3EQEA

Crystal structure of the yubc protein from bacillus subtilis. northeast structural genomics consortium target sr112.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
SHMELYECIQDIFGGLKNPSVKDLATSLKQIPNAAKLSQPYIKEPDQYAYGRNAIYRNNELEIIVINIPPNKETTVHDHGQSIGCAMVLEGKLLNSIYRSTGEHAELSNSYFVHEGECLISTKGLIHKMSNPTSERMVSLHVYSPPLEDMTVFEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cystein dioxygenase
publication title Crystal structure of the YubC protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 26
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3eqeA00
1CAVB 2F4PA 1NE6A 2GC2A 4IEVA 4X6QB 3SHRA 2O1QA 4EWEA 3RYPA 1OD5A 2P17A 3NL1A 4I2OA 1CGPA 4OLLA 1O7FA 1Q3EA 2GZWA 2ET1A 3CLPA 1V70A 2BGCA 3UKVA 5I0SA 1ZZ7A 4FT8A 1GQGA 1OI6A 2CAUA 5FQ0A 1RC6A 4IEYA 4KWJA 3IWZA 2BEOA 2PTMA 3H1MA 3FHIB 3OCPA 1DZRA 5KHHA 1J58A 4QGMA 1ZRFA 2B9UA 2GH2A 4Q0PA 4D7TA 3M70A 1OMIA 3KGZA 3NVCA 1G6NA 3ETQA 4MGYE 3E97A 4AQ6A 1XE8A 2OZJA 1CAUB 4PIXA 4EV0A 4R8HA 1I5ZA 4Z07A 1IPJA 1I6XA 4I09A 1H1IA 1O5LA 4MV2A 5KHKA 2IC1A 4EWDA 2GC3A 2UYAA 4I01A 4E2GA 1O5UA 1X82A 4HBNA 2OZ6A 3EBRA 2QDRA 1Y9QA 3N4MA 4H7LA 3LA3A 3LOIA 3EO6A 2Z2SB 3MYXA 4A2UA 4YARA 5CU1A 3TNQA 2EVXA 3E5UA 2XKOA 3E5QA 4HVQA 2HKXA 3H1WA 4XFAA 4L2NA 3OGJA 4AQ2A 1L3JA 3ES4A 2PFWA 1QXJA 3IDCB 3GBFA 1VR3A 3B02A 3KGLA 2IXLA 3CL1A 1RTVA 2QCSB 4XF9A 3WW1A 4HN1A 4HSJA 5I0TA 5D1IA 3S0MA 1O3QA 4AVAA 2CGPA 3H1YA 3KMHA 3I59B 2K0GA 3HQXA 2GC0A 1EY2A 2VPVA 4YYOA 5E1RA 3JZVA 4JVAA 4MH0E 3C3VA 1EP0A 5I93A 2Q4SA 3NJZA 2WFPA 3CF6E 3SXWA 3OF1A 1CAWA 5LEKA 1J3RA 4N9IA 1QXRA 1CAXA 3BPZA 4E2SA 5HI0A 3MPBA 4WVZA 3H3UA 3H7JA 3TNPB 3FWEA 1RUNA 4IEXA 3PLQA 3H9AA 1CAWB 2BNMA 3FX3A 2B8MA 3BCWA 1EPZA 4EROA 3NSTA 2XGXA 1ZZ8A 4FAHA 5FDBA 2QVSB 4XF3A 1XRUA 4KU8A 1U12A 2IXJA 1JUHA 4Q0QA 3S7EA 1WA4A 4FBFA 5JSRA 2IXHA 2Q30A 2E9QA 2UY8A 4HN0A 5JAXA 4F8AA 1YHFA 1QY4A 5BUVA 5J7MA 1LR5A 2EA7A 1GQHA 2VECA 3GYDA 4HSLA 3U10A 3SMHA 2ZCWA 4IESA 4LULA 1O3SA 3BU7A 3O14A 4XFIA 2FQPA 4WBBA 5FQ0B 4PJYA 4QM8A 3LAGA 4QXKA 5FLIA 1YFXA 4QMAA 4E2QA 5I8YA 4WZCA 2GC1A 1NZCA 2HJIA 4ZU4A 3H8UA 3FJSA 1PMIA 2ETEA 3QOPA 4Q0UA 4Q0SA 4CYDA 1RUOA 4MGZE 3RNSA 1NYWA 3ES1A 2D93A 3ROUA 5BV6A 5I0RA 3ST7A 4RD7A 1H1MA 4LA3A 2BNNA 4LA2A 2PHLA 4QX5A 3RZZA 2O8QA 4AXOA 4HMZA 2PHDA 2KXLA 2QNKA 2D5FA 1EYBA 2D40A 1ZVFA 4JTNA 1LRHA 3BALA 4IERA 3I7DA 3RYRA 2ZKLA 1UD1A 2PAMA 5FLHA 5FPZA 2VQAA 3DV8A 1SEFA 5EZWA 1RGSA 2MHFA 1LKNA 4XEZA 3DN7A 4EWAA 5FLJA 4D7SA 4XETA 1IPKA 2IXCA 1Q43A 5LEJA 2MNGA 4IETA 3UKNA 4TLFA 1SQ4A 3NW4A 1TQ5A 4LLOA 3R6SA 1WLTA 1SFNA 2H0VA 3E6BA 4META 4I02A 4QGNA 4YNIA 4MZUA 5K8SA 2ATFA 2GAUA 3RDIA 2ET7A 1VJ2A 3S7IA 4N9HA 5BPXA 3SCHA 4XFBA 1YUDA 3LZZA 3SCGA 3UKTA 3U0ZA 3H7YA 4PIZA 3E6CC 2OYZA 3D0SA 4ZU7A 5EFUA 5CADA 5FPXA 3QACA 1NE4A 3D0JA 4OFGA 1FT9A 2UY9A 1OFNA 4QGLA 4KU7A 5JSPA 1CAXB 2C0ZA 2FMYA 4XF0A 4GULA 4I0BA 4HVRA 1UCXA 2OPKA 3EJKA 4XFCA 1YFWA 4LTAA 1ZX5A 4B29A 4YRDA 1CAVA 1NXMA 2XLGA 1WGPA 2Y0OA 5LRRA 4HVOA 4AVBA 3MDPA 4PIYA 1X8EA 2XKPA 1HW5A 1LB2A 3LA2A 1ZZBA 2H6BA 2PAEA 5JCTA 1Y3TA 3U11A 4ONUA 4JTOA 1ZREA 4JV4A 4KL1A 2PYTA 3WW4A 4Q29A 1ZNPA 2WC2A 3OTFA 5JSOA 2PAKA 3HT1A 2XHKA 4MX3A 4F7ZA 2H6CA 1YFUA 5FCCA 4R52A 1ZZCA 2BYVE 3M3IA 1RL3A 3CO2A 3MZHA 4BIFA 3HIFA 1ZZ6A 2CV6A 4J1XA 3VHRA 4XF1A 1CAUA 4UBGA 5BY5A 3USSA 5JR7B 4DINB 4HZFA 4AVCA 2OA2A 1O3TA 3RYKA 4X6RB 5I91A 2XL9A 4KWKA 1ZRDA 1J3QA 2K9ZA 4P9GA 1UW8A 4QM9A 4Z82A 2XL7A 3ELNA 3SCFA 1VP6A 4IEUA 3LWCA 3FE5A 1ZZ9A 3IBMA 4I3PA 1QWRA 2CAVA 4LEJA 4IEZA 3G7DA 5F1RA 5KHIA 3E5XA 4MGIE 1DGWA 3RPQA 3NKTA 2V09A 3WW3A 1J3PA 2BNOA 4BYYA 4ORFA 4XF4A 4YSFA 4K8FA 1X8MA 3D82A 5I8TA 5KHJA 1O3RA 2Q1ZB 2QJVA 4UXAA 1PM7A 4IEQA 5J48A 1YFYA 2IXIA 4O9GA 1YLLA 4J1WA 4KWLA 4UBHA 4XFGA 5C6CA 1Q5OA 4BH9A 1FXZA 4IEPA 3DL3A 3L2HA 4IEOA 4O9EA 2PA7A 5KHGA 5I0UA 4LUMA 2Z69A 5T3NA 2MPFA 3E6DA 3ZDSA 2N7GA 5CVRA 1J59A 3I59A 3FZ3A 2I45A 4IEWA 3IDBB 4ZU5A 1YWKA 4NVPA 3IIAA 2XLFA 1UPIA 3EHKA 4I0AA 4XFFA 4BHPA 3HT2A 3BB6A 2B5HA 2GU9A 3ACLA 3OD0A 2IXKA 3KCCA 3I54A 1O4TA 1UIJA 3DKWA 2D5HA 1J1LA 4MUVA 3H50A 3EQEA 5LRSA 4FAGA 2EAAA 3FFQA 3LA7A 5KBFA 1DZTA 2DCTA 2PQQA 3CEWA 1DGRA 4MGKE 5E16A 5J3UA 5BXXA 2Q0AA 5I8SA 2XLAA 5AVPA 3PNAA 1XE7A 3WW2A 1UIKA 3KSCA 4Q0VA 5C8WA 3CJXA 1CX4A 4LUKA 1X7NA 3PVBB 1FI2A 2UYBA 4XFHA 3H3ZA 4HLTA 4L11A 1ZRCA 1ZRRA
chains in the Genus database with same CATH superfamily
