2BBVA

The refined three-dimensional structure of an insect virus at 2.8 angstroms resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
308
structure length
308
Chain Sequence
LTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVTRKDVLNQSINFTANRDTFILIAPTPGVAYWVADVPAGTFPISTTTFNAVNFPGFNSMFGNAAASRSDQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSNVQFPVATTPATSALVHTLVGLDGVLAVGPDNFSESFIKGVFSQSVCNEPDFEFSDILEGIQTLPPANVTVATSGQPFNLAAGAEAVSGIVGWGNMDTIVIRVSAPTGAVNSAILKTWACLEYRPNPNAMLYQFGHDSPPCDEVALQEYRTVARSLPVAVIAAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*CP*UP*UP*AP*UP*AP*UP*CP*U)-3')
publication title The refined three-dimensional structure of an insect virus at 2.8 A resolution.
pubmed doi rcsb
molecule tags Virus/rna
total genus 65
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 1994-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bbvA00
4CEWA 1HX6A 3VBRB 1RUH3 1PO12 5L7OA 1EAH3 4GH4A 1NY71 3ZFGC 1ND2A 3J8F1 1RUD2 2MEV3 1RUC3 1MEC3 2RMU2 5BNOC 1POV3 2HWB3 1RUJ2 5ABJB 4IV1A 1OPOA 5BNPB 4BCUA 3NAPB 5D8AC 1RMU2 5ACA1 5J96B 2WFF3 1RVF2 4QPIB 4FTSA 3ZFEB 4GB31 3VBOC 1PGL2 1H8TC 1ASJ2 4N43A 1NCRA 4AEDC 4RHV2 3CJIA 5JZGB 1FMD3 4Q4Y2 4QPGC 1RUI2 1V9U3 3ZFFA 1VBD2 1RHI3 2DF7A 1BMV1 1PGW1 4CEYB 1AR82 1RB8G 1COV1 1BBT2 4RQPA 3VBSB 1BEV2 2RM21 1VBA1 4IV3B 2PLV1 1CD3G 3JD72 4CDXA 1RUH2 2RR13 3HAGA 4N43C 1AYN1 4PDWC 1QJX3 2RS53 3VDDC 2MEV2 3ZFFC 1AYM1 1MEC2 2TBVA 2HWB2 4CEWB 3DPRA 1FOD3 1AL23 1NCQC 2FZ1A 2WFF2 1C8M3 5L7OB 2WLPA 4GH4B 2R061 4RR3C 1SMVA 1ND2B 1PO13 5C8CB 1OOPC 1HRI1 1V9U2 1RHI2 4IV1B 1QQP1 1X36A 4NWVA 5CFCC 3VBFA 5K0UC 1PIV2 4WM8A 1NCRB 2RS13 3CJIB 1D4M2 1AR61 1W39A 1ZBE3 3TN91 3JB8A 3S6PA 5FMOS 1FPN3 1RUF3 1R1A2 1RUD1 4RHV3 1PVC2 1QJU1 1TME3 3ZFGA 1RUJ1 1AR72 1RUI3 5C4WA 2RS52 4RQPB 2HWD1 1NG0A 5BNOA 1FOD2 4CDXB 1VBE3 2BFUS 3VBUC 5D8AA 1AR83 1ASJ1 1OHFA 4GMP1 4Q4Y1 5AC93 4WM8C 3VBOA 3JD73 4GMP0 1H8TA 4AEDA 1VBD1 4Y5Z0 2HWF3 4WM7A 5CFDA 1Z7S1 1QJZA 4QPGA 4CDWC 1X33A 4Q4V2 3DPRB 2BPA2 2FZ2A 1BBT1 3IDEA 1BEV1 2VQ0A 4CDQC 5C4WC 4YVWB 1GFF2 4RS5C 1RUH1 2RS12 1EAH1 5C9AC 1ZBE2 4YVSB 2ZAHA 1K5MA 5ACA3 5DDJ2 1VBB2 1FPN2 1RUF2 2MEV1 1RUC1 1VBC3 4PDWA 4JGZC 1MEC1 1B35B 4WM7C 1TME2 1POV1 5CFDC 2HWB1 1AR92 1RUG2 2RS32 5FOJB 3VBFB 1POV0 3VDDA 2IZWA 4Q4X1 2WFF1 5A33A 4LLFA 1DDLA 2XBO3 4Z92B 1VBE2 1ZBA3 1NCQA 2R072 1PIV3 4CDUC 1FMD1 2GSYA 3JBG2 5AC92 1MQTC 1D4M3 4RR3A 1R093 3ZFGB 2HWF2 1RHI1 1K5MC 1OOPA 5FMOL 1R1A3 5BNOB 5BNNA 3VBHA 1PVC3 5GKAC 1AR73 5CFCA 5D8AB 4Q4W3 1VAKA 5K0UA 3VBOB 2RR11 1H8TB 2HWC3 1NA1C 4AEDB 5J98B 5A32A 1PO23 2WS93 1ND3C 1WCDJ 2HWE3 4QPGB 1EV13 1QJX1 5ACA2 1VBC2 2BBVA 1RUE3 4Q4V3 1FOD1 5BNNC 4JGYA 3VBHC 1HXS1 1AL21 1R083 2Y26A 1C8M1 2WZR1 2XBO2 3VBUA 1ZBA2 1F8VA 1VRH3 2R043 4RFT0 1PO11 1BMV2 2X5IC 1PGW2 4N43B 1TMF3 4PDWB 1R092 4N53C 1VBA2 2PLV2 4CDWA 5DDJ3 1VBB3 3VDDB 3ZFFB 3VBRC 2RMU1 5A33B 1HRV3 1AR93 1RUG3 2RS33 1NCQB 4CDQA 4JGYC 2RS11 4Q4W2 1RMU1 1RVF1 1ZBE1 4RS5A 4RR3B 2HWC2 1QJY3 5C9AA 1PGL1 1PO22 4CEYA 1FPN1 2WS92 1RUF1 1OOPB 2R073 2HWE2 4RHV1 1EV12 5ABJC 1TME1 3JBG3 3VBSA 5BNPC 1RUI1 3NAPC 4JGZA 4QPIC 5CFCB 3ZFEC 2R062 1RUE2 5K0UB 4NWWA 1AR81 4FSJA 1R082 1HRI2 1A6CA 3JD71 3J8F3 1VRH2 2R042 4CDUA 2HWF1 1F2NA 1MQTA 4CEYC 1TMF2 3VBSC 4JGYB 4IV3C 1AR62 3TN92 4GB33 1HRV2 5C8CA 3VBUB 1QJU2 3LOBA 4WM8B 3JB4C 1NA1A 2HWD2 1QJY2 4Q4X3 1ND3A 4CDWB 1VBC1 4CEWC 1COV3 1V9U1 2RM23 1VBA3 2PLV3 5L7OC 4CDQB 5C4WB 4GH4C 2XBO1 4RS5B 1ZBA1 1Z7S2 1ND2C 4EJRA 5C8CC 1PIV1 5C9AB 1CJDA 2XPJA 1AYN3 1D4M1 1NY72 1R091 1HQNA 3J8F2 2BUKA 4IV1C 2X5IA 1AYM3 2BFUL 4JGZB 1R1A1 4WM7B 5CFDB 4FTEA 1PVC1 4N53A 3FBMA 5LK7B 1EAH2 1AR71 1NCRC 2QQPA 3VBRA 3CJIC 2RS51 1AUYA 2GH8A 4Q4W1 4GB32 2R063 4FTBA 1RUC2 2HWC1 4Y4YA 1PO21 4CDUB 2WS91 2HWE1 1MQTB 1EV11 1HRI3 1HXS3 1QQP3 1IHMA 4Q4X2 4YVWA 1VB4A 4RQPC 1K5MB 2WZR3 5ABJA 5BNPA 4CDXC 1RUE1 1COV2 3NAPA 4Q4V1 1FMD2 2RM22 4QPIA 1R081 3ZFEA 4YVSA 1AR63 2ZZQA 3TN93 5JZGA 1B35A 1NA1B 4SBVA 1VRH1 2R041 1RUD3 1M06G 1QJU3 1AYN2 1ND3B 2RMU3 1RUJ3 1TMF1 1C8NA 2WWSA 3DPRC 2HWD3 1AYM2 1RMU3 5DDJ1 1VBB1 1RVF3 4YVWC 2RR12 5BNNB 1HRV1 1AR91 1NOVA 1ASJ3 1RUG1 2RS31 4IV3A 3VBHB 4GMP3 4Q4Y3 1QJX2 4YVSC 3ZXAC 1VBD3 1VBE1 1QJY1 1Z7S3 2X5IB 5JZGC 2R071 1B35C 1E57A 5A32B 1HXS2 1VB2A 3JBG1 5AC91 1AL22 2ZTNA 4N53B 1QQP2 3VBFC 1BBT3 1C8M2 3M8LA 2WZR2 1BEV3 1AL0G
chains in the Genus database with same CATH superfamily
