2Q4SA

Ensemble refinement of the protein crystal structure of cysteine dioxygenase type i from mus musculus mm.241056
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2007-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q4sA00
1J3QA 3S0MA 2XKOA 2QVSB 2H6BA 3E5UA 3NKTA 2XLGA 2Z2SB 3IIAA 3RYKA 4QMAA 2P17A 2Y0OA 3OD0A 3ACLA 2HKXA 3RNSA 1IPJA 4PIZA 4UBHA 1SQ4A 3IBMA 1IPKA 4F8AA 2VPVA 3I59A 2IXJA 3D0SA 1ZREA 4I09A 4A2UA 1GQGA 5JR7B 2XL7A 5KHHA 1UCXA 4QGNA 1RTVA 3E97A 1X8EA 5FPZA 1UW8A 4XF1A 2PTMA 3EHKA 3BALA 3RYPA 5J3UA 4B29A 4YNIA 4I0BA 1UPIA 3U0ZA 1FI2A 4RD7A 3FHIB 2XLAA 3LA3A 4MGZE 4XEZA 1XE8A 3I54A 2D93A 3ZDSA 5KHJA 3MYXA 2XHKA 3NJZA 4MX3A 4IERA 2UYBA 3OCPA 4PIYA 3I7DA 1OI6A 2GZWA 2PFWA 3BPZA 5K8SA 2EA7A 3JZVA 4HVQA 3H8UA 1FXZA 1YWKA 2OYZA 2QCSB 1EY2A 4QXKA 4I02A 3R6SA 4BH9A 4D7TA 2BGCA 5JSPA 1YUDA 1TQ5A 2Q4SA 3H9AA 4XF0A 3UKTA 2XLFA 4LUMA 4I3PA 1L3JA 4MGIE 1J58A 2VQAA 4X6QB 4XFBA 2B9UA 4HLTA 1RUOA 2CGPA 1XE7A 4XF3A 4E2GA 4HN1A 3LZZA 4Z82A 3RDIA 3FJSA 3NVCA 4AXOA 4KU8A 4K8FA 4ONUA 3KGZA 3CEWA 4IEWA 1OFNA 1O3SA 2PYTA 4LULA 4KWLA 2N7GA 3OGJA 2MHFA 4META 4MUVA 5E1RA 2PQQA 4BYYA 4OLLA 5C6CA 4XFGA 3WW4A 1ZNPA 5J48A 2CAVA 1ZZ9A 2D5HA 4J1XA 4QM8A 4XFHA 4P9GA 2OPKA 4IESA 4EWDA 2GH2A 3NW4A 3SCGA 4XFIA 4IEPA 4EWEA 2IXCA 4KU7A 2EVXA 3LWCA 2F4PA 5EFUA 3E6BA 5JSRA 4Q0QA 3O14A 2V09A 1QWRA 1O3TA 1CAVA 4E2QA 1DGWA 4ZU7A 1CAXA 4HSLA 3RPQA 5JSOA 3N4MA 2PAMA 2GU9A 1VR3A 2ETEA 1QY4A 2PHLA 5FLHA 5I93A 1H1IA 5BY5A 5J7MA 4IEXA 4ZU5A 1ZZ6A 1CAVB 2D5FA 5CU1A 2BNOA 1CAXB 2PAKA 3HT2A 4AVCA 5FQ0A 3QACA 1LB2A 3DN7A 3H50A 2Q0AA 4GULA 3BB6A 3E5XA 4E2SA 4ZU4A 2Q1ZB 5I0RA 3E6DA 4EWAA 4QGLA 1GQHA 2UY9A 3DL3A 4KL1A 4I2OA 3NSTA 4HZFA 3UKVA 1NE4A 1CGPA 5FCCA 3I59B 2CV6A 1O5LA 3DV8A 4IEOA 3C3VA 4BHPA 3H1WA 3PNAA 2C0ZA 2FMYA 2ZKLA 1RGSA 5F1RA 1Y3TA 3GBFA 3SXWA 4N9HA 5JCTA 5FLIA 1XRUA 3H1YA 5D1IA 1O3QA 3VHRA 1NE6A 2UYAA 3M70A 2WFPA 1J1LA 4F7ZA 4IEUA 5KHKA 3RZZA 4J1WA 4R52A 2I45A 1CAWA 4HVOA 1EP0A 3ES1A 2B5HA 1G6NA 3B02A 4QM9A 4JTNA 2ATFA 1WA4A 2XGXA 3KCCA 4IEZA 1ZRRA 1DZRA 2GAUA 1I5ZA 4O9GA 2K0GA 3H3UA 3SCFA 4LUKA 4O9EA 4I01A 1ZRCA 4AQ6A 4Z07A 2QNKA 2VECA 1CAUA 1UIKA 4KWJA 2K9ZA 3WW3A 2H0VA 1ZZ7A 4JVAA 4JV4A 2CAUA 3NL1A 1DGRA 1O7FA 5LRSA 3UKNA 1LR5A 2DCTA 3DKWA 1WGPA 3PVBB 1DZTA 3KSCA 3LOIA 3HQXA 1ZZBA 2H6CA 2IXKA 4XFAA 4FBFA 1VJ2A 5FPXA 1J3PA 3S7IA 1Q43A 1X82A 1SEFA 5BUVA 5CVRA 4X6RB 1YFXA 2OA2A 3CL1A 3G7DA 1RL3A 3L2HA 1EPZA 3WW1A 5KHIA 3LAGA 3KMHA 1ZZCA 1ZZ8A 3BU7A 4LTAA 2D40A 1J59A 3SCHA 1VP6A 3U11A 3GYDA 4XFFA 4BIFA 3OTFA 2O1QA 1RUNA 3ST7A 3EBRA 3FFQA 3CF6E 3HIFA 3MDPA 5FDBA 1PMIA 3S7EA 2IXLA 4XETA 3ROUA 4YARA 2ET7A 1OMIA 5I8YA 3EJKA 2FQPA 2Q30A 3H7JA 4WVZA 1SFNA 1YFYA 1J3RA 3LA7A 3MPBA 4LEJA 5EZWA 2QJVA 1ZVFA 2O8QA 4Q0VA 2PHDA 3ELNA 2PAEA 2GC0A 1V70A 3LA2A 1Y9QA 2ZCWA 4HVRA 4ORFA 1Q3EA 3IDBB 4N9IA 4IEQA 5I0SA 4FT8A 4WBBA 5FQ0B 4TLFA 4OFGA 3U10A 2GC2A 2MNGA 4MGYE 1ZRDA 2Z69A 5KHGA 3HT1A 4AVBA 1HW5A 4XFCA 3CO2A 3D82A 5BPXA 4QX5A 1Q5OA 4FAGA 3TNPB 2BYVE 5FLJA 2OZ6A 4Q0PA 4XF9A 1O3RA 2WC2A 1EYBA 1X7NA 3MZHA 4YYOA 5I91A 4MV2A 3WW2A 4EROA 2GC1A 3EO6A 2B8MA 3E5QA 4L11A 5C8WA 1QXJA 1NYWA 2MPFA 4D7SA 4Q0UA 3E6CC 4HN0A 4I0AA 1ZRFA 1O5UA 3CJXA 4HSJA 4IETA 4R8HA 1YLLA 2GC3A 1CAWB 1U12A 1NZCA 1CX4A 2HJIA 4HMZA 4QGMA 5E16A 3SHRA 2BNNA 3D0JA 5HI0A 4JTOA 4YSFA 4LA2A 3CLPA 1O4TA 4DINB 1LKNA 5T3NA 3IWZA 3EQEA 3SMHA 4KWKA 3H7YA 4AQ2A 3RYRA 5BV6A 4MGKE 1X8MA 2ET1A 4YRDA 4LA3A 1CAUB 1WLTA 5BXXA 3ES4A 4NVPA 1FT9A 3H3ZA 3M3IA 2IXHA 1PM7A 4CYDA 4L2NA 2KXLA 1YFUA 4LLOA 1JUHA 5LRRA 4PJYA 5I8TA 3IDCB 2PA7A 4XF4A 3H1MA 3USSA 3BCWA 1UIJA 5I0TA 1QXRA 2IC1A 5AVPA 4PIXA 3ETQA 1NXMA 2XL9A 2IXIA 4FAHA 2E9QA 4UXAA 5LEKA 4H7LA 3FE5A 4MZUA 1RC6A 2UY8A 4UBGA 5KBFA 5JAXA 2BEOA 5I8SA 5CADA 1LRHA 4IEYA 3PLQA 2BNMA 1UD1A 4AVAA 1YFWA 3OF1A 1H1MA 1ZX5A 3KGLA 1YHFA 3TNQA 2QDRA 4HBNA 3FX3A 4IEVA 2OZJA 5LEJA 3FWEA 1I6XA 3FZ3A 4Q0SA 4WZCA 2EAAA 5I0UA 4EV0A 4Q29A 3QOPA 4MH0E 2XKPA 1OD5A
chains in the Genus database with same CATH superfamily
4JAAA 3ZFEB 4Y3OA 3B9CA 4UW3A 2YGLA 1BLZA 4Q4Y1 5FYIA 5LASA 4QD2A 4AI2A 2WA4A 2Z2SB 3C7FA 2DUQA 4Y1VA 4XUPA 2P17A 4JGYC 3GZEA 3ACLA 3U1XA 2A6VA 5ACA3 4UBHA 5DQ0A 4BQYA 5HCFA 3IBMA 4JGYA 4RFRB 2HEYF 1XXNA 4LITA 1FPN1 1KJRA 2JG9C 2QQWA 1S0CA 1C8NA 1WKYA 3LIGA 4K21A 2WWUA 5C8CC 3FN9A 4XJ8A 2IXJA 3D0SA 2W91A 4MO3M 4F3JA 1UZWA 1GQGA 2BVVA 2JG9A 2CY6A 2YBSA 2Q8CA 2A6WA 4QQ2A 1O4YA 1UU4A 2ARAA 2Q5TA 2W94A 2JD4A 3RI9A 1AR92 1AXZA 2G19A 1RTVA 2XWBB 3E97A 3QLQA 4LKFA 5K0UA 3WR0A 3EB7A 1YRZA 3D5OA 2YHJA 2FDJA 5KXCA 1UOBA 5FYUA 4E4DX 3BALA 4O65A 3RYPA 4PBOA 3ZOIA 2CGOA 2JKBA 3DECA 4B29A 5DAVA 3CQOA 3WG4A 1VBE3 1HJGA 1IQAA 1FI2A 2QQNA 3J4UH 5FYCA 2RS12 2BP6A 2FDIA 2RDSA 4QX2A 1JUIA 1GZWB 1UYZA 4UFHA 3W21A 4AEMA 4G4FA 5CYYA 3ZDSA 5KHJA 5LWBA 4OQ8A 4CCKA 2W3JA 1AR71 4OHZA 4QXHA 4NO4A 5FK7A 1PGL2 2UYBA 1RUF2 4XQ4A 4PIYA 2J22A 3OBZA 2PFWA 4V2WA 3AYEA 3ACGA 4KQ7A 5KR7A 1WW6A 1ULDA 2OT7A 4OQ9A 1S0BA 2VNOA 4OZOA 3TYJA 1NA1B 4QDSA 3WUDA 4DXRA 4PDWC 1WMXA 