1NAEA 5CIRA 2ARBA 3UJQA 5LA2A 5ANNA 2E53A 2GC2A 3AVSA 4RHV2 5C4WA 3UJOA 4D6SA 3KCXA 5DUVA 2B39A 2WINB 1FOD2 4XUPA 4Y20B 5K9YA 2XQXA 1CGPA 1QQP3 3M8LA 4G9SB 5E6HA 4CXXA 3CLPA 2RHPA 3KM5A 1J83A 3HN3A 1RC6A 3MF6A 4IEYA 3IWZA 1W0NA 3R05A 2BEOA 4BMBA 3H1MA 4IV3C 3TRSB 3T3YA 5ABJC 1PO23 1S0FA 4NAMA 5DQ0A 1DZRA 4JDMA 1PGL2 5IVJA 1SACA 5DDJ2 4AVTA 1NA1A 4AE2A 4XDQA 1ZRFA 3VBHC 4EZ4A 2NM1A 4E9KA 1Z7S1 1OMIA 4QB6A 1S0DA 3VZKA 3S6PA 1YRZA 4CZSA 5AVAA 1OF4A 2AH2A 2V5YA 1AR91 3CBNA 1G6NA 1SLCA 1VBB3 2D6LX 3CQOA 4GB33 2W68A 4BQ4A 4IV1C 4WVMA 2P3JA 4EV0A 5FO8B 1NA1B 2JX9A 4OI2A 1RMU1 1STMA 1DG6A 4JGYB 4QKBA 2VZ1A 4GH4B 3IKWA 1I6XA 2JG8C 3ZSJA 2PHUA 5F37A 2Q5TA 1DQ4A 4MV2A 1RJ8A 1QJX3 1VAKA 2WYSA 2YPJA 5KHKA 2IC1A 4FPHA 1Z78A 3AP7A 3IPVA 5CA6A 4OQ8A 4GIQA 4E2GA 2WFF1 1A78A 1X82A 4HBNA 3EBRA 2DVAA 4NHMA 1TNRA 3N4MA 1RVF2 3RGBA 2XBO2 3CZUA 3FLRA 4XAAA 4Q4Y1 3EO6A 1JOBA 4CCCA 4E4HA 1PMJX 4QDRA 4KBBA 1W2UA 1WZXA 3MEPA 5FY1A 2IVIB 2ZAAA 2XQRA 4HG6B 4DPNA 1QJFA 4CEYA 3DGTA 2O0OA 4N8MA 2WO7A 4PQQA 1ULOA 4XFAA 2XUMA 1QNYA 5LBEA 2EIEA 1HRI3 4Y1XA 2ZMKA 3TB0A 4ES8A 1OBNA 4OI1A 4OHXA 3FLTA 4WVWA 3RJRA 1QXJA 2HWD2 2QQNA 3GBFA 1ZBE3 4K3UA 1QNWA 1VR3A 3J9SA 4UFIA 1VBD3 2VQUA 4CDXC 5FZ1A 5DXDA 1GZTA 2OIIA 4P9IA 5FPUA 3CL1A 4QDQA 1GR3A 2YYOA 2WA3A 4CEYB 1QJU2 2C4XA 1GYKA 1D2SA 2WNVA 3AKRA 1OKOA 1XNAA 4HSJA 4LKDA 1ENXA 2X29A 2IVJA 5A7SA 2P3YA 2XXZA 1WCDJ 2OVUA 3USUB 2A75A 5D1IA 1UZZA 3MPPG 4IE4A 4TYSA 5A1LA 1O3QA 5FMBA 2Y6JA 3KT1A 3H1YA 3N35A 3KMHA 4DB5A 1H0BA 1EV12 5FZ3A 3KWVA 3AKTA 1OUXA 3VBOB 1S0GA 1MS3A 1QEXA 2VUDA 2WJSA 3ZM8A 5HCAA 2W1SA 5FFOC 2WNVB 2AZ5A 4OUEA 4AYUA 4CDWA 1GU3A 3I2OA 2V72A 2WNEA 4QX8A 4PDWA 2Q4SA 3NJZA 2WFPA 5T5LA 2ZZQA 1C1LA 1H8TA 1S0CA 3OEAA 3BTAA 2BV4A 3BOWA 2GN7A 3PUAA 1J3RA 1RUE3 3FL7A 2W91A 2WQZC 4CSWA 5LK7B 1CAXA 4XQDA 3BPZA 4V1PA 4XZPA 2DFBA 3ZMOA 4A7ZA 1WD3A 3MPBA 3GALA 4WVZA 5CKMA 4BISA 2ADDA 4NWVA 4CDWB 3ZYPA 1JZ4A 1GBGA 4Q4V2 4PDWB 1VBE2 4FPYA 5DUWA 4BK4A 3PVNA 1RUD2 4HKWA 5F5AA 3H3LA 1RUNA 1R1ZA 3H9AA 1H9WA 2BNMA 4A42A 4XDOA 1C8NA 5JXGA 5KWRA 4RR3A 4WM7A 4JZRA 3POBA 4XILA 4OVEA 4EROA 1CX1A 5F7UA 2D6PA 5H9PA 5T5JA 4Y4YA 4DXZA 5L9VA 3IIIA 3HR9A 4FOVA 4UWDA 1V6IA 3VZLA 1BBT1 2IXJA 1HRV1 5JOZA 2E63A 1XYPA 4DS0A 2YXSA 1JYCA 4BIOA 1JODA 4H14A 1YXWA 1L7QA 5JSRA 4RR3B 2G9FA 4TN7A 4NR1A 4WM7B 4S2FA 2OKXA 4HN0A 4X8PA 1YHFA 4Q4X3 1PGSA 5B4XA 4PI2A 5J7MA 4NAOA 1LR5A 3QH7A 4CUBA 5HCBA 4NROA 4QAWA 2QQUA 3ZN5A 3CKHA 3OPTA 4HSLA 5IVEA 2VBPA 3UV9A 1S0BA 2JKXA 4QQOA 1RUF1 5FZ9A 1GZWB 2V4VA 4YGDA 4LQRA 3DEMA 5HXMA 4JDNA 5G05L 1WA6X 1GSLA 3LF7A 3PJQA 5A3OA 3FMGA 5FUPA 1XNCA 4UFLA 1JS9A 1YFXA 1JTZX 4QMAA 4AFAA 2TBVA 5FZ0A 1UZ0A 1Q8VA 1GOGA 4KGGA 4RYDA 1RUI2 5F39A 1PMIA 3GHMA 2YZ4A 2D44A 4O7XA 1LEMA 3S5AA 2G19A 3LB9A 4GMP0 1O4YA 2ZGRA 2BERA 5FYYA 3ZYJB 4R9AA 2CSGA 1RIRA 2JECA 4NIAA 3APBA 1MS8A 3WP3A 4LA3A 4LA2A 1XE0A 1DP0A 3W9AA 5C9AC 4H55A 3ZR6A 3H0OA 4R4XA 1FPN3 2QNKA 4OUSA 2D6OX 1ALYA 2P4EA 3UGFA 4XMAA 5IVBA 4YW4A 4CEWA 2RS51 5JR2A 2FDHA 2FD8A 4LBLA 1ZVFA 4JKKA 3VBSA 1HQNA 3P1IA 5C8CA 4XJAA 3I7DA 2W9XA 2ZKLA 2CNAA 4EN0A 1BYHA 5F32A 4FOQA 5FPZA 3SH3A 1BQPA 1HJFA 3WG4A 3VUOA 1SEFA 5FZ7A 4ASLA 5EZWA 4CCNA 1RGSA 3ME2A 3T08A 3DN7A 4LBOA 2G4IA 4EWAA 4W65A 3VBSB 5C4WC 2BPA2 3B3QE 5FREA 1PO22 1IPKA 3NV1A 4URTA 3WG2A 3V56A 5FYSA 2FDGA 2ID4A 2JDAA 3T0AA 3UKNA 4LLOA 1TQ5A 3R6SA 3VZMA 4P5YA 4LITA 4P9YA 1WLTA 3RFRA 3KVAA 4CDUC 3AL6A 2PN5A 1VBB2 3RI8A 3DCQA 2Y26A 4META 2Q1FA 4EN9B 4GB32 4MGTA 1Z7S3 2B45X 1S55A 3L9JT 4YGCA 4BQYA 4QT6A 1W3VA 3HBZA 4MZUA 2X05A 1AR93 2EICA 5JXIA 5C5TA 5FZ4A 3WNOA 1DZQA 4RFRB 2J1RA 2J1UA 1UWWA 1V6JA 3AK0A 1QJX2 4EE2A 1W6MA 2WAAA 2R1DA 3URFA 3VHPA 4BM8A 4CUGA 1HKDA 3NAPC 5BPXA 5CNAA 1OHFA 1NCQA 3K77A 2HYKA 1UYXA 3LZZA 3SCGA 3B69A 3IN9A 1GWKA 4GMP1 3H8RA 3JB8A 2WT0A 3D0SA 1LU1A 4L97A 2OYZA 3UESA 1WUVA 3KV9A 5CADA 5DUUA 5FPXA 2J1VA 3UETA 2WFF3 1AX1A 1SZBA 3D0JA 2RMU2 4FFFA 4LKSA 3QBQA 4OFGA 4YM0A 1CWPA 4CXWA 3K2OA 1PNGA 3WG1A 4XF0A 1LAJA 1ZYBA 1KEXA 1PK6B 3SC7X 2NP0A 3WDTA 3GXUA 2WZPP 1XPWA 5FJHA 1HRI2 5ANQA 3AXDA 2NZ9A 1CAVA 4KWUA 2JG9A 1D4M2 1L7LA 3MUY1 5FY8A 2Q1MA 3POFA 1ZBE2 4YGBA 4Y24A 2XKPA 5FMDA 1PZ7A 3MIBA 1NQJA 3ZYRA 1H1AA 4YW1A 5JCTA 5LCWL 1Y3TA 2RG4A 5IYYA 3W5NA 3VBUB 1QHDA 1XJAA 4B1MA 5GZEA 3JD72 2NMOA 5F5QA 2XH6A 2CGOA 2VW1A 2JG9B 1PMHX 2K46A 2MEV2 3SKVA 3T4VA 1IG0A 2PYTA 2YBSA 3HQRA 4MXWA 4Q29A 2XR4A 1IS4A 3R4DB 5GALA 1ZNPA 2WC2A 3OTFA 3VB9A 3D4KA 5J36A 1OSGA 5CZKA 4C1WA 2PAKA 2WT2A 3HT1A 5JSOA 3TEZA 4F7ZA 4LXLA 3ZIWA 2H6CA 3H8OA 4IQPA 5A1AA 3U78A 1H2KA 2Q8OA 4BQ5A 3VHOA 2ORXA 1XSQA 3WOGA 3DKQA 4J1XA 4COYA 1QGLA 3OG2A 4P08A 3NWKA 2GNTA 3LSEA 1UZVA 2LM3A 5FXWA 3NQHA 2WUHA 4P9WA 4HZFA 1UY3A 3KB5A 5FZKA 1O3TA 5IVCA 5CG9A 1SLIA 5IWFA 5CAZA 1ASJ1 1IZ3A 2W5FA 2VZVA 4QM9A 4BXSV 3V64A 4ZZ5A 3Q8AA 1DGWX 3N9MA 4BA6A 1H8TC 1PHMA 3MGUA 5G04L 3WF0A 1CVNA 1UZWA 4EYUA 1DYPA 4E4SA 2W46A 1PVC3 4XCAA 3WP5A 1ZZ9A 2PLV3 4I3PA 1BVVA 2RS13 3WUCA 4LEJA 2ZACA 2BJSA 3K48A 1OVPA 3I8TA 5C5UA 5F1RA 4AI9A 1QDCA 4JRLA 3ZKYA 4HONA 1ND2A 5IAVA 4CUAA 1W2TA 4RSUA 1U5IA 2EIBA 4OI0A 5HBAA 4XJ9A 1HX6A 3NV3A 2AC1A 2GALA 3WV6A 2V09A 2BNOA 2G9ZA 3PUQA 5DPNA 4BYYA 1BBT3 1HRV3 1HXS1 3FHQA 5EYYA 4Q4X2 3AMQA 4PT6A 2VE1A 2ZZJA 1DQ2A 2R0FA 3Q8FA 4NRQA 2XHNA 3POYA 2VOKA 1O3RA 4Z92B 1YI9A 2HYXA 2Q1ZB 3I2DA 4LHKA 5FZIA 2OW4A 2Y64A 3EXUA 1KJRA 4XTMA 4YW6A 5LA9A 1YLLA 4Y33A 4J1WA 2QQLA 4UBHA 4XFGA 3WDYA 1S0JA 3R0RA 3O5SA 2EXIA 4KNCA 2BWCA 3I3QA 1Q5OA 2XDVA 1FXZA 3ITQA 4IEOA 4O9EA 2E7TA 2PA7A 4EJRA 2JDKA 2ZGKA 2VG9A 2KA3A 2JDZA 2IUWA 3K51A 4IV3A 5FYIA 2Z69A 4ISRA 4URAA 5T3NA 2P3IA 4LPLA 3VBHA 2VVFA 2ARCA 2N7GA 3I59A 4ATFA 3O0VA 4IEWA 1W9WA 3AZWA 3LIGA 4ZU5A 3RZKA 2J1TA 2VMIA 5LATA 3HVDA 1N1VA 2VXJA 2PHXA 4NVPA 2VMDA 