2BBVA

The refined three-dimensional structure of an insect virus at 2.8 angstroms resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
308
structure length
308
Chain Sequence
LTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVTRKDVLNQSINFTANRDTFILIAPTPGVAYWVADVPAGTFPISTTTFNAVNFPGFNSMFGNAAASRSDQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSNVQFPVATTPATSALVHTLVGLDGVLAVGPDNFSESFIKGVFSQSVCNEPDFEFSDILEGIQTLPPANVTVATSGQPFNLAAGAEAVSGIVGWGNMDTIVIRVSAPTGAVNSAILKTWACLEYRPNPNAMLYQFGHDSPPCDEVALQEYRTVARSLPVAVIAAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/rna
molecule keywords RNA (5'-R(*UP*CP*UP*UP*AP*UP*AP*UP*CP*U)-3')
publication title The refined three-dimensional structure of an insect virus at 2.8 A resolution.
pubmed doi rcsb
total genus 65
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 1994-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bbvA00
1RUJ3 3CJIA 2WS93 5L7OA 4N43A 2MEV1 1RUE1 1RUG1 2HWE1 2WFF2 1VRH1 1ZBA3 3VBRA 3JD72 1F8VA 4GMP1 2RM22 1D4M2 1BBT3 1VBD1 4CDQC 1VAKA 4GB33 1HXS2 1BEV2 4CDQB 4QPGB 5DDJ1 2PLV1 2RS13 1AR62 4JGYA 4CDUC 2R042 4IV1C 2RS32 1AYN1 4CDUB 1PGW1 4CDQA 4IV1B 4QPGA 3LOBA 1IHMA 1NY72 3VBUC 1PGL2 3VBUB 1PIV3 2WFF1 1TME3 3JD71 2RM21 1MQTA 1OPOA 1D4M1 1Z7S3 2RR13 4JGZC 5CFDC 1RMU3 1FMD2 4JGZB 3VBUA 5CFDB 1BEV1 4RHV2 4Q4Y1 3VBOC 2RMU2 3JBG2 1DDLA 3VBOB 4YVWC 1FOD3 4YVWB 3FBMA 1ZBA2 2GSYA 2RS31 4JGZA 1K5MA 5CFDA 4Q4V2 3VBFA 1H8TB 1PO22 4Q4W3 3VBOA 4CDXC 4LLFA 1PGL1 5ACA1 1POV3 5GKAC 4YVWA 2BPA2 1AL23 1H8TA 1AUYA 1FMD1 1EAH3 1R1A3 4RHV1 4Q4X1 5C8CC 2RMU1 1HRI1 3JBG1 5C8CB 4SBVA 2VQ0A 1HRV3 2HWC3 3J8F2 1BMV1 1MEC3 2HWB3 4Q4V1 2HWD3 1AR93 1PO21 1QJY3 2Y26A 2RR12 1X36A 5A32B 1HQNA 1VB2A 1ZBE1 1RUF3 1RUC2 4FTEA 2R063 1EV13 2WZR2 1NA1C 4BCUA 2RS51 1ND3C 1RUI3 1CD3G 1NA1B 4EJRA 1ND3B 1FPN2 1PVC3 5A32A 5C9AB 2BFUS 5ABJC 5D8AB 1F2NA 1RUH3 5ABJB 1NA1A 3S6PA 1A6CA 3J8F1 1ASJ2 5C9AA 1W39A 5L7OC 5D8AA 5L7OB 1VBA3 1TMF2 1QQP2 4FTBA 5ABJA 1QJU1 1VBE1 2DF7A 1RUC1 1RVF3 2WZR1 3TN93 1FPN1 2WLPA 5ACA3 1QJX3 1AR92 1RHI3 1VBB3 1RB8G 4JGYC 4JGYB 4RS5C 1AYM3 4QPGC 1ASJ1 1C8M2 4RS5B 4AEDB 1RUD2 5J98B 1COV2 1VBC3 5BNPA 4CEWC 2XBO2 4CEWB 1TMF1 1QQP1 1PVC2 1E57A 1MQTC 4RS5A 4AEDA 1MQTB 4FTSA 2ZZQA 4CEWA 1AR82 4RR3C 5AC93 4WM7C 4RR3B 3ZXAC 4WM7B 5A33B 5FOJB 1SMVA 1R083 4YVSB 1ZBE3 1VBA2 2FZ2A 2HWF3 3VBFC 1K5MC 3VBFB 1PO12 1K5MB 1C8M1 1HXS1 1V9U2 1RUD1 4RR3A 4WM7A 1RUJ2 5A33A 4GMP0 4YVSA 2XBO1 5CFCB 2WS92 4PDWC 1AR61 2BUKA 4PDWB 2R041 1AR73 1QJX2 1H8TC 2BFUL 1R093 4RQPC 4RQPB 1NY71 1BBT2 5CFCA 1AR81 4GB32 4PDWA 3ZFFC 3VBSB 3M8LA 1B35B 3ZFFB 1VBE3 2R073 5K0UC 4RQPA 2RS12 3HAGA 5K0UB 1PO11 1V9U1 2MEV3 3VBSA 1RUG3 1RUE3 1B35A 1RUJ1 2HWE3 3ZFFA 1VRH3 4CEYC 4CEYB 4GMP3 4FSJA 1PIV2 5K0UA 1C8NA 3VBHC 4IV3A 1ZBA1 1VBD3 3VBHB 1TME2 1Z7S2 1BBT1 1RMU2 4CEYA 5FMOS 4GB31 5DDJ3 1NG0A 2PLV3 3VBHA 1AYN3 2RS11 1FOD2 3NAPC 1NCRC 5C9AC 5C4WB 3NAPB 1AR72 1NCRB 4N53B 1R092 2WFF3 5D8AC 4Q4W2 1OOPC 3JD73 1OOPB 1QJZA 2RM23 1PIV1 5C4WA 1D4M3 3NAPA 5BNNC 1NCRA 4N53A 1AL22 5BNNB 1TME1 1BEV3 1Z7S1 2RR11 4Q4Y3 2GH8A 1RMU1 1EAH2 1R1A2 1OOPA 2ZTNA 5BNNA 2RS33 1HRV2 2HWC2 1FOD1 1NOVA 4GH4C 4Y4YA 4GH4B 1MEC2 1VBD2 2HWB2 2QQPA 4NWWA 5BNOB 2HWD2 5BNPC 4Q4W1 5BNPB 1QJY2 1AL0G 1POV1 1HX6A 4AEDC 4GH4A 4CDWA 1AL21 1FMD3 1RUF2 2WWSA 5BNOA 2R062 1EV12 1GFF2 4RHV3 1RUI2 3JB8A 4NWVA 4Q4X3 2RMU3 1HRI3 3JBG3 1EAH1 1R1A1 1M06G 3ZFGC 1HRV1 4Q4V3 2HWC1 1RUH2 3ZFGB 1PO23 4QPIC 1MEC1 2HWB1 4QPIB 2HWD1 4YVSC 4WM8C 1AR91 4WM8B 1QJY1 4Q4Y2 5FMOL 3ZFGA 2RS53 3IDEA 1NCQC 1RUF1 2BBVA 4QPIA 1NCQB 2R061 1RVF2 1COV1 1EV11 3ZFEC 5CFCC 3TN92 1RUI1 5J96B 4WM8A 3ZFEB 5JZGC 5JZGB 1PVC1 1POV0 5ACA2 1RHI2 1VBB2 3J8F3 1NCQA 4CDUA 1RUH1 4IV1A 1CJDA 3DPRC 3ZFEA 3VDDC 5JZGA 1AYM2 3DPRB 3VBSC 3VDDB 1B35C 1QJU3 1VBC2 1ND2C 4Q4X2 1HRI2 1ND2B 1RUC3 1VBA1 4IV3C 2WZR3 2X5IC 4IV3B 3DPRA 2XPJA 2X5IB 2FZ1A 3VDDA 1FPN3 1BMV2 1RVF1 3TN91 1OHFA 2WS91 1ND2A 5AC92 4CDXB 1QJX1 2X5IA 1RHI1 1R082 1VBB1 1ASJ3 1ZBE2 2TBVA 2HWF2 2RS52 1AYM1 2IZWA 1TMF3 1QQP3 4Z92B 4CDXA 1VB4A 1VBC1 5C4WC 4N53C 1X33A 4RFT0 5AC91 5C8CA 1QJU2 1R081 1C8M3 1HXS3 1VBE2 1RUD3 2R072 3JB4C 1COV3 2HWF1 1WCDJ 2XBO3 1AR63 2MEV2 1RUE2 1RUG2 2HWE2 2R043 1VRH2 4CDWC 1AR71 4CDWB 5BNOC 1ND3A 1R091 1AR83 3CJIC 4Y5Z0 4N43C 3CJIB 5DDJ2 2ZAHA 4N43B 2PLV2 3VBRC 3VBRB 1PO13 1AYN2 1V9U3 2R071 1PGW2 5LK7B
chains in the Genus database with same CATH superfamily
