3EQEA

Crystal structure of the yubc protein from bacillus subtilis. northeast structural genomics consortium target sr112.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
SHMELYECIQDIFGGLKNPSVKDLATSLKQIPNAAKLSQPYIKEPDQYAYGRNAIYRNNELEIIVINIPPNKETTVHDHGQSIGCAMVLEGKLLNSIYRSTGEHAELSNSYFVHEGECLISTKGLIHKMSNPTSERMVSLHVYSPPLEDMTVFEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative cystein dioxygenase
publication title Crystal structure of the YubC protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
total genus 26
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3eqeA00
3FFQA 2IXLA 1YFUA 4IEUA 4XF3A 2BGCA 3RYPA 3B02A 4BYYA 2H0VA 3GYDA 4HMZA 1YFXA 1CAWA 5FPXA 4Q0PA 4AVBA 4HVOA 4IETA 1RGSA 3WW3A 1FI2A 3H8UA 4D7TA 3NW4A 3EHKA 1CAXA 1ZRDA 3E5XA 4XF1A 4FT8A 3OF1A 3WW4A 5FQ0A 3RDIA 4LTAA 3PVBB 4AQ2A 3E5QA 4LEJA 1I6XA 1QXJA 1ZNPA 4QXKA 1SQ4A 4L2NA 2D40A 1YFWA 5I8YA 2HJIA 3EJKA 3H7YA 4AVAA 3LA7A 5BPXA 4QGLA 2GC2A 3KGZA 2B5HA 5J48A 1QY4A 1GQGA 1U12A 2D5FA 4QM9A 3UKNA 2EAAA 5KHIA 4QMAA 2FQPA 4LULA 1UD1A 3SMHA 1UCXA 1CGPA 2BNNA 4JTNA 1OFNA 5BXXA 5EFUA 1IPJA 4IERA 4N9IA 4PIZA 4J1WA 3HIFA 2IXJA 4LLOA 2CAVA 2V09A 3M3IA 2CAUA 5JSRA 4B29A 3GBFA 4XFAA 3U0ZA 3BPZA 3CO2A 4XFFA 4D7SA 4IEXA 2DCTA 5JSPA 3IDCB 1ZRFA 2VECA 3KSCA 2UY8A 5FLIA 2PFWA 3ES4A 1YUDA 5J7MA 5AVPA 1UIJA 3FZ3A 4Z82A 2ET1A 4L11A 4KWJA 3KMHA 4HLTA 4MGKE 1O3SA 3LZZA 5KHGA 4XEZA 1OD5A 5CADA 1X8MA 1WGPA 2PHDA 1PM7A 2Q1ZB 1CAWB 4I0BA 4A2UA 1VP6A 3CL1A 2HKXA 4XFCA 1XE8A 3NJZA 2Q4SA 2XGXA 1J3QA 3CF6E 5C8WA 1HW5A 3RZZA 2QDRA 3S7IA 3U10A 3BCWA 3RPQA 1RC6A 4MGIE 1OMIA 3BB6A 3H1WA 4PIYA 3PLQA 3I59A 5LEKA 5I0UA 2XLAA 1ZRRA 4IEOA 5BY5A 5I93A 1Q3EA 2Q30A 3OCPA 3MYXA 4AQ6A 4IEYA 3PNAA 4ZU4A 1LKNA 3SCFA 3ES1A 2F4PA 1ZZBA 3FHIB 4XFBA 1DGRA 3H9AA 5FDBA 2GC1A 4HZFA 2UYBA 5I8SA 2OZJA 3M70A 3H1YA 3OGJA 4JVAA 1RL3A 1CAUB 1V70A 3CJXA 3SCHA 3SCGA 2P17A 1RTVA 3UKTA 1EY2A 4MGZE 4EV0A 1ZX5A 3MPBA 1ZZ8A 1Y9QA 5I0TA 5J3UA 2QJVA 5I91A 3FJSA 4HVQA 2Z69A 3U11A 2GC0A 1O4TA 4LA3A 1J59A 5F1RA 4LUMA 4KWLA 3OTFA 3VHRA 2XLGA 3H7JA 1SEFA 4META 1YLLA 1LRHA 3DV8A 4I0AA 5C6CA 4ONUA 3ELNA 2K9ZA 4Q0SA 1NZCA 2C0ZA 4E2GA 1OI6A 3IIAA 3KCCA 3IDBB 2GH2A 1DGWA 3EBRA 3WW2A 3JZVA 4UXAA 1CAVA 5I0RA 4UBHA 2D93A 4F8AA 3E97A 1H1MA 3QOPA 2ETEA 1ZZ7A 3G7DA 4I2OA 2OA2A 3ETQA 4MZUA 3NVCA 2XL7A 3O14A 5KHHA 1JUHA 1YFYA 4E2SA 3EO6A 3USSA 2B8MA 1H1IA 3E5UA 4X6QB 5CU1A 4I02A 4Q29A 2IXKA 5EZWA 1X8EA 1PMIA 4IEWA 3NKTA 3C3VA 1DZTA 3H3ZA 3NL1A 5KBFA 1TQ5A 4IEZA 5CVRA 3H3UA 4R8HA 1DZRA 3DN7A 2EVXA 1CX4A 2MPFA 2BYVE 3QACA 1L3JA 2XL9A 4FAHA 4UBGA 2CV6A 3SHRA 3IBMA 5T3NA 3BU7A 4Q0VA 3D0SA 1J1LA 1Q5OA 2IXIA 3HT2A 4EWEA 4E2QA 2H6BA 2O1QA 2BNOA 5JR7B 3I7DA 3MDPA 4LA2A 4MGYE 2OYZA 1CAXB 1UW8A 4EWAA 4O9GA 1ZZ9A 2PAKA 5FQ0B 4YSFA 2I45A 2VQAA 4I01A 4XF4A 5D1IA 3LWCA 4H7LA 5JAXA 3S0MA 2WFPA 1O3QA 4J1XA 1ZZ6A 3N4MA 2IC1A 3RYRA 3FX3A 1NYWA 2QNKA 4CYDA 4IEPA 1FXZA 3DL3A 5LRRA 5I0SA 4EROA 4Q0QA 3TNPB 4AVCA 2E9QA 1O7FA 3E6DA 3I54A 3H1MA 1WLTA 2WC2A 4KWKA 3LOIA 4MUVA 3HT1A 4HVRA 4NVPA 2IXHA 2MNGA 2B9UA 4ZU5A 3E6BA 2XKOA 4TLFA 4DINB 2XKPA 2ZCWA 3LA2A 4O9EA 5FLHA 2GU9A 4K8FA 3SXWA 2FMYA 4P9GA 4Z07A 4Q0UA 3FWEA 1O3RA 2PAEA 2BNMA 1VJ2A 3RYKA 3NSTA 1G6NA 5FCCA 2Z2SB 3ROUA 1J3PA 3MZHA 2XLFA 4X6RB 5BUVA 2UYAA 2EA7A 1Q43A 3RNSA 1EYBA 3FE5A 3OD0A 4OLLA 2ET7A 4WZCA 1O5UA 2PAMA 2K0GA 4ORFA 1I5ZA 4FAGA 4LUKA 4HN1A 1LB2A 4YRDA 3L2HA 4XETA 4XFHA 2OZ6A 5FPZA 4I09A 2CGPA 4HN0A 4FBFA 1O3TA 1X82A 1XRUA 2PYTA 1J58A 4GULA 4WBBA 1O5LA 3I59B 3KGLA 1GQHA 2PTMA 2ZKLA 4OFGA 1J3RA 1XE7A 4BHPA 1LR5A 4QGNA 1Y3TA 5KHKA 2PQQA 3TNQA 1FT9A 2UY9A 2XHKA 3HQXA 1YHFA 3ST7A 2QVSB 1NE6A 2O8QA 3ACLA 5K8SA 4QM8A 1CAUA 4XFGA 4IESA 4I3PA 5LRSA 3IWZA 4IEQA 4MV2A 5JSOA 4IEVA 1ZREA 2PA7A 3LA3A 2OPKA 2QCSB 3EQEA 3ZDSA 4XF0A 2N7GA 2Q0AA 4RD7A 4YARA 4YNIA 2GC3A 3D0JA 2PHLA 2BEOA 4KU7A 5E16A 3DKWA 4XFIA 4XF9A 2GZWA 1EP0A 4WVZA 1X7NA 3CLPA 1ZRCA 4N9HA 4ZU7A 5FLJA 1NE4A 2Y0OA 2ATFA 5LEJA 3E6CC 4JV4A 2KXLA 1CAVB 3H50A 3D82A 2MHFA 3R6SA 3S7EA 1YWKA 4KU8A 4PIXA 4MX3A 3WW1A 4KL1A 4EWDA 3UKVA 5I8TA 4QGMA 4QX5A 3CEWA 4HSJA 1NXMA 2H6CA 4R52A 1RUOA 1IPKA 4BH9A 1VR3A 4PJYA 5E1RA 2D5HA 2VPVA 4MH0E 1QXRA 3BALA 5KHJA 4JTOA 1ZZCA 1EPZA 4F7ZA 5HI0A 4BIFA 1SFNA 1WA4A 4AXOA 3LAGA 1RUNA 1UPIA 4HBNA 4HSLA 5JCTA 1UIKA 4YYOA 1ZVFA 2IXCA 5BV6A 2GAUA 1QWRA
chains in the Genus database with same CATH superfamily
