2WS93

Equine rhinitis a virus at low ph
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
226
structure length
226
Chain Sequence
b'APIRVVSVPESDSFMSSVPDNSTPLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLSAAELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMACIHAVWDVGLNSAFSFNVPYSSPADFMAVYSAEATVVNVSGWLQVYALTALTSTDIAVNSKGRVLVAVSAGPDFSLRHPVDLPDKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 34
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ws9300
1NOVA 4Q4X2 1ND2C 1POV1 2HWB2 1R1A2 1C8M3 1ZBE2 5BNOA 4CDUC 1EAH1 2HWC2 1TME3 1PO11 1TMF1 4YVWA 1QJU3 1NCRC 4FTSA 4RS5A 4Q4Y2 3LOBA 1QJX1 5C9AA 5AC91 2HWE2 5D8AC 2XBO3 2R073 1QJY2 2RS13 3VBOC 5ABJC 1B35C 1VBA2 1ZBA2 4YVSB 4Y4YA 4FTBA 3ZFGC 1AYM2 4PDWA 1AL21 2BFUS 3VBUA 3IDEA 1AR83 2WFF3 1PIV3 1FMD2 1EV11 2HWF3 1HXS3 1M06G 1AR73 4GB33 1H8TA 1PO21 2WS92 2R043 2FZ1A 3JB4C 4WM7B 1RUH1 1PGW2 1AR92 1GFF2 5A33A 4GH4C 5C4WB 2HWD3 2RS33 3J8F1 4RHV3 1VBB3 3TN91 4IV3B 1RMU1 4IV1C 5BNNB 1HRI2 1MEC1 1OOPA 1ND2A 1RUI2 3CJIC 4CDUA 4N53A 1C8M1 5JZGB 1AYN1 1VBE2 1TME1 2RS52 5FMOS 2WZR3 1D4M2 1R092 1QJU1 3VBHB 4YVWC 1QJZA 1FOD3 4CDQB 1QQP1 3NAPB 1COV2 2ZZQA 4RS5C 1DDLA 3ZFFC 2HWB3 1AR62 1R1A3 1ZBE3 5D8AA 2HWC3 2XBO1 1WCDJ 2VQ0A 2R071 5C9AC 1VBD3 2RS11 3DPRB 5ABJA 5BNOB 1B35A 1BMV1 2RM22 4CEWA 5L7OA 1PVC2 1RUJ2 1SMVA 1AL0G 2HWE3 4GMP3 1E57A 1AR81 2WFF1 2ZTNA 4Y5Z0 1QJY3 1PIV1 1VRH2 5K0UC 1VBA3 2HWF1 1ZBA3 5CFDA 1AR71 1RUC2 4GB31 1R082 2PLV2 4Q4W2 1AYM3 1NCQA 5ACA1 3VBUB 1V9U2 1W39A 4QPGA 4GH4A 1K5MC 4QPIB 1MQTB 2HWD1 2RS31 4RHV1 1ND3C 2WS93 5C8CB 1VBB1 1H8TB 4IV1A 1RUD2 3CJIA 4RQPC 3FBMA 1OOPC 4N43B 2RMU2 1AR93 4N53C 2WZR1 3VBFC 1VBC2 4CDWC 4WM8A 1RUF2 1FOD1 3VBSB 1HRI3 1HQNA 1RUI3 1RVF1 3ZFFA 3JD71 1EAH2 2HWB1 1ND2B 2HWC1 1TMF2 1VBE3 4CDUB 1VBD1 2RS53 1D4M3 1R093 1BEV1 5A32B 1NCRB 1FPN1 4CEWC 5L7OC 1COV3 2BFUL 5AC92 4RFT0 3JBG2 1AR63 2HWE1 4GMP1 4FTEA 1QJY1 1X33A 2R061 5D8AB 1Z7S1 4Z92B 5K0UA 3VBRC 1VBA1 2RM23 1ZBA1 3VBOB 5ABJB 1B35B 1PVC3 1RUJ3 1BBT2 4AEDA 3HAGA 5CFCA 3VDDC 5CFDC 3ZFGB 4CDXC 1EV12 5FOJB 1NCQC 1VRH3 1X36A 1K5MA 5DDJ1 2DF7A 1RUC3 1R083 2PLV3 4Q4W3 1ND3A 4QPGC 4CEYB 2WS91 3S6PA 2QQPA 1C8NA 2XPJA 4NWWA 4RQPA 5C4WC 1V9U3 4NWVA 1PGW1 5FMOL 4QPIA 1AR91 3VBFA 1HRV3 2GH8A 4CDWA 4GH4B 3TN92 1RB8G 1RMU2 1POV0 1MEC2 4JGZC 1HRI1 1RUD3 4WM8C 4IV1B 1NY71 1AYN2 2RR12 1TME2 3CJIB 4Q4X3 2RMU3 1VB4A 2RS51 2BUKA 2MEV2 1D4M1 1VBC3 1R091 3NAPC 1AUYA 1RUF3 1QQP2 2BPA2 4YVWB 3ZFEC 4Q4Y3 4RR3C 1EAH3 1AR61 4RS5B 1CD3G 3ZFFB 1TMF3 3VBRA 1NA1C 5C9AB 2RM21 5BNPC 1RUJ1 1HXS1 3VDDA 1F8VA 1FOD2 4CDXA 4AEDC 5CFCC 3JBG3 2R041 1PIV2 4PDWB 1RUE2 4GB32 1FMD3 1RUC1 5K0UB 1BBT3 1R081 1CJDA 4Q4V2 4WM7A 1ASJ2 3ZXAC 5ACA2 4JGYC 5C4WA 1V9U1 4IV3A 3M8LA 1HRV1 2X5IC 1K5MB 1RUG2 1RHI2 4QPIC 1PGL1 1ND3B 4JGZA 5A33B 1OPOA 4Q4X1 4RQPB 2TBVA 1R1A1 1OOPB 1ZBE1 1PO12 4CDQA 3NAPA 1VAKA 1VBC1 4N53B 3TN93 3VBFB 1RMU3 4CDWB 1MEC3 3ZFEA 1RVF2 3JD72 4RR3A 4Q4Y1 3DPRA 2FZ2A 1AYN3 2RR13 1QJX2 1VBD2 1NA1A 4BCUA 2MEV3 1BEV2 4YVSC 5BNPA 1FPN2 1QQP3 1AL22 4CEWB 5L7OB 4SBVA 1AYM1 3JBG1 2R062 1Z7S2 1FMD1 3VBRB 1BBT1 1PO22 1A6CA 3VDDB 5CFDB 4CDXB 4JGYA 4WM7C 1MQTA 5DDJ2 1RUE3 5C8CA 4CEYC 1RUH2 1NCQB 2X5IA 3J8F2 4Q4V3 4IV3C 4QPGB 1ASJ3 2Y26A 5BNNC 2BBVA 4N43A 3JB8A 5ACA3 5J96B 5LK7B 5JZGC 1RUI1 1C8M2 3VBSA 1VBE1 1NG0A 1RUG3 3VBHC 1RHI3 1QJU2 1OHFA 2WWSA 4CDQC 1HX6A 4EJRA 1NY72 4JGZB 4WM8B 2RR11 1COV1 1POV3 5A32A 3DPRC 5BNOC 2XBO2 1NCRA 1PO13 2MEV1 2R072 2RS12 4YVSA 1BMV2 4GMP0 1RVF3 1PVC1 3JD73 1VB2A 3ZFEB 1QJX3 4RR3B 5AC93 3VBOA 1AR82 2WFF2 1BEV3 1NA1B 3ZFGA 2HWF2 1HXS2 1FPN3 1VRH1 1AR72 4LLFA 5BNPB 2PLV1 1AL23 4Q4W1 4PDWC 2R042 5J98B 4AEDB 5CFCB 3VBUC 2R063 1Z7S3 1F2NA 4CEYA 1EV13 1RUE1 1MQTC 5C8CC 2HWD2 1H8TC 2RS32 1PO23 4RHV2 4Q4V1 5BNNA 1VBB2 4FSJA 1ASJ1 2GSYA 5JZGA 5GKAC 2WLPA 1RUD1 2IZWA 4N43C 4JGYB 5DDJ3 1HRV2 1RUH3 2RMU1 3VBHA 1RUG1 2WZR2 1PGL2 1RHI1 2X5IB 3J8F3 3VBSC 2ZAHA 1IHMA 1RUF1
chains in the Genus database with same CATH superfamily
1V6KA 1QDCA 4JX0A 1VE0A 4U36A 1BZWA 4Q4X2 1OC1A 3N9MA 4KL1A 3C7OA 2HWB2 1PHMA 1C8M3 1DQ0A 5BNOA 3HBKA 3EB7A 3Q8FA 5JSRA 4L9BA 4FBFA 4N90A 4LHKA 4YZ4A 4BPZA 1QJU3 4YPJA 3VZOA 5EIYB 3WCRA 2VC9A 2PHLA 5DAXA 3WF2A 1KS4A 2J1AA 4AGRA 3R4DB 1OLQA 1WCSA 5DG1A 5CBLA 4YM3A 1JOBA 1W9TA 2EAAA 5C9AA 1GZTA 1XJAA 1GZWA 4QT6A 1WLTA 4B4RA 1L7QA 2ZZJA 4QB6A 1OFSA 5EJZB 2ZGOA 4QQOA 4AYUA 3VHNA 1Q8QA 4M00A 1POQA 3N7MA 4D8MA 3IMNA 4UT5A 1PM7A 1JBCA 1DBNA 1ZBA2 4Y4YA 2OUJA 3VZKA 1SFPA 5A3UA 4IESA 1UU5A 2WO2A 2XGXA 3ES1A 3HNMA 3I2GA 3TRSB 3K2OA 2BFUS 4FPEA 3GDBA 1LCLA 3IDEA 3M3OA 4XACA 1F9KA 4DRVA 2WFF3 1LGCA 4HT1T 4I3GA 3V64A 2GN3A 4LK7A 3ROUA 4IGOA 1OSGA 1UX6A 1WLWA 1J3RA 2WO7A 3AJZA 2JIGA 5FZ1A 2PA7A 2ZX3A 3UK9A 1H8TA 4P9WA 1PO21 2Z4FA 1H2LA 2WS92 4QGNA 3ZYGA 2O8QA 1S0IA 1W2TA 3OOXA 4Y20B 2YDEA 1G9DA 2VZQA 1Z0HA 1KJLA 2OKXA 2ZMKA 3I3MA 2G9GA 1K5JA 1ENQA 1GWMA 3R4UA 2VUDA 4HK8A 4B1LA 4BIOA 3ZDSA 2PHDA 3HN3A 1GFF2 3OJBA 3LIGA 2OZJA 1G7YA 4R4XA 5I8YA 1DGLA 2EA7A 3AMPA 2X53S 5FBZA 4GIQA 3TN91 4DXZA 3AYCA 