2W68A 3VBRB 3AYDA 2Z2SB 4Z82A 3SCHA 4NHMA 1OFSA 1S4CA 2VGDA 3CJXA 3I3DA 1ENSA 1PO12 1UZ0A 3C7OA 3WXPA 1WUVA 3NKGA 5A1FA 5K9YA 1SFPA 5FZBA 3MLLA 4AF9A 1XSRA 2GALA 3Q8FA 4KL1A 4PLNA 3ZYBA 4AVSA 2D7FA 3GALA 3R0RA 1ND2A 2YU2A 3J8F1 3POFA 3KVAA 3AP9A 4OI0A 1CX1A 3IM0A 4HXCA 2YYOA 1CAWB 3AL6A 2B42B 4K21A 1WMXA 1UX6A 5BNPB 2VMCA 4BCUA 5JOWA 3KB5A 4XVHA 1B09A 5A3PA 1M4WA 2IXJA 5D2AA 3RMYA 5ACA1 5FRAA 1O3RA 4EN8B 1S0EA 2OYZA 4XJZA 1WLTA 3NJZA 1H8TC 1JYTA 1NCRA 4NJ4A 2H0VA 2DVBA 2L9LA 3KSCA 2Q4SA 5H9RA 2FMDA 1GOGA 1PGSA 3AYCA 3NNGA 3PU8A 5DZEA 1JXNA 1XSQA 1V9U3 1VBD2 1JZ2A 1CAUB 1RHI3 2VW1A 1OF3A 3A0NA 4Y24A 1PGW1 4DMIA 1AR82 1IS4A 5FMBA 2A6YA 1XNCA 5JR2A 1COV1 1IS6A 2QQJA 3SH3A 2X05A 3VBSB 4GWNA 3E5QA 3WCSA 5FPXA 2G4IA 4P9IA 1MACA 4D7TA 4AI2A 3OEBA 5LBFA 1RUH2 5A3LA 2VCMA 4L11A 4TSVA 2WA3A 3X29B 1QU0A 3J26N 3ORJA 4OHVA 4CP9B 2VZRA 3L2YA 1ENXA 3ES4A 1KQRA 4PDWC 1QXPA 3HNMA 3B02A 1QJX3 5C3SA 1JZ7A 5IK7A 4LIVA 1MPXA 4QU1A 1ULPA 2RS53 1CAXA 1AYM1 2RJ2A 3T2QA 3ZR6A 1FOD3 4XFGA 1LGBA 1MS3A 1IKPA 1RJ7A 1IQDC 5FY4A 4D7SA 1H8VA 3B93A 1RITA 2G9GA 3KV9A 1NCQC 4GZ9A 4I02A 4PBPA 4QKFA 2FZ1A 2WFF2 1N1VA 2WLPA 2BVBA 3MFCA 2D3SA 4IW3A 1SLLA 3O1UA 2R061 1MVQA 1SMVA 4XDOA 2FDGA 3VZLA 4P9XA 1ND2B 1PO13 4ZY9A 2AZ5A 3FHAA 3HMYA 1OOPC 3ILNA 1NLSA 3OGVA 3WG1A 2WWUA 4KGGA 4JTOA 4KG0A 4XUTA 4MGIE 1GUIA 1HRI1 4XDPA 5B4NA 1UCXA 5FZ9A 2VNRA 3BYWA 2OX0A 2ETEA 4LE3A 1DYKA 3MV11 5FP3A 3VHRA 4ES8A 3BTXA 1G8WA 3BOWA 1PIV2 3FLPA 5JI7A 3UKNA 2VMHA 2WNUA 2WZPP 1NCRB 2WBKA 2RS13 3C7EA 4LORA 1ZZ9A 2D6NA 1W39A 2HYKA 3KQRA 1NT0A 1F4AA 3NJVA 4DINB 4YZ1A 3UGFA 1DCSA 3M3IA 1RUF3 1VLNA 3MO4A 1RUD1 3JQXA 4Y22A 1OXCA 1U5XA 4AVAA 1QJEA 1EUUA 2PYTA 3T09A 3Q8EA 1TME3 2Z4FA 3QLQA 2P6CA 4HFSA 4HT1T 2BOJA 2V4AA 1QXRA 1A3KA 2G9FA 1AXZA 3EHKA 3LE0A 4JKMA 4NPRA 4FPYA 4RA0A 1DHKB 4YARA 3U4SA 2NMNA 2HWD1 4AXOA 3ILRA 1PHMA 4P02B 3LD8A 4IEWA 1XE7A 3I49A 5D8AA 1AR83 1W3XA 4JX0A 1ASJ1 1K42A 1H4GA 1LTEA 1LR5A 2Y34A 4Y1VA 4LO8A 4Q4Y1 2WQ8A 3H1YA 4WM8C 3I2IA 2A6XA 3VBOA 3T0BA 5AC93 2R6QA 4GMP0 4A7ZA 2QQKA 5I0DA 1GANA 4JDMA 5FYBA 3RI8A 1Q43A 3RZKA 1CAVA 4C91A 5E8AA 1Z7S1 4XDQA 5GZEA 2UY9A 4LHLA 4BLIA 4CDWC 1US2A 1X33A 1CAXB 3BKZA 5FZAA 2E32A 4CP2A 4DZGA 4R9AA 3QBQA 5C33A 5LB6A 2BPA2 4LOSA 2BBAA 4YM1A 1UY1A 3IDEA 1A8DA 2GC1A 3KVBA 1MVEA 3WV6A 3ZN6B 4XIKA 1IKQA 2JG9A 2A3WA 5LY2A 3WY6A 4CDQC 4ZZ5A 5C70A 1GFF2 2XVKA 1BCXA 3CU7A 1TZOA 3KF5A 4BJ0A 1N3QA 2ZGNA 4FPEA 2GMEA 2JDZA 1F5JA 4AEKA 5FZ7A 1IPSA 1RYYA 3RZMA 4H55A 2NMOA 2GH2A 1F35A 2D3RA 4QX7A 4XPVA 1K5MA 4LE4A 4NVPA 1IPJA 3AKPA 4LK7A 3N9QA 1LOEA 2MPFA 3N4MA 4UW4A 2WAOA 5IK5A 5EYXA 1DLCA 2VM9A 4HOOA 4OZXA 1VBC3 3OY8A 4JGZC 4M3CF 4WM7C 1GYKA 4XJWA 4B3NA 2RS32 5FOJB 3NV2A 2PHTA 4UBGA 1HJFA 2XR4A 4P5HA 1UU6A 4IEVA 5CVRA 2IXLA 3AYEA 2GP3A 3MHZA 2PHXA 2WNUB 2WFPA 3N7JA 3PURA 4WVMA 5A33A 4GALA 4LLFA 5JOZA 5I0SA 5LA0A 1DDLA 5TSWA 1VBE2 3VD5A 3FJSA 5FIXA 2ZABA 2BV4A 1ZVFA 1PIV3 1RXFA 3B3QE 1OH4A 5JCTA 1N3PA 4DS0A 2VMDA 3HIFA 3JBG2 1OQEA 4G4FA 3UGHA 2J22A 1DQ4A 2R7EB 1UL9A 2EA7A 1NQDA 1BZWA 2HWF2 3IMNA 3IKWA 1RHI1 4XUPA 4YGEA 5B2GB 3O1SA 2X09A 2OVUA 5BNNA 4MGQA 1JHNA 3W58A 1DGWX 1O91A 2VXJA 1TG7A 1ZZ6A 2ZBJA 3GJBA 4HG6B 5CKNA 1DGLA 1L3JA 4O7XA 4MSVA 1JS9A 1XE8A 4AHWA 5D8AB 2E63A 4NUBA 3H1MA 3VKMA 1WLWA 3E6DA 2PTMA 2ILMA 2QJVA 3WW3A 2GMMA 3VBOB 4MGSA 5F2SA 1VMFA 3BTAA 1GNHA 1O4YA 4DXSA 5FY1A 4B7EA 1E5SA 2WAAA 2ZKLA 5A32A 3M4FA 4NPMA 3MYXA 1CAVB 3ENRA 1WZXA 2HWE3 4QX2A 5CKMA 3VZJA 4K7JA 4BQ4A 3T4HB 3NQHA 1H6XA 5BPXA 1QJX1 1S0BA 5CB7A 1V6OA 4I01A 2WNEA 4COZA 4W65A 4HKLA 4OHXA 4P08A 4AQTA 2R32A 3T1MA 1K45A 1RUE3 1FOD1 1I5ZA 4YG6A 1UQXA 4CP1A 3HT1A 4HK9A 1XYNA 5GZGA 2XJPA 4Q1RA 4FPJA 4ZS3A 5L9VA 5CEHA 2XVGA 3IB3A 3VBUA 1C1FA 2DV9A 1ZBA2 4NRPA 2WSUA 1YI9A 2GC0A 2W5FA 3K4DA 1VAVA 2VZ1A 4M01A 5T3NA 3W21A 1PO11 3H8UA 2X5IC 3FN9A 4C1WA 5M0TA 1QHDA 2A73B 3OY8B 4YG0A 3LA3A 4NHXA 4UFKA 3WUCA 2VZVA 4YZ3A 3FWEA 3KCYA 2VOTA 1V6IA 3POEA 3AVRA 5EHDA 4LNVA 1UY0A 1KDKA 3SISA 2WT0A 4A3ZA 3DEMA 2NYYA 2G19A 4WVMB 1HRV3 2RS33 3BOPA 4GJZA 4XMIA 5DABA 5GALA 4MZUA 3OD0A 5T54A 1W9YA 5A33B 2DBNA 2QQIA 5I93A 4NOTA 1GR3A 3E97A 2RS11 3MUY1 5FWEA 5J09A 4FFHA 4FVVA 1LU1A 1OT5A 2D6PA 2YPJA 4RS5A 1WBLA 3MW4A 5GLWA 3ZKYA 2FDJA 1HQWA 5I8SA 2P1BA 3WNKA 2XQRA 1QJY3 3R4SA 5CKQA 5DAPA 3RS6A 5C9AA 2YC4A 1RUF1 3J7LA 3O7OA 2K0GA 1DZTA 5KHJA 1SLTA 4NHLA 1ULOA 1TME1 3JBG3 4LBJA 5F9TA 3VZKA 3O1MA 1VJ2A 2K9ZA 4MYEA 5F2WA 4E4HA 3FUQA 1Y43B 4QPIC 3VGIA 3ZFEC 4XW3A 1I1EA 4HKOA 3WF1A 3RGBA 2OXBA 1XU1A 2VZOA 3VN4A 5JOYA 1FV3A 5FYVA 3KLSA 1OLMA 1AR81 1R082 1KFXL 4FAGA 1S2BA 4XFIA 1YQ2A 1S0FA 2ARAA 3PNAA 4GQ7A 2IXKA 2VZ3A 3IBMA 3N7MA 1JUHA 4KBBA 3JUUA 2EIEA 5FWJA 2DURA 2PHFA 5LEJA 4CU9A 1VRH2 4CDUA 5AVPA 3LEKA 3ACLA 4QU2A 3LZZA 1MQTA 2JIGA 5FZGA 5A70A 4IGOA 4CEYC 1UYXA 4HLTA 4P9WA 4QXHA 4BQ1A 4OUEA 2I2SA 4LLOA 3WDVA 3TN92 4OHWA 5A7OA 2GAUA 4Z07A 5C8CA 2VNGA 4AYUA 3VBUB 2ZGUA 4E8DA 3AJZA 3DL3A 3ZXJA 5JOXA 1CESA 3OPWA 2W46A 1L7RA 3WHTA 3LEMA 1W0NA 2CTVA 1NA1A 5FY0A 1GZWB 2C26A 1UXXX 1XOYA 2CGOA 2RHPA 3LA7A 3PVOA 4QKDA 2JIJA 4A44A 1VBC1 2WYFA 2J1VA 4CEWC 3AKQA 4HONA 4CUCA 1VRBA 4DXRA 4CXXA 1I5PA 3POSA 3HWJA 4FOWA 4ARYA 4E8CA 1J83A 3MZHA 1KRIA 3AMHA 4M4RA 5C4WB 1LODA 3TYJA 4AI1A 1CZTA 3B69A 2B39A 3SKJE 5FUIA 1UU5A 1X82A 2QQLA 3KV6A 4RS5B 1UZYA 4WVWA 3ZMNA 1V6KA 3LGRA 3U14A 1PIV1 5K8SA 5C9AB 3T3YA 2XL9A 4C0BA 3VKLA 1NLQA 2F6BA 5A7PA 2DCYA 5EXOA 2WT2A 3B94A 3J8F2 1WMEA 1ULFA 2ZX1A 3EO6A 3UKVA 2BFUL 2V5YA 4CE8A 1WW5A 3U1XA 3HBKA 2W3JA 4N53A 3BU0A 1NXMA 2BDRA 3I7DA 2ZZJA 3TAYA 3U37A 4HVRA 3WDXA 4J6GA 3CJIC 1PMJX 3K51A 1AUYA 3D0JA 3UYJA 4FXGB 1O5LA 1MS9A 2R0FA 3SITA 4FQ4A 3ZSLA 3OYWA 4FTBA 3BTZA 5LRSA 4J1WA 4CDUB 2Y6LA 2ARBA 2HWE1 3P5BA 4XFBA 4D6QA 1MQTB 1CJPA 4X6QB 1BHGA 4P14A 3U4XA 3BIEA 3CO2A 1G6NA 5FZ8A 