1VE0A 3R6SA 4PLOA 1TVGA 4EN9B 1K45A 4BH9A 1MR5A 1GZ9A 5A1FA 4AYUA 2F4LA 5BNPB 3BN6A 5IVVA 1AVBA 5FXVA 3T1MA 3TBDA 5LA0A 4HL0A 2W2IA 4QX7A 5FP8A 4XZUG 4AGRA 4EN8B 5FYHA 1TQ5A 2Q4SA 2Y6KA 3ZXJA 2R062 3H9AA 3AX4A 4Q8KA 1US3A 3OGVA 1RMU2 3N9LA 1XNTA 1BJQA 1L3JA 1RUJ3 1OVSA 1D4VB 2VQAA 1HKDA 2D6MA 4IE7A 3VLBB 1RUOA 1KQRA 5D21A 4AE2A 5AC93 2W1SA 2LRPA 1AYN3 4IGQA 5DZGA 2Y8KA 2R6QA 1I5PA 3RZJA 3FJSA 4FCAA 4AXOA 4DY5A 4OI0A 4CDQC 5JZGB 2R072 4KU8A 3VBHA 2ZX0A 3I3DA 1OVPA 5GZDA 1C8M1 4CDQA 3KGZA 1A78A 4IEWA 2R49A 5A7PA 3C7HA 4LULA 1JU4A 1D7PM 3OGJA 5A3PA 5FPAA 1W9SA 1COV1 5F2WA 2QBXA 2ZGQA 5F5QA 5A1LA 4AQTA 5IK7A 3HBZA 1R091 3LQCA 1LHWA 1R082 1ZNPA 1W6NB 3JUUA 3M3QA 4LXLA 3GNEA 3TRSB 2VJXA 5J48A 5FP7A 3AP7A 1JHNA 2R16A 4P9GA 1YIFA 2ZGNA 2HWE1 1PIV1 4PHZA 1DP0A 3S57A 4Y22B 3B9IA 3RZMA 2Y60A 2ZX3A 1HRI1 2RJKA 3B93A 3WDYA 1GWKA 1EAH1 2WZEA 3VBOC 2NN8A 1AR82 3V0BB 2HWC2 2RS32 2V09A 2QQVA 3WQBA 1CAVA 5LB6A 1W8OA 3AP9A 3VBOA 1CAXA 4LMFA 4XABA 5FYVA 5JSOA 1C4RA 3MBWA 3N4MA 5A3OA 3THPA 2ETEA 4CP0A 2PHLA 5T5PA 5FLHA 3B7MA 3AVRA 3IDEA 2V5YA 5BY5A 1UXZA 4IEXA 4FFGA 3TOJA 4NIIA 3UJOA 4HOOA 3TN92 2RM23 2VG9A 2JG8A 4FFIA 3APBA 4RR3B 3BKZA 2PMWB 2K46A 3HT2A 5F7UA 4OHXA 2J1EA 3ZXLA 2JICA 1GWLA 1KGYA 5A7WB 2EXJA 3VN4A 4FTEA 2D98A 2ZZJA 2A6YA 5CIRA 4MXVA 3WDTA 1DDLA 5FWJA 3E5XA 2G9GA 4COYA 5GZCA 2ILMA 2KA3A 4GD4A 4A6SA 2ZHNA 2QQKA 4IQPA 3ZX7A 5C5TA 1TME1 4B1MA 5LBCA 4KL1A 4I2OA 1REEA 3NSTA 1U5YA 4SLIA 2DCJA 2WSUA 1NE4A 2JDZA 1GANA 1ND2C 1SZBA 3T0DA 1CIWA 1RUC2 3I59B 1G86A 4D94A 4IEOA 1LU1A 2XJRA 3JQXA 3P3PA 2FCUA 3SH5A 2P4EA 3W5NA 4OI2A 3SXWA 4N9HA 1WCSA 1W6OB 4IGPA 1GBGA 3RRDA 4ASKA 5JCTA 2FCVA 3INAA 3VDAA 2VUJA 4HKLA 1W8HA 1WLDA 1XRUA 1VBB3 2QQIA 5FZ6A 2E7TA 5FKCA 5D1IA 4DRRA 3VHRA 1O3QA 1UOJA 4XYXA 1VBD3 5FXWA 1FYUA 4GMP3 4CCMA 3I2DA 3WSOA 4BQ3A 5CA6A 5IAXA 4Q5OA 3I2OA 3RZGA 3RZZA 1RJ7A 1F8VA 4WVWA 2X5IC 1N1VA 2P37A 2P6HA 3ZXDA 2FCTA 1WMDA 1KD7A 4NIAA 1GFF2 4CCJA 3FLTA 1EP0A 4NWVA 4CCOA 3I2KA 2B5HA 3T3YA 3B02A 3WP6A 2WN2A 1QIQA 1DZRA 2GAUA 3FC0A 3O1MA 2CU5A 2EIGA 2FZ1A 4GJZA 1QOSA 4QQHA 3LDRA 4AF9A 2VBBA 3HN3A 3SCFA 3WCRA 4AVSA 1CESA 4O9EA 2VD7A 3PVEA 4AHXA 1YNAA 2BGOA 3WXPA 1F5FA 4UFKA 3GCWA 2QNKA 4EYUA 5HCBA 3A21A 1JZ3A 3AZYA 3JBG2 4JVAA 5A3LA 4NIHA 1MZEA 1UNBA 2CAUA 2WBKA 1DGRA 1OA3A 1N1SA 3AKQA 2GMMA 1WBLA 4DZGA 5C4WC 1B35A 3OYWA 1SPPB 4TSVA 3DKWA 4KNCA 1FOD2 1MS8A 3VL8A 4BQ1A 1NLRA 1SCSA 5GLVA 3K51A 4QHZA 2OKXA 1OXCA 3HQXA 1ZZBA 3O1UA 1J84A 4AHZA 2IXKA 3ACHA 4GH4C 1NAEA 1SFPA 5DUUA 3M2MA 3GBGA 4BCUA 2UWCA 3HOBA 3NNFA 4GH4A 4D6QA 5IAVA 5L9VA 3N3HA 4L9BA 5A32B 4YFWA 3U4SA 4UFIA 3BTYA 3IMMA 2OA2A 4NAMA 3CL1A 2WR9A 2WABA 5EQUA 3AJZA 1LOFC 2FDFA 4CE8A 1EPZA 1PNFA 2ZMKA 2VGDA 4OMCA 4LBLA 4B7KA 5KXBA 3JD72 3AZWA 3LFMA 4QB2A 3PUIA 1RUD2 1LOFA 1RXGA 1WWYA 1H4HA 2XMLA 1ZZ8A 3M8LA 2AEYA 2JEMA 2DURA 2DVAA 4Z8BA 1LEMA 4Y1ZA 1J59A 2RVAA 1T2XA 3SCHA 5HV0A 2WT2A 3SISA 5GLTA 3ZYBA 2RMU3 5IVFA 3NRUA 2YDEA 1I9RA 3KM5A 4NWWA 1ZBA3 2Y6JA 1N3QA 5L36A 4CCCA 1W04A 1PMIA 3PUHA 3PVNA 1OC1A 2IXLA 2JDNA 2W68A 2B45X 1YQCA 4Y4YA 5F8PA 4Q8LA 1XJAA 1HIXA 5FYTA 4ARXA 1JS9A 1ZVFA 5EPAA 2RR11 5FZGA 3VDDB 1IQDC 1QH7A 1MS5A 4Q0VA 4Y26A 4P5HA 3ZFEC 2XHNA 1IS3A 3POYA 3ELNA 4QPWA 1H1AA 2PAEA 1ODMA 3POFA 1RHI1 1Y9QA 3LDBA 2XH6A 4HVRA 4ORFA 4QQPA 4B4PA 5CBLA 1Q3EA 5FOBB 1NY72 4N9IA 3AB0A 5FKBA 3VD9A 5I0SA 4FT8A 1IKPA 2O14A 5FQ0B 4DFSA 4OFGA 1RUE3 1HXS2 2MNGA 4ATFA 3K2OA 1JYXA 3KT7A 4Q27A 1XQNA 5C3PA 1C1FA 2WNVB 5CFCB 4EJRA 4YARA 1PO13 5JMCA 4NOTA 4AGVA 4LO8A 1Q56A 2GP3A 2GP5A 4XFCA 5JOZA 5FZ9A 4QX5A 5IVJA 2IUWA 4LE4A 5ABJB 4AVVA 2GMPA 1H8TA 2HLEA 4MVTA 3AXEA 2C1FA 2BVBA 3NWKA 4K1ZA 3LIHA 3ASIA 4XF9A 1QEXA 1UY3A 2G1MA 3CU7A 3KWVA 4BQ4A 2FDHA 5DPNA 1LJ7A 1X7NA 1HB2A 2WO2A 3SEPA 4BIOA 2D6NA 1RUG1 5DDJ1 2ARCA 4UOJA 4MV2A 5F32A 4YW2A 1PGW1 4EZ4A 4LE3A 1DF0A 4IV1C 2GC1A 3HMYA 2NM1A 1LCLA 1NYWA 1QXJA 3WV6A 1UKRA 4IDZA 4IV1A 3DKQA 3T2OA 2XQXA 4PF5A 5FMBA 5A7QA 1LULA 2IFWA 1NA1C 1UX7A 4GWNA 1Y9MA 3WP3A 1RUH1 3W58A 1HB1A 1LESA 4I30A 1ENXA 3M3EA 1NA1A 4IETA 4MHUA 1YLLA 2R0FA 1CAWB 2RDQA 5BNPC 4PLMA 4WM7B 1CX4A 1HV1A 2YMZA 2ZGOA 1DBNA 2OXBA 3NO8A 4IE0A 3WDWA 2W92A 3AYDA 5BNPA 1AR93 3Q8AA 2ZGSA 5CFDB 1KFUL 4JTOA 1UOGA 4TZDA 3ZSJA 1KFXL 3WX5A 3P5BA 4FPHA 3OY8B 1FMD1 1WLCA 4ET7A 1LHVA 3EQEA 3FUQA 3VBUB 4AFMA 4KWKA 3KVBA 3AKTA 2RS13 3CIHA 5FZOA 1AL21 3RYRA 4AQ2A 3I2HA 3V64A 3O1PA 1OD3A 1ULOA 3A23A 4LA3A 1CAUB 1VRH2 3M3OA 3OJBA 5FZLA 2ZGUA 5JZGC 1GR3A 1W6PA 1RUF3 1BBT1 2VTXJ 1OQDA 5JZGA 2IXHA 1F5JA 2WIIB 2GDFA 4LPLA 1OT5A 2YU2A 4MOAA 4N53B 3WHTA 4CYDA 3AP5A 1UYYA 4FFHA 4JGZB 4RGAA 4WV8A 3AC0A 5IATA 1TEIA 4AFAA 4CP9A 3BI3A 3PURA 5LBFA 4CPBA 1JUHA 1ENRA 3POGA 5BNNB 4AEDB 3VB9A 3MUZ1 4RS5B 3BOPA 2R063 4UF0B 2NLRA 2ZA9A 4L99A 4W6YA 5DG1A 2XB6C 1RMU3 4FQZA 4NHXA 4CZSA 1V6KA 2P3IA 1W6NA 4HANA 2RE9A 2VCBA 3OPZA 4FOYA 1RITA 3VBSB 4NRQA 4GKXA 3ZMNA 4PIXA 4AI3A 3LEIA 2HBTA 3N9PA 5FZFA 1YQ6A 4D8MA 1OUXA 4NIDA 3TEWA 4H7LA 2BBAA 4Y1YA 5EYXA 4CXWA 4DO0A 4P14A 1CWPA 1N1TA 4LKEA 1D0GA 1G9DA 3I3QA 