2QQMA 5FOBB 1H0BA 4FCAA 3E6CC 4IV1C 5BNNB 5FYHA 5CG8A 3JXSA 2EVXA 4R9CA 1LGNA 4CP9B 4UAPA 3CJIC 5I8SA 3EYPA 4ZKTB 3WDUA 1AYN1 3AMHA 1VBE2 3J4UH 3ZYIB 1XNTA 4W8JA 2WZR3 2XJUA 1Q8VA 3M3QA 4X8PA 4GZ9A 4UXAA 3FFZA 3D8CA 2VAUA 2JECA 2AC1A 4IEOA 1QQP1 4NIAA 3BALA 4YGDA 3PIGA 2HYXA 4CVUA 4ASMB 1LOBA 2ILMA 1WCDJ 4RGAA 2GNBA 3DPRB 4HVQA 2OW4A 2AENA 2JIJA 2WT0A 2RM22 1W6OA 3UNPA 1KXGA 3EXUA 3B5LB 4I3PA 3IDBB 3RZJA 4A6SA 3FHQA 4ONUA 5HV0A 1UD1A 1JH5A 3SCHA 2VBBA 1PX3A 1W8WA 4JRLA 4KU8A 1AR81 3KQRA 1JOPA 2Q5TA 5FZ0A 3ZXDA 1PIV1 4DOUA 1UAIA 1OF4A 2QDNA 1BKZA 2EIEA 4OQ9A 2HWF1 3V56A 1REFA 4AAPA 2DU1A 1AR71 5JXJA 5FPAA 4QPWA 4WVMB 2YROA 5DUVA 3UYJA 3ZXLA 1C5IA 1AXKA 2QKDA 4Y5TA 4BISA 3MZHA 2XJRA 2W9XA 4FFGA 4IE5A 5GLZA 5H9RA 3VHRA 4CTEA 1A8DA 1FV2A 3OY8B 4UF0A 3I2HA 2VMEA 1BCXA 2D40A 4QPGA 4LULA 1K5MC 2WNUC 2NLRA 3OEBA 2RS31 4RHV1 3PL0A 1W9SA 5KHKA 3BU0A 4AFAA 3N7JA 4NUBA 3WY6A 4IV1A 4I2OA 1S0JA 4UBGA 4HKWA 4ZS3A 5IVJA 1LHWA 3CJIA 5D2AA 3D3AA 4BDVB 3WOGA 3WG2A 1KDKA 3FBMA 2YGLA 3G7DA 4LE4A 3IT8A 4XF0A 3KT7A 1ZYBA 1U5IA 1WGPA 4N43B 3TAYA 4AR2A 4E2QA 4MYEA 1YYNA 4HBNA 4N53C 2JD9A 1RUNA 3ZLIA 4NPRA 5B4XA 4TSVA 1FOD1 3E5UA 3AZYA 5DG2A 2JB4A 3IPVB 3KF3A 3ZXGA 3VKNA 1RVF1 2VNRA 3HOBA 4WVZA 3T2QA 2NMNA 3U78A 2ZBJA 4MX3A 1V70A 2VW0A 3Q9OA 1A8MA 1SHWB 1GV9A 4QDSA 4N8MA 1DQ6A 1F5FA 5JIAA 1CZTA 1U5XA 1OURA 2J7MA 4XJAA 5A32B 5BY5A 3AVRA 4HL0A 2N7GA 1SLIA 1NCRB 3I3BA 3KCYA 1FPN1 4CEWC 5HV4A 2WO1A 5ANNA 5BPXA 2J1RA 5GZDA 2VW2A 1X9TA 3KQ4B 3JBG2 1AR63 4FPHA 4QU2A 4UFIA 4LHSA 3POFA 4GMP1 5C3RA 2WUHA 2YBSA 4YW5A 2PQQA 3FJSA 3TBDA 3VBRC 3MIDA 3PIJA 1VBA1 5ABJB 1AJOA 1B35B 1PVC3 3KZ4C 1RUJ3 3NQHA 4AEDA 3K48A 2NQYA 3ENRA 4DY5A 3C7EA 1OD3A 3RZLA 4GKXA 4BQ2A 2Y8KA 3K77A 3PHMA 1D0HA 2OXBA 2JDUA 1UCXA 4CCNA 5FOJB 3TEXA 2EXIA 1IPJA 4EWAA 2BZDA 2DV9A 3VDCA 1K5MA 1ULPA 3RYKA 2UY8A 1Y43B 2WNUA 1QMJA 1O91A 2DCTA 3ACHA 5A6QA 5KXBA 4EROA 5CG9A 3ZYHA 3H3ZA 3PU8A 2P2KA 1XYOA 1V6IA 1OA4A 2ADDA 2B46X 3DYMA 3E6BA 3BUCA 3LEKA 4AZZA 4R4ZA 4D7SA 2XPJA 1J3QA 2BOIA 3HT2A 1GR3A 4IW3A 3ETPA 4Y3OA 3FUOA 2EICA 3OB8A 1V9U3 3FHIB 2VBDA 4CCJA 1PGW1 5FMOL 3USSA 5FPXA 1JN2P 4CCDA 4OUSA 2PHFA 1HRV3 3WNNA 4XJZA 1BJQA 3ZX7A 1L7LA 1MPXA 1POV0 1W6NB 2Y33A 5KC6A 1UOGA 5I8TA 3POWA 2FQPA 3NNJA 1MZ6A 4JGZC 1XE7A 4FPGA 2Y34A 5DXDA 2RDQA 1NY71 1D4VB 4C0HA 1A3KA 1DQ5A 1RUOA 1RXGA 2RMU3 5T3NA 4NHXA 4XFAA 2NPIA 3ZXEA 1Q5OA 1D4M1 4BQYA 5IATA 1AUYA 4PIXA 5J1XA 1NE4A 3AP4A 2BPA2 3AP5A 2Z79A 2ATFA 3J7MA 4Q4Y3 3OTFA 1EAH3 1GNHA 5FZBA 3WNPA 1QEXA 3NW4A 3ZFFB 1TMF3 2E26A 1APNA 1M4WA 3GJBA 2Y6JA 5FXXA 4Z2WA 3VBRA 1HB1A 1NA1C 4YG6A 2QNKA 3LWCA 3WD5A 2A71A 3PVBB 2XVKA 3AYEA 3MHZA 2DTYA 1N3PA 5KXDA 4LIVA 4BK4A 2RHPA 4BM8A 1PGSA 3WG3A 5LY1A 1I3HA 3ME2A 2E53A 1REEA 1YQ6A 5CFCC 2JDMA 3GBGA 2W94A 5BUVA 2JENA 3TEZA 5I0UA 1WD4A 3POJA 3IBMA 4OVEA 1N3QA 4GKYA 1RUE2 2A5ZA 1J3PA 2XJQA 3KWVA 2A1XA 3WEZA 3WW4A 4FOWA 3WNKA 1RUC1 4Y20A 2DWRA 1CJDA 5FK7A 1ONAA 4FOVA 4XJ8A 4CXYA 1XNAA 3K3NA 3UGHA 5T55A 2VNOA 2W95A 2BERA 5HXVA 5L19A 5ACA2 1X9PA 4W6YA 2ZACA 1D2SA 3ZSEA 4XEZA 4AVCA 2W91A 1OFNA 3LPFA 1CAWA 2JE8A 2GC1A 3M8LA 2VZSA 1S2BA 2UU8A 1AXYA 1IS5A 1H9WA 4ZHNA 2IXJA 3H3LA 4IEYA 4CP9A 4S2GA 5CVRA 4HFSA 1W6QA 3HN1A 1ND3B 1WBLA 2JDKA 3JQWA 4JGZA 4IE6A 3SMHA 5A33B 1OF3A 2XL7A 5FREA 3ZMOA 2VO5A 4OYUA 1OPOA 4S2DA 1BXHA 2YBKA 4P9YA 4I01A 3K3OA 1MVEA 4AFDA 2JE9A 1VBC1 3NNMA 3AKQA 3O5SA 4FPLA 4LIUA 3VBFB 1TE1B 1MEC3 4UWDA 2E7TA 4DZGA 1YFUA 3D0JA 1KGYA 4BHPA 1GP6A 1MS0A 1O4YA 3DPRA 1ZRFA 3HT1A 3C7HA 1AX2A 3MICA 2FZ2A 2WT2A 1AX0A 3LFMA 4W6WA 1NA1A 2R1DA 4NMIA 3WINE 4NRPA 2VNGA 4YVSC 3ZR6A 4Q8KA 1Y4WA 4PJYA 1ZREA 3AYAA 3RMXA 2Y6FA 3TNQA 4Y5SA 3BTAA 3AP6A 5A7OA 2H0BA 5C70A 2R062 2TNFA 1MS1A 1Z7S2 4MXWB 5EJ3A 4DNYA 5KBFA 4BLJA 5JLVA 3TOJA 4YLZA 2WZPP 3J9SA 1FMD1 5L36A 1BBT1 2GH2A 4MGQA 3QLQA 3ZYPA 5AVPA 4LPLA 4CU8A 3OY8A 4R9AA 5EZWA 2DUQA 2NP0A 1AF9A 1US2A 4CDXB 5KR7A 1WD3A 2DBIA 4QDRA 1NXMA 1TEIA 1YQCA 2WAOA 1OQDA 4HN1A 2WBKA 4X8NA 1KRIA 4TTGA 3RZKA 1KJRA 2DUOA 1WW7A 4NHLA 1NZIA 2CYFA 3UESA 2ZS6B 4LE3A 3QCWA 4YGEA 1PMIA 4XJ9A 3A23A 3K4AA 2XOMA 1IZ3A 2DCZA 3D6EA 1RIRA 3WZ1A 4CCLA 4IV3C 4LKDA 1ZA4A 2D3PA 3D82A 3MIGA 4LORA 4N43A 4FFHA 5LK7B 1BQPA 2WQ8A 1SLTA 2D6OX 2H0VA 2VG9A 3KV4A 1JYIA 2YFZA 3S30A 1W90A 5HCAA 1SFNA 3RQ0A 2WIIB 3TYJA 4F7ZA 1OQEA 2PHTA 1NG0A 1RUG3 3IPVA 3AMQA 1RHI3 1SDDB 1IS4A 3DYPA 4CDQC 2VMDA 3OGRA 1O59A 1G6NA 3WCSA 1RJ8A 1VALA 2W52A 1XC6A 1TQ5A 4MHRA 4WM8B 2RR11 1J1TA 3RJRA 3PNAA 2DTWA 5IVEA 3PMEA 4E8DA 5A32A 5A3PA 1U12A 4QAWA 1NCRA 2R072 2MEV1 2RS12 4YVSA 5FJHA 2Y64A 5FMDA 2BV4A 1BMV2 4J6GA 1HN0A 4KMQA 3BPZA 3PUQA 2QTWB 1SLCA 2VMGA 1UU6A 2VZVA 3VDAA 1R1ZA 1JUHA 2HYKA 1DCSA 1PVC1 4YFWA 1F15A 4PQQA 1LULA 3ZFEB 5H9SA 4JVAA 2ZKLA 2ARCA 4RR3B 1JHJA 3BGAA 4LKFA 1YEWA 2E33A 2VVFA 4B4QA 2LALA 3BOWA 1C28A 1H4HA 1KS5A 1OMIA 3AKTA 2ET7A 1UN1A 2R0HA 3ORJA 4IEXA 4HMZA 3LEGA 3NJVA 4O65A 4WVWA 1ENSA 3ST7A 1SPPA 3VUOA 1H1AA 4XAEA 4CPBD 2VTXJ 3AMMA 5EQUA 4XQ4A 5LA9A 1RYYA 5IVYA 2WDBA 2E7QA 3UKNA 4ORFA 2VQTA 5CNAA 1UPIA 3P3PA 4Z1VA 4MG2A 5J7MA 2BVVA 