5FZ1A 4DRRA 1QQP3 1IHMA 1VB4A 4RQPC 2BRTA 1W6OA 2WZR3 1XNAA 4BIFA 4SLIA 2XJTA 5ABJA 4CUBA 2RJKA 1RUE1 1COV2 3NAPA 5LASA 5JIUA 5EJZB 4Q0SA 4IEZA 5FO7B 3KV5A 3BIWE 1S0IA 1UKRA 1Y4WA 1LEMA 1YRZA 5FYSA 4QQHA 3TN93 5KHIA 4JVAA 3WW1A 3TWIA 3VKOA 4MH0E 5JZGA 1NA1B 3WVJA 2C1FA 1DQ0A 2XL7A 4W4ZA 2RMU3 3DYMA 4GULA 1RUJ3 5C6CA 3KT1A 5EJ3A 1BKZA 4QDRA 2JG8A 4M0NA 1AYM2 1RMU3 2LM3A 4META 1RVF3 1X7NA 3IDCB 1HB4A 2IFRA 3UETA 4BOWA 1K3IA 1XNKA 3I2DA 5T52A 4V2VA 3ZSMA 1OLRA 1HRV1 2RS31 1GQHA 4IV3A 3FX3A 2R1BA 1Q8PA 4GMP3 4XYXA 2GN3A 1CIYA 5A3WA 3CZJA 1TVGA 4QB6A 2ID4A 1FX5A 4Y1UA 4JHTA 1OD3A 4YVSC 4YZ2A 3JCIA 3AZXA 4HN0A 2YB7A 1VBE1 4KWUA 1QJY1 2EF6A 2PN5A 2D40A 2ZMLA 1B35C 5EIYB 2E9QA 3ZIXA 3JBG1 5IFPA 1AL22 2ZTNA 4N53B 2ZACA 2I07B 4AVVA 1BBT3 2Y8KA 1C8M2 4NHKA 3WF0A 3TB0A 1SLBA 3M8LA 4D94A 5JXHA 2JWPA 4IEXA 4PLOA 2ENRA 2Q0AA 2Y6FA 3IN9A 3OBZA 4AE2A 2BVVA 2PQQA 2DVGA 4ZHNA 1U5YA 4FOQA 2WL1A 5L7OA 3OYWB 2VBDA 3G6JB 2BW8A 4GH4A 3FFZA 4OI2A 2ZX0A 4AL9A 2EAKA 4JQTA 4X8NA 1NY71 3ZFGC 4B7KA 5LY1A 1RUD2 4R9BA 2ET7A 1GWKA 2MEV3 4P00B 1MEC3 1OSGA 2HWB3 1P8JA 3EBRA 4RL7A 1ULGA 5ABJB 1HW5A 1OPOA 2EIBA 4LO4B 3NAPB 4UFLA 4WVVA 2R1DA 5J96B 2BGCA 1SACA 3RPQA 1J3RA 4EN7B 2OZJA 4CCOA 1PGL2 1ASJ2 1OLQA 2VCCA 3OCPA 2ET1A 2Z79A 4IQPA 4AEDC 2PFWA 5LBCA 3NNFA 5JZGB 1YXWA 4ONUA 4Q4Y2 3CIHA 4LBMA 5T55A 4YSFA 3H7JA 3FFQA 5IAVA 3AP4A 5CZKA 1XNBA 2YBKA 4Q8KA 1QF3A 1RIRA 4JC1A 1LHUA 3POGA 4OMCA 5F7UA 1ZREA 2VPVA 3ALQA 1HN1A 2JG8B 3URFA 3MW2A 5LA2A 1W9SA 2IVIB 2BGOA 2JEMA 3GXUA 3LFMA 4HL0A 1NX9A 2YC2A 2ZPXA 2A3XA 3CL1A 1K5JA 4IV3B 2W39A 4XOGA 2A6VA 3RVHA 3SXWA 3JD72 2XWJB 3BTYA 1W6MA 4CDXA 1FT9A 1GOFA 1QOOA 5FLJA 1FI2A 1EPZA 1QY4A 5F39A 3HAGA 4NO4A 4XCBA 2D3PA 4CCLA 3TEYA 5F5CA 1REDA 1PM7A 4N43C 2WDBA 2QBXA 5JSOA 4QB2A 4IEQA 5FPZA 1I9RA 3AXDA 5BYNA 4JHZA 2VW0A 4CPBD 4ES9A 3O1TA 1ALYA 4NIGA 4K8FA 3NJXA 2VY0A 4BQ5A 2PHWA 3ZFFC 2YZ4A 2VOKA 4JRAA 1S0DA 2WZ8A 2GZWA 1SPPA 3JU9A 3UL2A 5JPNB 1XNTA 4CU8A 1E5RA 4H14A 1H2NA 1KS4A 1LU2A 4RGGA 1AL23 4XCAA 3MIFA 1DG6A 1W9WA 2CV6A 1C8M3 4LBKA 5L7OB 1OD5A 1D4VB 1QMJA 4GH4B 2OUJA 3EQEA 1WBFA 4XF1A 1JHJA 5BY5A 3W9AA 3KT4A 3AZWA 2EIDA 3WG2A 3WP5A 1WW4A 3OOXA 4TXWA 2P34A 4B4RA 4W6YA 4CCNA 3LPGA 5C71A 5JR7B 1TQ5A 1V9U2 2E7TA 4YZ4A 2WN2A 4GA9A 2I45A 4B4PA 3GHNA 1RHI2 4E9KA 1QQP1 5A1AA 4I2OA 3LF7A 5IK4A 5CFCC 3Q8BA 4I0BA 4ASKA 3I3BA 3CBNA 1N1SA 5JIAA 1XE0A 3VBFA 5F8PA 3K3OA 3BCWA 5K0UC 4Y1YA 4H2AA 3E1F1 4PT6A 5K7PA 2DVAA 4KU7A 3O0XA 4WM8A 4YW7A 1DFQA 1L7LA 5GLZA 4W8JA 2OPWA 1T6BX 3TN91 1HLCA 3OUHA 5FMOS 2FDKA 5IATA 1PVC2 1JUIA 5JMCA 4ATFA 1YCIA 1RUJ1 3CF6E 1YQ8A 3RYKA 4XTPA 2ZJCA 5D21A 3EJKA 2RS52 4EZ4A 3B7MA 3WW4A 5BNOA 5JSPA 3O12A 4YW3A 3VZOA 1W8FA 3GJAA 1ZRFA 1DZQA 1ZZ8A 1FOD2 3NKTA 4EN6B 1F9KA 1W6MB 3LSEA 4CDXB 4DIQA 4OHZA 4GMP1 2ORZA 3DXTA 1HIXA 3HN3A 4XILA 3JZVA 1KFUL 3JD73 2GU9A 3FL7A 1UZWA 4I3GA 3ZYRA 3OPTA 4LHSA 5FK7A 1CR7A 4CCCA 4WM7A 3N35A 3FMGA 4Q5OA 1JYNA 4QPGA 1GSLA 3AFKA 3DUIA 2UU8A 4Q4V2 5FLIA 5JVVA 4QXCA 1SPPB 3PIGA 4BLJA 2JXAA 1IPKA 3WQ7A 2EXHA 1BBT1 2J1TA 5L9RA 3CQOA 2Q8DA 4NPLA 4AG4A 1LOFC 4QQLA 1YUDA 2DTWA 2W95A 4O65A 4XURA 4XUNA 4QX1A 1N1YA 4YVWB 4AFDA 4AWDA 5JLVA 4AQ6A 1C28A 1UZVA 2IVJA 2RS12 2CDOA 5E89A 4XJUA 1QKQA 4B8EA 2ZAHA 3SQOA 1AXYA 5DZFA 3FBYA 1D0GA 1URXA 1WKYA 4ZS2A 3MF9A 1RUF2 1XQNA 1W6PA 1FNYA 2JDNA 2OW4A 3C2UA 3GBWA 2O8QA 4HPKA 2CAVA 1QH6A 2MEV1 3RSJA 4AGGA 1MEC1 5CFDC 1TME2 2ZHLA 3A7QA 2HWB1 1AR92 3O5SA 4LO7A 4AEMA 2NQYA 3RYPA 2WUHA 1DGRN 4Z1VA 3VBFB 1PZ7A 3I3EA 1PMHX 3VDDA 3WF3A 2XQXA 1W8TA 2ZX4A 2IZWA 5CA6A 4B29A 2WWJA 2UURA 1XNDA 1S0CA 4QX0A 3POYA 4CXWA 2XBO3 3D82A 1CX4A 5KWRA 3GNEA 3MF6A 1BK0A 4IXLA 1GKBA 5FYYA 4E4DX 3RG0A 1LCLA 4QM8A 3LPFA 3VD9A 5HCHA 5AC92 2VTFA 4RR3A 2FCTA 1R093 1N3OA 1SBEA 1W3VA 3NV3A 5FMOL 1W2TA 3A23A 3AX4A 5J36A 4D6SA 5EYYA 5BNOB 1PVC3 2AENA 4MVTA 3OTFA 2XUMA 5HCFA 4TYSA 2PHLA 2DFCA 1W9FA 2WZEA 4TTGA 2J1SA 2VBPA 5C7GA 4AFCA 3I2GA 1UNBA 1YIFA 1YQCA 1UO9A 2H6BA 3LA2A 3FLRA 3H50A 1E5HA 2GDFA 1UOGA 3FC0A 1W28A 3ROUA 5A6XA 5L9BA 3TEZA 4O9EA 5FKCA 1ND3C 4RN5A 3T2TA 4N7UA 4QPGB 1EV13 1W04A 1PK6A 4KG8A 3BGAA 3GM8A 5JSRA 5HCBA 3UGGA 1W05A 4RFRB 1JZ4A 5FZKA 3ZXKA 4L92A 1VBC2 4KMQA 4HSJA 2BBVA 1Q8VA 3ZPYA 4LITA 4IESA 1LKNA 5FYHA 3FZ3A 4Q4V3 1VR3A 4HVQA 2ZGLA 3VBHC 2HBTA 3V64A 1AL21 5IK8A 4CCMA 2Y26A 4NE9A 1CIWA 1BJQA 3IIAA 1C8M1 2D6MA 3WNNA 3N7LA 3PUQA 5DUXA 3SCGA 3C7FA 1UKGA 3Q9OA 1APNA 3B9IA 2ATFA 1MZ6A 4RFT0 1UOBA 5A7QA 2JECA 2R0HA 3D0SA 1W6PB 2D5HA 4ET7A 2AACA 3LIGA 4BWOA 1V6LA 1SG3A 4LBQD 3MV01 3FLTA 2VMFA 1OVPA 1VBA2 4UFMA 4CCEA 4QX3A 2FQPA 3VZMA 3GBFA 4XBQA 3S5QA 3VDDB 1CZSA 1JU4A 2VMIA 3VBRC 5FZLA 4YPJA 2FCVA 1UU4A 2CSGA 5C5UA 3MW3A 4WV8A 1AR93 4AVCA 5I0TA 1J59A 3ZXLA 1WLCA 4L9BA 2XJQA 3ZYHA 4Z2WA 4JGYC 3WSOA 4MX3A 3WP3A 3G7DA 4UWDA 4XAEA 3GZUC 3HD8B 3E5UA 4UW3A 4RR3B 1A78A 4N90A 2Y6JA 3UKTA 3WUDA 1PGL1 2BU9A 4CEYA 2VW2A 2XMLA 1UWWA 1F15A 1IGOA 2HWE2 2RDRA 4QDSA 4TLGA 4XFFA 4ZU4A 3ZO0B 1LEDA 1A8MA 5BNPC 1K12A 4JRLA 3WR0A 4RGAA 1C5IA 1UY2A 1EP0A 2Y6HA 4BZ4A 2GNBA 3LOIA 1RUE2 4QKBA 4UW6A 2GP5A 3BPZA 3MIBA 4PF1A 4FSJA 3NNJA 2QQNA 3I2OA 1A6CA 