2WS93

Equine rhinitis a virus at low ph
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
226
structure length
226
Chain Sequence
APIRVVSVPESDSFMSSVPDNSTPLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLSAAELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMACIHAVWDVGLNSAFSFNVPYSSPADFMAVYSAEATVVNVSGWLQVYALTALTSTDIAVNSKGRVLVAVSAGPDFSLRHPVDLPDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
total genus 34
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9300
5AC91 1ND2B 1EV13 2X5IA 1RMU1 1HQNA 5DDJ2 4WM8C 1TMF2 2RMU3 2WZR2 1V9U2 3JD73 5ABJC 2PLV3 1VBA3 1HRI1 2R072 4CDQB 5AC92 3HAGA 1TME3 1RMU2 4CDQA 4PDWC 5J98B 1VBC3 1BEV1 3FBMA 3JB4C 1HRI2 1RUJ1 1AR61 1OHFA 5C8CA 1ASJ3 2QQPA 4IV1C 4JGZA 5BNNA 1K5MA 1BEV2 1FMD1 1RUJ2 2HWF1 1VB4A 1VBB1 4AEDC 2HWB1 1AL21 1WCDJ 2BPA2 2XPJA 4RFT0 1PO23 4GH4C 5C9AC 5FMOS 3TN91 1FMD2 1ZBA1 2HWF2 1OOPC 1HXS1 1VBB2 1AL22 3CJIB 2WFF1 1AYM3 3J8F1 1AYN1 3CJIA 1QJU1 4GMP0 1H8TC 3TN92 2BFUS 1ZBA2 2RR11 2VQ0A 1HXS2 2HWC3 2WFF2 4GB32 4QPIC 1QJX3 3J8F2 1AYN2 1B35B 4IV3B 4N43A 1ND2C 1QJU2 2XBO1 5JZGA 1RHI3 4IV3A 1FPN1 1ZBE3 2R042 4EJRA 2RR12 1NOVA 3VBHA 1AR93 4CDQC 2XBO2 2WS93 3VBUB 4RS5B 1FPN2 1HRV3 4WM8A 5ABJB 2FZ2A 2BBVA 1R1A1 5ABJA 1BBT1 1QQP1 3S6PA 1RVF1 4WM7B 5BNOB 1Z7S2 2HWD1 3VBRC 4Q4Y3 4PDWA 4FTBA 1AR73 5A32B 1BBT2 1FOD3 1QQP2 1E57A 2R063 4IV1B 1RVF2 4IV1A 2HWD2 3ZFEC 3DPRC 2HWE3 1VB2A 4Q4V3 4SBVA 1CD3G 1RUH1 1MEC1 4AEDA 2MEV1 1C8NA 5C9AB 5BNPB 4GH4A 3JBG1 5C9AA 5CFDC 5DDJ3 1RUH2 1MEC2 1OOPA 2MEV2 1QJY1 1H8TB 3JBG2 1B35C 1H8TA 4YVWC 4QPIB 2RS13 3VBOC 4QPIA 1QJY2 1ND2A 5LK7B 1RUE3 1D4M3 1NCRB 3VBUC 4CEWB 4RS5C 1RUG1 5ACA1 1PO13 3ZFGC 1AUYA 2RS31 1OPOA 1C8M3 1IHMA 4WM7C 5BNOC 1RUG2 5ACA2 1COV1 1AR81 1FMD3 4Q4X1 2RS32 3VBRB 2HWF3 3VBRA 1AL23 1M06G 4CEYC 3ZXAC 1EV11 1RUI3 1RUC3 1COV2 1AR62 2RMU1 1AR82 4Q4X2 4NWVA 3JD71 3ZFEB 3DPRB 2PLV1 1VBE3 1VBA1 3VBSB 1RUF3 3ZFEA 3DPRA 4GB33 1EV12 2ZTNA 1TME1 2ZAHA 4RR3B 5BNPC 1PIV3 2RMU2 1R083 2R043 2HWB2 3JD72 5D8AB 2PLV2 1VBA2 3VDDB 5CFDB 1EAH3 1NA1B 1ASJ1 1TME2 5CFDA 1POV3 4LLFA 2RS51 5FOJB 2ZZQA 5FMOL 1PVC3 4FSJA 1B35A 4RQPB 4YVWB 1ASJ2 4RHV3 4Q4W3 1R093 2RS52 4YVWA 1NCRC 1Z7S3 1VBD3 4CEWC 1PO21 3VBOB 4CDWC 3VBOA 2BFUL 5A33B 5A33A 3VBFB 1VAKA 3VBUA 1AYM1 4RS5A 4Z92B 3ZFGB 2HWD3 3ZFGA 5K0UB 2WWSA 1MQTC 1VRH3 2HWC1 1RUD3 4WM7A 5BNOA 1AYM2 1QJX1 3NAPC 4NWWA 1R1A2 4N53B 1F2NA 1ZBE1 5A32A 4Y4YA 1ND3B 4CDUC 4CEYB 1AR91 5CFCC 3VBSC 4CEYA 5L7OC 1HX6A 4FTEA 4RR3C 1BMV1 1HRV1 1ZBE2 5D8AC 1AR92 2DF7A 3VDDC 5BNPA 2RM21 1NA1C 3ZFFB 1BMV2 1X36A 4Q4Y1 1TMF3 4GMP1 1AR71 1V9U3 2WZR3 1FOD1 2R073 2R061 5AC93 1RMU3 2RM22 3M8LA 4RQPC 4Q4Y2 3IDEA 2HWE1 4JGYC 1AR72 4Q4V1 1HRI3 1FOD2 2R062 2TBVA 1PGL1 3VBFC 1NCRA 1NG0A 4QPGC 4CEWA 4CDWB 1W39A 2HWE2 1QJZA 1BEV3 4BCUA 4CDWA 4Q4V2 5K0UC 1RB8G 1RUJ3 5DDJ1 1AR63 1POV0 4CDXB 1PGL2 1A6CA 2X5IB 1MQTB 4N53C 1MQTA 1NY71 1ND3C 1NCQC 1VBB3 3NAPB 2HWB3 2RS11 3NAPA 1RUE1 2BUKA 1D4M1 4CDUB 3TN93 4FTSA 1NY72 1ZBA3 4CDUA 5CFCB 1HXS3 1PO11 2IZWA 2RS12 5CFCA 2WFF3 3VBSA 5L7OB 3J8F3 1AYN3 5C8CB 1C8M1 1QJU3 1RUE2 5L7OA 4RR3A 1D4M2 5GKAC 1VBC1 3ZFFC 4JGZB 2RS53 2RR13 1K5MB 5BNNB 4Y5Z0 1PO12 5D8AA 3VDDA 2XBO3 1C8M2 1NA1A 1FPN3 1VBC2 2FZ1A 1RUC1 1RUI1 4YVSC 1VBE1 4RQPA 1RUF1 4JGYB 5C4WC 4GB31 4JGYA 1R1A3 1CJDA 1RUC2 1RUI2 1BBT3 1PIV1 1QQP3 1R081 2R041 1DDLA 4QPGB 1RVF3 1X33A 1VBE2 3VBFA 2Y26A 4CDXC 1RUF2 1PO22 4QPGA 4N43B 1EAH1 5JZGB 2X5IC 1POV1 5K0UA 1PIV2 1R082 1GFF2 3VBHB 1PVC1 2GSYA 1RHI1 1EAH2 1F8VA 4RHV1 1NCQB 4N53A 1R091 4Q4W1 4WM8B 1Z7S1 1VBD1 1ND3A 1NCQA 1RUH3 1MEC3 2HWC2 5J96B 1QJX2 2GH8A 2MEV3 1PVC2 2WS91 1RHI2 3JBG3 5C8CC 4RHV2 4PDWB 1R092 2RM23 4Q4W2 1VBD2 4JGZC 5BNNC 1K5MC 4GMP3 1QJY3 1VRH1 2WS92 3JB8A 1RUD1 1HRV2 3ZFFA 4AEDB 1VRH2 1RUD2 4GH4B 3CJIC 4YVSB 1RUG3 5ACA3 4YVSA 1OOPB 2RS33 5C4WB 1PGW1 5C4WA 4N43C 3LOBA 5JZGC 1COV3 1AL0G 2WLPA 4IV3C 1TMF1 1AR83 1SMVA 4Q4X3 2WZR1 1V9U1 3VBHC 1PGW2 4CDXA 2R071
chains in the Genus database with same CATH superfamily
3MIHA 1EV13 3GBGA 2VMIA 1UYYA 5FJKA 2ZJCA 1HQNA 5DDJ2 1TMF2 1X8EA 2W91A 4CXXA 2IXHA 3JD73 5FYUA 1LB2A 4GQ7A 1HRI1 4QHZA 4J6GA 4CDQB 1YFUA 1W6MA 2O0OA 3ZXJA 3NJYA 4AFMA 3TWIA 1RXGA 2Q30A 5T5JA 2D6MA 3HR9A 1EPZA 1REFA 2E7QA 5JLVA 1AXKA 4XUQA 1HRI2 4Z07A 2C6SA 4GULA 4YM1A 1NZIA 1AR61 5F5AA 3WINE 2VZVA 4BA6A 1UAIA 4IE5A 2EIGA 4D69A 2DDUA 3ME2A 5C8CA 4A3ZA 3ZDVA 4RFRB 3OGVA 4JGZA 3JQWA 2VCBA 3ETQA 2ZX1A 1WA6X 4NAMA 4AGGA 3I2KA 2MPFA 4XQDA 1G86A 2C5DA 2PYTA 3LAGA 4XZPA 5KXCA 3ILNA 1AL21 5CB7A 2XR4A 4Y1XA 2ZS6B 3NSTA 4LR4A 3DL3A 4DMIA 1SPPB 2RJKA 1YLLA 4NJ4A 3TN91 5F3CA 1O3QA 1SLLA 3NNGA 3U78A 2QQUA 4QWNA 3OEAA 1AL22 1T2XA 1DGRA 3C3VA 4GJYA 1BHGA 5CEHA 1BYHA 4GMP0 4YW3A 4BM8A 4EE2A 2FDFA 1XOYA 2GALA 5CG9A 1GR3A 3TN92 3W9AA 4W6YA 2D7FA 2JIGA 3PDQA 4LBKA 2J1TA 5DUVA 5FLIA 4HXCA 4MG2A 4LE3A 1ND2C 2XBO1 2Z4FA 5JZGA 5CG8A 1LGNA 4XMAA 5JCTA 1OURA 5CKQA 1E5RA 4JQRA 4LKEA 2DCYA 4FI9A 4LXLA 3IPVB 2FHRA 4V1PA 5EIYB 4AFCA 1HB4A 3R6SA 2DVAA 1Q8PA 5JUVA 3O0VA 2PMWB 3BGAA 2XBO2 4Q1RA 3VBUB 4AWDA 