3EHKA 3T09A 4XC9A 4IV3B 3WT3A 5ABJB 4CUCA 4IV1A 2BW8A 4BHPA 4ASMB 4CDWC 1W8WA 3BB6A 3AMPA 2DTYA 3VBHB 3AXEA 1NLRA 1H6XA 2JG8A 3I4IA 5FP4A 2KR2A 4XXAA 5FMOS 4AEKA 3Q8EA 2GP3A 2R49A 2ZAHA 3T0DA 1JYVA 3DKWA 1Q8QA 1YIFA 5A3NA 1GQPA 5FOBB 4QQPA 4IV1B 1WMDA 1JYWA 4XIOA 1ND3C 1NLQA 3MLJA 3T2TA 1K42A 3I3BA 5D2AA 1E57A 5J37A 2D6KA 2JG8B 3UK9A 3CEWA 5J96B 1DGRA 3F95A 1DLLA 5SV5A 5BXXA 2Q0AA 2RDSA 2WL1A 3VD3A 2A1XA 3ZFFC 4LBQA 4YW7A 3M2MA 1MS5A 1UIKA 3UGHA 1TZOA 4Q0VA 4CEWC 5CFCC 5A33A 2NMNA 1CX4A 4A45A 3ASIA 4Q8LA 5C8CC 5FY5A 1D0HA 4XFHA 5A70A 1BHGA 5IFTA 4HLTA 5J09A 1ZRRA 4B1LA 4GKXA 1P8JA 4YVWC 3T2OA 1NE6A 4IEVA 3SHRA 3MLKA 4X6QB 2GSYA 1WLCA 2XG3A 2WQ4A 3KT4A 4C90A 4YZ2A 2P17A 3DXUA 2P2KA 4OLLA 1CQ9A 1AJKA 1BJQA 1VBD1 2Y34A 2ZTNA 5IUQA 2BOJA 3PDQA 5FZOA 5A32A 5FR3A 4AFBA 3O1PA 1NZIA 3AKQA 3LPFA 1AR92 5EV7A 4QU2A 1ZZ7A 5FQ0A 1OI6A 4B4RA 2YGLA 3TN92 4IE0A 4CDXB 2QQWA 4S2GA 3ZXAC 4C91A 1O4ZA 1AZDA 2VU9A 4QB2A 5FXVA 1JZ8A 1RMU2 1F5FA 4XJ8A 3THCA 1ZRIA 3KV4A 4QGMA 2R6QA 3KS7A 5ERLA 5FZOB 5A32B 2X10A 1XXNA 3OGGA 4J25A 2HLEA 5EJZB 4RQPC 2W52A 2RDRA 1UMHA 2DYCA 4BLJA 3LSDA 4XUTA 2A3YA 3NVCA 3LEGA 2WFF2 4QWNA 4MGYE 5FWJA 5KR7A 3BN6A 3J7HA 4NIDA 5DAWA 5DZGA 4GMP3 1F8VA 2OZJA 1CAUB 1I5ZA 1RUE1 1NCQC 4FOYA 4WM8A 1IPJA 1JW6A 1OLRA 1REDA 4Q4Y2 4M3CB 4YFZA 1IKPA 1H1IA 1O5LA 2WSVA 1JU4A 5L7OC 2VCBA 1AL21 3AYDA 5DAPA 5DZEA 5FO7B 5DAVA 5H9RA 5BNOA 1Y43B 5FKCA 5GLVA 4DFSA 4P9XA 5J98B 1N1TA 3LA3A 1WMXA 4SBVA 3ETPA 3T0BA 2HBUA 4YARA 1QF3A 4YW5A 4C1XA 2B7YA 2J22A 1S2BA 4Q5OA 5CU1A 1NOVA 5C3PA 1F2NA 3ZYHA 5EJ1B 1OLQA 3VKLA 4L92A 3WXPA 2VZPA 2EVXA 3E5UA 5FYMA 3VLBB 4HVQA 2HKXA 3H1WA 5JVVA 4L2NA 1AXKA 2ENRA 4AQ2A 2WWJA 4XZUG 4Y4RA 5LBCA 3TWIA 2QE3A 3ES4A 4L99A 3AKSA 2PFWA 1FYUA 2ZGOA 4RFT0 5FPLA 3CMGA 2JB8A 2R7EB 4CP0A 4QB1A 2YY1A 5GLWA 3N7MA 4AL9A 2WDBA 4UFHA 2QQVA 2RV9A 3P6BA 2QCSB 3NKGA 4LBJA 4R9CA 3WW1A 2ERFA 1W9SA 3RS6A 3AJYA 4MGQA 5I0TA 1D2QA 3GZUC 5DABA 1VRBA 4YZ5A 2CGPA 1B09A 3NMBA 4NOTA 2C5DA 1OFSA 3HQXA 2GC0A 1EY2A 4NHXA 1N3QA 2VUJA 5CFDA 3JZVA 4K7JA 4KQ7A 5DG1A 4JVAA 5A7WA 1ASJ3 3VZNA 1A34A 4RGKA 1GOFA 1CIYA 2AREA 5FYVA 5I93A 3ZXFA 1YC61 3SH5A 1VIWB 4QHZA 1CAWA 4R4ZA 1OA3A 2ZJCA 3N9LA 2XB6C 4S2DA 1UL9A 5LEKA 2FMDA 4LOSA 2J1SA 1W8NA 5JDBA 1D4VB 1R091 2Y60A 2Q8CA 2VGDA 1PIV1 1VRH1 3H7JA 3PL0A 1BBT2 4GKYA 1HRV2 5A7WB 5CEHA 1PZ9A 4DEQA 1TEIA 1W05A 1FPN1 4IEXA 5FZCA 1ND2C 5JOWA 1QJY1 2VOTA 1CAWB 4R9DA 3FX3A 1DU3D 2RM21 1QH7A 3U75A 4FQZA 2B8MA 3J7NA 5FUNA 1EPZA 3ACHA 1H9PA 4UT5A 1CIWA 4RL7A 1FV2A 4BZ4A 1RINA 1XRUA 3B94A 2WO3A 2YHJA 3M4FA 2TEPA 3PIGA 1JUHA 1LOCA 1PGW1 4TTGA 1RUG3 1RUF2 2D3PA 2B4KA 3C7GA 2AYHA 3CDZB 3QH6A 3S7EA 4FBFA 2Y0IA 1MACA 3GBWA 2R16A 1CZSA 2VULA 4N53A 3ZLIA 1VAVA 1GNZA 5JAXA 1NCRA 4L8QA 4NHLA 2Y6HA 3MF9A 4P14A 1OD3A 1QOOA 1QY4A 3HOBA 1SMVA 2XONA 3GJBA 2VZRA 3I2HA 2WLPA 5FBZA 4CDUA 2EA7A 2F6BA 1IS5A 2XVLA 2PQSA 4YG6A 2VECA 3WNPA 4AQTA 3A0NA 5C4WB 4XHBA 3EYPA 3ALQA 1BKZA 1OPOA 1GANA 4K9SA 1W04A 3RWKX 5GZDA 3J7LA 4ZY9A 1HDKA 1DQ1A 3BU7A 3Q8BA 2FQPA 1UYYA 3LCPA 1WBLA 4JHZA 4CDUB 1V9U1 4QM8A 3LAGA 5JXHA 4L0PA 5I0DA 2D3SA 3NAPA 1KFXL 1Q8OA 4E2QA 2A6YA 2HJIA 1XBFA 4OUMA 1URXA 2RS31 3H8UA 3ZXDA 1LOAA 1AYN1 3N36A 3ACGA 2RS52 2E7AA 4QU1A 2EALA 2VD7A 3ZYBA 5BV6A 3MIDA 3NAPB 5I0RA 2CY6A 3HNYM 4RD7A 4WVMB 2VCCA 1AL0G 1W9YA 4JQRA 3RZZA 1HJGA 2PXJA 3BUCA 2AUYA 2XVGA 5CKQA 2XMLA 4EQVA 4HMZA 4UFKA 2DCJA 2KXLA 4P9JA 4EZHA 4B8EA 5H9QA 3IPVB 1EYBA 3PMEA 3SNMA 2ZGTA 5FPVA 4JTNA 4YVSC 2I2SA 1LRHA 3VBFC 2DVFA 1YNAA 3AFGA 2VM9A 3RJ2X 3RYRA 1TME1 3NNFA 3ZMNA 3KCYA 2VQAA 1LECA 5FZBA 3KT7A 2ZBJA 3T2QA 3VDCA 3AP6A 3O1OA 1UOJA 2VQ0A 3N9QA 5A6ZA 2MHFA 2HEYF 3N7LA 3VKNA 2FZ1A 1GV9A 2VMEA 4D7SA 5AC91 1S2KA 2GMPA 2Y6GA 1LNSA 2QZ3A 3KV6A 3W59A 2EAKA 1EUUA 5EP9A 1Y7BA 2HWF1 3ZXEA 5JIUA 2CU5A 3NW4A 5FMOL 3X29B 1HN0A 1S0EA 3FHAA 2VMHA 1FV3A 2BGPA 4B4QA 3OOXA 1QDOA 2EIGA 3WF2A 2VJXA 4QGNA 1G9BA 3BIEA 1BVP1 1H6YA 3LFMA 1AYM1 2QDNA 1QH6A 1UOGA 2IFWA 3C7EA 3N3HA 3RVHA 2DVBA 4E4ZA 2P6CA 4K1ZA 3OY8A 4XQWA 4LMFA 4NMIA 1WCUA 2K2SA 4OCTA 4ZHNA 3DUIA 3GF6A 2VL4A 1TMF3 4Y26A 4LBQD 3UKTA 3MV01 1PVC1 1SFPA 1UU6A 1AL23 2W95A 4WM8C 3ABZA 2PLV1 3MV11 2RS11 5EFUA 2OS2A 1H8TB 5LBFA 3AP9A 1UY1A 5DG2A 1EPWA 3C7FA 4HANA 4IL7A 4KU7A 1HB2A 5DAQA 1CAXB 4CCEA 1NQDA 2FMYA 3AZXA 5BNOC 4O61A 2Z4FA 5F3GA 2BBVA 4YW3A 4I0BA 2JENA 1W8TA 2UWCA 1W39A 4HVRA 4OMCA 2OPKA 3EJKA 4XFCA 1ZX5A 4QQHA 4YRDA 3WCSA 1XNDA 2FDKA 2YC2A 1NXMA 2XLGA 4XVHA 3WCRA 1C5HA 3CJIC 3MIHA 3MDPA 4Y22A 5FOJB 3KHBA 4AAPA 1HW5A 2E7QA 1LB2A 1WLWA 2BRTA 2WYFA 1W2NA 5GLUA 4AF9A 1H2MA 2ARAA 2BU9A 1LHOA 3DECA 2ZS6B 4C8DA 5DAXA 4KH9A 1OC1A 4P02B 1MS9A 2FBEA 4JV4A 3ACFA 3WW4A 5F2SA 5T5PA 1X9PA 1XOYA 4Y1UA 3ZDVA 1J1TA 1JOJA 3JQWA 1V6NA 4QDSA 3WP6A 3ZO0B 5LWBA 3B9IA 4DY3A 5IVYA 3B00A 4ZONA 5FXZA 4Q26A 3GCXA 3O1VA 1ASJ2 1AR81 1YFUA 4R52A 3VBRA 1ZZCA 2BP6A 1KDKA 3M3IA 3ZSEA 4BQWA 2QQKA 5EQUA 2FHRA 3P3PA 4BLIA 1KJLA 1WKYA 5JLVA 5F8PA 5F5CA 4AHYA 4NRPA 4AGVA 1Y9GA 4XHXA 4UBGA 4FPGA 5BY5A 4Y1VA 4DRRA 5J1XA 5CFDC 1VMJA 1DF0A 4AVCA 2VZOA 4ZXEA 2OA2A 5FZMA 3RYKA 