2HWD2 2JWPA 1PO23 1XNBA 4AGGA 4MZUA 3WF0A 1VBB2 4AHYA 1ASJ1 2MHFA 4A45A 1L7RA 2HEYF 5CKNA 1XSRA 1FNYA 1O3RA 5A80A 5FUPA 5FCCA 1I5ZA 3AP7A 2FCTA 2YYOA 3RZZA 1HB3A 2VPVA 4L92A 1SCSA 4O9EA 4HXCA 1HRV2 4IEZA 4NPMA 4P9LA 1W6NA 2P17A 4XPVA 5FYCA 5IVFA 3V0BB 3TEWA 2RMU1 4V2WA 5KC5A 2O1QA 1FX5A 4LBLA 4K1ZA 4DUWA 4HPKA 2PHXA 3E5QA 1HN1A 1JU4A 2OQ7A 1AHSA 1GQPA 1X8MA 1YO8A 1QNYA 2QJVA 2XQRA 3GGLA 4LBQB 1EYBA 3HNBM 5I0SA 3PJYA 5JOXA 1MZFA 3K51A 1OLME 2XH6A 4DPNA 2TUNA 3KLSA 1RTVA 5FK8A 4EE2A 1J59A 4LHLA 1EAH1 2HWC2 4XUNA 4XYXA 2WNVB 4CDUC 2O0OA 2GP5A 1PO11 1NQJA 1OQ1A 1UKRA 2XUMA 1TMF1 2YG0A 1XYPA 3SH5A 3KB5A 4AOCA 1TNFA 2IXIA 5C5UA 2Q4SA 2CWSA 1HV1A 4Q4Y2 3O1UA 1OUXA 4AFCA 1WMFA 4IQPA 4URAA 2VTFA 3EJKA 3T2OA 5FXZA 5AC91 2WNEA 3VZJA 2HWE2 1GOHA 2A3YA 3MUZ1 5D8AC 2D6KA 2D43A 1SBFA 1QJY2 1UY1A 5IJRA 3VBOC 1Q56A 3ILFA 1UF2C 4HANA 1IPKA 1W0PA 2D6MA 4JAAA 4QM9A 4FTBA 3PJQA 4XFCA 1AYM2 5L9RA 4RSUA 3ZFGC 4YZ5A 4UI9L 2V72A 1NKGA 1K12A 2ZCWA 4XBNA 2C6SA 3RSJA 1AR83 3GHMA 3OYWA 1PIV3 1PNFA 4G3YC 2HWF3 3U4XA 1HXS3 2WA3A 1M06G 1AR73 4FVVA 5FO7B 5FPZA 4LO5B 4QKBA 3CEWA 3OGJA 3ZO0B 2ZGRA 2R043 2ZGKA 5FP7A 2E9QA 4HN0A 3RI8A 1JZ2A 3JB4C 1UZWA 1RL3A 2Q8DA 3NV1A 1AJKA 5IVCA 4MO3M 3ATGA 4WM7B 3FL7A 3ZPOA 2WQ4A 2W1UA 3UJOA 1AR92 2B9UA 4KG8A 1LOEA 5A33A 5C4WB 4H7LA 4COYA 5A1LA 2RS33 3J8F1 4RHV3 1CAXB 2C5DA 4K1YA 1UXZA 2BWAA 2DCYA 4M0HA 4PQ9A 4XUOA 3SCGA 2E31A 1GQGA 1HRI2 1MEC1 1ZZ7A 4NR1A 1VMHA 5J37A 4A44A 1H2MA 1CPMA 3JU9A 5FYBA 3WXPA 4CDUA 1Q8OA 1CWPA 1O8SA 2VL4A 1TME1 2K9ZA 2RS52 2W08A 2JG9C 4JV4A 3UGFA 4ZU7A 4FP2A 4QQLA 1JZ5A 3PU3A 1R092 3APBA 2NYYA 1U5ZA 3B9CA 5DAVA 2WL1A 5FXWA 5DUXA 1FOD3 2I45A 1P8JA 1OA3A 3DUIA 2CNAA 4KBBA 2AEZA 2HBUA 2ZZQA 3NJZA 4OHYA 4NOTA 1UU4A 2VZRA 4QX0A 1UY3A 1R1A3 1SCRA 1ZBE3 5D8AA 4XF1A 3EQEA 2XBO1 2K0GA 1XB9A 2ZX0A 4GA9A 5C9AC 2WO3A 3WNLA 2QQNA 3WNOA 3ZYJB 2ZOEB 2PN5A 4C8DA 1UY0A 4OI1A 5IFTA 5LB6A 2GNDA 4JC1A 2XKOA 4IEQA 3H8UA 3GYDA 5FRAA 2DVAA 3T4VA 2LM3A 2RVAA 4JDOA 1JZ3A 2YU1A 1AL0G 3THTA 3NNGA 1W6PB 4XFHA 3WF1A 4GMP3 4IXLA 1E57A 1W99A 2ZEWA 1QOSA 2IUWA 1QNWA 2F17A 2JB8A 2WJSA 3MI8A 4CUAA 1VRH2 2CSGA 3BN6A 1H1MA 3FLTA 3SQOA 1VBA3 3MIBA 5K0UC 2YPDA 4B7KA 1NAEA 4GB31 4YM2A 1R082 2PLV2 3WX5A 4Q4W2 5H9QA 5FP8A 1ZZ8A 1C4RA 4P9XA 3USUB 1XNCA 3O0WA 4Q2FA 4XF4A 1KFUL 1LHUA 2GMMA 1GZ9A 1C5HA 3U37A 3BODA 1IS6A 3O1MA 5G05L 1XSQA 4M01A 3VBUB 5FXVA 3WR0A 3GHNA 3ACIA 2QZ2A 4M3CE 4AHWA 3WQ7A 1UMHA 4NIIA 1G9CA 1X7NA 2UY9A 1MQTB 3J7LA 4Y1VA 1YHFA 4Y4RA 1NYWA 2D7FA 2FHRA 3HEIA 3ITQA 2JKXA 5ERLA 2ZGUA 2D44A 2G9FA 2BGOA 2OVUA 4P9JA 3T2TA 1C1FA 4RQPC 4XDQA 2VQAA 5IW0A 4AQSA 1A78A 1LAJA 2JG9A 3LF7A 3UKTA 1E5IA 1V6MA 5JXIA 5FAXA 5C3QA 4MLOA 4OHZA 3GZAA 1BVVA 2WFPA 1LGBA 1H4GA 4WM8A 5FYTA 1RUF2 3VBSB 1C57A 1WWYA 4LK6A 3AFGA 2WINB 5FYSA 3T0BA 2X09A 2DCJA 1RUI3 3ECQA 3K4ZA 3P5BA 2VMHA 3VKMA 4QXBA 1AXZA 2HWB1 5JSPA 3A4UA 3IKWA 1ND2B 1T6GC 1G9FA 4PCRA 3RVHA 1UOFA 5FY8A 3LE0A 5HCHA 1D4M3 2CU5A 5T5LA 2JG8B 4XUPA 4M3CB 3PVNA 5FMCA 2BQPA 4ISQA 4BU2A 1UOBA 5LRRA 5HCFA 1COV3 2AREA 2BFUL 5FZ9A 5DPNA 4F83A 2C9KA 3I2OA 2IXLA 4YW3A 3L2HA 2YUEA 1XOYA 3M7AA 4FTEA 2JD4A 3WV6A 1X33A 5DZGA 2W0XA 5K0UA 5F39A 1W8UA 4B7EA 3PTRB 1WA4A 1NE6A 1ZBA1 5JPMB 3O0XA 3OPTA 3D5OA 2YFUA 2EIDA 3VDDC 2UYBA 3A0KA 3KCXA 3T1LA 1N1SA 3I8TA 3BIWE 4XIOA 4XC9A 5KHIA 2BOJA 1J1LA 3VD9A 2VTXA 3LA2A 4V2VA 4M0NA 3OBAA 4DUVA 2QE3A 3WQ1A 4AVVA 4UFJA 5GM0A 2CAUA 1RUC3 2VZPA 2WLQA 4D7YA 2OQ6A 4QPGC 2WS91 5F5AA 3S6PA 5JAXA 1OH4A 4AQ2A 4DMIA 1W0OA 3GCXA 4NWWA 5DZEA 2R49A 4RQPA 4HK9A 3V0BA 1SBEA 1TG7A 5C4WC 1E5HA 5EXOA 5FKBA 1AX1A 1BLZA 5APAA 4LBQA 2D6NA 1S0EA 3AZZA 2GH8A 4Y1XA 1F4HA 4GH4B 3TN92 5A3OA 5FYIA 1CIYA 3ZN6A 4CU9A 2XVLA 4YGCA 1GWKA 5EYYA 2YB7A 4AI3A 3JUUA 3V0AA 3PURA 3DYOA 3OG2A 1RUD3 1UNBA 2Q0AA 5F3GA 2YY1A 3PUIA 4KGQA 3ZYBA 4A42A 4AHXA 1LKNA 4ARYA 2YHJA 1AYN2 4BIFA 3NMBA 2FDKA 3WG4A 1S0BA 4DXSA 4LITA 3JCIA 1V6LA 2Y60A 1VR3A 1XNKA 5EP9A 3NJXA 1QOOA 3O7OA 1VBC3 3F2ZA 3VLBB 1ZX5A 1EPWA 3DL3A 3ZSMA 1HQWA 1QQP2 2WZ8A 3ILNA 1WUVA 4IE4A 5JIUA 1SDWA 4YVWB 4CP2A 1UW8A 3HR9A 3PDQA 4RS5B 1CD3G 4QQHA 3L9JT 1HJGA 2PHUA 4JDMA 1IG0A 3OBRA 5EHDA 2W2IA 3NV4A 5FZCA 3O12A 2ETEA 3ES4A 2RM21 3VHOA 2P3JA 1YJLA 5BNPC 2C24A 4XVHA 5IVBA 1HXS1 3VDDA 1QH7A 1WW5A 3MUY1 1ENXA 1JUIA 3IAPA 1JXNA 5B2GB 2D93A 4AEDC 2ERFA 3VD5A 1UKGA 3BPSA 2R041 5T50A 1LESA 1MACA 1PIV2 4D6QA 1REDA 3CLPA 4XETA 5FYYA 1IGOA 3LEMA 4Q0SA 3BOPA 5LA0A 4CCOA 4XF9A 3WHUA 2B45X 1IQAA 2WSVA 1FMD3 2P3IA 3AX4A 3OUHA 2LUWA 1BBT3 1S2KA 5FJKA 1JYCA 4OI2A 3WW2A 4Q4V2 4MVTA 4NHYA 4WM7A 3KCCA 5C3SA 3ZM8A 2QQWA 1YFYA 3W58A 3KV9A 3MPPG 5C4WA 4LQRA 2VOXA 4FXGB 1CAXA 1O8PA 1ZNPA 2FCVA 5LATA 2IWGB 4DEVA 2VW1A 3S7EA 5CAZA 2QFEA 4KG0A 2ZGQA 5J09A 3PLQA 1QU0A 4NE9A 3GCWA 4YW1A 4AEMA 1PGL1 2IXHA 4BJ0A 4BQ5A 3SXWA 4NAMA 2HKXA 1YRZA 2VZ1A 1VMJA 3BU7A 2WNOA 3VN4A 1V6OA 3GZEA 3U75A 4QWNA 2PAEA 3E6DA 1R1A1 1OOPB 1FNZA 1ZBE1 2PELA 4UYBA 3I59B 5T52A 5EJ1B 4O61A 5FLHA 1RMU3 4BQXA 2IC1A 3CU7A 1HV0A 4CDWB 5IFPA 1K3IA 1RVF2 2QBXA 3CO2A 5LBBA 1OUSA 3E1F1 2RR13 1EUUA 1QJX2 4GJZA 