1PNFA 3N7LA 1WW7A 4HBNA 3CJIA 4QWNA 3VL9A 3UV9A 4GZ9A 5ISLA 2ATFA 5L9RA 2J7MA 4R9BA 2ZOEB 1O8PA 4GMP1 1W9FA 2EAAA 1BBT3 3R05A 4OHWA 2WO7A 5EP9A 4Q8LA 4EN8B 4CP0A 5CG8A 1MVEA 3BCWA 3O5SA 1JZ3A 4GB33 2DCYA 1BEV2 2FCTA 2NYYA 1Y3TA 3WQBA 3WHTA 3WP6A 2ADEA 3LA2A 1S4CA 4YNIA 2W1QA 3MW2A 4LO8A 3ES4A 3ACLA 2G4IA 2E9QA 2PHXA 2O8OA 2AREA 5M0TA 4CDQA 1O4YA 1Q5OA 2UWCA 2XVGA 4ARYA 3AJYA 2E7QA 4YM1A 3TRSB 2FDJA 3HNMA 2QTWB 3K3NA 4KNCA 3VV1A 3ACIA 4DY5A 3VBUB 4FAHA 3LQCA 2WFF1 4QM9A 2IC1A 4Y24A 2P6CA 2ZGOA 3AVSA 4DQAA 5IK8A 1C57A 1OD3A 1W2OA 3ATGA 2RM21 4NVPA 1MQTA 4P00B 4NIHA 3ZR5A 1W6PA 3EXUA 1CR7A 1D4M1 3C3VA 1UIKA 1RMU3 4HZFA 1ENXA 4IE5A 4EN0A 4OHVA 3TEWA 1ENSA 4RHV2 3VBOC 1WW4A 1TVGA 2RMU2 2A5ZA 3JBG2 4E2GA 3TEZA 1UWWA 3FJSA 5HV4A 4LBKA 4YVWC 1WBLA 5FY1A 3D0SA 3WP5A 4BH9A 1H0BA 4XILA 3BOWA 2GSYA 2RS31 5CFDA 1DG6A 1UYZA 3BYWA 4EROA 2WR9A 4XMAA 1YRZA 1CN1A 3W58A 1UYPA 1V6JA 5G05L 4CP9A 1PGL1 1W8FA 2VULA 1POV3 4ZU4A 2ZGNA 1GNYA 2PN5A 2ARAA 4YZ1A 1W0NA 2YGMA 3NVCA 2F17A 4UBGA 3ZSEA 2VNGA 1XYPA 4KL1A 1KRIA 4FPCA 5GJ6A 1FMD1 3KQRA 1XNTA 1WD3A 2BERA 5FLHA 2Y60A 4COZA 1YWKA 1OQDA 3IMMA 5L73A 3BGAA 2GNBA 4Q4X1 2WFPA 2CTVA 4WV8A 5FZDA 2GC1A 3DGTA 1F31A 3N9OA 1HRV3 5C8CB 1ULCA 3QACA 2AENA 5D2AA 1JYXA 2XLAA 3HEIA 4XFBA 4XIOA 5FP4A 1HQWA 2VBDA 2VCMA 3ZMOA 4ASKA 5L9BA 1DQ2A 1ZZBA 2VZVA 2IVJA 3FBYA 1KJLA 2YPJA 2E7AA 1KD7A 3C7EA 5A32B 1HQNA 5BUVA 1EYBA 3ZYRA 5LCWL 3LD8A 1BYHA 4EQVA 4BLJA 4CXYA 5A3PA 3NKTA 2GAUA 5A1FA 4FTEA 1IPKA 1OLME 2R063 3CIHA 2WZR2 2QQMA 5T5LA 3FE5A 1ND3C 3OEAA 4NHYA 3U0ZA 3ZMNA 4XUPA 2LROA 4XUQA 1K5JA 4SLIA 5JLVA 2OW4A 4LBNA 3N3HA 4RGKA 5A7QA 1W2NA 2GC2A 4I30A 4XDQA 4FCAA 2CAUA 4QX2A 4XQWA 5ABJB 2BGCA 1FT9A 4COWA 1A6CA 1VRBA 4NHLA 5C9AA 5A7OA 1LB2A 1YI7A 2VW1A 4KBZA 4LUMA 2BYVE 3DL3A 3KV9A 5FZ4A 1EY2A 5JPNB 5L7OB 1VBA3 1QQP2 2VW2A 3LA3A 1S0FA 1H2KA 5FY7A 4CYDA 3GYDA 1MS3A 1RVF3 3ZYGA 4ATEA 4HVRA 3AKRA 3SMHA 4QXBA 3KD4A 3VZKA 4S2FA 2BVBA 5LA2A 3MYXA 4Z1VA 3IZOA 4FXKB 4OCTA 2YBSA 4XBQA 2K46A 4N9HA 1JHJA 3IKWA 2QNKA 4HVOA 3OYWB 1W6QA 1RB8G 2W0XA 1NXD1 4JGYB 1Y7BA 2P3KA 3DECA 2CGOA 1AYM3 1LU2A 4NHMA 4UOJA 4R52A 1CJPA 3BALA 2XR4A 1WCKA 3FLPA 2JDUA 3QH6A 1ACCA 1COV2 4HL0A 3HQUA 2Q1MA 3B00A 5BNPA 3H3UA 1TMF1 1PVC2 4FOYA 5E6HA 1EUUA 4OUEA 1DHKB 1O5UA 3ZXFA 3H3ZA 1MQTC 4J25A 2P1BA 4KU8A 4CXXA 2NZ9A 5C3QA 2ORZA 5FXZA 3WT3A 4AQ2A 3I3QA 5DABA 3C7HA 4EWDA 1LJ7A 5A3MA 1C1FA 5A7WB 4WM7C 1W3XA 3I54A 4RR3B 1K45A 3ZXAC 3TNQA 3WG2A 3VD9A 1W9SA 1SMVA 4YVSB 2C9KA 3HNYM 2AYHA 1SLBA 4PIYA 5I8SA 4XCAA 5HPOA 3I59A 2GC3A 3UKNA 3VN4A 4AEJA 2JG8C 1K5MB 1HXS1 3M4FA 2WNUC 2X8KA 3I2DA 1LOFC 3E1F1 4Q2FA 1UY3A 1W99A 5C33A 2DVDA 3NJZA 1CIYA 2XVKA 4YZ3A 4TWTA 3WF1A 4AVSA 2XBO1 5CFCB 1GQPA 5HXMA 4RYDA 3UGHA 5F5CA 3J7LA 2VQUA 3H8RA 2JWPA 3BIEA 3B9IA 1AR73 4V1PA 5BV6A 4DUXA 1UF2C 1UMIA 3IIAA 4X6RB 4RQPC 4E9KA 4NR1A 2C1FA 2WNEA 3ITQA 1KXGA 3LGRA 1AX0A 4E8DA 4I02A 2J1RA 3NNLA 2YPDA 4QDSA 4B8EA 3ZFFC 4AW7A 2Y6KA 4RA0A 1S0GA 1B35B 2ID4A 5FFOC 5L19A 2HEWF 3MEPA 2XLFA 5A6YA 3HAGA 1W6OA 1DLLA 1OH3A 2UWBA 4CCLA 5LA1A 2VZTA 1PO11 2FMDA 3CKHA 1CAUA 3VKNA 2OIIA 3IPVA 3KGZA 3LCPA 1XU1A 5IVYA 3KT7A 3OUJA 1YJLA 4N7UA 4CTEA 1REDA 1W6MB 3WF3A 4Q0SA 1Y43B 4GMP3 2WN3A 1E5RA 5K0UA 5A3UA 2YBPA 3THDA 4FFIA 4OI2A 2DFCA 3VBHB 5FP8A 3RSJA 1GQHA 2JXAA 3BTXA 3BI3A 1ZRRA 5JR7B 2BW8A 1S0BA 3KV4A 4CEYA 1WBFA 1GZWA 1SLLA 3I2GA 4XZUG 1O59A 4B1MA 5GZGA 2J1TA 1OC1A 3ZPYA 5IVFA 1XNDA 3CNAA 2GMMA 1YI9A 1F35A 1M06G 3SHRA 4HN1A 4RN5A 2E6VA 1WLTA 2RS11 2YFUA 3AKQA 5CBLA 5E89A 5C9AC 5C4WB 4HK9A 1YNAA 4DINB 5FO8B 1HB2A 1HN0A 2WFF3 4D7YA 1OA2A 1I9RA 1ZZ9A 3VZOA 1NUKA 1SFNA 2WBKA 3OPWA 4NUBA 2RM23 1PIV1 4L9BA 3AYAA 3RNSA 4YFZA 5BNNC 1D4M3 3NAPA 1NCRA 3GZTB 4N53A 3BTYA 5JXIA 1V0AA 2WNOA 3ZYFA 1F4HA 4K40A 2FDIA 5FZ9A 1NYWA 2D3RA 2AH2A 4FPOB 4LR4A 4CCDA 5LZ6A 2VD7A 3AMQA 1OOPA 4K3UA 2EICA 2ZTNA 3BOPA 3IIIA 5F3IA 2BOIA 4QX3A 5GLVA 3VDCA 4XF9A 3ZXLA 4BXSV 3M70A 1W8NA 4UW3A 2RS33 4XABA 2UURA 4C90A 4I2OA 1KGYA 5F5QA 1FOD1 1NOVA 1UX7A 2VOWA 1WA6X 1F5JA 3OGJA 2GN7A 3AC0A 5CIRA 4GH4B 4CCCA 1MEC2 1VBD2 3FMGA 4O61A 3O1RA 1OSGA 1ZZ8A 1OBNA 4BQYA 5BNPC 4CPBD 4AHZA 4MO3M 3UT0A 1TG7A 4QGMA 4AYUA 1O3QA 5C6CA 1KJRA 3AL5A 3TAYA 1HX6A 1FNZA 4HOOA 4PLOA 2ADDA 4CDWA 1AL21 3VLBB 1FMD3 2VZ3A 2FBEA 4Q0QA 5FREA 5BNOA 1CWPA 2B42B 3JB8A 3VZNA 1OT5A 4Q4X3 4NIDA 1EAH1 3AMMA 4NHKA 3FFQA 5EV7A 3GBFA 2Y6LA 3IDAA 2MPFA 1GLHA 1KFXL 2O0OA 1DU3D 3CZUA 2ET7A 3S0MA 2AC1A 3AFGA 3ZFGC 4URAA 3CU7A 1WGPA 1RUH2 1W9YA 4R9AA 2VC9A 4YG6A 4LUKA 1XJAA 4JAAA 5FZ3A 5HCFA 2JDKA 2UY8A 1UU4A 1LODA 3H0OA 1GICA 1AR91 1NE6A 2BVVA 1D0HA 4ITCA 5KBFA 4X8NA 3J7MA 4WVMB 4XTMA 4A7YA 4HSLA 3EBRA 2PHLA 5FPLA 2JD4A 1VJ2A 3Q9OA 2RJKA 2VMIA 4C1XA 4YRDA 4M0NA 4KWKA 4QKNA 3V0AA 4QPIA 4XDPA 2WNVC 3ZFEB 1UAIA 2WWJA 1BLZA 5DUWA 5KC5A 1POV0 2DBIA 2RV9A 4MGYE 3RFRA 2FHRA 3KT1A 2VQAA 1UCXA 2EIDA 4JZRA 1GP6A 3OY8B 5H9RA 3WXPA 4Z8BA 4ZKTB 3T0DA 1NCQA 4YW1A 5I8YA 4AR2A 2VE1A 3DPRC 4LKEA 5JZGA 2Y6HA 2JG9B 1UY2A 3K4DA 1RJ7A 2PTMA 4ZU7A 1DYOA 3O7OA 3THCA 4K1YA 5CKMA 1VBC2 1ND2C 2ARBA 4Y1XA 3WCRA 3THPA 2GMEA 5IAVA 3QCWA 4QX0A 4W6XA 4D6SA 3PURA 4KG8A 4PT6A 1WCQA 4LBMA 4IV3B 4LK6A 4PJYA 4HMZA 3RYPA 2FZ1A 3VDDA 2PQQA 1MZFA 3POFA 4IEXA 3DCQA 4Y20B 3WG4A 2XJRA 3PUSA 1WLDA 1DYKA 1CZTA 1ODNA 1OHFA 1TNFA 4BDVB 5JSPA 5DAWA 3SISA 4RD7A 2WT2A 3I2FA 4D0QA 1QJX1 2NQYA 4Y3OA 5FYIA 1VBB1 4DXTA 4GJYA 3URFA 3HBKA 4FPLA 1ZBE2 1S1AA 5I91A 4AK3A 3WV6A 4BA6A 5FZCA 2YDEA 1FNYA 3SITA 2IZWA 1TMF3 3WNPA 3ZX7A 3DKQA 3H7YA 4DXSA 4CDXA 3D82A 1GOFA 1NT0A 3PVOA 4P5YA 2BGOA 5SV8A 1J83A 4HLTA 4N53C 3WHUA 2W95A 1JYIA 2JDNA 5JR2A 4LJHA 3KF5A 4FFFA 4MVTA 5FZEA 4Y26A 5LBEA 4MXWA 3ZYIB 1X33A 4R4XA 5A80A 2ET1A 2NLRA 3G7DA 3PJQA 1SPPA 5DZEA 4WZCA 4HSJA 4GA9A 3E6BA 4PQQA 5AC91 5C8CA 1A8MA 2ES3A 3T2PA 3RG0A 