4X8NA 1K5JA 5KBFA 3Q8FA 2JKXA 4LO5B 2PHXA 4OVEA 5L7OB 5I8SA 1VPHA 5LW9A 3I2IA 2Y6GA 1OLQA 3VV1A 1Y9GA 3WF2A 3X29B 4E8DA 3VZNA 4AVAA 3IDAA 1WMEA 2QDNA 1H1MA 4BQ2A 3MW2A 2QQPA 2ZOEB 4YGEA 3ZN4A 4E4SA 5FMOS 4IEVA 5IFTA 1U0AA 1VMHA 1W99A 1HB4A 2WL1A 2WQZC 1N3OA 1GNYA 2ZEZA 5FYBA 2DU0A 2W52A 4ISRA 1PVXA 5LEJA 1R083 1G7YA 5IJRA 2OIIA 2QUOA 1JXNA 1VBA3 4INDA 1JYVA 4QXCA 3MIEA 5I0UA 4EV0A 4Q29A 1ZA7A 2WZR1 1DGLA 4M3CE 2XKPA 5T54A 3DPRB 5JSPA 1OD5A 1J3QA 4JHZA 4N43B 3MLLA 3S0MA 2XKOA 2WN3A 1W8UA 3NKTA 2XLGA 1DGRN 4QWNA 4IGOA 3I3MA 1GQPA 1Y43B 4XCBA 4QMAA 2Y0OA 3OD0A 5GLWA 1AR83 3RNSA 1BZWA 2HWC3 2RS33 1REFA 3BIEA 1IPKA 1Z0HA 1W39A 5LY2A 1ODNA 2VPVA 1W8TA 3I59A 1GP6A 2W0XA 5AFBA 5K9YA 4AL9A 3MPPG 5JR7B 1XPWA 3ME2A 1UQXA 2XL7A 1U5ZA 3Q8CA 2W9XA 2BGPA 1W6OA 2ZAAA 2ZGPA 4KG0A 2Z42A 3A7QA 3TN93 4MG2A 5FRAA 1X8EA 1LGNA 5FPZA 1J1TA 1QQP1 1UW8A 2A71A 4XF1A 3WCSA 1W9YA 1ASJ2 1AX2A 4L97A 5KC5A 3KHBA 4XZPA 4ZXKA 3K77A 4LBJA 5BNOB 4ZONA 3BUCA 3WG2A 1WMFA 4ZS3A 4A44A 4CU7A 4AQSA 3M7AA 2XLAA 4Y5TA 3LA3A 1BCXA 1AYM1 1D2SA 1FNZA 3AMHA 4YVWB 2X05A 2DUOA 5FTTC 2YXSA 3IAPA 4CEYB 1SBDA 4JKKA 3J8F1 4LLFA 1GICA 1ND3B 1OI6A 1QXPA 2GZWA 3I7DA 3BPZA 4FPCA 4PQ9A 3UV9A 1AR62 2DU1A 3H8UA 2DFBA 4DB5A 1YWKA 2HWD1 1EY2A 1PO21 2JE8A 2YC4A 1ENQA 4D7TA 1H6YA 2X29A 1SDDB 4C90A 1FV3A 1W9TA 1V9U2 2ZGLA 2A75A 4B1LA 1IG0A 1US2A 1MZFA 4D6RA 2ZPXA 4M3CA 4TN7A 4XDPA 4CU8A 3FBMA 4Y20B 2XLFA 5FAXA 2NQYA 4I3PA 4G3YC 3BGAA 4ZPIA 4I3GA 4AWDA 2XPJA 3GCXA 5C33A 1J58A 3QH7A 4LKSA 2B9UA 4HLTA 3SEEA 3BODA 3VZOA 5I0DA 4XMAA 1S0DA 1CZVA 3VBHC 4E2GA 2MEV2 1QHDA 4HN1A 1I1EA 1CVNA 4Z82A 4R9DA 3O1SA 3L9JT 4EQVA 2HWB1 5F3EA 2XVGA 4RHV1 3PIJA 2Y38A 5A32A 3OOXA 5J09A 4K6BA 1FV2A 3PIGA 1OFNA 2VZSA 2PYTA 4QPGB 3D6EA 5J37A 2VVFA 1ULPA 1YO8A 2AENA 2R1DA 3OGGA 3P1IA 5IVCA 4OCTA 2DDUA 1BEV2 4KWLA 3UETA 1SBEA 5CKMA 1GWMA 4YM2A 2MHFA 4META 3WP4A 2BZDA 2TBVA 4XTMA 1H4GA 3NNJA 5DUWA 1QJX2 2PQQA 3MLKA 5E1RA 4OLLA 5F39A 5FK8A 3VGIA 4AI9A 4BYYA 1UXXX 2XVKA 3JBG3 4LIUA 3WP5A 4D7YA 5FXZA 2A1XA 1P8JA 2J7MA 2PN5A 1UZVA 4K7JA 5GM0A 1XNBA 2CAVA 2E33A 3MV11 1TMF1 3VBFA 1FOD3 4IESA 4EWDA 2GH2A 2I07B 1LU2A 4AAXA 1SLTA 5A7SA 1XNCA 3DXUA 4W65A 1QKQA 4Z2AA 1JYNA 4KU7A 5JOXA 4NRPA 3PUAA 4AI8A 5EFUA 3E6BA 4Q1PA 1GMMA 5JSRA 1PVC1 5BYNA 3VDDC 1NCRB 1DU3D 4HPKB 4NUBA 2A5ZA 2HWF3 3DGTA 4BZ4A 4Q4Y2 2VZUA 1E5RA 3FHAA 2XBO1 3LCPA 4PI0A 2XXZA 2A3XA 4XVHA 3VDDA 4E2QA 4URAA 1Q8OA 4ZU7A 1JZ7A 2ZAHA 4HSLA 3RPQA 2ADEA 3R4UA 4Q26A 3D3AA 2PAMA 3THDA 1SLAA 1X50A 5GZGA 1MQTA 2BWAA 4QQLA 3JD73 1JHJA 4LNVA 3NV4A 1RUD3 2W95A 2PHWA 4M4RA 1FPN2 1VAKA 4QDRA 4ZHNA 3SKVA 1YI9A 5HV4A 2X53S 5EJ1B 1OURA 3HAGA 2D5FA 5CU1A 2EIBA 2PAKA 3HNYM 4FXKB 3CZJA 1GSLA 5H9RA 1QJFA 2D6PA 3AMPA 4AVCA 5FQ0A 1LB2A 1HX6A 3PVOA 2WNVC 3ZN6B 5CFCC 4JZRA 4A3ZA 3TB0A 4FTBA 1HRV1 1XB9A 2WSVA 1GNZA 2VR4A 3BB6A 5T55A 4E2SA 4EWAA 5ABJC 1JYCA 3FHQA 2WFF1 4CXYA 5C8CA 4DEVA 3N7MA 3DL3A 3I2GA 4CUBA 5ABJA 2VMHA 2UWAA 4HZFA 4DUXA 1OH4A 1RINA 3HPNA 5H9PA 4KGGA 3Q9OA 5F6LB 3UGFA 4EN7B 5DAXA 2CNAA 4Z92B 1OSGA 1W9FA 4YW4A 3RWNA 1AR72 1WCDJ 4BU2A 5F1RA 1Y3TA 1PNGA 1W2UA 4AG4A 3POIA 4TLGA 5FUPA 2E51A 3ENRA 1FX5A 2KR2A 4AVTA 5JPNB 4S2DA 4XACA 3H1YA 4COVA 4XAAA 1W3VA 4AEJA 3CNAA 3WT3A 2A3YA 1HXS3 1NE6A 1GOHA 5FY0A 4MHRA 3AZZA 1C5IA 4UW6A 1J1LA 4DXSA 1UAIA 1X33A 4F7ZA 3C7OA 3IT8A 4WM7C 2A73B 1QJU1 1GKBA 5GZFA 2VAUA 4ZY9A 3RSJA 3THCA 5A6QA 5FR3A 1CAWA 2AZ5A 1JYWA 4H2AA 1L7QA 2JDUA 4WM7A 1LOCA 1PM4A 1XU1A 3H42B 5A1AA 5CFDC 4CDXB 3LDKA 4W50A 2YPJA 2VZVA 2X8KA 3CZUA 3ES1A 3J7NA 4GALA 4PDWA 5CFDA 1UY4A 1W0NA 2YUEA 2XJPA 4Q4W1 3KCYA 4O61A 2XGXA 3KCCA 2JX9A 4IEZA 5DG2A 3SNMA 1CZSA 4CUAA 1SFYA 3VBUC 2JECA 4M0HA 3HN1A 2D44A 1TNFA 4FPEA 2WA3A 4MGQA 5G05L 1I5ZA 5KWRA 2WS91 4O9GA 2H0BA 1Z78A 4QPIB 3WNKA 4LUKA 1EPWA 5EP9A 1R1A1 1C8M2 5LBBA 4LBQA 1ZRCA 1LENA 4LK6A 5ANNA 1CAUA 4KWJA 1PMHX 1O3TA 2HYXA 5EXOA 5FP3A 3V0AB 1A34A 3LF7A 1ZZ7A 1GV9A 2WYSA 5CISA 2JDPA 4JV4A 1X9TA 3NL1A 5LRSA 4R9BA 1COV2 2VMGA 2DCTA 1C5HA 4JGZC 2VUCA 4KBZA 4R4XA 1BXHA 3POJA 1R092 4NPMA 3KSCA 5T52A 3DYOA 4BDVB 2H6CA 5BNNC 5E89A 4AEDC 2VZ3A 2CGNA 2VUDA 1VJ2A 2VOKA 5BNNA 4AEDA 2HWE2 1PIV2 3OEBA 4NRMA 1Q43A 1XE0A 3N9OA 3U78A 1LECA 3B94A 3OBRA 1T6BX 3VBSC 5BUVA 2EIEA 2GNTA 4XBLA 1HRI2 5CVRA 4X6RB 5GLZA 1QJY1 2B7YA 4QKNA 2Q8DA 1OOPB 1EAH2 3G7DA 2ZABA 4LBMA 4M0NA 1VBA2 4LORA 1IS4A 1UMIA 1LOGA 2WYFA 1YYNA 2VOWA 4XJAA 1QGLA 1SLBA 2YBKA 5KHIA 1VRH3 2A70A 5K4LA 2HEVF 3LAGA 1Q8QA 1ZZCA 4DQAA 4LTAA 2ID4A 2D40A 4DUVA 1MEC1 2LM3A 1VALA 3N7KA 4OYUA 4AHYA 1VP6A 5A3WA 3OBTA 2DVDA 2R071 5DUXA 4R4ZA 2VNGA 5FZ1A 5FY7A 3MIGA 3ST7A 1ZA4A 3RZHA 2E31A 3S7EA 1DQ0A 2VZ1A 4U36A 1RUI1 2PHRA 3KV9A 2FQPA 2R30A 4S2HA 4WVZA 1NXD1 1QOOA 1JZ6A 4YVSB 5FZ8A 1J3RA 2RJ2A 4UYBA 3DCQA 3LA7A 3WF0A 3AJYA 2O8QA 1TME2 3NV2A 3DPRC 2NYYA 2ZJCA 4N43C 3USUB 2XDVA 1CPMA 3LSEA 4HK8A 1Z7S1 3C2UA 3DPRA 1KRIA 2PLV1 1V70A 1JOBA 1MS9A 3LA2A 2ZCWA 4AK3A 2O8OA 1RYYA 5JLVA 1K42A 1F2NA 5IFPA 1OHFA 2BW8A 2V72A 4FOVA 2LUWA 3N7LA 4JX0A 2D43A 3GHMA 4WBBA 4TLFA 5FZ3A 