1GP6A 3AP5A 1W0OA 3JD71 1C57A 3DCQA 4PI0A 3PVNA 2VECA 4XJ9A 5AFBA 1GMMA 1PK6B 1YHFA 1ZZCA 4K3UA 5IVCA 2QQVA 3T30A 5LEKA 4FPGA 2JKBA 1YEWA 3PUAA 1XRUA 1BXHA 1KD7A 1O59A 2Q1FA 4D6RA 3T0DA 3ZN4A 5GZCA 4EQVA 5KC6A 2VL4A 5L36A 3BU7A 5FREA 4Y20A 5ANNA 3SNMA 3VBSC 3LFIA 3HR9A 3RNSA 3N3HA 1F4HA 2VR4A 5F5AA 3ZOIA 3GCXA 5A6ZA 2PHRA 1HRV2 4K8RB 2J7MA 3HVDA 4BA6A 4XUOA 5EV7A 1VAMA 4LULA 4PIXA 1JOPA 3LOBA 5LA9A 3KV4A 2LS6A 2WT1A 4IGQA 4F83A 4QT6A 2WJSA 4PLMA 2YG0A 3WF2A 3QD6A 3PIJA 2ZKNA 2ZXQA 1UPSA 1QJY2 4Q4X3 4Q26A 4NRMA 5J7MA 3OGSA 3N9MA 1O8SA 1ZYBA 3ME2A 2XJVA 5IVVA 4XZUG 4Y22B 1W2AX 4Q29A 3NNMA 1AVBA 1V9U1 2RM23 2V73A 1VBA3 1GWLA 1S1AA 2A70A 5GLTA 5LW9A 4AFAA 4OHYA 5EQUA 2ZHMA 1LRHA 2LTNA 2XBO1 4I09A 1TNFA 4K1ZA 3AJYA 3ZN5A 3U10A 1ND2C 3I59A 4M3CA 3RYRA 4BMBA 4KWJA 5HV4A 2ORXA 4XXPA 3I2KA 2XPJA 1AYN3 1KGYA 1AJKA 1KEXA 3J9SA 4HZFA 5CG8A 4O61A 1NY72 2ZEYA 1R091 5JDBA 2BUKA 3M3CA 3OGGA 5F3EA 4A4AA 1S0GA 3HQRA 1H1MA 1IG0A 4S2FA 5FYTA 3I3MA 1ENRA 4FTEA 1A34A 1PVC1 4AR2A 2XXZA 2Y64A 3AZVA 1EAH2 4OUMA 3NNLA 4BISA 1NCRC 2QQMA 2KD7A 4KWLA 2RS51 1LULA 1XYOA 1PZ8A 2RJLA 5DPNA 2WINB 4ISRA 2JG9B 2JDAA 4MXWA 3ABZA 1RUC2 2DVDA 4GJYA 1SDWA 1UF2C 3KT7A 4E2GA 1EV11 4IDZA 1HXS3 1Q8QA 4ZU5A 2X53S 4YW1A 2CWSA 2JDHA 1K5MB 3PJYA 4Y20B 4JKKA 5FYUA 4OMDA 4CU7A 3ON7A 3H9AA 1W8ZA 4Q4V1 4HK8A 1D2SA 1FMD2 4P9GA 3U75A 1AX1A 4YLZA 2LW8A 4YVSA 3RJ2X 2VNVA 1OURA 1UYPA 4AVBA 1E5IA 3NVCA 1W8HA 3LB9A 1UYZA 1JYIA 4N9IA 4YGDA 3LDBA 1B35A 2HLEA 3SLIA 1WCQA 2TEPA 1W90A 3TNQA 4HKWA 1KJLA 1OA3A 2KA3A 4CA9A 3O0WA 5BNQA 3VD4A 2CYFA 3DECA 2Q8OA 3WINE 5T5PA 4IEYA 4IEUA 3T0AA 2XONA 1KJRA 2IFWA 2Q30A 1LOGA 2BWCA 2VMEA 3ZIWA 3LEGA 1KS5A 4RSUA 4UBHA 3HEIA 4Y1ZA 1O5UA 3OD4A 2PA7A 3UK9A 2NP0A 5BNNB 1AR91 2E6VA 1X8EA 4U36A 4QAWA 2ADEA 2BZDA 2XKPA 3ZXGA 4M3CB 4ZONA 2UYAA 1W9TA 3T2OA 1IS3A 1O8PA 2E33A 2PELA 2ZA9A 2QCSB 1DYPA 5E1RA 3B9CA 3WG3A 4A6OA 1JZ6A 5FZHA 3QH7A 3EXUA 1MS4A 1Y7BA 3MPBA 3ITQA 1ST8A 5FKBA 2PMWB 1E57A 2KR2A 5A32B 5AC91 5LRRA 5EFUA 1JOBA 1GICA 1QQP2 1H9PA 4LEJA 2BNOA 1IG3A 5FXXA 2V72A 2P3IA 2WZR2 1BEV3 2GC2A 3WNMA 2BYVE 2WNUC 1O3SA 3CLPA 2Y33A 2ZCWA 3HOBA 2Y38A 2WKKA 2OQ7A 3USUA 1O7FA 4TWTA 2BQPA 1GP5A 4MXWB 2B45X 4EROA 5FMCA 1EAH3 3T4VA 4D0QA 2HH9A 2NLRA 3WQBA 1YFXA 3N36A 4DNYA 1LHVA 2F4PA 1ULCA 2ZGTA 4EE2A 1O3QA 1JODA 5A80A 3KGLA 1HB2A 4XAAA 3MICA 1RUC3 3A0KA 4FQZA 4ISQA 2RMU2 1LOAA 1RUJ2 1W2OA 2W1SA 3UT0A 1V6MA 4I3PA 3NW4A 2W2IA 4IV1A 5A7WA 3AMNA 3C8XA 3I2HA 1ACCA 4YYOA 4PI2A 1QOSA 4BQXA 2MHFA 5D8AC 2VOWA 1RMU2 1YJKA 1RVF2 4B1MA 2XOMA 4FTSA 3GF6A 5FPAA 5FYCA 3PJQA 4COUA 2YPDA 1Q8OA 1WA6X 2VULA 5E16A 5IVYA 3J7MA 3VBOC 4E2SA 5DUVA 4N43A 4RHV2 2N7GA 5ERLA 1FMD3 4XQ4A 4IL7A 4UF0A 3VLBB 3ZSJA 2AREA 3ASIA 1AX0A 1RUI2 4LHKA 3R6SA 4XFHA 2WNVA 3ZFFA 1QXJA 1XXNA 2ES3A 2JE7A 2QKDA 1O6UA 3UNPA 1CGPA 1OKQA 1JW6A 4NR1A 2YV8A 3H3LA 3DYPA 4GIQA 3SCFA 1W0PA 5EP9A 1RB8G 3ZR5A 1BBT2 3CZUA 2I74A 2RM21 1VBA1 2F17A 5F37A 3INAA 2XDVA 4FFGA 4QGLA 5FO9B 2R49A 5C3OA 1VMJA 4CCDA 2XLGA 4BXFA 4MGTA 1HV1A 4FT8A 3ZYFA 2IXCA 5CU1A 4AEJA 1MZEA 3MGUA 2E7QA 1AYN1 2D6OX 4QQOA 5DUUA 3W5NA 4AFMA 2VVEA 4XTMA 3HN1A 3D3AA 3SH5A 5LK5A 2YUEA 2MEV2 3DYOA 5JPMB 1MEC2 5A6YA 4ZXEA 2CL2A 2HWB2 3WNLA 3I3QA 3A21A 1HDKA 3IPVA 2V5DA 1IS5A 2YMZA 3DPRA 2H0BA 2VBBA 2E53A 3I8TA 4BQ3A 1CWPA 3USUB 4AI9A 1G9CA 2EVXA 2ZS6B 4JV4A 4DUVA 4B4QA 4E2QA 3WQ0A 4N7IA 4OFGA 4Z2AA 4BHPA 1JZ5A 4K40A 5C8CB 4Y33A 4PJYA 3HJRA 5FZ0A 4RD7A 3H8XA 1PMIA 1POQA 3OJBA 3AXEA 4DUWA 2FDIA 5A7WB 2Z42A 4IV1B 3NSTA 1X36A 4NWVA 3RZHA 4CRQA 2NPIA 3DKWA 1LGCA 2Y0IA 2JDYA 4PCRA 5FBJA 5J3UA 3TBDA 1W8UA 2DCTA 5FXZA 3VHOA 1G9AA 2OT7A 1C5HA 1PX3A 2YHJA 4EZHA 2ZMKA 4V1PA 4BK4A 2QDRA 3K77A 2X10A 1D4M2 1ZBE3 3HBZA 3QOPA 1PM4A 4GXLA 4N9HA 4UF0B 4XQWA 2GNDA 5LCWL 3S6PA 4MGZE 1PX4A 3IT8A 2WNVB 3WP4A 3OG2A 5KC5A 3BODA 1FPN3 3VHNA 3WF4A 2HJIA 3SC7X 2ZHKA 1LENA 2VAUA 1DYOA 2WQZC 3R05A 4RHV3 5FP9A 5IW0A 4DEQA 4QXBA 1NE4A 1BYHA 1RUI3 1MS5A 1UD1A 2P3YA 4XE9A 5DAWA 1GP4A 1C1LA 4ZXKA 4DY3A 5KXEA 5E88A 2WSVA 1L7QA 4OCTA 4MG2A 1S2KA 1G7YA 2A71A 2GN7A 5AFEA 2WC2A 5FK8A 2QVSB 2VUAA 5F3CA 3ECQA 3VBUC 3WDUA 1PZ9A 5FYIA 5KHKA 3SEEA 2W9XA 3P6BA 2IC1A 3V0AA 3AFGA 2BTVC 1H8TA 2CGNA 5BXXA 3ZDSA 3ZYPA 2AYHA 4LTAA 2UWBA 4XC9A 4Y5Z0 3DGTA 3L9JT 4COVA 5CFDA 4TZDA 3D6EA 4LKSA 3CKHA 5IJRA 4FPKA 1MS8A 4AOCA 4BIOA 3F2ZA 3IPVB 3DPRB 4KBZA 4CU6A 1XYPA 2D97A 3OF1A 1Q5OA 1BEV1 2O8OA 2VQ0A 3M70A 4ITCA 5H9SA 5C4WC 2YFZA 5CYYA 1S55A 1W6OB 4DPNA 2YBPA 2AEYA 4W6WA 4RS5C 5DZGA 5IHRA 1X9PA 3IAPA 4MOAA 4XFAA 4OQ8A 3POWA 3LDKA 3Q8CA 5FPBA 4UFHA 2UWAA 3BPSA 2QZ3A 2VUJA 1EAH1 2FMYA 4XIOA 5C9AC 1QGLA 3MPPG 4LXLA 4Q0VA 4Y26A 4ZPIA 3WDWA 2Q8CA 3HNYM 3IZOA 1Q8SA 5ACA3 2XJSA 3S7IA 3VV1A 5FY5A 5A3UA 5KXDA 3WG4A 2P37A 4A3XA 1NE6A 3C7GA 1RUC1 4PDWA 1OVSA 2J42A 1ZRIA 2F4LA 3F95A 4LUMA 1RUG2 4NIDA 1NZIA 2OKXA 4JAAA 3OBAA 2AGSA 3PVEA 4DRVA 1YYNA 1POV0 3E6CC 1OLME 4OI1A 3H8RA 1LOBA 4CYDA 5GLVA 2ZGRA 4G9SB 4R4ZA 5KHHA 2B9VA 1NCQA 5GJ6A 3PUHA 4XHXA 2XLAA 1OPMA 1QDOA 2R072 4CDUC 1FMD1 3M3QA 1ODNA 4DO0A 4S2GA 1MQTC 1D4M3 5FY9A 5A3TA 4DB5A 4CPBA 1GNZA 5EJ1B 5FP8A 3USSA 1OOPA 