3IDAA 1W9YA 2H0VA 5KR7A 1VP6A 2JEMA 3MZHA 3R4DB 4M3CE 2BQPA 4B3NA 2GN7A 3VUOA 2J1AA 4ZXKA 2WABA 2DCZA 2ARXA 5F39A 3O1PA 3E6BA 5ANNA 3N7LA 3UGHA 2OKXA 2J1TA 1O59A 1CZSA 1VBB1 2A3YA 2FZ2A 3AKSA 2CWMA 2ZEZA 4XF3A 3ZPYA 3GHMA 2ZACA 3S5AA 2D3RA 4IESA 3MIEA 2FCTA 2D44A 1GZWB 1IS5A 2VAUA 2XL9A 3BALA 3LOIA 4HOOA 5LBFA 4EZ4A 1GWLA 1S0CA 4NIGA 1JYNA 2VQAA 3K2OA 3AL6A 4XIOA 1IGOA 2Y60A 4MX3A 2NZ9A 3NAPA 1ND2C 1AF9A 4PBOA 5BNNB 5GLUA 5LBCA 2GN3A 4A7YA 3WOGA 3NNJA 1XNDA 5BNNA 3A7QA 1CONA 4BYYA 3TAYA 2RJKA 1ULEA 3JQXA 1IG0A 3N9QA 5A1LA 1BZWA 2P1BA 2UWAA 4HKOA 3LIGA 4XE9A 5IK8A 3N4MA 1NA1A 3RFRA 1UU6A 3AL5A 5DG2A 3THCA 2XBO2 4I09A 2GNDA 4AEJA 4IV3C 3T0AA 3DECA 2XKPA 4OYUA 5EQUA 4D7SA 2VNRA 3B7MA 3AYDA 1BXHA 1GWKA 4YVSC 3LEIA 3CLPA 4LKEA 4EN9B 3WD5A 5K7PA 3GCXA 4W6XA 1W2TA 3ZYGA 1AXYA 3OPWA 4CCDA 3IPVA 5GZEA 1MPXA 5AVAA 4TLFA 4CU9A 2J1UA 4YVSB 1RUE3 4BA6A 4E27A 3OGSA 3GZAA 4GKXA 1SFPA 3VHRA 3ZPOA 4UFJA 1ZYBA 4B29A 1EAH1 4PJYA 4HANA 1PK6C 5JI9A 1J3QA 5JR2A 1JYCA 3S7IA 1LHUA 3VBOB 2W39A 2A6WA 1M4WA 5FK7A 1ND3A 4EQVA 1MACA 2QQJA 3M3CA 1MS3A 2DTWA 3N9LA 4DFSA 3H8OA 1UIKA 2BWAA 3T2PA 4XJ9A 4LO6B 2ZHLA 4P5YA 3AZYA 5DAQA 4ZS2A 2B4KA 1UOFA 5FZLA 4CCJA 1H9PA 1ZBA3 3O1VA 1L7LA 4NUBA 3ETQA 3VKFC 5LY1A 2QQIA 1MS0A 2JDUA 2ORXA 1DG6A 2BGOA 2VMHA 2VOKA 2X10A 3KV4A 4IQPA 3HVDA 4AHZA 2XLAA 5LY2A 4A6SA 2D97A 1AR71 2IFRA 4P5HA 1VRH1 3CU7A 3IIAA 1HRI2 3IIIA 4GALA 4XF1A 1W99A 4UFHA 3UKNA 1DGLA 1HRV1 1UY1A 4DPNA 5CISA 1OT5A 1JZ6A 1H6XA 2RM22 2F4LA 3C7FA 3ON7A 3KVBA 1A78A 1OF4A 4DUWA 4BLIA 2QQNA 1RUC1 2ORZA 4Y4YA 4Q0PA 3SHRA 3DGTA 4GIQA 2OZ6A 2K9ZA 3GXUA 1XPWA 2YU1A 3OY8B 2VW0A 1NYWA 4QB6A 5EJ1B 3VBSA 4QX0A 1AYN1 5K0UA 4ZKTB 3ZSEA 1WA6X 4JGZB 3S0MA 3CQOA 3VL9A 2ZPXA 1YCIA 5LA2A 4JGZA 1UL9A 3RI8A 1X8EA 1DGWX 3UGGA 1R083 3U14A 4EE2A 5LWBA 2AZ5A 4XZPA 4Q4V3 5A7NA 4WVMB 2WA4A 1UWWA 1F5FA 1IZ3A 2DVFA 3FWEA 1SACA 2XJTA 3HD8B 4DXSA 5JWPA 2XJUA 3HQXA 3K46A 3CNAA 1MVQA 2VTXJ 4OUEA 3DUIA 2QTWB 3A0NA 3IDEA 4PI0A 2RS32 4W6YA 5FJHA 3OYWA 3UKTA 4AYUA 1JHNA 1MVEA 4CDXC 2EXHA 4MSVA 4QX3A 3SH5A 3ZVXA 4LBKA 1OXCA 1ZX5A 2CAVA 1V6OA 5DAWA 1DQ1A 1HRI3 1H2MA 1MR5A 4ZHNA 5FY1A 5A7WB 2Y64A 3VHNA 3H3ZA 4AG4A 2XUEA 2P37A 2VTFA 4P9JA 1JZ5A 4PI2A 5D2AA 5JXJA 