4D3WA 3V65A 1NT0A 3OG2A 4W65A 2FZ2A 5LY2A 1R1A1 3VV1A 2ENRA 3SCGA 3WSOA 1XXNA 5GLWA 3VL8A 2W3JA 5FPBA 2FD8A 1IS3A 3I97A 1KJLA 3I2JA 2XJUA 1JUHA 4K1YA 4MVTA 1W6PA 4WM7B 3L9JT 1LU2A 3VBRC 4PDWA 4D0QA 1KGYA 2W46A 1OC1A 2XXZA 3NJXA 1AR73 4A42A 4JZRA 4XIOA 1I5ZA 1JYIA 1E57A 2LRPA 4FPHA 1Q56A 1WMDA 3O1RA 1LTEA 4YW7A 4NRQA 4NHXA 3GCWA 4LK6A 4XUPA 4GWMA 4YFWA 4JCKA 3ZFEC 4YARA 4JTNA 3BU7A 1XU2A 2FCUA 3DYMA 1VB2A 4AAPA 2DCKA 2WSUA 4AHYA 3LA2A 4M3CB 1W2AX 4AEDA 5CISA 1XNDA 4H7MA 4NRPA 5DMYA 4KWUA 2VECA 4FXGB 3AFKA 1WLTA 2CHHA 2P3YA 5LRRA 5C9AA 3AYEA 2YGLA 4HVRA 4MXWB 4BH9A 4P5YA 1W99A 1LOBA 3H1YA 3M70A 1KD7A 1QJY1 2RDRA 3BODA 4MZUA 1YNAA 3ZKUA 1H8TA 3GHMA 4PLNA 5EWSA 3FE5A 5LASA 1JZ2A 1D4VB 3GZTB 1L7RA 2B46X 2FCVA 1S0CA 3OD4A 4XFBA 3VZJA 2AEZA 3EQEA 1OH3A 2NN8A 2RS13 4UOJA 1QJY2 4LBQD 2I2SA 1ODNA 3I2IA 3ZR5A 4BMEA 5A7SA 1H2MA 1ZX5A 2BVBA 4UBGA 1FAYA 4CEWB 4Y1YA 1W9FA 4LULA 4S2GA 5ACA1 1H0BA 2OT7A 3RYRA 4BQ1A 5IK4A 3WEZA 3AZWA 1GNZA 3CZUA 2RS31 3DV8A 2XLAA 4LBQB 3GNEA 1C8M3 4ATEA 5IVBA 2AZ5A 5DUWA 3WG1A 3N7LA 4LORA 5FREA 4TZDA 3RG0A 4MV2A 1QH6A 4E2GA 1RINA 5ACA2 1W8WA 2EAAA 3BVCA 1EYBA 2X09A 4OULA 1FMD3 1UU6A 2RS32 2RDNA 2XJTA 5E16A 1PK6B 1UOJA 1BZWA 3T1MA 2JD4A 4LA3A 3DYPA 4CEYC 5AFBA 2XVGA 2B4KA 1IG3A 3A0NA 1RUI3 2OZ6A 5APAA 4HFSA 4GA9A 3BYWA 3S7EA 3BPSA 4NWVA 4RGKA 3D4KA 5EPAA 3DPRB 2PLV1 1VBE3 4CCEA 5IVJA 3VBSB 3WUCA 1RUF3 1UZWA 3AZZA 4JRAA 4LA2A 1B09A 1RJ7A 1PMIA 3U07A 5KHHA 5FYTA 2C4XA 4RR3B 5BNPC 4CUCA 2ZHLA 2G19A 2GC3A 1PMJX 2Y6JA 4M4PA 1NKGA 1W9YA 2ZGTA 3NNLA 5A3WA 4N90A 1R083 3MPPG 4MGIE 5A3LA 2VZSA 4CPBD 3VHRA 4QD2A 3RNSA 5D8AB 2DVGA 2PLV2 3KGZA 1AF9A 3A7QA 4AHXA 1LOEA 1ENSA 4BLIA 1X9PA 4LBLA 2CGOA 4URTA 4CVUA 4H55A 4EWDA 1ONAA 4DXZA 2DCJA 4FPKA 2V5YA 2VQUA 2OS2A 4MX3A 4QAWA 5CVRA 3LCPA 3OPWA 3W21A 2G9ZA 3RSJA 4IEVA 3ZYIB 5KXBA 4YW4A 4FSJA 1F31A 4ASLA 4CCNA 3WNOA 1B35A 1DYKA 4YVWB 2PHUA 2ZZJA 4V2WA 5L36A 3BOPA 4PHZA 4D7YA 2RVAA 1NCRC 1Z7S3 4AI0A 1CGPA 1NLSA 4I3GA 5LEJA 5F6KA 3VBOA 2WAAA 3UJQA 5BXXA 1YI9A 5JMCA 2ZKNA 1VAKA 5E6HA 1MZ5A 2BGCA 4RS5A 4CYDA 1FNZA 5HBAA 4UW5A 4EN0A 5K0UB 2VCAA 4FQ4A 3VKFC 1VRH3 1CN1A 4B1MA 1KJRA 4BQ5A 5BNOA 2E6VA 4WZCA 4FPYA 3WP6A 4EWEA 2VTXA 1C5IA 4Z8BA 5FZLA 3NWKA 4Q8LA 2YY1A 2AREA 1W8OA 4X6RB 3WNLA 4Y4YA 1I9RA 1ND3B 2YB7A 3RZGA 2EF6A 4CDUC 2VZ1A 1N1TA 3HD8B 4QKDA 4CSWA 1FYUA 1JOBA 1AR91 2QTWB 2FDGA 5FP8A 1DLLA 3PVNA 2JG9A 3EMRA 1TNFA 1HX6A 2ZHNA 4UBHA 1W3XA 1QKQA 1WZXA 5JR7B 4FTEA 5LRSA 4IE4A 1OVPA 2YUEA 1LGCA 3K2OA 3AP9A 3POWA 1IG0A 1AR92 2FDJA 4P14A 1J58A 1H9WA 1ULOA 4Q2FA 4AFDA 1NA1C 4KG8A 3RVHA 2VNOA 1X36A 3MYXA 2Y6FA 1SG3A 1TMF3 3KM5A 4WBBA 4GMP1 5FZ6A 3KGLA 1JZ5A 1W8UA 4YYOA 4BXSV 1J1TA 4E4DX 3FUOA 5SV8A 5T54A 5LA9A 1FOD1 1WLCA 1MVEA 4S2HA 3BKZA 4DRRA 2XDVA 4QGNA 2WNVB 2HWE1 1OF4A 3T0DA 1DCSA 1UU4A 1CQ9A 3KT7A 2UURA 3FX3A 1HRI3 2OIIA 2QJVA 1FOD2 4XC9A 4I2OA 5FR3A 5DAXA 1CWPA 3ZN6A 5B4NA 4KWKA 4XETA 4SLIA 4QKNA 3S57A 5DXDA 2E32A 2HWE2 4CDWB 2VBDA 1W90A 1VMHA 1O3RA 2A6XA 1AR63 5I8SA 1Y9GA 3J9SA 3BTXA 3DUIA 4CDXB 4JKLA 1LGBA 2AEYA 3IIAA 5CIRA 1W6NB 1XC6A 2VOTA 2LTNA 2VXJA 3ZDSA 3N35A 1QEXA 5FYHA 2J1EA 4N53C 2BZDA 1PHMA 5FZKA 1R64A 3N9OA 3VHPA 2D5HA 5EZWA 2YPJA 3ZIWA 3IMNA 2VPVA 5HI0A 3N7JA 1H1MA 4XDPA 4B1LA 2H0VA 5EP9A 4E4HA 2BEOA 4E4SA 1GKBA 3TN93 5FTTC 3T2QA 2GMEA 3GZUC 4TLGA 4HG6B 2DURA 3TEWA 2IZWA 2OW4A 1KEXA 2WO2A 5L7OB 2X29A 1FATA 2A6YA 5C8CB 4COWA 5GKAC 1JYWA 2YC2A 3POEA 4JGZB 1VLNA 4AAXA 2O8QA 5FZMA 4BQ4A 4Y5Z0 3ZSMA 2XG3A 1NQDA 1UXXX 3AP4A 2VQTA 2D3SA 4FFIA 3VDDA 4Q29A 3O1MA 2OX0A 2XBO3 1MS5A 3SH3A 2WT1A 3B00A 4FP3A 5JR2A 5F3EA 4D6QA 4QX7A 3CKHA 4CCOA 1RUC1 1QOSA 1W0OA 3D0SA 3R05A 4YVSC 5T50A 1YEWA 3AFGA 2ARXA 2BRTA 4DS0A 4OUEA 5IUQA 3VZMA 3OBZA 4PBPA 3AP7A 2HJIA 1GZWA 2F17A 3I2GA 4N7IA 5G05L 1R1A3 2C0ZA 1RUC2 1VP6A 2WL1A 4MO3M 3URFA 3WLUA 4BWOA 1PIV1 4Q0UA 3LEGA 3MFCA 2R041 2DUQA 2SLIA 4JDNA 2ARAA 3SISA 3ZXGA 1CZSA 1AJKA 3DKQA 5EYXA 3I49A 3VBFA 4G3YC 2Y26A 4UW4A 2Y0IA 3NJVA 2KD7A 3U0ZA 4PQ9A 4QPGA 1NE4A 1QDOA 3H3LA 4QPYA 5EV7A 1OFSA 3AYDA 5JZGB 3DKWA 4LK7A 3QBQA 3VHOA 3WDUA 3TEXA 1PIV2 2JE8A 3KVAA 3VZKA 1H30A 5FP4A 5KHGA 1HQWA 1PVC1 1Q8VA 2P3KA 3T2PA 2VCMA 3S7IA 2VVEA 2GAUA 1A8DA 4OHWA 3FFZA 1XRUA 5FZ8A 3FJSA 1LOFC 1U0AA 2KR2A 5L9RA 1PVC2 3IN9A 2P2KA 2VD7A 3MW2A 4W6XA 1ZZ6A 1PGSA 3HWJA 1WKYA 1H9PA 5EJZB 1RIRA 4PDWB 2YPDA 3UJOA 3WCRA 2WT2A 2W95A 4N8MA 4AVSA 1XU1A 5IW0A 5BNNC 1W0NA 2D40A 1QJY3 5FY4A 5EHDA 2P3IA 4XURA 1GOHA 1Z0HA 2K9ZA 3ZFFA 1YXWA 4K3UA 2V09A 3OYWA 3ZXDA 5IHRA 4BYYA 2ADEA 3NV3A 1WMEA 5LEKA 3X29B 1YQCA 4AEDB 3MPBA 3WF3A 3BTZA 1YWKA 4E8CA 3WF4A 1ENQA 2E63A 2JKXA 2NPIA 2WA4A 2WN2A 3CDZB 2JE9A 2X8KA 4QXHA 3WW1A 5C33A 5C6CA 2Z2SB 5ACA3 1OKOA 1O8PA 2A3YA 1H4HA 2RS33 5ANQA 5AVAA 5C4WB 2I07B 4Y20A 1PGW1 4BXFA 4QX2A 5FPLA 3ZYHA 1DQ5A 2D6LX 3LOBA 3H3UA 5DZEA 4HZFA 4ASKA 3MDPA 3LEMA 3PNAA 4HPKA 5K9YA 1VJ2A 4PCRA 2WLPA 2GH2A 5A3TA 5I0UA 1SMVA 3WHTA 5LZ6A 3ZXFA 3RZLA 4K8RB 2WZR1 1V9U1 1WGPA 4XXPA 1S0BA 3VBHC 1PGW2 2VOXA 2PELA 4HETA 2Y0OA 1G9AA 4OUSA 2ZGQA 2ZX2A 1RMU1 4U2AA 2WBKA 3J26N 3B02A 