3ZPOA 5F37A 3U10A 5A7OA 4UW4A 4MGYE 3ZMOA 3VUOA 1OFSA 1IKQA 1E5HA 4DEQA 2Z69A 4XTPA 5KHGA 1HW5A 1DQ1A 1D4M1 1F31A 2WT1A 1ND2A 5BPXA 1WCKA 1V6NA 3NNGA 5A80A 1VRBA 2RDRA 1Q5OA 4FAGA 2BYVE 5M0TA 2E7AA 2P1BA 3H3LA 4LIVA 2OZ6A 3LFIA 5FLJA 4MLOA 4PF1A 4DNYA 2RS51 3MUY1 2DYCA 4Q0PA 2XJSA 1H9PA 2WNOA 1AZDA 5BNOC 4ITCA 1EYBA 3BU0A 1BK1A 1JTZX 3N9QA 5FMOL 4GWMA 1MVQA 2CYFA 5BNOA 3MZHA 4LHNA 1PGSA 4YYOA 3QCWA 4GJYA 3BPSA 4OI4A 4YVWC 2HEWF 3KF5A 3QH6A 3DEMA 3FUOA 2RV9A 1IGOA 3BYWA 1W6MB 3L2YA 3JB8A 3OUHA 4TYSA 4CEYC 1PX3A 5GALA 4YVWA 2Z5WA 5FZAA 2CTVA 1W0PA 2VBDA 1ND3C 4Q4V1 4CCEA 4CEYA 1BVP1 2X5IA 3ACFA 4QKDA 4D7SA 3K48A 3VHPA 3M4FA 4OULA 5GJ6A 2DTWA 3Q8EA 2WNEA 4HT1T 2AC1A 1ZRFA 1CD3G 1O5UA 4LBQD 3CJXA 1RUC1 2UU8A 2ZX2A 1U12A 2ZACA 4E9KA 2ZGMA 3CKHA 5DUVA 3SH3A 2JIJA 3HBKA 2VW0A 2BNNA 2JWPA 2XG3A 2VMCA 5EWSA 5FZ4A 3AVSA 4LA2A 1DYKA 3WF3A 1ASJ3 1O4TA 1G9CA 4Y24A 1EV11 3NQHA 3J7MA 1OUSA 3ZIWA 1B09A 4QX1A 2QQMA 1ZYBA 2VXRA 3VKOA 5JI7A 4K3UA 5A3TA 5IYYA 1DLCA 4MGKE 2C6SA 4Q4X1 1IS5A 4YRDA 5FZHA 3KHCA 2GSYA 5C4WA 2JDMA 3ES4A 3CDZB 4NVPA 2WZ8A 5IK5A 2ORZA 1VMFA 4YZ1A 1AR63 1RVF1 3AKPA 3VDCA 2R041 4CDUB 2YY1A 1PM7A 4EN6B 4A4AA 5D8AB 3ZVXA 3VBRB 3OSDA 4LOTA 4WVVA 4WVMB 2P2KA 2KXLA 1Q8SA 2HWF2 5FZIA 1YFUA 3KLSA 4LLOA 2Q1FA 1K5MB 2YC2A 4YPJA 3ZYJB 1V9U3 4YWAA 4GB31 1MPXA 4PJYA 1H2MA 2WUHA 4RL7A 1HV0A 2CL2A 3A0NA 4CEWB 1QF3A 5B4NA 1KEXA 3S30A 4XHBA 4KI5M 3IM0A 1W2OA 3VHOA 1NKGA 3H1MA 1IHMA 3BCWA 4Q2FA 4W6XA 2ZZQA 5CNAA 5E88A 5JPMB 3VZKA 1ONAA 4COWA 2QQLA 5A33A 5FMDA 4ASLA 1V00A 2E9QA 2RR12 2WINB 5H9SA 3T2PA 4YZ2A 5LEKA 1LOBA 2OUJA 2MEV3 4MXWA 5EYYA 2VW2A 3ZYGA 3FLPA 4PT6A 1NCRC 2LTNA 4UBGA 1VBC1 3B69A 1O91A 4GAZA 5C3QA 1F35A 4CDWB 1RHI2 4KG8A 5CADA 2DCZA 4IEYA 3O1TA 3URFA 3RJRA 1YFWA 1UU6A 3MGUA 1YHFA 1BEV3 1AX1A 4JDMA 3AFGA 2VW1A 1CONA 5FZ7A 5T5OA 1QJX3 5LA9A 3RZLA 1JN2P 1MVEA 4UFMA 4Y4RA 3ZFEA 1ZBE1 3FWEA 2OQ7A 1POV1 5EHDA 4IE4A 2G9ZA 1LAJA 4CU9A 2EICA 3ZYPA 4COUA 1V6JA 4WZCA 2EAAA 1VIWB 3A22A 1LOEA 2E63A 2VXJA 4WM8B 1RJ8A 1UMHA 4MH0E 1AXYA 3JQWA 2LS6A 1OQ1A 4GWIA 3I3BA 4M00A 2BU9A 5LBEA 2V4VA 2D6KA 4AGGA 2QVSB 5ACA1 2CWMA 5FZCA 5EIYB 4CSWA 3RYKA 4C1WA 3NV3A 4AEKA 2ZBJA 1IPJA 3AL6A 1RUG2 1SQ4A 4PIZA 3LGRA 4Q4Y3 1XBFA 4HK9A 5DDJ2 3WF1A 2W5FA 4F8AA 1S2BA 3IZOA 1PGW2 1J83A 3D4KA 5FYMA 4CXXA 2PXJA 3ABZA 4FQ4A 1ZREA 5FPVA 4I09A 4DIQA 4DRVA 5B4XA 3N9MA 3ZYIB 2VZPA 4K8RB 2FDGA 1FPN3 1TZOA 1RUH2 1UCXA 1Y4WA 2VQTA 4XE9A 1DQ5A 4DS0A 5LA1A 3MLJA 2J1RA 3ORJA 4BLIA 4C0BA 4NJ4A 1GZWA 1VBE1 3SLIA 2PTMA 4GWJA 3VKNA 1OQEA 4KGQA 2YU1A 3EHKA 3AMNA 1BMV1 1LNSA 2B42B 5J3UA 3UESA 4YNIA 4I0BA 3T0AA 2QZ2A 4FXGB 1OPOA 1O59A 2KM2A 1F9KA 5F3GA 5K0UB 4A41A 3FHIB 5DXDA 4BQXA 1CIYA 1H9WA 4MGZE 1FMD2 3I54A 2D93A 4AZZA 3MYXA 2XHKA 3NJZA 3R4SA 5ISLA 1JOJA 4IERA 2VOXA 2WWJA 1AL22 3MF6A 2VE1A 5IVBA 1S2KA 2A6ZA 2F17A 3LPFA 3ZXAC 4AAPA 1AX0A 1AF9A 4LO6B 4A7ZA 2R1BA 4PCRA 2DVBA 2EA7A 4HVQA 1AR73 1FXZA 1H2NA 3HD8B 2IVIB 2BBVA 2OYZA 1BBT2 2D6OX 2QCSB 4I02A 5FIXA 4Y5Z0 1VAVA 3VZMA 1H2KA 4B4RA 1CJPA 3UL2A 1FATA 1DYOA 1APNA 2VBPA 1GP4A 1RUJ1 3ZIXA 3WINE 4LR4A 2ZGTA 2YB7A 2XUEA 1XU2A 1JW6A 3OGSA 4FOWA 4LO4B 3U37A 3MFCA 3T0BA 3ZYHA 2XVLA 5FMCA 3AYCA 4LHKA 5AC91 1UL9A 2VZTA 3ATGA 3F95A 1AXKA 3R05A 4JDNA 5LY1A 1AYN1 1H2LA 4UI9L 3TEYA 2R7EB 2CGPA 5D2AA 2ZHLA 3RS6A 1SBFA 1K12A 3ZM8A 5TSWA 1ENSA 1LODA 4YW6A 2VU9A 4P9IA 2YGMA 3GGLA 5FO7B 4H14A 4C91A 3O5SA 1OA2A 1OLRA 1DYPA 4K8FA 3ZO0B 2QQUA 3C7GA 1WW7A 1DQ4A 1OOPC 2BQPA 2P3JA 4ONUA 4RYDA 3CEWA 4CCNA 5FO9B 1O3SA 2NZ9A 2W1WA 2Y34A 3I49A 4W4ZA 3POSA 1XSQA 3O7OA 4IV3B 1XYPA 2LALA 2N7GA 3F2ZA 1C8M3 3GZTB 2QFEA 3KQRA 1O8PA 3VBHB 2ZMLA 3KCXA 4K1YA 4MUVA 1IZ3A 1CX1A 5IVEA 2C24A 2Q1MA 1IOAA 1EUUA 2W39A 3R4DB 4XFGA 4Y22A 3WW4A 2ZHKA 2JDKA 3AKRA 5KXDA 5JXHA 1ULFA 4MGTA 3VD5A 1ULCA 3FL7A 1COV3 5BNQA 3K3OA 1LGCA 2D5HA 2W1UA 5FY8A 3MIHA 3GJAA 2OPKA 1R093 4OMDA 1GYKA 4R9AA 3NW4A 4HG6B 3SCGA 4ZXEA 4BLJA 3V0BA 4IEPA 5FXXA 4EWEA 3WNXA 1CQ9A 1NLQA 1SLIA 3I2FA 1AJOA 5FY4A 3LWCA 4LBNA 1HLCA 2WZR2 2HWE3 1PIV3 2VY0A 4LBOA 4OUEA 3VL9A 4G9SB 4BMEA 2WO3A 3FFZA 2GALA 3T4HB 3BTZA 1KJLA 2NMOA 1HRI3 2YC0A 4RR3C 5JXIA 1DGWA 1EAH3 3LD8A 3NJVA 3S5QA 2AR6A 2FMDA 3HQUA 3PJQA 4RR3A 5DMYA 3IN9A 2C9AA 2RM21 2GU9A 2WRAA 1QY4A 5HXVA 4UT5A 2B9VA 5A7WA 2VM9A 3PMSA 1XNKA 2PELA 2JE9A 2WLPA 5I93A 2FBEA 2WNUB 2ZEYA 3M3CA 4YZ3A 4ZU5A 3WG1A 5J7MA 1CAVB 3M1HA 4XUQA 2Q8EA 2BNOA 3SQOA 1CAXB 2KD7A 5FO8B 2JE7A 4K20A 3IPVB 1S0IA 1YQ5A 3KV6A 1BHGA 1W9WA 3DN7A 4NROA 1QJZA 5C8WA 5GZEA 1UYXA 3N35A 2VCCA 2RG4A 4GULA 5CZKA 3RJ2X 2J1UA 3AYAA 4IXLA 4S2FA 3RI8A 1QQP2 4Y1XA 5F6KA 3LEMA 5AFEA 4FOQA 2JG8B 3KZ4C 5I0RA 1VLNA 4XJWA 3E6DA 2X10A 5FP4A 4ZKTB 1W05A 4QHBA 2E53A 1QNYA 3A4UA 4QDQA 1N1YA 3RVHA 1GQHA 2UY9A 2V73A 3ZSLA 5E6HA 1AUYA 2JDYA 2E32A 4O7XA 4YFZA 1NCQB 1CGPA 1AYM2 1PX4A 2CV6A 1O5LA 1TME3 3VKFC 3C3VA 5LCWL 4BHPA 4AI0A 3T08A 2E6VA 1DFQA 2FMYA 2ZKLA 4UFJA 1VBB1 3J8F2 1NT0A 1MZ5A 3W20A 1UY1A 3GBFA 4BPZA 4A7KA 2VNRA 1VBD1 4GXLA 4GMP1 5FLIA 5FUIA 1D0HA 1ULEA 3BTXA 2VMDA 2XONA 