2Q4SA

Ensemble refinement of the protein crystal structure of cysteine dioxygenase type i from mus musculus mm.241056
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
186
Chain Sequence
b'ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 50
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2007-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q4sA00
2MNGA 4Q0QA 5BY5A 1DGRA 3KSCA 2ETEA 1YFYA 1FT9A 4LTAA 5BPXA 4O9EA 3BU7A 1CAVA 2HJIA 1IPJA 1G6NA 2GU9A 1J59A 5KHGA 4HN0A 3USSA 3WW3A 1NYWA 2EA7A 1H1IA 3CJXA 2UY9A 3FZ3A 5EZWA 1L3JA 4Q0UA 4MV2A 2XLFA 1VR3A 1WA4A 2GZWA 1FXZA 2PFWA 4A2UA 4EWEA 1ZNPA 2QNKA 3H1YA 4MUVA 1LB2A 1YLLA 1ZX5A 4EWAA 2WC2A 1TQ5A 4IEPA 2Q30A 5FCCA 3SXWA 4UBGA 2PHDA 1CAWA 4AVBA 3FE5A 5J3UA 4QXKA 5J7MA 2QVSB 3PVBB 1OMIA 2V09A 3RYKA 4D7SA 3EBRA 1O3SA 1Y9QA 2IXHA 1VP6A 3CL1A 1SQ4A 3LA2A 4L11A 3PNAA 1ZZCA 3QACA 2BNOA 4L2NA 4O9GA 1OFNA 4I02A 4Q29A 1ZZ9A 3NVCA 1X8MA 2UYBA 4MGIE 4Q0PA 5FPZA 1ZREA 4EWDA 2CGPA 4XEZA 4YRDA 2GC0A 2Z2SB 3EHKA 2D40A 2UY8A 3SHRA 3E5QA 2OZ6A 2ET7A 3E5UA 4XF0A 5KHHA 4I3PA 4XF4A 1ZRFA 4HBNA 3U0ZA 2CAVA 3OD0A 2PYTA 1O3QA 5K8SA 2IXCA 3E6BA 4HLTA 4KU8A 3U11A 2WFPA 1O4TA 3UKNA 1OI6A 3DN7A 3NL1A 4OLLA 4LUMA 2BYVE 1Y3TA 1X7NA 4K8FA 5I91A 2GC3A 1NE6A 4LUKA 3SCHA 2BNMA 2QCSB 5E1RA 2K0GA 5I0SA 5JR7B 2ET1A 4JTNA 3SCFA 1RGSA 1GQHA 2PAMA 2Q4SA 3OF1A 4J1WA 2C0ZA 3B02A 4IETA 3KCCA 4LA2A 3CLPA 4H7LA 2EVXA 2IXIA 4AVCA 4XFHA 4YSFA 2PQQA 1WGPA 1RL3A 1I5ZA 1NE4A 4AQ6A 1ZZ6A 3DL3A 5JSRA 5D1IA 5FDBA 4XFFA 3KMHA 2B9UA 1O3TA 4Q0SA 1LR5A 2CV6A 3MDPA 5FLHA 1QXRA 2OYZA 2P17A 1J3RA 1VJ2A 2D5HA 4X6QB 2CAUA 4YARA 3BCWA 4EROA 2FQPA 3R6SA 2D93A 3S0MA 1NZCA 4J1XA 3M3IA 2O8QA 1OD5A 4GULA 4I0AA 3MZHA 3H50A 1QWRA 4HVOA 4IEOA 4ORFA 4D7TA 3LA3A 4E2GA 3NW4A 5HI0A 2PAEA 2VQAA 4QGMA 3D0SA 1JUHA 3SCGA 4Q0VA 3LZZA 4KL1A 1J3QA 3WW2A 1UW8A 2Q1ZB 2KXLA 3UKTA 1Q43A 5I0TA 4MGYE 1ZRCA 2MPFA 4IEUA 3EO6A 2Y0OA 3HT2A 4HZFA 3IIAA 3EQEA 3LOIA 1DGWA 4QM8A 3D0JA 3O14A 4WVZA 1FI2A 2XL9A 4ONUA 1RUNA 3VHRA 5KHKA 2PAKA 3ELNA 4MGZE 3KGZA 1ZRDA 3IBMA 3H3ZA 5E16A 5I8SA 2I45A 5I8TA 4IEWA 4WBBA 3L2HA 4HVRA 3NJZA 1ZVFA 4CYDA 1XE8A 1PM7A 3S7EA 1IPKA 2IXLA 1NXMA 4XFGA 3H8UA 2ATFA 3BALA 3BPZA 5I8YA 1YFXA 1CGPA 2OA2A 3CEWA 2GC2A 4KWJA 4PIXA 3I59B 1YWKA 2BNNA 5AVPA 4AVAA 3E5XA 3U10A 3LA7A 3C3VA 3RPQA 1RUOA 4HMZA 1Q5OA 4UBHA 4WZCA 4FAHA 4PIZA 5KHIA 3H7YA 4ZU4A 1Q3EA 3ST7A 1J58A 1I6XA 4KWKA 2H6BA 3GBFA 3NSTA 3E97A 2GH2A 1UD1A 2IXJA 2XLGA 3LWCA 1XRUA 2IXKA 4KWLA 3MPBA 2F4PA 1LKNA 1UIJA 3OTFA 4FBFA 4MX3A 3KGLA 3E6CC 3BB6A 4R52A 4BIFA 1X82A 2OZJA 3I59A 5FLIA 5FLJA 2BGCA 1XE7A 2PHLA 3G7DA 3H7JA 2H6CA 3OCPA 3TNQA 4R8HA 4HN1A 2XGXA 4KU7A 2HKXA 2UYAA 5CU1A 1CAXA 2Z69A 4META 1UIKA 5C6CA 3WW1A 3JZVA 3SMHA 3RYPA 1ZRRA 2VPVA 3H1MA 4HSJA 5JAXA 5LEKA 3FFQA 1U12A 2IC1A 5T3NA 2OPKA 4I2OA 3EJKA 3N4MA 4XF9A 