4JKLA 1AZDA 4QGLA 3H8OA 3BYWA 1W3VA 4LTAA 5F2WA 4YW7A 1PZ8A 4P5YA 3LPGA 2MEV3 5FZOA 2W3JA 5BNPA 1FPN2 2XWBB 3IIIA 3VKFC 2IXCA 1QHDA 4BMBA 3GM8A 1AL22 2JDAA 2BU9A 1ULOA 4SBVA 4ZZ5A 5L7OB 5FZKA 3JBG1 4KWJA 1DIWA 2KA3A 3SCFA 3NNLA 2ZHLA 3T4HB 5DMYA 2XLGA 5KXEA 4Y22B 3OD0A 2NM1A 3OUJA 4MGSA 5FQ0B 2ZJCA 2EXHA 5KHHA 5KXCA 2QQIA 5FV3A 4FAHA 3VZMA 5TSWA 1DGWA 1SLLA 2NN8A 3HJRA 4XBQA 3VKOA 1HJFA 1E5SA 1HB2A 1JODA 3CQOA 1DFQA 2BYVE 3IWZA 2LW8A 2JDZA 3LD8A 4QXHA 4TLGA 5A7NA 5A3MA 1NLSA 3AZXA 5BV6A 5CFDB 3KVBA 4NIDA 1EPZA 2K2SA 4PF1A 3T1MA 4Y33A 3EMRA 4D69A 1MQTA 4OLLA 3UGGA 2LTNA 1RUH2 1H1IA 5LCWL 1NCQB 4AI9A 3U10A 2ARXA 4EQVA 4AEKA 3S0MA 4E2SA 1ASJ3 2W1QA 2Y26A 5BNNC 2I2SA 3RPQA 3JB8A 3KHBA 4NAOA 4Q1PA 4LBNA 4GWIA 5J96B 2W39A 2ZX2A 5FYVA 3MYXA 1W2UA 4KI5M 1W2OA 1RUI1 1C8M2 4KH9A 4A41A 4E27A 1NX9A 3VBSA 2B4KA 4Q29A 5DZFA 5JSOA 1K42A 4QX3A 2VVDA 2YGMA 4TZDA 1QJU2 1OHFA 2WWSA 3I2JA 5C3OA 4EJRA 2ENRA 1NY72 3TB0A 4ZZ8A 4L97A 1W3XA 4OFGA 2J1VA 4MGKE 4QKDA 3RS6A 1COV1 4YZ2A 1ULEA 3U0ZA 3DPRC 4DO0A 1S0FA 3T08A 4QXCA 1PO13 2D5FA 4EWEA 4AL9A 1GBGA 3MBWA 1C1LA 5CB7A 3SEEA 3UJQA 4RA0A 2PAKA 3OGSA 3KT1A 2R7EB 4GMP0 4AE2A 3JD73 4IDZA 2XR4A 1O3TA 4W6XA 1CONA 2JICA 4XDPA 2P34A 4W4ZA 5AC93 2EIBA 4AVBA 2WFF2 1W8FA 3CMGA 4XUTA 3DKWA 5IK8A 3J7HA 1BEV3 3LAGA 2BP6A 4LBOA 1NLQA 4KWUA 1ACCA 1K45A 4ATEA 3AYDA 2EXJA 2AGSA 4LO4B 2XHKA 2V4VA 1XXNA 2VU9A 4EZ4A 1SLAA 3L2YA 4B4PA 3IIAA 5A7WB 1LB2A 4XCBA 2E7AA 1UIJA 2ARAA 4R8HA 3SH4A 4DUXA 3I3QA 3RRDA 4G4FA 3NNFA 4BYYA 4OUMA 1RUE1 2QQKA 2V4AA 2Y0IA 5HCBA 4NROA 2AZ5A 3MW3A 3KGLA 4IE0A 1URXA 4YZ3A 2LROA 5BNNA 3LZZA 2Y0OA 2EAKA 4IEUA 2FBEA 4GAZA 3H8XA 5CYYA 1ODNA 3LKJA 5LY2A 4DRRA 2AACA 3RFRA 3CIHA 2WLPA 1RUD1 4LA2A 2IZWA 4N43C 4JGYB 2MNGA 4QU1A 5DDJ3 4QQPA 2RV9A 5EWSA 4A7ZA 5JR2A 1UZ0A 3SKJE 4IE7A 5BXXA 2GC2A 3NV2A 2WZR2 4IERA 4DY3A 2JKBA 3U1XA 3J8F3 2X5IB 4E4ZA 3FN9A 1UYPA 5FZDA 5E16A 2ZAHA 5JDBA 2R16A 2A73B 1IHMA 3GXUA 4QPIB 3RWNA 1O5LA 2Y6HA 3MW2A 3WP6A 2P5BA 4S2HA 3T0DA 5KHJA 4DIQA 1HIXA 3Q8BA 4LUMA 1DZQA 2XJVA 1W9WA 4XILA 1O3QA 3W5MA 1TME3 1W8TA 2G4IA 4MXVA 1DGWX 4YVWA 4C1WA 1PK6B 1NCRC 2YBPA 1ZRRA 2QQLA 4RS5A 3TNPB 3I3EA 5C33A 2Q1ZB 4AEJA 1DP0A 2C26A 3NKGA 4NHMA 4PBOA 3LOBA 2ORZA 4NIGA 2OT7A 2XBO3 1V6JA 5C71A 1X82A 1JZ6A 4I0WB 5ABJC 1UZVA 1B35C 1DGRA 4WVMA 2VVEA 5FFOC 5FY7A 5SV8A 4CXXA 3KV6A 2ZPXA 1SACA 5IK4A 3QD6A 4FPKA 2QZ3A 5A7SA 4PLNA 1DZTA 5LRSA 5FDBA 2BGPA 2A6YA 5A3NA 2IFRA 5FZHA 3AVSA 4I09A 4TXWA 2W47A 2Z2SB 4HOOA 5DUUA 1FMD2 1EV11 1QGLA 4D7TA 3EO6A 3FE5A 5JPNB 2TEPA 4GB33 1UIKA 3MDPA 2VCMA 5JI7A 5T5PA 3U07A 1W0NA 4XW3A 1D0GA 3QH7A 4GALA 2FZ1A 1A34A 4AI0A 2D97A 3CKHA 2Y6LA 1GNZA 1YI7A 3V65A 2JDPA 4MGZE 4L8QA 5JCTA 1WW6A 3PUHA 2FMDA 2Z69A 5L9VA 4PHZA 1W6MB 3O1SA 4JDNA 1QY4A 1CVNA 4E4SA 2RDRA 3CJXA 3THCA 1G86A 3INAA 3UT0A 2VOKA 4CYDA 4QB2A 1RMU1 2B42B 4UW6A 4WZCA 4D0QA 1OOPA 1S0CA 3C7FA 3I59A 4MV2A 3VHPA 2E51A 5JZGB 3K4DA 1H6YA 4XE9A 1GP4A 5CADA 5C5TA 2DVFA 1ULFA 4XDOA 4AWDA 4Q8LA 3M3CA 4BXFA 2VOTA 3VBHB 4DS0A 1W8NA 2RG4A 2Q1MA 4AGVA 2WN3A 2XQXA 4HVOA 3RWKX 4R52A 2BGCA 3WDWA 5HI0A 1DDLA 4A7YA 3ZFFC 2HWB3 1AR62 4N7UA 3WT3A 3O0VA 4B1MA 4L11A 5CKMA 4XIKA 2R071 2RS11 5EYXA 5ABJA 5BNOB 1B35A 4F3JA 3VZNA 5LA1A 3HD8B 1BMV1 1UMIA 5L7OA 1JYVA 4XXPA 1NT0A 4YGBA 1PVC2 3N3HA 3WG1A 1RUJ2 3LGRA 4Z07A 4DFSA 2VBPA 1JYWA 2W1WA 3CF6E 4HKOA 2GC0A 5FQ0A 1UXXX 2D98A 3RZMA 3B01A 1ZZ9A 3B93A 5CIRA 3CZJA 2G1MA 2ZTNA 4Y5Z0 1GZWB 4YWAA 1DQ1A 2VGDA 3N36A 4YG0A 5G04L 4CE8A 1ZBA3 3THPA 5CFDA 2XLFA 1WCKA 5FYUA 1C3HA 2XONA 5FZIA 1CIWA 2GMPA 2CGNA 2G19A 4K8RB 3SC7X 4LKSA 1HQLA 2J1TA 2RJ2A 4U2AA 1H30A 1NCQA 1JZ7A 1QOTA 2QDRA 2Q1FA 2ZHKA 3KT4A 1CESA 2C0ZA 3C8XA 1EY2A 4K3UA 1V9U2 1W39A 1QXJA 5JMCA 4H3WA 2C1FA 1V0AA 2DU0A 4JRAA 1XU2A 4GULA 1WCQA 3AJYA 4ZS2A 4C0BA 4L0PA 2HWD1 1ND3C 2WS93 3OUIA 5C8CB 1VBB1 2P6CA 5K9YA 1H8TB 4K20A 5AFEA 5FY9A 3AL5A 1YQ2A 1YLLA 3QOPA 1OI6A 3KD4A 1QIQA 2JDHA 4WBBA 4LT5A 2HH9A 2ZHNA 1NZCA 1KFXL 1UY4A 3M70A 3WF4A 3FMGA 1MS5A 2XWJB 2RMU2 4G9SB 4QHZA 3WDVA 4YW2A 4WV8A 5LASA 3VBFC 1LRHA 1CX1A 1CAUB 2D3SA 4AK3A 5FKCA 1QXPA 3Q8AA 4BMEA 3M1HA 1HQNA 2ZMLA 4XMAA 2A6ZA 1BK1A 3JD71 4NRQA 1EAH2 1Y7BA 3ZFFA 4ARXA 4BQ4A 5LWBA 2P3KA 2HWC1 4YSFA 1TMF2 1VBE3 2Y38A 3BCWA 5JR7B 1RINA 1VBD1 3RGBA 2PHWA 5DUWA 3OCPA 2A3XA 4GWMA 2WRAA 1BEV1 3I4IA 1JHNA 4DXTA 3KSCA 2XG3A 4CUGA 1F35A 1LU1A 3AZVA 1S2EA 1G9AA 5AC92 4ITCA 2XLAA 4QKFA 1MZEA 2HWE1 2JX9A 4HETA 3PMSA 2YXSA 4QX7A 1QJY1 4XFBA 4UW3A 4COVA 4CU6A 4Z92B 2RM23 1ZM1A 3RG0A 5FZ4A 3PVEA 1RGSA 4RYDA 4UBHA 2I07B 2ZEYA 1JMUB 1W6OB 3HAGA 3OGGA 2AH2A 1YJKA 2XJTA 2J1UA 4GD4A 4KU7A 4XZUG 5C3PA 3WDXA 4CDXC 3WW1A 1LEMA 5FZLA 3F95A 3RJ2X 3FBYA 3HQUA 2GALA 2W46A 1X36A 3BVCA 2QCSB 5AVAA 5FLIA 1BK0A 2WQZC 5DDJ1 1CJPA 5J3UA 4MGTA 2BNOA 5IK5A 3I49A 3H0OA 1ND3A 3W59A 4XOGA 1QDOA 1UYYA 2KM2A 2GU9A 4FOYA 2KD7A 4OI4A 1JW6A 2QUOA 2QQPA 2GN7A 4CSWA 4FPYA 3WLUA 1D7PM 2YC0A 1ULCA 3M2MA 1UZYA 2DCKA 3B9IA 4J25A 1J58A 5E89A 3I3DA 3ZSKA 4PI0A 4FI9A 2BRTA 3QBQA 4QPIA 4UF0B 1AR91 3VBFA 1GKBA 2GNTA 2ZAAA 4SLIA 4LLOA 3CDZB 