3NAPC 1UF2C 4AEDB 1Q8PA 2P3JA 3KVAA 4URTA 5EJZB 3AZXA 1CGPA 1NY72 1WW4A 3K4DA 3VKLA 1AR72 5K0UB 3EXUA 5FP4A 3BGAA 3S7EA 1RUJ3 1UYPA 2RR13 1QQP1 3SXWA 3T3YA 4FTBA 2C6SA 3J8F1 1WD3A 2YDEA 2GP5A 4LK6A 2JDKA 2QKDA 5F2SA 2WJSA 5FY7A 3B02A 1KJLA 1VBA3 4DINB 1UZZA 5ABJA 1J83A 2HWE2 1VR3A 2R062 3CJIA 2CWSA 1N1VA 1OUXA 1BCXA 3I2DA 3VD3A 2LW8A 4BK5A 5HBAA 1ZRCA 2XH6A 1QH6A 5BNPC 3PU8A 1UZ0A 4UFMA 2D98A 1WMEA 2BGCA 3DPRB 2GMPA 4IE7A 5FUIA 4LBQD 1HRV3 1Q43A 1IS6A 4C90A 2P6HA 3PNAA 2WZ8A 5JSPA 4HL0A 5IVVA 1XSRA 3GALA 3MDPA 4GH4C 2JG8B 3PUIA 1RJ8A 4IEXA 2J1SA 2RMU3 1C5HA 3BYWA 2HBTA 1K5MA 5E1RA 1GUIA 1B35A 2DUOA 1XU2A 2VMDA 3LPFA 3WDWA 4AAXA 1COV2 3POGA 3ZFGB 5FUNA 4N43A 4RHV1 3BCWA 1XNBA 4K40A 2O14A 4MGZE 3F2ZA 3GHNA 3JBG3 4XAEA 1REDA 5F5AA 4CCOA 5KHKA 2JDNA 1GLHA 1QHDA 4CSWA 4LK7A 4Q2FA 4XBNA 1VBB2 3V65A 2PHXA 4GA9A 1W0NA 2XHKA 4FPEA 3C7OA 4AI0A 4Y20A 3Q8CA 3I4IA 4YW5A 4RFT0 4ZU7A 1TQ5A 1TG7A 3GBWA 5A32A 4C0HA 2VUJA 2ZAHA 4N53C 1AR62 3AKTA 3LZZA 3ZYJB 4OFGA 1YWKA 5FTTC 5T55A 2VQ0A 1QJU3 3KT4A 4XMIA 3B01A 2RV9A 1O5UA 2X5IB 3EO6A 4P9YA 5FIXA 3GNEA 1Y9GA 3WT3A 2QFEA 5D8AA 3DPRA 3ACFA 3ES4A 1ZM1A 3IPVB 5KXBA 2VPVA 4D6QA 4E8DA 4ISQA 2WS92 1QJY1 1TME1 2ZHNA 4RQPC 4BDVB 1DQ0A 1OLMA 1S2KA 3RYRA 1XRUA 3V0BA 3J26N 3N9MA 4G4FA 4COVA 3BUCA 2RVAA 3KHBA 2WUHA 4RGAA 4BCUA 1OF3A 2EVXA 4B4RA 1QJY3 1TME3 3FUOA 3LCPA 3OUHA 4UI9L 2JDZA 4KBZA 3E97A 1KFUL 2OVUA 1MEC1 4KG0A 4R9BA 4EWEA 4DXTA 1E5RA 2FD8A 2VVEA 3O1TA 1Z7S1 4Q4Y3 3S57A 4Q4X1 4QB2A 1ZREA 2WINB 1FOD1 2X8KA 4ZS3A 5LRRA 3P1IA 5GLZA 3HQRA 4MUVA 1NA1B 2ES3A 3TBDA 1RVF2 1K45A 1N1YA 1AYM2 1A34A 5F6KA 4JGZC 4XZUG 3WF1A 5JIAA 2A75A 1E5HA 1R092 1SCRA 1ZBA1 4GWMA 1BK0A 2WSVA 5GLWA 4W4ZA 3T1MA 4FCAA 1PM7A 1PO13 2L9LA 4AHYA 1PGW2 3M3QA 2VBPA 4PLMA 2VNGA 1U5XA 1GP4A 4M4RA 3H7JA 4KBBA 4OHZA 1HJFA 3GJBA 1AYN2 1VBC3 1ULCA 1ULPA 4NN0A 5FZ0A 4XUTA 2E7QA 2HWD1 4KWLA 3V0BB 1J59A 4BHPA 5DDJ1 4EN7B 1ASJ2 1OD3A 2JICA 1IQAA 3J4UH 5FZ4A 5J3UA 1LHWA 1R1A3 4YW6A 5GZFA 1J84A 1S1AA 1KITA 2LUWA 3MIBA 4TWTA 4XEZA 4B7EA 4V1PA 1ZZ8A 2HJIA 5FMBA 4LUKA 3AYEA 4AEDC 3PUHA 3VBSB 3P3NA 3H1MA 4PCRA 4GWJA 5F8PA 2VH9A 3NNFA 4CRQA 4TTGA 4FT8A 1CAVB 4IERA 5E88A 2Q1ZB 1VLNA 2G9ZA 4QPIC 3LB9A 4W50A 2LM3A 4ZZ8A 