2HWD2 3SC7X 1QH6A 1PO22 1KITA 3THTA 5L9BA 2ARBA 4QB6A 5L9RA 3M70A 1FAYA 5GLUA 3DYMA 2Y26A 2WFPA 4BE3A 1UYPA 2ZX1A 3K4ZA 5KHKA 1JH5A 4R52A 2I45A 5FYYA 1BKZA 1PZ9A 4K40A 2NPIA 5JOWA 4HVOA 3C7EA 4XDQA 1K3IA 4JHTA 2E7QA 3ZXGA 5IW0A 2AYHA 1CR7A 3RQ0A 4XURA 1LHOA 4FPJA 4QM9A 4JTNA 1YJKA 2YG0A 3POEA 1DG6A 1S4CA 4BISA 1SG3A 3WQ1A 5FREA 3TWIA 5C9AB 4AHWA 2HWB2 3ZXKA 3H3UA 4RHV2 4PQQA 4CPBD 3CJIB 1UN1A 4TWTA 1SPPA 2VZRA 3AMQA 4I01A 5DZEA 5CG8A 4CVUA 3AP4A 3K46A 4B4QA 4Z07A 2VECA 2ARXA 5IWFA 4C8DA 3WW3A 1G8WA 3OPTA 3CHXA 4XBQA 4CDUC 3VD4A 4Y33A 1WLWA 5D8AC 4QT6A 1UY2A 4U2AA 3UKNA 1LR5A 3ZR5A 5FZKA 1G9FA 4LBKA 1HDKA 2JIGA 1WGPA 2X09A 1DZTA 3PVBB 5D8AA 4BK4A 2WJSA 4GIQA 1JZ5A 1K5MC 4BK5A 2WAOA 4LJHA 4XQWA 3HNMA 3VZLA 1TMF2 4FBFA 1SLCA 4CEWC 4HONA 3UJQA 3D8CA 5F5IA 4NPRA 1QMJA 1J3PA 1B35B 3OYWB 1BVVA 1WUVA 3S7IA 3IIIA 3MEPA 4CEWA 3PTYA 2SBAA 3VDBA 3NAPB 4A42A 5J1XA 4D69A 3EYPA 5LATA 3ZYFA 4K9SA 4DY3A 1PVC2 4F83A 3T09A 4ES8A 4GH4B 1YEWA 2ZTNA 1UKGA 2VZOA 5FOJB 2AH2A 3WW1A 2XBO2 4BJ0A 1KDKA 2RMU1 2PQSA 3BU7A 1ZBA1 1GP5A 4XUNA 4CDWC 2DBIA 2DCYA 2JDAA 2JENA 3U11A 1OA4A 1WW4A 3BOWA 1O8SA 5IUQA 4CDWA 4XFFA 4BIFA 3VD7A 1WBFA 2OUHA 2O1QA 2P34A 5FWEA 2W87A 4YM0A 1LHNA 2DWRA 3AP6A 3AZXA 3CF6E 3EBRA 3FFQA 3HIFA 5ANQA 5FDBA 4LHLA 3GJBA 4C1XA 1W28A 2FDKA 3ROUA 2F6BA 2ET7A 5AVAA 3LSDA 3EJKA 2Q30A 4CTEA 2LROA 1HRV2 2VZQA 2EF6A 1SFNA 1YFYA 4P5YA 4V1PA 3U4XA 5FFOC 3MPBA 4XJ9A 3T30A 1Q8VA 5F3CA 2AUYA 2WFF2 2OS2A 3OUJA 4RQPB 5A3UA 3W5MA 2ZHMA 5C3OA 3KT4A 2HH9A 4CP2A 2RR13 4N90A 4QPYA 5IHRA 1RUE1 2WNVA 5CFCA 1UMZA 2DF7A 4IL7A 2K2SA 4L92A 2IFRA 1HN0A 3IB3A 3K75B 2TUNA 4NPLA 1PO11 1F4HA 1RHI3 2GC2A 4UAPA 2YFZA 4XIKA 2Y6FA 5DAPA 3WF4A 3WNPA 1U5XA 2XWJB 4YW5A 1ZRDA 2JB4A 3BTAA 1ZRIA 4AVBA 1S0GA 3HNBM 3PJYA 2E26A 3ZR6A 4CCDA 3D82A 3VKMA 3T2TA 3GXUA 3TEXA 2BFUS 3ITQA 4XMIA 5IK4A 1H0BA 1QJU2 5FYZA 1W2NA 4R9CA 1IPSA 2OX0A 3O12A 1O3RA 1IG3A 2WC2A 5KC6A 2VCAA 2QZ3A 4CU6A 4GQ7A 1GNHA 4CRQA 3DUIA 1HJFA 5K0UC 1HB3A 1F4AA 3O1OA 1H8TB 4OUSA 4E8CA 4Q4W2 5I91A 1C57A 3LOBA 3MV01 4XDOA 4BA6A 3H8RA 3WW2A 4JC1A 1WD4A 3EO6A 2B8MA 3O0XA 2WS92 2Z79A 2MPFA 1RUG3 5DDJ3 1JZ4A 4Q0UA 2C4XA 1R1A2 4B8EA 1DIWA 1E5IA 1M06G 2ZS6B 2WLQA 4ZS2A 1NG0A 4YW3A 5DN2A 1AR91 1BK0A 1S1AA 2OQ6A 4DUWA 4HSJA 2VOVA 2GC3A 2ZX4A 3OY8A 3UYJA 1NZCA 2HJIA 1RUH3 4IV1B 4QGMA 5CG9A 3SHRA 1UF2C 1S0JA 2EIDA 3VBUA 4NE9A 4JCKA 5FBJA 3UNPA 2W1QA 1SACA 2HYKA 3ZPYA 4YSFA 3V56A 2RS11 2CDOA 4DINB 1LKNA 4MYEA 4N53C 1VMJA 4IE6A 4MGSA 1PGL1 5CB7A 1RUF1 1E5SA 5BV6A 4FSJA 2WKKA 3PHMA 1X8MA 4N53A 2ET1A 4TTGA 1O6UA 1FMD3 1QJY2 5A70A 1WLTA 4E4HA 4JGZA 2P3YA 2ZEXA 4YGBA 4JRLA 4LKDA 1AL23 4RS5C 3SKJE 1H6XA 1FT9A 5C71A 3JXSA 4FPYA 4AOCA 2ZMNA 1W90A 3K4DA 4YG0A 5FZOB 3ILNA 4RS5A 2J1VA 4UF0A 4P9XA 3SH4A 4L2NA 1BBT3 4IV3C 1MEC2 2R061 1W6PB 4J6GA 4L0PA 3RWKX 1GOFA 1NX9A 4OI1A 2BV4A 4QX0A 5FZ0A 3ZFFB 1RMU1 4IV3A 4LQRA 4MSVA 3VBSA 1I3HA 5JIAA 4W6WA 3KT1A 5EV7A 2BWCA 3AMMA 4Z1VA 2EXIA 4JDOA 4DXZA 5I8TA 2ENRA 5FJKA 1YIPA 4LO7A 5APAA 4HXCA 4XF4A 1YQ2A 1YJLA 4AFCA 3H8OA 1RUI2 5L7OC 4FPFA 3AFKA 1STMA 5I0TA 2XR4A 4CP9B 1MS4A 1TNRA 4E4ZA 2GN7A 5L19A 1KS5A 2B46X 3MIBA 5L7OA 3O0WA 4IE5A 4QB1A 3ETQA 3AZVA 3RGBA 1NXMA 2XL9A 4ZZ8A 3ZLIA 4UXAA 2VMIA 4EE2A 4QAWA 4YGDA 4P02B 4MZUA 1OLME 3J7LA 1JZ2A 4FPOB 1W03A 1RC6A 4XUTA 2WDBA 5JAXA 5DZFA 4NHKA 1Z7S2 4ARYA 1EUTA 1MACA 2PLV2 3I8TA 2W08A 4XJZA 3PLQA 3T2QA 1XNAA 1ST8A 2QKDA 4AW7A 2R32A 1JMUB 2JB8A 2P5BA 1XC6A 2Y6LA 1VB4A 2VTXA 3HQRA 3W59A 1R081 4HBNA 2NP0A 2WNUC 4ZZ5A 5FZDA 1WW5A 1LOAA 5F5CA 1VBA1 1LHUA 3NNMA 5CAZA 2WNUA 4DMIA 3TEZA 4N43A 2DUPA 5FY1A 2OZJA 1DLLA 1CZTA 1D4M2 1I6XA 1W8ZA 3FZ3A 4OZXA 1KDMA 2DBNA 2VUAA 2UURA 4KMQA 1A6CA 3IPVA 4Q0SA 2VQ0A 4NAOA 1BYHA 5H9QA 5FPLA 3O0VA 3LE0A 4FP2A 2BJSA 4JKLA 3WY6A 2BPA2 1OKQA 2JDHA 1E57A 2JG8C 2AGSA 2RS52 4QQOA 3IMNA 4OHVA 2DV9A 1AR81 3U07A 4QHOA 3I4IA 2HWC1 3RMYA 2H6BA 2RS31 3E5UA 2ZKNA 5F9TA 2WZR3 3IIAA 5SV8A 5T50A 3PL0A 1NCQC 3I2JA 2HKXA 3J7HA 4XOGA 5SV5A 1AHSA 1GUIA 4YW1A 4BMBA 4H55A 4LHSA 4DOUA 1OF3A 1NCQA 3JCIA 4XIOA 1W6QB 1HQWA 2PHTA 3TN91 4Q4V2 2LW8A 4A2UA 2G4IA 2B4KA 1POQA 2SLIA 1DQ6A 4HETA 5KHHA 4QGNA 5B2GB 4A7YA 2AEZA 1NQJA 1R1ZA 5JI9A 1WCUA 3ZDVA 1V6OA 3OPWA 3WVJA 2IZWA 3U14A 2XJQA 1OLMA 3T1LA 1ND3A 1QQP3 4V2VA 2Z4FA 1UPIA 3U0ZA 3N7JA 3KD4A 4RD7A 1NUKA 2RHPA 1EV12 3MICA 3ACIA 1Y7BA 2HBUA 1XE8A 4XEZA 3WOGA 4DXTA 3ZXFA 1JBCA 4BWOA 4P08A 3LKJA 4MX3A 1RIRA 5C3RA 3OCPA 3O1RA 1AYM3 4Q4X2 2WZPP 5K8SA 2FHRA 3QD6A 3SITA 2FD8A 3JZVA 5EJZB 5C9AC 3J8F3 4Y20A 1NLSA 1OBNA 3CJIC 4QXKA 1GZCA 5GKAC 3PTRB 1RVF2 5C9AA 2R042 4RA0A 3TNQA 2BGCA 1F15A 2J1AA 3CJIA 5C70A 1AJKA 1OPMA 2VULA 1YUDA 2HWD3 4B3NA 2UWBA 5FZBA 1YQ8A 1PO23 4BOWA 3LPGA 3HEIA 2ORXA 2A3WA 3R0RA 4QU1A 4XF0A 2OW4A 1UY0A 1WCQA 4IUGA 4LUMA 5T5JA 3UKTA 2WT0A 1DGWX 2P3KA 4N7IA 1OF4A 4GB32 4MGIE 4D6SA 3WNOA 1QDOA 2W47A 2ES3A 4QPGC 4X6QB 1JODA 1GZTA 4XFBA 3BVCA 1V6MA 4ASMB 4M3CB 1XE7A 2BOJA 5CKNA 4QPGA 4XF3A 1B35C 2QQOA 3LZZA 1SHWB 3RDIA 4C0HA 2WWSA 3NVCA 1DQ2A 1GOGA 5FY9A 4LOSA 3MF9A 3ZFGB 