4X6RB 4IE7A 5I91A 2BOIA 4QX0A 1LESA 2XL9A 3DF0A 4KWKA 1ZRDA 1UMZA 5BNPA 4QKFA 1ND3A 1KQRA 1OF3A 2JXAA 1AX2A 1R093 3SCFA 2PMWB 1PIV3 1VRH3 2W87A 2E31A 3AM2A 1VP6A 1FMD3 1HXS2 2ZEWA 4QD2A 4AVSA 1D0GA 2V5DA 3AP5A 2Q8DA 3HEIA 3ZFFA 4N43C 4GD4A 1QJY3 3B7MA 3MIGA 2BWAA 2E33A 1VBC1 2RM23 4H3WA 1UXXX 5CFCA 4V2WA 1O91A 3E5XA 2EIDA 1W6QA 1IQDC 1ND3B 2A73B 2VY0A 4K20A 5I8TA 1KGYA 1MVQA 4XUNA 3WW3A 2Y6KA 3WG3A 1QQP2 1UKGA 1A8DA 3KF3A 5JOYA 4I3GA 3V0AA 1XSRA 4ORFA 4YVWA 2LUWA 4KG8A 4BJ0A 4YSFA 1JYTA 3AP4A 4H2AA 3ZFFB 4LE4A 3JCIA 1X8MA 1OQDA 2WS93 4DMIA 3WSOA 5CISA 2GP5A 1JN2P 2YC0A 3IT8A 2HBTA 4W6XA 4CEWB 1LCLA 1VBA3 5C3RA 5CFCB 2QJVA 1W6QB 4NHYA 5J48A 1YFYA 1R1A1 3SQOA 5C8CB 3BI3A 1UYPA 1MEC1 4KWLA 1ULEA 1GP6A 3PJYA 4N53C 5A3PA 1R083 1NCRC 4IEPA 3DL3A 3L2HA 4YVWB 3L2YA 3BGAA 4WVVA 2YGMA 3V0AB 4XOGA 2Z79A 2QBXA 4QX1A 4CPBA 5KHGA 2JJ6A 1RUH1 5HV0A 3QD6A 2R061 2WNUA 1VMHA 3VGIA 3VDAA 3E6DA 3ZDSA 4B4PA 3V0BA 2CWSA 4LHNA 5CVRA 1GWMA 3JB4C 3FZ3A 5ACA3 1KDMA 3LQCA 3IDBB 2YPDA 1H4HA 4HKLA 4P00B 4DXSA 1ODMA 1W2AX 4RQPA 1V9U3 4UFMA 1HB3A 1I3HA 5JPMB 3W58A 2D6MA 2JDMA 3PTRB 1RUJ1 4DRVA 3CHXA 2RS33 4K21A 3MLLA 5C3OA 4XFFA 3U14A 1KRIA 1XU2A 3M3OA 5FK7A 3THTA 3V0BB 2GU9A 1AYN3 2BUKA 2OQ6A 2WR9A 3MUZ1 3OGVA 5F3IA 4FPKA 5FZ6A 3VKOA 3OD0A 4RQPB 4NWWA 5L7OA 1HB4A 3WF4A 2GH8A 1HV0A 4G4FA 5F3CA 1CD3G 5DZFA 1GKBA 1UIJA 3VL8A 1OOPC 1W6MB 3DXTA 1AR61 3TEXA 2PHFA 2DUPA 3AZVA 3EQEA 2I74A 5LRSA 4FAGA 2HWE1 3KVBA 1NCQB 3I2FA 4LKFA 5KBFA 3U07A 1DZTA 2YB7A 3ZXGA 2DCTA 2PQQA 3O0XA 5FXXA 5KXBA 4MGKE 1R64A 5L7OB 2ZX2A 4OI4A 2VMCA 3I49A 4XJWA 3ZVXA 1VB4A 2WLQA 3WLUA 1ZBA3 2XLAA 2RJ2A 4WZFA 1TME3 1XE7A 5C7GA 1VBD2 3KSCA 1DQ5A 1KFUL 3GHNA 3CJXA 3ZXLA 1GNHA 2YDEA 5A3UA 4JCKA 3P5BA 3VD7A 2WAOA 1Q56A 1KS4A 4CDQC 4COUA 1MPXA 4L11A 2C9KA 3ILRA 4AI0A 4N90A 1ZRCA 3I2KA 2EXHA 1JXNA 1CAVB 2F4PA 3ZXJA 3LEMA 5AC93 1V0AA 5FMCA 4JDOA 1X9TA 1SLBA 1CPNA 4MO3M 1SG3A 3NL1A 2HWF3 4GALA 4I2OA 2ZXQA 1O7FA 2TNFA 1Q3EA 5FV3A 1B35A 1NUKA 1UYZA 4UF0A 3I2GA 4DNYA 2QQIA 5JMCA 1V70A 2BGCA 3U4SA 1H2LA 4HKOA 1GQGA 1VALA 2CAUA 2R0HA 4Q1RA 1EAH1 2SLIA 4U36A 5GLTA 1A6CA 3V65A 1K5MA 2PTMA 1AYM3 1JU3A 4HL0A 4MXWB 5FZFA 3FHIB 5FWEA 1BXHA 3OCPA 1RUE2 3OBTA 1J58A 1DYKA 3THPA 1FX5A 3K75B 4V2VA 2JE7A 1JBCA 2B9UA 5GZFA 4Q0PA 5F6KA 4UF0B 1GLHA 1E5SA 1H2NA 3DYPA 3WVJA 5AFEA 1SLLA 4LOTA 3KGZA 4GXLA 2ZABA 4HK8A 3WDVA 2X8KA 3ETQA 2ORZA 3B9CA 5FP3A 4D94A 4AQ6A 2ZX3A 4KGQA 1LHWA 2LTNA 4Z07A 5CG8A 5FZLA 2VO5A 3CNAA 3K4AA 1W8HA 1ULGA 4IGQA 3MIFA 3POJA 1UQXA 5E89A 4EWDA 1SDWA 5JUVA 1ACCA 2GC3A 5GKAC 4CA9A 2D7FA 4MGSA 4MXVA 1C4RA 2QDRA 3ACIA 5A7QA 1W6PA 3HNMA 4TWTA 2ZGUA 4ASKA 2DCKA 1JZ3A 3AYAA 2OQ7A 1RUI1 5FUIA 3SITA 2I07B 1ND2B 4B7KA 4AEJA 2AR6A 2Z2SB 4IW3A 4A2UA 2SBAA 1T2XA 3F2ZA 5GZGA 1OVSA 4LBMA 1OQEA 2KD7A 3OYWA 1RUG1 2Y6FA 2XKOA 3E5QA 3BTZA 3GGLA 4AQSA 1YQ6A 2VOWA 4NPRA 1V6MA 3N7JA 4LKEA 5HV4A 1UX6A 5HPOA 4XQ4A 3WD5A 3UGGA 3ZIXA 1L3JA 4LT5A 1SLAA 4M0NA 1SCSA 1IPSA 3PURA 1E5HA 2WZ8A 3NJYA 3J7MA 4UFJA 3OYWB 4OHVA 5JI7A 3KGLA 5CB7A 3VD9A 1LODA 2C26A 1GNYA 3LEIA 4Q27A 3ZPOA 1AR83 1BZWA 1ULDA 3ILFA 4UW4A 1AUYA 3BODA 1FNZA 4XUQA 2JE8A 1W9TA 2JKBA 4Q4W1 3VBRC 5E88A 4FFGA 4INDA 4AVAA 2A7AA 1W6NA 3I59B 1C57A 1LGCA 1R092 1W3XA 2VPVA 4YYOA 1PIV2 1VRH2 1TVGA 3MHZA 2LW8A 2DCYA 1N47A 1F35A 3IAQA 1XNKA 1EP0A 2ZEZA 3AMHA 3C3VA 1FPN2 4MH0E 5CYYA 4BDVB 5K0UC 1QJY2 4JKMA 3SXWA 2RM22 3PHMA 2YU2A 3OF1A 1REEA 4X8NA 3EB7A 2NYYA 5BNPC 4C0BA 1PM4A 5JZGC 1W6NB 2YUEA 4Y5TA 4A6SA 1QXRA 2VOVA 2VZUA 4IXLA 4E8DA 1BMV1 1VBC3 5IVFA 2X53S 5APAA 4ZZ8A 3H3UA 2A6ZA 4ARYA 1PGW2 3ZPYA 5FKBA 1PZ8A 4XYXA 3FWEA 2WZR1 3LDRA 1DYOA 1G9FA 4YVSA 2QKDA 2ZMNA 3PLQA 3VBFA 1ST8A 3CZJA 2PHWA 2VC9A 4FPFA 2RE9A 1AR71 4B7EA 4GQ7A 1WMFA 3LPGA 2DTWA 2XGXA 1LOBA 4LO5B 4NO4A 2QVSB 5FZEA 4AK3A 4D8MA 4CVUA 5FAXA 4BQ3A 4KU8A 4E8CA 4AEDC 1R1A3 1U12A 3P3NA 4LBQB 1MEC3 4YVSB 3W21A 2YFUA 3VBFB 5A33B 1WA4A 2YROA 3FLPA 2W92A 3DPRA 4UW6A 4A7KA 3PVOA 5A3LA 4BQ1A 3WNNA 1Z7S2 2FDIA 5EPAA 2RMU1 4CRQA 2UY8A 4JC1A 1W6OA 2EXJA 3WQ1A 4BCUA 1RUH3 4AGGA 4YM3A 2R063 2Y8KA 1UKRA 4MYEA 2XBO3 3A7QA 2Y6LA 3UNPA 1GQHA 3IDAA 3T1LA 2D3RA 1QKQA 2XJSA 1REFA 2WNUC 3GYDA 3HN1A 1GMMA 3IMNA 3N9PA 4YFWA 3U10A 3VDBA 2ZCWA 5SV8A 2ZMLA 3WNMA 5F2WA 1D4M1 1F9KA 4TSVA 3TYJA 1AYN2 1RUJ3 2JE9A 3VKMA 1SPPA 1W6OB 3O14A 4XFIA 4WBBA 1YCIA 4DOUA 2O8OA 5FQ0B 5LW9A 3OPWA 3MW3A 2DBNA 4LJHA 2XJTA 5LBBA 3NNJA 1GWLA 4NIIA 5BNQA 2HWD3 4WZCA 2YBPA 1NZCA 4LIUA 3JD71 5EXOA 5FYTA 5IK8A 1TE1B 2QTWB 3FJSA 1WD4A 3M7AA 3BTYA 1TMF1 2ZKNA 4Q0UA 1F4AA 1SPPB 2IFRA 4CXYA 4MGZE 1AR63 1MVEA 1VAMA 4ES9A 1IS6A 1DFQA 3RNSA 4N7UA 1OH3A 2HWE3 2TUNA 3WUDA 3ROUA 3LKJA 4OULA 3ST7A 1V00A 1H1MA 1TME2 3WF3A 3T1MA 1EV13 1S0IA 2HWB1 1DGLA 2PHLA 3GNEA 3O0WA 4IGPA 4QX5A 2R071 4OZXA 4RGAA 1IQAA 4WM8B 4DY5A 5M0TA 2FZ2A 4AXOA 3S5QA 4EN8B 1H30A 2H0BA 3CJIA 4UAPA 4W8JA 4E4DX 2D5FA 3AL5A 5C71A 4RS5A 5A7OA 1WW6A 2D40A 2DV9A 5LASA 5AC92 1ENRA 2JDYA 2VUAA 4CCMA 4CPBD 5BNOB 1G9DA 4YG0A 4PLMA 4QPWA 3W20A 2VBDA 2HWF2 1UD1A 2QZ2A 2OX0A 2VW0A 2JDNA 4EN6B 2LALA 3DV8A 3UL2A 5JOXA 1JYNA 