5IUQA 1FT9A 1RC6A 2PTMA 5JI9A 5FY4A 4FQZA 4XTPA 1IS3A 1RB8G 5F1RA 1MEC2 2RDNA 4P08A 1CZVA 3C3VA 3N9QA 2DVDA 4QKNA 3GZTB 1HRI1 3I97A 3N9OA 3LQCA 1UMZA 4WM8C 1FYUA 1Q43A 4IV1B 5J48A 5AFBA 1JZ8A 4LO7A 1TME2 2CL2A 3I2KA 3CJIB 4JTNA 2OYZA 4A3ZA 1NXD1 1FI2A 4AF9A 4LBQD 4EN0A 5JWPA 1VB4A 2A7AA 2RS51 1H2NA 2BUKA 4CCCA 4FPCA 2QQOA 5GZCA 1OKQA 2YU2A 1R091 1X50A 4PLOA 4AVSA 2E32A 1US3A 3ZIXA 2H6CA 4YM1A 4P5HA 3ZFEC 1GQHA 1GLHA 1H2KA 1DYOA 1QKQA 1ZRIA 4MXWA 4OHXA 2VQUA 2VZ3A 4RR3C 5FPBA 1SEFA 5FTTC 4PI2A 1I1EA 1LNSA 4WVVA 4IEVA 4QPYA 3VGIA 2SBAA 4COUA 2JXAA 2AEYA 2JEMA 4FO9A 1KD7A 2LS6A 2VMIA 4OZXA 2VZTA 5A7PA 5JOWA 1BVP1 5L73A 1UX7A 3ALQA 4HZFA 4K9SA 4B8EA 1PM4A 1DYPA 1ST8A 3CZUA 4E4HA 4CDXA 4FAGA 4CUBA 2WAAA 2DVBA 3AM2A 3LEIA 3JBG3 3NV3A 4QXKA 2HBTA 5ANQA 4CCMA 5A1AA 3CBNA 3GZUC 4PDWB 3W20A 4XUQA 4C90A 3FHAA 3NSTA 1B09A 4MUVA 3TEYA 4GB32 4PT6A 2DDUA 1R081 1GU3A 3VZLA 3ZKYA 4FOQA 5DAWA 2CV6A 2OZ6A 3LOIA 4RD7A 5F32A 2NMOA 1IOAA 1GMMA 5K8SA 2JJ6A 3ZXAC 5C8WA 3WQBA 5FR3A 1DGRN 4RGKA 4UFMA 5DABA 4CXWA 3H1YA 2C9AA 1VLNA 2YC4A 3VL9A 3DF0A 1BYHA 4XQDA 4HG6B 2DFCA 1TZOA 2KR2A 5FZ8A 5IK7A 1K5MB 1RUG2 4P00B 5D21A 2F4LA 2WNUB 2XKPA 3LDKA 2ZHMA 1RHI2 3SLIA 2PYTA 2X29A 4EZHA 3WVJA 3OBZA 2VZUA 4ASKA 5GJ6A 5IAXA 1SFYA 1W05A 3VD4A 4OHVA 1MVQA 4B29A 2E63A 1LECA 2WNVC 3DEMA 3MW4A 4I02A 2TBVA 3DKQA 4Q4X1 4E2GA 3HPNA 3B3QE 3S5QA 4F8AA 4QB1A 1T2XA 1VAKA 1V6NA 2HEWF 4N53B 3WW3A 4DINB 1UQXA 1VPHA 2XB6C 1YC61 5FIXA 4AFMA 1OVSA 4HSJA 4ZONA 5FP3A 1AVBA 5GLTA 3ZFEA 1PX4A 2ZX1A 4RR3A 3WNXA 1OXCA 3LFIA 1YFXA 4AQ6A 3QH6A 4O7XA 3NWKA 1ZZCA 3POBA 3N9LA 3PVOA 3R4SA 4DB5A 1YIFA 1O7FA 3GNEA 3ACFA 4V1PA 5FZAA 5I0RA 4JQRA 1MS9A 3N9NA 1O6UA 4CEWB 3MV01 4URTA 4TYSA 2OUHA 3NVCA 4PBPA 1OKOA 4EYUA 5JMOA 2V5DA 3SNMA 5KHGA 5JXHA 2C4XA 3HQXA 1LEDA 4EN7B 3P3NA 4Q5OA 5CZKA 3VBRB 3J26N 3POGA 1CQ9A 1UZZA 1PO22 4KBZA 1ZA7A 2XL9A 2VCBA 2I74A 1A6CA 5T5JA 4GJYA 1RXFA 1R64A 2CAVA 4MGYE 1G8WA 1S1AA 2FDGA 4WM7C 3AFKA 1OD5A 3HVDA 3BI3A 4LOSA 2ZABA 1ULDA 1W9YA 4P9IA 1SG3A 3MLLA 4AFBA 1RUE3 5FUNA 1UY2A 2ZA9A 2P4EA 5C8CA 3LDRA 2GC3A 4UOJA 1N3OA 1YUDA 4RFRB 5FZGA 2ZXQA 4OMCA 1CPNA 1LTEA 1Q8PA 1IG3A 3JQXA 3KM5A 4ZXEA 2WWJA 5ACA3 3QACA 1WMEA 2OIIA 2WNVA 3WQ0A 2B8MA 3UV9A 4QX2A 4BE3A 1W28A 1CAUA 1N1VA 4Y1UA 3AKSA 4KGGA 2Z5WA 5LEKA 1CAWB 1DQ4A 1VBE1 2A75A 3LCPA 2GAUA 3H3UA 3WDYA 4DQAA 3W21A 3WP3A 3ZXFA 3NJYA 1HX6A 2W5FA 4XMIA 4CA9A 5LA2A 4CP1A 2WR9A 4O9GA 4PIZA 2WYSA 1W04A 1W6QB 4XJWA 1UWWA 3RDIA 4JGZB 2ZKNA 3OEAA 3ZSJA 4HVRA 1XU1A 1W8HA 3MV11 4R9BA 3SKVA 1O4ZA 5F3EA 4CU7A 1O5UA 2YPJA 5GZEA 4D6RA 2VY0A 1J83A 1OBNA 3CL1A 3HNYM 2UWAA 3O1PA 4LBMA 4D6SA 1QJFA 3R0RA 4BH9A 2ZGNA 4OQ8A 2ORXA 4TN7A 5GALA 4N7IA 2R1BA 1YQ5A 2P6HA 3MFAA 1AR82 1OH3A 1OLMA 1ZZ6A 5JXGA 3BTXA 1Z78A 3T09A 1NA1B 4QDQA 1D2QA 2HWF2 3ON7A 1HXS2 1PVXA 4MSVA 1AR72 2CGOA 4LLFA 3U4SA 1DYKA 1YWKA 2WA4A 4LUKA 3RI9A 4ZXKA 1GSLA 2W92A 1VMFA 4MGIE 4PDWC 2R042 3OSDA 4KWLA 2GMEA 2YV8A 1GANA 4ZPIA 3ZMNA 5FO9B 4YM0A 1O3SA 1JTZX 5CFCB 3VBUC 2R063 1Z7S3 2E6VA 2CWMA 3X29B 2ARBA 4XQWA 1EV13 2RJLA 5F5CA 1CGPA 3H1WA 3H8RA 1MQTC 1FATA 5LBCA 3RYPA 2VXRA 2A6XA 2WSUA 2VM9A 1XE0A 3ZYRA 4QMAA 4EN8B 1Q3EA 2ZMNA 2RS32 4Y1YA 1EP0A 4RHV2 4Q4V1 2RE9A 2H6BA 2XJPA 5DAPA 2GSYA 3WSOA 3C2UA 3DECA 4NN0A 4IUGA 2BWCA 5GKAC 5IAVA 1NQDA 1W8OA 1Y9MA 4OCTA 3MPBA 5H9PA 4Q0VA 4PF5A 5FMBA 1W03A 3ZPYA 1PGL2 4FPJA 2WYFA 4Y24A 3VBSC 2GZWA 4YG3A 3ZDVA 3LDBA 1UO9A 1FOD2 2ZGLA 3URFA 4KNCA 2VUCA 4XFIA 2JDNA 3AXEA 4ES8A 1NOVA 4META 3BIEA 1ND2C 1POV1 1R1A2 4ES9A 1ZBE2 2UWCA 2A70A 3E5XA 2AUYA 4I0BA 5FYZA 3OPWA 2WABA 3ZN5A 4IGPA 2ADEA 1CAVB 2JG8C 5E1RA 4YW4A 5KWRA 4YFZA 2EIGA 2BJSA 3AXDA 5CU1A 3JZVA 4RN5A 4LEJA 4BQ1A 4FTSA 3CHXA 4RGGA 3NL1A 2HLEA 3ZSLA 4FXKB 3N9PA 1W6PA 1F5JA 1HLCA 3FX3A 1QJX1 3ZYFA 3ZKUA 2VJXA 4AW7A 5D1IA 5F3CA 1Y9QA 2V5YA 2R073 2O14A 2RS13 4AHZA 3K46A 2WC2A 5FUIA 1VBA2 1WA6X 2Q8CA 5IHRA 4YVSB 4UFHA 5FY0A 4FFFA 3USUA 2P37A 4UFKA 4UW5A 2ID4A 2VULA 2L9LA 4PDWA 2CDPA 3AP9A 1AL21 5LBEA 5LW9A 2AYHA 1HDKA 2R32A 1STMA 3ASIA 1TNRA 3VBUA 3ZXJA 2CDOA 3KVAA 1HW5A 2YC2A 3T2PA 3SHRA 4EN9B 4K7JA 1S55A 3UL2A 4OMDA 3WNMA 5BYNA 3S5AA 4LO8A 4QHBA 3AB0A 3IDAA 4Q0PA 3THDA 1IQDC 2CTVA 2D5HA 2P3YA 2OX0A 2FDIA 4FQ4A 3AMNA 2PAMA 3I2DA 1GYKA 1SPPB 1W8ZA 2VCCA 3OBTA 1FV3A 1OT5A 3K75B 5EPAA 1RUH1 1PGW2 1GZCA 4AVTA 5B4NA 1CN1A 5GZGA 3FLRA 5A3LA 1ZZBA 1WMXA 4GH4C 2DURA 1LU2A 2HWD3 5JVVA 1VBB3 3BB6A 1LHOA 4IV3B 1ZRDA 4Q26A 1T6BX 2ZX4A 2EF6A 1ND2A 1RUI2 2EALA 2AR6A 3IN9A 4N53A 1C8M1 4N9HA 5FY1A 1XNDA 3H1MA 4UW4A 3O1OA 2JG8A 2XDVA 5FMOS 3DXUA 1VJ2A 4M3CA 1D4M2 4J1WA 1UPSA 2V09A 1GWLA 1QJU1 5F5IA 3SITA 1CX4A 1VIWB 3GALA 1F31A 1QJZA 4Y1ZA 4YVWC 1WMDA 4CDQB 2PHRA 3NAPB 4HPKB 1X8EA 4LBKA 2VMCA 1COV2 1LENA 4RS5C 2HEVF 1UOJA 5LEJA 4Z8BA 2VECA 3W5NA 1QWRA 2HWC3 1DU3D 3OGVA 3PUAA 3BTYA 2VQ0A 4A6OA 5L9BA 1VBD3 2RJKA 1RITA 1WZXA 1YFWA 3KV5A 5F3IA 4A3XA 2FDFA 1JOJA 4GWJA 4CEWA 3RMYA 5FY5A 4RL7A 1SMVA 4K8FA 4XBLA 3D0SA 3IAQA 5F6KA 2VMFA 1W2AX 4TLFA 2HWE3 5FPUA 3CNAA 2YZ4A 3B94A 2BVBA 2WFF1 1KEXA 3HMYA 5EFUA 2DYCA 4AI2A 2UYAA 