1F4HA 1JUIA 4JHZA 4OHVA 5FZHA 4WM8C 4IE6A 4QXBA 1CIYA 4JDMA 5LW9A 4ZU7A 2WZR2 1V9U2 2GN7A 4NAOA 2PLV3 4BE3A 4NIIA 4IEOA 5DQ0A 4KI5M 2P34A 4R9AA 2AGSA 2R30A 4Y24A 3LD8A 2Q0AA 1RMU2 5LA0A 3OBRA 4YZ3A 5FZ7A 1VBC3 2AC1A 2YYOA 5F37A 1N3OA 3M3IA 2Y6HA 3ZO0B 3OUJA 1RUJ1 1JYCA 3V0AB 2XJVA 3OD0A 4D6SA 2WFPA 4BJ0A 2QQPA 1WCUA 2R7EB 2PTMA 4UFMA 1H2LA 2JXAA 2XKOA 1X9TA 5G04L 1FMD1 4PIYA 1O8SA 1BKZA 1RUJ2 2YDEA 2GP5A 3B3QE 1VBB1 2PQSA 2HWB1 3A23A 3NNFA 5AVPA 3WF0A 5FZBA 4AQTA 3QCWA 1WCDJ 1YYNA 5FUIA 2NZ9A 4NIHA 5I0RA 5E1RA 5A6QA 5FY9A 2BPA2 1WD4A 1C5HA 3K3NA 4M01A 2OQ7A 1FMD2 1UOFA 4E9KA 2W2IA 1FV2A 4UFKA 4XFAA 2JG8C 1OLQA 3L2YA 1VBB2 3LFIA 4BIOA 3U37A 4HVQA 1AYN1 2A1XA 3CJIA 1MACA 5ANNA 4NRMA 1QJU1 2VVDA 4XYXA 1AX2A 1CAVA 3OBTA 3ZXKA 5K8SA 1ALYA 3RZMA 4RGAA 3WG4A 1H1AA 3LPGA 3B9CA 3E6DA 4GAZA 2D97A 2XKPA 1E5SA 2Q8DA 1H1IA 1AYN2 3AC0A 2D6PA 1B35B 3OGGA 1O4ZA 4BZ4A 4DINB 1QJU2 1F5FA 4OHXA 4NO4A 4CU8A 1KFXL 3S5QA 4IV3A 2VUAA 3CL1A 4YG3A 3O1TA 2EA7A 4UF0B 3I3EA 2DFCA 1NOVA 1NAEA 4PLOA 4YZ5A 3THTA 3ZKYA 3J4UH 1AR93 1LOCA 4P00B 3RPQA 3M3OA 1PM4A 4MHRA 1ULCA 2XJQA 4RS5B 3AKSA 3G7DA 4YGBA 2F4LA 5ABJB 3UGFA 1OH4A 3VZLA 1CPNA 3CU7A 1LHWA 3WCSA 1C1LA 2P6CA 1W9WA 3S6PA 1QOTA 2WQ8A 5BNOB 4EZHA 2CNAA 1Z7S2 3SC7X 4KMQA 3ZX7A 4XJAA 1CX4A 4LKSA 1WCKA 4LO5B 3AP5A 3GDBA 1BVVA 4R9DA 4FVVA 1UYPA 1FOD3 2JDKA 3A0KA 3KCYA 2JDHA 1WBLA 4IV1B 1JTZX 4LOTA 4YZ1A 5JPMB 4XQWA 2GMMA 1K42A 3DPRC 2Q8CA 2HWE3 1H8VA 2VBBA 1GZCA 1GOGA 2EVXA 2QCSB 4CCKA 2EICA 4CU6A 2WAOA 3LQCA 2DBIA 3NJZA 2W39A 3H7YA 1H2NA 4IERA 1RUH1 1MEC1 4C0BA 3FLPA 5L19A 2VW2A 2BVVA 1NQJA 1RC6A 1C8NA 1V6IA 1W28A 1W9TA 1UY2A 2BTVC 1H2KA 1TEIA 1U12A 3GJBA 1S0GA 1GV9A 3KQRA 3KZ4C 1WW5A 3LDRA 2FQPA 5BV6A 2FMYA 3MIDA 4QHOA 1RUH2 1MEC2 2ILMA 5DAWA 2FDHA 4CP0A 1MS0A 2RJ2A 2VC9A 3MF9A 5FYVA 3D0JA 5FXZA 4XUTA 4Y3OA 5IVVA 2WNEA 5CYYA 1I3HA 1V0AA 5M0TA 2ZGPA 4L0PA 3WY6A 2QBXA 3NL1A 3H0OA 4IEWA 1Q8QA 4KGGA 4YVWC 1UCXA 5H9RA 2QDRA 3ES4A 5FY7A 4JDOA 1H6XA 4QPIB 3N9NA 2LUWA 1S2EA 3WNPA 3NKTA 3J7NA 1HV0A 1ND2A 2MNGA 3ZN6B 4Z2WA 4LITA 3V64A 3MUZ1 5CADA 4KBZA 4DUVA 5A6YA 1LEMA 2G1MA 3POFA 1YJLA 1X50A 1W03A 3ZSJA 5H9PA 4B4PA 4BQ3A 3ZYPA 3LA3A 3AKQA 4DB5A 1WCSA 2OUJA 5A3UA 3UGHA 5ERLA 4ZXKA 5JOYA 2ZX0A 4LBOA 1Q3EA 3MIEA 3WDTA 1O6UA 2VZRA 2NMNA 2RE9A 1HN0A 4K20A 4Q4X1 1DZRA 3ALQA 4A6SA 4ZPIA 1SQ4A 1UN1A 5FZ9A 1ZZ7A 3VBRA 5JPNB 1M06G 3ZXAC 3WG2A 3S30A 1RUC3 2UWBA 1AR62 2ZOEB 5HCAA 4Y1ZA 4P9XA 1JYXA 4XTMA 4Q4X2 4ZXEA 1SHWB 2EAKA 3GYDA 4IEPA 3ZFEA 3IBMA 4EN7B 3FHAA 1CAXA 2R49A 2ZTNA 1S0EA 2HBTA 1QNYA 3VD4A 4HKWA 4LNVA 1PIV3 2YC4A 1X82A 2K2SA 2VULA 2R043 3HOBA 2XWBB 3SMHA 5EXOA 4IXLA 3VDDB 5FYYA 4P5HA 3SEEA 5CFDB 3K3OA 1OFNA 3I4IA 3LSDA 1ASJ1 4CUAA 1CESA 4K9SA 2I45A 4LLFA 4JRLA 3WNXA 5K4LA 1CX1A 2UY9A 2WNVC 2ZGRA 2EXHA 4LO6B 1DQ1A 2ZZQA 2NP0A 3KV5A 5FMOL 5JIAA 2UY8A 1ZZ9A 2QZ3A 2WNUC 4QB2A 1PVC3 4NHLA 3BUCA 1ASJ2 1ZM1A 1JYTA 1OA2A 1UZVA 3NW4A 4XBQA 5DN2A 2VMFA 3NNMA 1DGRN 1NUKA 3FN9A 1O59A 2YC0A 4M3CF 4CUGA 2GC0A 4PJYA 4CDWC 3SQOA 2BFUL 1XJAA 1FX5A 2UYBA 4RL7A 3QLQA 3N7MA 5A33A 4NUBA 3VBFB 4YG6A 4I0BA 3ZFGB 5A1LA 4HLTA 4OQ8A 3DXTA 3KF5A 3N9QA 4BQWA 1S0DA 4KNCA 4F8AA 2DBNA 2R1DA 3ELNA 4A4AA 3GGLA 1SLCA 2IFWA 2WWSA 3LDBA 1PZ7A 2GMPA 4P9GA 3PTRB 4V2VA 2IXIA 1UL9A 2P1BA 1Y43B 3PLQA 4XXAA 5FWJA 2DUOA 5T3NA 3RRDA 4OI2A 2OZJA 2O8OA 4MXVA 5LBBA 4AI2A 4Y22A 2CWSA 3B5LB 1HDKA 1R1A2 2ETEA 4Z82A 4DIQA 1W0PA 2V4VA 2ZGSA 3BTYA 4GWIA 3USSA 4QX3A 3T08A 5A32A 1ZBE1 3CZJA 4YGCA 3WW3A 2PHDA 3IM0A 1UZ0A 3BOWA 4YM0A 2KA3A 4XFIA 4E2QA 2PA7A 3CNAA 4CEYA 1N1YA 5J36A 4K40A 3P6BA 3HBZA 2WA3A 5F2WA 1UZYA 5L7OC 1Y7BA 1BMV1 2PXJA 4C1WA 4FOQA 2QDNA 1ZBE2 2XQRA 2QQLA 2W68A 5IFPA 3I59A 4QMAA 1ULGA 2DF7A 4O9GA 3MFAA 3WD5A 3DF0A 1UO9A 1O5UA 1W6QA 3HT2A 4K7JA 1EUUA 1CAWA 5BNPA 3WXPA 5JI7A 2HEVF 3ZFFB 1BMV2 3B94A 2RDQA 3D5OA 3LGRA 4H2AA 4NVPA 3OYWB 4R8HA 4UT5A 2F6BA 2IVJA 3K46A 1Q8SA 4Y5TA 4OQ9A 3WG3A 2WZR3 1V9U3 1S0IA 2XGXA 3CF6E 5FV3A 4AVCA 3BPZA 5A7QA 3P3PA 2R061 3PJQA 4JKKA 4HSJA 4L11A 1A78A 2Q1MA 1RMU3 5GZFA 4RQPC 2JWPA 4XMIA 2D6OX 3WDXA 4ZHNA 3IDEA 3GM8A 2OA2A 4META 3VD5A 3VKOA 3TYJA 5IAVA 3POIA 4G4FA 3VZNA 3UKVA 2R062 5F5IA 3F2ZA 4Y20B 2B7YA 1JHJA 5B4XA 5GZCA 1NCRA 5FP7A 4QGMA 2W1SA 2B9VA 1UX7A 4PI2A 1QJZA 1J3RA 2YMZA 2LS6A 3E6BA 4MUVA 2A6VA 1RUJ3 3CIHA 4UFJA 4AEJA 2WKKA 4BQYA 2ATFA 4FOYA 5GZEA 1KS5A 3PU8A 3WUDA 2P3JA 3MEPA 5IYYA 3I54A 4UI9L 3NV2A 4EN8B 4BIFA 2VGDA 1CAUA 1A8MA 1MQTB 1W2UA 2G9GA 3MI8A 4IEQA 1SLAA 1HB3A 1NY71 2TEPA 4QM8A 3ILRA 3PL0A 3ECQA 5E8AA 3ZVXA 4FPFA 1VBB3 3NAPB 2HWB3 3O1SA 2OVUA 4CUBA 4FT8A 1JU4A 1QIQA 1JODA 3KSCA 5C5TA 4HVOA 5GLVA 1RUE1 3VL9A 5A3NA 1D4M1 3OSDA 2WT0A 4XUOA 1SFNA 4FTSA 4BOWA 1NY72 3P3NA 4MYEA 4O9EA 4QHBA 4CDUA 5CFCB 1PO11 1VIWB 2VOVA 1ZRCA 2ZHMA 3JU9A 2Y6KA 4DEQA 3ACHA 2UWCA 1AYN3 1ZRIA 4PLMA 2P5BA 3MF6A 4JHTA 3ST7A 5C3RA 1QJU3 4RYDA 1RUE2 1VMJA 2BU9A 3KT4A 1D4M2 1VBC1 2Y6LA 1BLZA 1GNYA 4NPRA 1W05A 4FP2A 3E6CC 4FPOB 4ZS2A 1PO12 2NYYA 1N3PA 3O1OA 1LHUA 4DZGA 1L7LA 2EXKA 2UU8A 5FZOA 5IWFA 5LK5A 4QU1A 1NA1A 1TQ5A 3O5SA 4XVHA 