1G9AA 2A5ZA 3BIWE 3IB3A 2HWC1 1RB8G 2BTVC 3CJIB 2WA4A 1LKNA 3D3AA 4W6YA 4AR2A 2GMEA 1RUD3 1XYNA 1I9RA 2W39A 4ITCA 5FLJA 1AYM2 3OUJA 3WZ1A 1UF2C 3MW2A 4LHLA 2IXCA 2X5IA 2WKKA 3TEYA 1DIWA 3AZYA 4ZPIA 1B35C 5LEJA 1O59A 1CPMA 1EAH3 2MNGA 4IETA 4UOJA 1IHMA 1QMJA 2JB4A 1C8M1 3NJVA 4KBZA 4XTPA 4CTEA 1SQ4A 2BBAA 3ZN4A 2AGSA 4COZA 2JWPA 1WCKA 4CCJA 1PO11 5FRAA 1SFNA 2H0VA 1K5MC 1J84A 4M3CF 4F83A 3IDEA 5T55A 3WP4A 4I02A 4IGOA 1PVC2 4YNIA 1SLTA 2D43A 2L9LA 2PLV2 1W8ZA 2RS12 4XBQA 5T52A 5K8SA 1AVBA 1UO9A 1NG0A 4KI5M 3AMNA 2GAUA 5EHDA 3RZMA 1IG3A 3OJBA 2VNVA 4LHSA 3RDIA 2ET7A 1VJ2A 1ZM1A 5GLZA 4BQ2A 3K4ZA 1JZ6A 3WHUA 3SCHA 5TSWA 4XFBA 4JGZA 4FSJA 5CFDB 4N43A 5KXDA 3OSDA 1FMD1 3UYJA 1WBFA 2HEVF 5L36A 3J8F1 1U5XA 4FFHA 4FOWA 2ZHLA 4ZU7A 4I30A 4W4ZA 2VTFA 3QACA 3ZKUA 4AFCA 2IZWA 2KM2A 2VVDA 3ZSLA 1QIQA 4NRMA 5E8AA 5LB6A 2UWAA 4W6WA 3OBRA 3M3CA 5JSPA 1LTEA 4DZGA 1JYIA 3GZAA 4D69A 2ZGPA 2C0ZA 1RUI3 4FPCA 4DIQA 2BVVA 4N43B 3CU7A 4GULA 3HBKA 2XUEA 4QPYA 5HCFA 1UCXA 5KXEA 4H7MA 4DUWA 1YFWA 4LTAA 3RQ0A 1A8MA 4B29A 1AF9A 5LRRA 4AVBA 1WGPA 1W90A 2WS91 4HVOA 1G7YA 2WBKA 1C28A 4QXBA 1VBA1 4PIYA 1X8EA 3WNLA 2W47A 4XXPA 2D6NA 3LA2A 1YIPA 4LE3A 3SH4A 4Y20A 1ZZBA 5EWSA 2H6BA 4UYBA 3VN4A 4BK5A 2ADEA 1AR82 2R32A 4W50A 2X09A 2VZTA 4YGEA 3GBGA 1R081 4RA0A 1JHNA 4ONUA 4BOWA 4ET7A 3N7KA 5C70A 1A3KA 4JTOA 5A6QA 3T4HB 1US3A 5GM0A 1RHI1 1VPHA 3THDA 3VV1A 1OA2A 3I97A 1ZREA 1M4WA 2J1EA 4KL1A 5HCHA 3SEPA 2HEWF 4N53B 1HIXA 1VB2A 4MADA 3S57A 2A3XA 1NCRB 1HB1A 1W8UA 4AHWA 4BXFA 4DEVA 2XHKA 5ACA1 4Q4W3 2DBIA 3RWNA 3ENRA 1LHNA 5FCCA 1LJ7A 2BYVE 4AGRA 5KC5A 1PX4A 4ARXA 4NJ4A 2A6XA 2QQPA 4AI8A 1W99A 4FPJA 4BIFA 3HIFA 4QQ2A 4FXGB 2WWUA 1LGNA 4COVA 3VHRA 4XF1A 1LOFA 4P5HA 3USSA 3WDWA 1BK0A 1VBC2 2YV8A 4JGYA 4M01A 1IKQA 1OOPA 1JHJA 4GH4A 5EYXA 1E5RA 3KZ4C 5FY0A 5FZAA 4D7YA 2DURA 2XOMA 4XW3A 3RI9A 3BTXA 1I1EA 4XACA 1J3QA 2K9ZA 3MBWA 2DCZA 1UW8A 4P9GA 4Z82A 5IK7A 2VH9A 3WDUA 2XL7A 3ELNA 3H42B 4JHTA 5FY7A 2WN3A 3TN91 5EIYB 3RRDA 4PF1A 5IATA 3O1MA 4HETA 1MQTC 2VTXA 2D97A 4IEUA 4IE6A 3IMMA 4YZ4A 2WZR3 3IBMA 4UW3A 2VR4A 1QWRA 4Y5Z0 2CAVA 1OOPB 4IEZA 2RR11 3G7DA 4AOCA 1AR73 1WWYA 1SHWB 5KHIA 2WWSA 1R1A2 3WR0A 2ES3A 1MEC2 1ZBA1 1POV3 2V4AA 3NKTA 3ZFEC 3MFCA 4CDQA 5FO9B 2XVKA 5C3SA 4CCOA 1I5PA 2C24A 4XF4A 2GNBA 1RUH2 1LOGA 3EMRA 2R062 4K8FA 3D82A 1XYOA 2G9GA 3CIHA 4FFIA 5FPBA 3I2JA 1HLCA 4QXCA 5KHJA 2F4LA 5T50A 3PMSA 3ZOIA 2RMU3 3J4UH 4IEQA 2D98A 3LD8A 1C3HA 4MOAA 4O9GA 3BKZA 4GZ9A 2VMGA 3DPRC 5D8AC 4CDQB 5C6CA 2CDPA 2R1BA 2FCVA 2PHRA 4CU8A 1HQLA 4JKLA 4CCDA 1E5IA 1RUJ2 3M3EA 2C6SA 2ZHNA 2QQMA 4M00A 4NPLA 3FC0A 4ZS3A 1TG7A 5KC6A 3T2PA 3ECQA 1O8PA 2JDPA 3NNLA 4LUMA 1UNBA 4QKDA 5A80A 3USUA 1JYXA 1UXZA 1D4M3 4BPZA 2UWBA 3JBG1 3POSA 1G86A 5F6LB 2VXRA 2FDFA 3AFKA 4CP2A 2BGOA 3OPZA 4GWJA 1RUC1 2Y38A 3OEBA 3WX5A 3VBOA 5BNNC 4PLNA 3JUUA 1XQNA 3SKJE 1W8FA 1UPIA 3PU8A 1AR62 1XNBA 3JD73 5FP9A 5AFBA 4CCKA 2VUCA 1AX0A 1ODNA 2HWE2 1COV1 3HT2A 4AFDA 2MEV3 2VMFA 5FK8A 2WSUA 5IHRA 4JQTA 4XCBA 3NV4A 5F3EA 1BEV1 1PX3A 3VZOA 4AVVA 3I3MA 4GJYA 3HJRA 1BLZA 1FNYA 2C9AA 2OT7A 3MFAA 3VDDA 3DYMA 3OY8B 3WNXA 1O4TA 1CJPA 3SLIA 1C5IA 4FTBA 3AZZA 2HWB3 3O1SA 3JXSA 5DMYA 3Q8CA 2F17A 5K4LA 2R073 2WN2A 4MUVA 4Y1ZA 3ON7A 2VNRA 3NJXA 5T5OA 3G6JB 4K40A 1RYYA 2AEZA 2HH9A 5GJ6A 3SEEA 4OMDA 1SCRA 4LBKA 2VNOA 3VDDB 4C0HA 2A70A 1UY0A 1WW4A 1GICA 1MZFA 1YQ8A 2XPJA 2QFEA 3PNAA 3WW2A 2VCMA 1K5JA 4RS5C 2R041 4LUKA 4BMEA 1X7NA 1K3IA 1MS4A 2HWC3 4FPOB 1QOSA 1FI2A 3ZSKA 2UYBA 4QX2A 3KF5A 3ZFGC 1FAYA 2YC4A 2XWJB 1VE0A 3JU9A 3KHCA 1MS0A 1EAH2 3KQRA 4LR4A 2JD9A 4I0WB 3O1UA 3AVRA 4Y22B 3Q9OA 2O1QA 2BVBA 4EWEA 5C3QA 4LBNA 1UPSA 3RYPA 1OD5A 4FCAA 1N3PA 5FZGA 2ZGNA 3A23A 2W0XA 3ORJA 4O65A 1C8M3 1V6KA 1GZWA 2GZWA 4DQAA 2X5IC 3BPSA 1NY71 1PO13 2ET1A 3ILNA 3MW4A 4ISQA 3UKVA 4ZKTB 5I0SA 4FT8A 3FFZA 4KWJA 4KMQA 2E26A 1BCXA 2RDNA 1H4GA 3HPNA 3VKFC 4RHV1 4K8RB 5KHHA 1BK1A 1RITA 5K0UA 2GH2A 5FY9A 1FOD1 4QQLA 3AYCA 2XJUA 3M70A 4UI9L 4D7TA 1JZ5A 2P6HA 4AI3A 1QOTA 3VBRB 2ZHMA 4NIHA 1LOEA 5FY4A 5FYHA 2CL2A 2J42A 3QLQA 4Y5SA 5JZGA 4JRAA 2FDJA 4Y1YA 1U5YA 1QU0A 3E97A 1LGBA 3OGSA 5IJRA 3TAYA 4DXRA 5A3TA 1XE8A 4PIXA 2DU0A 1JMUB 1LULA 4FTEA 2B46X 3J8F3 5K0UB 4JGZC 4R8HA 2J1AA 3FUOA 1PGL1 4QX7A 5DDJ1 3LGRA 3IZOA 3INAA 1YJLA 4I09A 2NQYA 3HQUA 5BNPB 1JZ2A 5LY2A 1Y9MA 5FZDA 5T54A 4A3ZA 1RUG2 5JZGB 3TOJA 2FCUA 2UYAA 1ZA4A 2VZSA 2WT1A 4I01A 4MG2A 1APNA 2YBKA 4ZS2A 1UY4A 5FPAA 4AI2A 1O5UA 2OZ6A 4XURA 4QPGC 1Y9QA 1X50A 4AEDA 2E32A 4YWAA 4H7LA 2RJKA 2ZOEB 4IE5A 3U4XA 2B42B 2JD4A 4CU6A 3LOIA 3MYXA 3PU3A 2WRAA 4XJZA 3TNQA 1C1FA 4FPEA 5L9BA 1QXPA 2VNGA 4EN7B 1MZ5A 4IDZA 4AEDB 1RHI3 1OXCA 2VVEA 2VQTA 2NPIA 2XJRA 3OGJA 4Q4W2 3WF1A 4AHXA 4MVTA 2XWBB 5GZCA 5FIXA 1DDLA 4FTSA 1RVF1 2XBO1 1H8VA 4FP3A 4IUGA 3ZYGA 3IDCB 3RSJA 4OQ9A 5DN2A 4AAXA 3B02A 4AI1A 2IXLA 1LU2A 2JICA 3PUSA 4HPKA 1RTVA 5A3MA 3LDBA 4XF9A 4JX0A 4HN1A 2EF6A 1YO8A 4YW2A 3BYWA 4XAEA 1DLCA 3GDBA 3NRUA 2LS6A 4PBPA 1JI6A 2WNUB 4OHZA 1CJDA 3S0MA 4DUXA 3IAPA 2ZPXA 5LY1A 2G1MA 2QUOA 3HD8B 4ATEA 4QPIA 2HWD1 2K0GA 4Z8BA 2GN3A 1BMV2 