4BDVB 1TME2 4QPGC 3VBUB 1YFUA 1POQA 5EIYB 2QDNA 1X33A 2BGCA 4Q4W2 2AC1A 5HXMA 2YHJA 2A6YA 3FLPA 3GYDA 5EJ3A 3BODA 5FPXA 1G8WA 1MEC2 4HVOA 4IETA 4XABA 2CNAA 4BLJA 2VJXA 4LR4A 2RS32 5JOYA 1OLRA 3VB9A 4G9SB 3NW4A 3VDDB 1OPOA 1WCUA 4A6OA 2HBTA 2HYXA 4HFSA 3WDVA 3T4HB 1ZRDA 4XBNA 3MF9A 1K5MB 2KA3A 2VE1A 4I3GA 1POV1 5LA1A 3HJRA 5A1LA 2PELA 1RUF1 2VTXA 3RDIA 1QDCA 2QQIA 4LTAA 3OG2A 2VZQA 2HH9A 4XXAA 3K77A 3O1OA 4ZZ8A 4LEJA 4JQTA 1JZ4A 1QXJA 1CN1A 2VZTA 1RINA 1VBC2 4OHVA 1SBDA 4YM2A 3RZJA 2X53S 2XMLA 3J7LA 3SC7X 2ZBJA 3LOBA 2NN8A 2V73A 3VHNA 1NA1C 1XNBA 4Y1UA 4AL9A 3ZXLA 2EXJA 1AZDA 1JMUB 1PGSA 5A3LA 1YC61 3NNMA 4QM9A 1A8DA 2A6WA 1MS0A 2EAAA 3PU3A 3DPRA 5KHIA 4QMAA 3L9JT 3OEBA 4FP2A 1E5RA 3WNKA 3SMHA 3R4UA 4LBOA 3BGAA 4XJWA 5E6HA 4CUBA 4Q4X3 2BNNA 1CGPA 4AHWA 1LAJA 3RMXA 1DQ1A 2VCBA 3AMNA 2V4AA 3WT3A 2WKKA 4AYUA 4WM8B 4QKFA 3B00A 5J98B 1JU3A 1H2MA 2HWC2 1RUG3 4OI1A 3HIFA 1JZ5A 4FTEA 1V6NA 5FYHA 5IT6A 3ILRA 3SH4A 5JZGC 3L2YA 1WCKA 3M3IA 2JDNA 4NMIA 3ON7A 2VCMA 3S30A 4B29A 5C9AB 3I8TA 3W9AA 4AEDA 3BPZA 1XNTA 1DCSA 4AGRA 2ZHMA 4IEXA 4LO8A 5JSPA 1ZRFA 5T5OA 2E26A 5E88A 5C3PA 3A7QA 3ES4A 5HCFA 4MXWA 5J7MA 4AI9A 4EN8B 2QQKA 4PCRA 1HXS3 3OBRA 3T09A 3WY6A 3HR9A 4MGKE 1GZ9A 3OBZA 4RR3A 2EALA 5FZ1A 2AACA 1GP5A 2XJPA 2YGLA 1DGLA 2OKXA 5A6XA 5JIUA 1X8MA 5L73A 3TEZA 1QJU3 2HWE2 2QQOA 4CDWB 4RHV2 5K4LA 3WF4A 4OHYA 3BUCA 4CPBD 2FDJA 4I0BA 4QQOA 4MADA 1G9CA 4QX1A 1AX0A 4P9WA 2HKXA 2OUHA 1OHFA 1TNFA 2E31A 4GH4A 4L99A 3AXEA 1XE8A 4XFCA 2BFUS 5FZ0A 4YZ1A 4YW5A 2YC4A 4CEWB 4BK5A 1JYNA 3S6PA 2W52A 4LBJA 3ZX7A 5A33B 1NCQB 4KGGA 2QDRA 5ANQA 3RPQA 1RC6A 1WZXA 2F4LA 1QGLA 4Q26A 2VZPA 2X8KA 2VCCA 4WZFA 1NG0A 4Y1XA 4BXFA 4ZZ5A 2W47A 3I59A 1KRIA 5G05L 1R64A 1LJ7A 2QKDA 4N8MA 3OGGA 5BY5A 2ZGQA 2WZR2 4P02B 3WP4A 1SPPB 1ULCA 4L8QA 1JW6A 2Q30A 3Q8FA 4CUCA 4MYEA 4IDZA 3I2DA 1DDLA 1DHKB 4YVWB 5FZHA 3TEYA 4JGYA 1V6MA 4C90A 4DIQA 1IS4A 5FYIA 1NCRB 3EYPA 1Q8SA 1MS5A 2UYBA 2VNVA 4LNVA 3WF0A 3WDWA 2A3YA 5AFEA 2TBVA 1NA1A 3OGJA 3N9OA 4JVAA 1RUJ3 3D6EA 4UOJA 3KM5A 1RL3A 4LO4B 4PLNA 1DLLA 3SCHA 5I0DA 4IV1A 5J37A 4WVMB 4XUOA 4HKOA 1JI6A 1NXD1 1ZX5A 4ASMB 2ZXQA 1KXGA 1Q8PA 2VY0A 3WQBA 1Y7BA 3ITQA 3PDQA 1JYTA 2JDYA 3WXPA 4HVQA 3AX4A 5DUUA 1YQCA 1RUC3 2WWUA 4C0BA 4E8CA 5GZCA 1O4TA 1TNRA 1GNYA 1WMEA 1RUD3 4Q4X1 5FPBA 5IYYA 1M06G 2WQ8A 2I2SA 4KWLA 1O4YA 2WQZC 3IN9A 4CXXA 1A6CA 5FKCA 2XLGA 3H7JA 4PI2A 1AR93 1BCXA 5HXVA 1RUG1 1YIFA 5C6CA 4ONUA 4LOTA 4H14A 3ACIA 4D94A 2WO2A 1OI6A 3WINE 3IIAA 4XZPA 1G86A 3PIJA 3EBRA 3Q8EA 3HQRA 3MW4A 4NWWA 5CA6A 3AKSA 5A7WA 3E97A 3CZJA 2X5IB 4MG2A 4NIHA 3WLUA 5BNOA 4LBQA 1F31A 2ETEA 1WCSA 1UN1A 2A3XA 2XJSA 4B1MA 4B3NA 1AX1A 4IE6A 4MGSA 2EXIA 2YG0A 2YGMA 1HXS1 3GBWA 3ZXGA 3G7DA 2YBPA 3BKZA 1QJX3 2JDPA 1RUH3 1WW4A 5LBCA 2EIDA 3LIHA 4MZUA 1QJU1 3T3YA 2NMOA 3PVNA 3AP4A 4EN6B 3USSA 1OVPA 2VQUA 1GOGA 2XG3A 4B4RA 2XBO3 1A8MA 2JDAA 2IWGB 1LOAA 4XE9A 1X9PA 2W0XA 1XU1A 5CU1A 5FWEA 3WDUA 1CIWA 1PVC3 4DXTA 1ND3A 3V56A 2J1RA 4CEYB 4IEWA 2Y34A 1OA2A 1UOBA 1FNYA 5FZMA 4Y3OA 3IM0A 4RGGA 4W8JA 3NKTA 4GZ9A 4FOVA 5GKAC 1DZTA 3BIEA 2ARBA 2QQVA 1XBFA 4DB5A 3NL1A 1E57A 4NIAA 3WZ1A 5CVRA 4AVBA 2W68A 4GWIA 1U5YA 4QPIB 3KQ4B 1LECA 4OYUA 1CX1A 1NZIA 4MXVA 3K4ZA 3DYMA 2EVXA 4GKXA 4YPJA 4E4ZA 1CX4A 2VOKA 4LKFA 2Y6FA 5C5TA 2P1BA 1XQNA 2BYVE 3WG2A 1SFYA 2VXJA 3I97A 4IL7A 2C1FA 2XL9A 5CKQA 2AR6A 4E4SA 2CV6A 4GWJA 3KHBA 2YFZA 3IBMA 1YNAA 1ONAA 4AVVA 1BK1A 3LSDA 4K8RB 2UURA 1V6OA 5F32A 4AQSA 1Q5OA 3RI8A 2BOIA 3K2OA 1ND2B 2H6BA 3S5QA 3QH6A 2JD4A 2VZRA 3RJRA 3WQ7A 3I7DA 1W04A 3MDPA 4LA2A 4MGYE 4YZ5A 4DUVA 1RUJ1 4XAEA 4D8MA 1UW8A 3VBSB 1VMHA 4CRQA 4DQAA 3O1VA 1DQ5A 2YU2A 2XVKA 2PAKA 4O9GA 3O1SA 4CZSA 3D4KA 5LY2A 2BW8A 3WDTA 2NMNA 3PVEA 4Q2FA 3RSJA 4CUGA 4ASLA 3BU0A 4S2FA 1RUC1 5FY9A 5C8CC 1RXGA 2VW1A 2IC1A 3N4MA 1RUD1 2RE9A 2ZGPA 3JQXA 1NYWA 1H2NA 2ZZJA 1FXZA 2C4XA 2BBAA 3DL3A 5I0SA 2GP5A 2QE3A 3WNPA 2BGOA 3THCA 5FZDA 1AR91 1HRV3 1E5SA 4QHZA 2XWJB 1SMVA 3VKMA 1GSLA 4GB33 2Y6LA 4CDQC 3H1MA 3NKGA 5FXVA 4BOWA 1N3QA 2EAKA 1GNZA 1MZ5A 2ORZA 2WYSA 4P9XA 4AEJA 2ZEXA 3T30A 4K6BA 3V0AB 4BQ4A 1RUI3 1W0OA 5B4XA 2B9UA 4WM7C 3KV6A 3TWIA 5EWSA 2BBVA 2WSUA 4Q4X2 1LHWA 1QF3A 2XKOA 4TLFA 2VVDA 3MLKA 2BQPA 2ZCWA 1ACCA 3LA2A 3PVOA 4RGKA 5FLHA 3DCQA 2ZGUA 3LEMA 3PUAA 3POYA 5D8AC 1HB2A 1QJX1 1RUG2 4YW6A 1AR73 2R49A 5J96B 1RUH1 2PAEA 4Z1VA 5CIRA 2ZGLA 4P9IA 1VJ2A 2JKBA 3CKHA 3MIBA 2ZMLA 4QB1A 5FV3A 4KMQA 5LATA 3RYKA 3ZYPA 2ZTNA 4DEQA 1XJAA 4JGZC 2ZX1A 4JDMA 4M4RA 3IT8A 3JQWA 2XBO1 5FK7A 2UYAA 4M3CB 1Q43A 1SCRA 3POWA 1PVC1 3RNSA 2XVGA 4FXGB 4NR1A 3POSA 2E63A 1HXS2 4WZCA 3J4UH 1AYM3 2JIJA 3MICA 1I5ZA 3B9CA 4A42A 2VMHA 2VD7A 3I2FA 3GCWA 4NWVA 2GH8A 4XC9A 1HB4A 4YRDA 3L2HA 5FZ7A 5A3PA 1QJU2 3CU7A 1PZ8A 2DFBA 3KHCA 4AGVA 3AFGA 2WSVA 1C3HA 4NPRA 5LBFA 1S0EA 2PHFA 3VD5A 3FHQA 5IATA 3K48A 4CDXB 2OQ6A 4NPLA 4DY5A 4XDPA 4FBFA 2PHXA 5A3UA 1Y9GA 4Y1YA 3GM8A 1C28A 2Q8OA 4RQPC 1D4M3 1PO11 4IXLA 1LCLA 2GNBA 4YLZA 3M1HA 1VB2A 3ILNA 3CQOA 1W28A 1XE7A 1JOBA 4BHPA 1LR5A 3U1XA 4QDRA 5ABJB 2B7YA 5FZFA 2E51A 4FPYA 2E32A 4ZONA 3K4AA 1YHFA 3OYWA 5FXWA 3H8XA 2VQ0A 4Y4YA 5DQ0A 3ZFFC 3PUQA 4B8EA 5C8CA 4IESA 3SQOA 3THPA 3N9NA 4RFT0 2RS53 2WN2A 3V64A 1CVNA 5L19A 1WCQA 1UY3A 1I5PA 4CDUC 3O1UA 2VC9A 1H8TC 3VBOB 3NWKA 4PDWB 4B4QA 1BEV3 3I3MA 4JHTA 1HRV1 1RUJ2 4ZHNA 3USUA 1HN0A 4YGDA 2LRPA 1WLCA 2JE7A 3HQUA 2N7GA 4GB31 3NV1A 2Q0AA 2VVFA 4Y22B 2GC3A 3ZXDA 2PHLA 2UWBA 3U14A 1NAEA 1NX9A 1S55A 1UYPA 3RFRA 4WM7A 3DKWA 4X8PA 1LNSA 4COZA 5AC92 4HONA 2JG8B 4GMP0 1QJY3 3J8F3 1X7NA 1RUC2 3CLPA 4JC1A 1IQDC 1ALYA 4MO3M 4WVZA 2OS2A 3EB7A 2WNVC 1RUD2 3FFZA 2Y6GA 1CJDA 2WQ4A 2CY6A 1NE4A 2WNUA 1Q8OA 2Y0OA 4LKEA 2PHRA 4QX0A 1W3XA 4IV3A 5LEJA 3S5AA 5CG9A 5D8AA 3T1MA 3E6CC 1OVSA 3MGUA 1REFA 1AVBA 