4FCAA 2XLFA 1VBC2 2FZ1A 4L2NA 1NYWA 1SLIA 4OMCA 5FOBB 4LUMA 1JS9A 2PHFA 5A7PA 1JI6A 2CAVA 2QZ2A 5FP9A 5A70A 2WYSA 3M3CA 4JGYB 5CKNA 5C4WC 4IGQA 5FY0A 4QGLA 4GB31 2X05A 5FXVA 2WZPP 2VMHA 4I30A 3ZR6A 4C0HA 1LECA 4QX5A 1OF3A 2JECA 3POBA 4NHYA 4QB6A 3KD4A 4LHSA 4B4RA 1DDLA 3WV6A 2D98A 3R0RA 5LWBA 1OSGA 1SBEA 4RN5A 2HEWF 1KXGA 2A6ZA 2QQWA 4IEYA 4IGPA 4LKFA 1JHNA 1K45A 2X5IC 1POV1 3KHCA 3UKTA 3RZHA 5I8TA 3T0BA 3W59A 5FZAA 3WR0A 4HT1T 1STMA 1OLME 5I0SA 1U5ZA 5KC5A 3LPFA 3J7LA 1NCQB 4N53A 4Q4W1 2ZEYA 1UKRA 1RUH3 1MEC3 1JH5A 5FPVA 5CAZA 3HPNA 3RZJA 3MW4A 2EIDA 4XIKA 2QQOA 2C9KA 3PMEA 4NROA 4YLZA 4Q4W2 1G6NA 2RM23 4I09A 3U4XA 1S55A 3PVEA 1LJ7A 1K5MC 4XHBA 1UYXA 1VALA 3CMGA 1IKQA 1IQAA 3ETPA 5DUXA 4L9BA 3JZVA 5FLJA 1ZRRA 1ULEA 2PN5A 4BK4A 1GU3A 3FUQA 4TYSA 5FAXA 5FMDA 5FQ0A 4QM9A 1MR5A 1WD3A 2A3WA 3SNMA 3AVSA 4AFAA 1GWKA 1WMXA 3OUIA 4QT6A 4AW7A 5JXJA 1F4AA 5J09A 1G9BA 1UMZA 1Y9QA 4OMDA 5E89A 4XJZA 4XZUG 5F2SA 1ZREA 3I2FA 1GZ9A 2C26A 3IDAA 5FRAA 2O14A 3KWVA 4A45A 4EQVA 5I0DA 5KXEA 3UK9A 2D6KA 4YVSA 4MGKE 1QMJA 4Q5OA 2BW8A 4XACA 3GZAA 1CPMA 4XJ8A 2VVFA 4XCBA 1XBFA 1WLDA 1N1SA 4INDA 4AQSA 5F32A 2VL4A 3POYA 4EYUA 2V4AA 4OYUA 4BMBA 4N43C 1CR7A 4AE2A 5J37A 4COYA 3ABZA 3Q8EA 1AL0G 2YBKA 3N7KA 5H9SA 4A6OA 1ULPA 1KQRA 4H3WA 4JX0A 4Q4X3 4KU8A 5GLZA 5C3OA 2YG0A 1C3HA 3ZN5A 1AX1A 3THCA 3EXUA 4IUGA 4E2SA 4EROA 3GCXA 2R071 3U75A 3U10A 4B7KA 1JMUB 3AMQA 1ND2B 3C7EA 4GKYA 1QXPA 5AC91 4WVMA 1O5LA 4O65A 2CWMA 2DVDA 5KHKA 5FYSA 2H0BA 1YFWA 4EV0A 5ABJC 2YGMA 4RD7A 2EXJA 1W6MB 2UYAA 2R072 1XSRA 5K7PA 5AC92 1I5PA 3HAGA 1YIFA 4OI4A 4CDQA 2W1QA 1U5XA 1E5HA 2FDIA 4AGVA 1PVXA 3ASIA 1KFUL 3N9MA 4YGEA 1LOFA 2GNDA 3ATGA 3KV6A 4I01A 4XFGA 1BEV1 2ZMLA 2CDOA 3TOJA 3FBMA 3JB4C 3NKGA 3I2OA 1QGLA 2H6BA 5LBCA 3B01A 5FXWA 3PUAA 1ASJ3 4ORFA 4PF5A 1S2BA 4IV1C 5C7GA 2PHXA 3UETA 1JZ6A 4IDZA 3AKPA 3ZYBA 5F3GA 5C70A 1RL3A 3D6EA 4AHZA 5BNNA 1BEV2 2BGPA 3CHXA 4XE9A 1W6OA 2SBAA 1WW4A 4JVAA 3U1XA 2C9AA 1ULFA 1YQ6A 1QU0A 3OCPA 2HH9A 4DEVA 3ZMOA 5F39A 4FAHA 1GYKA 3MZHA 2XPJA 4RFT0 4GH4C 3LB9A 3DN7A 4M00A 2BBAA 2DYCA 2QFEA 4QDSA 3Q8AA 2GNBA 2J1AA 3HNYM 1SPPA 4XFHA 1OOPC 5FZ0A 5LBFA 4JAAA 3KV9A 4D7SA 3PVBB 3N9PA 2WFF1 5FZFA 2XONA 2WQZC 3J8F1 4C90A 2Q8OA 3M3EA 2JB4A 4B8EA 3APBA 3N4MA 5CA6A 2W0XA 2ZGOA 3IDCB 4ASMB 4AVVA 2N7GA 3B7MA 4YW2A 1BCXA 2RR11 3WZ1A 1QY4A 5CNAA 3WQ7A 2B8MA 3MIFA 2WFF2 2ZGLA 4QPIC 4DXTA 3J8F2 4S2DA 1DYOA 4PQQA 5LA1A 1RHI3 1LR5A 1ENRA 1FPN1 2IWGB 5FZEA 1ZBE3 2R042 4FPLA 1GBGA 4PBOA 4CXYA 3A22A 2RR12 3E1F1 4R4ZA 3SITA 4TN7A 3VBHA 4HK8A 1AX0A 1IS5A 2W92A 3IPVA 4UW6A 2ID4A 3U11A 4WVWA 1N1VA 4CDQC 2WS93 5C3SA 2B9UA 2VMGA 4MOAA 2DCTA 3T4HB 1DZTA 1FPN2 1V00A 2XJPA 4WM8A 3O12A 3O1VA 4KH9A 4M4RA 1E5IA 2BBVA 4OHYA 2WC2A 4J1XA 1W6PB 5FPUA 2QVSB 2ZX3A 1RVF1 1OQ1A 2ZGMA 5A7WA 4AFBA 2DTYA 3MV11 2HYXA 4QQLA 2D6NA 2WIIB 3O1PA 4FTBA 1D0GA 5A32B 1XYPA 1IQDC 2GC2A 3ENRA 2JJ6A 2R063 2LW8A 5DG2A 3WDWA 2BNMA 1XPWA 4FFGA 1IPJA 1RVF2 2FMDA 2RV9A 4WVVA 1W06A 3LKJA 3KCCA 3O14A 2QQNA 2B39A 1QJEA 3WNNA 3KF3A 3K48A 3VKLA 2JDPA 4LPLA 4SBVA 1W2TA 1YFYA 4ARYA 3I59B 1MS9A 2JDZA 3FZ3A 3K4ZA 4N7UA 2XMLA 4D6RA 4M3CA 3AX4A 1W6QB 5C9AB 4E4ZA 5BNPB 3H3ZA 2XVLA 4BPZA 1RUNA 5CFDC 4DO0A 1LULA 1QOOA 4LO8A 5EQUA 4DUXA 4AQ6A 2ZXQA 1ZVFA 4NIAA 4LMFA 2JG8A 2UWAA 3HIFA 2RG4A 4YFZA 3DGTA 4KL1A 1ZNPA 5JSOA 3JXSA 1VE0A 4K6BA 1H8TB 1VMFA 1V6MA 3PHMA 2X53S 5FP3A 5A1AA 2A73B 3RFRA 1EUTA 1G9DA 1W2OA 1DBNA 2FBEA 4UW3A 4YG0A 4EZ4A 5IVFA 2ZACA 3ITQA 2A5ZA 4YM2A 4AI8A 1XNBA 4BU2A 1LKNA 3ACLA 1YQ2A 1RUE3 5CBLA 5T55A 1D4M3 1NCRB 4NR1A 4FFFA 5GLTA 3VBUC 4FPJA 5IAXA 4DRVA 3VDBA 2IXLA 3WDVA 1PO13 1JOJA 3ZFGC 5IVYA 1RUOA 3F95A 5CU1A 1SLBA 1OVSA 1OPOA 1QF3A 2VM9A 2ORZA 3SH4A 4A7KA 3RZKA 1O3TA 2TUNA 4WM7C 1GWLA 5GZGA 3MGUA 5FYIA 2IFRA 2JD9A 2XLGA 3M2MA 1CAUB 4UWDA 1UOBA 2AH2A 2RDSA 4BQ2A 1COV1 3B9IA 3AMHA 3E5QA 1AR81 4QKBA 5IVCA 4UFLA 2HWF3 4YW5A 5LA2A 2VCCA 2C24A 5A7OA 3W5MA 2CTVA 1WMFA 4D8MA 4R9BA 1R1ZA 1URXA 2HEYF 2YZ4A 4LT5A 3Q9OA 4M3CE 1JOPA 2X10A 1V6LA 1COV2 4DXSA 5JMOA 3IB3A 1XSQA 2RMU1 3MUY1 4AVAA 1AR82 5A6XA 1J84A 3ILFA 4QDQA 4HN0A 2ARCA 1VBA1 4FAGA 5DZFA 2XVKA 1I1EA 3DPRA 4Q0PA 4I0AA 1TE1B 4GB33 3FL7A 1S2KA 1TME1 1WLWA 2ZAHA 1OT5A 1KDMA 3K4DA 4Q8KA 3BB6A 1MZ6A 1YQ8A 1BXHA 2BWCA 2RMU2 2HWB2 3H1WA 4LQRA 5DAQA 4D7TA 3QD6A 1VRBA 1L3JA 2W1UA 1VBA2 3WP5A 3JCIA 1FV3A 2HLEA 1NA1B 2GNTA 1GOFA 1TME2 1UF2C 1J83A 1POV3 5FOJB 1W8FA 3QACA 4PI0A 4OI1A 4JV4A 4DQAA 4FOVA 3C7HA 2AYHA 2ERFA 3M1HA 4FFHA 1GANA 4AG4A 4XFFA 4FBFA 1S4CA 2YHJA 4IW3A 5HV4A 1NE6A 2WINB 3LZZA 2D93A 4Q0QA 2WWJA 2VH9A 3PIGA 4Q4W3 5GALA 4YVWA 1DGLA 3GZEA 5JAXA 4CEWC 1PO21 2D3RA 2YXSA 4K8FA 3HN3A 4KWJA 3VBOB 4GIQA 1UY0A 3LE0A 4XF0A 3AYAA 2EXIA 5FYMA 4YW1A 2WNOA 2XJRA 2OXBA 4NOTA 5F8PA 4Q27A 3THDA 3CJXA 4CXWA 3QOPA 1AYM1 4LHKA 3UV9A 3AMNA 5I91A 2HWD3 1O3SA 4CU9A 2FCTA 1J1LA 4I02A 2EIEA 1CJPA 2J1RA 4UAPA 5LATA 3CBNA 4Q0SA 1ENXA 1MQTC 2AENA 4U36A 2HWC1 1PK6C 1AYM2 1QJX1 3NAPC 1XYNA 2GC1A 3NV4A 4ZONA 4LHNA 1DG6A 3SCFA 3MLKA 4XTPA 5IK7A 4N53B 3IIIA 3ZSLA 1F2NA 5JXGA 4IGOA 1K3IA 5HCHA 