1EY2A 1YFUA 1H1MA 5JCTA 1ZZ8A 1CX4A 1EP0A 4B29A 4Z07A 2N7GA 1LRHA 3M70A 4RD7A 1UPIA 4XFIA 5KBFA 3S7IA 4QMAA 5I0UA 1YUDA 4QX5A 3H1WA 3WW4A 3ZDSA 2B8MA 5C8WA 4E2SA 3FHIB 4N9HA 2E9QA 5JSPA 4PJYA 4LA3A 2XL7A 2XKOA 4YNIA 1DZRA 1RC6A 2PA7A 3ES4A 3NKTA 3UKVA 3H9AA 2B5HA 4EV0A 4IERA 2PTMA 2QJVA 5FQ0A 3FX3A 1J3PA 1WLTA 2QDRA 4IEQA 3RZZA 3IDCB 4MH0E 2FMYA 5J48A 4F8AA 3I7DA 3MYXA 4XF1A 3CO2A 1DZTA 3PLQA 3RYRA 1YHFA 4UXAA 3HT1A 2O1QA 2Q0AA 4JTOA 3RDIA 3CF6E 1QXJA 2XHKA 3IWZA 1J1LA 1O5LA 4HSLA 4TLFA 4AQ2A 4DINB 5I0RA 3ACLA 1EYBA 4XFAA 4LULA 1PMIA 2ZKLA 1V70A 4LEJA 4IEXA 2H0VA 3QOPA 3GYDA 4I01A 4E2QA 1RTVA 3H3UA 4OFGA 1SEFA 4JV4A 4P9GA 2GAUA 3HIFA 3OGJA 3ETQA 4QGLA 4IESA 4NVPA 3DKWA 5CADA 3LAGA 4Z82A 3HQXA 4F7ZA 5LEJA 2EAAA 3IDBB 4PIYA 4JVAA 1GQGA 4ZU5A 1SFNA 3ES1A 2XLAA 4QM9A 1CAXB 4BHPA 3E6DA 1ZZBA 2GC1A 4X6RB 1O5UA 4IEYA 4I0BA 4IEVA 5BXXA 4BH9A 1EPZA 3FWEA 4BYYA 4HVQA 1O3RA 4YYOA 1UCXA 2DCTA 5FPXA 2VECA 4XF3A 3RNSA 1HW5A 2D5FA 2BEOA 1CAUB 5LRSA 5CVRA 4AXOA 4IEZA 4QGNA 2ZCWA 5LRRA 4FAGA 5EFUA 2K9ZA 3TNPB 4I09A 5BUVA 4LLOA 4ZU7A 1CAVB 3ROUA 1YFWA 3I54A 4N9IA 4XFCA 1O7FA 4FT8A 5KHJA 5FQ0B 4XFBA 1X8EA 1ZZ7A 2MHFA 3DV8A 5F1RA 4XETA 4MZUA 2XKPA 1QY4A 5BV6A 5JSOA 1CAWB 4MGKE 1CAUA 5I93A 3FJSA 3D82A
chains in the Genus database with same CATH superfamily
2MNGA 1SZBA 2RM21 4Q0QA 1DGRA 4WZFA 2V72A 1COV3 3WOGA 1KQRA 1W8TA 4URTA 2HYKA 1FT9A 1TME2 4UFJA 5BPXA 3IIIA 1TZOA 1YQ6A 2VMGA 3JB4C 1PZ8A 1WMEA 1Y7BA 1PO22 4Y5TA 1CWPA 1CAVA 1W6PA 3AKRA 2GU9A 5BNNB 1JN2P 4YM2A 4HN0A 2YB7A 1J59A 2JICA 2R0FA 1ENQA 2BOIA 2X8KA 2NZ9A 4XIOA 3I2FA 5H9SA 3CJXA 2YHJA 3ASIA 1EV13 3JUUA 3MW4A 1GFF2 1S2BA 1XBFA 2YGMA 2W1UA 2ZX1A 1LESA 3MEPA 5CKMA 3WG1A 4AEKA 2VQ0A 4C1XA 4JKLA 1F2NA 4EWEA 4A2UA 1GZ9A 3CBNA 1ZNPA 2QNKA 4MUVA 1HXS1 2RJKA 4XJWA 3LSDA 2WC2A 2V4AA 4LOSA 1OUXA 5JMOA 2VOTA 2GSYA 5DZGA 1E5HA 2O8OA 3AMNA 4MO3M 3SXWA 4GA9A 5L73A 1CAWA 2E7AA 2X09A 5J3UA 1HN1A 4NAOA 3OUIA 5FP9A 3IAPA 3MUZ1 4BIOA 1OA3A 5J7MA 1US2A 3VL8A 1NLSA 1ZA7A 3KV9A 4XCAA 1UY2A 1NCQB 5FZEA 3ZFFA 4DPNA 3J8F1 5C4WB 5C3OA 2VZRA 4HL0A 1RHI2 5JIUA 1GMMA 3RYKA 3OPTA 1JHJA 5GM0A 5FZ8A 2HYXA 4QU1A 1GBGA 4QQHA 2VXRA 1HIXA 1VBC2 5FO7B 4ARXA 3I3QA 4QDSA 5IK5A 4B1LA 4UFHA 4L2NA 5IFPA 1MEC2 4BQYA 4Q29A 2RS12 5K4LA 4Q0PA 5ERLA 1X8MA 1BLZA 2YU1A 3JBG1 3PMEA 4NPLA 4YZ3A 2D3RA 4GH4A 4EWDA 3AP6A 2W52A 4YW1A 3OGVA 2CGOA 1AR81 2WABA 2WWUA 1K5MC 2I2SA 2VBDA 2RR11 3VBOA 4LBQD 1Q8SA 5APAA 2W47A 4IV3A 1UU6A 3MF6A 4XF0A 1VBE2 5KHHA 4FOWA 2G1MA 5ACA2 2BGOA 1BXHA 1ZRFA 5JPMB 2WS92 4OQ8A 3FUQA 2VW2A 1PGW2 2PYTA 5A7PA 5JI7A 2WNVA 2IXCA 4FPEA 4LBJA 4KU8A 5FRAA 4ZY9A 1PVC1 4OMCA 5C9AC 1KS4A 3VB9A 2E7QA 3I2DA 3A23A 3UKNA 4MXWB 4CUAA 1OI6A 1VBA2 3DN7A 3CJIB 1G9CA 1LAJA 4LUMA 4CDXB 5HXMA 4UFIA 3PURA 4QDQA 1Y3TA 4DZGA 1X7NA 1UX6A 3ZX7A 4IV1A 1U0AA 2CWSA 2GC3A 1FATA 4LUKA 3ZSKA 