1QJY3 1JI6A 2YMZA 3KGZA 1ENRA 4MADA 3HIFA 3UETA 2K46A 4CCEA 1LOAA 1SLBA 1LHVA 2P1BA 4BOWA 1RUC2 5A6YA 3ABZA 1AYM3 1JYXA 2UWBA 3C7GA 2XVGA 4W65A 2F6BA 4LKEA 4YZ1A 4H55A 1HB4A 3O1RA 5FPVA 4WZFA 5ACA1 3GF6A 4E9KA 1WW4A 4YRDA 1YI9A 5JUVA 4L2NA 3I2IA 3OYWB 4GH4A 3S7IA 3U14A 1NLRA 5F9TA 2VOWA 4M4RA 1N1YA 3FC0A 2X05A 3I7DA 2J1SA 1ULGA 3ELNA 1JZ4A 3E97A 1RUD2 1JYTA 3HQRA 2QQVA 3LA3A 4Q0QA 3WF3A 4XHBA 1OOPC 5JOZA 4B3NA 4FPOB 1AR93 2BDRA 2WZR1 2V73A 4LR4A 1VBC2 1KITA 1PNGA 1GOFA 4CDWC 3AZWA 3OD4A 2FD8A 3MFCA 4D3WA 2JDYA 2LRPA 1HRI3 3WUDA 3WUCA 1LR5A 4XF3A 2B7YA 2ES3A 3FWEA 4FPFA 3FZ3A 1GOGA 4JHTA 3AKRA 5F2SA 5F7UA 2IVIB 4CDUB 2RS53 1YIPA 2B5HA 5F5QA 3KHCA 4X6RB 1R093 1QH6A 3H7YA 3MIFA 4JKKA 2ZGPA 4R9DA 2BEOA 2W87A 4M4PA 3MEPA 1HKDA 2VE1A 1WCUA 2VXJA 1DHKB 5L7OC 3B02A 5F8PA 4RFT0 2PMWB 2XXZA 3MLJA 4YARA 2A6VA 2Q8OA 3IM0A 3DCQA 2FMYA 2WN2A 1XE8A 1OLRA 5FZ6A 3W9AA 3LB9A 5D8AB 2R061 1Z7S1 2A6WA 4J1XA 3POIA 3VBOB 3A22A 5F6LB 4NRMA 2XMLA 5HPOA 1BBT2 2B9VA 5CFCA 2CHHA 1UL9A 5CFDC 4OUEA 4COZA 3ZFGB 2GP3A 4CCKA 2IVJA 4UFLA 1WBFA 3T3YA 1EV12 1QF3A 1VRBA 4A7KA 4CP0A 5FWJA 3A21A 1NCQC 1VRH3 4MHUA 3H50A 3ACGA 3I2FA 5IT6A 1QXRA 2DF7A 2ZGSA 4I30A 2BNMA 4HKLA 3HWJA 1R083 2PLV3 4QD2A 2WT1A 4Q4W3 4CEYB 5HXMA 2EXKA 2MPFA 2HJIA 4ISRA 3SH3A 5A6ZA 5CA6A 4JTOA 1LOCA 1YQ8A 1C8NA 3SISA 1XBFA 5DAQA 2VD7A 4GWNA 1XRUA 1XYNA 4ZY9A 4NWVA 4K40A 4AG4A 3Q8EA 4I0AA 4QX1A 1J84A 3NO8A 1GP5A 4L99A 4CDWA 3POEA 3ZIWA 3ZXKA 4XFGA 1DF0A 1Q8SA 1RMU2 2J42A 4LA3A 1O4TA 5GLWA 5I0DA 2W1SA 4LOTA 2ZEZA 1MS4A 1JS9A 4P14A 1CAVA 2RR12 2IFWA 3DGTA 1S4CA 4XHXA 3S57A 1W2NA 4IEWA 4A4AA 1H8VA 1I5PA 2FCUA 4Q4X3 4Z82A 3B7MA 3O1TA 2R6QA 4LO6B 2J1EA 2MEV2 2PQSA 3A7QA 3R6SA 5IVVA 4OULA 5M0TA 3NRUA 2JG9B 3NAPC 2ZGMA 4ET7A 3LIHA 1RUF3 3G6JB 2XJSA 4BXSV 1G9BA 4MH0E 4QQ2A 3N35A 4DXRA 5FP9A 1GICA 1DQ2A 4Y22A 3LA7A 1AR61 2Y6KA 3ZR5A 1Y3TA 5FZFA 1SZBA 4EV0A 3MIHA 5C9AB 2F4PA 2OPKA 5I91A 4AQTA 2Q30A 4XFFA 1RUJ1 2IXKA 3ETQA 4XXAA 1OA2A 4AI1A 3KF5A 3MF9A 1F8VA 1RJ7A 2X8KA 5FBJA 4XABA 5CKQA 4OZOA 4QM8A 3BKZA 1LJ7A 2R30A 1BHGA 1W06A 4CRQA 3OF1A 4ASLA 4A2UA 1WLDA 4JQTA 4QX5A 1IKPA 2PXJA 3D4KA 1U0AA 2ET1A 2RDSA 2SLIA 3P6BA 4ATFA 4NVPA 4PIYA 2OS2A 5FPLA 4YYOA 4EN6B 5K0UB 4Z2AA 4XCAA 3AKPA 2FDHA 2VUAA 5JOYA 1ASJ2 2OPWA 3Q8CA 3VD7A 4AI8A 1PZ9A 4LMFA 1DG6A 3KS7A 4LHNA 4GXLA 4JGYC 3AL6A 1UYZA 1E5RA 1V9U1 3IDCB 5A3TA 3DN7A 2GDFA 4EWDA 3N7LA 4NHKA 4JHZA 5IWFA 3RZHA 5GLUA 4DEQA 4IV3A 1I9RA 1HRV1 1MS8A 5BNQA 2NZ9A 2X5IC 5IYYA 3MGUA 1IKQA 1NUKA 4QPIC 4H2AA 5FLJA 3VDBA 3H42B 1L3JA 3PUSA 1GNYA 3DXTA 1XQNA 4W50A 3MIEA 4RQPB 1CZSA 5A70A 2BW8A 3M3EA 2VOVA 1PO12 4CDQA 3NAPA 4FFIA 1PK6C 1KDMA 5K7PA 1TVGA 3TN93 4XURA 3RNSA 4BK5A 2Q8EA 4NO4A 1OPMA 4LJHA 5FYMA 3O14A 3OPZA 4CZSA 3JD72 1MS3A 1VAVA 3ZN6B 4Q4Y1 3B00A 3V0AB 3J7NA 1AYN3 3ZVXA 4QHOA 2VNVA 1VBD2 4IL7A 4BCUA 4S2FA 1PZ7A 3MLKA 3BTZA 5CEHA 1BEV2 4KQ7A 4XAAA 3FLPA 3P1IA 4NIHA 2KXLA 3AC0A 3IB3A 3T0AA 2R0FA 1QQP3 5C7GA 4IEPA 5A7WA 4ZU4A 3M3IA 2BBAA 3ZOIA 1KQRA 3POSA 4K21A 3VD3A 1AYM1 2ZGTA 3H9AA 1F4AA 4QX8A 1N1TA 2WZEA 2X10A 3M4FA 4C1XA 3N7KA 4HONA 4JKMA 2W68A 3LSDA 2JE7A 2D3RA 2Z42A 5CISA 4BWOA 2D6PA 5A1FA 1UYXA 1DLLA 1VAMA 2PFWA 3GBWA 1IPSA 4XZPA 3MF6A 4XTMA 2G9ZA 5GLVA 3VDDB 3FFQA 2B39A 1H6XA 5FZMA 1JU3A 4M3CF 4JGYA 2ZEXA 3WP5A 4P9GA 3ILRA 2J22A 4GQ7A 1U5YA 5DDJ2 4BZ4A 1LHNA 2CY6A 4HLTA 4OHWA 2UURA 5A7QA 4CEYC 5I93A 1ALYA 1DLCA 2QQJA 2X5IA 4KWKA 5FZEA 4BQ3A 4FP3A 4JZRA 4Y26A 1YXWA 4LXLA 3J8F2 5J36A 4Q4V3 5C6CA 1DZRA 4QPGB 3GJAA 2DUPA 4H14A 3R05A 2BBVA 5EV7A 3RYRA 4YW6A 5K4LA 4K6BA 4NJ4A 5A3WA 2VCAA 3SEPA 4E4DX 2CGPA 1V00A 5JZGC 3AK0A 3I54A 5LBFA 1ODMA 2VUJA 1CR7A 1LODA 3HBZA 1PK6A 5DN2A 1LOFC 5FO8B 4X6QB 2QQUA 3VBHC 3WDTA 4BA6A 5FWEA 5E88A 3LSEA 2XHNA 2BTVC 5FP4A 1WKYA 3VV1A 1I6XA 4QGMA 3EBRA 4AVAA 1OVPA 4PLMA 3KMHA 3WHTA 1SBDA 3VL8A 1JYNA 1POV3 1YCIA 4LNVA 1GUIA 1LOGA 2QVSB 3IZOA 1FXZA 5BNOC 2XBO2 2Y6GA 3ACLA 2XUEA 4XJUA 4NPLA 1VP6A 3VKLA 1SQ4A 4JCKA 4CUCA 1PMHX 2GNMA 3N4MA 4N9IA 1W9FA 1H9PA 1RVF3 4BLIA 1VB2A 5F37A 1MR5A 4OI0A 2OA2A 3FUQA 4FT8A 1ZVFA 3RZGA 1QJX3 2WWUA 4INDA 5ISLA 3VBOA 2VH9A 3T30A 1WLCA 3PTYA 5I0TA 4CPBA 3H7JA 1MZ5A 4MOAA 3U11A 2BNNA 4AXOA 3A0NA 5LK5A 3ZFGA 4LBJA 4BQWA 1FPN3 1VRH1 5FZOB 3POYA 4IETA 4COWA 1S0DA 5DQ0A 5LZ6A 2D6LX 5BNPB 3WP4A 2PLV1 4Q27A 1AL23 1PMJX 4Q4W1 3DV8A 5SV5A 5GZFA 5J98B 1FAYA 3VB9A 3MO4A 2DVGA 1ZRCA 4AEDB 1S0GA 4ZU5A 1EUTA 3IMMA 1F2NA 1W6MA 4D94A 4CEYA 2FDJA 2DFBA 5FZ3A 4TWTA 1XPWA 4E8CA 5FZ7A 5C8CC 1H8TC 5T54A 4Q1RA 4YNIA 3O1VA 4AAXA 4FSJA 2WKKA 5E6HA 2VZOA 3ZN4A 2VR4A 4IGQA 4H7MA 1N47A 5JZGA 1QJEA 5T5OA 2O8OA 1Y9GA 5A6XA 1RUH3 3UKVA 4Q0UA 1LOFA 5HBAA 2A3WA 3VBHA 1RUG1 1YNAA 3GBFA 3TWIA 4C91A 5E8AA 1RHI1 3B69A 3EHKA 4P02B 2DBNA 3NKTA 4BB3A 1RUF1 4HSLA
chains in the Genus database with same CATH topology