5I8YA 4Q1PA 1ZYBA 3UYJA 3IAQA 5CFCC 1GP6A 2JG9B 3VBSC 4P02B 5HPOA 3TAYA 3ACGA 3AMMA 5DAPA 4OFGA 3W58A 1SCRA 4RR3C 1LEDA 1SCSA 1HRV1 2VBPA 3SKVA 3JUUA 1REDA 2VJXA 2E31A 1GP4A 1K5JA 2H6CA 4KGQA 1RXFA 5D8AC 1DQ2A 2BERA 3GALA 3T30A 5L73A 4CE8A 1G9CA 2RM21 4CCDA 3DXUA 1QWRA 1EP0A 1V6JA 1Q8OA 4LUKA 4Q4Y1 5FQ0B 1LODA 2GNMA 2JICA 2PHRA 1LCLA 4QQPA 3IT8A 1BVP1 1H4GA 4S2FA 5FO9B 3MV01 1OQEA 2R073 3ZXLA 5JXIA 4OLLA 5AC93 2VNVA 4RSUA 1C4RA 3PUHA 4L92A 5IK5A 2RM22 3M8LA 3BTAA 3K4AA 1XE7A 3VDAA 4Q4Y2 2WNVA 1HJGA 1WW7A 1W8NA 4JGYC 3C7GA 4MHUA 2WNUA 4Y1VA 4Q4V1 3KT1A 4BQXA 2R6QA 2OYZA 1GZTA 4J1WA 2RJLA 4MLOA 4XJUA 1OD5A 4FPGA 5FFOC 1PGL1 2JB8A 1Y4WA 3ZYGA 1NG0A 4HK9A 1GICA 4ISRA 4YGDA 4CRQA 5FY1A 4EWAA 1ST8A 2BDRA 2A75A 2J42A 4AYUA 2CSGA 5JI9A 1BEV3 4Y4RA 4AF9A 4BCUA 4CDWA 4Q4V2 1JYNA 5K0UC 1RB8G 2ET7A 2Z42A 5DDJ1 2GU9A 4ZU5A 1XE8A 1YFXA 1AHSA 5I93A 1O4TA 1POV0 5HXVA 2BOJA 1MPXA 1PGL2 4YNIA 2YV8A 2CAUA 4LBJA 1A6CA 1Z78A 1LESA 1A3KA 2PAMA 3HVDA 4WVMB 4ZZ5A 2Y60A 1UY3A 1CIWA 2ZEZA 3H42B 2WN3A 1S0JA 4QU2A 5FJHA 3PUQA 1W8ZA 4LHLA 1DZQA 1ND3C 1NCQC 5FZGA 4A44A 3M3QA 1DU3D 3KV4A 4XUNA 4KG0A 4NPMA 4WV8A 1D0HA 1UWWA 3PMSA 3P5BA 1XE0A 4BISA 2QQVA 2BUKA 2XWJB 3KLSA 4QDRA 5D2AA 2IC1A 1TNRA 2IUWA 1W8TA 1HB1A 4XFCA 3RS6A 1TVGA 1HW5A 3EHKA 3KB5A 1LAJA 1YI7A 3MBWA 4A41A 2VUCA 2WFF3 1VPHA 3IZOA 1G7YA 2GP3A 3AYCA 3J8F3 5FPZA 3VD3A 5FPXA 2Q1ZB 5L7OA 5E88A 2IXJA 4TTGA 2WJSA 2WLQA 1RJ8A 2VQAA 5IFTA 1BK1A 2E7TA 2YFUA 2RS53 1OXCA 2J1VA 2RR13 5BNNB 1W6OB 3UNPA 2ZAAA 3LDKA 1T6GC 3RJRA 3THPA 3M4FA 4TWTA 2DV9A 4GD4A 3V0BA 4ZZ8A 1FPN3 4ES9A 3LA7A 4IE7A 3PJYA 3RWNA 1S1AA 2PQQA 4MGTA 2Q5TA 2QKDA 2Y64A 2L9LA 5DABA 2JDNA 5EFUA 5F5CA 5LCWL 3Q8CA 5H9QA 3FC0A 2W08A 5FZDA 3WX5A 3ZOIA 2XHNA 2JKBA 2VNGA 3KHBA 5JXHA 1GZWB 4RQPA 4AR2A 3UKNA 4LTAA 5F7UA 1O7FA 2WABA 2BJSA 3FHIB 1MZFA 3POJA 3OY8A 1GP5A 3POSA 2WO3A 3DCQA 3HT1A 1UQXA 4IESA 2VZPA 1RVF3 1X33A 2ZABA 4QPGB 1UPSA 1C1FA 4CDXC 4CCCA 1OUSA 2CV6A 4Y33A 3GBWA 4E8DA 3T4VA 1EAH1 4DY3A 5LB6A 3PVOA 2YU2A 5HV0A 5GZDA 4BB3A 1GQGA 1IPKA 3SKJE 3I3QA 4COVA 3OGSA 3VBHB 3AMPA 1H6YA 1LOAA 2QUOA 4IL7A 4JQTA 4E27A 5BY5A 1J3PA 5F3IA 4CP9A 1RHI1 2HKXA 2E33A 1EAH2 4Q0VA 3RI8A 3MIGA 4RHV1 3HMYA 2J7MA 1R091 4I0WB 4WM8B 4YM3A 3BI3A 4LOSA 1VBD1 1DP0A 4HMZA 5FO7B 1QJFA 1FXZA 4AL9A 3VKMA 2VTXJ 4COZA 3WP3A 2GH8A 4OZOA 4BK5A 2VMCA 2PAEA 2W5FA 2WS91 1RHI2 2PFWA 3Q8BA 2D3PA 2G4IA 1YCIA 4KWLA 4XJWA 5C8CC 4RHV2 5A7WB 3TEYA 3TB0A 3AL5A 1R092 5T52A 3H9AA 2WWUA 4AI9A 1VBD2 3NV1A 2BP6A 4JGZC 4OCTA 4XOGA 2GDFA 3KS7A 5FDBA 3K77A 4A7ZA 5JWPA 2WDBA 5EJ1B 2WS92 1UY4A 3G6JB 4L99A 4XF4A 1RUD1 5A7NA 2ZHKA 3QH7A 5IJRA 5L9BA 1LNSA 4DFSA 4QKFA 5EJ3A 4CCJA 4CTEA 1APNA 4AGRA 4XQ4A 5JSRA 2P6HA 2P4EA 2Y33A 3K75B 3UGGA 1UMHA 1HQLA 1MS8A 4TSVA 2K0GA 5KBFA 1ODMA 1LHOA 5A6ZA 2QNKA 3GBFA 3D3AA 1RUD2 5IT6A 5FBZA 2XJSA 1N3QA 4FXKB 4CP1A 4HKOA 3WQ1A 2BQPA 4B3NA 1PNGA 4GWNA 2CYFA 3T3YA 1F35A 2QQJA 2JG8B 2Y8KA 3AL6A 4UFIA 4MSVA 3U14A 4B7EA 2P37A 4QXKA 5FZ3A 1CZTA 3MW3A 5C4WA 3VKNA 1UU5A 2Z69A 4HPKB 1WA4A 3HEIA 3H50A 3T1LA 1EPWA 2V73A 1DFQA 3AP6A 4LO4B 4PIZA 5JZGC 2B5HA 1COV3 3ZXEA 3ACIA 3H1MA 5BNQA 4W8JA 1DHKB 1AR83 3OB8A 2AR6A 3LEIA 1BJQA 1ZRDA 2OUHA 3B69A 2CY6A 3LIHA 4XF3A 1UKGA 1L7QA 1W9SA 3JQXA 4F7ZA 2X5IA 3W20A 1PZ9A 2DTWA 3ZYFA 3FHQA 3EO6A 4NMIA 2QQIA 2RMU3 5J3UA 2Y38A 4AQ2A 1UOGA 5FUPA 4BHPA 2R0FA 1VBA3 3VLBB 3TEZA 4XABA 1UXZA 2JX9A 5JVVA 3WQ0A 4MGSA 2DWRA 2K46A 1TME3 3MO4A 4N9IA 2EIBA 2TNFA 4P9IA 4CCMA 3POGA 1OLMA 4PDWC 3WOGA 5J98B 3T0AA 3ZPYA 1XQNA 2J1UA 1IS6A 1NXD1 3J7MA 1W04A 3H8RA 5GM0A 1SACA 2NMOA 1OHFA 1G8WA 4HBNA 4ONUA 1W2NA 1Y9MA 3SXWA 5KR7A 2R0HA 4JTOA 2VW1A 3V0AA 2E26A 4WVZA 3BALA 4LO7A 4IQPA 1OPMA 2W94A 3R4UA 1K5MA 3E5XA 1NZCA 1U5IA 1MS4A 2ZMNA 1ZA4A 4F3JA 1GWMA 2HWF1 3H8UA 5T5PA 1JXNA 1SFPA 2GZWA 1VB4A 2Q1FA 2HYKA 3RDIA 2G9FA 4AEDC 1WW6A 2YBPA 3LEKA 2WO7A 1M4WA 2XOMA 1PO23 3D8CA 1PX4A 2GN3A 3OGJA 3QH6A 2E53A 2VMEA 3I7DA 5C9AC 2P17A 5FMOS 2D44A 3RZZA 3WP4A 2XUEA 1NLRA 2VOKA 1ZBA1 2HWF2 3DYOA 4R52A 5B2GB 1HXS1 4A2UA 5BYNA 3HQXA 3CJIB 2WRAA 2IVIB 1AYM3 1CAVB 3C7FA 1OI6A 3NO8A 4UYBA 3T2OA 4CCLA 4AVTA 3SLIA 1H8TC 2VMDA 5BPXA 4QQOA 4QXCA 3H7JA 2BFUS 3O1UA 1D2QA 5DPNA 1UYZA 1ZBA2 2VTFA 3E5UA 4LKDA 4D94A 2VQ0A 1HXS2 5FY5A 2Z5WA 3MLLA 2HWC3 2ZCWA 3SEPA 3WHUA 3H8OA 5D21A 2PHWA 4GB32 3N3HA 1QJX3 4OVEA 2ES3A 1OUXA 5FZIA 4IV3B 3I3DA 3I3BA 4N43A 3AVRA 1ZZCA 1NXMA 3WW4A 5JDBA 2XB6C 1LHVA 2ZGUA 4EJRA 1LRHA 1S0FA 3BIWE 3RQ0A 1N47A 3USUA 4HANA 4UF0A 1UMIA 4TLFA 1KITA 4Y1UA 2XL9A 1SBFA 1AXZA 4XILA 1SLTA 3EB7A 3IAPA 2YU1A 3LIGA 1SBDA 1HRV3 4CZSA 4AI3A 2WSVA 4DNYA 4NIGA 2VY0A 1BK0A 1ZZ8A 3R4SA 5ABJA 4IEZA 1BBT1 1YUDA 1QQP1 3PUSA 4RA0A 2VU9A 4L8QA 4YSFA 1ACCA 2Z79A 2F4PA 3M7AA 2HWD1 3J7HA 4KQ7A 1SFYA 3EBRA 4Q4Y3 2YROA 5LBEA 4WZFA 3TNQA 1QH7A 3P1IA 1GQHA 4GWJA 4QX8A 5KWRA 3S5AA 1BBT2 5FY8A 2CL2A 1QQP2 5F6LB 4RGGA 4DPNA 3ORJA 2XUMA 1RYYA 4X6QB 2WYFA 3ZYJB 4B4QA 1X8MA 4IV1A 2HWD2 5FZ4A 3C8XA 3BN6A 5FLHA 4H7LA 5A3OA 5L9VA 2BV4A 4EN6B 4COUA 1LHNA 4Q4V3 1CD3G 1OMIA 1DQ4A 2PHLA 1POQA 1REEA 5FK7A 