2J7MA 4YG3A 2BFUS 3AC0A 4QKNA 2ZGQA 4HPKB 1OA4A 5E1RA 4Z2WA 5BYNA 1LOFC 5JWPA 1KXGA 2AEYA 1F15A 2YMZA 4M0HA 2WZR2 1DGRN 1NA1C 2W1WA 1QJU1 3FUQA 4JGYC 4D3WA 4GH4C 1S2EA 1HV1A 3CF6E 3TN93 4WV8A 1AR72 1UX7A 4FQ4A 3PVEA 1QJZA 5B2GB 4HK9A 4QPIB 4A41A 4N9IA 2RVAA 1RMU3 2V73A 1NKGA 3FBMA 4E2SA 1EV11 2DFCA 2RR13 5B4NA 1RJ7A 5HI0A 2JEMA 1S1AA 1G8WA 1M06G 1PK6A 1ENSA 4FVVA 3TNPB 2P34A 3SISA 4MHRA 4TLGA 3RZHA 3LFIA 5FYBA 3BCWA 1MZEA 1V6LA 4COWA 5JXJA 1MS1A 3NSTA 5EJ3A 1ZZ8A 4FAHA 5FDBA 3GZTB 4KG0A 1GP4A 5FZ8A 1OT5A 4K1YA 1OURA 4Q4Y3 1VLNA 4XF3A 2ZHKA 2ZX0A 3R4UA 3VBUA 4D6RA 4Q0QA 3ZSMA 3K4DA 2DUOA 1SBFA 2AACA 3AKPA 3POWA 3M3QA 4Q4V1 1VBE1 4GAZA 4LLFA 1RUD1 1LEDA 3K46A 4RN5A 3KV5A 3BU0A 2IXHA 2Q30A 1OQ1A 2W3JA 1AXYA 2E9QA 4A4AA 4LIVA 5L19A 3LEKA 4F8AA 1UOFA 4CU9A 4GA9A 1Y4WA 2Z5WA 1F31A 4CEYC 4PF5A 5BUVA 4NHKA 1F4HA 2VW2A 3JBG3 1N3OA 2PELA 4NE9A 5ISLA 3POEA 1OH4A 3LIHA 1RUC3 1CONA 3B93A 3SMHA 2P5BA 1TMF2 1TNFA 2P37A 1B35B 4NN0A 4IESA 5F5IA 1N1YA 4LULA 3A4UA 1CZTA 1W9FA 3LDKA 1O3SA 1AL22 3OBZA 3VBOC 3PUHA 4P9LA 4FXKB 4XIKA 1COV3 1YI7A 2WNVC 1UMIA 2A6WA 2XJPA 4PJYA 1K5MB 2UURA 4QXKA 5FLIA 3K3NA 1CESA 5I8YA 5LA1A 1AHSA 3T30A 2GC1A 1BEV3 5HXVA 2HWB2 5K7PA 3S30A 4Y3OA 1POQA 2R072 3OUIA 4ZU4A 1UN1A 4AWDA 4K6BA 3RMXA 2JIGA 2ETEA 3QOPA 4PCRA 4QHBA 4Q0SA 2DDUA 4CYDA 1RUOA 1WW7A 3HAGA 1WW5A 3E1F1 3VDDC 4R9BA 3RZJA 1Q8PA 1KITA 5FBJA 4MHUA 4OYUA 1O6UA 3PIJA 1NYWA 1KD7A 2WABA 1GUIA 2D93A 3ES1A 3ZX7A 4BQXA 4LO8A 1US2A 3B5LB 4PDWC 5A1FA 2B9VA 3I2IA 5LK5A 1W0OA 1PVXA 1AXZA 4YPJA 5FZHA 2BNNA 2ZGMA 1POV0 2O8QA 2HWC2 4OZOA 1LHVA 4SLIA 4CP9A 1SDDB 2RJLA 3ZYFA 5C33A 2PHDA 4XBNA 4FI9A 4AEMA 2R043 2VBBA 2W1QA 1L7RA 3K3OA 1YEWA 3BALA 4IERA 3VL9A 2OUJA 5FYUA 1D7PM 4YM1A 5A6XA 2PAMA 1C8M2 4RR3C 1W6PB 4WM7C 5FLHA 5FP7A 4N7IA 2VAUA 4CP9B 1FATA 3PUIA 1PO12 2CTVA 4YLZA 3KD4A 4A44A 3DYOA 5LZ6A 3D5OA 3N9NA 4XEZA 4A3XA 1NT0A 3LOBA 4TXWA 4OHWA 1W06A 4XETA 5A3WA 2WZEA 4DXTA 1DCSA 2W94A 1Q43A 1YYNA 4XPVA 2QQOA 3BOPA 2CGNA 2ZGLA 3AB0A 3ZR5A 3RZLA 2CYFA 4TLFA 1QQP1 2O14A 3RMYA 1OLMA 4RHV3 4PQ9A 4LORA 5L9RA 5ABJA 1RUF3 3E6BA 5JIAA 2P1BA 2GMMA 1FOD3 1XC6A 1CR7A 4M4RA 1JH5A 3C7OA 4GJZA 4PLOA 3NO8A 1FMD2 1AJOA 5FYZA 4QHOA 2ZX4A 3J8F2 1YQ2A 1PO21 5IAXA 1WLDA 1IGOA 2ATFA 5IT6A 2XJVA 1T6BX 2R30A 1X33A 2YFZA 5FTTC 3S7IA 5JI9A 3AYEA 1MQTA 3A21A 4JAAA 4N9HA 4LNVA 1GFF2 5D21A 5DDJ3 2YG0A 3O7OA 1SBEA 4CE8A 3AJZA 1YUDA 4PBOA 5KXCA 1VBB1 1T6GC 4XUOA 2WO2A 4LO4B 3ZYIB 2CHHA 3H7YA 2VCAA 4GB31 3OGRA 4PIZA 3U0ZA 3E6CC 1F5JA 4HOOA 2WS92 2CWMA 4G3YC 4GWIA 1UZYA 1VBA2 1WMEA 4M4PA 3RG0A 1NE4A 3ZFEA 1FT9A 2UY9A 5IW0A 5CKNA 4AW7A 3H8XA 1OFNA 1GOHA 1RXFA 4QGLA 4NUBA 1MQTB 4QXHA 1QJX1 2GNMA 5FP8A 1POV1 2VZ3A 4XDPA 2VTXJ 4XMIA 5A6YA 2NN8A 4F3JA 2DVGA 2DUQA 1SFYA 1R082 3M1HA 4PI0A 1RHI2 1YJKA 3N9OA 4BE3A 3I3DA 2RS53 4YM2A 3ZFEB 2Y0OA 1CN1A 3POIA 5D8AA 2QQJA 1X36A 2EXKA 2VOXA 4NIGA 1JUIA 5ACA2 3KQ4B 4OHYA 1NX9A 3VBSC 3NNGA 2PAEA 3A22A 1V9U2 1RVF3 2E51A 4AZZA 2PHTA 3WQBA 3O12A 4BB3A 5IK5A 3U11A 4L9BA 3VD5A 1W03A 2RS32 5IVVA 4Q2FA 4B3NA 4CP1A 1HRI1 1S4CA 4CDXA 2BZDA 1RXGA 1ULCA 1LHUA 3DPRB 5D8AB 2CDOA 5BNNA 3ATGA 4GWNA 4A7YA 1ZBE1 1UOBA 2P3KA 1MR5A 1XNTA 1ZA7A 3D8CA 3OD4A 5L73A 3GCWA 4MX3A 1GP5A 3R4SA 1UAIA 2NLRA 1DQ6A 1VMFA 1WCQA 4NPMA 5JPNB 1ENQA 2JIJA 4YZ3A 2C1FA 2A6VA 2WIIB 5IK4A 1RL3A 3CO2A 1YQ5A 2BDRA 1UU4A 4AG4A 3MZHA 4D0QA 3HNBM 3IM0A 1ZZ6A 2CV6A 4QPIC 5CBLA 3A0KA 1Z0HA 2MEV1 4HT1T 5BNNB 2FCTA 1QJU3 3MICA 1CAUA 3B01A 2ZX1A 4DO0A 2RR12 1KS5A 5JR7B 2GDFA 3FBYA 3VHNA 3D6EA 2ZA9A 4M3CA 1ZBA2 1W2OA 1YQCA 4LO6B 4UW5A 3MO4A 1LENA 3I3EA 4MSVA 3WHTA 4BWOA 1OLME 4Q8KA 1CZVA 3TEWA 4MLOA 1IS3A 4AHZA 3LWCA 3FE5A 1EUTA 1OKQA 2UU8A 4A6OA 2WO1A 2W08A 2W1UA 1PK6C 4AFMA 3AMMA 5JMOA 4ZXKA 2AENA 2ZGSA 1DGWA 4MGIE 3RPQA 3WQ7A 3O1TA 3OBAA 3C2UA 3JQXA 3ZFGA 2XJQA 3WY6A 5F9TA 5A7PA 4J6GA 4D6QA 2A71A 1J3PA 5IFPA 2GNDA 1WCSA 1XU1A 3GZEA 4Q4V3 1NXD1 1VBE3 3GJAA 3WQ0A 3VBUC 2W2IA 3JBG2 1DQ0A 4RS5B 3WEZA 4UXAA 4TZDA 1PM7A 2IXIA 4YZ1A 1JZ7A 2JG9C 1V6OA 1RUC2 4XABA 3ZFGB 2JDHA 4BU2A 2OUHA 1W8OA 4LO7A 2BFUL 4RGGA 1HQWA 4BH9A 1JOPA 2JDUA 3OB8A 2ZEXA 1MZ6A 3ZXKA 1UY2A 2VZQA 5I0UA 1COV2 4Q4X1 3OUHA 1SBDA 1DHKB 2Y33A 1ONAA 2ZEYA 4LK6A 2MPFA 1XB9A 1QJEA 2DWRA 1BEV2 3J26N 1J59A 2X5IB 2I45A 2Z42A 3FN9A 3LE0A 4S2HA 2Q8EA 1GZCA 2RDQA 3WDXA 3RZGA 3ZN6A 1YWKA 3C8XA 3MIEA 1UU5A 2DVDA 1W0PA 3IIAA 2XLFA 4U2AA 4XJUA 4XE9A 4E27A 4I0AA 1GZ9A 2OPWA 4LK7A 3QCWA 4HXCA 3HWJA 3PTYA 5DUXA 2OXBA 1PNFA 3MI8A 4Z2AA 2ILMA 2B5HA 1ULPA 1G9CA 5FJKA 3NV2A 2DF7A 1OUSA 3NNMA 3KLSA 4FPLA 3ACLA 2IXKA 3ZN6B 5A7NA 2YU1A 4Z1VA 4DUVA 1U5ZA 2E6VA 3I54A 2LROA 3KCCA 4DINB 1K45A 4CU7A 4Q1PA 2DU1A 2R042 2D5HA 1J1LA 3O1RA 3GM8A 4QPGA 3H50A 4FO9A 4JGZB 4CCLA 4PHZA 2EAAA 3FFQA 3W5MA 3LA7A 3U37A 1O8SA 1HN1A 5C9AA 3C7HA 1K12A 5LA0A 2WNOA 4GWMA 4XBLA 5E16A 3WINE 5J3UA 3HMYA 4QX3A 5FYCA 5I8SA 3VZJA 1OPMA 2LRPA 3AX4A 5AVPA 3TBDA 1NLSA 3UT0A 2A3WA 2WQ8A 3POGA 4M3CE 3U1XA 1Q8SA 3BVCA 4QPGB 5C8WA 1N1SA 3PVBB 3VD4A 1NY72 1HXS3 4FP2A 2BQPA 1IOAA 4HFSA 3WNKA 5C9AB 2IWGB 1DBNA 1ULFA 3H3ZA 5H9SA 1U0AA 1W28A 2ARXA