2J22A 3VKOA 5A70A 3GZTB 5KR7A 4GJYA 3VBSB 3ZXFA 4QPGC 3UGFA 5CISA 1UQXA 2DF7A 1ENXA 1HKDA 2VNRA 3ZXEA 2PAMA 4K7JA 1M06G 3V56A 1OQEA 1Y9GA 3OGGA 1L7LA 1ULGA 3OF1A 3WF3A 4J1WA 3GNEA 4ASLA 3B02A 2PLV2 3AFKA 4LLFA 4P5HA 3CZJA 1MZ6A 4LA2A 1Z7S3 3OUHA 3PU8A 5H9RA 2XONA 3OG2A 2EVXA 1JU4A 2VUAA 1BJQA 1H2NA 3D6EA 1H9WA 4XUOA 5DXDA 2ZGNA 2ZGMA 3NNLA 2SLIA 3C7EA 5FY0A 4CCOA 1JYCA 2O0OA 3R4DB 1UYPA 5LBEA 3MLJA 5A32A 3F2ZA 5JIAA 4YVWA 1BEV1 4CUGA 2FZ2A 5D1IA 1AUYA 5FDBA 4XFFA 3B9CA 4PI2A 2GNTA 3KMHA 2B9UA 1WWYA 4NUBA 4E4DX 3GGLA 4WVVA 2XQRA 3L9JT 4Y33A 1S0EA 3VBHB 2QQPA 2KM2A 2IZWA 2WS91 4WVMB 2ILMA 1J3RA 3AMHA 4H7MA 5FMOL 1QOSA 2HEWF 4R9BA 5LA9A 1GZCA 4MLOA 2CAUA 3EYPA 1NCRC 1OLRA 2QQJA 2Y6KA 2FQPA 5FJHA 4EROA 1GNYA 1BMV1 2XUMA 1F5JA 2RV9A 2D93A 5EQUA 1XPWA 1FOD1 1RMU2 3VHPA 1WCSA 4GULA 3HJRA 2NP0A 3WP6A 1QJZA 1M4WA 3N9MA 3C7OA 4CCJA 2WNUB 4OZXA 1SLAA 3VLBB 1F8VA 4R9DA 1N1TA 1YRZA 3AKTA 3A22A 4CDWA 5J1XA 5FZAA 3MV11 3ZFGC 3NV3A 2EIDA 1FPN1 2PAEA 1MS0A 3FL7A 2P6CA 4XXAA 2YC4A 2BV4A 4W8JA 3WW2A 2XHNA 5FO9B 4QHBA 2ZX2A 2XVGA 3EB7A 3MIBA 1EAH1 1P8JA 1IG0A 1JOBA 2LM3A 1SLCA 2OT7A 2QQVA 3HAGA 4NHMA 2MPFA 1ZRCA 3LEMA 4IEUA 1FV3A 2EIBA 4DNYA 1BK0A 5ABJC 4IQPA 1NY72 2Y0OA 4HXCA 4P14A 1VRH1 4HZFA 4B3NA 3EQEA 2JEMA 2VY0A 4FPLA 4LHKA 4QM8A 3O14A 4XQDA 2OPWA 1QMJA 1IS4A 4UT5A 5LBBA 4ONUA 4FXKB 3LPFA 2BJSA 3ZN5A 5KHKA 1COV2 1PHMA 1RUJ2 1UO9A 2PAKA 2TEPA 3AKPA 5DPNA 1ASJ3 3QLQA 4Q4Y1 3ZR6A 4GXLA 4W65A 2NMOA 3T0DA 1GWKA 1CZSA 3KGZA 1C57A 1AR71 2ZZQA 3Q9OA 3URFA 4DY5A 4UWDA 1WW6A 3MBWA 2FDGA 4RR3C 3VDAA 2ZS6B 5A33B 1WD4A 4LITA 3L2HA 1VBD3 4HVRA 5JZGB 5LWBA 2VUDA 1CIWA 1XE8A 2ZGTA 5JOWA 1JUIA 2MEV2 5CFDA 1QH7A 3MFCA 4IE7A 3K51A 2R0HA 4KGGA 4W50A 2OIIA 3FUOA 3H8UA 4J25A 1LOFA 3IMMA 2ATFA 2JX9A 1X9PA 1MVEA 3APBA 1ULDA 2YYOA 3BI3A 4HK8A 2OA2A 3HQRA 1HJGA 3CEWA 1DQ6A 3I59B 1YWKA 4AEDB 4Q27A 2CL2A 3B94A 2JE9A 2W87A 1AZDA 1W9SA 2DUOA 2E26A 4UYBA 3RPQA 3AL5A 2DU1A 3ITQA 1W0OA 5GLUA 1G9FA 4C8DA 4E8DA 1OVSA 1BQPA 2A6WA 2R073 3THPA 1ND3C 1Q3EA 1I6XA 2CWMA 2R043 2WRAA 2P5BA 1IS6A 3PTYA 5K7PA 2VC9A 3GXUA 1XNKA 3E97A 2GH2A 2VMCA 1AR92 5IVFA 4OHXA 3KS7A 3LWCA 2GNMA 2IXKA 3O1VA 2RS53 3OD4A 2XWJB 3JQXA 1LKNA 4B4QA 3VBRB 1RUJ1 1W9FA 4QHOA 1GYKA 1LGBA 3ZFFC 3HBZA 2HEVF 1ODNA 1N47A 3LD8A 4N7UA 1XSRA 1QOTA 4CEWA 1ST8A 1PMHX 2J1TA 1LHNA 4QQOA 3THTA 1YJKA 4CDWB 1PK6B 3TOJA 4MHUA 2CGNA 1MPXA 1XE7A 4BLJA 1E57A 4FO9A 4GMP3 3G7DA 3H7JA 5B2GB 2Y6HA 3OCPA 2TBVA 2EIEA 3VHOA 1S0CA 2RE9A 4RGGA 3TNQA 4Y1VA 5C3QA 1SMVA 4HN1A 3RMXA 4KU7A 4YVSB 4D3WA 5K9YA 3LKJA 2CTVA 4Y24A 2BGPA 1QHDA 3IT8A 3PIJA 4FOVA 1CAXA 4Y1XA 3RG0A 5A1AA 4KH9A 5L9RA 2Z69A 2QBXA 3L2YA 4META 3IM0A 1CX1A 2XJTA 5FYYA 2JD4A 3VBOC 3SMHA 2UWCA 1WLWA 2HWB2 1ZRRA 2YROA 3K4DA 4IV3C 4HSJA 1R081 3H1MA 3WHUA 4E4HA 1S0DA 2J1AA 3N3HA 5JAXA 3TEWA 5LEKA 2VCAA 4QXBA 1KRIA 3V65A 