1V6NA 3GF6A 1OLRA 5FYBA 2BOIA 4P08A 2MEV1 2VZTA 2A6WA 3AK0A 4GH4A 3JBG1 1Q43A 1JYVA 2ZX4A 2ADDA 2R32A 2RHPA 3HNMA 5DDJ3 1OOPA 1GQPA 2JIJA 2MEV2 1RGSA 1YHFA 4IEXA 4XCAA 1PM7A 5A3PA 3JBG2 1B35C 1GSLA 1RITA 2R16A 3MHZA 2VOWA 1A34A 1KS4A 3OUHA 5C5UA 3OBAA 2Y6GA 3VGIA 1AVBA 2A71A 3WF2A 4C91A 4FQZA 4R4XA 4FO9A 2WNUB 3WDYA 4Z1VA 3VBOC 2LALA 4QPIA 5LK7B 3MICA 3OOXA 4XW3A 1JW6A 4RS5C 3VD9A 3BIEA 1RUG1 2I74A 3OF1A 3VHNA 4HKLA 1AUYA 2YFZA 2A70A 4FPCA 4CP2A 5C3QA 1UNBA 1IHMA 2HBUA 4XDQA 5BNOC 2BGOA 4LBMA 3ZSKA 4CA9A 4R9CA 4NHKA 1RUG2 1VR3A 2V5DA 1UPIA 1US2A 5FPAA 5J48A 1VAVA 3NMBA 5F1RA 1CONA 5A3MA 3GJAA 2ZA9A 1IPSA 4ITCA 4UXAA 3TRSB 5FUNA 3VBRB 2VAUA 4AXOA 1KRIA 2JDMA 1AL23 3DEMA 3MIBA 1EV11 1SZBA 3AZVA 1YQ5A 2JG9C 1GNHA 2DVBA 2JDAA 5F5QA 5JIUA 2R1BA 5FBJA 1W8HA 2BNOA 3JD71 3ZFEB 1C28A 3ZMNA 1CAXB 1JZ7A 2DCZA 1PZ8A 3EJKA 5FXXA 3AM2A 3UESA 1O4YA 4MADA 4ZY9A 2D5FA 1EV12 2VE1A 1F15A 3NVCA 4XAAA 1YC61 2DUPA 2OKXA 3Q8FA 4XHXA 2W1WA 1IOAA 1DIWA 3IDBB 1XYOA 1DYPA 3LF7A 4XPVA 3JD72 2ZEXA 4X8NA 4AZZA 1JU3A 1QHDA 2CGNA 1UIJA 1EAH3 2Q4SA 4NHMA 2PHTA 4XJ9A 5CFDA 3V0BB 2RS51 2CGPA 5DAVA 3NQHA 1W3VA 5DZGA 3BU0A 4XDOA 2NM1A 5KC6A 5DG1A 2VO5A 5IK8A 4IEUA 3HBKA 4RQPB 4RHV3 5C3PA 1DQ6A 5F9TA 1CZVA 1R093 2RS52 3FWEA 2VR4A 4X8PA 1VBD3 3FLRA 4BLJA 2E9QA 5LY1A 3OY8B 1DF0A 3TNPB 4HN1A 4ZU4A 5A33B 5J7MA 3FMGA 3OTFA 3N36A 4N9HA 1SEFA 3OPZA 3NRUA 3RYPA 2BYVE 1JBCA 1UIKA 1IS4A 3CO2A 5FK8A 1QNWA 3VBUA 1AJOA 3INAA 4Z92B 3LOIA 4QX0A 5JOXA 1ZZBA 2ARBA 3ZFGA 1FT9A 4YPJA 2NQYA 3HJRA 1XNAA 1KDKA 3LSEA 5KHIA 1WCQA 1WWYA 4QPWA 4Y22B 2AACA 2OQ6A 1RUD3 4WM7A 2BWAA 2JDYA 2W52A 4I3PA 3WQBA 4NWWA 4OZXA 4CP9B 2KM2A 2OPKA 3PTYA 3RYKA 3AKRA 4Y5SA 5JSPA 4AI1A 1IZ3A 4DY5A 2ZPXA 1T6BX 4ET7A 1D7PM 5J1XA 3LWCA 1YJKA 1C57A 3T2TA 5CZKA 1PNFA 3WT3A 5KXDA 4DOUA 4QQ2A 4CEYB 3VUOA 2ZGKA 1QXRA 3LFMA 5C8WA 4AVBA 4PT6A 3PIJA 3KMHA 5GLUA 3VB9A 4BDVB 2YBSA 3HQRA 4MGZE 2LM3A 4URAA 1LOGA 1XNCA 2O1QA 5FMBA 4HL0A 2JE7A 3ZSEA 3I2HA 4K1ZA 5JOWA 4AEKA 1CAWB 3ZYRA 3VDDC 3NNJA 3ES1A 4LIUA 4MGQA 1JZ4A 4UFHA 3MLJA 4AEMA 1K12A 1LU1A 2ZKLA 3A21A 4MXWA 4MGYE 1HKDA 1AR71 4YZ4A 4PIXA 3KQ4B 1O91A 3N9LA 4XF1A 3SHRA 2WUHA 1V70A 5AFEA 4QQHA 3IMMA 2VZOA 2LROA 4ATFA 4KBBA 3KVBA 2MHFA 5A80A 4B29A 5HXMA 4P9YA 1AR72 2CU5A 3O7OA 3RJ2X 3ON7A 3RMYA 4F83A 1GLHA 2TBVA 4M0HA 2JEMA 3R4DB 3CLPA 3VBFC 4IE0A 4AK3A 1VAMA 4QPGC 3ZPOA 4CEWA 1W39A 4GXLA 1YIPA 4XEZA 1G9FA 5FKCA 3FLTA 3WNKA 3IKWA 3K51A 3GHNA 4NN0A 4LEJA 2ET1A 3TBDA 1OD3A 3D82A 1UZZA 1HJFA 1QXJA 4LBQA 4Y26A 5FYZA 4XBNA 4A7YA 4W50A 5EYYA 4TXWA 2VW0A 4EN9B 5JOZA 2X5IB 3CQOA 4LLOA 2VNRA 1RTVA 4PF1A 3RMXA 1MQTA 3PUIA 2DU1A 3PURA 1PK6A 2RS11 2ZBJA 4GALA 4ZS3A 5FZ1A 3NAPA 2QQKA 2ZMKA 1JN2P 1HV1A 3T09A 1EY2A 3V56A 5KHJA 1OKQA 3VZOA 4Q26A 4ISQA 4W6WA 4CDUB 2V72A 1LENA 2B45X 4W4ZA 3ZIXA 4DUWA 4O61A 1ZBA3 2WO1A 4P9JA 2B42B 1HXS3 4FOWA 2RS12 5CFCA 4K21A 3AZXA 3GXUA 3VBSA 1OA4A 1JZ8A 2VUJA 3OEBA 4ARXA 3VD7A 1UY1A 1C8M1 2J22A 4P9WA 4RR3A 3AXDA 5T5LA 1MZEA 4XAEA 3ZFFC 4C8DA 4YZ2A 1OA3A 1K5MB 3S0MA 1HB2A 2DU0A 5D8AA 5FZOB 3RI9A 3O0XA 4NE9A 5FWEA 4C1XA 1ULDA 4AHWA 3OPTA 1C8M2 1V6KA 2AUYA 3A4UA 2WZ8A 3L2HA 3H8XA 2IXCA 4A3XA 3FFQA 3B93A 1WBFA 5DUUA 2DFBA 4XF9A 1RUI1 3WF1A 3AB0A 3CEWA 2ORXA 4HONA 3SH5A 4CPBA 5FZCA 3UL2A 1YRZA 4DXRA 4KU7A 4H14A 1I6XA 3I2DA 1VBE1 3I8TA 1MVQA 3WVJA 4CU7A 1RUF1 1MS1A 2XHKA 3OGRA 5ISLA 4HSLA 2A7AA 4JGYA 1XNKA 1SDWA 2VZQA 3KCXA 2JDUA 1RUI2 1CJDA 1YO8A 2VXRA 3WNMA 1BBT3 3RGBA 1QQP3 1R081 3AZYA 4FPEA 4LJHA 5SV5A 1J3QA 1VBE2 4GKXA 1OBNA 1RUF2 4YWAA 1PO22 3AJZA 4N43B 4G9SB 5FIXA 2XL7A 3AKTA 1V6OA 1CVNA 5GJ6A 5K0UA 3ACFA 4GZ9A 2QE3A 1R082 4JKMA 1GFF2 3USUB 4ZKTB 3AXEA 4M0NA 3HN1A 5FO8B 2GSYA 4ES8A 1F8VA 1HIXA 3ZN4A 1F9KA 2WZEA 5CKMA 5FYCA 3C7OA 4GJZA 3U4SA 2D43A 3E97A 2QQMA 1Z7S1 1NX9A 2XH6A 5C71A 1ND3A 1NCQA 5TSWA 3I3MA 4QX1A 2HWC2 4NIDA 3EYPA 5J96B 4P9LA 3W5NA 1QJX2 2PAKA 5T5OA 2MEV3 2VUDA 3ZM8A 4OI0A 1ZA7A 3VDCA 4O7XA 1P8JA 3JBG3 3IWZA 2WQ4A 1JZ3A 1AXYA 2IXKA 1XB9A 1BQPA 2E51A 4LE4A 5HCBA 1US3A 2WR9A 4JC1A 2BNNA 2W87A 3SCHA 5IVEA 3ZLIA 4GMP3 1DLCA 5D1IA 3BCWA 3VN4A 1NLQA 5FKBA 4IETA 1MS3A 1VRH1 4YRDA 5HCFA 1SDDB 3WW2A 1FNYA 1PX3A 4L97A 1GMMA 2CDPA 2OPWA 3JB8A 1HRV2 3UT0A 5I0TA 1XNTA 5FMCA 2E7AA 2VZ3A 2DVFA 3RWKX 2Q8EA 1UX6A 1Q5OA 4HOOA 2KXLA 1TZOA 1D2SA 1VRH2 2EALA 1GUIA 1Y3TA 2Y34A 3PU3A 2W47A 4LIVA 1DQ0A 1ZRFA 5A1FA 1WUVA 1PMHX 4YW6A 4GH4B 2A3XA 2JENA 3CJIC 1DGWX 1RUG3 4XBLA 4YVSB 3HNBM 5FCCA 4OHZA 3OJBA 1HLCA 3DECA 1OQDA 4QB1A 5IATA 1AZDA 3O0WA 2FDKA 1IKPA 1OOPB 1UD1A 1X7NA 2VG9A 4MH0E 1J59A 3FBYA 2XQXA 1HN1A 1QDCA 2J1SA 4LBNA 2VZUA 1UW8A 2C1FA 3ROUA 2ZGNA 4IV3C 1TMF1 2NLRA 1IGOA 4NPLA 4Z2AA 1U5YA 1TG7A 1FI2A 4OUMA 2ZEWA 4AOCA 5BUVA 3AJYA 4CDXA 3C2UA 3HQUA 4J25A 1W6NA 1F5JA 2W9XA 1DGWA
chains in the Genus database with same CATH topology