3T2QA 4C8DA 3AMNA 4BK4A 2P2KA 3ST7A 1WA4A 4XF1A 4D69A 1HXS3 1VBE2 3LA7A 2B9UA 1LULA 5JSRA 2WSUA 2HWF1 2BWCA 4CPBA 3E97A 1PX3A 2XBO3 5FZLA 4QQ2A 1W9TA 3KHBA 1LOAA 4AZZA 3VL8A 1ZZ6A 3HR9A 1LHUA 5LY1A 4XUTA 5JXHA 2HYKA 4B3NA 3ZO0B 4CDWC 3S5AA 4RL7A 1SLAA 4W50A 4AOCA 2XJUA 4D6QA 3M3IA 5BNOC 5JOYA 1SZBA 2W39A 3AP9A 5KXDA 4EZ4A 3W59A 3N9NA 1NKGA 4FOWA 1XU2A 4IGPA 3MPPG 5A6XA 3VD7A 3V0BA 4N90A 3WCSA 2Y0OA 2ZAHA 4N43B 1W04A 2VOVA 1PM4A 3WNNA 2PXJA 4JVAA 3W9AA 1PO13 4JDOA 2R071 5IK4A 5J09A 4X6QB 5LK7B 2OQ7A 2Y34A 2YYOA 3BB6A 4IEQA 4BISA 5EQUA 2D6NA 3C8XA 4MOAA 4META 2B4KA 2WS93 5L7OA 1YXWA 4FOQA 2ILMA 5I0RA 3GDBA 3NJVA 1RUE1 1RUG1 1WCUA 2HWE1 1ENQA 2KXLA 4CZSA 3VBRA 4PI2A 5GLZA 5JCTA 3I2KA 5LASA 2B5HA 1F8VA 1XNAA 1TE1B 1XNCA 3ETPA 4QXCA 3GCXA 4M3CA 2ZA9A 4LEJA 4XEZA 5FY9A 3INAA 4JDNA 4CSWA 5I0SA 2Q1FA 2VZUA 4A4AA 1G9CA 5GLUA 1UZYA 2R6QA 1SCSA 3H42B 2R16A 2D6OX 2VXRA 5BY5A 5DDJ1 1FX5A 2PLV1 1J1TA 2RS13 3NW4A 1NQJA 4JGYA 4BQWA 2ZGKA 5FZAA 4P5HA 1WCSA 1AYN1 2H0BA 4ASMB 4C0HA 2VVEA 1PGW1 3RMXA 1GOGA 4IV1B 3VGIA 4QPGA 3WG1A 5CEHA 3MIGA 1IG0A 1GP5A 1NY72 4F7ZA 2H6CA 2VMDA 3PMSA 3VBUC 4CU8A 1OLQA 2JENA 4I09A 1PIV3 2ZAAA 1EPZA 4AI8A 4BWOA 1YQ2A 3WG3A 3HD8B 5AFBA 3FLRA 1JOPA 4OHXA 1SLTA 3GALA 1OPOA 4AFDA 3ZN4A 2PHRA 2XKOA 5C71A 3OGGA 3HJRA 3ZKYA 4AI3A 4DRVA 1MS4A 2ZGPA 4JGZB 4L97A 1ZVFA 1BEV1 1GQGA 2WT0A 4XAEA 3MLJA 4Q4Y1 3UYJA 4B4RA 3EJKA 3L2YA 5DG2A 1DDLA 4LO4B 4LQRA 1H30A 4LNVA 3D6EA 1FOD3 2VZQA 3UGFA 1JZ2A 2KD7A 3BU7A 5JOXA 2VW0A 1K5MA 2B46X 3C7FA 2LALA 2DCTA 2OUHA 1XE8A 4UW6A 4OMDA 4KWJA 1OH4A 4GWIA 3ZN6B 1PO22 3OPZA 1H2NA 3VBOA 3RZHA 3ZYHA 4CDXC 1ONAA 4XAAA 4XW3A 4PHZA 5B4NA 2P17A 4YVWA 1W9WA 2XQRA 3AKTA 3B9CA 3SC7X 2B39A 1A8DA 3ZYPA 1AL23 4HK8A 2XHKA 2IFRA 1H8TA 1XXNA 1H8VA 2VGDA 1SBFA 2DV9A 1LOCA 4QU1A 1XC6A 2D40A 1EAH3 2DUQA 1DGWA 1N1TA 3P3NA 1QOTA 5FWJA 4RHV1 1URXA 5C8CC 1PZ7A 2RMU1 1VAVA 3JBG1 2W3JA 3K46A 4SBVA 1MS9A 3HIFA 3WNOA 5C5TA 2VNRA 5JOWA 2HYXA 4DO0A 2AR6A 3GCWA 1REEA 1GP4A 3J8F2 2VAUA 5FYYA 2ETEA 4NRQA 3POYA 1QMJA 5H9PA 4AGRA 1BMV1 1GR3A 2BRTA 1UY0A 3NRUA 2J1UA 3NNFA 1CESA 1AR93 3VKOA 2FCVA 2ZEWA 3ZIXA 2YHJA 4XXAA 1MR5A 4C91A 3N36A 5KHIA 5LRSA 3ZYBA 4CDUB 2DVAA 4H2AA 4U36A 3N4MA 3ELNA 2A6YA 2IVIB 1RUC2 3GZEA 4B7EA 3N7KA 5FBZA 2RS51 3ECQA 1CD3G 1NA1B 3CJXA 4EJRA 3S57A 3PLQA 2CAVA 2EXJA 4BYYA 2DUOA 4OZXA 1DGLA 5FZKA 1FATA 3USUB 2ZXQA 4EZHA 4F83A 3G6JB 1LHVA 2BFUS 5ABJC 5D8AB 3RJRA 1UZZA 3V64A 4F8AA 3OG2A 3S6PA 3AL6A 1JYNA 1UX6A 5FKBA 4QQOA 3ZDSA 4AE2A 1CVNA 1CAWA 3N7JA 1JYVA 2JKBA 1N1VA 4CE8A 5L7OC 4LTAA 1GZTA 1SBDA 4AFMA 4NIAA 3PTYA 2BTVC 4URTA 1KS5A 2H6BA 1O4TA 1QJU1 5EYXA 5FK8A 2GMPA 2DF7A 2YC0A 4M00A 4A42A 4AHWA 2PAKA 3JU9A 2WZR1 3MGUA 2HH9A 5C3SA 3WSOA 3WDUA 2JB4A 3WNKA 2WLPA 4MH0E 4ONUA 1VALA 5FZ0A 4LHSA 1UN1A 2WA3A 5ACA3 5T50A 1QJX3 3MW3A 3PIJA 4IE4A 1VBB3 1HV0A 5JMCA 5CZKA 1UD1A 1XE7A 2YG0A 4JGYC 1KS4A 3JQWA 3O1VA 2Y6FA 3U78A 3ZKUA 4LBOA 4LHLA 1Y9QA 4QPGC 4RS5B 3HT2A 1RUD2 5DAQA 1DF0A 3SH5A 5DUXA 4E8CA 4KG0A 4L11A 3HNBM 1OKQA 3SQOA 4CEWB 4XOGA 1QQP1 1W8TA 2E26A 5T5PA 1DP0A 2AEZA 2GALA 1V6LA 2B8MA 2YU1A 4X8PA 3WD5A 2D6KA 3VZMA 1HB4A 4L2NA 3UL2A 3EMRA 3MI8A 2XONA 4AEDA 2ARXA 2HLEA 2WABA 4IEOA 4FTSA 3R0RA 2F4PA 2EF6A 2WQZC 1AR82 2CDPA 2ZZQA 4RR3C 5AVAA 4DIQA 5AC93 3ETQA 3CZJA 2A71A 3CO2A 4NO4A 5J3UA 5A33B 5FOJB 3NNJA 5H9QA 1JOBA 2QQJA 5FYTA 4AI9A 4BE3A 4NROA 1VBA2 4DRRA 5EIYB 3NMBA 2HWF3 3AZZA 1K5MC 3N9QA 2W1UA 2X05A 4G3YC 1QDCA 5A3TA 3J9SA 1V9U2 3IAQA 2X29A 4NRMA 4WM7A 4IEUA 4JX0A 1RUJ2 4ORFA 1L7RA 4YGBA 5FZOA 1S2KA 4XFAA 4YW4A 1US3A 3AP7A 3U4SA 1AR61 3WDWA 2J1SA 2E7TA 4PDWB 2R041 2PHFA 1IKPA 5FPVA 1W8UA 4PIZA 2G9FA 1H8TC 3OGSA 5FBJA 5I0TA 1RXGA 2JG8A 3SNMA 2WNUA 1LOFA 5FQ0B 1GNZA 4H7MA 4LO6B 4QXKA 4QHOA 3IBMA 2A3WA 1YQ5A 5D21A 3VBSB 1A3KA 1LGBA 3ZXKA 1AJKA 2RDRA 3AMPA 4Y22A 2R073 2W5FA 2BZDA 5ANNA 4DOUA 4RQPA 3OBRA 3VKLA 2WKKA 3LDRA 4L99A 2R0FA 1UO9A 2WAOA 3SLIA 4OQ9A 3VHOA 3OUHA 1RUG3 1RUE3 1POQA 2HWE3 5F5IA 3ZFFA 1RYYA 3M3CA 3AK0A 1N1SA 4IW3A 2VY0A 4O9GA 2HEYF 3KF3A 2WL1A 2Y38A 3VBHC 4IV3A 1ZBA1 4QPWA 4UW4A 2X53S 1TME2 1OF4A 4YZ5A 3KCYA 4OZOA 3T0BA 1Z7S2 1JYWA 1AXKA 3RQ0A 2HEVF 1NLRA 5KHKA 5FMOS 2VVFA 4IEZA 1CGPA 3N9MA 5DDJ3 1NG0A 1CAVA 4B1LA 5GALA 1NZIA 2PLV3 1CAXA 3LE0A 3POEA 1I1EA 2G9GA 1O3RA 5FZHA 1AYN3 1V6NA 4AGGA 3IM0A 3R4SA 1QOSA 3QD6A 4Q0UA 5IFTA 4LK7A 2F4LA 3R4UA 5GZDA 1AR72 1W05A 5F8PA 5CAZA 4MV2A 4P9YA 3I3MA 1UL9A 1RINA 2C6SA 3FL7A 4JHZA 5KXEA 5FP9A 2QQOA 4Q4W2 3SCGA 3AXEA 3HVDA 4ZHNA 1QJZA 3I2OA 1PZ9A 1MZEA 5A3OA 4Z2AA 2XHNA 1P8JA 5KHGA 3WVJA 1JZ6A 4XURA 4DPNA 3WUCA 1BEV3 1REFA 3O0VA 4XUNA 2WWUA 2RR11 2D3PA 2P3YA 2VO5A 4Q4Y3 2WQ8A 1B09A 3PMEA 1U5IA 1R1A2 4Y1YA 3LEMA 4QDRA 2Q8CA 4ZPIA 4OLLA 3AM2A 3BTAA 5DMYA 5BNNA 4MADA 2WAAA 2JD9A 1Q8VA 1QWRA 3WF0A 2HWC2 2SBAA 2ENRA 2LTNA 5H9SA 1LEDA 1UPSA 2ZGLA 3JZVA 4GH4C 4QB6A 4UAPA 4Y4YA 4DFSA 5JXJA 3AYCA 1WW6A 2UY9A 1Q8QA 5KHHA 2HWB2 3SEPA 5A6ZA 5FOBB 4NWWA 1XPWA 2Q5TA 2HWD2 2XH6A 3O0WA 1RIRA 3I3EA 3OBZA 1G9AA 1QJY2 1O7FA 1L3JA 3S7IA 1WWYA 1UU5A 1PMJX 1AL0G 3I7DA 3VB9A 1O4ZA 2DCJA 4JQRA 1WMDA 1MS1A 3AZWA 4MGZE 5LEKA 4AEDC 