2E33A 3J7HA 2OPKA 4P9XA 1V6KA 2V73A 5T3NA 4W6WA 1OLMA 4LQRA 5CZKA 3LEGA 2WAOA 1YFUA 3THDA 2WNVC 1LODA 5JCTA 4CDUB 4LHSA 4DXRA 4B29A 4L0PA 1NXD1 2WA3A 4U2AA 4Y1YA 4AFAA 2ZEXA 1QJY1 2HWD3 4COVA 5KBFA 1HRI3 2JG9B 1NQJA 1U5YA 1QKQA 3VKFC 2WUHA 1DGRN 3PUAA 3MLKA 2HWC3 3WW4A 3ZXKA 2GDFA 3LDKA 1OVPA 4BPZA 2K2SA 1YC61 3OGRA 1RUI1 4IE6A 5DAVA 5C8WA 4E2SA 3FHIB 2WINB 5CFDB 2DCZA 3LEKA 3V0BB 1B35A 2DU0A 1AYM1 4ZZ5A 2ARXA 3FLTA 3OYWB 4KGQA 3WF2A 2JG8A 4ZXKA 2ZZJA 3OSDA 3NNJA 2WZR3 2XBO2 5F3EA 1QJU3 2IVIB 2QDRA 1DHKB 1REEA 2YXSA 3WXPA 4MH0E 5C3PA 3AMMA 4Y1UA 1J84A 4JAAA 5J48A 2WA4A 3MLLA 4YGBA 3N7LA 4YW4A 3UL2A 5A3NA 3ON7A 3MYXA 4UW4A 2PQSA 5F39A 1MS8A 4BISA 3PLQA 2A70A 3RYRA 2PELA 1YHFA 3DYMA 4BK4A 5L36A 3SLIA 1PO12 3RDIA 3I4IA 4AVTA 1ND2A 4UW3A 5A80A 1SG3A 3RI9A 2DBIA 2WO3A 5JDBA 3KB5A 2LRPA 4NIAA 4BJ0A 1IPSA 1HB3A 4JGZA 1O5LA 1WMFA 1JODA 1C1FA 3B01A 4YGEA 3UGGA 3ZYRA 1GLHA 4A3ZA 3RJRA 1OOPA 5FYVA 2WT0A 1OD3A 1PMIA 2HWF3 2ZKLA 4OI1A 1W90A 3VBFB 4LEJA 3ETPA 1W6OA 2Y6JA 2W9XA 2YPDA 3K75B 1JOJA 2WWJA 3QOPA 5J37A 4XCBA 1RUC1 4FPCA 3DPRB 4KQ7A 2RM23 2CYFA 4XUQA 4AHZA 4FPFA 2ES3A 4P9GA 4MHRA 4K1ZA 4QGLA 1DQ0A 1MACA 2YFUA 3OPWA 4NVPA 4YW2A 4S2HA 4EZHA 4FTBA 3WF0A 2BU9A 4EE2A 5L9VA 4RHV2 1D4VB 4Z82A 4F7ZA 2E31A 4N43A 2WKKA 3ZXDA 4E4SA 2HWE2 1ZBA2 1DYOA 3VV1A 4JKKA 4ZU5A 1NAEA 1F15A 3OBZA 1SACA 1CVNA 2D97A 2XLAA 5FJKA 4GJZA 1CAXB 2WFF1 1Z0HA 4OZOA 3RI8A 3E6DA 2ZGUA 4MSVA 3U75A 4Q4V2 4FFFA 1HXS3 4PDWA 4WM8A 1S0BA 1ASJ2 2RDQA 4RN5A 5JR2A 4I0BA 1SCRA 1Y9MA 1S0GA 3P5BA 3OY8A 3R4UA 4LKDA 2JWPA 5FKBA 2LALA 1IG3A 5IUQA 4LBMA 5GALA 2D98A 3FWEA 4JC1A 1NLRA 1VBD2 4AZZA 3O1SA 3VBUC 4YYOA 3WT3A 2X5IB 4IDZA 2PHFA 4JHTA 3ACFA 3MV01 5FPXA 2VVDA 3VL9A 3TN91 3RFRA 1UAIA 1DQ2A 2D5FA 3AKSA 5FZLA 3VD4A 1JMUB 2BEOA 5LRSA 1ONAA 3LQCA 5FV3A 4BQWA 4AXOA 2GN7A 2Q1MA 1W0NA 1YYNA 2ZCWA 3B69A 4AF9A 4NRMA 1F9KA 3GALA 4ZU7A 4OUSA 1RUH1 4HETA 3WDWA 3ROUA 3PVEA 5FYHA 1V6LA 3WG4A 2YY1A 1H0BA 2QQLA 3K46A 5J96B 1AR83 4XFCA 4D6QA 2Y26A 2YDEA 1O7FA 4FFGA 2LTNA 4H55A 1GNHA 1ZBE1 2VU9A 2ZMLA 1W8NA 4YW5A 2R1BA 3ZLIA 5C8CA 2DVAA 1IS3A 5GJ6A 3D3AA 1LOFC 2QQUA 3KQ4B 4QU2A 4YLZA 5FUNA 3HQUA 3DEMA 2LROA 3NV2A 3UGHA 3LDRA 3CU7A 3LDBA 5JXJA 3K4AA 4NIDA 1CQ9A 5DUVA 4BDVB 2WO2A 1PZ7A 5C3RA 1SFPA 1HQLA 3KD4A 1H2MA 1CAUA 2QZ2A 1RVF3 3D82A 2Y60A 4JGZB 4S2GA 2RS31 4QQPA 5EJ1B 5F2SA 3F95A 3GCWA 4GWNA 2P3IA 3AMPA 5BY5A 1NA1A 2ETEA 1MS9A 3WCRA 3JD71 5E6HA 2LS6A 2QFEA 4OHVA 4EQVA 2ZEZA 3BU7A 2JDPA 2VZVA 3I2GA 4XDPA 1U5ZA 3DKQA 1SDDB 1IPJA 4AYUA 3USSA 4MGSA 3KZ4C 4RQPB 2A6VA 1NYWA 1I5PA 1H1IA 2UY9A 3FZ3A 4D69A 2PHXA 1KD7A 3HEIA 4JRLA 5EZWA 3BKZA 4MV2A 4TYSA 5FMOS 5FY4A 1UOJA 4ZHNA 1WA4A 3ZN4A 3J7MA 2J1EA 2D43A 1LB2A 4Q4X1 1YLLA 1ZX5A 4EWAA 1JBCA 4DMIA 1TQ5A 2OVUA 4IEPA 1W6MA 5FCCA 4X8PA 2AREA 3W5MA 5GLWA 4UBGA 4YWAA 1VBB1 2OS2A 1BEV3 4AVBA 