3MIHA 1EV13 3GBGA 2VMIA 2ZJCA 1HQNA 5DDJ2 1TMF2 1X8EA 2IXHA 3JD73 1LB2A 4GQ7A 1HRI1 4J6GA 4CDQB 1YFUA 1W6MA 2O0OA 3ZXJA 4AFMA 3TWIA 2Q30A 5T5JA 2D6MA 3HR9A 1EPZA 1REFA 2E7QA 5JLVA 1AXKA 1HRI2 4Z07A 4GULA 4YM1A 3WINE 3ZSMA 1AR61 4D69A 4BA6A 1UAIA 2EIGA 5C8CA 3ME2A 4JGZA 3JQWA 3ETQA 2ZX1A 4AGGA 2MPFA 4XQDA 1G86A 2C5DA 2PYTA 3LAGA 4XZPA 5KXCA 3ILNA 1AL21 5CB7A 4Y1XA 2ZS6B 3NSTA 4LR4A 3DL3A 4DMIA 2RJKA 1YLLA 3TN91 1O3QA 1SLLA 1AL22 1DGRA 3C3VA 1BYHA 4GMP0 4YW3A 4BM8A 2GALA 5CG9A 1GR3A 3TN92 3W9AA 4W6YA 2D7FA 4LBKA 5DUVA 5FLIA 4LE3A 1ND2C 2XBO1 5JZGA 1LGNA 4XMAA 5JCTA 4JQRA 2DCYA 3IPVB 2FHRA 4V1PA 4AFCA 3R6SA 2DVAA 1Q8PA 3O0VA 2XBO2 4Q1RA 3VBUB 4AWDA 4D3WA 3V65A 4W65A 2FZ2A 1R1A1 3VV1A 2ENRA 3SCGA 1XXNA 5GLWA 3VL8A 1IS3A 1KJLA 2XJUA 1JUHA 4K1YA 4MVTA 1W6PA 4WM7B 3L9JT 1LU2A 3VBRC 4PDWA 1AR73 4XIOA 1I5ZA 1JYIA 1E57A 4FPHA 1Q56A 1WMDA 1LTEA 4YFWA 4GWMA 3ZFEC 4JCKA 4YARA 4JTNA 3BU7A 1XU2A 1VB2A 2DCKA 2WSUA 4AHYA 3LA2A 4M3CB 4AEDA 1XNDA 4H7MA 2VECA 4FXGB 3AFKA 1WLTA 5LRRA 5C9AA 3AYEA 2YGLA 4HVRA 4MXWB 4BH9A 1LOBA 3H1YA 3M70A 1KD7A 1QJY1 3BODA 4MZUA 1YNAA 1H8TA 3GHMA 4PLNA 5EWSA 3FE5A 1D4VB 3GZTB 2B46X 1S0CA 3OD4A 4XFBA 3VZJA 3EQEA 2RS13 2NN8A 1QJY2 4LBQD 2I2SA 4BMEA 1H2MA 1ZX5A 2BVBA 4UBGA 1FAYA 4CEWB 4Y1YA 4LULA 4S2GA 5ACA1 1H0BA 3RYRA 4BQ1A 5IK4A 3AZWA 1GNZA 2RS31 3DV8A 2XLAA 4LBQB 3GNEA 1C8M3 4ATEA 2AZ5A 5DUWA 3WG1A 3N7LA 5FREA 4TZDA 3RG0A 4MV2A 1QH6A 4E2GA 1RINA 5ACA2 2EAAA 1EYBA 4OULA 1FMD3 1UU6A 2RS32 2XJTA 5E16A 1PK6B 1BZWA 3T1MA 2JD4A 4LA3A 4CEYC 5AFBA 2XVGA 3A0NA 1RUI3 2OZ6A 4HFSA 4GA9A 3S7EA 4NWVA 3D4KA 3DPRB 2PLV1 1VBE3 3VBSB 3WUCA 1RUF3 3AZZA 4JRAA 4LA2A 1B09A 1RJ7A 1PMIA 3U07A 5KHHA 5BNPC 4RR3B 2ZHLA 2GC3A 5A3LA 2ZGTA 4N90A 1R083 3MPPG 4MGIE 3VHRA 4QD2A 3RNSA 5D8AB 2DVGA 2PLV2 3KGZA 1AF9A 4AHXA 1LOEA 1ENSA 4BLIA 4LBLA 2CGOA 4URTA 4EWDA 4H55A 1ONAA 4DXZA 2DCJA 4FPKA 2V5YA 4MX3A 5CVRA 3LCPA 3RSJA 4IEVA 3ZYIB 5KXBA 4YW4A 4FSJA 1F31A 4ASLA 1B35A 1DYKA 4YVWB 2PHUA 2ZZJA 5L36A 3BOPA 4D7YA 1NCRC 1Z7S3 4AI0A 1CGPA 1NLSA 4I3GA 5LEJA 5F6KA 3VBOA 3UJQA 5BXXA 1YI9A 5JMCA 2ZKNA 1VAKA 1MZ5A 2BGCA 4RS5A 4CYDA 1FNZA 5HBAA 4UW5A 4EN0A 5K0UB 4FQ4A 3VKFC 1VRH3 1CN1A 1KJRA 5BNOA 2E6VA 4WZCA 4FPYA 3WP6A 4EWEA 1C5IA 4Z8BA 3NWKA 4Q8LA 2YY1A 2AREA 4X6RB 4Y4YA 1I9RA 1ND3B 2EF6A 4CDUC 1N1TA 3HD8B 1FYUA 1AR91 1DLLA 3PVNA 2JG9A 4UBHA 1TNFA 1HX6A 2ZHNA 4FTEA 1QKQA 5JR7B 5LRSA 2YUEA 1LGCA 3AP9A 3POWA 1AR92 4P14A 1J58A 1H9WA 4Q2FA 4AFDA 1NA1C 4KG8A 2VNOA 1X36A 3MYXA 1TMF3 3KM5A 4WBBA 4GMP1 3KGLA 4E4DX 1J1TA 3FUOA 5SV8A 5T54A 1FOD1 1WLCA 1MVEA 4S2HA 4DRRA 4QGNA 2WNVB 2HWE1 1UU4A 1CQ9A 3KT7A 2UURA 3FX3A 1HRI3 2OIIA 2QJVA 1FOD2 4I2OA 3ZN6A 4KWKA 4XETA 4SLIA 5DXDA 4CDWB 2HWE2 1O3RA 2A6XA 1AR63 5I8SA 3J9SA 3DUIA 4CDXB 1LGBA 3IIAA 5CIRA 1W6NB 2LTNA 3ZDSA 3N35A 4N53C 1PHMA 3VHPA 2D5HA 5EZWA 2YPJA 3ZIWA 3IMNA 2VPVA 5HI0A 3N7JA 1H1MA 2H0VA 2BEOA 4E4SA 1GKBA 3TN93 5FTTC 2GMEA 3GZUC 2DURA 2IZWA 2OW4A 5L7OB 2X29A 1FATA 2A6YA 5C8CB 4COWA 5GKAC 4JGZB 1VLNA 2O8QA 4Y5Z0 2XG3A 1NQDA 3AP4A 2D3SA 3VDDA 4Q29A 2XBO3 1MS5A 3SH3A 2WT1A 3B00A 4FP3A 1RUC1 1QOSA 1W0OA 3D0SA 3R05A 4YVSC 5T50A 3AFGA 2ARXA 4DS0A 5IUQA 3VZMA 4PBPA 3AP7A 2HJIA 1GZWA 4N7IA 1R1A3 2WL1A 1RUC2 1VP6A 2C0ZA 3URFA 3WLUA 4BWOA 1PIV1 4Q0UA 3MFCA 2R041 2DUQA 2SLIA 4JDNA 3SISA 3ZXGA 1AJKA 5EYXA 3VBFA 4G3YC 2Y26A 4UW4A 2Y0IA 3U0ZA 4PQ9A 4QPGA 1NE4A 1QDOA 5JZGB 4QPYA 5EV7A 1OFSA 3AYDA 3DKWA 3QBQA 3VHOA 3WDUA 1PIV2 3VZKA 1H30A 5KHGA 1HQWA 1PVC1 1Q8VA 2P3KA 3S7IA 2VVEA 2GAUA 1A8DA 4OHWA 3FFZA 1XRUA 3FJSA 1LOFC 1U0AA 1PVC2 3IN9A 2P2KA 3MW2A 4W6XA 1ZZ6A 1PGSA 3HWJA 1H9PA 1RIRA 4PDWB 3WCRA 3UJOA 2WT2A 4AVSA 1XU1A 5BNNC 2D40A 1QJY3 2P3IA 1Z0HA 2K9ZA 3ZFFA 1YXWA 4K3UA 2V09A 3OYWA 3ZXDA 4BYYA 3NV3A 1WMEA 5LEKA 3X29B 4AEDB 3MPBA 1YWKA 1ENQA 2E63A 2WA4A 2NPIA 2JE9A 2X8KA 5C33A 3WW1A 5C6CA 2Z2SB 5ACA3 2A3YA 1H4HA 2RS33 5AVAA 5C4WB 2I07B 4Y20A 1PGW1 1DQ5A 2D6LX 3LOBA 3H3UA 5DZEA 4HZFA 3MDPA 3PNAA 4HPKA 5K9YA 1VJ2A 4PCRA 2WLPA 2GH2A 5I0UA 1SMVA 3WHTA 3ZXFA 2WZR1 1V9U1 1WGPA 4XXPA 1S0BA 3VBHC 1PGW2 2VOXA 2PELA 4HETA 2Y0OA 1G9AA 4OUSA 2ZGQA 2ZX2A 1RMU1 4U2AA 3J26N 3B02A 1JUIA 4OHVA 4WM8C 4JDMA 4ZU7A 2WZR2 1V9U2 2GN7A 2PLV3 4BE3A 4IEOA 2P34A 4R9AA 2AGSA 2R30A 4Y24A 2Q0AA 1RMU2 3OBRA 4YZ3A 1VBC3 2YYOA 1N3OA 3M3IA 3ZO0B 1RUJ1 1JYCA 3V0AB 2XJVA 3OD0A 2WFPA 2QQPA 2PTMA 1H2LA 2JXAA 2XKOA 1FMD1 4PIYA 1BKZA 1RUJ2 2YDEA 3B3QE 1VBB1 2HWB1 5AVPA 4AQTA 3QCWA 1WCDJ 1YYNA 2NZ9A 5I0RA 5E1RA 2BPA2 1WD4A 1C5HA 4M01A 1FMD2 4E9KA 1FV2A 4XFAA 2JG8C 1OLQA 3L2YA 1VBB2 4BIOA 4HVQA 1AYN1 3CJIA 1MACA 1QJU1 2VVDA 4XYXA 1AX2A 1CAVA 3OBTA 3ZXKA 5K8SA 1ALYA 4RGAA 3WG4A 1H1AA 3B9CA 3E6DA 2D97A 2XKPA 1H1IA 1AYN2 3OGGA 2D6PA 1B35B 4BZ4A 1O4ZA 4DINB 1QJU2 1F5FA 4OHXA 4NO4A 1KFXL 4IV3A 2VUAA 3CL1A 4YG3A 2EA7A 2DFCA 1NOVA 4PLOA 4YZ5A 3THTA 3J4UH 1AR93 1LOCA 3RPQA 3M3OA 1ULCA 2XJQA 4RS5B 3AKSA 3G7DA 4YGBA 5ABJB 3VZLA 1CPNA 3CU7A 1LHWA 3WCSA 1C1LA 3S6PA 1QOTA 5BNOB 2CNAA 1Z7S2 3ZX7A 4XJAA 1CX4A 1WCKA 4LO5B 3AP5A 1BVVA 4R9DA 4FVVA 1FOD3 3A0KA 3KCYA 4IV1B 1WBLA 1JTZX 4YZ1A 5JPMB 4XQWA 2GMMA 3DPRC 2HWE3 1H8VA 1GZCA 2EVXA 2QCSB 3NJZA 2W39A 3H7YA 1H2NA 4IERA 1RUH1 1MEC1 4C0BA 3FLPA 5L19A 2VW2A 2BVVA 1NQJA 1RC6A 1C8NA 1V6IA 2BTVC 1H2KA 1TEIA 1U12A 1S0GA 1GV9A 3KQRA 3KZ4C 1WW5A 5BV6A 2FQPA 2FMYA 3MIDA 