5FZ3A 3KCCA 3VL8A 2Q1MA 3L2HA 4NIIA 4LO5B 1QWRA 2JX9A 3D8CA 3AVSA 3VBHA 4QX8A 4M0HA 4LPLA 1VIWB 2P6HA 5GKAC 3AP6A 5FXWA 1HN0A 4E4SA 2Q8EA 2OIIA 4Q4W3 4W50A 1W06A 5CBLA 1DLLA 3PHMA 2O0OA 4LHNA 1RJ8A 2QUOA 4P5YA 1H8TB 5FP4A 5DQ0A 1H30A 2HWC3 1NA1C 2JENA 4IGPA 3JQWA 4A6SA 1PO23 5FZMA 1SZBA 1H2KA 1QEXA 2WS93 5HBAA 1JZ3A 3O1OA 4LQRA 3WZ1A 3TRSB 1UIKA 5I91A 4LT5A 4Q0QA 4NHYA 2VZPA 3HNBM 1H6YA 3RWKX 1WA4A 4DXZA 4H3WA 3THTA 2O1QA 4JCKA 5FPVA 3OUJA 2SLIA 3MUZ1 1J58A 3AZYA 3NMBA 2K46A 5KXBA 4XF0A 2XB6C 1HJGA 4JGYA 1UY3A 5EZWA 1ZRDA 3U11A 1GQGA 2P5BA 3PUIA 4BE3A 5CG9A 3KCXA 2CDPA 5JAXA 2WZR1 4Q0PA 1SQ4A 2XBO2 1YIPA 1WGPA 2A1XA 3MI8A 4C1XA 2VMGA 4PIYA 5GM0A 1WLDA 1AF9A 2W91A 4LOTA 1CAWA 2B4KA 3ZYGA 2P3JA 1OA4A 2R043 2VZQA 3P1IA 1J3QA 1BMV2 5FY7A 4AW7A 4RYDA 1TMF3 2WABA 3DXUA 1R092 3M1HA 2ZOEB 1LECA 3HPNA 4PDWB 3WDTA 4N53C 4TN7A 4S2DA 4XZPA 3NV4A 2DDUA 1IQAA 2J1RA 2PLV2 3ATGA 3FE5A 4LKEA 4CDWA 3K75B 1GWMA 4K20A 5T5LA 5BUVA 3WT3A 4H7LA 3WQ1A 4XUQA 5HXMA 2RMU1 4BYYA 1RUG3 1SHWB 3W5MA 2BERA 3O1RA 2IUWA 3ZX7A 4IE6A 1J3PA 1NCQB 4CDQA 4EV0A 5DUWA 2FHRA 2YY1A 1RMU1 1VP6A 2ARXA 1RVF1 1CAUA 1ZBE1 2SBAA 1YFUA 3GGLA 4MXVA 4NMIA 3K2OA 4LBOA 4D7YA 5KXCA 4S2HA 1STMA 3VL9A 1U5IA 3MIGA 1ZA7A 2B46X 2FBEA 1J84A 1FPN1 2LUWA 1OOPB 2R073 4RHV1 1EV12 1Q3EA 2OA2A 4Q1PA 3VB9A 5ABJC 3VBSA 2YFUA 3ZPOA 2C6SA 3AC0A 4AGRA 1RUI1 2QFEA 1YJLA 1H1AA 1N47A 2DUQA 2Y6KA 3NAPC 4UI9L 4YW2A 1REFA 4BDVB 3AL5A 3PUSA 3DF0A 4JGZA 4DY5A 2H6CA 1REEA 1EPWA 2OUHA 2VCAA 2Z69A 2RDNA 3PU3A 1QNYA 4GKXA 4QQ2A 3ZDVA 2GNTA 4NWWA 4R4XA 3S5AA 1G9BA 1LGNA 1UMZA 5KHGA 1Y9MA 3N9PA 1ENQA 5L19A 4I30A 4BB3A 3K48A 3MFAA 5CAZA 4PBOA 1ZNPA 5CADA 3RZZA 1ZRRA 2KXLA 3UESA 2JG8C 1F2NA 2LALA 1FXZA 4IEOA 4Y5TA 2W1WA 3C3VA 1SFYA 2CU5A 3GBGA 4CVUA 2W87A 4XBNA 5C5TA 2W0XA 1JYCA 4OI4A 2ARCA 3VKNA 2DVFA 1CONA 3FHQA 4JGYB 4IV3C 4EN0A 1AR62 3H7YA 1MZFA 2DFBA 3H0OA 1X8MA 1PVXA 2XLFA 4GB33 1SLCA 4AAXA 1NUKA 3ZXEA 1J1TA 2HEVF 4XF9A 5FFOC 3ZM8A 5C3QA 4QPWA 1WD3A 1QJU2 4X8PA 1AHSA 1HB3A 1W8NA 5HXVA 5IVBA 1AXKA 4I0AA 2JD4A 3JB4C 4FP3A 4WM8B 1GU3A 3VHPA 1CPNA 3AMPA 4JDOA 3S0MA 3WNOA 4CDWB 4CXYA 4LUKA 3GHMA 4FOYA 3NWKA 1XPWA 1JH5A 3IDAA 5H9QA 4FI9A 1JYVA 2VVDA 1NYWA 3FHIB 1FAYA 1F5FA 5FJHA 1MS0A 2BP6A 3AMQA 4PIZA 3ELNA 5JXJA 2PLV3 5L7OC 3ETPA 4WVZA 4CDQB 1UZZA 3M3EA 3APBA 4GH4C 4KH9A 4YGCA 1SCRA 3AKSA 3I54A 1EUTA 1UIJA 4AHYA 1YLLA 4UYBA 3TEWA 4GAZA 1CJDA 4DEVA 2QNKA 4Q0UA 1N1TA 4MGYE 4XF3A 1D4M1 2UWCA 1SLAA 3S7EA 1H4HA 5FZCA 4DOUA 1FV2A 3IWZA 2X5IA 4JZRA 2JB8A 1VE0A 3U0ZA 3UV9A 3PL0A 2VXRA 5DXDA 4JGZB 4AHZA 4WM7B 4CZSA 2OQ6A 3B5LB 2GNMA 3EB7A 3H1WA 3VDBA 4IUGA 4MHRA 1DQ2A 2C9KA 5A3NA 3RZGA 1CZVA 2DYCA 3POIA 5FYMA 4FO9A 3ZVXA 3KWVA 2XUEA 4A7KA 4AI8A 4Q4W1 4BH9A 4ASMB 2A5ZA 4FPFA 1T2XA 5BV6A 1GZTA 1RUOA 1Y9QA 3WLUA 3KGZA 3A22A 4HSLA 2HWC1 3KD4A 4Y4YA 1PO21 2BEOA 1I6XA 1WCKA 2WS91 3M2MA 1V0AA 4H7MA 4LBQA 4IE7A 2PHUA 3ZN6A 3O0VA 4Q4X2 1RTVA 3S57A 4WBBA 1SCSA 5FZEA 3KMHA 2ZGMA 4N8MA 5FDBA 2P17A 2PAKA 2W1UA 4D3WA 2ZGQA 3I97A 4HPKB 3ZXFA 1QNWA 4CDXC 2EAAA 1DQ5A 1D7PM 3E6BA 3TOJA 1JYXA 2E26A 5FCCA 1HKDA 3N9NA 2RM22 4QPIA 4FOVA 4Y5SA 1ZA4A 3ZFEA 1S0JA 2PXJA 1AR63 1OUSA 1LNSA 2ZZQA 3LIHA 4Z8BA 5JUVA 4RGKA 2CHHA 2Y0OA 1GLHA 5FUPA 4EWDA 3AMMA 5FLHA 3WHUA 1UYYA 1XC6A 1WW7A 1DU3D 2R041 1MZ5A 2C9AA 2WR9A 4LO6B 1QJU3 1AYN2 1WCSA 4IETA 3THCA 5KR7A 1M06G 2E51A 2LROA 3KHCA 1TMF1 1C8NA 2WWSA 3BUCA 2E31A 3B00A 2PAEA 4FPOB 4HVOA 2B7YA 1OC1A 2JICA 4YVWC 2WO1A 4MHUA 2RR12 2A75A 3TEXA 1NOVA 1RUG1 3O1VA 4M00A 3ZSEA 3UJOA 1R64A 2VTXA 3JXSA 2C4XA 3QACA 2DU0A 2QTWB 2PHDA 2VZUA 4J25A 3ZXAC 3BALA 1XBFA 3OGRA 1VBD3 2YGMA 2IXHA 5LZ6A 2X5IB 3B01A 2R071 1LHWA 1QH7A 3POJA 4Y4RA 1SBDA 3WNPA 1HXS2 5IVFA 3VD3A 3VBFC 2G1MA 1W6QA 4HETA 1DP0A 2CAUA 4YGBA 4EN9B 3M3OA 4CEWA 1HX6A 5F5QA 4XBLA 2FD8A 4LBNA 4JDNA 1RL3A 2JDUA 4Q2FA 4QKNA 1RUH3 3ZMOA 3NRUA 3SKVA 1YI7A 4OYUA 1SDDB 1XB9A 2J1UA 1UPIA 2QQWA 3GZTB 4EWAA 3KHBA 3WDYA 4R52A 5DAQA 4NIAA 4LBQB 4R8HA 4FBFA 4XETA 3LWCA 2DUPA 4EYUA 4PHZA 1TE1B 1YWKA 3H3UA 3RDIA 5LWBA 2JD9A 5FR3A 2D5FA 3GZEA 3CMGA 3HT2A 1POV3 2EIGA 4YW6A 5BNOC 5LA1A 2V4VA 2WNOA 2ZGPA 3I4IA 5FPUA 1XU2A 4LIUA 4DQAA 4XACA 3KM5A 5FUNA 2WFF3 4QPIB 4KU8A 4A2UA 3ZFEB 3LCPA 1V00A 3J7HA 4GB31 5A1LA 4QGMA 4OLLA 1NQJA 1OQDA 4ORFA 3CJIA 1DQ6A 1UAIA 1OBNA 2ZEZA 4QPGC 4UFJA 1G9DA 5GZFA 5FOBB 1ZM1A 2XGXA 3ZSKA 4HMZA 1RC6A 3I2JA 2DF7A 1TNRA 4L8QA 1OA2A 3T08A 4XJAA 1AX2A 3BVCA 3GDBA 4AI0A 1BMV1 4CEYB 4F8AA 3CHXA 1FATA 3SMHA 2AEZA 2DWRA 3K46A 3MBWA 4QHBA 5FP7A 4LMFA 4RQPA 4XJ8A 4UW5A 3RMXA 4CUGA 4ATEA 5C3PA 5DMYA 2UYBA 1BEV2 3THPA 4E27A 1YO8A 1ZZBA 2DTYA 2PLV1 1CD3G 1I3HA 4JKLA 2VE1A 1OKOA 3RFRA 4CCKA 2RR13 2D6LX 5HI0A 5A3OA 2VD7A 4D69A 2W52A 1BVP1 3OPZA 1LJ7A 3OGJA 4BQYA 4INDA 2XG3A 5FZOA 5IVJA 1UXZA 1YC61 4LR4A 3VDDC 1W6QB 3AZZA 2TBVA 2QQOA 3O1PA 2J1EA 5FV3A 4CEWB 5FZDA 1W03A 5JI9A 3OBTA 2WRAA 1W2UA 1JU3A 4A41A 2ZAAA 1DIWA 5DAXA 2WYSA 1MS1A 1OMIA 1ULDA 5IWFA 2UY8A 5FO8B 2AUYA 2CNAA 3ZYJB 4C90A 2BOIA 4HN1A 4XEZA 1TEIA 2D43A 2RV9A 4RR3C 4FPCA 4UOJA 4YG3A 2P3KA 3W20A 1R1ZA 3D4KA 4KI5M 4B1LA 1X9TA 2VUCA 5F5IA 3C7HA 4BM8A 2ZGOA 