5A7QA 1QOOA 3LSEA 4FP3A 4QQLA 1AR92 1YYNA 4JV4A 3H42B 3PIGA 4XVHA 2Q8EA 3RRDA 3TAYA 4CVUA 3VUOA 1AR71 3H50A 2MHFA 3J7NA 2BV4A 4O7XA 5FWJA 3IB3A 4JGZA 3S7EA 2C24A 3NV4A 2BGPA 5KXDA 3GHNA 4PIXA 1WW7A 2VUDA 4MX3A 1HQNA 5IHRA 3OEAA 3WG4A 5FMOS 5FZLA 1S0IA 3NAPB 4UW3A 3UKVA 1W2OA 3RGBA 4DRRA 1NLRA 4QX5A 3CEWA 4DXRA 5L36A 1HQWA 5FZBA 5C4WB 1YEWA 5IK8A 2ZS6B 5LW9A 5D2AA 1ENSA 4Y1VA 1GBGA 1AYM1 3OPWA 1QJX2 2F6BA 4PJYA 1N1TA 3H8RA 1RUH2 1GKBA 2D5HA 5JUVA 1IHMA 3BOWA 1JU4A 3AJYA 1JZ6A 3MHZA 1HKDA 1R093 1VAVA 1JTZX 1BBT3 1O59A 2CU5A 3WNNA 4D69A 2FZ1A 5CKMA 1EPZA 1TE1B 3VBHA 2DWRA 1JOPA 2XBO2 1F2NA 3VBFC 5HI0A 4FTSA 1JZ8A 4YVSB 4ZS3A 2YB7A 3LAGA 2HWE3 1KJLA 2VW2A 4HSLA 1VBD3 5A7PA 1PVC2 1LGBA 2WDBA 3CJIB 2IXCA 4JDNA 1D4M1 2HWF3 1QWRA 1GYKA 5CYYA 3FFQA 2IXLA 5KXEA 3G6JB 1REEA 4L9BA 3KV5A 3BI3A 4IEUA 4XF3A 5CFDB 1RXFA 3VD3A 3GZTB 1JYWA 4OZOA 4Q0PA 1QXPA 1QOSA 1QJEA 2AEZA 2ZZQA 5CNAA 1C8M3 4QKNA 4XUPA 3A21A 3GJAA 3QD6A 1GWLA 3AP5A 5H9RA 2O0OA 3O1RA 4N53B 1FI2A 3ZMOA 5BNQA 1W05A 3ZXKA 1IPSA 1UZ0A 3MUY1 3OY8B 3H8UA 2CL2A 1QH7A 1XYPA 3ZFFA 5CAZA 1ODNA 1QNWA 1F5JA 1CAXA 4K3UA 1W9TA 1FV3A 4XF1A 5K0UB 2ZEZA 3AJZA 3HNMA 1DP0A 4JKMA 4A41A 5FQ0A 5FAXA 2RS51 5IUQA 1DIWA 1YQ5A 2AGSA 3WP5A 2VUAA 4FXKB 1QIQA 2VVEA 1QQP3 3SEPA 1PO23 4NRMA 4QQHA 1BEV1 2JB8A 5F3GA 1XSQA 1MQTA 2D40A 4JAAA 4COWA 1UF2C 2LALA 5CB7A 2HJIA 2YPDA 1US3A 4EN0A 4DEVA 1MS3A 1UY2A 2WN3A 2GC2A 2PMWB 3LIGA 4QPWA 2W94A 3JU9A 4NHYA 2B5HA 2JDHA 3ZYFA 4QD2A 1AYN3 1OT5A 5A70A 3DEMA 1OOPB 2WO3A 2YDEA 1W06A 1DQ2A 3AP6A 4K7JA 5A7SA 2FQPA 2VZ3A 3RWKX 1QJY1 2W2IA 3J8F1 1GWKA 1UD1A 4LULA 3T0DA 1UCXA 1D2QA 3CMGA 3JBG3 1OURA 2EF6A 2Z42A 2D6MA 1EUUA 1AXKA 1ODMA 4LIVA 5DZFA 4KG8A 5L7OB 3H8OA 3ZKUA 2WFF3 3P5BA 1QMJA 3LB9A 5BXXA 3ZFGC 2GNTA 4BZ4A 5F3IA 4N9IA 3C7EA 4PIZA 1HRV2 3Q9OA 1W2NA 3I2OA 1IG3A 1RUF3 4J1WA 4LLOA 4XW3A 5FPVA 1JHNA 2DF7A 4GB32 4YGBA 2CAUA 1K12A 2VQTA 5FP8A 1OD3A 5T55A 3QH7A 4MGQA 5H9SA 2B42B 5A1AA 3CO2A 4AEMA 2ZX0A 2DUPA 3RJ2X 1COV3 1PVXA 2R063 3IDCB 4Z2WA 1HB1A 4BQ1A 1H4HA 1VALA 4C1WA 1XSRA 2UY8A 4IW3A 4XJ9A 2WUHA 1YUDA 2QQMA 3AM2A 5FREA 2ADDA 3BN6A 3AMMA 2ET1A 5JOWA 3KMHA 4HLTA 1ULOA 1PMJX 5KHGA 2JKXA 4YW3A 4HKWA 2WBKA 1AR72 3ZO0B 5CADA 3FN9A 2WT2A 1MS9A 5L9RA 4NPMA 5T50A 2D97A 1J1TA 1NKGA 1YCIA 2DUQA 4HPKA 1R091 2PHDA 4UW6A 1S0DA 1PK6C 1XB9A 2YBSA 1BBT1 4XMAA 1G7YA 3VBFA 5LA9A 4ET7A 1HX6A 4BU2A 1VP6A 2Q5TA 3PURA 3AMHA 3O1TA 4DFSA 3DXUA 1VBD1 2ZGMA 5C8WA 1TZOA 1G9DA 1HW5A 2DCKA 3PU8A 3AP7A 2HWF1 1LEDA 4LHSA 3BCWA 4XJ8A 4K9SA 3HEIA 1AYM2 5KXBA 2VOTA 1OFSA 1OMIA 3BB6A 2DTWA 3ZFEC 1FX5A 2Z4FA 2F17A 3DUIA 1C8M1 1W8UA 5LEKA 4PF5A 2TEPA 2V4VA 3KVAA 3N3HA 4HXCA 3VBUC 2ZX2A 4V2WA 5FPUA 3M8LA 1YQ2A 3LEKA 3OUHA 1PM4A 5DUXA 4CP2A 1U5XA 1JZ7A 1N3OA 3BIWE 4QQ2A 1S4CA 4ZU4A 3SCFA 3ES1A 1D4VB 4RYDA 3I4IA 4A3XA 3D8CA 3A0NA 1D4M2 3DPRB 4FO9A 4N90A 4TLGA 1DGRA 3CHXA 4UI9L 4XFBA 3U37A 1B09A 4HZFA 4ISQA 4JHZA 5I8SA 5JPNB 3M70A 3VDDC 1QQP1 4FQZA 1UZZA 1PO21 1SDWA 2RS13 1K3IA 4A3ZA 3KWVA 5LA0A 1CR7A 5LCWL 1LHOA 1K5MC 4GAZA 2JE9A 1R1A3 1V70A 2P2KA 4XQ4A 1UMIA 4ES9A 4QX7A 2RDSA 4QU2A 2VBDA 4ARXA 4DUXA 2ZGOA 3UKTA 4MGZE 4EV0A 4LPLA 2JXAA 3HN1A 3IDEA 1AYN1 4JRAA 1Y9QA 5FO8B 3U4XA 4QWNA 4QB2A 2QQLA 2QQUA 3RZKA 4LO6B 5EJZB 1W8FA 1ZA4A 2Z69A 1PMHX 2RS52 1MZ6A 4LA3A 2GMPA 4CCMA 3JBG1 1GUIA 2I07B 4UW5A 5C33A 4DNYA 3ZFGA 5FYMA 4IE7A 2WFF1 3AMPA 2EXHA 3KQRA 4GJYA 3VHRA 1BEV2 4N43A 2WWJA 3K46A 2X10A 2R1BA 2JB4A 5DABA 5GM0A 1DF0A 2K9ZA 1N47A 2W1SA 3UETA 2JG9B 2C0ZA 4E2GA 3I49A 5LA2A 3KCCA 1ENQA 5J36A 4LQRA 2C9AA 5FTTC 1LOFA 3WW2A 3RI9A 4WM8C 5I0RA 5FMCA 4UBHA 5FUPA 2XUMA 4F8AA 1COV1 1QJY2 1S0BA 1XNKA 1KS5A 2R061 3J8F2 4SBVA 3B3QE 3VKNA 4AFMA 2V5DA 3AL5A 2VOWA 3QOPA 1REDA 4GH4B 4YM1A 2VMCA 3DECA 4BXSV 5C9AC 3O0VA 1S2BA 4AE2A 1GZTA 3C7HA 1VAMA 4YZ4A 2W95A 4OQ8A 2D3PA 4I2OA 1NQDA 3WCSA 2OA2A 4LE4A 3ETQA 2RMU3 4XZUG 2WO1A 3KT7A 4AHYA 3APBA 3ZPOA 4XUQA 4QHBA 5GALA 4AGGA 4Z92B 4KBZA 2CGOA 1W8TA 2D6OX 1IQAA 2Z79A 2UWAA 3LEIA 4BPZA 3T1LA 3CZUA 1ULDA 3HBKA 3HN3A 5AC93 1AR63 3R4SA 1ZM1A 2QFEA 1UAIA 5JR2A 4I02A 3VD4A 4CDWC 4J25A 3AKQA 4TTGA 4W50A 1UY1A 3ZFEA 3ZPYA 3AKPA 5FKBA 2IVIB 1SLIA 4LE3A 4BB3A 1JODA 3IDAA 2WYFA 4JGYB 3VL8A 5FMDA 4CEWC 3H3ZA 1V6IA 4FTBA 1K5JA 4OMCA 1NCQC 1R092 4R4ZA 1JXNA 1Z7S1 3RZHA 1BBT2 5F8PA 5FYBA 4CE8A 5A3TA 1GV9A 4M4PA 5LBBA 2DCJA 3JD73 4IV1B 1JYIA 3DXTA 1L3JA 4LBLA 2XUEA 1VBD2 3ZSMA 3TB0A 2Q8CA 2IVJA 3BU7A 4QX8A 4Q0VA 3VKOA 1UY4A 2HWF2 4EWEA 3HT2A 2D3RA 4ATFA 1T2XA 2XH6A 3CDZB 2VZVA 2O1QA 1UU4A 2QQWA 2WA4A 2BNOA 5DXDA 1K5MA 4LBNA 5JR7B 2RS11 4BE3A 4W6YA 1X50A 4BIOA 4QPGA 2OYZA 1C8M2 5HBAA 4YVWC 2XJTA 1X36A 1R1A1 5F39A 1O8SA 1CD3G 3I3QA 1NCRC 4E4HA 4EE2A 1I1EA 2XPJA 3VZOA 3AYCA 5LK5A 4D3WA 4XF4A 1POV0 5JDBA 3LD8A 4H7LA 1O3QA 2B39A 5A6YA 2GNDA 4MHRA 5A3MA 2IUWA 3WD5A 2RDNA 2D6KA 3FX3A 5FR3A 5T5PA 3C7FA 4P5HA 4FPCA 4JQRA 1QQP2 4CU7A 3VDBA 1PO22 3W5NA 1SG3A 2HBUA 2GALA 1O4ZA 4Q0QA 4OZXA 3TNPB 5BNOB 4LBQB 5BNPB 3FBMA 4Q4Y3 3HNYM 2TNFA 4BM8A 1UU5A 1SHWB 3E6DA 2HWD3 5IVBA 1FNZA 1PX3A 4KWKA 1LEMA 1RMU3 4WM8A 2FDKA 3LOIA 