1GSLA 2N7GA 1RUF2 2D93A 4YGDA 5T3NA 1EV12 2YC2A 3E5QA 3BPZA 1SFPA 1BCXA 1IPSA 1IPJA 1RUI2 4RHV3 1BHGA 1JU3A 5FO7B 2VBBA 2RMU3 2VXJA 3JBG3 5E1RA 1X8MA 3U07A 4JV4A 3PHMA 2VJXA 4BHPA 2QQVA 3NV2A 4LKFA 2VZSA 2GDFA 3PU8A 1K42A 3OB8A 4I3GA 2I2SA 3SKJE 1UKRA 4KBBA 4LHKA 4YGEA 2OYZA 5BNQA 1LHWA 5KWRA 3O1PA 5IYYA 1PHMA 3POSA 3QBQA 1MEC1 2X10A 2EIBA 2RDQA 3N35A 1LRHA 3OGRA 4QKDA 2VMFA 4WM8B 4S2DA 5LA0A 4I01A 1YQ8A 3WUDA 2UWAA 3IT8A 4M0HA 3ZFGA 4EYUA 2AEYA 3B93A 3MIDA 5DXDA 2RS53 1J58A 2WYSA 2ZGUA 4HG6B 3UESA 5IHRA 1KEXA 1DIWA 5F6LB 3ME2A 3I2JA 2K9ZA 3ZFEC 4D3WA 1WD4A 3TN92 5FYSA 1OURA 3LEKA 3RZJA 3AXDA 1W2UA 5DG1A 4XFFA 4MGTA 5FYUA 1XSQA 5GZEA 4CUGA 1RHI2 3FWEA 3POGA 5GM0A 4CDUA 1I5PA 1RUH1 4IV1A 2P4EA 2JG9C 5IATA 5HI0A 2BGPA 2WNVA 1S0DA 3MLLA 1JZ5A 3MHZA 4CP2A 3MW4A 1QJU3 2V4AA 2A6XA 4PBOA 4QKFA 3VDBA 5A1LA 1RUOA 1LR5A 4Q4X2 1HW5A 3T1LA 4W6YA 1I3HA 4QGLA 4IV3C 5A7NA 2WZR3 2ZPXA 4YW3A 3DPRA 2XPJA 5DUUA 2X5IB 5I93A 4BPZA 4OI0A 2YUEA 3OD0A 3AZXA 2P3IA 1WMFA 3H7JA 4KGQA 3W21A 2WS91 4IXLA 1ND2A 1W8ZA 1D2SA 2Q8DA 4BJ0A 5FUIA 1OF3A 4V2WA 1SDDB 4QQHA 4NIIA 1OA4A 1R082 2Y8KA 1JZ7A 4Y33A 3BTZA 4XCBA 1UOJA 5LA9A 2VCAA 5CU1A 4FPHA 4MSVA 1BJQA 1JBCA 1N1YA 1QQP3 1GV9A 2NMOA 2PHDA 2Z4FA 3NJXA 1VB4A 4Z92B 3O1OA 1VBC1 1ZRIA 2VTFA 2B9VA 4AGVA 3J7NA 4RSUA 4UF0A 2OS2A 4QXHA 5EFUA 4CVUA 2YMZA 4NMIA 3PIGA 4AF9A 3X29B 1N3PA 2W94A 3HBZA 1PK6B 4PF1A 5JIAA 1FV2A 3PUQA 4ARXA 2VH9A 4DY3A 3GZUC 5L36A 5F32A 1LNSA 1DGRN 1C3HA 2XLGA 3B94A 4AVAA 2VOXA 5AVPA 2A73B 3T30A 4Q0VA 4GAZA 2Y64A 3W5MA 3ORJA 4KWLA 4XF0A 4M3CF 3A0NA 5F2WA 3SCFA 2VVDA 2RJLA 1N47A 1DLCA 2GZWA 3I49A 2XKPA 1DQ4A 1MPXA 5FPUA 3JQXA 1COV3 1YIFA 4LIUA 4S2GA 1PZ8A 1BVP1 4AVVA 1WCDJ 2CHHA 1AR63 2MEV2 2R0HA 3I3DA 3KGLA 3LKJA 3T09A 1X82A 2TEPA 2R043 3B69A 1VRH2 4KQ7A 1LHNA 2QJVA 2XL9A 1S2EA 2GP3A 3WNMA 4HXCA 1PGSA 4FO9A 1W6NB 5KHJA 4OMCA 4HKLA 1R091 1U5ZA 4LBQB 3KWVA 4I0WB 1QH7A 3IDBB 4HKWA 5IVJA 3KV5A 4Y5Z0 4BU2A 1JZ8A 4N43C 3CJIB 2E33A 4XUOA 5IJRA 1UY4A 3MUY1 5FXVA 1NQDA 3ZXDA 3TB0A 1WMXA 2VZ1A 5KXBA 1WUVA 4XDOA 3IN9A 4GQ7A 4BQ5A 3FHIB 2BP6A 2XJPA 4Z2WA 1EP0A 4A2UA 2WINB 5F3CA 5IUQA 1H1MA 4RFRB 5GZFA 2GNDA 3CL1A 2WA4A 3IAPA 1QOOA 1ZBA3 1LOEA 1OMIA 2CWMA 3TEYA 3JD72 1V6MA 2QKDA 1ZZ7A 1SCRA 5BXXA 3KMHA 2DU1A 4IERA 1UU6A 2Q8OA 1VAKA 1V6KA 2FDHA 1HXS2 5CISA 4CDQB 2GU9A 4FAGA 4YM0A 2D6LX 3NV3A 2WQ4A 1XYNA 5D1IA 4YW2A 1JI6A 4CCKA 3CBNA 2I45A 3BKZA 4CDUC 3NQHA 4IV1C 1NLSA 4BMEA 2I07B 5FPAA 3LOBA 4EWAA 1W6PB 1IHMA 4IUGA 1PVXA 4LKDA 3WQ7A 4CA9A 2R49A 1DCSA 1QH6A 3SEEA 1AF9A 1DQ0A 3BIWE 3O14A 4TYSA 2AUYA 3BUCA 2W52A 1HJFA 1W0OA 2Q4SA 2JX9A 5FDBA 1I5ZA 1VR3A 2BWAA 4W6WA 3ZLIA 3O1SA 4GWNA 3GNEA 4QX1A 2RR13 4JGZC 5CKNA 3LPGA 1RGSA 4WBBA 3SKVA 5A7SA 4QT6A 1UMHA 3OUIA 4WVVA 3VBUA 5CFDB 3M3QA 4HANA 2ZHMA 3FFZA 4GWMA 3H1MA 4K8FA 3AP5A 2EAKA 4CP9B 4AXOA 5DPNA 3W5NA 4M01A 3UJOA 2QZ2A 4QPYA 3MFCA 3A22A 4K8RB 3HN1A 4Q4V2 1PMIA 1APNA 2VMCA 2CWSA 2ZCWA 1SLIA 1ULFA 3MDPA 2P5BA 4FI9A 4LLFA 2WT1A 5ACA1 1DZQA 5JI7A 1O5LA 3ZSKA 3FX3A 3VZJA 2C26A 2J1AA 3WW1A 2BPA2 2PAEA 4XJZA 3T3YA 3M7AA 2C24A 1MS8A 1UKGA 2IWGB 1AUYA 2DCZA 2VCCA 4LORA 5F6KA 3TNPB 4R9CA 2BDRA 1WMEA 4FOVA 3RGBA 3WP4A 1LEMA 4FFHA 5F9TA 3ALQA 1HRI1 2XOMA 2VUJA 3K51A 3L9JT 3TWIA 4XFIA 3UNPA 4H7LA 1GWLA 2FDFA 4AFCA 5C70A 3M1HA 4OULA 1UZ0A 1CQ9A 1MEC3 3KHCA 1W03A 1AJOA 1OUSA 1RL3A 1W2AX 3ZIWA 3VDAA 4WZFA 1PO21 3SXWA 3BN6A 4Q1RA 3VUOA 1XYOA 1CPMA 4KI5M 3P3PA 4YW5A 4JC1A 2ZZJA 3MPBA 2MNGA 1LHOA 4AWDA 1NA1C 4MGIE 2RG4A 5EPAA 2XGXA 2XMLA 1AZDA 4XETA 1FPN2 4XBLA 4ASLA 4E27A 2WO1A 3AP6A 4NPLA 5A32A 1JN2P 5C9AB 5FJKA 5JVVA 3OD4A 4AG4A 1KDKA 2KM2A 2A75A 5F3EA 4UT5A 4HN0A 5HCBA 1QXJA 1RUH3 3ENRA 1T6BX 3J8F1 2J1VA 4Y1ZA 5BYNA 5JAXA 1ASJ2 3KSCA 2E53A 3FUQA 4W4ZA 4D7SA 1C5HA 3A7QA 2CGNA 2C5DA 1SHWB 4OVEA 4PQ9A 5ABJA 1A34A 3AFKA 5FY0A 5IWFA 2JDAA 1SG3A 1O6UA 2QDNA 1RUC1 4XC9A 1W6QB 5IFPA 3NV1A 3BODA 3KS7A 2W68A 4P9GA 1LGNA 4BCUA 4EN6B 1O91A 3H9AA 3P6BA 2VR4A 1GOHA 3K4AA 1QJFA 5LY2A 2RVAA 3LFMA 2UU8A 2PHWA 1W90A 1G7YA 4H3WA 4ZU5A 2CL2A 1HB1A 3LIHA 3PVNA 1AR92 4GKYA 5LBCA 5A3LA 3MF6A 1OVSA 3OCPA 4DZGA 1J3QA 1LOBA 1KQRA 1ZYBA 4IEYA 3T0AA 1V6OA 4RS5C 1YFWA 3NKGA 3QH7A 4FPEA 1C8M2 1DBNA 2O14A 4AL9A 3B01A 1FXZA 4MHRA 5LW9A 1LTEA 2WO3A 1VBC3 2EA7A 3OYWA 4CEWC 1DGWX 1OUXA 3NO8A 3SH4A 2H0VA 3VD3A 4R4ZA 4AQSA 2BV4A 1IQAA 1C28A 3NL1A 3JCIA 2XG3A 1BZWA 2YFZA 3J7HA 2Q1ZB 4W8JA 2VTXA 3N7MA 3I59B 4FPYA 4V2VA 2ZABA 4TLGA 3T4HB 2OX0A 3AZYA 1JOJA 3WDXA 3MBWA 4Q29A 4XZPA 2NM1A 3OSDA 3OOXA 5FY8A 4J1XA 3O12A 5TSWA 4AEKA 1HB3A 1ZBE3 4GD4A 2D6MA 1OA3A 1Q3EA 4KGGA 4COUA 1O3SA 2FZ2A 4FQ4A 2V73A 3LSDA 2BEOA 1G9FA 5A7WA 3VBFB 1RUD1 2VECA 4RR3A 1TZOA 1ZRFA 1XBFA 2OT7A 2YZ4A 4QX8A 5EJ3A 2YGLA 1S0EA 4GMP0 4YVSA 3LOIA 4HKOA 3S5QA 3WF2A 3ASIA 4PDWC 2D97A 4OHZA 4FBFA 4XF4A 2YXSA 3D0JA 3WW2A 1L7LA 1QJX2 5FMDA 5FZIA 2BFUL 1R093 1Z78A 1JU4A 4YWAA 4L0PA 4CU6A 1T6GC 1BBT2 1W6OB 4XF3A 2QQUA 2CYFA 5CFCA 2XB6C 3PVEA 1AR81 1QNWA 2PAMA 2D6PA 4GB32 3DKWA 4EWEA 3FC0A 3IPVB 3M8LA 5FXWA 4Z07A 1IGOA 1HJGA 1RC6A 3CLPA 3H50A 4JKKA 4LO7A 5LRRA 3WNXA 2QQLA 4IE7A 2WO2A 2XL7A 4PF5A 4P9LA 