5FPLA 4P9YA 5IT6A 4YWAA 5DAVA 4YFZA 2WN3A 1H2MA 2JE8A 2W94A 4OUSA 5CIRA 3OEAA 2JE9A 4XFCA 5LBBA 4X6RB 2ZMNA 2JB4A 2VNOA 3CNAA 2W47A 3MIHA 1O3TA 4BQWA 3KQ4B 3EYPA 3CJIB 4PF5A 4QMAA 1AR61 1ZX5A 4QB1A 2TUNA 1GZWA 3JB8A 1PK6C 2TNFA 1EY2A 3LDRA 3Q8AA 1R1A2 4ZKTB 1VMHA 2J1AA 1U5ZA 1QJU1 3I59B 3K4ZA 1JTZX 4CSWA 4FFIA 3ZFGA 5E6HA 4A7YA 4BMEA 1AR72 4QQPA 1YQ6A 2G9ZA 5C4WA 4RQPB 3PDQA 3ZLIA 1EYBA 1NG0A 1V6JA 4P9LA 1HQLA 1AZDA 4AVTA 2RDSA 2ERFA 2JKXA 5FAXA 1DBNA 1VBE3 2BFUS 4YM3A 2C24A 3ACHA 1OHFA 2RDQA 3IIIA 3POBA 3PVBB 1IZ3A 1BK1A 1XJAA 3M7AA 1DF0A 3NV1A 1DQ1A 2XHKA 3OBRA 4LK6A 1W8OA 4YW5A 4A42A 4BPZA 2IWGB 4NAOA 4FPLA 1DGRA 4AEDA 2O14A 4Y3OA 4KWKA 3WEZA 5C8WA 1VBD1 5FZOB 2HWF3 4MV2A 5KBFA 3MLJA 3ACFA 3RJRA 1QJZA 3V65A 1UMHA 4MADA 1Q56A 3ZXDA 1T6GC 4YFWA 4AGVA 4P9JA 1H1IA 4Y1XA 2OS2A 2XVLA 5FTTC 1GZ9A 2VVFA 4HANA 1V6NA 2B9UA 2Q5TA 3MIDA 4QD2A 1JYWA 2VU9A 3LKJA 3SEPA 1US3A 2HEWF 2WO7A 3THDA 5I8TA 4E4ZA 4NROA 4QDQA 1RUH1 3VDCA 4MO3M 4QXKA 5FZFA 3D5OA 2JDKA 3N9OA 1ZBE2 5I0RA 3PMSA 4YVSB 5IYYA 1S2EA 4AQ2A 4AQSA 1Z0HA 4LA3A 5DDJ2 1VBB2 1FPN2 4MUVA 4FP2A 3LAGA 3DV8A 5K4LA 1Z78A 2VQUA 3QCWA 5J48A 1B35B 1POV1 4AAPA 1CVNA 2VH9A 1ZZ7A 1UMIA 1WWYA 2RE9A 2ZGKA 1VALA 1RXGA 5JMOA 2D93A 4Q4X1 3WW2A 2WFF1 3DKQA 5FZIA 4XHBA 1YNAA 2QDNA 3KZ4C 4CUAA 1G86A 3MLKA 5J37A 2JG9C 3OB8A 4Z92B 1UOFA 1ZBA3 3I2FA 2ZX2A 4IEPA 2WQ4A 3V0BA 2PQSA 1HB1A 1OF4A 2GSYA 2VQTA 1D0HA 2W1QA 1NKGA 4LBLA 3MEPA 3H8OA 3ZFGB 1LAJA 1K5MC 1X50A 2A6WA 4MLOA 4AFBA 4COWA 1R1A3 1UX7A 5DG2A 3PLQA 3J4UH 2BWAA 4J1XA 5C3RA 1H0BA 1OQ1A 2Y6GA 1D2QA 2VOVA 1AR73 2ZHNA 2VCBA 3FUOA 5A6QA 3GCWA 5CFCA 2DCZA 2B8MA 2D6KA 4UAPA 2BGPA 5F1RA 1SBFA 3VZNA 4AI3A 4GWMA 1VAKA 2P4EA 5K0UA 2Q1ZB 2XH6A 3HQUA 1OI6A 1V70A 2RR11 5SV5A 3ZKUA 4AEDB 1NLRA 5J98B 2JDMA 4YNIA 1GZCA 3W59A 3WNXA 1WCDJ 5F6KA 5F32A 3O14A 5FJKA 1OUXA 3AKRA 1SLIA 1G9FA 4NAMA 5DG1A 5ACA2 5I8YA 2GC3A 2W92A 4FAHA 1H9WA 2GMPA 3ACGA 2VUDA 5AVAA 3GYDA 2DUOA 4YZ5A 3LQCA 1CQ9A 1WMDA 4YM2A 3T2PA 3LEIA 2VG9A 1JOJA 3OSDA 5JXIA 5BNNC 2XJUA 2CY6A 4IERA 1HXS1 1GBGA 4K1YA 4MGKE 3S30A 3ILFA 2JJ6A 3U07A 1R083 2OPKA 4M3CE 2AR6A 1GOHA 1CPMA 2W08A 2XJRA 1ODMA 2HBUA 1OH3A 4U2AA 1HV0A 2QQUA 1F8VA 1RUNA 4PQQA 3BI3A 3E5XA 1YFWA 1FYUA 1LOCA 1VRH3 5GLUA 5HPOA 2OZ6A 1PGW2 2WO3A 2ZEWA 4M4PA 4N43B 4YM0A 3N9LA 2DBIA 1LHOA 5T50A 2EXKA 1DZRA 4LJHA 4A45A 3QH6A 5D1IA 2WA4A 2D44A 2Y60A 5DDJ3 1VBB3 3RRDA 3ZFFB 2QE3A 2EXIA 4UFIA 1JBCA 5HCAA 4QPYA 3RZJA 1W99A 5SV8A 5F6LB 1LOFA 1C3HA 5A7NA 3V0BB 2HEYF 2XHNA 4Q4W2 3LSDA 5G05L 3ETQA 5IFTA 2HWC2 1BLZA 1IOAA 1PO22 2WS92 4GD4A 4L2NA 1RINA 1YFYA 2BNMA 1ONAA 2EALA 4L97A 5CNAA 3NL1A 5JXGA 3TNPB 1RGSA 3AKTA 5B4XA 4D8MA 5FMDA 2XKOA 3NJYA 4QGNA 4XF4A 3RQ0A 5CFCB 2AC1A 3EMRA 1UY4A 2R062 4BK5A 4C8DA 1UOJA 5K0UB 1KITA 2LRPA 1KXGA 3PMEA 4BQ2A 1HRI2 1PNFA 2YGLA 4R9CA 2MNGA 3WD5A 4COYA 1VPHA 2FDHA 3AB0A 1O4TA 3J8F3 2X29A 2R042 5FZ4A 2HWF1 4WZCA 4GWJA 1SFNA 1CN1A 4QHZA 3WX5A 4UXAA 3AM2A 2A3YA 1TMF2 4L0PA 5JWPA 2BJSA 4NN0A 3U78A 4Q8LA 5IUQA 3R4UA 4GKYA 3KF3A 3IAQA 4UT5A 3RZLA 3BN6A 2Z5WA 4XXAA 4IE4A 1PNGA 1WW6A 4KGQA 5T5OA 5GZDA 1GQPA 1J1LA 2KM2A 2V09A 3MIEA 3WCRA 4CTEA 4KQ7A 2QZ2A 3IMMA 5FQ0A 3RI9A 1UN1A 3VDAA 1U0AA 4OULA 4QX5A 5G04L 5FY8A 2HWD2 1JZ8A 1YQ5A 2DCKA 2FZ2A 2ZX3A 1ND3A 3H42B 4QHOA 2A7AA 5H9PA 1H2LA 3T1LA 2YDEA 3AYAA 3R4DB 4F7ZA 5LBEA 1Y9GA 1BVVA 1QDCA 4EWEA 1NZCA 2XWBB 1BQPA 1LHNA 1COV3 2VC9A 4K6BA 2NM1A 1WMFA 4KNCA 5DN2A 1W8WA 4QWNA 4DXTA 5A3MA 2BNNA 4ASLA 3UJQA 4FPHA 4FCAA 3WP6A 2VQAA 3N7KA 4ZZ8A 5IAXA 5J1XA 1GNYA 2B5HA 1ZBA1 1W6NA 1Y3TA 1Z7S2 3KS7A 4XABA 4EJRA 5EWSA 3J7NA 5C8CC 2EICA 5F3GA 3CEWA 4K9SA 4LKFA 4DFSA 4QM9A 2HKXA 3ZYIB 3V0AB 1HQNA 4C0HA 2YC0A 2X8KA 4IV1C 2DU1A 3NO8A 2VJXA 1JN2P 1NAEA 4OVEA 3RWNA 1AYM3 1LESA 4F3JA 3ACIA 1R1A1 5I0UA 5CFDB 5IVEA 5T5JA 3FBMA 4NRQA 3P3PA 1F31A 1GV9A 4O9GA 5CISA 5LK7B 4AK3A 1AR71 2QQPA 3OUIA 3VBRA 1ZRCA 4CP0A 3CDZB 2PAMA 2YROA 1DGWA 2GH8A 1JI6A 4GB32 4OQ9A 4WZFA 2R063 3VKFC 3SH4A 4ARXA 2WNVC 1O4ZA 2WLQA 5F3IA 1HRI3 1OFNA 5ISLA 2K2SA 3K4AA 2R16A 2VTXJ 3A4UA 2E7AA 4FXKB 4YVWA 3BB6A 2WO2A 3AP7A 4Q27A 5ANQA 1QOTA 2CWMA 2JDPA 5BNPA 3VUOA 2P2KA 2NZ9A 5EPAA 2D98A 4GWIA 1C4RA 4IE0A 2C0ZA 2VO5A 1R081 4YW4A 5FXVA 2CGPA 1ULEA 4FFFA 4I0WB 4R9DA 2IXIA 4URAA 3PTRB 3GZAA 3SHRA 5FQ0B 1MR5A 3V56A 3MDPA 1UW8A 2NN8A 1VRH1 4SBVA 1RUD3 3IDBB 1LB2A 1SEFA 2FDFA 1ND3B 4V2WA 2RVAA 4BU2A 2YU1A 1JMUB 4JTNA 4AHXA 1WCUA 4JQRA 3DPRC 4PQ9A 4LKDA 2EXJA 4W6XA 3WOGA 1U12A 2HWD3 4IE5A 5DDJ1 1VBB1 3H3ZA 4L99A 1QIQA 5HV0A 4OZOA 4TLFA 4YRDA 1KDMA 2ZGSA 3DN7A 4AZZA 3VBHB 4CCJA 1ASJ3 2R30A 2YXSA 2VZSA 3K3NA 1AJOA 1W6NB 5FYZA 2VOXA 4G3YC 2A6ZA 4XMAA 4Q4Y3 1QJFA 4URTA 1NXD1 1QJX2 4NIHA 2VZTA 5L73A 4CP9A 2FCUA 1W2NA 1WD4A 2RG4A 3P3NA 4LA2A 3AK0A 1Z7S3 5A7SA 3VD7A 5JZGC 2DCJA 2ZEXA 3HQXA 5FZ6A 2HYXA 3ST7A 4ZU7A 1VB2A 2C5DA 3ES1A 4DUXA 1FNZA 4HBNA 2YBSA 5LATA 2ADDA 3PTYA 4XQDA 2AH2A 2WIIB 4BXSV 5APAA 5FBZA 1AL0G
chains in the Genus database with same CATH topology