3FE5A 4AVSA 1LOBA 3ZXGA 4Y5Z0 2VUCA 2DUQA 4O7XA 5FY1A 1POQA 2VCMA 1OHFA 1RXGA 2RMU2 2WO1A 2YFZA 3PVBB 5DUWA 4YW7A 1JYIA 4Y22B 1JZ8A 1DQ1A 1A3KA 1UL9A 2DVBA 2V09A 4FVVA 1HRI2 3M3OA 4D7SA 3EBRA 5DG1A 1O3SA 2IXHA 4Q4W1 5BNNA 1O8PA 1DBNA 5FYUA 3WNPA 3BTZA 1S0IA 1ZZCA 2HWC2 4R4XA 4L97A 3ACIA 5D8AB 1R1A2 2BNOA 4M0NA 2VL4A 5BNOA 1EPWA 2QQMA 1Q8QA 3MICA 4C1WA 2W92A 1OFNA 1FOD3 3CQOA 1LNSA 4MGIE 5CFCB 4JZRA 4CCCA 5FMDA 5T50A 3TWIA 3ALQA 1UYYA 2WQ8A 2WZR2 1OH3A 4CP2A 4UF0B 3ZXAC 5C33A 2GC0A 4BMEA 2FDKA 4N53B 5A7QA 4FPGA 3SHRA 2DVFA 1W0PA 3NAPC 2XDVA 1OC1A 1C4RA 3JB8A 4QKNA 4ASMB 4W4ZA 1H8TA 2NPIA 2Z42A 4HBNA 1W9TA 4NMIA 4F83A 4MOAA 4LO6B 4UOJA 4M00A 5K8SA 4G9SB 4XIKA 3E6BA 2WFPA 5DABA 1NCQA 3TBDA 1O4TA 5BNOB 2AACA 2JG8C 3ILNA 3VN4A 1NT0A 4YW6A 2G9FA 5IK4A 1NE6A 2JDKA 1L7QA 3SCHA 4N7IA 1XXNA 2R16A 2QQWA 3NNGA 2D3SA 2VNGA 3SH4A 2A6ZA 1VRH3 2HWF2 3FC0A 5E1RA 2K0GA 4Z8BA 4TXWA 4RSUA 1QF3A 5JR7B 3SCFA 1KJRA 4B1MA 1RGSA 3POGA 1GQHA 1F35A 5JI9A 1S4CA 5LBCA 3O1RA 4QQ2A 5EYXA 4LKSA 1STMA 1UF2C 2LUWA 1QQP1 4XUPA 1HN0A 3VDDC 1AR73 1RXFA 3SH5A 2VTXA 4QHZA 1DLCA 4QX1A 5GLVA 4BCUA 4M4RA 1WGPA 5C7GA 1K5MB 4DB5A 3AZVA 1AYN2 4JRAA 4EYUA 1REFA 1D4M1 1GV9A 2DCYA 1UY1A 1AXZA 3CJIA 4FP3A 5D21A 4CDXA 3CNAA 5DDJ3 5FYZA 3T2PA 5J36A 1RUE1 5FPLA 4Q2FA 3HN1A 5DUXA 4XJUA 3WQ1A 1LR5A 4BMBA 4GKYA 3MDPA 2C6SA 4EN0A 2OYZA 2Z5WA 2AYHA 2NQYA 3U37A 4CPBD 5C9AB 5A6ZA 4AFBA 2FCUA 3VBSA 5HCBA 1VJ2A 3U78A 3GCXA 4N43C 2EALA 1QU0A 3R6SA 1S0FA 1W06A 3I3BA 3S0MA 4XOGA 3AZXA 4XILA 4I0WB 3M3IA 5GKAC 3B3QE 2O8QA 3WF4A 1W99A 2P3JA 4I0AA 4QPGB 3RRDA 5FZBA 1AR63 2ZGPA 2ZGRA 3LIHA 4JGYC 3O1TA 4PDWC 1O6UA 2DTWA 3PVNA 2Q1FA 4P9YA 4HVOA 1DYKA 3AYAA 5LA2A 1X50A 3TEZA 4RL7A 4IEOA 5FZ3A 1GWLA 3BIWE 3NV4A 5F3IA 4AQSA 1E5SA 5EPAA 3EMRA 2R062 4QPYA 2ZEYA 3SCGA 2I07B 2KR2A 2BVBA 2OXBA 1HV0A 5IAVA 1GOGA 3LZZA 1IQDC 4KL1A 4A41A 1RUF2 1XU2A 3VBHA 3O0VA 2JDZA 5FK7A 5FZOB 4A6SA 1LGNA 3MGUA 4WVMA 4B4PA 1H8TB 1Q43A 2ENRA 4DY3A 3ORJA 4OMDA 4AI3A 4TLGA 4XMAA 4DQAA 3HWJA 1ZM1A 1SLLA 2WJSA 1W6QA 2VULA 2D3PA 3T4HB 3K3NA 5J98B 2GP3A 2P3YA 1RYYA 3HT2A 4GD4A 2FCTA 3C7HA 4XTPA 5I93A 1LENA 3J7NA 3LOIA 3N7MA 4WVZA 1RVF2 1GUIA 2WQ4A 1SLIA 1W9YA 2W46A 3DXTA 3SC7X 4CDQB 4XHBA 4CU6A 1RUNA 1JXNA 1HQWA 2IWGB 2KA3A 2WNUA 3WQBA 5EXOA 3ZVXA 4B7EA 1R083 3ZOIA 3FLPA 4MGZE 4NWWA 4AHYA 3I2OA 1W8UA 3IBMA 5EJ3A 2JENA 4AWDA 5LCWL 1NZIA 3M8LA 2VQTA 2QE3A 3ZKYA 3K2OA 1G8WA 2PHRA 5GZEA 1OH4A 4B4RA 4WBBA 2VXJA 2FDFA 1X33A 3I8TA 1ZVFA 2OW4A 5KC6A 3U4XA 1QJX3 1TME1 1KJLA 1PM7A 2Q8OA 3Q8CA 4COYA 3PU3A 1LEMA 1QJY3 1WD3A 4P08A 2ZGSA 3BOWA 1PO21 5A7NA 1TMF2 5KHGA 2C24A 2DDUA 3M2MA 3ZFGB 1K45A 5FZCA 3AJZA 4ES9A 2ARCA 1SBFA 3BALA 1R1ZA 2A6YA 4NRPA 4UI9L 5I8YA 2X53S 4PLOA 1YFXA 1CGPA 4BWOA 1RUI3 4KWJA 3TB0A 3WNXA 1XNDA 2RJ2A 2E63A 3PTRB 2WBKA 1AYM3 4HKWA 3E5XA 2Y34A 3EXUA 4WM7B 1W2OA 