1VBE3 1XE0A 3O1UA 5JMOA 5K0UB 3MV01 3AZVA 3ILRA 2DUPA 2XUMA 1ZM1A 4AFBA 2VUDA 1V9U1 1HLCA 4MLOA 5FIXA 1I6XA 1OVPA 3LEGA 2ZKNA 1B35A 1RUJ1 1SDWA 4QX7A 2QUOA 2W9XA 1EUTA 5FAXA 2FDGA 3KVAA 2LS6A 1JODA 4MX3A 4C1WA 4CEYB 3GHNA 3IB3A 3I8TA 1GZWB 4XVHA 2A70A 2QVSB 3H8UA 1X50A 1G86A 3RWKX 2W1SA 2ZEZA 3U14A 2CU5A 3WZ1A 4LOSA 2VBPA 1N3QA 1OI6A 1OLMA 3WW4A 4P9JA 1RMU2 1W6MA 2LM3A 3TBDA 3DYMA 5K7PA 1GANA 3WINE 3MF9A 4PLNA 4B4PA 3VBHA 2OKXA 1GU3A 2XWJB 3AB0A 5FYZA 3KB5A 4K6BA 3GHMA 5DQ0A 1ZA4A 1DQ1A 5E16A 3RYKA 3AKPA 4O65A 3NAPB 1NCRB 1H6XA 1YHFA 2D7FA 2G9ZA 3PUAA 1JMUB 2NN8A 1IS3A 4N53B 1ODMA 3K77A 5FK7A 4P08A 3ZVXA 2CGPA 1BK1A 3RJ2X 1S0JA 3WX5A 4FPGA 1OOPB 1QXPA 4AI1A 1CZSA 1UYYA 5K4LA 5C4WA 1WW5A 2TNFA 2Y6GA 2VMGA 5KC6A 2L9LA 1TME1 5C3RA 4CUCA 3POJA 2Y0IA 2IFWA 2J22A 3ES1A 4L8QA 3CMGA 3RZKA 1VE0A 1Z7S1 4K7JA 4A44A 2ZMKA 2GH8A 4KMQA 1OPMA 4UFKA 1Q8PA 2A6ZA 4JRLA 2NMNA 1SFYA 4E4HA 2P3JA 1D4VB 1IQDC 3CQOA 4LT5A 5DZGA 2O1QA 2RDNA 2XXZA 1HRV2 1UMZA 1H4GA 2WYFA 3T08A 4TXWA 4JTNA 4XXPA 4EN9B 5C8WA 4Y1VA 4JDMA 2QQPA 5BNOB 5JXGA 3TOJA 3BU0A 4N7IA 1O3TA 4Q4W1 5G04L 1Q56A 2ZGQA 4CCJA 3LFIA 4E4DX 5KR7A 2QFEA 1MS0A 2AZ5A 2VNVA 3IDCB 5T52A 3WQ1A 4AQTA 2CSGA 4J6GA 4Q26A 3H8OA 2BQPA 3BVCA 3GBGA 4GH4A 5IK7A 3LF7A 3POBA 4LXLA 2FCUA 1H1AA 2WWSA 2R062 1F5FA 1GFF2 2OZJA 3IMNA 4O7XA 5GLWA 5DAVA 1G8WA 3DF0A 4NWVA 2JE9A 4YPJA 1HRI3 3WOGA 1XQNA 1R1A1 2OA2A 2OZ6A 5LBFA 3ZR6A 5FR3A 1OQEA 2ZMLA 1YYNA 3MIFA 4WVZA 5T5JA 3A4UA 4K21A 5CKQA 1FV3A 4BK5A 2HWC1 2WIIB 1X9TA 4OUSA 1PO23 5HV0A 2DCKA 3T2OA 4TLFA 2HWB1 1US2A 4UI9L 1YFUA 3V0AB 3E5XA 4QPIB 1ST8A 2HWD1 4WM8C 4XMIA 4YVSC 4YLZA 5CB7A 2Q0AA 3K4ZA 1W28A 1QJY1 4XQ4A 4Q4Y2 5FMOL 2DVFA 1F4AA 5ERLA 2VTXJ 4A45A 4M3CE 1JTZX 4IGQA 4ES8A 3GJAA 1TQ5A 3IDEA 5FV3A 3Q8CA 2Z5WA 4IESA 5EZWA 1NE4A 1RUF1 4J1WA 2BBVA 2CNAA 1NCQB 1AVBA 1COV1 1EV11 1RVF2 3L2HA 4QHZA 5FZ8A 4QMAA 5CFCC 1RUI1 4S2HA 3WQ0A 1VIWB 3T2TA 4WVMA 5JZGB 5JUVA 1PVC1 4DNYA 2PMWB 1KFUL 2ZEYA 3A0KA 3FLTA 4UW5A 5A3WA 3ABZA 1V70A 1YLLA 3OJBA 1GNHA 2ZJCA 4OUMA 1XOYA 4A41A 3VZLA 5HCAA 2QZ3A 3J8F3 2Y6JA 5K8SA 3AMHA 3O0XA 1CJDA 2EXKA 3ZFEA 3AJZA 1HKDA 1AYM2 3C2UA 1V6IA 3VDDB 1B35C 2HBTA 2YB7A 4D7TA 1JW6A 1YUDA 3DV8A 1HQLA 3OY8A 4Q5OA 2YBKA 4XBNA 1VPHA 1RUC3 3RYRA 4JRAA 4Y5TA 2YV8A 4BIFA 2X5IC 3B7MA 3MIEA 2JG9A 2RHPA 4PI0A 4YFWA 5A3NA 4R8HA 4YW7A 1WLWA 4CCEA 5DUVA 5C5UA 1BMV2 4A6SA 3H1WA 3ZXEA 2JDYA 3CEWA 1X8EA 1U5YA 5LBBA 3TN91 1EPWA 5T5OA 2R30A 1SEFA 3U4XA 1GMMA 1VMJA 3U75A 1XB9A 2B7YA 2W47A 3NV4A 1YCIA 3P5BA 4B4QA 2ZS6B 3K3OA 4CDXB 3M2MA 3DN7A 1RHI1 3O1TA 4JKLA 1ZX5A 4Y20A 1HDKA 3I3BA 3V65A 2JDPA 1F9KA 2RS52 2VMEA 4PLMA 3MZHA 1GWMA 1AXYA 5F3GA 2PA7A 3U11A 4MXWB 3GZAA 3MIBA 3Q8BA 5GZCA 4IGOA 3I4IA 1SPPB 1AX1A 2FD8A 5GLTA 3U10A 1GWKA 5C4WC 3EB7A 2WN2A 1PK6C 2XVLA 4OFGA 4YG3A 2JJ6A 2OPKA 4LHNA 4BZ4A 2JICA 3HOBA 2ZBJA 3VD5A 5A1AA 3ACHA 1JZ4A 1CX1A 2QBXA 2D98A 2D3SA 5C3OA 4UBHA 5C3PA 4YM3A 3VKMA 2BNNA 3C7GA 1XNBA 4RFT0 5SV5A 4GULA 4E2SA 2JEMA 2ZMNA 1QJU2 1R081 1S2BA 2XJTA 4WVWA 1RUD3 5ANQA 4BLIA 1U5XA 2ZACA 2R32A 5DN2A 4Q8KA 1ULPA 1F15A 2CV6A 4JHTA 1Y9MA 1IZ3A 2GNTA 1MVQA 1G9BA 5FPBA 1MZ6A 4AI2A 4AVCA 5CA6A 3E6CC 2A6WA 5FZ6A 3V0BB 4HETA 2C9AA 5HBAA 1JUIA 3RI9A 1BXHA 1AR83 2DU0A 2QE3A 2W46A 1MACA 4K1ZA 4QQLA 4ET7A 3CJIC 3D3AA 5L9VA 3LEIA 4Q1PA 1W8WA 4ZS3A 3RI8A 5FP3A 2YY1A 3ACFA 5FPZA 5FZ7A 3F95A 3KLSA 4OI4A 2W08A 3VBRB 1V9U3 3CF6E 4LMFA 3HQRA 4DEVA 1RUJ3 3MIHA 4OQ8A 4EN7B 3EQEA 1XNKA 3VHNA 4MG2A 3E6DA 3KM5A 4M3CB 1ZNPA 3RRDA 4N43A 1H9PA 4JCKA 1G9DA 2HKXA 2MEV1 1QXRA 2WFF2 2ARCA 1VRH1 2A3YA 1VMHA 3OGVA 4NAOA 4BQXA 1JHNA 2RM22 3POWA 4IE6A 1UZVA 3KCXA 4HPKB 4QB1A 4BQ2A 1D4M2 1Q8SA 1R1ZA 1BQPA 1VBD1 2ZX2A 3MV11 4CDQC 1C1LA 3DXTA 4K9SA 2ZGMA 1OFNA 4QPGB 3VHPA 3GF6A 3WNLA 4D94A 5C7GA 4D8MA 5FO9B 4JTOA 1SQ4A 1DQ5A 2W2IA 5CNAA 5FLIA 3AP4A 1AR62 1RJ8A 1UOFA 4CCOA 3W20A 3UKTA 1R64A 1CPNA 2R042 2W91A 4A3XA 4QQPA 4XJ9A 3RDIA 2RS32 3PJYA 3SCHA 2JB8A 4DXRA 1KITA 5J7MA 2FDKA 1GUIA 5J48A 1IS5A 1UIJA 5J36A 3WLUA 1VP6A 2YROA 1ULEA 4U2AA 1PGL2 1JYTA 4IL7A 1ULGA 4P14A 3C7OA 1H6YA 1M4WA 2KR2A 4FP2A 4DS0A 2P6HA 5IVEA 3AKSA 5JSOA 4ZXKA 4QKBA 1TME3 3JD71 3WDVA 4LE3A 5HXVA 4DB5A 1FI2A 1Z7S3 5CFDC 4OYUA 5DZFA 1FMD2 3NNGA 2G19A 3ZDVA 4DMIA 2PHUA 1AXZA 4HVQA 2KA3A 2RE9A 4BXFA 4LBJA 1PMHX 4GWJA 4LBLA 3VBOB 3ZXJA 5JWPA 3LDKA 2SLIA 3WDYA 4MZUA 4YVWB 3FBMA 3U37A 5JDBA 5FTTC 2WSVA 3OBAA 1ZBA2 1ENRA 3VBFA 4JGZA 2OQ6A 5F1RA 5IVCA 1ZRCA 5B4XA 1H8TB 3WY6A 3JXSA 4IDZA 1ALYA 2VM9A 3F2ZA 4Q4W3 3B3QE 1N3OA 4YYOA 1ULDA 1QIQA 2PYTA 3NNMA 4MUVA 5GKAC 2V09A 5F37A 2ZGRA 4RGAA 3RMYA 4UXAA 3KV6A 4AI0A 4AHXA 2JE8A 2DVBA 4FFGA 3WR0A 2ERFA 2V5YA 3ZN5A 4B7KA 3M3EA 3USSA 1UOBA 3ZN6A 2IXLA 2ZX4A 3DYPA 1DZRA 3AYEA 4IETA 2ZX3A 1H2LA 5I0UA 4FT8A 3PUIA 3LB9A 1R1A3 1YEWA 2IUWA 1UW8A 3VHRA 4P9WA 4PIXA 3ZSMA 1CX4A 2VQ0A 3LZZA 2HWC3 4TZDA 4EV0A 1PX4A 3FZ3A 5FYMA 1JYCA 3GXUA 2HWB3 4Q4V1 1MS5A 3Q8AA 2HWD3 4YM2A 2XJVA 3BPSA 4XYXA 3PL0A 2DTWA 3MLKA 1QJY3 2Y26A 2RR12 4FVVA 2E51A 1UXZA 4A3ZA 4NPRA 1X36A 5CADA 5I0DA 1QKQA 2IXKA 1NX9A 5BPXA 5CG9A 3JUUA 1VB2A 4HT1T 3V56A 3KQ4B 3KZ4C 5EJZB 4AAPA 3GBWA 