2W68A 3VBRB 3AYDA 2Z2SB 4Z82A 3SCHA 4NHMA 1OFSA 2VGDA 3CJXA 1ENSA 1PO12 3WXPA 1WUVA 3NKGA 5K9YA 3MLLA 4AF9A 2GALA 4KL1A 4PLNA 4AVSA 2D7FA 3GALA 3R0RA 1ND2A 3J8F1 3AP9A 4OI0A 3IM0A 2YYOA 1CAWB 2B42B 4K21A 1UX6A 5BNPB 4BCUA 5JOWA 3KB5A 1B09A 1M4WA 2IXJA 3RMYA 5ACA1 5FRAA 1O3RA 4EN8B 1S0EA 2OYZA 4XJZA 1WLTA 3NJZA 1H8TC 1NCRA 2H0VA 2DVBA 3KSCA 2Q4SA 5H9RA 2FMDA 1PGSA 3AYCA 5DZEA 1JXNA 1V9U3 1VBD2 1CAUB 1RHI3 2VW1A 3A0NA 4Y24A 1PGW1 4DMIA 1AR82 1IS4A 2A6YA 1XNCA 1COV1 1IS6A 3SH3A 3VBSB 4GWNA 3E5QA 3WCSA 5FPXA 2G4IA 4P9IA 1MACA 4D7TA 4AI2A 5A3LA 1RUH2 4L11A 4TSVA 2WA3A 3X29B 1QU0A 3J26N 4OHVA 3L2YA 1ENXA 3ES4A 1KQRA 4PDWC 1QXPA 3B02A 1QJX3 5IK7A 2RS53 1CAXA 1AYM1 1FOD3 4XFGA 1LGBA 1MS3A 1IKPA 1RJ7A 4D7SA 1H8VA 3B93A 1RITA 2G9GA 4I02A 1NCQC 4PBPA 2FZ1A 2WFF2 1N1VA 2WLPA 2BVBA 3MFCA 2D3SA 1SLLA 2R061 1MVQA 1SMVA 3VZLA 4P9XA 1ND2B 1PO13 2AZ5A 3HMYA 1OOPC 3ILNA 1NLSA 3WG1A 4KGGA 4JTOA 4KG0A 4MGIE 1HRI1 1UCXA 2VNRA 2ETEA 4LE3A 1DYKA 3VHRA 4ES8A 1G8WA 3BOWA 1PIV2 3FLPA 5JI7A 3UKNA 2VMHA 2WNUA 2WZPP 1NCRB 2RS13 1ZZ9A 2D6NA 1W39A 2HYKA 3KQRA 4DINB 4YZ1A 3M3IA 1RUF3 1VLNA 1RUD1 3JQXA 4Y22A 1U5XA 4AVAA 2PYTA 4KG8A 1TME3 3QLQA 4HFSA 4HT1T 3EHKA 1QXRA 1A3KA 2G9FA 1AXZA 4RA0A 4NPRA 4FPYA 1DHKB 2NMNA 2HWD1 4AXOA 3ILRA 1PHMA 4IEWA 1XE7A 5D8AA 1AR83 1ASJ1 1H4GA 1LTEA 1LR5A 4Y1VA 4LO8A 4Q4Y1 3H1YA 5AC93 4WM8C 3VBOA 2A6XA 2R6QA 4GMP0 4A7ZA 1GANA 4JDMA 3RI8A 1Q43A 1CAVA 4C91A 5E8AA 1Z7S1 4XDQA 5GZEA 2UY9A 4LHLA 4BLIA 4CDWC 1X33A 1CAXB 4CP2A 4DZGA 4R9AA 3QBQA 5C33A 2BPA2 2FZ2A 4YM1A 3WV6A 3IDEA 1A8DA 2GC1A 1MVEA 3ZN6B 4XIKA 1IKQA 2JG9A 2A3WA 4CDQC 3WY6A 1GFF2 2XVKA 1BCXA 3CU7A 1N3QA 2ZGNA 4FPEA 2GMEA 2JDZA 1F5JA 4AEKA 4H55A 2NMOA 2GH2A 2D3RA 4XPVA 1K5MA 4LE4A 4NVPA 1IPJA 3AKPA 1LOEA 2MPFA 3N4MA 4UW4A 5IK5A 5EYXA 4OZXA 1VBC3 3OY8A 4JGZC 4M3CF 4WM7C 1GYKA 4XJWA 4B3NA 2RS32 5FOJB 3NV2A 2PHTA 4UBGA 4P5HA 1UU6A 4IEVA 5CVRA 2IXLA 3AYEA 2PHXA 2WNUB 2WFPA 3N7JA 4WVMA 5A33A 5JOZA 4GALA 4LLFA 1DDLA 5I0SA 5TSWA 1VBE2 3FJSA 2ZABA 1ZVFA 1PIV3 3B3QE 5JCTA 1N3PA 4DS0A 3HIFA 3JBG2 1OQEA 4G4FA 1DQ4A 1UL9A 2EA7A 1NQDA 1BZWA 2HWF2 3IMNA 3IKWA 1RHI1 4YGEA 5B2GB 2OVUA 5BNNA 1JHNA 3W58A 1DGWX 1O91A 2ZBJA 1ZZ6A 1DGLA 1L3JA 4MSVA 1XE8A 4AHWA 5D8AB 2E63A 3H1MA 3VKMA 1WLWA 3E6DA 2PTMA 2ILMA 2QJVA 3WW3A 2GMMA 3VBOB 3BTAA 1GNHA 1O4YA 4B7EA 5A32A 2ZKLA 3M4FA 3MYXA 1CAVB 3ENRA 2HWE3 3VZJA 4K7JA 5BPXA 1QJX1 1S0BA 5CB7A 1V6OA 4I01A 2WNEA 4COZA 4W65A 4HKLA 4OHXA 4AQTA 2R32A 3T1MA 1RUE3 1FOD1 1I5ZA 4YG6A 4CP1A 3HT1A 4HK9A 1XYNA 5GZGA 2XJPA 4Q1RA 4FPJA 2XVGA 3VBUA 1C1FA 2DV9A 1ZBA2 2WSUA 1YI9A 2GC0A 5T3NA 1VAVA 4M01A 1PO11 3H8UA 2X5IC 4C1WA 1QHDA 2A73B 3OY8B 4YG0A 3LA3A 3WUCA 4YZ3A 3FWEA 3KCYA 1V6IA 4LNVA 1KDKA 3SISA 2WT0A 2NYYA 4WVMB 5A33B 1HRV3 2RS33 3BOPA 4XMIA 5GALA 4MZUA 3OD0A 5T54A 5I93A 4NOTA 1GR3A 3E97A 2RS11 5J09A 5GLWA 4FVVA 1LU1A 2D6PA 4RS5A 2YPJA 1WBLA 3MW4A 1HQWA 5I8SA 3RS6A 1QJY3 3R4SA 5C9AA 1RUF1 3O7OA 2K0GA 1DZTA 5KHJA 1SLTA 4NHLA 5F9TA 1TME1 3JBG3 4LBJA 3VZKA 1VJ2A 2K9ZA 4MYEA 3FUQA 1Y43B 4QPIC 3VGIA 3ZFEC 4XW3A 1I1EA 4HKOA 1XU1A 3VN4A 5JOYA 1FV3A 3KLSA 1AR81 1R082 1KFXL 4FAGA 1S2BA 4XFIA 1S0FA 3PNAA 4GQ7A 2IXKA 3IBMA 3N7MA 1JUHA 4KBBA 3JUUA 2DURA 2PHFA 5LEJA 1VRH2 4CDUA 5AVPA 3ACLA 4QU2A 3LZZA 1MQTA 4CEYC 4HLTA 4P9WA 4BQ1A 2I2SA 4LLOA 3WDVA 3TN92 4OHWA 2GAUA 4Z07A 5C8CA 2VNGA 4AYUA 3VBUB 2ZGUA 3AJZA 3DL3A 3ZXJA 5JOXA 1CESA 3WHTA 2CTVA 1NA1A 1GZWB 2CGOA 2RHPA 3LA7A 3PVOA 1VBC1 4CEWC 3AKQA 3POSA 3HWJA 4FOWA 3MZHA 1KRIA 3AMHA 5C4WB 1LODA 3TYJA 4AI1A 3B69A 2B39A 3ZMNA 1UU5A 1X82A 4RS5B 1UZYA 4WVWA 1V6KA 3LGRA 1PIV1 5C9AB 2XL9A 4C0BA 3VKLA 2F6BA 2DCYA 5EXOA 2WT2A 3B94A 3J8F2 1WMEA 1ULFA 2ZX1A 3EO6A 3UKVA 2BFUL 2V5YA 1WW5A 4N53A 1NXMA 3I7DA 2ZZJA 3TAYA 4HVRA 3WDXA 4J6GA 3CJIC 3K51A 1AUYA 3D0JA 4FXGB 1O5LA 1MS9A 2R0FA 3SITA 4FQ4A 3ZSLA 3OYWA 4FTBA 5LRSA 4J1WA 4CDUB 2ARBA 2HWE1 4XFBA 3U4XA 1MQTB 1CJPA 4X6QB 4P14A 3CO2A 1G6NA 4DRRA 1QQP3 1IHMA 1VB4A 4RQPC 1W6OA 2WZR3 4BIFA 4SLIA 2XJTA 5ABJA 2RJKA 1RUE1 1COV2 3NAPA 5JIUA 4Q0SA 4IEZA 5FO7B 3BIWE 1S0IA 1UKRA 1LEMA 1YRZA 4QQHA 3TN93 4JVAA 3WW1A 3TWIA 3VKOA 4MH0E 5JZGA 1NA1B 3WVJA 2C1FA 1DQ0A 2XL7A 2RMU3 4GULA 1RUJ3 5C6CA 3KT1A 5EJ3A 1BKZA 2JG8A 4M0NA 1AYM2 1RMU3 2LM3A 4META 1RVF3 1X7NA 3IDCB 2IFRA 4BOWA 1XNKA 3I2DA 5T52A 3ZSMA 1OLRA 1HRV1 2RS31 1GQHA 4IV3A 3FX3A 2R1BA 1Q8PA 4GMP3 4XYXA 2GN3A 1FX5A 4Y1UA 4YVSC 4YZ2A 3JCIA 3AZXA 4HN0A 1VBE1 1QJY1 2EF6A 2PN5A 2D40A 2ZMLA 1B35C 2E9QA 3ZIXA 3JBG1 1AL22 2ZTNA 4N53B 2ZACA 2I07B 4AVVA 1BBT3 1C8M2 4NHKA 3TB0A 1SLBA 3M8LA 4D94A 4IEXA 4PLOA 2ENRA 2Q0AA 3IN9A 4AE2A 2BVVA 2PQQA 2DVGA 1U5YA 4FOQA 2WL1A 5L7OA 3OYWB 3G6JB 4GH4A 2BW8A 4OI2A 3FFZA 2ZX0A 2EAKA 4X8NA 1NY71 3ZFGC 4B7KA 1RUD2 4R9BA 2ET7A 2MEV3 1MEC3 1OSGA 2HWB3 3EBRA 4RL7A 1ULGA 5ABJB 1HW5A 1OPOA 4LO4B 3NAPB 4WVVA 2R1DA 5J96B 2BGCA 1SACA 3RPQA 1J3RA 4EN7B 2OZJA 1PGL2 1ASJ2 1OLQA 3OCPA 4IQPA 2ET1A 2Z79A 4AEDC 2PFWA 5JZGB 1YXWA 4ONUA 4Q4Y2 4LBMA 5T55A 4YSFA 3H7JA 3FFQA 3AP4A 1XNBA 4Q8KA 1QF3A 1RIRA 4JC1A 1LHUA 1ZREA 2VPVA 3ALQA 2JG8B 3URFA 3MW2A 2JEMA 4HL0A 2ZPXA 2A3XA 3CL1A 4IV3B 2W39A 4XOGA 2A6VA 3SXWA 3JD72 2XWJB 1W6MA 4CDXA 1FT9A 1QOOA 5FLJA 1FI2A 1EPZA 1QY4A 3HAGA 4NO4A 2D3PA 1REDA 1PM7A 4N43C 5JSOA 4IEQA 5FPZA 