3TEXA 4QT6A 3SKVA 2JD9A 2ARAA 1HRV2 2J42A 1MQTC 4XUTA 4TN7A 5ABJB 1PX3A 3OUJA 4UBHA 1OBNA 1N3OA 3AL6A 4PQ9A 5T52A 4FAHA 3RGBA 1HX6A 4RS5C 2H6BA 4IE4A 5A33A 5JZGA 1AXYA 1UD1A 2XLGA 4HKOA 4TTGA 4YFWA 4TZDA 3UK9A 5IJRA 5DZEA 1RHI1 1PIV2 1BHGA 2HH9A 5DZFA 1PNGA 2VZ3A 5FZGA 4RR3B 3B93A 5LA1A 5C71A 1VBC1 4FBFA 2QQIA 4D0QA 4DEVA 1REDA 3BB6A 4QB1A 4V1PA 1MEC1 1XNBA 4Q1RA 2RS11 4R52A 5FBJA 4TSVA 1X82A 3I59A 4AEDA 4AW7A 5LY1A 1LOGA 2PHLA 1JYNA 1YCIA 5AC93 2H6CA 3GBWA 1RUC3 1GP6A 2VOWA 5BNOC 5JWPA 5C5UA 4PF1A 4CU9A 1KDMA 1RUG2 3VD5A 4DUVA 1VBE1 2XGXA 4AEJA 5ACA1 1C3HA 5EIYB 3IDEA 3H8OA 1ALYA 1Y4WA 2VBBA 5IYYA 1PGW1 2VTXJ 4KBBA 1H6XA 3KHBA 3NWKA 4NIGA 2D6MA 2EXJA 5DAWA 3O5SA 5F7UA 1UIKA 1W6QB 3WW1A 3JZVA 1TEIA 3RYPA 5HXVA 2VPVA 3FHQA 3H42B 4LT5A 1VBA1 1BVVA 3FFQA 1U12A 4CSWA 3VZLA 4I2OA 1RUD3 1OSGA 1GNZA 1ND3B 2D6NA 4XF9A 3UESA 3RMYA 3HNBM 1CPMA 1EY2A 1NG0A 2WFF3 3VBRA 2VVFA 1G86A 1CX4A 1EP0A 1OA2A 2A3YA 5C4WC 2DYCA 2N7GA 5IATA 5F5AA 1GSLA 1POV1 1UPIA 4XFIA 4OQ9A 1VALA 3WP4A 1I9RA 1D7PM 1E5RA 5I0UA 1PK6A 1K3IA 4E9KA 5A3TA 1JZ5A 2B8MA 1OKOA 2BOJA 3PIGA 1WLCA 5F6KA 4QKDA 1W05A 1XYOA 2PLV1 4N9HA 4YVSA 5JSPA 4BXSV 1FNYA 2R32A 3TN93 4LA3A 1WZXA 2XL7A 3E1F1 4YNIA 1DZRA 5DDJ2 2PA7A 2ORXA 3UKVA 3VKNA 2B5HA 4GB33 1V6OA 4CEYC 1VRBA 1PM4A 2WT1A 3U07A 3O0XA 2QJVA 3I3EA 4JKMA 2VW0A 3WSOA 3ZO0B 3BTXA 2EICA 1LHWA 1WLTA 1POV0 3KLSA 3RZZA 4HG6B 2E32A 1WMXA 1RUH3 3J4UH 5CEHA 4DUXA 1HLCA 5FYBA 4HT1T 3C2UA 3MIHA 4CDUA 2ID4A 5JLVA 3RJ2X 4PF5A 1SLBA 5GZFA 4NRQA 2Q0AA 3CJIC 3CF6E 1UOFA 2YGLA 2JG9A 1YO8A 3AM2A 5C70A 1QXJA 2JDAA 1V6NA 2XHKA 2VCBA 3QD6A 2HEYF 5JOYA 1AR62 3O1PA 1AL0G 2Q5TA 4AQ2A 3ZMOA 4CXWA 5I0RA 2ZXQA 4NOTA 2WL1A 1EV12 5BNQA 2QQNA 4DO0A 1RMU1 4LULA 3LIGA 2B39A 3ZIXA 3V0BA 1UMZA 5FWEA 1YIFA 2ZX0A 3WY6A 1SPPB 2YMZA 3OYWA 5SV8A 5KC5A 4JQTA 3LOBA 4CXXA 4IEXA 2H0VA 4QB6A 5L7OB 5LATA 1RTVA 1V9U3 3ZXLA 2E51A 4OFGA 1N3PA 1SEFA 3JD73 3LSEA 2P3KA 3HIFA 1UZYA 3UNPA 2XJRA 2GNDA 3K77A 1DU3D 5CADA 3LAGA 4NHYA 5LEJA 4UW5A 4PIYA 2WIIB 2W39A 4RGAA 1GQGA 5FTTC 5FXZA 4ET7A 2FDHA 1SFNA 5FYMA 3VHNA 2JB8A 2QQKA 2BUKA 2DCKA 2EXKA 4BHPA 1O59A 4DOUA 1ZZBA 5CA6A 3M7AA 1OF4A 4BXFA 5KXDA 1O5UA 4Q4X3 1NY71 1BK1A 3VBHC 4W6XA 4Q5OA 2ADDA 2D6LX 4PCRA 1H6YA 2ZGOA 1VBB3 4BH9A 1N1YA 5F3CA 3VBFA 2WWSA 3OJBA 1EPZA 1S2EA 2WLPA 1O3RA 2VR4A 5F8PA 4QXCA 4URAA 1COV1 3DPRA 1QJX2 1GOHA 1OLME 4W6YA 5AFEA 3KV5A 4MADA 4XF3A 1HW5A 1PGL2 2ZGKA 1W8OA 4ATEA 5A6QA 3KCYA 4NPRA 4Q4W3 4XAAA 5T5PA 3SISA 2JJ6A 4AI1A 2UWAA 3WCSA 1WCDJ 4R9CA 4CU8A 4Y4YA 2K9ZA 5T55A 2MEV1 5FPUA 2JKBA 5BUVA 3D8CA 1NKGA 3WF1A 1O8SA 1IKQA 4GH4C 4BLIA 1ULOA 2VBPA 4P5YA 4QX7A 4BQ5A 3NRUA 3SH3A 4N9IA 4XBQA 2WYFA 4V2VA 4BQ3A 3VZKA 3HNYM 5AFBA 4GZ9A 2J1RA 1GKBA 2Y6FA 5BNPA 3VDCA 1KXGA 1AXKA 2X5IA 2XKPA 3ZMNA 3T30A 3KCXA 2AENA 5BV6A 4CP9B 3N9PA 1H9PA 4E4ZA 1SFYA 2O14A 1Z7S2 