3THTA 1AYN2 1OBNA 3WHTA 1BMV1 3HT1A 4HVRA 3MW2A 4QHOA 2P4EA 4KQ7A 3LDBA 2MNGA 3URFA 3P6BA 1WMFA 4B1LA 1AF9A 3MV11 4AQTA 4DRVA 5C9AA 2D3SA 2HEYF 3B5LB 4ZU5A 3JBG2 4Y5Z0 2ZEWA 3ILFA 2WFF2 1GOHA 5EHDA 1UZWA 1UY0A 4O9EA 2VBPA 2BDRA 1ND3B 3M3CA 1GP6A 1RUF2 5JI7A 4BQXA 2FCVA 1P8JA 3T2QA 3FBYA 1XNAA 2X5IC 2RMU1 5GZFA 4YWAA 2Y64A 1XYOA 3BOPA 1FOD3 1MS1A 3VGIA 2Z2SB 1EUTA 3VDCA 1W99A 5FZOA 4J6GA 2EXKA 2XLFA 3VHOA 5JZGA 1MZEA 3KZ4C 1IOAA 2JIGA 4PLMA 4QB6A 5BUVA 4Q4V3 1COV2 2R062 5T5LA 4S2GA 4CDWA 3HBZA 2E7TA 1AR61 3BYWA 4JKLA 4YZ2A 5AC91 3WCRA 2BPA2 2W5FA 4OLLA 2P3YA 1RHI3 5C3OA 2V5YA 3WV6A 3ZR6A 1YRZA 2XB6C 1MACA 4CEWA 2VUCA 4FAGA 4TZDA 4HN1A 5FPLA 1NCQA 2J42A 3U4SA 4XFHA 3GBGA 4P9YA 1W6PB 3FL7A 2BP6A 3PMSA 1GU3A 1O6UA 4CEYC 4ASKA 2ZHNA 3BTAA 3PUSA 5H9QA 1MR5A 3WUDA 3JD71 4P08A 3ZM8A 4UFLA 2LM3A 4XIKA 5FP3A 5IW0A 1A34A 1X82A 1XRUA 1JYVA 1WBLA 1H0BA 1UYYA 1J58A 4GULA 1AHSA 4QX3A 1BVP1 4QPIC 5LASA 4F83A 3SISA 2PTMA 2R6QA 1S0JA 2VMGA 5FZAA 2ZKLA 4OFGA 1J3RA 2XVLA 5K7PA 1F8VA 1Y3TA 4GQ7A 5KHKA 3MEPA 4L97A 3TNQA 1V6KA 1L7RA 1Z7S2 3O1MA 1FT9A 1LTEA 2UY9A 4HKLA 1WW5A 3SLIA 4MHUA 2W1UA 3P3PA 5DUWA 1BK0A 1ND2C 3AYEA 3W5MA 3FUOA 4XFGA 3IPVA 2NQYA 4UFKA 1MPXA 4XXPA 4I3PA 3VBSC 3WP6A 5IK4A 3IWZA 4K20A 4A7KA 4CP0A 5JSOA 4NE9A 1UOGA 3BTXA 5IVCA 4R9DA 4COVA 4IEVA 2RS12 1IKQA 1WBFA 2PA7A 4UYBA 4CCKA 3LA3A 5FOBB 2OPKA 4DY3A 2FMDA 4Q4Y1 1PO13 3AZYA 1R1A2 3ZDSA 4XF0A 3VV1A 4BQ2A 2FCTA 2HWD1 2P3JA 5A3WA 4ZXKA 4TSVA 5DZEA 1X9TA 1RMU1 5FFOC 4BMBA 3ZYBA 3S57A 1ASJ3 2YROA 2BEOA 1A3KA 5E16A 3M3OA 3HPNA 4OUEA 3VBRB 5AVAA 4AHXA 1ZRCA 1QJFA 1NT0A 1ST8A 4NIGA 3GDBA 4ZU7A 5TSWA 3MBWA 1HB3A 1W0PA 5FLJA 4LK7A 4NRPA 4GD4A 4BQ5A 2W9XA 1DGWX 2EIBA 2JEMA 2XOMA 1CWPA 2DURA 4HT1T 4LBKA 4MVTA 1SCSA 3TOJA 4P5YA 2KXLA 2X5IA 3M4FA 1CAVB 1LOEA 5DG2A 5IFPA 1YJKA 1W9FA 1YQ6A 4XOGA 3SKJE 1R1ZA 2OVUA 1FOD1 1VMJA 1YWKA 4Q8LA 5DG1A 3RWNA 4AK3A 2RR13 3AZXA 5IVJA 1BMV2 2AYHA 2BTVC 2VMEA 1DGRN 2DU0A 1LOGA 4Q4V1 4KL1A 1E5IA 2W87A 1HRI3 4PF1A 2PLV3 4QGMA 1GZWA 1UX6A 4PHZA 2ERFA 4NROA 2R043 1NXMA 4XUTA 5FK8A 3MUZ1 1HV1A 2H6CA 4R52A 1RUOA 4RFRB 2X05A 4DO0A 1RHI1 4UFMA 4BH9A 1XNCA 2RDRA 4A44A 5FZ4A 1JZ2A 1Z0HA 2SLIA 4I30A 1DQ0A 2P6HA 2RMU2 5C3SA 4AWDA 1QXRA 2G1MA 4FPEA 2ZEYA 4XILA 2DCZA 2ZGSA 1ZZCA 3M3QA 4AFDA 4F7ZA 1V6LA 4BIFA 5HV4A 3KCYA 5GLWA 2J1SA 2I74A 1SFNA 3FUQA 1WA4A 2D7FA 1SLCA 2P3KA 3HNBM 4AXOA 1UPIA 2YXSA 1W6NA 5FY1A 1AR62 1UIKA 2NLRA 1LGNA 4OVEA 5CFCB 3NVCA 1GWMA 3AXDA 4M0NA 4PLOA 4CDXC 3T0AA 4LKSA 3B02A 2G4IA 2H0VA 2R073 3RYPA 4AI3A 4BYYA 4RSUA 4HMZA 1YFXA 1CAWA 2YYOA 2WA3A 4I0WB 1OA4A 5LZ6A 1XC6A 1RGSA 1LESA 5FY8A 1ND2A 2VZSA 5FY4A 1XNDA 1KS4A 2QUOA 4GMP1 1TG7A 3USUB 4AFCA 1K42A 3EHKA 5FJHA 3JD72 1JUIA 4ISRA 4XURA 3AB0A 3AVRA 3VBSA 3E5XA 4FT8A 3OF1A 4YGCA 5ABJC 5F5QA 1H6XA 3M3EA 3AZWA 3PVBB 5FZIA 1JBCA 3MLJA 1I6XA 2YZ4A 4QXKA 4BK4A 3NJYA 5FO9B 3V0BB 1FAYA 1LHUA 1SQ4A 2QQNA 2WNUB 1VRBA 1O91A 2B46X 3WOGA 4A7ZA 4BJ0A 4IV3B 4LMFA 2W3JA 3H7YA 3SEEA 5DPNA 2ES3A 1M4WA 3LA7A 5BPXA 4QGLA 1GFF2 2NZ9A 4KWUA 3RMYA 5GLZA 1QY4A 1GQGA 1U12A 2D5FA 4FOWA 2W46A 3UKNA 3VBOC 1ASJ1 4PDWC 4BMEA 3AFKA 5KC5A 1D2SA 3LFMA 4QXBA 1VMFA 3TEXA 1W39A 3UT0A 1WLDA 2W08A 4YM0A 1UO9A 1F5FA 2D6LX 2X29A 4JTNA 4BQ3A 4Y20A 4XYXA 3WNLA 3V0AA 4CA9A 5ERLA 4HG6B 2CSGA 4UW4A 1IPJA 1B35B 1XOYA 5EFUA 2ZAAA 4Q4Y2 4K40A 2R30A 2JG8C 4B4PA 2FDHA 1NLQA 1UZYA 3MO4A 2HWD2 5FMBA 1QEXA 3MIGA 5A32B 3HVDA 1ULFA 3SH5A 4FPKA 1RMU2 3GBFA 1LHVA 4AOCA 5JSRA 2RR11 3NMBA 2CDPA 4XFAA 4HANA 3U07A 4CDQA 4D7SA 3CNAA 2VR4A 2DCTA 2BU9A 4A7YA 4ES8A 1HRI1 2VECA 5JVVA 5JOZA 3VD9A 1RB8G 2DVAA 2PLV1 3VBHB 5T52A 5FLIA 3V65A 2Z5WA 2PFWA 2R041 1CJPA 3WDXA 5AVPA 3GZUC 2LTNA 2BWAA 1UKRA 2XQRA 3ZYHA 4AI8A 4Z82A 4CP1A 1XU2A 4M3CA 4L11A 4KWJA 2G19A 3LZZA 3NJVA 5GLUA 3N9PA 3NAPC 2VAUA 1W9SA 3PJYA 1N1YA 1YXWA 3WSOA 4AZZA 1FOD2 3WX5A 5FBJA 1O8PA 1OXCA 2CWSA 1BQPA 3OGSA 2Q1ZB 1F9KA 5C4WC 4PI0A 2JJ6A 1FPN3 1I3HA 3CL1A 4XAAA 4Q4V2 2QBXA 4AAXA 2P5BA 4OI0A 3NJZA 2Q4SA 4FFGA 4UFJA 3UGHA 4YGEA 1J3QA 5EP9A 5HCBA 1JH5A 2XJVA 4CDXA 1YJLA 4NN0A 2JDMA 1T6GC 1RHI2 3U10A 1UNBA 2J1VA 3ASIA 3DGTA 4FSJA 3KD4A 4UAPA 1LULA 2A73B 2FBEA 2XWBB 4YFWA 2OX0A 2R071 4YVSC 3H1WA 1SACA 3RVHA 5E8AA 3ZOIA 1UU6A 3PLQA 3CJIC 3F95A 4CP9B 3HMYA 1PIV3 3AVSA 2XLAA 4IEOA 5I93A 1MQTB 1OKOA 3WF1A 1ULPA 1Q3EA 5DAXA 4C91A 1LOBA 3MYXA 4AQ6A 5CFDC 2ZGKA 1W6QA 4BQYA 5ABJA 4Y5TA 2GDFA 3GXUA 2E6VA 1W6OB 1ZA7A 1YQ8A 3C7OA 3PNAA 3N9MA 3UNPA 2F4PA 1H30A 1VRH3 2VU9A 4Q8KA 3FHIB 3ZN6A 2YFUA 1W8ZA 2R0HA 4N53C 2GC1A 3O0WA 4COYA 1OQ1A 5G04L 2OZJA 3H1YA 5FY5A 1EV13 4RQPA 4AAPA 5KXCA 4BQWA 5K0UC 2SBAA 3VLBB 1CAUB 1R083 1HDKA 1QKQA 4YW4A 1ULGA 2RJLA 3SCGA 5J09A 1W6MB 4GA9A 2YY1A 3MPBA 5I0TA 5J3UA 3WQ1A 4LO7A 4OI2A 5C71A 4Q1RA 5I91A 3FJSA 3T4VA 3POFA 2VH9A 5HCHA 3PHMA 1PGW1 1ULEA 2GC0A 1CZVA 1J59A 5H9PA 2W1WA 1OLQA 1MVQA 2PHTA 2CYFA 4LUMA 3PTYA 4FPLA 1XYNA 1OQEA 4E9KA 3OTFA 4OHZA 4MSVA 1OOPC 1EAH3 5JXJA 1H9WA 2JG8A 4RS5B 1RVF3 3KT1A 4META 3FMGA 2HLEA 3N9LA 4CDUA 1VBB3 1PO12 1H8TA 1QH6A 3ORJA 2IFRA 3ELNA 1IKPA 4XCBA 1NZCA 4CU8A 3VZNA 