1RUH2 1MEC2 2ILMA 4CP0A 1MS0A 3MF9A 3D0JA 2WNEA 1I3HA 2ZGPA 3WY6A 3NL1A 3H0OA 4IEWA 1Q8QA 4KGGA 4YVWC 1UCXA 5H9RA 2QDRA 3ES4A 4JDOA 4QPIB 2LUWA 3NKTA 1HV0A 1ND2A 2MNGA 3ZN6B 4Z2WA 3V64A 5CADA 1LEMA 1YJLA 1X50A 3ZSJA 5H9PA 4B4PA 3ZYPA 3LA3A 3AKQA 4DB5A 1WCSA 2OUJA 4ZXKA 5JOYA 2ZX0A 4LBOA 1Q3EA 3MIEA 3WDTA 2NMNA 2RE9A 4K20A 4Q4X1 1DZRA 3ALQA 1SQ4A 1UN1A 1ZZ7A 3VBRA 5JPNB 1M06G 3ZXAC 3WG2A 3S30A 1RUC3 2UWBA 1AR62 2ZOEB 5HCAA 4Y1ZA 4P9XA 4XTMA 4Q4X2 2EAKA 3GYDA 4IEPA 3ZFEA 3IBMA 4EN7B 1CAXA 2R49A 2ZTNA 1S0EA 1QNYA 4HKWA 4LNVA 1PIV3 1X82A 2K2SA 2VULA 2R043 2XWBB 3SMHA 5EXOA 4IXLA 3VDDB 4P5HA 5CFDB 1OFNA 3I4IA 3LSDA 1ASJ1 1CESA 4K9SA 2I45A 4LLFA 4JRLA 3WNXA 2UY9A 2WNVC 2ZGRA 2EXHA 4LO6B 1DQ1A 2ZZQA 2NP0A 5JIAA 5FMOL 2UY8A 1ZZ9A 2QZ3A 2WNUC 1PVC3 4NHLA 1ASJ2 1ZM1A 1OA2A 3NW4A 4XBQA 1DGRN 2YC0A 4M3CF 2GC0A 4PJYA 4CDWC 2BFUL 1FX5A 2UYBA 4RL7A 3QLQA 3N7MA 5A33A 3VBFB 4YG6A 4I0BA 3ZFGB 4HLTA 1S0DA 4KNCA 4F8AA 2R1DA 3ELNA 1SLCA 2WWSA 2IFWA 1PZ7A 2GMPA 4P9GA 4XXAA 2IXIA 1UL9A 3PLQA 1Y43B 2DUOA 5T3NA 3RRDA 4OI2A 2OZJA 2O8OA 4MXVA 4AI2A 4Y22A 2CWSA 3B5LB 1HDKA 1R1A2 2ETEA 4Z82A 1W0PA 2ZGSA 3USSA 5A32A 1ZBE1 4YGCA 3WW3A 2PHDA 3IM0A 3BOWA 4YM0A 2KA3A 4XFIA 4E2QA 2PA7A 3CNAA 4CEYA 1N1YA 5J36A 4K40A 3HBZA 2WA3A 1UZYA 5L7OC 1Y7BA 1BMV1 4C1WA 4FOQA 2QDNA 1ZBE2 2W68A 3I59A 4QMAA 1ULGA 2DF7A 4O9GA 3MFAA 3WD5A 3DF0A 3HT2A 1O5UA 1W6QA 4K7JA 1CAWA 5BNPA 3WXPA 5JI7A 2HEVF 3ZFFB 1BMV2 3B94A 3LGRA 3D5OA 4NVPA 4R8HA 3OYWB 2F6BA 1Q8SA 3WG3A 2WZR3 1V9U3 1S0IA 2XGXA 3CF6E 4AVCA 3BPZA 3P3PA 2R061 3PJQA 4HSJA 4L11A 1A78A 2Q1MA 1RMU3 5GZFA 4RQPC 4XMIA 2D6OX 3WDXA 3IDEA 2OA2A 4META 3VKOA 3TYJA 4G4FA 3VZNA 3UKVA 2R062 4Y20B 2B7YA 5GZCA 1NCRA 4QGMA 1QJZA 1J3RA 2YMZA 3E6BA 4MUVA 2A6VA 1RUJ3 4AEJA 2WKKA 2ATFA 4FOYA 5GZEA 1KS5A 3WUDA 2P3JA 3MEPA 3I54A 4EN8B 3NV2A 4BIFA 2VGDA 1CAUA 1A8MA 1MQTB 1W2UA 2G9GA 3MI8A 4IEQA 1SLAA 1NY71 2TEPA 4QM8A 3ILRA 5E8AA 3ECQA 3ZVXA 4FPFA 1VBB3 3NAPB 2HWB3 2OVUA 4FT8A 3KSCA 4HVOA 5GLVA 1RUE1 3VL9A 1D4M1 2WT0A 1SFNA 4FTSA 4BOWA 1NY72 3P3NA 4MYEA 4O9EA 4QHBA 4CDUA 5CFCB 1PO11 1VIWB 2VOVA 1ZRCA 2ZHMA 3JU9A 2UWCA 1AYN3 4PLMA 3MF6A 3ST7A 1QJU3 1RUE2 3KT4A 1D4M2 1VBC1 4NPRA 4FP2A 3E6CC 4FPOB 1PO12 2NYYA 1N3PA 1LHUA 4DZGA 2EXKA 2UU8A 5LK5A 1NA1A 1TQ5A 3O5SA 4FCAA 2XLFA 1VBC2 2FZ1A 4L2NA 1NYWA 1SLIA 5FOBB 4LUMA 2PHFA 2CAVA 2QZ2A 3M3CA 4JGYB 5C4WC 4QGLA 4GB31 4C0HA 2WZPP 2VMHA 4I30A 1LECA 4QX5A 2JECA 3KD4A 4B4RA 1DDLA 3WV6A 2D98A 3R0RA 1OSGA 1SBEA 2HEWF 1KXGA 2A6ZA 4IEYA 1JHNA 2X5IC 1POV1 3UKTA 5I8TA 3W59A 3WR0A 4HT1T 5I0SA 1U5ZA 5KC5A 1NCQB 4N53A 4Q4W1 1UKRA 1RUH3 1MEC3 1JH5A 5CAZA 3MW4A 4XIKA 3PMEA 4YLZA 4Q4W2 1G6NA 2RM23 4I09A 3U4XA 1S55A 3PVEA 1LJ7A 1K5MC 4XHBA 1VALA 1IKQA 1IQAA 5DUXA 4L9BA 3JZVA 5FLJA 1ZRRA 1ULEA 2PN5A 3FUQA 4TYSA 5FAXA 5FQ0A 4QM9A 1MR5A 1WD3A 2A3WA 3SNMA 4AFAA 4QT6A 4AW7A 1G9BA 5J09A 1UMZA 1Y9QA 5E89A 4XJZA 1ZREA 1GZ9A 5FRAA 5KXEA 3UK9A 2D6KA 4YVSA 4MGKE 1QMJA 2BW8A 3GZAA 1CPMA 4XJ8A 2VVFA 1WLDA 1N1SA 4INDA 4AQSA 3POYA 4BMBA 4N43C 1CR7A 4AE2A 5J37A 4COYA 1AL0G 3N7KA 5H9SA 1KQRA 4H3WA 4Q4X3 5GLZA 4KU8A 1C3HA 3ZN5A 1AX1A 3EXUA 4E2SA 4EROA 2R071 3U10A 4B7KA 3AMQA 5AC91 1ND2B 4GKYA 1QXPA 4WVMA 1O5LA 2CWMA 2DVDA 5KHKA 2H0BA 1YFWA 4EV0A 5ABJC 2YGMA 4RD7A 2EXJA 1W6MB 2UYAA 2R072 5K7PA 5AC92 3HAGA 1YIFA 4OI4A 4CDQA 1U5XA 4AGVA 1PVXA 3ASIA 1KFUL 4YGEA 1LOFA 2GNDA 3ATGA 5CG8A 4I01A 4XFGA 1BEV1 2ZMLA 3TOJA 3FBMA 3JB4C 3NKGA 1QGLA 2H6BA 3B01A 1ASJ3 4ORFA 4PF5A 1S2BA 4IV1C 2PHXA 3AKPA 1RL3A 3D6EA 4AHZA 5BNNA 1BEV2 4XE9A 1W6OA 2SBAA 1WW4A 4JVAA 2C9AA 1ULFA 1QU0A 3OCPA 3ZMOA 4FAHA 1GYKA 3MZHA 2XPJA 4RFT0 4GH4C 3LB9A 3DN7A 4M00A 2DYCA 2QFEA 2GNBA 4XFHA 1OOPC 4JAAA 4D7SA 3PVBB 2WFF1 2WQZC 3J8F1 4C90A 2Q8OA 3M3EA 4B8EA 3APBA 3N4MA 5CA6A 2W0XA 2ZGOA 3IDCB 4ASMB 4AVVA 2N7GA 3B7MA 4YW2A 1BCXA 2RR11 3WZ1A 1QY4A 5CNAA 3WQ7A 2B8MA 3MIFA 2WFF2 2ZGLA 4QPIC 3J8F2 4S2DA 1RHI3 1LR5A 1ENRA 1FPN1 2IWGB 1ZBE3 2R042 4FPLA 1GBGA 4PBOA 2RR12 4R4ZA 3SITA 3VBHA 4HK8A 1AX0A 1IS5A 3IPVA 4UW6A 3U11A 4WVWA 1N1VA 4CDQC 2WS93 2B9UA 2VMGA 2DCTA 1DZTA 1FPN2 1V00A 2XJPA 4WM8A 3O12A 4KH9A 2BBVA 4OHYA 2WC2A 4J1XA 1W6PB 2QVSB 2ZX3A 1RVF1 1OQ1A 2ZGMA 4AFBA 2DTYA 4QQLA 2D6NA 2WIIB 4FTBA 1D0GA 5A32B 1XYPA 2GC2A 3ENRA 2JJ6A 2R063 5DG2A 3WDWA 2BNMA 1IPJA 1RVF2 2FMDA 4WVVA 3LKJA 3KCCA 3O14A 2B39A 3K48A 3VKLA 4SBVA 1YFYA 3I59B 1MS9A 2JDZA 3FZ3A 4N7UA 4M3CA 3AX4A 1W6QB 5C9AB 4E4ZA 5BNPB 3H3ZA 2XVLA 4BPZA 1RUNA 5CFDC 1LULA 1QOOA 4LO8A 4AQ6A 1ZVFA 2JG8A 2UWAA 3HIFA 4YFZA 3DGTA 4KL1A 1ZNPA 5JSOA 4K6BA 1H8TB 1V6MA 3PHMA 2X53S 2A73B 1G9DA 1DBNA 2FBEA 4UW3A 4YG0A 2ZACA 2A5ZA 4YM2A 4AI8A 1XNBA 1LKNA 3ACLA 1RUE3 5CBLA 5T55A 1D4M3 1NCRB 4NR1A 5GLTA 3VBUC 4FPJA 4DRVA 2IXLA 3WDVA 1PO13 1JOJA 3ZFGC 1RUOA 5CU1A 1SLBA 1OPOA 1QF3A 3SH4A 4A7KA 1O3TA 2TUNA 4WM7C 5GZGA 3MGUA 2IFRA 2XLGA 3M2MA 1CAUB 2AH2A 1COV1 3B9IA 3AMHA 3E5QA 1AR81 2HWF3 4YW5A 2CTVA 1WMFA 4R9BA 1R1ZA 1URXA 2HEYF 2YZ4A 4LT5A 3Q9OA 4M3CE 1V6LA 1COV2 4AVAA 2RMU1 1AR82 3ILFA 4HN0A 1VBA1 4FAGA 5DZFA 2XVKA 1I1EA 3DPRA 4Q0PA 4I0AA 1TE1B 4GB33