3NAPC 4FP3A 5EJ3A 2ADDA 5CKQA 3WG3A 2I74A 2R0HA 3NAPA 1JOPA 3FMGA 3DF0A 1VBC2 2HWB3 1PHMA 2XJVA 3JBG1 4RFT0 1PK6B 4RHV3 1W2AX 4XXAA 3VHNA 1L7LA 3ZKYA 3H8XA 2OVUA 2YFUA 3U75A 1SMVA 5C6CA 1FOD1 1S55A 4XXPA 4AR2A 3WQ0A 2GN3A 5FZMA 1ZZ9A 4D3WA 4J1XA 4QM8A 3MHZA 1C3HA 4XFHA 1RB8G 1NCRA 4XILA 4HPKA 1ZBE2 2RDNA 4XFIA 3UGGA 3P6BA 1PMJX 4NR1A 5JOYA 3WNNA 2IXCA 2HWF1 1TMF3 2D97A 2EVXA 1OKOA 2F4PA 4QU2A 4CA9A 3CBNA 3AL5A 2VL4A 4Q0QA 3VBFB 4N8MA 1G9BA 3N36A 2EXKA 1UPSA 4QXBA 5ACA2 3O14A 2O0OA 1X36A 1A8DA 3CMGA 2GNDA 3JD71 3QBQA 4NHMA 5F2SA 1QWRA 1RUD1 2Y64A 3N9NA 3PDQA 4MADA 4RQPC 2JJ6A 3GZUC 1URXA 1PVC3 3ZSKA 4RQPA 1BQPA 4XCAA 1JYTA 1VR3A 2DCKA 3ZN6A 2ZXQA 2XBO3 2L9LA 4XHXA 2GH8A 1H1IA 3RG0A 5JDBA 4S2GA 1ZZ6A 2GNMA 3A0KA 1A3KA 1FNYA 3B3QE 5HXMA 3KS7A 5IT6A 1REDA 3EMRA 1SCRA 3QACA 2VCMA 1MQTB 3C8XA 3ETPA 2D3SA 1JYIA 1QU0A 2C5DA 3H50A 3RFRA 2Q0AA 3V65A 4QKFA 3WD5A 1UU5A 1VBE2 4ZU4A 1W8WA 2Q1ZB 1SDWA 3GHNA 3MW3A 1C1LA 1BMV2 1HRV3 3AK0A 4QGLA 4ISQA 4P9YA 4CUGA 2BUKA 3UKVA 4JGYB 3GDBA 3NJYA 5A3NA 1QJEA 1YXWA 2ZGKA 5FCCA 2BRTA 2WFF3 3DV8A 1POV0 4NN0A 1NY71 4XJUA 4PI2A 3H1WA 2JG9B 1H8TC 3PNAA 1QOTA 2C0ZA 5C8CB 1V0AA 1RGSA 3ILFA 1S2EA 4PBPA 3KF3A 1HXS1 4YG3A 1NZIA 5C7GA 1UZZA 4LK7A 1UZYA 2P6CA 2AREA 3MFAA 1GU3A 5A3MA 4Q1RA 2VTFA 1TG7A 4CDXC 2G9FA 1XOYA 5FPBA 3FBYA 4TXWA 3MIDA 2Q8OA 2UYAA 5F5AA 2XQRA 4CDXA 1XYNA 4ATEA 1RUJ2 1ACCA 4IEUA 2AACA 4J1WA 3PUQA 1NQDA 5JR2A 4NHLA 1W8FA 2VH9A 4QPIC 5AC92 2C26A 4XUOA 5HPOA 1YC61 5C3SA 1AYN2 1QJU3 2JXAA 4QPIA 1UO9A 3W9AA 1G6NA 4JRAA 2ATFA 1WA4A 2EALA 3NJXA 1XSRA 1ZRRA 2ZEWA 3ZXEA 3V0AA 5JXGA 2VOTA 3ZYRA 4A45A 3KV5A 4Q4W3 2K0GA 2BFUL 2V5DA 2VC9A 4PDWB 5L73A 5T5LA 2QQJA 1W2TA 3GALA 3ZKUA 5HCHA 1S0FA 2WQ8A 4AQ6A 1LTEA 2XJUA 2BTVC 3WQ7A 5E8AA 3WUCA 2QE3A 1UIKA 2WS93 4XC9A 2K9ZA 3NKGA 4YW7A 2H0VA 1MS0A 1DCSA 1R1A3 2B39A 1O7FA 4JQTA 4FI9A 5C5UA 4FO9A 4LBQB 5FY5A 5FZEA 2DVFA 3LOIA 3WNMA 3ZFFC 1VB2A 2VMEA 4BQWA 1PZ7A 1TE1B 5DABA 1W0OA 3JU9A 1OOPA 1YCIA 1WA6X 3ZFFA 5G04L 4XFAA 2OPWA 3LEKA 5FPXA 4AFDA 2CHHA 3JB4C 3B01A 1NOVA 4PLNA 5KXEA 1X82A 1SEFA 2XJTA 4CDQB 4YM3A 2YV8A 1U5IA 4BXSV 1GLHA 1YFXA 1VRH1 3UGHA 5FPUA 1X9PA 4UW5A 1L7RA 1QDCA 1RL3A 3L2HA 5FYSA 4M01A 4HKOA 4XAEA 3WZ1A 2DVGA 4QX3A 1QJY3 3HVDA 3K4AA 4CCLA 5F3IA 3KMHA 2DFCA 3K3NA 3T4VA 4KBBA 2RM22 1IS6A 3OUIA 4UWDA 4YVSC 2BOIA 1XNDA 4FTSA 4IW3A 3S6PA 4D0QA 4YVSA 3GYDA 3ILRA 1KS4A 3OTFA 1MEC3 1LEDA 4OHWA 1RUNA 3MDPA 3S5AA 4NHYA 2D3RA 4YZ4A 2BERA 4XETA 3POWA 2R073 2Y0IA 3B00A 2W46A 4HKWA 4OUMA 1OMIA 3USUA 4AFBA 5I8YA 4XPVA 3H7JA 1V6LA 1S0EA 2VMFA 4LEJA 5EZWA 5A6XA 1V6IA 1M4WA 2QJVA 1RUI3 2VO5A 1ULGA 1UZ0A 4Y5SA 5ERLA 4P9LA 3VBOB 4COZA 5FBZA 4UFLA 5J96B 4Z2WA 1PZ8A 3OD4A 2PHDA 3ALQA 3AM2A 3WNLA 1DZQA 3WDXA 2GC0A 1ZM1A 1LGBA 3BIWE 1DHKB 3RMXA 3IDBB 3IAQA 4M4PA 1VAMA 4IEQA 1QNWA 1VBB2 3Q8BA 1Z7S3 4X8PA 2FZ2A 2PLV3 2I2SA 1VBD2 2YBPA 3MI8A 3PU8A 2NMNA 3KQ4B 4P9JA 1W6QA 1D2QA 1MS1A 3HT1A 3UT0A 3CO2A 1G9AA 2WAAA 3AKSA 4YGCA 3KB5A 3NMBA 4JKMA 3WDVA 1KXGA 4WZFA 3HWJA 3TNPB 4BM8A 5JWPA 4BXFA 1D4M3 3I97A 3TAYA 1W3XA 3VD3A 3KV4A 5JUVA 2RJLA 1W6MA 3MO4A 5DAQA 4FFFA 3GZAA 1Q8PA 1YI7A 2GNBA 1ND2B 3EXUA 2A7AA 5HBAA 4YZ5A 1SLLA 2RS53 3OBAA 4RSUA 2EXHA 2PHUA 2QTWB 4AI1A 3NNLA 4NMIA 2Y33A 4OHYA 1JU3A 4GKYA 4EROA 1HQLA 3PUSA 3NV1A 3E5QA 4L11A 5LK7B 2WO7A 3OEAA 2PHFA 1N47A 4RGGA 5FV3A 4FVVA 4YG6A 1WD3A 3E6CC 2J1SA 3GF6A 4HN0A 4KH9A 4I0AA 2C9KA 4XBNA 4Q4V3 4YLZA 3O1VA 4NIGA 1AL0G 3GBWA 1UWWA 4R8HA 5IVYA 2XUMA 3HJRA 4CUCA 1ASJ1 3ZN5A 2X5IB 3POBA 3B5LB 4HMZA 4M3CF 5E16A 4RN5A 3AXDA 4H3WA 1RUC3 3D0JA 3UK9A 5HI0A 2CWSA 3G6JB 5K7PA 1UX6A 1UOFA 4QX8A 3CLPA 3WLUA 4GMP0 5A6YA 4I0WB 1MZ6A 3GM8A 2YYOA 5T3NA 3IWZA 2D6LX 3LB9A 2CSGA 4GZ9A 1A8MA 4EN0A 3ZSMA 5JMOA 1H8VA 2XOMA 3SMHA 3VBRC 1R64A 3H7YA 2A6XA 4CDUA 2WO1A 2TEPA 1EV13 3FLRA 1AR61 1N3PA 2TNFA 3VBRA 4WVMA 5BXXA 3PU3A 3VZJA 4FPGA 2WQ4A 4DPNA 3ZFGC 4B7EA 5CEHA 4LT5A 2IWGB 1K5MA 2CDPA 4BB3A 3H3ZA 3M3IA 4Q4X3 4YM1A 2ERFA 3ZFGA 4CP1A 4QKBA 5JXJA 4ES9A 2RMU2 1WZXA 2VNVA 3WDUA 1C28A 1V9U1 3OG2A 3LEGA 3P3NA 5C4WB 1ZBA2 1PK6C 4FPKA 3VKLA 3WHUA 3ZSEA 2YPDA 3E1F1 1RVF3 2R043 2J1TA 3ON7A 1PK6A 5A7NA 5LRRA 1RXFA 4XW3A 2J42A 1O4ZA 1HQNA 3IDCB 2PA7A 4FPLA 4XQDA 4W8JA 1JZ8A 2VQUA 3USSA 5J36A 4Y1UA 4GB33 1H30A 1UIJA 5FJHA 5LZ6A 1QXRA 4P9WA 2IC1A 4JQRA 2MEV1 5A6ZA 5AVPA 5FP9A 1W8NA 5HCAA 5J98B 4RGKA 3H0OA 5LK5A 5JIUA 2IVJA 5LA2A 2IXIA 4FAHA 3RZKA 4GA9A 2GMEA 3MW4A 1JI6A 4EZHA 3FE5A 3PMEA 3VBFC 2YROA 1CN1A 1T6GC 2UY8A 4E27A 2D3PA 4KWUA 1W06A 2BDRA 5A33B 1ALYA 1OH3A 1BEV1 2BEOA 3J26N 1RUE2 1CPNA 1LRHA 2VVDA 2BNMA 2YZ4A 3HR9A 3KVAA 4SBVA 4L8QA 1QJX1 1UD1A 3DXTA 2ZGRA 2VVEA 1VBC3 3OF1A 3KGLA 1ZX5A 4MXWB 1MS3A 1PO12 2QDRA 2V4AA 4URTA 4N7UA 4WM8C 5IK8A 3FX3A 4HFSA 2D7FA 3J9SA 1CJDA 3MIFA 4WM8A 4BQ5A 5DAWA 3I3EA 1XYOA 2EAKA 5JVVA 2DTYA 3IKWA 3OB8A 1MQTC 2Y6HA 3OGRA 4A6OA 3ECQA 4H7MA 4J25A 4A3XA 5FUNA 3DYPA 2JD9A 1ZBE3 3QOPA 1POV3 4P00B 3WEZA 1HN1A
chains in the Genus database with same CATH topology