5L7OC 3VD7A 4YM3A 3NNFA 1ASJ2 3TYJA 4UXAA 2ZMNA 4BISA 3VKFC 2D93A 4QU1A 3KCXA 4YZ3A 4HPKB 1DQ6A 2C6SA 2O8OA 5JMCA 2ZAHA 1OKQA 2ZHKA 3ZSJA 2O14A 1PZ7A 4LO5B 1KDMA 4NHKA 4XACA 1SLAA 1ZZ7A 5FYTA 2FZ2A 4BA6A 2WNVA 1LGCA 3ALQA 3MV01 4UWDA 3SITA 2RS31 3WVJA 5A80A 1DFQA 3TEWA 1UWWA 3I2IA 2HEVF 3AKTA 4W4ZA 1C5IA 2XL7A 3OD4A 3MFAA 5KHHA 1JUHA 1RUE3 2QZ3A 1DYPA 2G9FA 2JDZA 2RR12 3A22A 3EO6A 3MIDA 4XPVA 1FPN1 3I2HA 1F15A 2PN5A 2B8MA 5BNNB 1H1IA 3C2UA 4WV8A 3LQCA 4Q1PA 2PXJA 2RG4A 4NRQA 2ZX4A 2L9LA 1HRI2 4LLFA 3T2PA 4Y5SA 2GNMA 2VNRA 2PLV2 1GICA 4FCAA 4RA0A 2R042 4Y24A 1NLSA 4XHXA 3ZDVA 1X8EA 1PMIA 3VZKA 4YVSA 1W8WA 5ISLA 3I2KA 1XXNA 1V6JA 3WNOA 1F4HA 1KEXA 5KBFA 2BFUL 4IEZA 3OJBA 1PIV1 5CFDA 1OUSA 2OW4A 4DXZA 5GZGA 3NRUA 1OH4A 5DDJ3 5EXOA 2MPFA 3QACA 3RQ0A 1MS8A 3MIHA 4XDOA 4YW1A 1QNYA 4N53A 4UBGA 4INDA 3I2JA 4FAHA 1VRH1 5T3NA 3D0SA 2R16A 2ZPXA 1VBE3 4UF0A 5IAVA 4E2QA 2ZGRA 2R072 1W9YA 1EV11 2R32A 5C70A 2XXZA 4BLIA 1W03A 4GWNA 1S1AA 1C57A 3A0KA 1R081 4AR2A 4MLOA 4N43B 2DUOA 3DPRC 3MF6A 4AW7A 4QDSA 5FYVA 4K21A 3J7HA 1STMA 5APAA 2UWCA 3W58A 2AEYA 2XONA 3J9SA 2VQAA 5D1IA 5FYSA 2GMEA 5JAXA 1C1FA 1Z7S3 2DTYA 1W90A 3FC0A 1MVEA 1ZZ6A 3QBQA 3WNMA 4FPOB 3VZJA 1VPHA 1JS9A 1EAH1 1RVF1 3GJBA 1XPWA 2G9GA 2PHUA 2J1UA 5F6LB 1VBB1 5FBZA 4AVCA 5B2GB 5L7OA 1O7FA 1VAKA 1KDKA 1JYCA 1CPMA 3DYPA 5IVYA 3D3AA 3C8XA 4MUVA 2OIIA 4E4DX 5LWBA 4M3CE 4EJRA 2IXHA 4B7KA 4SLIA 4NIIA 1PGW2 1IS3A 1U5ZA 2V72A 1LODA 2J1TA 1KGYA 2JICA 2LROA 2JG9C 3E6BA 4E27A 3TRSB 1V9U3 1G9FA 2VMFA 3Q8AA 4BCUA 4YW7A 3K51A 2A7AA 2GU9A 3KVBA 4K8FA 4LJHA 5DN2A 3SXWA 1W3VA 2FMYA 1VIWB 3K4DA 4ZPIA 4Z07A 3NNGA 4Q0UA 2VZUA 3FWEA 4AEDB 5F37A 2VZOA 4Y1ZA 2BNMA 2YC2A 4GH4C 4Q5OA 1RUE1 3ZXAC 3MZHA 4CCDA 4LBMA 4MXWB 1OH3A 4X6RB 5JMOA 1AXZA 3UGGA 2E7AA 4URTA 2ZGTA 3ACFA 1E5HA 4Z2AA 4RR3B 2E33A 3SNMA 4FPGA 4A4AA 1AJOA 2OQ7A 3OD0A 3ACHA 4TN7A 2WZEA 2LS6A 3VZMA 1GMMA 1WMXA 4NO4A 2Q8DA 3VN4A 1Y43B 2RV9A 4A6SA 4IGPA 2PAMA 2IZWA 2ZA9A 4ORFA 5A3OA 4CU6A 2Q1FA 5FZEA 1LB2A 3O0XA 5FIXA 3BTYA 4AVSA 2OZ6A 3IIIA 4TWTA 1GZCA 5FPZA 5JPMB 2ZOEB 4CSWA 4I09A 4QPGB 1FPN2 4OUSA 3KF5A 2WIIB 3LDKA 3U78A 4JGYC 2P34A 4MGTA 1GANA 2BUKA 5DDJ1 1PK6A 3ZYGA 2ARAA 4M3CF 1H1AA 3OUJA 2NM1A 1ENXA 2C26A 2PYTA 4FFIA 4E8DA 4U2AA 4RL7A 1CIYA 1CZSA 1VBE1 1JOJA 1KITA 3I59B 5F7UA 1WMDA 3UESA 4DPNA 1GQHA 4IV1C 5FYUA 3OPTA 1NQJA 2DVFA 5FY7A 2YBKA 4ARYA 2Y26A 5CEHA 5F6KA 2HWB3 4QAWA 1AUYA 2PQQA 2YU1A 3T0BA 4Q27A 2WO7A 1JHJA 1PIV2 3MIEA 4KNCA 2XHKA 5FUIA 1UQXA 3DF0A 2BVBA 3EXUA 4IQPA 1U0AA 2QVSB 3LEGA 1NUKA 2A71A 2O8QA 3B69A 5GZDA 5FXZA 5FJKA 4QM8A 3MPPG 3ZKYA 4P14A 3VBUA 5A6QA 1IS6A 4LIUA 1VRH2 2FHRA 1NA1B 4PQ9A 4QXCA 3ABZA 4RN5A 2WNEA 3LKJA 3H3LA 3AMQA 4HL0A 3I2GA 5F5CA 4CCCA 4IEQA 4FQ4A 3ST7A 3T2TA 5DZGA 3N7MA 3OUIA 1EV12 5A7OA 2W92A 1UOFA 3MFCA 2W39A 1H8VA 4C1XA 4D7YA 4G4FA 1J84A 2JDUA 1R082 3VDDA 2DFCA 4KGQA 4MOAA 4NAMA 4RD7A 4YNIA 2DVBA 3FHAA 4DXSA 1OUXA 2A70A 3GGLA 1HIXA 2JD9A 3B01A 5BNPC 1LHNA 1AL0G 1UXZA 1W2AX 4IUGA 4XFIA 4XF9A 4XDQA 5BNOC 3RZLA 1RYYA 2H0BA 2GZWA 1YIPA 1EP0A 2JG9A 2ZMKA 4OCTA 5FZOB 5GJ6A 5C7GA 3RS6A 5JZGB 1KJRA 1SLBA 4RGAA 3OGRA 4V2VA 4JZRA 1GOFA 4CXWA 5IVEA 1V9U1 2ATFA 5JI9A 1EAH2 1KFUL 5CBLA 1RVF2 3MIFA 1VBB2 1DQ4A 4ZXEA 3ZXFA 5BYNA 1MS4A 5A7WB 1IGOA 2VBBA 2BZDA 1W2TA 5CISA 3MI8A 5FY0A 5DMYA 1W8OA 2EICA 4GKYA 2Y6HA 4KBBA 1G9BA 4GXLA 1ND3C 1ZBA3 3WW1A 1BHGA 4CCLA 4LT5A 4EWDA 3LF7A 1KFXL 3TBDA 5F9TA 2Y38A 4HSJA 4WVWA 3AYDA 2A5ZA 3R05A 1SBEA 4C0HA 4O65A 2WINB 4XQDA 3NV3A 2WWSA 4R9CA 1J83A 2IFWA 4MH0E 5IWFA 3TN93 3PUIA 3BALA 1UKGA 1RUE2 2HEWF 1HLCA 4QKBA 4EZHA 1KQRA 1UPSA 2RM23 1JN2P 4JTOA 4ZKTB 2WABA 2K2SA 2WRAA 1Y9MA 3OSDA 2J22A 4AG4A 2ZABA 4CCNA 5J1XA 1OF3A 2XJUA 4B7EA 4DOUA 1QJZA 5GLVA 2LW8A 3WG1A 3KF3A 5F5IA 2LUWA 4FI9A 3H0OA 3POJA 4XIOA 3A23A 2E53A 3GZEA 1H4GA 3IPVB 1K45A 5JIAA 4AI0A 2DBNA 3HWJA 3ZMNA 1S2EA 3WEZA 5FP9A 3N36A 3BVCA 1SDDB 4OI4A 1ENRA 1GLHA 2BWCA 2DVDA 2BJSA 3ZYIB 2HWB1 2FD8A 4QT6A 3WW3A 5IVFA 1UYXA 5IK7A 4LK6A 4D7TA 5FZ6A 5A33A 1MZFA 5DDJ2 3LPFA 3AZZA 5F2SA 1PGL1 1CZTA 3NV2A 2ZHLA 1QDOA 3ZR5A 1OA3A 3WW4A 3ZN4A 4S2HA 2RJKA 1VBE2 3WP3A 4AQ2A 4NJ4A 3E5QA 1F35A 1WWYA 3AK0A 1ZNPA 3R4DB 3O12A 3K3OA 1US2A 3UJQA 2Y6JA 4L2NA 4PBOA 4Y4RA 1SBFA 1RIRA 1SPPA 1YFWA 2HYKA 3EJKA 3A4UA 4H7MA 5ANNA 4COUA 5I8YA 4AVAA 3IZOA 3KGZA 3ZSKA 1AL23 4EYUA 1UXXX 5BNPA 5J48A 3ZXJA 4YVWA 4AFAA 5EYXA 3JCIA 4XTMA 2WZ8A 3WF3A 1NCRA 4P9JA 2A6VA 4P9LA 2AH2A 2AUYA 4QKDA 3I3DA 4GMP3 4YW2A 5FYYA 3B9IA 5A7NA 1QU0A 4GWMA 5IAXA 1OFNA 2VCAA 4P00B 1GZWB 2CDOA 4AF9A 4H55A 5FP7A 1FMD3 4IERA 4WVMA 4DUWA 3VBRC 4YFZA 3OPZA 2IXJA 4K1ZA 5FRAA 1DYOA 2CAVA 1W8NA 2OPWA 2V09A 5F2WA 2A1XA 1Q8QA 2GN7A 4IGOA 1ZRIA 1DLCA 3KT4A 3K3NA 3U0ZA 3QCWA 2VMIA 1L7QA 3GALA 3O7OA 4XFFA 5IK5A 1FV2A 3PTRB 1ZBA1 3GF6A 2D6NA 2VG9A 3KSCA 1C4RA 2OXBA 4IE5A 3AYAA 4CCOA 1BXHA 1D0GA 3HAGA 1OPMA 3N7JA 4L92A 4XJAA 3O1PA 1UIJA 1V9U2 3FZ3A 3POGA 2E7QA 1TEIA 1W6NB 1APNA 2WL1A 3I3BA 4L0PA 4OULA 1QOTA 4H2AA 5FZ8A 2Y60A 3ZLIA 1NOVA 2WLQA 2WS93 1O3SA 3LCPA 4K1YA 4XEZA 1DU3D 1OD5A 4IE0A 2B9VA 5FMOL 3TN91 