4D7YA 2HBUA 5IT6A 4WM7A 2CL2A 2VMGA 3IAQA 3BKZA 2JD4A 3W58A 1FATA 2BVVA 1KDMA 4QDSA 2A73B 2RS11 4UYBA 1TMF3 1Q8SA 3SEEA 5FO7B 3IWZA 3Q8AA 1EUTA 1W90A 2WLQA 5FPLA 5FZ3A 5A6XA 4X6RB 4LE4A 5L36A 3LDKA 3SC7X 4XYXA 3ZXGA 4LJHA 1RMU1 4YFZA 4QQOA 1KFXL 4SLIA 4K1YA 3OEAA 5IAVA 2XPJA 2DF7A 1OVPA 4QDQA 1WA4A 1PZ9A 1AR61 4KL1A 3ZYBA 5JMOA 4N9HA 4JKKA 2VGDA 2GZWA 4KI5M 2HEYF 5GLVA 1LGNA 3EQEA 1YI9A 1G8WA 4IV3A 5LA1A 4E4ZA 3H3LA 2VZ3A 1TE1B 1ZZBA 2QJVA 1LHNA 4COUA 3H8XA 2DVBA 4A45A 4YM2A 3NJVA 4YW7A 4UW5A 4ARXA 1OSGA 1SDDB 4Q4Y2 4IXLA 4L97A 4SBVA 5FZKA 5FZIA 4CP9B 5C8CB 4AL9A 1CAUB 3ACIA 2HH9A 1YLLA 2WL1A 2WS91 2FDGA 1H4HA 3AP9A 5FLIA 4EROA 2A71A 2Y38A 4QKFA 1ND2A 2JD9A 5EZWA 1GYKA 2BERA 1QJEA 1US3A 5JOZA 5FY4A 1EP0A 1YI7A 4E9KA 2JG8A 2HLEA 5AC91 4NROA 4CDWC 1QIQA 2GC0A 3FBMA 5CYYA 1O3TA 1SMVA 4ORFA 1UO9A 2WYSA 3ZFGA 2LS6A 4LLFA 1RJ7A 1RUC3 3TNPB 2G9FA 1R081 3LSEA 4COWA 3WV6A 5JDBA 4HVOA 4LKDA 3BB6A 4OQ9A 1HV1A 1JOPA 3PURA 2ZEWA 1QJU2 2EF6A 4OHWA 3SITA 5BNOC 4NIHA 1MS8A 3AFKA 1XB9A 1QXRA 2YC4A 4IL7A 2YV8A 1E5IA 2JE8A 4CEYB 3AM2A 4FOWA 5KBFA 2FHRA 5DAXA 2SLIA 2D3SA 1VB2A 2DFBA 2WBKA 1ASJ3 3EYPA 1CESA 2XUMA 1C4RA 1OLQA 2A6VA 3M7AA 4I2OA 1UXXX 1E5SA 2CSGA 4FFHA 4XETA 3H8UA 1PZ8A 1ULOA 2W95A 3WF0A 1H8TB 5IVYA 5BUVA 1PMIA 5BY5A 3H1WA 1LOAA 4HMZA 1W6NB 3LOBA 1P8JA 3VD4A 3AP7A 4QPGA 4COZA 3TN93 3KD4A 4YLZA 1H6YA 1R091 5FLJA 4L2NA 2Q8OA 4BZ4A 2XMLA 3AZZA 4MGQA 4PHZA 4OUSA 3O1RA 1GR3A 2CNAA 4B1MA 1EV11 1F9KA 2D40A 2E7TA 1AUYA 4LBOA 4FQZA 1YO8A 3HT1A 4ZU5A 3WLUA 4Q4Y1 1AYM3 2XLGA 2P5BA 3MBWA 1OA3A 3I2OA 1RVF3 5LA9A 3VD9A 1CIWA 2RS52 2WNVC 4XFHA 4NO4A 1T6GC 4LOSA 1IKPA 2F17A 2XQXA 3S30A 2WDBA 4Y1YA 3LF7A 5FY8A 4WVMA 1VBD1 4YYOA 1H2KA 5D21A 1QU0A 1XE8A 5FZDA 5APAA 1JOBA 2DTYA 2OQ6A 1I5ZA 2I74A 5K4LA 3AMNA 5HCFA 2ZX2A 2Y6GA 3QH7A 4E2SA 1IOAA 1D4M2 1PGL2 3WDUA 1K5JA 1OA4A 2A5ZA 2R32A 4Q0VA 5BYNA 3MUY1 2HWC1 1OQ1A 4CDWA 1SZBA 1U12A 3AKRA 3DEMA 1YFYA 4NHMA 4LT5A 1I5PA 1VBC2 3I2HA 5D8AC 3WNMA 3MICA 1RUF1 3ACGA 4LO8A 4IW3A 4XCAA 3WP3A 5FP7A 5I0RA 1J1TA 1RUI2 1NCQA 3AP4A 1UU4A 5DN2A 1PO12 3VN4A 1JH5A 4QPWA 4TSVA 1W6PB 4DEVA 4PIYA 2CHHA 2BGPA 3WSOA 1G6NA 5C9AA 4L92A 4GMP3 2VBDA 4IV1B 2R7EB 2VUDA 3HOBA 2Z42A 2ZX3A 1VBB3 2BZDA 3H0OA 