1V6KA 1QDCA 4U36A 1BZWA 4Q4X2 4KL1A 2HWB2 1PHMA 1C8M3 1DQ0A 5BNOA 5JSRA 4L9BA 4FBFA 4N90A 4LHKA 4YZ4A 4BPZA 1QJU3 3VZOA 3WCRA 2PHLA 1KS4A 4AGRA 3R4DB 1OLQA 1WCSA 5DG1A 5CBLA 4YM3A 2EAAA 5C9AA 1GZWA 4QT6A 1WLTA 4B4RA 2ZZJA 1OFSA 2ZGOA 4QQOA 4AYUA 3VHNA 1Q8QA 4M00A 3N7MA 3IMNA 1PM7A 1JBCA 1DBNA 1ZBA2 4Y4YA 2OUJA 3VZKA 4IESA 1UU5A 2XGXA 3ES1A 3TRSB 2BFUS 4FPEA 1LCLA 3IDEA 3M3OA 1F9KA 4DRVA 2WFF3 1LGCA 4HT1T 4I3GA 3V64A 2GN3A 3ROUA 1OSGA 1UX6A 1WLWA 1J3RA 3AJZA 2PA7A 2ZX3A 3UK9A 1H8TA 4P9WA 1PO21 1H2LA 2WS92 4QGNA 3ZYGA 2O8QA 1S0IA 4Y20B 2YDEA 1G9DA 1Z0HA 1KJLA 2ZMKA 2G9GA 1ENQA 3R4UA 4HK8A 4BIOA 3ZDSA 2PHDA 1GFF2 3OJBA 2OZJA 1G7YA 4R4XA 5I8YA 1DGLA 2EA7A 3AMPA 2X53S 5FBZA 4GIQA 3TN91 4DXZA 3AYCA 5FOBB 1H0BA 4FCAA 3E6CC 4IV1C 5BNNB 5CG8A 2EVXA 4R9CA 1LGNA 3CJIC 5I8SA 4ZKTB 3WDUA 1AYN1 3AMHA 1VBE2 3J4UH 3ZYIB 2WZR3 2XJUA 1Q8VA 3M3QA 4X8PA 4UXAA 3FFZA 3D8CA 2JECA 4IEOA 1QQP1 3BALA 4YGDA 4ASMB 1LOBA 2ILMA 1WCDJ 4RGAA 2GNBA 3DPRB 4HVQA 2OW4A 2AENA 2WT0A 2RM22 1W6OA 1KXGA 3EXUA 3B5LB 4I3PA 3IDBB 4ONUA 1UD1A 1JH5A 3SCHA 4JRLA 4KU8A 1AR81 3KQRA 2Q5TA 3ZXDA 1PIV1 4DOUA 1UAIA 2QDNA 1BKZA 2HWF1 3V56A 1REFA 2DU1A 1AR71 4WVMB 2YROA 5DUVA 3ZXLA 1C5IA 1AXKA 2QKDA 3MZHA 2XJRA 5GLZA 5H9RA 3VHRA 4CTEA 1A8DA 1FV2A 3OY8B 1BCXA 2D40A 4QPGA 4LULA 1K5MC 2WNUC 2NLRA 2RS31 4RHV1 5KHKA 4AFAA 3N7JA 3WY6A 4IV1A 4I2OA 1S0JA 4UBGA 4HKWA 1LHWA 3CJIA 3WOGA 3WG2A 1KDKA 3FBMA 2YGLA 3G7DA 4LE4A 3IT8A 4XF0A 3KT7A 1ZYBA 1U5IA 1WGPA 4N43B 3TAYA 4E2QA 4MYEA 1YYNA 4HBNA 4N53C 1RUNA 4NPRA 4TSVA 1FOD1 3E5UA 3AZYA 5DG2A 3IPVB 3ZXGA 3VKNA 1RVF1 2VNRA 4WVZA 2NMNA 2ZBJA 4MX3A 1V70A 2VW0A 3Q9OA 1A8MA 1GV9A 1DQ6A 1F5FA 5JIAA 1U5XA 4XJAA 5A32B 5BY5A 4HL0A 2N7GA 1SLIA 1NCRB 3KCYA 1FPN1 4CEWC 5BPXA 5GZDA 2VW2A 3JBG2 1AR63 4FPHA 4QU2A 4GMP1 4YW5A 2PQQA 3FJSA 3TBDA 3VBRC 3MIDA 1VBA1 5ABJB 1AJOA 1B35B 1PVC3 3KZ4C 1RUJ3 4AEDA 3K48A 2NQYA 3ENRA 4DY5A 4GKXA 3PHMA 1D0HA 1UCXA 5FOJB 2EXIA 1IPJA 4EWAA 2DV9A 1K5MA 3RYKA 2UY8A 2WNUA 1Y43B 1QMJA 1O91A 2DCTA 5KXBA 4EROA 5CG9A 3H3ZA 2P2KA 1XYOA 1V6IA 1OA4A 2B46X 3E6BA 4R4ZA 4D7SA 2XPJA 1J3QA 3HT2A 1GR3A 3FUOA 1V9U3 3FHIB 1PGW1 5FMOL 3USSA 5FPXA 1JN2P 4OUSA 2PHFA 1HRV3 4XJZA 1BJQA 3ZX7A 5KC6A 1POV0 1W6NB 5I8TA 3POWA 2FQPA 1MZ6A 4JGZC 1XE7A 4FPGA 5DXDA 1NY71 1D4VB 4C0HA 1A3KA 1DQ5A 1RUOA 2RMU3 5T3NA 4XFAA 2NPIA 3ZXEA 1Q5OA 1D4M1 1AUYA 4PIXA 1NE4A 3AP4A 2BPA2 3AP5A 2Z79A 2ATFA 4Q4Y3 3OTFA 1EAH3 1GNHA 3NW4A 3ZFFB 1TMF3 1APNA 1M4WA 4Z2WA 3VBRA 1NA1C 4YG6A 2QNKA 3LWCA 3WD5A 2A71A 3PVBB 2XVKA 3AYEA 2DTYA 1N3PA 5KXDA 2RHPA 4BM8A 1PGSA 3WG3A 1I3HA 3ME2A 2E53A 1REEA 5CFCC 3GBGA 5BUVA 2JENA 5I0UA 1WD4A 3IBMA 4OVEA 1N3QA 4GKYA 1RUE2 2A5ZA 1J3PA 2XJQA 3WW4A 4FOWA 1RUC1 4Y20A 2DWRA 1CJDA 1ONAA 4FOVA 4XJ8A 5T55A 2VNOA 5L19A 5HXVA 5ACA2 4W6YA 2ZACA 1D2SA 3ZSEA 4XEZA 4AVCA 1OFNA 1CAWA 2GC1A 3M8LA 1S2BA 2UU8A 1AXYA 1IS5A 1H9WA 2IXJA 4IEYA 4S2GA 5CVRA 4HFSA 1W6QA 3HN1A 1ND3B 1WBLA 3JQWA 4JGZA 5A33B 3ZMOA 2XL7A 5FREA 1OPOA 4S2DA 1BXHA 4P9YA 4I01A 1MVEA 4AFDA 2JE9A 1VBC1 4FPLA 3AKQA 3O5SA 3VBFB 1TE1B 1MEC3 2E7TA 4DZGA 1YFUA 3D0JA 4BHPA 1MS0A 1O4YA 3DPRA 1ZRFA 2FZ2A 3HT1A 3MICA 1AX2A 2WT2A 1AX0A 4W6WA 1NA1A 2R1DA 3WINE 2VNGA 4YVSC 4Q8KA 4PJYA 1ZREA 3AYAA 3RMXA 3TNQA 3BTAA 3AP6A 2H0BA 2R062 2TNFA 1MS1A 1Z7S2 4MXWB 5EJ3A 4DNYA 5KBFA 4BLJA 5JLVA 3TOJA 4YLZA 2WZPP 3J9SA 1FMD1 5L36A 1BBT1 2GH2A 3QLQA 3ZYPA 5AVPA 3OY8A 4R9AA 5EZWA 2DUQA 2NP0A 1AF9A 4CDXB 1WD3A 1NXMA 1TEIA 1OQDA 4HN1A 4X8NA 1KRIA 1KJRA 2DUOA 1WW7A 4NHLA 2CYFA 2ZS6B 4LE3A 3QCWA 4YGEA 1PMIA 4XJ9A 3WZ1A 1IZ3A 2DCZA 3D6EA 1RIRA 4IV3C 1ZA4A 2D3PA 3D82A 3MIGA 4N43A 5LK7B 1BQPA 1SLTA 2D6OX 2H0VA 2VG9A 1JYIA 3S30A 5HCAA 1SFNA 3RQ0A 2WIIB 3TYJA 4F7ZA 1OQEA 2PHTA 1NG0A 1RUG3 3IPVA 3AMQA 1RHI3 1IS4A 4CDQC 1G6NA 3WCSA 1RJ8A 1VALA 2W52A 1TQ5A 4WM8B 2RR11 1J1TA 3RJRA 3PNAA 2DTWA 3PMEA 5A32A 1U12A 1NCRA 2R072 2MEV1 2RS12 4YVSA 1BMV2 4J6GA 3BPZA 1SLCA 2VMGA 1UU6A 1R1ZA 1JUHA 2HYKA 4YFWA 1PVC1 1LULA 3ZFEB 5H9SA 4JVAA 2ZKLA 4RR3B 2VVFA 4B4QA 2LALA 3BOWA 1C28A 1H4HA 1KS5A 1OMIA 3AKTA 2ET7A 1UN1A 2R0HA 4IEXA 4HMZA 4WVWA 1ENSA 3ST7A 3VUOA 1H1AA 3AMMA 4XQ4A 3UKNA 2E7QA 4ORFA 5CNAA 1UPIA 3P3PA 4Z1VA 5J7MA 2BVVA 2HWD2 1PO23 1XNBA 4AGGA 4MZUA 4AHYA 1VBB2 1ASJ1 2MHFA 2HEYF 1FNYA 1O3RA 5FCCA 1I5ZA 3AP7A 2YYOA 3RZZA 2VPVA 4L92A 4O9EA 1SCSA 4P9LA 4IEZA 1HRV2 3SMHA 4BQ1A 1W6NA 2P17A 4XPVA 3V0BB 2RMU1 5KC5A 2O1QA 1FX5A 4LBLA 4K1ZA 4HPKA 2PHXA 3E5QA 2QJVA 1AHSA 1X8MA 1YO8A 1QNYA 4LBQB 1EYBA 5I0SA 3PJYA 5JOXA 1MZFA 3K51A 2XH6A 4DPNA 2TUNA 3KLSA 1RTVA 1J59A 4LHLA 1EAH1 2HWC2 4XYXA 4CDUC 2WNVB 2O0OA 1PO11 1NQJA 1OQ1A 1UKRA 2XUMA 1TMF1 3SH5A 1XYPA 3KB5A 1TNFA 2IXIA 2Q4SA 2CWSA 1HV1A 4Q4Y2 4AFCA 1WMFA 4IQPA 3EJKA 5AC91 2WNEA 3VZJA 2HWE2 2A3YA 5D8AC 2D6KA 2D43A 1SBFA 1QJY2 3VBOC 1Q56A 3ILFA 1UF2C 4HANA 1IPKA 1W0PA 2D6MA 4JAAA 4QM9A 4FTBA 3PJQA 4XFCA 1AYM2 3ZFGC 4RSUA 4YZ5A 2ZCWA 4XBNA 3RSJA 1AR83 3GHMA 3OYWA 1PIV3 1PNFA 4G3YC 2HWF3 3U4XA 1HXS3 2WA3A 1M06G 1AR73 4FVVA 5FO7B 5FPZA 4LO5B 3CEWA 3OGJA 3ZO0B 2ZGRA 2R043 2ZGKA 2E9QA 4HN0A 3RI8A 3JB4C 1RL3A 3NV1A 1AJKA 3ATGA 4WM7B 2WQ4A 3UJOA 1AR92 2B9UA 4KG8A 1LOEA 5A33A 5C4WB 4H7LA 4COYA 2RS33 3J8F1 4RHV3 1CAXB 2C5DA 4K1YA 2BWAA 2DCYA 4PQ9A 4M0HA 3SCGA 1GQGA 1HRI2 1MEC1 1ZZ7A 4NR1A 5J37A 1H2MA 1CPMA 3JU9A 3WXPA 4CDUA 1Q8OA 1TME1 