2WT1A 4XTPA 1WGPA 2OUJA 5FO7B 1PM7A 1URXA 3Q8BA 2RM21 1CAWB 5K9YA 4OHXA 2K46A 3P1IA 4A2UA 5EPAA 5EYYA 1LENA 1TMF3 5FYZA 1W6PA 2DDUA 2WZPP 2A6ZA 1Q8VA 2XGXA 3CF6E 3ZYJB 4XQWA 5A3NA 3RZZA 5JXHA 5L9VA 3S7IA 4CXYA 3CBNA 2FDGA 5KWRA 4MGIE 2J7MA 2KR2A 4ATEA 4PIYA 4W6XA 2KM2A 4LHKA 5I0UA 2DVGA 5FZGA 5CFCC 2Y0IA 1ZRRA 3NO8A 1HJFA 3WHUA 5DAQA 3UK9A 3N35A 2PHWA 2JE8A 2XR4A 3OCPA 4R9AA 4CEYA 1A78A 4IEYA 1BVVA 2Q1MA 1PZ9A 2VXRA 1LKNA 3B94A 3IAPA 3N7KA 1ZZBA 3ZVXA 2ZACA 2AENA 3UGFA 1Q56A 3H9AA 5FDBA 1JYXA 3T2OA 4NIDA 5C3QA 3CIHA 2VTXJ 2JENA 2R1DA 2DV9A 1Y4WA 3N9QA 4EN9B 3D5OA 4QPIA 2VL4A 1VBA3 3OYWB 4M0HA 4Y20B 5LK7B 2HWB2 3ECQA 3CJXA 3PUHA 1NY71 4X8NA 5C8CB 1AX2A 2P17A 1RTVA 3ACGA 1AL21 3OBAA 1EY2A 4JX0A 1BLZA 1ZBE3 2BOJA 1ZZ8A 4LBQD 4QDQA 4LORA 5DAVA 5JLVA 5JOXA 2QJVA 4FPFA 1PGL2 2WNUC 5B4NA 4IV3C 3AL6A 3U11A 3AKRA 4CDQB 5F1RA 1UYZA 5FZKA 2WAAA 3UYJA 1PNGA 2VOXA 3J26N 1CPNA 3LFIA 4G3YC 3VBRA 1FMD1 1SEFA 1WW6A 4PT6A 4IE4A 4YG6A 5ACA3 1YLLA 2Y6KA 1TVGA 2G9ZA 1LRHA 3DV8A 4I0AA 4WM7B 5A6ZA 1AR83 4Q0SA 2BRTA 5FZ3A 1CQ9A 3SH3A 2C5DA 3PL0A 4AI2A 3IDBB 2GH2A 1DGWA 4CU9A 3F2ZA 1DZQA 1CAVA 3JZVA 1B35C 2JWPA 2D44A 4O61A 3PMEA 1WUVA 1G9AA 1HQLA 3N7LA 5D8AB 2MEV3 4FPHA 3IKWA 1H1MA 1T6BX 1U5IA 3KLSA 3KB5A 4JGZB 2DBIA 3WNXA 2Y33A 4R9BA 4EN7B 2ZX3A 1WLWA 3VKLA 2WS91 2ZGNA 2OT7A 4GALA 5CG8A 3VBHC 4DS0A 3O14A 2C9KA 1WA6X 4NHXA 5GLTA 4CCEA 1YFYA 4E2SA 2CHHA 1RJ7A 2VOVA 1HV0A 4CUAA 1LU1A 3WR0A 1DYKA 3DKQA 1ZBA2 2WT0A 4XUNA 1TMF1 5LY1A 3E5UA 4X6QB 4OHWA 2JX9A 3HD8B 4JKKA 2RJ2A 2ORXA 2IXKA 4Q29A 5EZWA 4LXLA 4FVVA 1FYUA 1W6QB 2VULA 3B93A 4NHMA 1TME3 2BERA 1HJGA 3IAQA 4Q4W3 3ZN6B 3ZN5A 2D98A 3C3VA 3JB4C 1OC1A 3GZAA 1W0NA 3TN92 1MEC3 1OLMA 3ZYRA 2RHPA 1SZBA 5C5UA 5CFCA 5M0TA 1TQ5A 4RQPB 3DYOA 3LDRA 1HN1A 1GQPA 2RM22 3H3UA 4FPJA 1DZRA 4R8HA 1WKYA 3ZIXA 2YMZA 4ZS2A 2RS33 4KG0A 3DN7A 4EZ4A 2P6CA 1IG0A 1WCDJ 3HOBA 4QQPA 2EIEA 5FUNA 3SHRA 5F3CA 2R7EB 1J1LA 2IXIA 1MQTC 4KH9A 5L9BA 2VM9A 2CGNA 5JXIA 2ZJCA 3AZVA 1VBC3 3ZFFB 1S0GA 2DYCA 1VBA1 1CAXB 3VZLA 1SLLA 1RUI1 3B7MA 1UOJA 4EWAA 3UL2A 2GSYA 1D0HA 1ZZ9A 2BVVA 3OBTA 4CDUB 3RZGA 5FQ0B 1OQDA 1ZBE1 4XBQA 4YSFA 3V0BA 1H8TB 2RVAA 2I45A 1YI7A 3POEA 4I01A 2VTFA 5EQUA 1YO8A 3LWCA 1UZVA 5DAPA 5FYCA 3S0MA 1BYHA 2WFPA 2GP3A 1N3PA 2WR9A 2VW0A 4IGQA 3QLQA 4J1XA 4TXWA 4W65A 4YG3A 2JDKA 3J7MA 4YG0A 3RYRA 5DUVA 3W21A 2B45X 4HK9A 2QNKA 3VL9A 4CYDA 3VDAA 4IEPA 4URAA 4LHNA 1DG6A 1VLNA 4D6SA 3LPGA 5LRRA 1SLTA 4EROA 1F4AA 4WVVA 4NOTA 5AFBA 3JXSA 4D6QA 2AREA 2QQJA 5EV7A 3KS7A 1S2KA 2HWC3 5ACA1 1BKZA 3NQHA 4HOOA 2E9QA 1NY72 2P37A 1S0FA 1AR81 2PQSA 2WNVB 2XDVA 3I54A 3POBA 5DAWA 4C8DA 1AL22 1WLTA 2WC2A 3WQ0A 1B35A 4HK8A 4GJZA 3WDYA 4CCJA 1RITA 2JECA 2ARXA 1W9WA 3NJXA 5SV5A 4RS5C 5LB6A 3IMNA 4NVPA 3ZSLA 3GHMA 4N7IA 1UX7A 2MEV1 3MW3A 1AXYA 2ILMA 2J1EA 2VUJA 4H3WA 4XJUA 3VBOA 5A32A 4XJZA 3BPSA 3POIA 4PDWA 3NNLA 3SKVA 5IJRA 4DINB 1JZ3A 2XKPA 3E1F1 2WJSA 2B4KA 4V1PA 1WD4A 4XBLA 4AI1A 3WG3A 3ENRA 3W59A 1FMD2 3ZSEA 4JCKA 1N1VA 4P9GA 1LOCA 4JRLA 4Y22A 4XCAA 4D0QA 1LU2A 1O3RA 5FXXA 5SV8A 3FLRA 3NSTA 1G6NA 5FCCA 4RHV3 1C8NA 3ROUA 1J3PA 2ARCA 4M00A 2ADEA 1S0CA 2A6XA 4Z8BA 2GMMA 5JWPA 4AVTA 2CWMA 2VZ1A 2NYYA 2EA7A 3UJOA 4TYSA 3ETPA 3THDA 2NP0A 4UFHA 1UMHA 1EYBA 3FE5A 2Y8KA 5FP4A 4S2DA 2ET7A 3KV9A 4OUMA 4EQVA 4QPYA 1TME1 5KC6A 1W2UA 1O5UA 4NAOA 2K0GA 3AC0A 3R0RA 4R4XA 1GNHA 3VBFB 2WS92 5BNNC 2YPJA 4JDOA 4Q4W1 4LUKA 2VO5A 1UL9A 3JUUA 3JB8A 4UF0B 5KR7A 2D43A 4XETA 1MEC1 2YUEA 2VNOA 4FFFA 2QQPA 3LGRA 2WNOA 3NAPA 4KI5M 2WZR3 4LKDA 2P3IA 2FDIA 1OSGA 3VHPA 2CGPA 1IS5A 1OF4A 1PHMA 1PX4A 3M7AA 4FOYA 4HN0A 1TMF2 5C4WA 5GZEA 4CP9A 4AHZA 1O3TA 1BJQA 1AJKA 3ZXEA 2FDFA 1EPWA 2VMDA 5LBEA 1L7LA 3INAA 1CONA 4WBBA 4ITCA 1O5LA 4LHLA 3K75B 4AFBA 3KGLA 1W8HA 1W6OA 3ZIWA 3PJQA 1VBC1 3KV4A 3P3NA 4NUBA 4QGNA 4N7UA 1D7PM 2VNGA 3ATGA 2D6PA 3GNEA 1V00A 2KD7A 3HQXA 2RDQA 3CJIA 1NE6A 1RJ8A 4FOQA 3ACLA 3NNJA 3I3EA 5EJ1B 1C1LA 5T5JA 5K8SA 1VE0A 1CAUA 4U36A 4HETA 1H9PA 2J1AA 1POV3 5FZ9A 4QX2A 5LRSA 1W6MA 1XE0A 4N43C 5F3EA 4MV2A 3OGVA 1H6YA 4FFHA 3T08A 1IZ3A 3X29B 3AP9A 1Z78A 3O5SA 1ZREA 2A75A 1VBA2 2DCYA 3MLLA 2EIGA 2QCSB 1SFPA 2HWC1 3OY8A 1RUI2 3EQEA 1LOFC 3OB8A 3LE0A 1GP4A 3C7GA 4YARA 2XJRA 1ZBE2 4RS5A 5K0UA 1C5HA 3WUCA 3D0JA 2X09A 2TUNA 1UMZA 3GCXA 4KU7A 5CZKA 5D21A 4W6WA 3UV9A 3ZFGB 4OMDA 5JXGA 2DU1A 5FZCA 4GIQA 3FLTA 2YC0A 4N9HA 1PNFA 2XJQA 3U75A 5IFTA 4AEKA 3Q8CA 1GR3A 5CKNA 2YV8A 5HV0A 1I9RA 2ENRA 2QZ2A 4UT5A 5ACA2 5FOJB 3W20A 5A1FA 2CTVA 3D82A 3ME2A 1OOPA 1AR82 4LITA 5T54A 3WF2A 1YI9A 3R6SA 2HWE1 4DZGA 4RHV1 4KU8A 5F5AA 2XHNA 2VGDA 2R0FA 4ZY9A 2A3WA 4LOSA 5HCAA 2ID4A 5FPAA 2XQXA 2GN3A 4AEDC 2MEV2 3EMRA 2W1QA 1H2KA 1KD7A 3OOXA 5I8TA 4XHBA 4D6RA 1OLME 5HPOA 1CESA 1V0AA 5BNNA 1PK6B 2WAOA 5IVVA 5C3RA 1IPKA 1QHDA 4QXHA 4M01A 1VR3A 4A45A 4Y33A 1WD3A 2NPIA 4Y26A 5E1RA 4CTEA 5E89A 2QTWB 2AZ5A 1BZWA 2VPVA 1FATA 4BWOA 4RR3C 4XMIA 1VB4A 2W91A 3IMMA 5KHJA 4CPBA 4UFIA 2UU8A 4OQ9A 1DBNA 2WLPA 2ZKNA 2WZR1 4PBPA 2FCUA 3RG0A 3M2MA 4PQQA 1ZYBA 3ZFEB 1H2LA 4F3JA 1RUNA 4HBNA 3RZMA 5JCTA 4NHLA 4YYOA 4DMIA 1ZVFA 3BTZA 5BV6A 2GAUA 1N1SA