4JAAA 3ZFEB 3B9CA 4UW3A 2YGLA 4Q4Y1 4QD2A 4AI2A 2WA4A 2Z2SB 2DUQA 4Y1VA 2P17A 4JGYC 3ACLA 5ACA3 2A6VA 4UBHA 5HCFA 3IBMA 4JGYA 2HEYF 1XXNA 1FPN1 1KJRA 2JG9C 1S0CA 1C8NA 4K21A 5C8CC 4XJ8A 2IXJA 3D0SA 4F3JA 2BVVA 1GQGA 2JG9A 2CY6A 2A6WA 4QQ2A 1O4YA 1UU4A 2Q5TA 2JD4A 3RI9A 1AR92 1AXZA 3QLQA 1RTVA 2XWBB 3E97A 3WR0A 5K0UA 1YRZA 3D5OA 2YHJA 5KXCA 4E4DX 3BALA 3RYPA 4PBOA 2CGOA 2JKBA 4B29A 3WG4A 1VBE3 1IQAA 1FI2A 3J4UH 2RS12 1JUIA 1GZWB 4AEMA 4G4FA 3ZDSA 5KHJA 1AR71 4OHZA 1PGL2 4NO4A 2UYBA 1RUF2 4XQ4A 4PIYA 2PFWA 3AYEA 4KQ7A 1WW6A 1ULDA 3TYJA 1S0BA 2VNOA 1NA1B 3WUDA 4PDWC 3R6SA 4PLOA 4EN9B 4BH9A 1MR5A 1GZ9A 4AYUA 5BNPB 1AVBA 3T1MA 3TBDA 4HL0A 4AGRA 4EN8B 1TQ5A 2Q4SA 2R062 3H9AA 3AX4A 4Q8KA 1RMU2 1BJQA 1L3JA 1RUJ3 1D4VB 2VQAA 1HKDA 2D6MA 3VLBB 1RUOA 1KQRA 4AE2A 5AC93 1AYN3 5DZGA 2R6QA 3FJSA 4FCAA 4AXOA 4DY5A 4CDQC 5JZGB 2R072 4KU8A 3VBHA 2ZX0A 5GZDA 1C8M1 4CDQA 3KGZA 1A78A 4IEWA 2R49A 4LULA 3OGJA 1COV1 2ZGQA 5F5QA 4AQTA 5IK7A 3HBZA 1R091 3M3QA 1LHWA 1R082 1ZNPA 1W6NB 3JUUA 3GNEA 3TRSB 5J48A 3AP7A 1JHNA 2R16A 4P9GA 1YIFA 2ZGNA 2HWE1 1PIV1 4Y22B 3B9IA 2ZX3A 1HRI1 2RJKA 3B93A 3WDYA 1EAH1 3VBOC 2NN8A 1AR82 3V0BB 2HWC2 2RS32 2V09A 1CAVA 3VBOA 3AP9A 1CAXA 5JSOA 1C4RA 3N4MA 3THPA 2ETEA 4CP0A 2PHLA 5T5PA 5FLHA 3B7MA 3IDEA 2V5YA 5BY5A 4IEXA 3UJOA 3TOJA 3TN92 2RM23 2VG9A 2JG8A 3APBA 4RR3B 3HT2A 4OHXA 3ZXLA 2JICA 2EXJA 3VN4A 4FTEA 2D98A 2ZZJA 2A6YA 5CIRA 4MXVA 3WDTA 1DDLA 3E5XA 2G9GA 4COYA 5GZCA 2ILMA 2KA3A 2ZHNA 4IQPA 3ZX7A 1TME1 4KL1A 4I2OA 1REEA 3NSTA 1U5YA 4SLIA 2DCJA 2WSUA 1NE4A 2JDZA 1GANA 1ND2C 1CIWA 1RUC2 3I59B 1G86A 4D94A 4IEOA 1LU1A 2XJRA 3JQXA 3P3PA 3SH5A 4OI2A 3SXWA 4N9HA 1WCSA 1W6OB 3RRDA 1GBGA 5JCTA 3INAA 2VUJA 4HKLA 1XRUA 1WLDA 1VBB3 2E7TA 5D1IA 4DRRA 3VHRA 1O3QA 4XYXA 1VBD3 1FYUA 4GMP3 3I2DA 5CA6A 3RZZA 1RJ7A 1F8VA 4WVWA 2X5IC 1N1VA 2P37A 3ZXDA 1WMDA 1KD7A 1GFF2 3FLTA 1EP0A 4NWVA 2B5HA 3B02A 3WP6A 1DZRA 2GAUA 3FC0A 2EIGA 2FZ1A 1QOSA 4QQHA 4AF9A 3WCRA 3SCFA 4AVSA 1CESA 4O9EA 3PVEA 4AHXA 1YNAA 3WXPA 1F5FA 2QNKA 5HCBA 3AZYA 3JBG2 4JVAA 5A3LA 1MZEA 2CAUA 3AKQA 1DGRA 1OA3A 1N1SA 2GMMA 1WBLA 4DZGA 5C4WC 1B35A 3OYWA 4TSVA 3DKWA 4KNCA 1FOD2 1MS8A 3VL8A 4BQ1A 1NLRA 1SCSA 5GLVA 3K51A 3HQXA 1ZZBA 4AHZA 2IXKA 4GH4C 5DUUA 3M2MA 3GBGA 4BCUA 2UWCA 4GH4A 3N3HA 4L9BA 5A32B 4YFWA 2OA2A 3CL1A 3AJZA 1LOFC 1EPZA 1PNFA 2ZMKA 2VGDA 4LBLA 4B7KA 5KXBA 3JD72 3AZWA 1RUD2 1LOFA 1H4HA 1ZZ8A 3M8LA 2JEMA 2DURA 2DVAA 4Z8BA 1LEMA 4Y1ZA 1J59A 3SCHA 2WT2A 3SISA 5GLTA 2RMU3 2YDEA 1I9RA 3KM5A 4NWWA 1ZBA3 1N3QA 5L36A 1PMIA 3PVNA 2IXLA 2W68A 2B45X 4Y4YA 4Q8LA 1HIXA 1ZVFA 2RR11 3VDDB 1QH7A 1MS5A 4Q0VA 4Y26A 4P5HA 3ZFEC 1IS3A 3POYA 3ELNA 1H1AA 2PAEA 1RHI1 1Y9QA 2XH6A 4HVRA 4ORFA 4QQPA 4B4PA 5CBLA 1Q3EA 5FOBB 1NY72 4N9IA 3AB0A 5I0SA 4FT8A 1IKPA 5FQ0B 4DFSA 4OFGA 1RUE3 1HXS2 2MNGA 4ATFA 3KT7A 4Q27A 1XQNA 1C1FA 2WNVB 5CFCB 4EJRA 1PO13 5JMCA 4NOTA 4AGVA 4LO8A 1Q56A 4XFCA 5JOZA 4QX5A 4LE4A 5ABJB 4AVVA 2GMPA 1H8TA 4MVTA 3AXEA 2C1FA 2BVBA 3NWKA 4K1ZA 3ASIA 4XF9A 3CU7A 1LJ7A 1X7NA 4BIOA 2D6NA 1RUG1 5DDJ1 4MV2A 4YW2A 1PGW1 4LE3A 1DF0A 4IV1C 2GC1A 3HMYA 2NM1A 1LCLA 1NYWA 1QXJA 3WV6A 1UKRA 4IV1A 4PF5A 1LULA 2IFWA 1NA1C 4GWNA 3WP3A 1RUH1 3W58A 1LESA 4I30A 1ENXA 3M3EA 1NA1A 4IETA 1YLLA 2R0FA 1CAWB 5BNPC 4PLMA 4WM7B 1CX4A 1HV1A 2YMZA 2ZGOA 1DBNA 3NO8A 3WDWA 5BNPA 3AYDA 1AR93 2ZGSA 5CFDB 1KFUL 4JTOA 4TZDA 3ZSJA 1KFXL 3WX5A 4FPHA 3OY8B 1FMD1 1WLCA 1LHVA 3EQEA 3FUQA 3VBUB 4AFMA 4KWKA 3AKTA 2RS13 4AQ2A 1AL21 3RYRA 3V64A 4LA3A 1CAUB 1VRH2 3M3OA 3OJBA 2ZGUA 5JZGC 1GR3A 1W6PA 1RUF3 1BBT1 1OQDA 5JZGA 2IXHA 1F5JA 2WIIB 2GDFA 3WHTA 4N53B 4CYDA 3AP5A 4JGZB 4RGAA 4WV8A 1TEIA 4AFAA 1JUHA 1ENRA 5BNNB 4AEDB 4RS5B 3BOPA 2R063 5DG1A 2NLRA 2ZA9A 4L99A 4W6YA 2XB6C 1RMU3 4FQZA 4CZSA 1V6KA 2P3IA 1W6NA 4HANA 2RE9A 3OPZA 4FOYA 1RITA 3VBSB 4GKXA 3ZMNA 4PIXA 4AI3A 4H7LA 4Y1YA 5EYXA 4P14A 1N1TA 1D0GA 1G9DA 4X8NA 5KBFA 4LO5B 2PHXA 4OVEA 5L7OB 5I8SA 1OLQA 3VV1A 3X29B 3VZNA 4AVAA 1WMEA 2QDNA 1H1MA 3MW2A 2QQPA 2ZOEB 4YGEA 3ZN4A 4E4SA 5FMOS 4IEVA 1U0AA 2WL1A 2WQZC 1N3OA 2DU0A 2W52A 4ISRA 1PVXA 5LEJA 1R083 1G7YA 2OIIA 2QUOA 1JXNA 1VBA3 4INDA 3MIEA 5I0UA 4EV0A 4Q29A 2WZR1 1DGLA 4M3CE 2XKPA 5T54A 3DPRB 5JSPA 1OD5A 1J3QA 4N43B 3MLLA 3S0MA 2XKOA 3NKTA 2XLGA 1DGRN 1Y43B 4QMAA 2Y0OA 3OD0A 5GLWA 1AR83 3RNSA 1BZWA 2HWC3 2RS33 1REFA 1IPKA 1Z0HA 1W39A 2VPVA 3I59A 2W0XA 5AFBA 5K9YA 3MPPG 5JR7B 3ME2A 2XL7A 1U5ZA 1W6OA 2ZAAA 2ZGPA 4KG0A 2Z42A 3TN93 5FRAA 1X8EA 1LGNA 5FPZA 1J1TA 1QQP1 1UW8A 2A71A 4XF1A 3WCSA 5KC5A 1ASJ2 1AX2A 4L97A 4XZPA 4ZXKA 4LBJA 5BNOB 3WG2A 1WMFA 4AQSA 3M7AA 2XLAA 3LA3A 1BCXA 1AYM1 1D2SA 1FNZA 3AMHA 4YVWB 2DUOA 5FTTC 2YXSA 4CEYB 1SBDA 3J8F1 4LLFA 1GICA 1ND3B 1OI6A 1QXPA 2GZWA 3I7DA 3BPZA 4FPCA 4PQ9A 3UV9A 1AR62 2DU1A 3H8UA 2DFBA 4DB5A 1YWKA 2HWD1 1EY2A 1PO21 1ENQA 4D7TA 2X29A 4C90A 1FV3A 1V9U2 2ZGLA 2A75A 1MZFA 2ZPXA 4M3CA 3FBMA 4Y20B 2XLFA 5FAXA 2NQYA 4I3PA 4G3YC 4I3GA 4AWDA 2XPJA 5C33A 1J58A 3QH7A 2B9UA 4HLTA 3BODA 3VZOA 4XMAA 1S0DA 4E2GA 1I1EA 2MEV2 1QHDA 4HN1A 1CVNA 4Z82A 4R9DA 3L9JT 2HWB1 2XVGA 4RHV1 2Y38A 5A32A 5J09A 