2K9ZA 2RS52 2W08A 2JG9C 4JV4A 4ZU7A 4FP2A 4QQLA 1R092 3APBA 2NYYA 1U5ZA 3B9CA 2WL1A 5DUXA 1FOD3 2I45A 1OA3A 3DUIA 2CNAA 4KBBA 2ZZQA 3NJZA 4OHYA 4NOTA 1UU4A 1R1A3 1SCRA 1ZBE3 5D8AA 4XF1A 3EQEA 2XBO1 2K0GA 2ZX0A 4GA9A 5C9AC 3ZYJB 2ZOEB 2PN5A 4OI1A 2GNDA 4JC1A 2XKOA 4IEQA 3H8UA 3GYDA 5FRAA 2DVAA 2LM3A 4JDOA 1AL0G 3THTA 1W6PB 4XFHA 4GMP3 4IXLA 1E57A 1QOSA 1QNWA 2WJSA 3MI8A 1VRH2 3FLTA 1H1MA 5K0UC 1VBA3 3MIBA 4B7KA 4GB31 4YM2A 1R082 2PLV2 3WX5A 4Q4W2 5H9QA 1ZZ8A 1C4RA 4P9XA 3USUB 1XNCA 3O0WA 4Q2FA 4XF4A 1KFUL 1LHUA 2GMMA 1GZ9A 1C5HA 3BODA 1IS6A 3VBUB 4M01A 3WR0A 3GHNA 4M3CE 2QZ2A 4AHWA 3WQ7A 1G9CA 1X7NA 2UY9A 1MQTB 4Y1VA 1YHFA 1NYWA 2D7FA 2FHRA 2ZGUA 2D44A 2G9FA 4P9JA 2OVUA 3T2TA 1C1FA 4RQPC 4XDQA 2VQAA 4AQSA 1A78A 2JG9A 3UKTA 1V6MA 5FAXA 4MLOA 4OHZA 3GZAA 1BVVA 2WFPA 1LGBA 1H4GA 4WM8A 1RUF2 3VBSB 1C57A 3AFGA 2WINB 2DCJA 1RUI3 3ECQA 3VKMA 2VMHA 5JSPA 1AXZA 2HWB1 3A4UA 3IKWA 1ND2B 1T6GC 1G9FA 4PCRA 1D4M3 5T5LA 2JG8B 4M3CB 3PVNA 2BQPA 4ISQA 5LRRA 5HCFA 1COV3 2AREA 2BFUL 4F83A 2IXLA 4YW3A 3L2HA 2YUEA 3M7AA 4FTEA 2JD4A 3WV6A 1X33A 5DZGA 2W0XA 5K0UA 4B7EA 1WA4A 1NE6A 1ZBA1 5JPMB 3O0XA 3D5OA 3VDDC 2UYBA 3A0KA 3KCXA 3T1LA 1N1SA 3I8TA 3BIWE 4XIOA 5KHIA 1J1LA 3LA2A 4M0NA 2QE3A 3WQ1A 4AVVA 5GM0A 2CAUA 1RUC3 2WLQA 4D7YA 4QPGC 2WS91 3S6PA 5JAXA 4AQ2A 4DMIA 1W0OA 4NWWA 5DZEA 2R49A 4RQPA 4HK9A 3V0BA 1SBEA 5C4WC 5EXOA 1AX1A 4LBQA 2D6NA 1S0EA 3AZZA 2GH8A 4Y1XA 4GH4B 3TN92 3ZN6A 2XVLA 4YGCA 4AI3A 5EYYA 3V0AA 3JUUA 1RUD3 2Q0AA 2YY1A 4KGQA 4AHXA 1LKNA 2YHJA 1AYN2 4BIFA 3WG4A 1S0BA 3JCIA 1V6LA 1VR3A 1XNKA 1QOOA 3O7OA 1VBC3 3VLBB 1ZX5A 1EPWA 3DL3A 3ZSMA 1HQWA 1QQP2 3ILNA 1WUVA 5JIUA 1SDWA 4YVWB 4CP2A 1UW8A 3HR9A 4RS5B 1CD3G 4QQHA 3L9JT 2PHUA 4JDMA 3OBRA 3NV4A 3O12A 2ETEA 3ES4A 2RM21 3VHOA 2P3JA 1YJLA 5BNPC 1HXS1 3VDDA 1QH7A 1WW5A 1ENXA 1JUIA 1JXNA 5B2GB 2D93A 4AEDC 2ERFA 1UKGA 2R041 5T50A 1LESA 1MACA 1PIV2 1REDA 3CLPA 4XETA 1IGOA 4Q0SA 3BOPA 4XF9A 3WHUA 2B45X 1IQAA 2WSVA 1FMD3 2P3IA 3AX4A 2LUWA 1BBT3 1S2KA 1JYCA 4OI2A 3WW2A 4Q4V2 4MVTA 4WM7A 3KCCA 1YFYA 3W58A 3MPPG 5C4WA 2VOXA 4FXGB 1CAXA 1ZNPA 2IWGB 2VW1A 3S7EA 5CAZA 2QFEA 4KG0A 2ZGQA 5J09A 3PLQA 1QU0A 4YW1A 4AEMA 1PGL1 2IXHA 3SXWA 2HKXA 1YRZA 3BU7A 3VN4A 1V6OA 2PAEA 3E6DA 1R1A1 1OOPB 1FNZA 1ZBE1 2PELA 3I59B 5T52A 5FLHA 1RMU3 2IC1A 3CU7A 1HV0A 4CDWB 1RVF2 3CO2A 2RR13 1QJX2 1AZDA 4QGLA 4LTAA 1PZ8A 2MEV3 5BNPA 1FPN2 2XWBB 3VKFC 2IXCA 1QHDA 4BMBA 1AL22 5L7OB 4SBVA 3SCFA 3JBG1 4KWJA 1DIWA 2KA3A 5KXEA 2ZHLA 2XLGA 4Y22B 3OD0A 2NM1A 5FQ0B 2ZJCA 2EXHA 5KHHA 5KXCA 4FAHA 3VZMA 5TSWA 1DGWA 1SLLA 2NN8A 4XBQA 3VKOA 1DFQA 2BYVE 3IWZA 2JDZA 5A3MA 5BV6A 5CFDB 1NLSA 3AZXA 1EPZA 2K2SA 3T1MA 4D69A 1MQTA 4OLLA 2LTNA 1RUH2 1H1IA 1NCQB 3U10A 2ARXA 4AEKA 3S0MA 4E2SA 1ASJ3 2Y26A 5BNNC 2I2SA 3RPQA 3JB8A 5J96B 4Q1PA 4LBNA 2W39A 2ZX2A 3MYXA 1W2UA 1RUI1 1C8M2 4KH9A 4E27A 3VBSA 4Q29A 5DZFA 5JSOA 2VVDA 2YGMA 4TZDA 1QJU2 1OHFA 2WWSA 4EJRA 2ENRA 1NY72 3TB0A 4L97A 4OFGA 4MGKE 3RS6A 1COV1 4YZ2A 1ULEA 3U0ZA 3DPRC 1S0FA 1PO13 2D5FA 4EWEA 1GBGA 5CB7A 1C1LA 3UJQA 4RA0A 2PAKA 3KT1A 4GMP0 4AE2A 3JD73 1O3TA 4W6XA 1CONA 2JICA 2P34A 5AC93 4AVBA 2WFF2 3DKWA 5IK8A 1BEV3 3LAGA 4LBOA 4ATEA 3AYDA 2EXJA 2AGSA 4LO4B 2XHKA 1XXNA 2VU9A 1SLAA 3L2YA 4B4PA 3IIAA 1LB2A 2E7AA 1UIJA 4R8HA 3SH4A 3RRDA 4G4FA 4BYYA 4OUMA 1RUE1 2Y0IA 5HCBA 2AZ5A 3MW3A 3KGLA 1URXA 4YZ3A 5BNNA 3LZZA 2Y0OA 2EAKA 4IEUA 2FBEA 3LKJA 4DRRA 2WLPA 1RUD1 4LA2A 2IZWA 4N43C 4JGYB 2MNGA 5DDJ3 4QQPA 5EWSA 4A7ZA 5BXXA 2GC2A 3NV2A 2WZR2 4IERA 4DY3A 2JKBA 3J8F3 2X5IB 4E4ZA 5JDBA 5E16A 2ZAHA 2R16A 2A73B 1IHMA 4QPIB 3RWNA 1O5LA 3WP6A 3MW2A 4S2HA 5KHJA 1HIXA 4LUMA 1DZQA 2XJVA 4XILA 1O3QA 1TME3 2G4IA 4MXVA 1DGWX 4YVWA 4C1WA 1PK6B 1NCRC 1ZRRA 4RS5A 3TNPB 5C33A 2Q1ZB 4AEJA 4NHMA 3NKGA 4PBOA 3LOBA 2XBO3 1V6JA 1X82A 4I0WB 5ABJC 1B35C 1DGRA 4WVMA 2VVEA 5FFOC 5SV8A 2ZPXA 1SACA 5IK4A 3QD6A 4FPKA 2QZ3A 4PLNA 1DZTA 5LRSA 5FDBA 2A6YA 2IFRA 4I09A 2Z2SB 5DUUA 1FMD2 1EV11 1QGLA 4D7TA 3EO6A 3FE5A 5JPNB 2TEPA 4GB33 1UIKA 3MDPA 5JI7A 3U07A 5T5PA 4XW3A 1D0GA 3QH7A 4GALA 2FZ1A 4AI0A 2D97A 1GNZA 1YI7A 3V65A 4MGZE 4L8QA 5JCTA 1WW6A 2FMDA 2Z69A 1W6MB 4JDNA 1QY4A 1CVNA 4E4SA 3CJXA 1G86A 3INAA 2VOKA 4CYDA 1RMU1 2B42B 4UW6A 4WZCA 1OOPA 1S0CA 3I59A 4MV2A 3VHPA 2E51A 5JZGB 4XE9A 5CADA 2DVFA 1ULFA 4AWDA 4Q8LA 3M3CA 3VBHB 4DS0A 2Q1MA 4AGVA 4HVOA 3WDWA 4R52A 2BGCA 5HI0A 1DDLA 4A7YA 3ZFFC 2HWB3 1AR62 4N7UA 3WT3A 3O0VA 4L11A 4XIKA 2R071 2RS11 5EYXA 5ABJA 5BNOB 1B35A 4F3JA 3VZNA 1BMV1 3HD8B 5L7OA 4XXPA 3WG1A 4YGBA 1PVC2 3N3HA 4DFSA 1RUJ2 3LGRA 4Z07A 3CF6E 4HKOA 2GC0A 5FQ0A 2D98A 3B01A 1ZZ9A 3B93A 5CIRA 2ZTNA 4Y5Z0 1GZWB 1DQ1A 2VGDA 3N36A 4YG0A 1ZBA3 3THPA 5CFDA 2XLFA 1WCKA 1C3HA 1CIWA 2GMPA 2CGNA 1HQLA 4U2AA 1H30A 1NCQA 1QOTA 2QDRA 2ZHKA 3KT4A 1CESA 2C0ZA 4K3UA 1EY2A 1V9U2 1W39A 1QXJA 5JMCA 4H3WA 2C1FA 2DU0A 4JRAA 1XU2A 4GULA 3AJYA 4C0BA 2HWD1 1ND3C 2WS93 5C8CB 5K9YA 1VBB1 1H8TB 4K20A 5AFEA 3QOPA 1YLLA 1OI6A 3KD4A 4WBBA 4LT5A 2ZHNA 1NZCA 1KFXL 3M70A 3FMGA 1MS5A 2XWJB 2RMU2 4G9SB 3WDVA 4YW2A 4WV8A 3VBFC 1LRHA 1CAUB 2D3SA 4AK3A 1QXPA 4BMEA