chains in the Genus database with same CATH topology
1TME2 4QPGC 3VBUB 1YFUA 2QDNA 1X33A 2BGCA 4Q4W2 2YHJA 2A6YA 3FLPA 3GYDA 5EJ3A 3BODA 5FPXA 1G8WA 1MEC2 4HVOA 4IETA 2CNAA 4BLJA 4LR4A 2RS32 5JOYA 1OLRA 4G9SB 3NW4A 3VDDB 1OPOA 4HFSA 3WDVA 1ZRDA 4XBNA 3MF9A 1K5MB 2KA3A 4I3GA 1POV1 2PELA 1RUF1 3RDIA 1QDCA 4LTAA 4XXAA 4LEJA 1QXJA 1CN1A 1RINA 1VBC2 4OHVA 1SBDA 4YM2A 2X53S 2ZBJA 3LOBA 2NN8A 2V73A 3VHNA 1NA1C 1XNBA 4Y1UA 3ZXLA 2EXJA 1AZDA 1PGSA 5A3LA 4QM9A 1A8DA 2A6WA 1MS0A 2EAAA 3DPRA 5KHIA 4QMAA 3L9JT 4FP2A 3SMHA 3R4UA 4LBOA 4XJWA 4Q4X3 2BNNA 1CGPA 4AHWA 3RMXA 1DQ1A 3AMNA 3WT3A 2WKKA 4AYUA 4WM8B 3B00A 5J98B 1H2MA 2HWC2 1RUG3 4OI1A 3HIFA 4FTEA 1V6NA 5IT6A 3ILRA 3SH4A 5JZGC 3L2YA 1WCKA 3M3IA 3S30A 5C9AB 4B29A 3I8TA 3W9AA 4AEDA 3BPZA 4AGRA 2ZHMA 4IEXA 4LO8A 5JSPA 1ZRFA 5T5OA 5E88A 3ES4A 5HCFA 4MXWA 5J7MA 4EN8B 4PCRA 1HXS3 3OBRA 3WY6A 3HR9A 4MGKE 1GZ9A 4RR3A 2EALA 2YGLA 2XJPA 5JIUA 1DGLA 1X8MA 5L73A 1QJU3 2HWE2 4CDWB 4RHV2 4OHYA 4I0BA 4QQOA 1G9CA 1AX0A 4P9WA 2HKXA 2OUHA 1OHFA 1TNFA 4GH4A 4L99A 4XFCA 3AXEA 1XE8A 2BFUS 4YZ1A 4YW5A 4CEWB 3S6PA 2W52A 4LBJA 3ZX7A 5A33B 1NCQB 4KGGA 2QDRA 3RPQA 1RC6A 4Q26A 1QGLA 2X8KA 4WZFA 1NG0A 4Y1XA 3I59A 1KRIA 1LJ7A 2QKDA 5BY5A 3OGGA 2ZGQA 2WZR2 3WP4A 1ULCA 4L8QA 1JW6A 2Q30A 4MYEA 3I2DA 1DDLA 1DHKB 4YVWB 4JGYA 1V6MA 4C90A 1IS4A 1NCRB 1Q8SA 1MS5A 2UYBA 4LNVA 3WDWA 2A3YA 5AFEA 2TBVA 1NA1A 3OGJA 4JVAA 1RUJ3 3D6EA 3KM5A 1RL3A 4LO4B 4PLNA 1DLLA 3SCHA 4IV1A 5J37A 4WVMB 4HKOA 1NXD1 1ZX5A 4ASMB 1KXGA 1Q8PA 2VY0A 1Y7BA 3WXPA 4HVQA 3AX4A 5DUUA 1RUC3 4C0BA 5GZCA 1O4TA 1TNRA 1WMEA 1RUD3 4Q4X1 1M06G 2I2SA 4KWLA 1O4YA 2WQZC 3IN9A 1A6CA 2XLGA 3H7JA 1AR93 1BCXA 5HXVA 1RUG1 1YIFA 5C6CA 4ONUA 4H14A 4D94A 1OI6A 3WINE 3IIAA 4XZPA 1G86A 3EBRA 3MW4A 4NWWA 5CA6A 3AKSA 3E97A 2X5IB 3WLUA 5BNOA 4LBQA 1F31A 2ETEA 1WCSA 1UN1A 2A3XA 2XJSA 4B3NA 1AX1A 2EXIA 2YGMA 3GBWA 1HXS1 3ZXGA 3G7DA 1QJX3 1RUH3 1WW4A 4MZUA 1QJU1 2NMOA 3PVNA 3AP4A 4EN6B 3USSA 2XG3A 4B4RA 2XBO3 1A8MA 2IWGB 1LOAA 4XE9A 2W0XA 1XU1A 5CU1A 3WDUA 1CIWA 1PVC3 1ND3A 3V56A 4CEYB 4IEWA 1OA2A 1FNYA 3IM0A 4RGGA 3NKTA 4FOVA 5GKAC 1DZTA 2ARBA 4DB5A 3NL1A 1E57A 3WZ1A 5CVRA 2W68A 1U5YA 4QPIB 1LECA 4MXVA 2EVXA 4GKXA 4E4ZA 1CX4A 2VOKA 1XQNA 2BYVE 3WG2A 1SFYA 4IL7A 2C1FA 2XL9A 2AR6A 4E4SA 2CV6A 3IBMA 4AVVA 1YNAA 1ONAA 1BK1A 3LSDA 2UURA 1V6OA 4AQSA 1Q5OA 3RI8A 1ND2B 2H6BA 3QH6A 2JD4A 3RJRA 3WQ7A 3I7DA 3MDPA 4LA2A 4MGYE 4YZ5A 1RUJ1 1UW8A 3VBSB 4CRQA 4DQAA 1DQ5A 2XVKA 4O9GA 2PAKA 4CZSA 3D4KA 2BW8A 3WDTA 2NMNA 3PVEA 4Q2FA 3RSJA 4ASLA 4S2FA 1RUC1 5C8CC 2VW1A 2IC1A 3N4MA 1RUD1 2RE9A 2ZGPA 3JQXA 1NYWA 1H2NA 2ZZJA 1FXZA 3DL3A 5I0SA 2QE3A 1AR91 1HRV3 2XWJB 1SMVA 3VKMA 1GSLA 4GB33 4CDQC 3H1MA 3NKGA 4BOWA 1N3QA 2EAKA 1GNZA 1MZ5A 4AEJA 4P9XA 4K6BA 3V0AB 1RUI3 1W0OA 2B9UA 4WM7C 3TWIA 5EWSA 2BBVA 2WSUA 4Q4X2 1LHWA 1QF3A 2XKOA 4TLFA 2VVDA 3MLKA 2BQPA 2ZCWA 3PVOA 3LA2A 5FLHA 2ZGUA 3POYA 5D8AC 1QJX1 1RUG2 5J96B 1AR73 2R49A 1RUH1 2PAEA 4Z1VA 5CIRA 2ZGLA 4P9IA 1VJ2A 2JKBA 3RYKA 3MIBA 2ZMLA 3ZYPA 2ZTNA 4JGZC 2ZX1A 4JDMA 3IT8A 3JQWA 2XBO1 2UYAA 4M3CB 1Q43A 1SCRA 3POWA 1PVC1 3RNSA 2XVGA 4FXGB 4NR1A 3POSA 2E63A 1HXS2 4WZCA 3J4UH 1AYM3 3MICA 1I5ZA 3B9CA 2VMHA 4NWVA 2GH8A 4YRDA 3L2HA 1QJU2 3CU7A 1PZ8A 2DFBA 4AGVA 3AFGA 2WSVA 1C3HA 4NPRA 1S0EA 2PHFA 3K48A 4CDXB 4DY5A 4FBFA 2PHXA 4Y1YA 1C28A 2Q8OA 4RQPC 1D4M3 1PO11 4IXLA 1LCLA 2GNBA 4YLZA 3M1HA 1VB2A 3ILNA 1XE7A 4BHPA 1LR5A 5ABJB 2B7YA 2E51A 4FPYA 1YHFA 3OYWA 2VQ0A 4Y4YA 3ZFFC 4B8EA 5C8CA 4IESA 3THPA 4RFT0 2RS53 3V64A 1CVNA 5L19A 4CDUC 1H8TC 3VBOB 3NWKA 4PDWB 4B4QA 1BEV3 1HRV1 1RUJ2 3USUA 4YGDA 1WLCA 2JE7A 2N7GA 4GB31 3NV1A 2Q0AA 2VVFA 4Y22B 2GC3A 3ZXDA 2PHLA 2UWBA 1S55A 4COZA 4WM7A 3DKWA 4X8PA 2JG8B 4GMP0 1QJY3 3J8F3 1X7NA 1RUC2 3CLPA 4JC1A 4WVZA 1ALYA 3ZYGA 2WNVC 1RUD2 3FFZA 1CJDA 2WQ4A 2CY6A 1NE4A 2WNUA 1Q8OA 2Y0OA 5CG9A 2PHRA 4IV3A 5LEJA 5D8AA 3T1MA 3E6CC 3MGUA 1REFA 1AVBA 1QOOA 3LSEA 4FP3A 4QQLA 1AR92 1YYNA 4JV4A 3RRDA 3VUOA 3TAYA 1AR71 3H50A 2MHFA 4JGZA 3S7EA 3NV4A 5KXDA 3GHNA 4PIXA 1WW7A 4MX3A 1HQNA 3WG4A 5FMOS 1S0IA 3NAPB 4UW3A 3UKVA 4DRRA 1NLRA 4QX5A 3CEWA 5L36A 1HQWA 5C4WB 5IK8A 2ZS6B 1ENSA 4Y1VA 1GBGA 1AYM1 1QJX2 2F6BA 4PJYA 1N1TA 1RUH2 1GKBA 2D5HA 1IHMA 3BOWA 3AJYA 1HKDA 1R093 1VAVA 1JTZX 1BBT3 4D69A 2FZ1A 1EPZA 1TE1B 3VBHA 2DWRA 2XBO2 3VBFC 1F2NA 5HI0A 4FTSA 4YVSB 3LAGA 2HWE3 1KJLA 2VW2A 4HSLA 1VBD3 1PVC2 1LGBA 3CJIB 2IXCA 4JDNA 1D4M1 2HWF3 1QWRA 1GYKA 3FFQA 2IXLA 5KXEA 3G6JB 1REEA 4L9BA 4IEUA 4XF3A 5CFDB 3GZTB 4Q0PA 1QXPA 1QOSA 2ZZQA 4AVBA 5CNAA 1C8M3 3QD6A 3AP5A 5H9RA 2O0OA 4N53B 1FI2A 3ZMOA 5BNQA 3ZXKA 3OY8B 3H8UA 2CL2A 1QH7A 1XYPA 3ZFFA 5CAZA 1QNWA 1F5JA 1CAXA 4K3UA 1FV3A 4XF1A 5K0UB 3AJZA 5FQ0A 5FAXA 2RS51 5IUQA 1DIWA 2AGSA 3WP5A 2VUAA 4FXKB 2VVEA 1QQP3 1PO23 4QQHA 1BEV1 1MQTA 2D40A 4JAAA 4COWA 1UF2C 2LALA 5CB7A 2HJIA 4EN0A 1MS3A 2GC2A 3JU9A 2B5HA 4QD2A 1AYN3 1OOPB 2YDEA 1DQ2A 3AP6A 4K7JA 2FQPA 1QJY1 3J8F1 4LULA 1UD1A 1UCXA 1D2QA 3JBG3 2Z42A 2EF6A 2D6MA 1AXKA 5DZFA 5L7OB 4KG8A 2WFF3 1QMJA 3LB9A 5BXXA 3ZFGC 2GNTA 4BZ4A 4N9IA 4PIZA 1HRV2 