3JQWA 4AL9A 2BTVC 3T3YA 1C8M3 4QQLA 1FAYA 3FBMA 1UY0A 3IPVB 3ATGA 4IV1C 1AX2A 1RITA 5HCAA 1AL23 1AR91 2V4VA 4IE5A 2G19A 5FPAA 4Z92B 1URXA 4QX3A 3KSCA 3KV4A 2ERFA 1YI9A 4GKXA 5H9QA 3ZYJB 5GLZA 1JYVA 4NWVA 2AZ5A 3OEBA 4IL7A 3SNMA 5DAXA 1GANA 1SBEA 2HJIA 1CR7A 1FMD3 3WNMA 5AC92 1R093 4QXHA 3W58A 4IXLA 3N9LA 3ZXJA 1JYTA 2ZX4A 2BP6A 2W2IA 3KF5A 4K8RB 2XVLA 1QQP3 3D5OA 4M0HA 2XLFA 2GZWA 2NN8A 4LMFA 1CJPA 3HPNA 5IVBA 5L19A 3WUDA 3H1YA 3AC0A 3ZFEA 2YBSA 1G9AA 1C5IA 1T6GC 2Q30A 2XJSA 1BBT3 3A0KA 5FUIA 4GIQA 5T5JA 3ZDVA 1D4M3 3KVAA 4AEDC 3AZYA 1N3QA 4A7ZA 4YVWC 5A7WB 4AG4A 1RUD2 1KS5A 2FHRA 2XVKA 1ENRA 1AJOA 1DG6A 4A7YA 1RUE3 2DVDA 4QXKA 1UWWA 3AB0A 2HWB1 4CXYA 1GWMA 1OMIA 3GDBA 1VMHA 2VTFA 1LULA 1R64A 4FPOB 1IOAA 3ZYPA 5JPNB 3LA2A 3PNAA 4K3UA 4L9BA 5LB6A 1PGSA 4ATFA 4RQPA 3MW2A 3QACA 2PXJA 3T2OA 2WNOA 2DFCA 4O9GA 3RWNA 2VMFA 1ZZ9A 3NVCA 2UYBA 5FPZA 3O12A 1UU4A 1H4HA 3UV9A 1ZREA 4KMQA 4GB32 4DRRA 2CGPA 3AP4A 4LBQA 4RFT0 4SLIA 4YRDA 1DDLA 2Z2SB 3B00A 2UY8A 2GNBA 4DS0A 5K0UB 3E5QA 5KWRA 3GF6A 1DF0A 2NMNA 3E5UA 4JX0A 4CDWC 4I3PA 4XF4A 1I3HA 1PK6C 3ZN6B 5FXVA 1APNA 4EN7B 1W6NB 5F37A 1XYPA 1OUSA 1ZYBA 2XBO1 2YZ4A 3DECA 5IWFA 4C90A 1O3QA 4HLTA 1HB4A 3GZAA 2EAKA 3ZKUA 4ES8A 4XZPA 4QPIB 3C7FA 3NO8A 4Y22A 2ZHMA 4QKFA 1SLTA 2P2KA 4ITCA 4OLLA 5GZGA 5BNPB 5CAZA 3M3CA 2BYVE 5LBFA 2DCJA 2A3XA 4K8FA 4LNVA 3VDBA 3WG3A 5D8AA 2VZSA 2Y6LA 2C5DA 5FWJA 1PO11 3N9NA 4XPVA 2AEYA 3J8F3 2WQZC 2XR4A 5I0SA 5CFCA 1W39A 5JOZA 3KF3A 2GMEA 4H2AA 4UF0A 1V9U2 2Q4SA 3WEZA 4N53A 1I1EA 1DP0A 2C0ZA 3R4SA 4YM0A 4IETA 3KCCA 4AEMA 2VMDA 4XBNA 2JG9C 2BW8A 3POFA 4H7LA 3JBG3 2IXIA 2BFUS 1UX7A 5CBLA 2XXZA 4Q8LA 4XW3A 1RL3A 1YNAA 3VD9A 2QDNA 1I5ZA 3N7JA 1JYXA 1XE0A 2X10A 1NE4A 2RR13 4AGVA 1Q8PA 1WCKA 5CFDC 2R072 1YQ5A 3M3EA 5JSRA 4KG8A 1BKZA 1PO23 4DUWA 2R042 1U5IA 1UOGA 4RHV1 3GBGA 1RJ7A 1UYXA 4NAMA 3N7KA 1W03A 2FDJA 4Q0SA 4Z1VA 3O7OA 1UZWA 3ZFEB 2CV6A 2HWE1 1ZBA1 1O91A 1QXRA 2BRTA 5FLHA 1PVC3 4OULA 4RFRB 1DCSA 3PMSA 2RS52 1V6IA 3KVBA 4M3CB 4OHZA 3X29B 1QEXA 4D6RA 2J1SA 2D5HA 1FNZA 2ADEA 4BQXA 5DMYA 1VPHA 4Q4V1 1KFUL 1ASJ1 1W8WA 4NO4A 2RJLA 5FOJB 1NZCA 3R05A 4J1XA 3FN9A 4Y20B 2JE8A 3NNMA 1OD5A 2BBAA 2TNFA 3FHAA 3MZHA 1VBD1 2GH8A 3LE0A 4GQ7A 3U4SA 2Q8EA 2D44A 1WUVA 2BQPA 3GHNA 1K5MA 2ZHLA 4LE3A 4ORFA 1LU2A 4XQWA 4YGDA 3POIA 4E2GA 3I3MA 3VBFC 4XZUG 3VDDB 4Y1ZA 1BYHA 5IAXA 2XQXA 5CYYA 3BVCA 4AR2A 1JUHA 4KBZA 2BWAA 4LBQB 3USUA 1VBC3 2PMWB 1J3QA 1WBLA 4AI9A 5BYNA 2JECA 5C9AA 1UW8A 2Q1ZB 4S2DA 1UMHA 4CEWC 3OBTA 5A1FA 2KXLA 5FXXA 4LK6A 3JXSA 2YBKA 5DG2A 1UY3A 4DXZA 1OA4A 2BWCA 1GZWB 2VM9A 5EP9A 1WW7A 3MF9A 2HWD2 2R071 2EXHA 2JDYA 5IK8A 1VBE3 2VVEA 1DGWA 1C8M2 2A1XA 2RHPA 2WS93 3D0JA 3SKJE 2ZPXA 2EXIA 3W21A 2XL9A 4QPGA 3Q8FA 1AL22 4FFHA 3V64A 4AK3A 4ZKTB 1CD3G 3SITA 3VHRA 3IB3A 3K4ZA 3WG2A 2F6BA 3AYDA 2W94A 4XHXA 4NHLA 1ULCA 1E5IA 