4IQPA 1ZBE1 1RUF3 5JI9A 4LLOA 2VMHA 4MYEA 4ATFA 3MO4A 5IAXA 1EV13 3B5LB 4I0BA 1SLCA 5T55A 2Q8EA 3DXUA 1RUI3 2DDUA 2AACA 1PNGA 1O8SA 1SBEA 5FMCA 1ZZCA 2V72A 1ND3B 1QHDA 1DZTA 1WLCA 3HN3A 1PVC3 2BOJA 4N8MA 4Y1UA 5EHDA 3T1MA 1W0PA 4LULA 2Q30A 1CAWB 2NPIA 4DXZA 4XFGA 1F2NA 2FMYA 5LB6A 1SACA 1NA1A 3FN9A 2EVXA 2W1WA 3LDBA 4DUVA 2NP0A 1HN1A 3RWNA 2JE7A 4LA3A 3USUA 4UFMA 5E8AA 2G1MA 3HPNA 4MGSA 1VMFA 1W39A 5FYVA 4A7ZA 4XQDA 1QEXA 5FPXA 5D8AA 3R6SA 2IXHA 4FTBA 1TMF2 2JIJA 4Q0PA 4Y5SA 1T2XA 4I3PA 3ILFA 2BNOA 3SH3A 3ZOIA 1VBE1 5J1XA 5FZBA 3WF4A 2JIGA 2DWRA 2HBUA 3TN93 4UYBA 1DFQA 2WC2A 5FUPA 1FPN1 4XACA 4FP3A 2XWBB 1RUNA 1GZ9A 3D5OA 2E31A 3I2IA 1LU1A 5FY5A 4FXGB 1RHI3 3H3LA 4XHXA 3ACGA 2Z69A 4DEQA 5IT6A 3RZLA 3AYDA 3PVBB 2WZ8A 2JDHA 4NAMA 5CVRA 1UZWA 3FHAA 1ASJ1 1QNYA 4N9IA 4AEDB 5J98B 4XFHA 4ZXEA 1RITA 2A3XA 2VOTA 1H2MA 3LAGA 3OBTA 4LA2A 2QQNA 5FUNA 2BBAA 5B2GB 1H1IA 2XBO2 3R4DB 4XPVA 5K9YA 5FLJA 2IXCA 1FAYA 1E57A 1U0AA 2D5HA 2JDMA 2OXBA 3FUOA 5FXXA 3S30A 3UKVA 3OTFA 2CDOA 2EXIA 4DUWA 4RS5A 1ZRDA 4O9EA 3APBA 3QOPA 5F5AA 1MQTB 3M3OA 2K2SA 3NJYA 4CEWA 4HFSA 3T4VA 1Q43A 5JPMB 1QDOA 2VG9A 4Q27A 4CXWA 4WM7B 5FP7A 3RZZA 3RZGA 4XJWA 1R083 3TYJA 5APAA 5FYHA 5FZOB 5LWBA 1H9WA 3EHKA 4W65A 3ZM8A 1E5SA 1XSRA 3P1IA 3VBFC 1CZVA 4FPKA 2ZHKA 4NIGA 2ZGSA 1PO12 1C8M1 1CONA 2JG8B 5E88A 2K0GA 5A70A 2WNUB 1DGRA 5CYYA 5A33A 1FYUA 3H8XA 2V4VA 3NWKA 1UOGA 3Q8EA 1D2QA 4GKXA 2PQSA 1YQCA 1J3RA 2WS92 2XJQA 3U1XA 1S0CA 2VU9A 4CU7A 1DQ6A 2BUKA 1LECA 5EWSA 2BNMA 5EYYA 2WDBA 1W06A 2R1DA 4TN7A 4XTPA 1PM7A 1YQ6A 3UK9A 4CCNA 2F6BA 1GKBA 2W92A 4HONA 4Y22B 5JOZA 1NLQA 3K75B 4RQPB 1NY71 4MHUA 3ZYJB 1GBGA 4NN0A 2LRPA 4NRPA 2VZPA 4AFAA 4PDWA 5FWEA 4AQ6A 4ZZ8A 1JS9A 1LOGA 4F3JA 4GXLA 3ZFFB 4KH9A 2IXIA 4G4FA 5FYCA 2D43A 1LESA 5KXCA 5K0UC 5FQ0A 4FPFA 2RS12 1L7QA 3ZSJA 3K2OA 2R1BA 2QCSB 3PTRB 2XJSA 5LEJA 2MEV3 3VBSA 4XJ8A 4UFLA 2RJ2A 1VRH3 2QQKA 4CEYC 1QGLA 1NZCA 5FZGA 3VD4A 3PNAA 4FSJA 1LGCA 1BVVA 1PIV2 3MUZ1 3OF1A 2VZRA 1C8NA 1CAVB 1CAXB 2D44A 1J3PA 1VBD3 1GZCA 4BB3A 2Z79A 3I2HA 1RXFA 4P9IA 4QD2A 1BBT1 3KT4A 1D0GA 4BOWA 4ES9A 5DAXA 5FZFA 1LCLA 4UFHA 3A21A 4IE0A 4GB31 5F2SA 5IVBA 2LUWA 1OFSA 5HCHA 1JUHA 4NJ4A 2B45X 3POIA 2A7AA 4NPMA 2VUAA 2XDVA 3ZSLA 4CUBA 5T54A 5IVVA 4MGKE 2VZOA 4UFJA 2C0ZA 2FQPA 3NAPC 1FOD2 5IK5A 1NCRC 2V5DA 3AVRA 3KVBA 5DAPA 1R092 1UNBA 1TEIA 2WLQA 1W3VA 3LIGA 5D8AC 4P02B 2RDSA 4BQ1A 1OOPC 4AEMA 2ZHNA 3JD73 1JH5A 1LKNA 1AX2A 3J26N 5FZMA 4YW6A 4AHYA 2BU9A 2QDRA 3D8CA 1AL22 5BNNB 4OHYA 2DYCA 2WZPP 5F7UA 1WZXA 2I74A 1BKZA 1OKOA 4YZ4A 1HIXA 1RMU1 1EAH2 2DBNA 4YGCA 1UQXA 3A23A 2UYBA 2DVGA 2GC0A 1W8HA 3OEBA 5FY4A 4H14A 5A7PA 4JKMA 4A7KA 4QGNA 4KU7A 3CHXA 4CCMA 4CUAA 2JECA 2XQXA 1J59A 3LPFA 4PCRA 1Q8OA 4ZY9A 2PELA 3LWCA 4AVBA 3TEXA 5BNPB 2PHTA 3J4UH 3ILNA 3ON7A 3Q8FA 2E63A 3ZXGA 2P37A 1POV1 4B29A 4C0BA 2EIGA 5F39A 4ISRA 4CP1A 4M4RA 4XJAA 1Y9GA 1YC61 3I97A 1S0IA 2OPWA 1IS6A 4LKSA 1OXCA 1RTVA 1BK0A 4Z82A 5IW0A 4MXVA 1UXXX 5FRAA 1HRV1 3HQXA 2QQIA 4Q4V3 1OD5A 2A6VA 3ZFGB 1QU0A 4TTGA 1ULOA 1C5IA 4I0AA 4E4SA 2ORXA 4LBQD 1E5IA 4PBPA 4INDA 4QPIC 4XE9A 1VLNA 1G6NA 2ZX1A 1X9PA 4R9DA 1IKQA 4ZONA 1KDMA 3AX4A 2ZEXA 2W87A 4K20A 2R7EB 2OVUA 2Z2SB 3B02A 4UWDA 4YG0A 4XIKA 1NAEA 1YFYA 1S55A 4HPKA 4NOTA 1OLRA 5EXOA 1NCQC 1YJKA 1K3IA 4LPLA 3VKFC 4ZS2A 4AAXA 2R061 2TUNA 4LITA 5LATA 2VPVA 4LOTA 2BJSA 5FKCA 2DFBA 1NXMA 3HT1A 4WM8A 4EE2A 5J96B 5JZGC 1MZ5A 2WNVB 4YARA 3NSTA 2J1EA 2QQWA 3IWZA 3DEMA 4BQ4A 5ACA2 5FCCA 3THTA 4QHBA 2PFWA 3WEZA 4BM8A 1VBB2 2VOKA 1CIWA 1H4HA 1OQ1A 2GP5A 2ZX0A 1Z0HA 4KWUA 4BIOA 4MGQA 2ZGTA 1IOAA 1JXNA 4RGGA 1ZREA 3VDDC 3DPRB 3WDTA 1QF3A 3VBSC 1CAUB 2YC4A 4XHBA 5EJ1B 4QB2A 4E4ZA 3PDQA 4COYA 4FPJA 1HRI2 1ND2B 1VBA1 1YFXA 2DTYA 4CRQA 2VNOA 2A1XA 2AGSA 1J84A 2XUEA 4L92A 4FQZA 5JIUA 2ZHLA 1FPN3 3LSEA 1RVF1 2GN3A 4XJUA 3EYPA 4A6OA 5FMBA 2ZKLA 5AC92 1XRUA 3PUHA 1E5HA 3RS6A 5FJHA 2GNMA 2CY6A 2EALA 2VCBA 2X5IA 4GJZA 2IXJA 4NHXA 1QJEA 2HJIA 1ZA7A 4GALA 1ASJ3 4UF0B 3ZPOA 4ZZ5A 2J42A 4LIVA 2TBVA 2HWF2 4JQTA 3EO6A 1U12A 2LW8A 5LK5A 1AYM1 3HMYA 2P34A 3OPTA 1D7PM 2VUCA 1STMA 1A78A 2GH2A 4E2QA 4AVTA 1IS4A 5A6QA 3DYOA 1VAMA 1UYXA 2C4XA 3UGGA 1LENA 3DUIA 2WRAA 3ROUA 4GIQA 3RZMA 4BMBA 2OUJA 4H55A 3H1YA 2JKXA 2YU2A 1YO8A 2O8QA 1J1LA 2VL4A 3KCCA 4QX5A 3UJQA 2WJSA 1C4RA 4QU2A 4TSVA 4NE9A 1X7NA 1AHSA 2VQTA 3K48A 3N9PA 1LAJA 2UYAA 2EXHA 1UPIA 1PK6A 4QDQA 4XFCA 4YSFA 3N9LA 2D5FA 4QM8A 1C8M3 2R072 4CU9A 3CDZB 3JB4C 3FHQA 1W2TA 1UY1A 1K12A 1TNRA 2MHFA 3E5UA 4UFIA 3RPQA 3UETA 2DURA 4LE4A 2X09A 4LO5B 1RUE2 1RUG2 2HWE2 2WUHA 3WP3A 5FZ1A 1Y4WA 4COVA 2JDZA 3MICA 4OI1A 2WZEA 4IEWA 5FYBA 2Z42A 3HWJA 4IEPA 4Y4RA 4ISQA 1YIPA 4YZ2A 1AR71 1QY4A 3GM8A 4CDWB 1IG3A 5AFEA 3O1MA 1ND3A 4QAWA 1GYKA 2Y33A 3RVHA 3WW3A 4BQ3A 3QLQA 5I8TA 1DYPA 3S7EA 3D4KA 4M4PA 3GGLA 1HV1A 3MFAA 5DDJ2 3PU3A 1W6NA 2EIEA 2PLV2 4P9XA 1W8OA 4IEVA 3VBRC 1WKYA 3GJBA 4G9SB 1AYN2 4LBQA 1PGW2 2E32A 1V00A 4D6RA 5J37A
chains in the Genus database with same CATH topology