4GMP1 4H7MA 5KC5A 5DAVA 4A42A 3VBUC 3H50A 1J1LA 1F15A 1Z78A 2YXSA 1QOSA 1ZZ7A 1W6OA 3LA3A 1RUF2 5T50A 2VZ1A 3JD71 3ELNA 5FRAA 4AEKA 3O1UA 1AVBA 2YYOA 1V6LA 5CA6A 5L9VA 4UFKA 1ENXA 2X05A 4AR2A 1XNTA 1HKDA 2ZZQA 4QPYA 1RUD3 1ULGA 1YEWA 2UYBA 4XQ4A 3WG1A 3B00A 1RUE1 1POV1 2YMZA 3MO4A 3PVEA 2W1UA 3ZM8A 4H2AA 5IVCA 5H9RA 1BBT1 5A7QA 2VZUA 4ZZ5A 3PJQA 5DDJ2 4QQPA 1WBLA 1B35B 2BUKA 2VXRA 4BMBA 4IEWA 3WXPA 4GQ7A 4TYSA 2VZTA 3RWNA 3THTA 3NWKA 5LBBA 1JYXA 3USSA 1K42A 1OBNA 3INAA 4QXHA 3LAGA 2WZEA 5FY0A 2IXLA 1AXKA 2CTVA 1HW5A 1H8VA 1ZZCA 2RE9A 1C57A 1OQEA 3VDDC 3J7HA 2ADDA 1QOOA 3IAPA 2XJQA 3OJBA 4NHLA 2R6QA 4OI4A 1H4GA 1ZBA2 4PF5A 1GKBA 4LHNA 3FZ3A 1VB4A 1AX1A 2NQYA 4HLTA 1RIRA 4YZ5A 4AI9A 5IHRA 3H3UA 4OHXA 3ZYFA 2R30A 2JENA 4PLOA 1KRIA 2ID4A
chains in the Genus database with same CATH topology
4YARA 2MHFA 3OGJA 1MS1A 1JUHA 3VKNA 3ZSJA 4YG0A 1HRV2 1Q56A 1R1A1 3WX5A 4HVQA 3WDXA 1CD3G 2VG9A 4CDXA 2RS33 2RS51 4MYEA 2R063 1HXS1 1YFWA 2JJ6A 2A6ZA 3J8F3 2HWE3 5T5JA 4CTEA 3BU7A 3KSCA 2CGPA 2C5DA 5FOJB 3U4XA 1FPN1 1FV2A 4P9XA 1UW8A 5SV5A 2VOWA 3X29B 1C28A 1SBDA 5FPXA 2DVDA 4XHXA 2CAUA 2EAKA 2YPJA 5AFEA 4FPGA 3RI9A 2O1QA 2IWGB 1AR73 2XLFA 2I07B 1C5IA 4MGYE 2XBO3 5C8CC 1BJQA 2JXAA 4AQSA 1LTEA 1RUD1 2ERFA 1NCRA 1AR92 2RHPA 3VLBB 1IS4A 2SBAA 4B4PA 2VULA 1WGPA 4KU7A 4AFAA 3IKWA 1FV3A 5A33A 1V70A 1H0BA 3ZN6B 3VDDA 2PHUA 2GC3A 1G9AA 3DF0A 4Q4W1 1O4TA 1SCSA 4I0AA 5JPNB 1VAMA 2UWCA 4Q4V2 1VIWB 1XYNA 1R082 2E7AA 4FPJA 2A3XA 1JTZX 1WCDJ 1BK1A 1OPOA 1EY2A 4EV0A 1S0JA 2YZ4A 5KC6A 3ES1A 3WNXA 4S2DA 4FP3A 1WCKA 1TEIA 3WDYA 2PQQA 1QGLA 3VZLA 1RUE2 3O12A 2FQPA 3ZMOA 1ENSA 3ZN4A 1QY4A 5BNOB 2DUPA 4MGIE 4GH4A 2R0HA 3PHMA 4Z07A 1KQRA 1PVC1 5F6LB 1FOD2 2ZAAA 5J48A 2OPKA 2AENA 4LR4A 3V0AB 1KXGA 2H6BA 3ZXKA 5FQ0A 5H9SA 2XB6C 4XFBA 3VBUA 3MGUA 2EAAA 4HK9A 4CDQB 2I45A 1BMV1 2KXLA 1UX6A 4LO4B 1AJKA 4HT1T 4MGKE 1UU5A 3NVCA 1S2BA 3KQRA 2WT1A 3E5XA 4OHVA 4ATFA 4MV2A 4GXLA 2CY6A 2YGLA 3LWCA 4L8QA 5I0TA 4NWWA 2JG9C 5DDJ3 2BBVA 1LECA 2RMU1 4AWDA 3EBRA 3JU9A 4FPHA 3TN91 5D8AB 1SLCA 1PVXA 4N53B 1CR7A 2WNVB 1XE7A 4RHV3 3WUCA 3DL3A 3VBFA 1D4VB 4XFAA 4YSFA 4M3CA 4NR1A 4M0NA 3UV9A 2GAUA 3R0RA 4M3CB 4HK8A 4AFMA 2QVSB 2WZPP 5TSWA 1GNZA 3WQ0A 4Q4X3 