1I9RA 3AXDA 5BYNA 4ES9A 2VW0A 1ALYA 4K8FA 2VY0A 2PHWA 3ZFFC 2YZ4A 2VOKA 4JRAA 1S0DA 2GZWA 3JU9A 3UL2A 5JPNB 4H14A 1H2NA 1KS4A 1LU2A 4RGGA 1AL23 3MIFA 1DG6A 2CV6A 1C8M3 4LBKA 5L7OB 1OD5A 1D4VB 1QMJA 4GH4B 2OUJA 3EQEA 1WBFA 4XF1A 5BY5A 3W9AA 3KT4A 3AZWA 3WG2A 3WP5A 1WW4A 2P34A 4B4RA 4W6YA 5JR7B 1TQ5A 1V9U2 2E7TA 4YZ4A 4E9KA 4GA9A 2I45A 4B4PA 3GHNA 1RHI2 4I2OA 1QQP1 5IK4A 5CFCC 4I0BA 1N1SA 5JIAA 3VBFA 3BCWA 5K0UC 4Y1YA 2DVAA 4KU7A 3O0XA 4WM8A 1DFQA 5GLZA 3TN91 1HLCA 5FMOS 1PVC2 1JUIA 5JMCA 4ATFA 1YCIA 1RUJ1 3CF6E 3RYKA 2ZJCA 3EJKA 2RS52 3B7MA 3WW4A 5BNOA 5JSPA 3O12A 4YW3A 3VZOA 1ZRFA 1DZQA 1ZZ8A 1FOD2 3NKTA 4EN6B 1F9KA 1W6MB 3LSEA 4CDXB 4OHZA 4GMP1 1HIXA 4XILA 3JZVA 1KFUL 3JD73 2GU9A 4I3GA 3ZYRA 1CR7A 4WM7A 3N35A 3FMGA 4QPGA 1GSLA 3AFKA 3DUIA 2UU8A 4Q4V2 5FLIA 5JVVA 4BLJA 2JXAA 1IPKA 3WQ7A 2EXHA 1BBT1 4AG4A 1LOFC 4QQLA 1YUDA 2DTWA 4YVWB 5JLVA 1N1YA 4AFDA 4AWDA 4AQ6A 1C28A 2RS12 5E89A 4XJUA 1QKQA 4B8EA 2ZAHA 1AXYA 5DZFA 3FBYA 1D0GA 1URXA 3MF9A 1RUF2 1XQNA 1W6PA 1FNYA 2OW4A 3C2UA 3GBWA 4HPKA 2O8QA 3RSJA 2MEV1 2CAVA 1QH6A 4AGGA 1MEC1 5CFDC 1TME2 2ZHLA 4LO7A 2HWB1 1AR92 3O5SA 4AEMA 2NQYA 3RYPA 1DGRN 4Z1VA 3VBFB 1PZ7A 3VDDA 5CA6A 2ZX4A 2IZWA 4B29A 2UURA 1XNDA 1S0CA 3POYA 2XBO3 3D82A 1CX4A 5KWRA 3GNEA 3MF6A 4IXLA 1GKBA 4E4DX 3RG0A 1LCLA 4QM8A 5AC92 4RR3A 1R093 1N3OA 1SBEA 3NV3A 5FMOL 3AX4A 5J36A 5BNOB 5EYYA 1PVC3 2AENA 4MVTA 3OTFA 2XUMA 5HCFA 4TYSA 2PHLA 2DFCA 4AFCA 1YIFA 2H6BA 3LA2A 3FLRA 3H50A 2GDFA 3FC0A 3ROUA 4O9EA 1ND3C 3T2TA 4N7UA 4QPGB 1EV13 1PK6A 5JSRA 5HCBA 3ZXKA 4L92A 1VBC2 4HSJA 2BBVA 1Q8VA 3ZPYA 4IESA 1LKNA 3FZ3A 4Q4V3 1VR3A 4HVQA 2ZGLA 3VBHC 3V64A 1AL21 5IK8A 2Y26A 1CIWA 1BJQA 3IIAA 1C8M1 2D6MA 3N7LA 5DUXA 3SCGA 1UKGA 3Q9OA 1APNA 3B9IA 2ATFA 1MZ6A 4RFT0 2JECA 2R0HA 3D0SA 1W6PB 2D5HA 4BWOA 1V6LA 4LBQD 3FLTA 1VBA2 2FQPA 3VZMA 3GBFA 4XBQA 3VDDB 2VMIA 3VBRC 1UU4A 3MW3A 4WV8A 1AR93 4AVCA 5I0TA 1J59A 3ZXLA 1WLCA 4L9BA 2XJQA 4Z2WA 4JGYC 4MX3A 3WP3A 3G7DA 3GZUC 3HD8B 3E5UA 4UW3A 4RR3B 1A78A 4N90A 3UKTA 3WUDA 1PGL1 4CEYA 2VW2A 4XFFA 3ZO0B 1IGOA 2HWE2 4ZU4A 1LEDA 1A8MA 5BNPC 4JRLA 3WR0A 4RGAA 1C5IA 1EP0A 4BZ4A 2GNBA 3LOIA 1RUE2 4UW6A 3BPZA 3MIBA 4FSJA 1A6CA 3AP5A 1W0OA 3JD71 1C57A 4XJ9A 5AFBA 3PVNA 2VECA 1PK6B 1YHFA 1ZZCA 4K3UA 5LEKA 4FPGA 2JKBA 1XRUA 1BXHA 1KD7A 3ZN4A 5GZCA 5KC6A 5L36A 3BU7A 5FREA 4Y20A 3SNMA 3VBSC 3HR9A 3RNSA 3N3HA 2PHRA 1HRV2 4BA6A 5EV7A 1VAMA 4LULA 4PIXA 3LOBA 2WT1A 4F83A 4QT6A 2WJSA 4PLMA 3QD6A 2ZKNA 1UPSA 1QJY2 4Q4X3 4Q26A 5J7MA 1ZYBA 3ME2A 2XJVA 4Y22B 4Q29A 1AVBA 1V9U1 2RM23 2V73A 1VBA3 1S1AA 2A70A 5GLTA 4OHYA 4AFAA 2ZHMA 1LRHA 2LTNA 2XBO1 4I09A 1TNFA 4K1ZA 3AJYA 3ZN5A 3U10A 1ND2C 3I59A 4M3CA 3RYRA 4BMBA 4KWJA 4XXPA 2XPJA 1AYN3 1AJKA 3J9SA 4HZFA 5CG8A 1NY72 5JDBA 1R091 2BUKA 3M3CA 3OGGA 1S0GA 1H1MA 4S2FA 1ENRA 4FTEA 1PVC1 3AZVA 1EAH2 4OUMA 1NCRC 4KWLA 2RS51 1LULA 1XYOA 1PZ8A 2RJLA 2WINB 4ISRA 2JG9B 4MXWA 1RUC2 2DVDA 1SDWA 1UF2C 3KT7A 4E2GA 1EV11 1HXS3 1Q8QA 4ZU5A 2X53S 4YW1A 2CWSA 1K5MB 3PJYA 4Y20B 3H9AA 4Q4V1 4HK8A 1D2SA 1FMD2 4P9GA 1AX1A 4YLZA 3RJ2X 4YVSA 4AVBA 3NVCA 3LB9A 1JYIA 4N9IA 4YGDA 1B35A 3SLIA 2TEPA 3TNQA 4HKWA 1KJLA 1OA3A 2KA3A 3O0WA 5BNQA 2CYFA 2Q8OA 3WINE 5T5PA 4IEYA 4IEUA 1KJRA 2IFWA 2Q30A 1LOGA 2BWCA 3ZIWA 1KS5A 4RSUA 4UBHA 4Y1ZA 1O5UA 3OD4A 2PA7A 3UK9A 2NP0A 5BNNB 1AR91 2E6VA 1X8EA 4U36A 2XKPA 3ZXGA 4M3CB 2UYAA 1IS3A 2PELA 2ZA9A 2QCSB 1DYPA 5E1RA 3B9CA 3WG3A 3QH7A 3EXUA 1MS4A 1Y7BA 3MPBA 1E57A 5A32B 5AC91 5LRRA 5EFUA 1GICA 1QQP2 1H9PA 4LEJA 2BNOA 2P3IA 2WZR2 1BEV3 2GC2A 2WNUC 2BYVE 1O3SA 3CLPA 2ZCWA 2Y38A 2WKKA 3USUA 1O7FA 4TWTA 2BQPA 4EROA 4MXWB 2B45X 1EAH3 2NLRA 1YFXA 3N36A 4DNYA 1LHVA 2F4PA 1ULCA 2ZGTA 1O3QA 3KGLA 3MICA 1RUC3 3A0KA 4FQZA 4ISQA 2RMU2 1LOAA 1RUJ2 1V6MA 4I3PA 3NW4A 4IV1A 3AMNA 4YYOA 1QOSA 2MHFA 5D8AC 2VOWA 1RMU2 1YJKA 1RVF2 4FTSA 3GF6A 3PJQA 4COUA 1Q8OA 3VBOC 2VULA 5E16A 4E2SA 5DUVA 4N43A 4RHV2 2N7GA 1FMD3 4XQ4A 4IL7A 3VLBB 3ZSJA 2AREA 3ASIA 1AX0A 1RUI2 4LHKA 3R6SA 4XFHA 2WNVA 3ZFFA 1QXJA 1XXNA 2ES3A 2JE7A 2QKDA 1CGPA 1OKQA 1JW6A 4NR1A 2YV8A 4GIQA 3SCFA 1W0PA 1RB8G 1BBT2 2I74A 2RM21 1VBA1 3INAA 4QGLA 5FO9B 2R49A 2XLGA 1HV1A 4FT8A 2IXCA 5CU1A 4AEJA 1MZEA 3MGUA 2E7QA 1AYN1 2D6OX 4QQOA 5DUUA 4AFMA 2VVEA 4XTMA 3HN1A 3SH5A 5LK5A 2YUEA 2MEV2 5JPMB 1MEC2 2CL2A 2HWB2 1HDKA 3IPVA 3DPRA 1IS5A 2YMZA 2H0BA 2E53A 3I8TA 3USUB 1G9CA 2EVXA 2ZS6B 4JV4A 4B4QA 4E2QA 3WQ0A 4N7IA 4OFGA 4BHPA 4K40A 5C8CB 4PJYA 4RD7A 1PMIA 3OJBA 3AXEA 2Z42A 4IV1B 3NSTA 1X36A 4NWVA 4CRQA 2NPIA 3DKWA 1LGCA 2Y0IA 4PCRA 5J3UA 3TBDA 2DCTA 3VHOA 1G9AA 1C5HA 2YHJA 2ZMKA 4V1PA 2QDRA 1D4M2 1ZBE3 3HBZA 3QOPA 4GXLA 4N9HA 4XQWA 2GNDA 3S6PA 4MGZE 3IT8A 3WP4A 2WNVB 5KC5A 3BODA 1FPN3 3VHNA 2HJIA 2ZHKA 1LENA 2WQZC 4RHV3 3R05A 1NE4A 1BYHA 1RUI3 1MS5A 1UD1A 4XE9A 4ZXKA 4DY3A 1C1LA 5KXEA 5E88A 2WSVA 1S2KA 1G7YA 2A71A 2GN7A 5AFEA 2WC2A 2QVSB 2VUAA 3ECQA 3VBUC 3WDUA 1PZ9A 5KHKA 2IC1A 3V0AA 3AFGA 2BTVC 1H8TA 2CGNA 5BXXA 3ZDSA 3ZYPA 2AYHA 4LTAA 2UWBA 4Y5Z0 3DGTA 3L9JT 4COVA 5CFDA 4TZDA 3D6EA 4FPKA 1MS8A 4BIOA 3IPVB 3DPRB 1XYPA 2D97A 3OF1A 1Q5OA 1BEV1 2O8OA 2VQ0A 3M70A 4ITCA 5H9SA 5C4WC 1S55A