chains in the Genus database with same CATH topology
5CIRA 2ARBA 3UJQA 2E53A 2GC2A 4RHV2 5C4WA 3UJOA 3KCXA 5DUVA 2B39A 2WINB 1FOD2 4Y20B 5K9YA 1CGPA 1QQP3 3M8LA 4G9SB 3CLPA 2RHPA 3KM5A 1RC6A 3MF6A 4IEYA 3IWZA 3R05A 2BEOA 4BMBA 3H1MA 4IV3C 3TRSB 5ABJC 1PO23 1S0FA 1DZRA 4JDMA 1PGL2 1SACA 5DDJ2 4AVTA 1NA1A 4AE2A 4XDQA 1ZRFA 3VBHC 2NM1A 4E9KA 1Z7S1 1OMIA 1S0DA 3VZKA 3S6PA 1YRZA 4CZSA 5AVAA 2AH2A 2V5YA 1AR91 1G6NA 1SLCA 1VBB3 2D6LX 4GB33 2W68A 4IV1C 4WVMA 2P3JA 4EV0A 5FO8B 1NA1B 2JX9A 4OI2A 1RMU1 4JGYB 1DG6A 4GH4B 3IKWA 1I6XA 2JG8C 3ZSJA 2PHUA 2Q5TA 1DQ4A 4MV2A 1RJ8A 1QJX3 1VAKA 2YPJA 5KHKA 2IC1A 4FPHA 1Z78A 3AP7A 3IPVA 5CA6A 4GIQA 4E2GA 2WFF1 1A78A 1X82A 4HBNA 3EBRA 2DVAA 4NHMA 1TNRA 3N4MA 1RVF2 2XBO2 3FLRA 4Q4Y1 3EO6A 4KBBA 1W2UA 3MEPA 2ZAAA 4DPNA 4CEYA 3DGTA 2O0OA 4XFAA 2XUMA 1QNYA 4ES8A 1HRI3 4Y1XA 2ZMKA 3TB0A 4OI1A 4OHXA 3FLTA 4WVWA 3RJRA 1QXJA 2HWD2 3GBFA 1ZBE3 4K3UA 1QNWA 1VR3A 3J9SA 1VBD3 4CDXC 5DXDA 2OIIA 4P9IA 3CL1A 1GR3A 2YYOA 2WA3A 4CEYB 1QJU2 2WNVA 1GYKA 1D2SA 3AKRA 4HSJA 1ENXA 2X29A 3USUB 1WCDJ 2OVUA 2A75A 5D1IA 1UZZA 3MPPG 4TYSA 1O3QA 3KT1A 3H1YA 3N35A 3KMHA 4DB5A 1H0BA 1EV12 3AKTA 3VBOB 1S0GA 1MS3A 2WJSA 5HCAA 5FFOC 2WNVB 2AZ5A 4AYUA 4CDWA 2WNEA 4PDWA 2Q4SA 3NJZA 2WFPA 5T5LA 2ZZQA 1C1LA 1H8TA 1S0CA 3BTAA 3BOWA 2GN7A 1J3RA 1RUE3 2WQZC 5LK7B 1CAXA 4XQDA 3BPZA 4V1PA 4XZPA 2DFBA 3ZMOA 4A7ZA 1WD3A 3MPBA 3GALA 4WVZA 4NWVA 4CDWB 3ZYPA 1GBGA 4Q4V2 4PDWB 1VBE2 4FPYA 5DUWA 3PVNA 1RUD2 4HKWA 1RUNA 1R1ZA 3H9AA 1H9WA 2BNMA 1C8NA 5KWRA 4RR3A 4WM7A 4XILA 4OVEA 4EROA 2D6PA 5H9PA 5T5JA 4Y4YA 4DXZA 3HR9A 4FOVA 1V6IA 3VZLA 1BBT1 2IXJA 1HRV1 5JOZA 2E63A 1XYPA 4DS0A 2YXSA 1JYCA 4BIOA 4H14A 1YXWA 5JSRA 4RR3B 2G9FA 4WM7B 4NR1A 4S2FA 4HN0A 4X8PA 1YHFA 4Q4X3 1PGSA 5J7MA 1LR5A 3QH7A 5HCBA 3ZN5A 4HSLA 3UV9A 1S0BA 4QQOA 1RUF1 1GZWB 4YGDA 4JDNA 1GSLA 3PJQA 3FMGA 1XNCA 1YFXA 1JTZX 4QMAA 4AFAA 2TBVA 1Q8VA 4KGGA 1RUI2 1PMIA 3GHMA 2YZ4A 2D44A 1LEMA 3LB9A 4GMP0 1O4YA 2ZGRA 3ZYJB 4R9AA 2JECA 1RIRA 3APBA 1MS8A 3WP3A 4LA3A 4LA2A 3W9AA 5C9AC 4H55A 3H0OA 4R4XA 1FPN3 2QNKA 4OUSA 2D6OX 1ALYA 4XMAA 4YW4A 4CEWA 2RS51 4LBLA 1ZVFA 3VBSA 1HQNA 5C8CA 4XJAA 3I7DA 2ZKLA 2CNAA 4EN0A 1BYHA 4FOQA 5FPZA 3SH3A 1BQPA 3WG4A 3VUOA 1SEFA 4ASLA 5EZWA 1RGSA 3ME2A 3DN7A 4LBOA 2G4IA 4EWAA 4W65A 3VBSB 5C4WC 2BPA2 3B3QE 5FREA 1PO22 1IPKA 3NV1A 4URTA 3WG2A 3V56A 3UKNA 4LLOA 1TQ5A 3R6SA 3VZMA 4P9YA 1WLTA 4CDUC 2PN5A 1VBB2 3RI8A 2Y26A 4META 4EN9B 4GB32 1Z7S3 2B45X 1S55A 3L9JT 4YGCA 4QT6A 3HBZA 4MZUA 1AR93 1DZQA 1V6JA 3AK0A 1QJX2 1W6MA 2R1DA 3URFA 3VHPA 4BM8A 1HKDA 3NAPC 5BPXA 5CNAA 1OHFA 1NCQA 3LZZA 2HYKA 3SCGA 3B69A 3IN9A 4GMP1 3JB8A 2WT0A 3D0SA 1LU1A 4L97A 2OYZA 1WUVA 5CADA 5DUUA 5FPXA 2WFF3 1AX1A 3D0JA 4OFGA 2RMU2 4YM0A 3QBQA 1PNGA 3WG1A 4XF0A 1ZYBA 1PK6B 2NP0A 3WDTA 2WZPP 1HRI2 3AXDA 2NZ9A 1CAVA 2JG9A 1D4M2 2Q1MA 1ZBE2 4YGBA 4Y24A 2XKPA 1PZ7A 3MIBA 1NQJA 3ZYRA 1H1AA 4YW1A 5JCTA 1Y3TA 3VBUB 1QHDA 5GZEA 3JD72 2NMOA 5F5QA 2XH6A 2CGOA 2VW1A 2JG9B 2MEV2 2PYTA 4MXWA 4Q29A 1IS4A 3R4DB 5GALA 1ZNPA 2WC2A 3OTFA 5J36A 3D4KA 5JSOA 1OSGA 4C1WA 2PAKA 2WT2A 3HT1A 4F7ZA 3ZIWA 2H6CA 4IQPA 1H2KA 2Q8OA 3VHOA 3WOGA 4J1XA 4COYA 1QGLA 3NWKA 2GNTA 3LSEA 2LM3A 4P9WA 4HZFA 3KB5A 1O3TA 5CG9A 1SLIA 5CAZA 1ASJ1 1IZ3A 4QM9A 3V64A 1DGWX 4BA6A 1H8TC 1PHMA 3MGUA 1CVNA 1DYPA 4E4SA 3WP5A 1PVC3 1ZZ9A 2PLV3 4I3PA 1BVVA 2RS13 3WUCA 4LEJA 2ZACA 3K48A 3I8TA 5F1RA 1QDCA 4JRLA 1ND2A 4RSUA 1U5IA 4OI0A 5HBAA 4XJ9A 1HX6A 3NV3A 2GALA 3WV6A 2V09A 2BNOA 4BYYA 1BBT3 1HRV3 1HXS1 5EYYA 4Q4X2 3AMQA 2ZZJA 1DQ2A 2R0FA 3POYA 2VOKA 1O3RA 4Z92B 1YI9A 2Q1ZB 3I2DA 4B3NA 4LHKA 2OW4A 3EXUA 4XTMA 1KJRA 1YLLA 4J1WA 4UBHA 4XFGA 3WDYA 1S0JA 3R0RA 3O5SA 2EXIA 4KNCA 2BWCA 1Q5OA 1FXZA 4IEOA 4O9EA 2E7TA 2PA7A 4EJRA 2ZGKA 2VG9A 2KA3A 2JDZA 3K51A 4IV3A 2Z69A 4ISRA 5T3NA 2P3IA 3VBHA 2VVFA 2N7GA 3I59A 4ATFA 3O0VA 4IEWA 3AZWA 4ZU5A 2VMIA 1N1VA 2PHXA 4NVPA 3EHKA 4IV3B 3WT3A 5ABJB 4IV1A 2BW8A 4BHPA 4ASMB 3BB6A 3AMPA 2DTYA 3VBHB 3AXEA 1NLRA 2JG8A 3I4IA 4XXAA 5FMOS 4AEKA 2R49A 2ZAHA 3DKWA 1Q8QA 1YIFA 5FOBB 4QQPA 4IV1B 1WMDA 4XIOA 1ND3C 3MLJA 3T2TA 1E57A 5J37A 2D6KA 2JG8B 3UK9A 3CEWA 5J96B 1DGRA 1DLLA 5SV5A 5BXXA 2Q0AA 2WL1A 3ZFFC 4LBQA 3M2MA 1MS5A 1UIKA 4Q0VA 4CEWC 5CFCC 5A33A 2NMNA 1CX4A 3ASIA 4Q8LA 5C8CC 1D0HA 4XFHA 4HLTA 5J09A 1ZRRA 4GKXA 4YVWC 1NE6A 4IEVA 3SHRA 3MLKA 4X6QB 2GSYA 1WLCA 2XG3A 2WQ4A 3KT4A 4C90A 4YZ2A 2P17A 2P2KA 4OLLA 1CQ9A 1AJKA 1BJQA 1VBD1 2ZTNA 5IUQA 5A32A 4AFBA 3AKQA 5EV7A 1AR92 4QU2A 1ZZ7A 5FQ0A 1OI6A 4B4RA 2YGLA 3TN92 4CDXB 4S2GA 3ZXAC 4C91A 1O4ZA 1AZDA 2VU9A 1RMU2 1F5FA 4XJ8A 4QGMA 2R6QA 3KS7A 5A32B 1XXNA 3OGGA 4RQPC 2W52A 2DYCA 4BLJA 3LSDA 2A3YA 3NVCA 2WFF2 4MGYE 5DZGA 4GMP3 1F8VA 2OZJA 1CAUB 1I5ZA 1RUE1 1NCQC 4FOYA 4WM8A 1IPJA 1JW6A 1OLRA 1REDA 4Q4Y2 4M3CB 4YFZA 1IKPA 1H1IA 1O5LA 2WSVA 5L7OC 1AL21 3AYDA 5DZEA 5FO7B 5H9RA 5BNOA 1Y43B 4DFSA 5GLVA 4P9XA 5J98B 1N1TA 3LA3A 4SBVA 4YARA 1QF3A 4YW5A 4C1XA 2B7YA 5CU1A 1S2BA 1NOVA 1F2NA 1OLQA 3VKLA 4L92A 3WXPA 2EVXA 3E5UA 3VLBB 4HVQA 2HKXA 3H1WA 5JVVA 4L2NA 1AXKA 2ENRA 4AQ2A 3TWIA 