4AGVA 1FAYA 1LULA 3E6DA 2UY9A 2A70A 5HI0A 3PTYA 4Y20B 5A32B 3NV4A 3IN9A 1G9DA 1V6IA 1PNFA 2DCKA 3FUQA 4PDWA 2OUHA 5JIUA 5KHJA 4OULA 2IXIA 3ZXAC 4HPKB 4JVAA 1FNYA 3VZNA 1QXJA 1J58A 2WFPA 1KS4A 1RUI3 1QMJA 5BXXA 1XYPA 1VBC1 4FPKA 5GZDA 2QNKA 4P9IA 3GF6A 1UIJA 4I3PA 2JE9A 2EXIA 3AKQA 1RUI1 2Z2SB 4XJWA 1QQP3 4CDUA 3RSJA 1YNAA 1D4M3 5CFDB 5SV8A 3M8LA 3KT1A 4Y1ZA 4KGGA 1NLRA 1WMDA 3ZSLA 1ENQA 3AP5A 4Y1UA 5CFCA 5FO9B 3PLQA 3SH4A 4JRLA 3MLKA 3APBA 3VKOA 2V73A 4XW3A 1KJRA 3J9SA 4A7ZA 2IFWA 2Z5WA 2JG9A 1WLWA 3VHPA 1SDWA 2PAMA 5J96B 2XBO1 4KWKA 1SFYA 4P9WA 2FBEA 4S2GA 4DZGA 2UURA 3ZYRA 3O0XA 1G9CA 3ZO0B 3WW4A 4U2AA 2XKOA 1SLLA 2Q30A 4XJZA 3O5SA 4YGCA 4XQDA 5F9TA 3WQ1A 1QF3A 5E8AA 5C4WB 3CJIC 2VVFA 4KH9A 4JTOA 1BBT3 3FC0A 3ZFEA 3ZN6A 1LESA 2WKKA 4K9SA 2E9QA 4AI1A 2VVDA 3AXDA 5T5OA 3TB0A 1QXPA 3AZVA 4R8HA 5GM0A 2MNGA 3VBHC 4YVWA 4WM7B 1BEV2 1JXNA 3ACLA 2D6KA 4AK3A 4UW4A 4YM0A 1LODA 2K2SA 4C0BA 4YNIA 3KGZA 4XF4A 1H9WA 1RUG2 3FBYA 1CPNA 1FYUA 4AHWA 1LHVA 4FVVA 2R0FA 3Q9OA 1Z7S3 4LLOA 1C8M3 4WM7C 4BPZA 4JDOA 1TNRA 2RS12 5EFUA 2HWE1 4UW3A 4H14A 4AFCA 2EXJA 1AX0A 1RHI2 4P9LA 2BFUL 3USUA 4BIFA 2BNMA 2C1FA 1RGSA 1MS4A 3MLJA 1J3PA 3DN7A 1UZYA 2G9GA 1VBD3 1RUG1 4Z2WA 4EJRA 4YG6A 1C8M2 3PMSA 2B45X 4XJAA 3AZWA 4Y24A 4R4ZA 1APNA 3HMYA 1NCRC 2R1DA 2YC0A 4RS5B 5I8SA 3N7JA 1DLLA 1VALA 5DG1A 1W6QB 2HEVF 2O8OA 3NSTA 4K1ZA 4RS5A 1BEV3 2CGNA 1W0OA 1PO21 2ZMNA 4B7KA 2B46X 3QH6A 3D82A 1LRHA 5FPZA 4L11A 4KG8A 1V9U1 5IK4A 3I59B 3M3IA 2AGSA 1CJPA 3OPZA 1LENA 3I59A 1LOCA 5JOYA 2UU8A 1KS5A 1I6XA 1GICA 1WD4A 4GH4B 3AP6A 4DXZA 3MIGA 2JKBA 4D7TA 4LBJA 1OMIA 3W9AA 3PJYA 4N43B 4AEMA 4BE3A 3KS7A 4YZ1A 2X53S 3JD73 1YXWA 3BOWA 4JQRA 4Q0UA 3S6PA 3TYJA 3HWJA 4X8PA 5T3NA 1HQNA 4XJ8A 3ZSMA 3SMHA 3NV2A 4LE3A 2W68A 1R1A2 4G3YC 4MZUA 3RYKA 1CJDA 1DYPA 3VBHA 4FPFA 2X5IA 2MEV2 4J1XA 1F2NA 1C8M1 1N3OA 1IPJA 2XL7A 3BPZA 1EV13 3O0WA 4RSUA 5EXOA 4N53A 2P34A 4DB5A 4Z1VA 3R05A 1HX6A 1I3HA 4AGRA 1N47A 2TUNA 2GC1A 2XVLA 3ME2A 1O7FA 2A3WA 3OF1A 2NMNA 1HLCA 2ZGMA 4QGLA 1DZQA 1U5YA 3VBRC 4YZ3A 2ZMLA 4I01A 1ZZ9A 3CO2A 4HKLA 2R042 3AFGA 1EAH2 2GDFA 1W2UA 4AQTA 4AXOA 2TNFA 1AL22 3N7KA 1D0GA 1WBFA 4YW3A 3T2TA 2OIIA 4DNYA 3AYAA 4HPKA 5ACA2 1W0PA 3AMPA 3RNSA 3M2MA 