1PNFA 3N7LA 1WW7A 4HBNA 3CJIA 3VL9A 3UV9A 2ATFA 4R9BA 2ZOEB 4GMP1 2EAAA 1BBT3 3R05A 4OHWA 4Q8LA 4EN8B 4CP0A 5CG8A 1MVEA 3BCWA 3O5SA 4GB33 2DCYA 1BEV2 2NYYA 1Y3TA 3WHTA 3WP6A 3LA2A 4YNIA 4LO8A 3MW2A 3ES4A 3ACLA 2G4IA 2E9QA 2PHXA 2O8OA 2AREA 4CDQA 1O4YA 1Q5OA 2UWCA 2XVGA 3AJYA 2E7QA 4YM1A 3TRSB 3VV1A 4KNCA 4FAHA 4DY5A 3VBUB 2WFF1 4QM9A 2IC1A 4Y24A 2ZGOA 4DQAA 5IK8A 1C57A 3ATGA 4NVPA 2RM21 1MQTA 1W6PA 3EXUA 1CR7A 1D4M1 3C3VA 1UIKA 1RMU3 4HZFA 1ENXA 4EN0A 4OHVA 1ENSA 4RHV2 3VBOC 1WW4A 2RMU2 2A5ZA 3JBG2 4E2GA 3FJSA 4LBKA 4YVWC 1WBLA 3D0SA 3WP5A 4BH9A 1H0BA 4XILA 3BOWA 2GSYA 2RS31 5CFDA 1DG6A 4EROA 4XMAA 1YRZA 1CN1A 3W58A 1V6JA 1PGL1 2VULA 1POV3 4ZU4A 2ZGNA 2PN5A 4YZ1A 2YGMA 3NVCA 4UBGA 3ZSEA 2VNGA 1XYPA 4KL1A 1KRIA 4FPCA 5GJ6A 1FMD1 3KQRA 1WD3A 5FLHA 4COZA 1YWKA 1OQDA 5L73A 2GNBA 4Q4X1 2WFPA 2CTVA 4WV8A 2GC1A 3DGTA 1F31A 5C8CB 1HRV3 1ULCA 3QACA 2AENA 2XLAA 4XFBA 4XIOA 1HQWA 3ZMOA 1DQ2A 1ZZBA 3FBYA 1KJLA 2YPJA 2E7AA 1KD7A 5A32B 1HQNA 5BUVA 1EYBA 3ZYRA 1BYHA 4BLJA 3NKTA 2GAUA 4FTEA 1IPKA 2R063 2WZR2 5T5LA 3FE5A 1ND3C 3U0ZA 3ZMNA 4SLIA 5JLVA 2OW4A 4LBNA 3N3HA 2GC2A 4I30A 4XDQA 4FCAA 2CAUA 4XQWA 5ABJB 2BGCA 1FT9A 4COWA 1A6CA 4NHLA 5C9AA 1LB2A 1YI7A 2VW1A 4LUMA 2BYVE 3DL3A 1EY2A 5JPNB 5L7OB 1VBA3 1QQP2 2VW2A 3LA3A 1S0FA 1H2KA 4CYDA 3GYDA 1MS3A 1RVF3 3ZYGA 4ATEA 4HVRA 3AKRA 3SMHA 3VZKA 3KD4A 4S2FA 2BVBA 3MYXA 4FXKB 4XBQA 4N9HA 3IKWA 2QNKA 4HVOA 3OYWB 1W6QA 1RB8G 2W0XA 1NXD1 4JGYB 1Y7BA 2P3KA 2CGOA 1AYM3 1LU2A 4NHMA 4R52A 1CJPA 3BALA 3FLPA 1WCKA 3QH6A 4HL0A 1COV2 2Q1MA 3B00A 5BNPA 3H3UA 1TMF1 1PVC2 4FOYA 1DHKB 1O5UA 3ZXFA 3H3ZA 1MQTC 4KU8A 2NZ9A 4AQ2A 3WT3A 4EWDA 1LJ7A 5A3MA 1C1FA 4WM7C 3I54A 4RR3B 3ZXAC 3TNQA 3WG2A 1SMVA 4YVSB 2AYHA 1SLBA 4PIYA 5I8SA 3I59A 2GC3A 3UKNA 3VN4A 4AEJA 2JG8C 1K5MB 1HXS1 3M4FA 2WNUC 2X8KA 3I2DA 1LOFC 4Q2FA 5C33A 2DVDA 3NJZA 4YZ3A 2XVKA 4TWTA 4AVSA 2XBO1 5CFCB 3B9IA 1AR73 4V1PA 5BV6A 1UF2C 3IIAA 4X6RB 4RQPC 4E9KA 4NR1A 2C1FA 2WNEA 1KXGA 3LGRA 1AX0A 4I02A 4B8EA 3ZFFC 4AW7A 4RA0A 1S0GA 1B35B 5FFOC 5L19A 2HEWF 3MEPA 2XLFA 3HAGA 1W6OA 1DLLA 2UWBA 1PO11 2FMDA 1CAUA 3VKNA 2OIIA 3IPVA 3KGZA 3LCPA 1XU1A 3KT7A 1YJLA 4N7UA 4CTEA 1REDA 1W6MB 4Q0SA 1Y43B 4GMP3 5K0UA 4OI2A 2DFCA 3VBHB 3RSJA 1GQHA 2JXAA 1ZRRA 5JR7B 2BW8A 1S0BA 4CEYA 1WBFA 1GZWA 1SLLA 5GZGA 3ZPYA 1XNDA 3CNAA 2GMMA 1YI9A 3SHRA 4HN1A 2E6VA 1WLTA 2RS11 3AKQA 5CBLA 5E89A 5C9AC 5C4WB 4HK9A 1YNAA 4DINB 5FO8B 2WFF3 4D7YA 1OA2A 1I9RA 1ZZ9A 3VZOA 1SFNA 2RM23 1PIV1 4L9BA 3AYAA 3RNSA 4YFZA 5BNNC 1D4M3 3NAPA 1NCRA 3GZTB 4N53A 4K40A 1NYWA 2D3RA 2AH2A 4FPOB 4LR4A 3AMQA 1OOPA 4K3UA 2ZTNA 3BOPA 5GLVA 4XF9A 3ZXLA 3M70A 4UW3A 2RS33 4C90A 2UURA 4I2OA 5F5QA 1FOD1 1NOVA 2VOWA 3OGJA 5CIRA 1F5JA 2GN7A 4GH4B 1MEC2 1VBD2 3FMGA 1OSGA 1ZZ8A 5BNPC 4AHZA 4QGMA 4AYUA 1O3QA 5C6CA 1KJRA 3TAYA 1HX6A 1FNZA 4PLOA 4CDWA 1AL21 3VLBB 1FMD3 2FBEA 4Q0QA 5FREA 5BNOA 2B42B 3JB8A 3VZNA 4Q4X3 1EAH1 3AMMA 4NHKA 3FFQA 5EV7A 3GBFA 2MPFA 1GLHA 1KFXL 2O0OA 1DU3D 2ET7A 3S0MA 3AFGA 3ZFGC 3CU7A 1WGPA 1RUH2 4R9AA 4YG6A 4LUKA 4JAAA 5HCFA 2UY8A 1UU4A 1LODA 3H0OA 1GICA 1AR91 1NE6A 2BVVA 1D0HA 4ITCA 5KBFA 4X8NA 4WVMB 4XTMA 4A7YA 4HSLA 3EBRA 2PHLA 2JD4A 1VJ2A 3Q9OA 2RJKA 2VMIA 4C1XA 4YRDA 4M0NA 4KWKA 3V0AA 4QPIA 2WNVC 3ZFEB 1UAIA 5KC5A 5DUWA 1POV0 4MGYE 2FHRA 3KT1A 2VQAA 1UCXA 5H9RA 4ZKTB 3OY8B 3WXPA 4Z8BA 1NCQA 4YW1A 5I8YA 3DPRC 5JZGA 2JG9B 1RJ7A 2PTMA 4ZU7A 3O7OA 4K1YA 1VBC2 1ND2C 2ARBA 4Y1XA 3WCRA 3THPA 2GMEA 3QCWA 4W6XA 4KG8A 4LBMA 4IV3B 4PJYA 4HMZA 3RYPA 2FZ1A 3VDDA 2PQQA 1MZFA 4IEXA 4Y20B 3WG4A 2XJRA 1WLDA 1DYKA 1OHFA 1TNFA 5JSPA 3SISA 4RD7A 2WT2A 1QJX1 2NQYA 1VBB1 3URFA 4FPLA 1ZBE2 1S1AA 5I91A 4AK3A 3WV6A 4BA6A 2YDEA 1FNYA 3SITA 2IZWA 1TMF3 3ZX7A 3H7YA 4CDXA 3D82A 3PVOA 5SV8A 4HLTA 4N53C 3WHUA 1JYIA 4MVTA 4Y26A 4MXWA 3ZYIB 1X33A 4R4XA 2ET1A 2NLRA 3G7DA 3PJQA 5DZEA 4WZCA 4HSJA 4GA9A 3E6BA 5AC91 5C8CA 1A8MA 2ES3A 3RG0A 3AMNA 2P2KA 3ST7A 1WA4A 4XF1A 4D69A 1HXS3 1VBE2 3LA7A 2B9UA 1LULA 5JSRA 2WSUA 2HWF1 2BWCA 3E97A 2XBO3 4QQ2A 1LOAA 3VL8A 1ZZ6A 3HR9A 1LHUA 2HYKA 4B3NA 3ZO0B 4CDWC 4RL7A 1SLAA 2XJUA 3M3IA 5BNOC 5JOYA 2W39A 3AP9A 5KXDA 3W59A 4FOWA 1XU2A 3MPPG 3V0BA 4N90A 3WCSA 2Y0OA 2ZAHA 4N43B 2VOVA 4JVAA 3W9AA 1PO13 4JDOA 2R071 5IK4A 5J09A 4X6QB 5LK7B 2YYOA 3BB6A 4IEQA 2D6NA 4META 2WS93 5L7OA 1YXWA 4FOQA 2ILMA 5I0RA 1RUE1 1RUG1 2HWE1 1ENQA 2KXLA 4CZSA 3VBRA 5GLZA 5JCTA 2B5HA 1F8VA 1TE1B 1XNCA 4M3CA 2ZA9A 4LEJA 4XEZA 3INAA 4JDNA 5I0SA 1G9CA 5GLUA 1UZYA 2R6QA 1SCSA 2R16A 2D6OX 2VXRA 5BY5A 5DDJ1 1FX5A 2PLV1 1J1TA 2RS13 3NW4A 1NQJA 4JGYA 2ZGKA 4P5HA 1WCSA 1AYN1 2H0BA 4ASMB 4C0HA 2VVEA 1PGW1 3RMXA 4CDUB 4IV1B 3VGIA 4QPGA 3WG1A 3MIGA 1NY72 4F7ZA 2H6CA 3PMSA 3VBUC 1OLQA 2JENA 4I09A 1PIV3 2ZAAA 1EPZA 4AI8A 4BWOA 3WG3A 3HD8B 5AFBA 3FLRA 4OHXA 1SLTA 3GALA 1OPOA 4AFDA 3ZN4A 2PHRA 2XKOA 3OGGA 4AI3A 4DRVA 1MS4A 2ZGPA 4JGZB 4L97A 1ZVFA 1BEV1 1GQGA 2WT0A 3MLJA 4Q4Y1 4B4RA 3EJKA 3L2YA 5DG2A 1DDLA 4LO4B 1H30A 4LNVA 3D6EA 1FOD3 3BU7A 5JOXA 2VW0A 1K5MA 2B46X 2LALA 2DCTA 2OUHA 1XE8A 4UW6A 4KWJA 3ZN6B 1PO22 3OPZA 1H2NA 3VBOA 4CDXC 1ONAA 4XW3A 2P17A 4YVWA 3AKTA 3B9CA 2B39A 1A8DA 3ZYPA 1AL23 4HK8A 2XHKA 2IFRA 1H8TA 1XXNA 1H8VA 2VGDA 1SBFA 2DV9A 1LOCA 1EAH3 2D40A 2DUQA 1DGWA 1N1TA 3P3NA 1QOTA 4RHV1 1URXA 5C8CC 1PZ7A 