3Q9OA 1RUF3 4J1WA 4LLOA 4XW3A 1JHNA 2DF7A 4GB32 4YGBA 2CAUA 5T55A 3QH7A 5H9SA 2B42B 3CO2A 4AEMA 2ZX0A 2DUPA 3RJ2X 1COV3 1PVXA 2R063 3IDCB 4Z2WA 4BQ1A 1H4HA 1VALA 4C1WA 2UY8A 4XJ9A 1YUDA 3AM2A 5FREA 3AMMA 2ET1A 5JOWA 3KMHA 4HLTA 5KHGA 4YW3A 4HKWA 1AR72 3ZO0B 5CADA 2WT2A 1MS9A 5T50A 2D97A 1J1TA 1YCIA 2DUQA 4HPKA 1R091 2PHDA 4UW6A 1S0DA 1PK6C 3VBFA 4XMAA 1BBT1 1G7YA 1HX6A 1VP6A 2Q5TA 3AMHA 4DFSA 1VBD1 2ZGMA 5C8WA 1G9DA 1HW5A 2DCKA 3AP7A 2HWF1 1LEDA 3BCWA 4XJ8A 4K9SA 1AYM2 5KXBA 1OFSA 1OMIA 3BB6A 2DTWA 3ZFEC 1FX5A 3DUIA 1C8M1 5LEKA 4PF5A 2TEPA 3N3HA 3VBUC 2ZX2A 3M8LA 5DUXA 4CP2A 1U5XA 1N3OA 3BIWE 4QQ2A 4ZU4A 3SCFA 3ES1A 1D4VB 4A3XA 3I4IA 3D8CA 3A0NA 1D4M2 3DPRB 4FO9A 4N90A 4XFBA 1DGRA 1B09A 4HZFA 4ISQA 5I8SA 5JPNB 3M70A 3VDDC 1QQP1 4FQZA 1UZZA 1PO21 1SDWA 2RS13 1CR7A 1LHOA 1K5MC 2JE9A 1R1A3 1V70A 2P2KA 4XQ4A 4ES9A 4QU2A 2ZGOA 3UKTA 4MGZE 4EV0A 2JXAA 3HN1A 3IDEA 1AYN1 4JRAA 1Y9QA 5FO8B 3U4XA 4LO6B 1ZA4A 2Z69A 2RS52 1MZ6A 4LA3A 2GMPA 3JBG1 4UW5A 2I07B 5C33A 4DNYA 3ZFGA 2WFF1 3AMPA 2EXHA 3KQRA 3VHRA 1BEV2 4N43A 2R1BA 5GM0A 1DF0A 2K9ZA 1N47A 2JG9B 2C0ZA 4E2GA 3KCCA 1ENQA 5J36A 2C9AA 5FTTC 1LOFA 3WW2A 3RI9A 4WM8C 5I0RA 4UBHA 2XUMA 4F8AA 2R061 1COV1 1QJY2 1S0BA 1XNKA 1KS5A 3J8F2 4SBVA 3B3QE 3VKNA 4AFMA 2VOWA 3QOPA 1REDA 4GH4B 4YM1A 5C9AC 3O0VA 1S2BA 4AE2A 1VAMA 4YZ4A 2D3PA 4I2OA 1NQDA 3WCSA 2OA2A 4LE4A 3ETQA 2RMU3 3KT7A 4AHYA 3APBA 4QHBA 5GALA 4AGGA 4Z92B 2CGOA 2D6OX 1IQAA 2Z79A 2UWAA 4BPZA 3T1LA 1ULDA 5AC93 1AR63 3R4SA 1ZM1A 2QFEA 1UAIA 4I02A 4CDWC 3AKQA 3ZPYA 3ZFEA 3AKPA 1SLIA 4LE3A 3VL8A 4JGYB 4CEWC 3H3ZA 1V6IA 4FTBA 1NCQC 1R092 4R4ZA 1JXNA 1Z7S1 1BBT2 1GV9A 2DCJA 3JD73 4IV1B 1JYIA 1L3JA 4LBLA 1VBD2 3ZSMA 3TB0A 3BU7A 3VKOA 4Q0VA 2HWF2 4EWEA 3HT2A 2D3RA 4ATFA 2XH6A 2O1QA 1UU4A 2WA4A 5DXDA 2BNOA 1K5MA 4LBNA 5JR7B 2RS11 4BE3A 4W6YA 1X50A 4BIOA 4QPGA 2OYZA 1C8M2 5HBAA 4YVWC 2XJTA 1X36A 1R1A1 1CD3G 1NCRC 1I1EA 2XPJA 3VZOA 3AYCA 5LK5A 4D3WA 4XF4A 1POV0 5JDBA 4H7LA 1O3QA 2B39A 2GNDA 5A3MA 3WD5A 2D6KA 3FX3A 5T5PA 4P5HA 4FPCA 4JQRA 1QQP2 1PO22 2GALA 4Q0QA 5BNPB 1O4ZA 3TNPB 4OZXA 5BNOB 5IK5A 4LBQB 3FBMA 4Q4Y3 2TNFA 4BM8A 1UU5A 3E6DA 2HWD3 1FNZA 4KWKA 1LEMA 1RMU3 4WM8A 3LOIA 3THTA 1AYN2 3WHTA 1BMV1 3HT1A 4HVRA 3MW2A 4KQ7A 2MNGA 3URFA 1WMFA 1AF9A 4DRVA 4AQTA 5C9AA 2D3SA 2HEYF 3B5LB 4ZU5A 3JBG2 4Y5Z0 3ILFA 2WFF2 4O9EA 1ND3B 3M3CA 1RUF2 5JI7A 3FBYA 2X5IC 2RMU1 5GZFA 1XYOA 3BOPA 1FOD3 1MS1A 3VGIA 2Z2SB 4J6GA 2EXKA 2XLFA 3VHOA 5JZGA 1MZEA 3KZ4C 1IOAA 5BUVA 4PLMA 4Q4V3 1COV2 2R062 5T5LA 4S2GA 4CDWA 3HBZA 2E7TA 1AR61 4YZ2A 5AC91 3WCRA 2BPA2 4OLLA 1RHI3 2V5YA 3WV6A 1YRZA 2XB6C 1MACA 4CEWA 4FAGA 4TZDA 4HN1A 1NCQA 4XFHA 3GBGA 4P9YA 1W6PB 3PMSA 4CEYC 2ZHNA 3BTAA 5H9QA 1MR5A 3WUDA 3JD71 2LM3A 4XIKA 1X82A 1XRUA 1WBLA 1H0BA 1J58A 4GULA 1AHSA 1BVP1 4QPIC 4F83A 3SISA 2PTMA 2R6QA 1S0JA 2VMGA 2ZKLA 4OFGA 1J3RA 2XVLA 5K7PA 1F8VA 1Y3TA 4GQ7A 5KHKA 3MEPA 4L97A 3TNQA 1V6KA 1Z7S2 1FT9A 1LTEA 2UY9A 4HKLA 1WW5A 3SLIA 3P3PA 5DUWA 1ND2C 3AYEA 3FUOA 4XFGA 3IPVA 2NQYA 4XXPA 4I3PA 3VBSC 3WP6A 5IK4A 3IWZA 4K20A 4A7KA 4CP0A 5JSOA 4R9DA 4COVA 4IEVA 2RS12 1IKQA 1WBFA 2PA7A 3LA3A 5FOBB 2OPKA 4DY3A 2FMDA 4Q4Y1 1PO13 3AZYA 1R1A2 3ZDSA 4XF0A 3VV1A 2HWD1 2P3JA 4ZXKA 4TSVA 5DZEA 5FFOC 1RMU1 4BMBA 2YROA 1ASJ3 2BEOA 1A3KA 5E16A 3M3OA 3VBRB 5AVAA 4AHXA 1ZRCA 4ZU7A 5TSWA 1W0PA 5FLJA 1DGWX 2JEMA 2DURA 4HT1T 4LBKA 4MVTA 1SCSA 3TOJA 2KXLA 2X5IA 3M4FA 1CAVB 1LOEA 5DG2A 1YJKA 4XOGA 1R1ZA 2OVUA 1FOD1 1YWKA 4Q8LA 5DG1A 3RWNA 4AK3A 2RR13 3AZXA 1BMV2 2AYHA 2BTVC 1DGRN 2DU0A 1LOGA 4Q4V1 4KL1A 1HRI3 2PLV3 4QGMA 1GZWA 1UX6A 2ERFA 2R043 1NXMA 1HV1A 2H6CA 4R52A 1RUOA 1RHI1 4BH9A 1XNCA 1Z0HA 2SLIA 4I30A 1DQ0A 2RMU2 4AWDA 1QXRA 4FPEA 4XILA 2DCZA 2ZGSA 1ZZCA 3M3QA 4AFDA 4F7ZA 1V6LA 4BIFA 3KCYA 5GLWA 2I74A 1SFNA 3FUQA 1WA4A 2D7FA 1SLCA 2P3KA 4AXOA 5AC92 1UPIA 2YXSA 1W6NA 1AR62 1UIKA 2NLRA 1LGNA 4OVEA 5CFCB 3NVCA 3AXDA 4M0NA 4PLOA 4CDXC 3RYPA 3B02A 2G4IA 2H0VA 2R073 4AI3A 4BYYA 4RSUA 4HMZA 1YFXA 1CAWA 2YYOA 2WA3A 4I0WB 1OA4A 1RGSA 1LESA 1ND2A 1XNDA 1KS4A 2QUOA 4GMP1 4AFCA 3USUB 3EHKA 3JD72 1JUIA 4ISRA 3AB0A 3VBSA 3E5XA 4FT8A 3OF1A 4YGCA 5ABJC 5F5QA 3M3EA 3AZWA 3PVBB 1JBCA 3MLJA 1I6XA 2YZ4A 4QXKA 5FO9B 3V0BB 1FAYA 1LHUA 1SQ4A 2WNUB 3WOGA 1O91A 2B46X 4A7ZA 4IV3B 3H7YA 2ES3A 1M4WA 3LA7A 5BPXA 4QGLA 1GFF2 2NZ9A 3RMYA 5GLZA 1QY4A 1GQGA 1U12A 2D5FA 4FOWA 3UKNA 3VBOC 1ASJ1 4PDWC 4BMEA 3AFKA 5KC5A 1D2SA 1W39A 1WLDA 2W08A 4YM0A 1F5FA 2D6LX 2X29A 4JTNA 4Y20A 4XYXA 3V0AA 4UW4A 1IPJA 1B35B 5EFUA 2ZAAA 4Q4Y2 4K40A 2R30A 2JG8C 4B4PA 1UZYA 2HWD2 3MIGA 5A32B 3SH5A 1ULFA 5JSRA 4FPKA 1RMU2 3GBFA 1LHVA 2RR11 4XFAA 4HANA 3U07A 4CDQA 4D7SA 3CNAA 2DCTA 4A7YA 4ES8A 1HRI1 2VECA 5JVVA 5JOZA 1RB8G 2DVAA 2PLV1 3VBHB 5T52A 5FLIA 3V65A 2Z5WA 2PFWA 2R041 1CJPA 3WDXA 5AVPA 3GZUC 2LTNA 2BWAA 1UKRA 4AI8A 4CP1A 4Z82A 1XU2A 4M3CA 4L11A 4KWJA 3LZZA 5GLUA 3NAPC 3PJYA 1N1YA 1YXWA 1FOD2 3WX5A 2CWSA 1BQPA 2Q1ZB 1F9KA 5C4WC 2JJ6A 1FPN3 1I3HA 3CL1A 4Q4V2 4OI0A 3NJZA 2Q4SA 4YGEA 1J3QA 5HCBA 1JH5A 2XJVA 4CDXA 1YJLA 4NN0A 1T6GC 1RHI2 3U10A 3ASIA 3DGTA 4FSJA 3KD4A