2DVAA 3WW2A 4DY3A 1LR5A 2WC2A 3AMQA 4QQHA 2VUAA 2XVGA 3ZFFC 2QUOA 4F83A 4FPYA 1OFSA 4R9CA 3BIWE 1RITA 5E16A 1SQ4A 2ZGRA 5L7OA 2ETEA 4JC1A 4E2GA 5CFCC 5CFDC 2PLV2 4YG3A 4AEDA 4CZSA 1WLTA 2ZGNA 5FQ0B 3ZFEB 2XG3A 4L9BA 3WCSA 3ZX7A 5C6CA 2VW2A 3AYCA 2ZGKA 3ROUA 2B42B 1CAVA 1NY71 1JBCA 2AH2A 2RJLA 2X5IC 4FPOB 5DXDA 3MLLA 1PNGA 4W65A 3H1YA 4XIKA 3ZIXA 4JGYC 5I91A 2XJPA 3ZMNA 4A2UA 4QD2A 5AFBA 1AX2A 1FMD1 1D4M1 5J36A 3WG4A 4CDWB 2VU9A 4HZFA 5LK5A 4HETA 1D2QA 1NE6A 5JSOA 3WR0A 1FOD3 5CBLA 5LEKA 2O8QA 1E57A 1VBA2 2PAEA 4NWVA 4AI8A 2PFWA 3WW1A 5KHIA 4BOWA 4MVTA 1PO11 5BNPB 2DUQA 1I9RA 2NMOA 5CAZA 3NJZA 1AXZA 5JSRA 2BVBA 3NKGA 3NO8A 1BEV1 2AR6A 1QWRA 5JOWA 2JG8C 3QLQA 4Y5Z0 3RMXA 2A6YA 2ZX1A 3ZXDA 3POSA 1QJX2 2E53A 2ZGPA 3NL1A 1G7YA 4Y1XA 2VMIA 2PHWA 4AE2A 1MS9A 1YYNA 1UKGA 4Q29A 2QDNA 3VZKA 4XFCA 1FPN3 1OOPA 1RUNA 1H1AA 4QGNA 2HWF2 2R49A 5A33B 1WLCA 1RC6A 1ZBE2 1DQ4A 3RDIA 4J1WA 3RQ0A 3FX3A 4K6BA 2Y26A 3M3OA 3ASIA 1VBE3 1LGBA 1PK6A 3B3QE 4KU8A 3KCCA 1DZRA 3PMEA 3JUUA 1SLAA 1IPKA 4MXVA 2FMYA 4LBNA 4Q0QA 4OUMA 3GZTB 5JMCA 1W6QA 5BV6A 1PO22 1MEC3 1URXA 1YJKA 1ZBE1 3OD0A 1FMD3 2GMEA 2Z79A 1AJOA 4FAGA 4HN0A 4AVAA 4OI2A 1XYOA 3K48A 1LOFC 2WSUA 4YW2A 1I1EA 1PVC3 1ZVFA 4X8NA 3VZJA 1R1ZA 2HWF3 3ATGA 3W59A 2WA3A 4XF9A 1W6MA 4QPIA 1IHMA 2LALA 5H9QA 1OHFA 4FBFA 4ATEA 2K0GA 4GB31 1OFNA 1OD5A 1ND3B 2HWB2 3UK9A 4AVCA 1UKRA 2JX9A 4ASLA 5EWSA 1LGCA 3O14A 2QQPA 2HWD3 2PTMA 3EJKA 1NCQC 3WQ7A 2HWD2 5JI7A 1Q5OA 1DGRN 1NOVA 3BTAA 4XXPA 5J7MA 2HWB3 2TEPA 5F5QA 3UJOA 2GC2A 1F5JA 3JQWA 5C8CA 3ZXFA 4I0BA 1ZRFA 5CU1A 1SLIA 3B94A 1S0EA 3OBTA 1YRZA 3L2HA 1YFXA 1H8TA 2G4IA 1NQDA 1ALYA 2D5HA 2PLV3 4PBPA 4AI2A 4AGGA 2AUYA 3WW3A 3IDBB 2PHTA 4FPCA 3MF9A 1PO23 4AQ2A 4XF0A 3N35A 4CDUC 1BKZA 4RR3C 1OA2A 1ASJ1 4QQ2A 2ILMA 5I0SA 1JOJA 3HAGA 1GV9A 1AR83 1UAIA 1DGRA 2ZKNA 5H9PA 4JGYA 4NPRA 3P3PA 4R9AA 1W6OB 3A4UA 4LEJA 5C4WC 3LGRA 4QXKA 4UW6A 3RRDA 4A7KA 1ZBE3 5F1RA 2VW1A 4RR3B 4F8AA 2R043 4XFIA 1MZ6A 2JE7A 2H6CA 2B9UA 1X33A 4IETA 5KWRA 2D93A 3LA7A 4YGDA 3TRSB 1AL0G 1RVF1 5B2GB 4OI0A 3B69A 1Y3TA 3ZFFB 1CX4A 2HWF1 5CFDA 4H7LA 4I30A 4P14A 3QACA 1SLTA 1U0AA 3OTFA 5CFCB 5J09A 4P9GA 4ES9A 4ZU4A 2H0BA 1FNZA 3M4FA 2HWC2 4YZ2A 2BEOA 4MXWB 1Q8OA 4META 