2RMU1 1VAVA 3JBG1 4SBVA 1MS9A 3HIFA 2VNRA 5JOWA 2AR6A 1REEA 3J8F2 1BMV1 2ETEA 5H9PA 3POYA 1QMJA 4AGRA 1GR3A 1CESA 1AR93 3VKOA 3ZIXA 2YHJA 4XXAA 1MR5A 4C91A 3N36A 5KHIA 5LRSA 2DVAA 4U36A 3N4MA 3ELNA 2A6YA 1RUC2 4B7EA 3N7KA 5FBZA 2RS51 3ECQA 1CD3G 1NA1B 3CJXA 4EJRA 3PLQA 2CAVA 2EXJA 4BYYA 2DUOA 4OZXA 1DGLA 1FATA 3USUB 4F83A 3G6JB 1LHVA 2BFUS 5ABJC 5D8AB 3RJRA 1UZZA 3V64A 4F8AA 3S6PA 1UX6A 4QQOA 3ZDSA 4AE2A 1CVNA 1CAWA 3N7JA 2JKBA 1N1VA 5L7OC 4LTAA 1SBDA 4AFMA 3PTYA 2BTVC 4URTA 1KS5A 2H6BA 1O4TA 1QJU1 5EYXA 2GMPA 2DF7A 2YC0A 4M00A 4AHWA 2PAKA 3JU9A 2WZR1 3MGUA 3WDUA 2WLPA 4MH0E 4ONUA 1VALA 1UN1A 2WA3A 5ACA3 5T50A 1QJX3 3MW3A 1VBB3 1HV0A 5JMCA 1UD1A 1XE7A 4JGYC 1KS4A 3JQWA 4LBOA 4LHLA 1Y9QA 4QPGC 4RS5B 3HT2A 1RUD2 1DF0A 3SH5A 5DUXA 4KG0A 4L11A 1OKQA 4CEWB 4XOGA 1QQP1 5T5PA 2B8MA 1V6LA 2GALA 4X8PA 3WD5A 2D6KA 3VZMA 3UL2A 4L2NA 3MI8A 4AEDA 2ARXA 4IEOA 4FTSA 3R0RA 2F4PA 2EF6A 2WQZC 1AR82 2ZZQA 4RR3C 5AVAA 5AC93 3ETQA 2A71A 3CO2A 4NO4A 5J3UA 5A33B 5FOJB 5H9QA 4BE3A 1VBA2 4DRRA 2HWF3 3AZZA 1K5MC 4G3YC 1QDCA 3J9SA 1V9U2 2X29A 4WM7A 4IEUA 1RUJ2 4ORFA 4YGBA 1S2KA 4XFAA 4YW4A 3AP7A 1AR61 3WDWA 4PDWB 2E7TA 2R041 2PHFA 1IKPA 4PIZA 2G9FA 1H8TC 5I0TA 2JG8A 3SNMA 2WNUA 1LOFA 5FQ0B 1GNZA 4H7MA 4LO6B 4QXKA 3IBMA 2A3WA 3VBSB 1A3KA 1LGBA 3ZXKA 1AJKA 3AMPA 4Y22A 2R073 4DOUA 4RQPA 3OBRA 3VKLA 2WKKA 4L99A 2R0FA 3SLIA 3VHOA 1RUG3 1RUE3 2HWE3 3ZFFA 3M3CA 3AK0A 1N1SA 2VY0A 4O9GA 2HEYF 2WL1A 2Y38A 3VBHC 4IV3A 1ZBA1 4UW4A 2X53S 1TME2 4YZ5A 3KCYA 1Z7S2 1AXKA 3RQ0A 2HEVF 1NLRA 5KHKA 5FMOS 2VVFA 4IEZA 1CGPA 5DDJ3 1NG0A 1CAVA 5GALA 2PLV3 1CAXA 1I1EA 1O3RA 2G9GA 1AYN3 1V6NA 4AGGA 3IM0A 3R4SA 1QOSA 3QD6A 4Q0UA 3R4UA 5GZDA 1AR72 5CAZA 4MV2A 4P9YA 1UL9A 1RINA 5KXEA 4Q4W2 3SCGA 3AXEA 1QJZA 1PZ9A 1MZEA 5KHGA 3WVJA 3WUCA 1BEV3 1REFA 3O0VA 2RR11 2D3PA 4Q4Y3 3PMEA 1B09A 1U5IA 1R1A2 4Y1YA 4OLLA 3AM2A 3BTAA 5BNNA 1Q8VA 1QWRA 2HWC2 2SBAA 2ENRA 2LTNA 5H9SA 1LEDA 1UPSA 2ZGLA 3JZVA 4GH4C 4DFSA 4Y4YA 3AYCA 1WW6A 2UY9A 1Q8QA 5KHHA 2HWB2 5FOBB 4NWWA 2Q5TA 2XH6A 2HWD2 3O0WA 1G9AA 1RIRA 1QJY2 1O7FA 1L3JA 3S7IA 1UU5A 1AL0G 3I7DA 1O4ZA 2DCJA 4JQRA 1WMDA 1MS1A 3AZWA 4MGZE 5LEKA 4AEDC 1GSLA 2N7GA 1RUF2 2D93A 4YGDA 5T3NA 1EV12 3E5QA 3BPZA 4Z1VA 1BCXA 4RHV3 1IPJA 1RUI2 5FO7B 2RMU3 3JBG3 5E1RA 1X8MA 3U07A 4JV4A 3PHMA 4BHPA 3NV2A 2GDFA 4I3GA 1M06G 2I2SA 1UKRA 4KBBA 4LHKA 4YGEA 2OYZA 5BNQA 1LHWA 5KWRA 1PHMA 3POSA 3QBQA 1MEC1 3N35A 1LRHA 4WM8B 4S2DA 4I01A 3WUDA 2UWAA 3IT8A 4M0HA 3ZFGA 3B93A 3MIDA 5DXDA 2RS53 1J58A 2ZGUA 1DIWA 5F6LB 3ME2A 2K9ZA 3ZFEC 4D3WA 1WD4A 3TN92 3AXDA 1W2UA 5DG1A 4XFFA 5GZEA 1RHI2 3FWEA 5GM0A 4CDUA 1RUH1 4IV1A 2JG9C 5HI0A 2WNVA 1S0DA 3MLLA 4CP2A 3MW4A 1QJU3 4PBOA 2A6XA 1RUOA 1LR5A 4Q4X2 1HW5A 3T1LA 4W6YA 1I3HA 4QGLA 4IV3C 2WZR3 2ZPXA 4YW3A 3DPRA 2XPJA 5DUUA 2X5IB 5I93A 4BPZA 4OI0A 2YUEA 3OD0A 3AZXA 2P3IA 1WMFA 3H7JA 4KGQA 2WS91 4IXLA 1ND2A 1D2SA 4QQHA 1OA4A 1R082 5CU1A 4FPHA 4MSVA 1BJQA 1JBCA 1N1YA 1QQP3 1GV9A 2NMOA 2PHDA 4Z92B 1VB4A 1VBC1 4AGVA 4RSUA 5EFUA 2YMZA 4AF9A 3X29B 1N3PA 3HBZA 1PK6B 4DY3A 5JIAA 1FV2A 5L36A 2VH9A 3GZUC 1DGRN 1C3HA 2XLGA 3B94A 4AVAA 2VOXA 5AVPA 2A73B 4Q0VA 4KWLA 4XF0A 4M3CF 3A0NA 3SCFA 2VVDA 2RJLA 1N47A 2GZWA 2XKPA 1DQ4A 3JQXA 1COV3 1YIFA 4S2GA 1PZ8A 1BVP1 4AVVA 1WCDJ 2R0HA 1AR63 2MEV2 3KGLA 3LKJA 1X82A 2TEPA 2R043 3B69A 1VRH2 4KQ7A 1LHNA 2QJVA 2XL9A 1PGSA 4FO9A 1W6NB 5KHJA 4HKLA 1R091 1U5ZA 4LBQB 4I0WB 1QH7A 3IDBB 4HKWA 4Y5Z0 4N43C 3CJIB 1NQDA 3ZXDA 3TB0A 5KXBA 1WUVA 3IN9A 4GQ7A 3FHIB 2XJPA 4Z2WA 1EP0A 4A2UA 2WINB 5IUQA 1H1MA 5GZFA 2GNDA 3CL1A 2WA4A 1QOOA 1ZBA3 1LOEA 1OMIA 2CWMA 3JD72 1V6MA 2QKDA 1ZZ7A 1SCRA 5BXXA 3KMHA 2DU1A 4IERA 1UU6A 2Q8OA 1VAKA 1V6KA 1HXS2 4CDQB 2GU9A 4FAGA 4YM0A 2D6LX 3NV3A 2WQ4A 1XYNA 5D1IA 4YW2A 2I45A 4CDUC 4IV1C 1NLSA 4BMEA 2I07B 3LOBA 4EWAA 1W6PB 1IHMA 1PVXA 3WQ7A 2R49A 1QH6A 1AF9A 1DQ0A 3BIWE 3O14A 4TYSA 2AUYA 2W52A 1W0OA 2Q4SA 5FDBA 2JX9A 1I5ZA 1VR3A 2BWAA 4W6WA 4GWNA 3GNEA 2RR13 4JGZC 1RGSA 4WBBA 4QT6A 4WVVA 3VBUA 5CFDB 3M3QA 4HANA 2ZHMA 3FFZA 4GWMA 3H1MA 4K8FA 3AP5A 2EAKA 4AXOA 4M01A 3UJOA 2QZ2A 4QPYA 3MFCA 3HN1A 4Q4V2 1PMIA 1APNA 2CWSA 2ZCWA 1SLIA 1ULFA 3MDPA 4LLFA 2WT1A 5ACA1 1DZQA 5JI7A 1O5LA 3ZSKA 3FX3A 3VZJA 2BPA2 3WW1A 2PAEA 4XJZA 3M7AA 1MS8A 1UKGA 2IWGB 1AUYA 2DCZA 5F6KA 3TNPB 4R9CA 1WMEA 4FOVA 3WP4A 1LEMA 5F9TA 3ALQA 1HRI1 2VUJA 3K51A 3L9JT 3TWIA 4XFIA 4H7LA 4AFCA 3M1HA 4OULA 1CQ9A 1MEC3 1AJOA 1RL3A 3ZIWA 4WZFA 1PO21 3SXWA 4Q1RA 3VUOA 1XYOA 1CPMA 4YW5A 3P3PA 4JC1A 2ZZJA 3MPBA 2MNGA 1LHOA 4AWDA 1NA1C 4MGIE 2XGXA 4XETA 1AZDA 1FPN2 4XBLA 4ASLA 4E27A 3AP6A 5A32A 5C9AB 1JN2P 5JVVA 3OD4A 4AG4A 1KDKA 2KM2A 2A75A 4HN0A 5HCBA 1QXJA 1RUH3 3ENRA 5JAXA 3J8F1 4Y1ZA 5BYNA 1ASJ2 3KSCA 2E53A 3FUQA 4D7SA 1C5HA 2CGNA 2C5DA 4OVEA 4PQ9A 5ABJA 3AFKA 2QDNA 1RUC1 1W6QB 3NV1A 3BODA 3KS7A 2W68A 4P9GA 1LGNA 4EN6B 1O91A 3H9AA 2UU8A 2PHWA 1G7YA 4H3WA 4ZU5A 2CL2A 3PVNA 5A3LA 4GKYA 1AR92 3MF6A 3OCPA 4DZGA 1J3QA 1LOBA 1KQRA 1ZYBA 4IEYA 1V6OA 4RS5C 1YFWA 3NKGA 3QH7A 4FPEA 1C8M2 1DBNA 3B01A 1FXZA 1LTEA 1VBC3 2EA7A 3OYWA 4CEWC 1DGWX 3NO8A 3SH4A 4AQSA 2H0VA 4R4ZA 1IQAA 1C28A 3NL1A 3JCIA 2XG3A