4K6BA 1FV2A 1OFNA 2PYTA 4QPGB 3D6EA 5J37A 2VVFA 1YO8A 2AENA 2R1DA 3OGGA 1BEV2 4KWLA 1SBEA 4YM2A 2MHFA 4META 3WP4A 2TBVA 4XTMA 1H4GA 5DUWA 3VGIA 1QJX2 2PQQA 3MLKA 5E1RA 4OLLA 4BYYA 4D7YA 2XVKA 3JBG3 3WP5A 2PN5A 4K7JA 5GM0A 1XNBA 2CAVA 1TMF1 3VBFA 1FOD3 4IESA 4EWDA 2GH2A 2I07B 1LU2A 1SLTA 1XNCA 4W65A 1QKQA 4KU7A 5JOXA 4AI8A 5EFUA 3E6BA 4Q1PA 5JSRA 1PVC1 5BYNA 3VDDC 1NCRB 1DU3D 4HPKB 2A5ZA 2HWF3 3DGTA 4BZ4A 4Q4Y2 2XBO1 3LCPA 1O3TA 2A3XA 3VDDA 4E2QA 4ZU7A 1Q8OA 2ZAHA 4HSLA 3RPQA 3R4UA 4Q26A 2PAMA 1SLAA 1X50A 5GZGA 1MQTA 2BWAA 4QQLA 3JD73 4LNVA 3NV4A 1RUD3 2PHWA 1FPN2 1VAKA 1YI9A 2X53S 3HAGA 2D5FA 5CU1A 2PAKA 4FXKB 5H9RA 1GSLA 2D6PA 4AVCA 3AMPA 5FQ0A 1LB2A 1HX6A 3PVOA 2WNVC 3ZN6B 5CFCC 3TB0A 4FTBA 1HRV1 2WSVA 1GNZA 3BB6A 5T55A 4E2SA 4EWAA 5ABJC 1JYCA 2WFF1 5C8CA 3N7MA 3DL3A 5ABJA 2VMHA 2UWAA 4HZFA 1RINA 5H9PA 4KGGA 3Q9OA 5F6LB 4EN7B 2CNAA 4Z92B 1OSGA 4YW4A 3RWNA 1AR72 1WCDJ 5F1RA 1Y3TA 1PNGA 1W2UA 4AG4A 2E51A 3ENRA 1FX5A 4AVTA 5JPNB 4S2DA 3H1YA 4COVA 4AEJA 3CNAA 3WT3A 2A3YA 1HXS3 1NE6A 3AZZA 1C5IA 4UW6A 1J1LA 4F7ZA 1UAIA 1X33A 3IT8A 4WM7C 2A73B 1QJU1 1GKBA 5GZFA 3RSJA 1CAWA 2AZ5A 4WM7A 5CFDC 1LOCA 1XU1A 4CDXB 2YPJA 2X8KA 3ES1A 4GALA 4PDWA 5CFDA 2YUEA 2XJPA 4Q4W1 3KCYA 5DG2A 2XGXA 3KCCA 2JX9A 4IEZA 3SNMA 1SFYA 3VBUC 2JECA 4M0HA 3HN1A 2D44A 1TNFA 4FPEA 2WA3A 5KWRA 1I5ZA 2WS91 4O9GA 2H0BA 1Z78A 4QPIB 4LUKA 1EPWA 1R1A1 1C8M2 4LBQA 1ZRCA 1LENA 1CAUA 4KWJA 5EXOA 3V0AB 1ZZ7A 1GV9A 4JV4A 3NL1A 5LRSA 4R9BA 1COV2 2VMGA 2DCTA 1C5HA 4JGZC 4R4XA 1BXHA 1R092 3KSCA 5T52A 2H6CA 5BNNC 5E89A 4AEDC 2CGNA 1VJ2A 2VOKA 5BNNA 4AEDA 2HWE2 1PIV2 1Q43A 1LECA 3B94A 3OBRA 3VBSC 5BUVA 2GNTA 4XBLA 5CVRA 1HRI2 4X6RB 5GLZA 1QJY1 2B7YA 1OOPB 1EAH2 3G7DA 2ZABA 4LBMA 4M0NA 1VBA2 1IS4A 1LOGA 1YYNA 2VOWA 4XJAA 1QGLA 1SLBA 5KHIA 1VRH3 2A70A 2HEVF 3LAGA 1Q8QA 1ZZCA 4DQAA 4LTAA 2D40A 1MEC1 2LM3A 1VALA 3N7KA 4AHYA 1VP6A 3OBTA 2DVDA 2R071 5DUXA 4R4ZA 2VNGA 3MIGA 3ST7A 1ZA4A 3S7EA 1DQ0A 4U36A 1RUI1 2PHRA 2FQPA 2R30A 4S2HA 4WVZA 1NXD1 1QOOA 4YVSB 1J3RA 3LA7A 3AJYA 2O8QA 1TME2 3NV2A 3DPRC 2NYYA 2ZJCA 4N43C 3USUB 1CPMA 3LSEA 4HK8A 1Z7S1 3C2UA 3DPRA 1KRIA 2PLV1 1V70A 1MS9A 3LA2A 4AK3A 2ZCWA 2O8OA 5JLVA 1F2NA 1OHFA 2BW8A 4FOVA 2LUWA 3N7LA 3ZXJA 2D43A 3GHMA 4WBBA 4TLFA 3U10A 3VUOA 4UW4A 4MGYE 3ZMOA 1OFSA 1IKQA 2Z69A 4XTPA 5KHGA 1HW5A 1DQ1A 1D4M1 1F31A 2WT1A 1ND2A 5BPXA 1WCKA 1V6NA 1Q5OA 4FAGA 2BYVE 2E7AA 5FLJA 4DNYA 2OZ6A 4MLOA 2RS51 2DYCA 4Q0PA 2XJSA 1H9PA 1AZDA 5BNOC 4ITCA 1EYBA 1BK1A 1JTZX 5FMOL 4GWMA 1MVQA 2CYFA 5BNOA 3MZHA 4LHNA 1PGSA 4YYOA 3QCWA 4OI4A 4YVWC 2HEWF 3QH6A 3FUOA 1IGOA 1W6MB 3L2YA 3JB8A 4TYSA 4CEYC 5GALA 4YVWA 2Z5WA 2CTVA 1W0PA 5C8WA 1ND3C 4Q4V1 4CEYA 1BVP1 2X5IA 4D7SA 3K48A 3VHPA 3M4FA 4OULA 5GJ6A 2DTWA 2WNEA 4HT1T 1ZRFA 1CD3G 1O5UA 4LBQD 3CJXA 1RUC1 2UU8A 2ZX2A 1U12A 2ZACA 4E9KA 2ZGMA 5DUVA 3SH3A 2VW0A 2BNNA 2XG3A 5EWSA 4LA2A 1DYKA 1ASJ3 1O4TA 1G9CA 4Y24A 1EV11 3ZIWA 1B09A 1ZYBA 2VXRA 3VKOA 5JI7A 4K3UA 4MGKE 4YRDA 4Q4X1 1IS5A 2GSYA 5C4WA 3ES4A 4NVPA 5IK5A 4YZ1A 1AR63 1RVF1 3AKPA 2R041 4CDUB 2YY1A 1PM7A 4EN6B 5D8AB 3ZVXA 3VBRB 4WVVA 4WVMB 2P2KA 2KXLA 1Q8SA 2HWF2 1YFUA 3KLSA 4LLOA 1K5MB 3ZYJB 1V9U3 4GB31 4PJYA 1H2MA 4RL7A 1HV0A 2CL2A 3A0NA 4CEWB 1QF3A 3S30A 3VHOA 4XHBA 3IM0A 3H1MA 1IHMA 3BCWA 4Q2FA 4W6XA 2ZZQA 5CNAA 5E88A 5JPMB 3VZKA 1ONAA 4COWA 5A33A 4ASLA 1V00A 2E9QA 2RR12 2WINB 5H9SA 4YZ2A 5LEKA 1LOBA 2OUJA 2MEV3 4MXWA 5EYYA 2VW2A 3ZYGA 3FLPA 1NCRC 2LTNA 4UBGA 1VBC1 3B69A 1O91A 4CDWB 1RHI2 4KG8A 5CADA 2DCZA 4IEYA 3URFA 3RJRA 1YFWA 1UU6A 3MGUA 1YHFA 1BEV3 1AX1A 4JDMA 3AFGA 2VW1A 1CONA 5T5OA 1QJX3 1JN2P 1MVEA 3ZFEA 1ZBE1 3FWEA 1POV1 4COUA 3ZYPA 1V6JA 4WZCA 2EAAA 1VIWB 1LOEA 2E63A 4WM8B 1RJ8A 4MH0E 1AXYA 3JQWA 1OQ1A 4OI0A 4M00A 5ACA1 2D6KA 4AGGA 2QVSB 2CWMA 3RYKA 4C1WA 3NV3A 4AEKA 2ZBJA 1IPJA 4PIZA 1RUG2 1SQ4A 3LGRA 4Q4Y3 4HK9A 5DDJ2 4F8AA 1S2BA 1PGW2 3D4KA 4FQ4A 1ZREA 4I09A 4DRVA 3ZYIB 1FPN3 1RUH2 1UCXA 4XE9A 1DQ5A 4DS0A 3MLJA 4BLIA 4C0BA 1GZWA 1VBE1 3SLIA 2PTMA 3VKNA 1OQEA 4KGQA 3EHKA 3AMNA 1BMV1 2B42B 5J3UA 4YNIA 4I0BA 2QZ2A 4FXGB 1OPOA 2KM2A 1F9KA 5K0UB 3FHIB 5DXDA 4MGZE 1H9WA 1FMD2 3I54A 2D93A 3MYXA 2XHKA 3NJZA 3R4SA 1JOJA 4IERA 2VOXA 1AL22 3MF6A 1S2KA 2A6ZA 3ZXAC 1AX0A 1AF9A 4LO6B 4A7ZA 2R1BA 4PCRA 2DVBA 2EA7A 4HVQA 1AR73 1FXZA 1H2NA 3HD8B 2BBVA 2OYZA 1BBT2 2D6OX 2QCSB 4I02A 4Y5Z0 1VAVA 3VZMA 1H2KA 4B4RA 1CJPA 3UL2A 1FATA 1APNA 1RUJ1 3ZIXA 3WINE 4LR4A 2ZGTA 4LO4B 1XU2A 1JW6A 4FOWA 3MFCA 2XVLA 3AYCA 4LHKA 5AC91 1UL9A 3ATGA 4JDNA 3R05A 1AXKA 1AYN1 1H2LA 2CGPA 3RS6A 2ZHLA 1SBFA 5TSWA 1ENSA 1LODA 2VU9A 4P9IA 2YGMA 5FO7B 4C91A 4H14A 3O5SA 1OA2A 1OLRA 1DYPA 4K8FA 3ZO0B 1WW7A 1DQ4A 1OOPC 2BQPA 2P3JA 4ONUA 3CEWA 5FO9B 1O3SA 2NZ9A 3POSA 3O7OA 4IV3B 1XYPA 2LALA 2N7GA 1C8M3 3GZTB 2QFEA 3KQRA 3VBHB 2ZMLA 3KCXA 4K1YA 4MUVA 1IZ3A 2Q1MA 2W39A 1IOAA 3R4DB 4XFGA 3WW4A 4Y22A 2ZHKA 3AKRA 5KXDA 1ULFA 1ULCA 1COV3 5BNQA 1LGCA 2D5HA 3MIHA 2OPKA 1R093 1GYKA 4R9AA 3NW4A 3SCGA 4BLJA 3V0BA 4IEPA 4EWEA 3WNXA 1CQ9A 1SLIA 1AJOA 3LWCA 4LBNA 1HLCA 2WZR2 2HWE3