1QJX1 4KNCA 5ACA3 3ILNA 1LU1A 4DY5A 1VRH2 2V09A 1B35C 4JDNA 1AL23 3SCGA 5K8SA 1N3QA 4GULA 1EAH3 1DYKA 4I0WB 5JZGC 1DBNA 2RS53 5CVRA 4PIXA 2ET7A 1PIV3 1XQNA 3JB4C 1H1MA 3JB8A 3C2UA 4CYDA 1PIV1 2DV9A 2VECA 3AMMA 4Q26A 1WMFA 1NG0A 3RPQA 1QJZA 3KGLA 4LTAA 4E2QA 1JUIA 4CP2A 1RUH2 1K5MC 5C9AC 5IK7A 3E6CC 2QE3A 2ZX4A 1NLSA 4Q4W2 5BNNC 2ZS6B 1S0BA 1F8VA 2MEV1 5BNPA 2YGMA 1QDCA 3ZYIB 2NPIA 2DCJA 5CADA 2R073 5EJ3A 4KGQA 1LEDA 4WM8C 3DKWA 2WIIB 1ZA4A 2D6NA 5T5PA 3ILFA 1NQJA 5DUUA 2UWBA 1UPSA 4QU2A 1YUDA 3G6JB 3RG0A 2BW8A 1LJ7A 4BQ1A 1H2LA 3GBFA 1LCLA 1RHI3 2WT2A 4XFGA 5L7OB 2GNBA 1AYM1 2E6VA 2ZKLA 4YW1A 4D3WA 1A3KA 1A8MA 5BPXA 2WLPA 2WNEA 2B39A 2D6LX 5EV7A 1PGL1 5K0UC 2TBVA 4AF9A 1Z0HA 1V6KA 4QPGC 3IBMA 3MW4A 1LOGA 1W39A 1DQ2A 3B9CA 4LA3A 4D69A 1XNKA 2OYZA 4NVPA 3M1HA 2Q1MA 4IEUA 4IEZA 4Z82A 3WP6A 4CEWC 4F3JA 5J98B 3OYWB 2ZGQA 3RZZA 3U10A 3FFQA 1C1LA 3I54A 3WDVA 4Q8LA 1OOPB 4OI1A 5BNOA 5DUXA 4GB32 2CYFA 4RD7A 1BVP1 4XTMA 4C91A 2D43A 2E51A 3ZFGC 3CL1A 2GNMA 1GNHA 2BYVE 3V56A 4IV1C 4O9EA 3KMHA 1CAXB 1ND3C 1TMF2 1GQGA 2NN8A 3WHTA 4XXAA 4IV3B 3ST7A 3WUDA 1VAKA 2ZGLA 1V9U3 4E4DX 2VOXA 4TZDA 3POWA 2Y0IA 2D6OX 1ULDA 2DCYA 4YM3A 1OKQA 1QOTA 1D0HA 2VNOA 5KHGA 1PHMA 1V6NA 4E4SA 5A3MA 4AI3A 1RUH1 2JECA 3E5QA 3FLTA 5FCCA 1Y7BA 4Q4W3 1BQPA 5CG8A 1QJU1 1ENRA 5C8WA 2OW4A 1RUH3 2IXKA 1BYHA 4XHBA 1DQ5A 2O0OA 3GZUC 4HVRA 3VV1A 2BPA2 5KXEA 5C33A 4AFBA 2EXKA 1SEFA 3EHKA 4AVTA 4RQPB 2ZOEB 1YIFA 1G86A 5FFOC 3MIDA 1LOEA 5L19A 1MZ5A 3CEWA 3M3EA 2VOVA 1AL21 1O3QA 3WP4A 1XU1A 1HXS3 3VBHB 4BH9A 2IXHA 4CEYA 2A7AA 2DCTA 5KXCA 2RR11 1RUJ1 3SNMA 1NE4A 1QH7A 1Y9QA 2Y0OA 4Y22A 4ITCA 3LKJA 4GB33 2BTVC 4Q4X2 1DU3D 1LU2A 3WG2A 4GKYA 5DZFA 1YIPA 2HKXA 2QZ2A 2D6PA 1SLBA 1W6NA 5CNAA 3U0ZA 3ZFFA 2PLV1 4FAHA 1RUG3 3GBGA 3ZYPA 1QQP2 4BMEA 1DGWA 4W6WA 5DUWA 1HQWA 4N7IA 4DS0A 4IEVA 3KB5A 1HIXA 1NXMA 1G9FA 5LRSA 1S0GA 3WG3A 2NLRA 4XTPA 2KM2A 2X29A 3FLRA 4XMAA 4XPVA 5FOBB 4Y22B 2DU1A 2DYCA 3JZVA 2WNUA 4RA0A 1RINA 1ZNPA 3WZ1A 2WNVA 3FLPA 3UKVA 3KCYA 1GZWA 4KQ7A 2ZZJA 1PIV2 4FOVA 4UBGA 3B9IA 1K5MB 3SH3A 2RMU2 5C9AB 4Y26A 3RJ2X 1X7NA 3VBOC 3D4KA 3MFCA 2DWRA 1F31A 4JRAA 5EYYA 3URFA 4Q27A 3DPRC 4WV8A 3HBZA 4YZ4A 4UBHA 4WVWA 2HWC3 5HXVA 5ABJB 3ZXEA 3U07A 5GZCA 