2QE3A 3ES4A 4L99A 3AKSA 2PFWA 1FYUA 2ZGOA 4RFT0 4CP0A 2YY1A 5GLWA 3N7MA 2QCSB 3NKGA 4LBJA 4R9CA 3WW1A 2ERFA 3RS6A 3AJYA 5I0TA 1D2QA 3GZUC 4YZ5A 2CGPA 1B09A 4NOTA 2C5DA 1OFSA 3HQXA 2GC0A 1EY2A 1N3QA 2VUJA 5CFDA 3JZVA 4K7JA 4KQ7A 5DG1A 4JVAA 3VZNA 1ASJ3 2AREA 5I93A 3ZXFA 3SH5A 1VIWB 1CAWA 4R4ZA 1OA3A 2ZJCA 2XB6C 4S2DA 1UL9A 5LEKA 2FMDA 5JDBA 1D4VB 1R091 2VGDA 1PIV1 1VRH1 3H7JA 4GKYA 1BBT2 1HRV2 1PZ9A 1TEIA 1FPN1 4IEXA 1ND2C 5JOWA 1QJY1 4R9DA 1CAWB 3FX3A 1DU3D 2RM21 1QH7A 4FQZA 2B8MA 1EPZA 1H9PA 1CIWA 4RL7A 1FV2A 4BZ4A 1RINA 1XRUA 3B94A 2YHJA 3M4FA 2TEPA 1JUHA 1LOCA 1PGW1 1RUG3 1RUF2 2D3PA 3S7EA 2AYHA 3QH6A 4FBFA 2Y0IA 1MACA 3GBWA 2R16A 2VULA 4N53A 1VAVA 1GNZA 5JAXA 1NCRA 4L8QA 4NHLA 3MF9A 4P14A 1QOOA 1QY4A 1SMVA 2WLPA 5FBZA 4CDUA 2EA7A 2F6BA 1IS5A 2XVLA 4YG6A 2VECA 4AQTA 3A0NA 5C4WB 4XHBA 3ALQA 1BKZA 1OPOA 1GANA 4K9SA 5GZDA 1HDKA 1DQ1A 3BU7A 2FQPA 3LCPA 1WBLA 4CDUB 1V9U1 4QM8A 3LAGA 2D3SA 3NAPA 1KFXL 1Q8OA 4E2QA 2A6YA 2HJIA 4OUMA 1URXA 2RS31 3H8UA 3ZXDA 1LOAA 1AYN1 3N36A 2RS52 2E7AA 2EALA 5BV6A 3MIDA 3NAPB 5I0RA 2CY6A 4RD7A 4WVMB 1AL0G 4JQRA 3RZZA 2AUYA 2XVGA 4HMZA 2DCJA 2KXLA 4P9JA 5H9QA 3IPVB 1EYBA 3PMEA 3SNMA 2ZGTA 4JTNA 4YVSC 2I2SA 1LRHA 3VBFC 2DVFA 1YNAA 3AFGA 3RJ2X 3RYRA 3ZMNA 1TME1 3KCYA 2VQAA 1LECA 3KT7A 2ZBJA 3AP6A 2VQ0A 2MHFA 2HEYF 3N7LA 3VKNA 2FZ1A 1GV9A 4D7SA 5AC91 1S2KA 2GMPA 2QZ3A 3W59A 2EAKA 1Y7BA 2HWF1 3ZXEA 5JIUA 3NW4A 5FMOL 3X29B 1S0EA 2VMHA 1FV3A 4B4QA 1QDOA 2EIGA 4QGNA 1G9BA 1BVP1 1AYM1 2QDNA 1QH6A 2IFWA 3N3HA 2DVBA 4E4ZA 4K1ZA 3OY8A 4XQWA 2K2SA 3DUIA 3GF6A 1TMF3 4Y26A 4LBQD 3UKTA 1PVC1 1UU6A 1AL23 4WM8C 2PLV1 2RS11 5EFUA 1H8TB 3AP9A 5DG2A 1EPWA 4KU7A 4HANA 4IL7A 1CAXB 5BNOC 1NQDA 2FMYA 3AZXA 2BBVA 4YW3A 4I0BA 2JENA 2UWCA 1W39A 4HVRA 2OPKA 3EJKA 4XFCA 1ZX5A 4QQHA 4YRDA 3WCSA 1XNDA 1NXMA 2XLGA 3WCRA 1C5HA 3CJIC 3MIHA 3MDPA 4Y22A 5FOJB 1HW5A 2E7QA 1LB2A 1WLWA 5GLUA 4AF9A 1H2MA 1LHOA 2ZS6B 4KH9A 1MS9A 2FBEA 4JV4A 3WW4A 5T5PA 4Y1UA 1J1TA 1JOJA 3JQWA 1V6NA 3WP6A 3ZO0B 3B9IA 4DY3A 3B00A 4Q26A 1ASJ2 1AR81 1YFUA 4R52A 3VBRA 1ZZCA 1KDKA 3M3IA 3ZSEA 2FHRA 3P3PA 4BLIA 1KJLA 5JLVA 4AHYA 4AGVA 4XHXA 4UBGA 4FPGA 5BY5A 4Y1VA 4DRRA 5CFDC 1DF0A 4AVCA 2OA2A 3RYKA 4X6RB 5I91A 1LESA 2XL9A 3DF0A 4KWKA 1ZRDA 1UMZA 5BNPA 1ND3A 1KQRA 2JXAA 1AX2A 1R093 3SCFA 1PIV3 1VRH3 3AM2A 4AVSA 1VP6A 1FMD3 1HXS2 4QD2A 1D0GA 3AP5A 3ZFFA 4N43C 1QJY3 3B7MA 3MIGA 2BWAA 1VBC1 2RM23 4H3WA 5CFCA 1O91A 3E5XA 1W6QA 2A73B 1ND3B 2VY0A 4K20A 1MVQA 3WW3A 3WG3A 1QQP2 1UKGA 1A8DA 5JOYA 4I3GA 3V0AA 4YVWA 4ORFA 2LUWA 4KG8A 4YSFA 3AP4A 3ZFFB 4LE4A 3JCIA 1X8MA 1OQDA 2WS93 4DMIA 5I8TA 5FO9B 1JN2P 2YC0A 3IT8A 4W6XA 4CEWB 1LCLA 1VBA3 5CFCB 2QJVA 1W6QB 5J48A 1YFYA 1R1A1 5C8CB 1MEC1 4KWLA 1ULEA 3PJYA 4N53C 1R083 1NCRC 4IEPA 3DL3A 3L2HA 4YVWB 3L2YA 3V0AB 4WVVA 2YGMA 4XOGA 2Z79A 5KHGA 2JJ6A 1RUH1 3QD6A 2R061 2WNUA 3VGIA 3E6DA 3ZDSA 4B4PA 3V0BA 2CWSA 4LHNA 5CVRA 3JB4C 3FZ3A 5ACA3 1KDMA 3IDBB 1H4HA 4HKLA 4RQPA 1V9U3 1I3HA 5JPMB 3W58A 2D6MA 1RUJ1 4DRVA 2RS33 4K21A 3MLLA 4XFFA 1KRIA 1XU2A 3M3OA 3THTA 3V0BB 2GU9A 1AYN3 2BUKA 4LT5A 4FPKA 3VKOA 3OD0A 4RQPB 4NWWA 5L7OA 2GH8A 1HV0A 4G4FA 1CD3G 5DZFA 1GKBA 1UIJA 3VL8A 1OOPC 1W6MB 1AR61 2PHFA 2DUPA 3AZVA 3EQEA 2I74A 5LRSA 4FAGA 2HWE1 1NCQB 5KBFA 3U07A 1DZTA 3ZXGA 2DCTA 2PQQA 3O0XA 5KXBA 4MGKE 5L7OB 2ZX2A 4OI4A 4XJWA 3ZVXA 1VB4A 2WLQA 3WLUA 1ZBA3 2XLAA 4WZFA 1TME3 1XE7A 1VBD2 3KSCA 1DQ5A 1KFUL 3GHNA 3CJXA 3ZXLA 1GNHA 2YDEA 4JCKA 1Q56A 1KS4A 4CDQC 4COUA 4L11A 1ZRCA 3ILRA 4AI0A 4N90A 2EXHA 1JXNA 1CAVB 2F4PA 3ZXJA 5AC93 4JDOA 1SLBA 1CPNA 3NL1A 2HWF3 4GALA 4I2OA 1O7FA 2TNFA 1Q3EA 1B35A 4DNYA 5JMCA 1V70A 2BGCA 1H2LA 4HKOA 1GQGA 1VALA 2CAUA 2R0HA 4Q1RA 1EAH1 2SLIA 4U36A 5GLTA 1A6CA 3V65A 1K5MA 2PTMA 1AYM3 4HL0A 4MXWB 3FHIB 3THPA 1BXHA 3OCPA 1RUE2 3OBTA 1J58A 1DYKA 1FX5A 2JE7A 1JBCA 2B9UA 5GZFA 4Q0PA 5F6KA 1GLHA 1H2NA 3WVJA 5AFEA 1SLLA 3KGZA 4GXLA 2ZABA 4HK8A 3WDVA 2X8KA 3ETQA 3B9CA 4D94A 4AQ6A 2ZX3A 4KGQA 1LHWA 2LTNA 4Z07A 5CG8A 3CNAA 1ULGA 3MIFA 5E89A 4EWDA 1SDWA 2GC3A 5GKAC 2D7FA 4MXVA 1C4RA 2QDRA 1W6PA 4TWTA 2ZGUA 2DCKA 3AYAA 3SITA 1RUI1 4B7KA 2I07B 1ND2B 4AEJA 2AR6A 2Z2SB 4A2UA 2SBAA 5GZGA 4LBMA 1OQEA 3OYWA 1RUG1 2XKOA 3E5QA 4AQSA 2VOWA 4NPRA 1V6MA 3N7JA 1UX6A 4XQ4A 3WD5A 3ZIXA 1L3JA 1SLAA 4M0NA 1SCSA 5CB7A 5JI7A 3OYWB 4OHVA 3KGLA 1LODA 4Q27A 1AR83 1BZWA 1ULDA 3ILFA 4UW4A 1AUYA 3BODA 1FNZA 2JKBA 4Q4W1 3VBRC 5E88A 4AVAA 4INDA 2A7AA 1W6NA 3I59B 1C57A 1LGCA 1R092 2VPVA 4YYOA 1PIV2 1VRH2 2DCYA 1N47A 4MH0E 1XNKA 1EP0A 3AMHA 3C3VA 5K0UC 1FPN2 1QJY2 3SXWA 2RM22 3PHMA 3OF1A 1REEA 4X8NA 2NYYA 5BNPC 4C0BA 5JZGC 1W6NB 2YUEA 1QXRA 2VOVA 4IXLA 1BMV1 1VBC3 2X53S 3H3UA 2A6ZA 1PGW2 3ZPYA 1PZ8A 4XYXA 3FWEA 2WZR1 1G9FA 4YVSA 2QKDA 2ZMNA 3PLQA 3VBFA 2PHWA 4FPFA 2RE9A 1AR71 4B7EA 4GQ7A 1WMFA 2DTWA 2XGXA 1LOBA 4LO5B 4NO4A 2QVSB 4AK3A 5FAXA 4KU8A 4AEDC 1R1A3 1U12A 3P3NA 4LBQB 1MEC3 4YVSB 3VBFB 5A33B 1WA4A 2YROA 3FLPA 4UW6A 3DPRA 4A7KA 5A3LA 3PVOA 4BQ1A 1Z7S2 2RMU1 4CRQA 2UY8A 4JC1A 1W6OA 2EXJA 3WQ1A 4BCUA 1RUH3 4AGGA 4YM3A 2R063 1UKRA 4MYEA 2XBO3 1GQHA 3T1LA 2D3RA 1QKQA