2ZABA 2ENRA 2GU9A 3VZMA 5IK5A 4OHYA 1EPWA 2R1BA 1SBFA 1ZRDA 1FX5A 1POV0 2XGXA 5L7OC 4FPLA 3SCHA 2PHDA 4BM8A 4N43C 4HSJA 2A6XA 1NCQB 2B5HA 4M00A 4JDMA 1ZRRA 4NOTA 2W08A 3L2YA 1PVC2 5FBZA 4LBLA 2UYAA 4M3CF 2XJRA 1UMZA 3IT8A 4PIZA 3D0JA 1AR93 1REEA 4LHLA 5I8YA 1VRH3 2PN5A 4IEYA 4XBQA 1SFNA 3MPPG 2PHLA 2WFF1 4AHXA 5FAXA 3VBRB 4XOGA 3V64A 3DV8A 2RS31 3FFZA 4RS5C 4PDWB 4FSJA 2ZGUA 1JYIA 1O4YA 2Z69A 4OLLA 2BNOA 2XVKA 4N9IA 2DU0A 1LB2A 5I8TA 2E63A 2ZGSA 3NV3A 4K21A 1V6MA 3KZ4C 3ZIWA 2HEWF 1MS5A 4I3GA 4HN1A 3H7YA 1GFF2 3TNQA 4B4QA 1VBE2 2GALA 1Y43B 3AB0A 4FTSA 4YVSA 1NCRB 2WT0A 4RHV2 3VHOA 4CDUB 3NKTA 1QNWA 4XILA 4NHKA 4S2HA 3A0KA 2RM21 3NAPB 4CEYC 3AXEA 3AJYA 3I8TA 4YFWA 1TMF1 2RM23 5D1IA 4CEWB 3MI8A 1WLDA 5FMOL 4DRVA 4EN8B 1AR82 2PYTA 5LK7B 1DDLA 4JTNA 2KA3A 3H9AA 4WM8A 1H1IA 3IM0A 1C1FA 2ZHMA 2ZTNA 4BLJA 3M70A 3SCFA 4YRDA 4QM9A 3VGIA 1RHI1 1RL3A 3WINE 4L99A 2ZCWA 3CF6E 2Q0AA 4LBQA 3SISA 1LEMA 1WCSA 1UCXA 3ZXLA 4K8FA 1L3JA 3VBSC 3ZFEC 3AKPA 4YGBA 4I02A 5T52A 3HT2A 4QQLA 4D94A 1FMD2 3VDDB 4AVVA 1B09A 2PELA 3C3VA 1MEC2 3NW4A 3QBQA 4LO7A 3MF6A 3SLIA 3MIFA 1TNFA 1OLRA 2CV6A 5KHHA 1O3RA 2UY8A 3K51A 1FI2A 1IKQA 4OVEA 2YY1A 1RUD2 2ZHKA 2YHJA 1Q3EA 2IC1A 3WHUA 3OCPA 1S0FA 4XJUA 4H3WA 3B5LB 3VL8A 1RUF3 4FO9A 1DF0A 2PAKA 3QOPA 3ZSKA 4XQWA 5T5LA 4WVVA 4LNVA 1UN1A 3MEPA 3MYXA 1OOPC 1Q8VA 4XFFA 1BVVA 1FPN2 4LULA 3I7DA 2PHRA 4Q4V1 1VAVA 4F7ZA 3RJRA 5DUVA 3VKMA 3KM5A 3KCXA 1YHFA 2YROA 1QNYA 4Y1VA 3U11A 4AFDA 2BWCA 1COV1 1GQHA 3OY8A 4FQ4A 3V0AA 3FE5A 1VJ2A 2WQZC 3PVBB 4RQPA 2C9AA 4RGGA 2PA7A 3POYA 2AYHA 4M01A 1MQTA 3THPA 4HBNA 4YVWC 5CG9A 4DMIA 1NZCA 4OZXA 4B8EA 4FOYA 1PGW1 1GANA 1OQDA 3ECQA 3BOPA 1A6CA 1Q8QA 4RR3A 3J8F2 4JGYB 1J3RA 4AQ6A 2WNUC 4JAAA 1ULFA 4Q8KA 5JPMB 1CN1A 2F4PA 2WFF2 4LA2A 4CP1A 2DVGA 3PVNA 3D0SA 2C0ZA 4LO5B 5CIRA 3WY6A 4DQAA 2DFCA 2D5FA 5JZGB 1JW6A 1RUOA 3L9JT 1LHOA 4Q1RA 1QJX3 5ACA1 3HN1A 1ZZ6A 2BNNA 1DZTA 5LEJA 4LHKA 1NXD1 1LKNA 2QDRA 4PLNA 2ZGOA 5JVVA 2P3IA 4R9DA 2LTNA 2MEV3 1GSLA 3RYPA 1RTVA 3B93A 5FREA 2ZBJA 1V6JA 2R071 3KLSA 4GWNA 1OPMA 3D6EA 4GMP0 1UPIA 1CAWB 4O9GA 1D2SA 4HSLA 2CGOA 2D6MA 5ABJC 4G9SB 1WW7A 3ZXJA 2R061 2P17A 1DQ6A 4JV4A 3N36A 3LSDA 1UD1A 1PZ7A 5GALA 2AREA 3WCRA 2ARBA 1GBGA