1VBA3 5E16A 4YPJA 5I8SA 3CZUA 1FMD2 3IKWA 1OFSA 1R092 2I45A 3MIFA 3N35A 4K20A 4RYDA 5FZIA 2DUPA 4FOYA 2VJXA 4IEWA 3S6PA 2OUJA 4JGYB 5KXBA 3NJZA 4CYDA 1QJU2 5F2WA 3S7EA 1LGCA 2ZHKA 2RDSA 3RZHA 1IPKA 2R6QA 4M4PA 5FZOA 5SV5A 1POV3 2IXLA 4LIUA 1A34A 3K3OA 3OGSA 4SBVA 5IFTA 4XFGA 3WQ0A 1F5FA 5F5QA 1W2AX 1FPN3 3DUIA 3I2HA 1TNRA 4OCTA 5AVAA 4ZXEA 1W8HA 3VD7A 2K46A 3MFAA 1W9WA 1BBT2 4FPHA 4BQ4A 5EWSA 2VNVA 5F6LB 1HJFA 2GC2A 2PLV3 4PIXA 1B35C 1QDOA 1DQ5A 5ANQA 3VKMA 1W2UA 1QNWA 1EAH3 4JCKA 4Q26A 3ACGA 5AVPA 4AVAA 2RDNA 4FPJA 2BPA2 4M01A 4PBOA 1GP5A 4CDQA 1Y43B 3CKHA 3SEEA 4LE4A 2ZGLA 1RUOA 1Q5OA 1VB4A 1AJKA 2CDPA 1H2KA 4PI0A 2WN3A 3BPSA 4WZCA 4XE9A 4YGCA 2Y8KA 2B9VA 5FY9A 5F3GA 5KHIA 3V0AB 5FK8A 2A71A 1J58A 1LECA 4KWKA 3WX5A 4XJ8A 2AGSA 3GBFA 1YQ2A 5FO8B 2RMU1 2RM22 2D6PA 4H3WA 3CIHA 2JDUA 5E8AA 1LHVA 4P9JA 1CZVA 2ZHNA 1ND2C 4Q4Y3 1ZRIA 4ZPIA 4KWLA 1HRI1 2XH6A 2BBVA 4MXVA 1HDKA 2F4PA 4JGZC 5FKCA 3ZFGA 2WLQA 1UIJA 4OHYA 3OTFA 2HWC1 3BGAA 5JOXA 1R1A1 4FXGB 4MX3A 3KGLA 1OOPC 3LGRA 4M3CF 4P9LA 1HB2A 1XSQA 4IGQA 1B09A 4AGRA 4OYUA 2OZJA 3GJAA 5FLIA 2OUHA 2VZQA 4IGOA 5FLJA 1H2LA 4WM7A 2WZR1 4GAZA 5D2AA 4LO4B 5IVYA 1LU1A 1HXS2 3T2TA 3A0NA 3USUB 5ABJA 1YEWA 5DAPA 4PLMA 1EUTA 5EV7A 4QAWA 1GOFA 5FY5A 4G4FA 2PHWA 4MVTA 2UYAA 2YG0A 3O1UA 1AVBA 5CU1A 2A73B 4K9SA 3I97A 2YV8A 3AP5A 1XNCA 1JHNA 1FV2A 5L9BA 5FOBB 4ZS3A 3ZM8A 1MQTB 3WZ1A 4DXSA 4HKLA 4CCEA 2NLRA 4AFDA 3S5AA 5LY2A 1DYPA 3ENRA 3IN9A 1LJ7A 2BZDA 5DQ0A 4RR3A 1WKYA 2WZ8A 3LPGA 1CJDA 4FQZA 4JDNA 4WM8C 3T0BA 2R30A 4P02B 3WVJA 4B7KA 4Z07A 4V2WA 3JU9A 3NV1A 5FZ9A 1LRHA 3M70A 2HWF1 3ZYBA 2L9LA 2A75A 5CG8A 3JBG2 4JQRA 4LBLA 2C1FA 4IUGA 4LBNA 4NHXA 5ANNA 2I74A 2ZJCA 4QX5A 3T1MA 5FFOC 1CESA 1V6MA 4KG0A 1AR82 3ZYGA 2DBNA 2WO7A 3ZDSA 1RUJ3 4A6OA 4A45A 4EZ4A 2RR12 3NKGA 4LJHA 5LW9A 2E9QA 4Y5SA 5CFCC 4WVWA 4EJRA 4EN9B 2XKOA 3I2JA 1H8VA 1RC6A 2W1SA 3ES4A 4P00B 4ARYA 3ZSMA 4L8QA 4MGQA 3QCWA 4N53C 5HV0A 4A3XA 1AYN1 1HQNA 5FQ0A 1PVC2 3FX3A 2A5ZA 3LCPA 4IEQA 2MEV3 2VZTA 1V00A 1N1SA 1N1VA 1QH6A 3IDCB 3POEA 2WSUA 4EN6B 1ND3A 1QNYA 4LPLA 2J7MA 3H0OA 4XF1A 3CO2A 1NCRB 4QPWA 3WUCA 5FYCA 1OQ1A 1ULPA 1JU3A 5C8CC 1JI6A 2O1QA 3G6JB 4JTOA 4N8MA 3BIEA 3NQHA 4COUA 1ENSA 4CCLA 2ZX3A 1C28A 3N36A 4BU2A 2WN2A 3ME2A 1NUKA 1H1AA 1J1LA 2ZBJA 4LO5B 2OKXA 3S30A 3AP7A 3UETA 1UMIA 4NIIA 1YXWA 1UOBA 4AAXA 1XNAA 3T09A 2HLEA 4XFAA 3AVSA 2VGDA 2Z4FA 3RZLA 3OEAA 1C5HA 4J6GA 1NQDA 3WP5A 1MZFA 1MVQA 3CMGA 5DAQA 1MS1A 4QB2A 3GYDA 1AR93 1J1TA 1MS3A 1NA1C 2EF6A 5FZ0A 4NR1A 3W20A 5FR3A 2ZGQA 4JV4A 5A3UA 3VD3A 2GAUA 2JIGA 3OGJA 2Y6GA 1RIRA 3PUQA 3WDVA 4IESA 2B42B 1BEV2 4P9IA 5FPVA 2AUYA 2B45X 3DKWA 1JS9A 2R061 3TEYA 1BZWA 1YIPA 2BFUL 3AP9A 2R1DA 3HQXA 3BTYA 2EAAA 2BVVA 3IDBB 5LASA 4CEYB 1RUF1 3DYPA 4JVAA 5I8TA 1Q8OA 2C26A 3A4UA 3B7MA 3QH6A 5FYIA 1RB8G 1WCUA 2EIGA 4ASKA 2J1UA 2FDIA 2IUWA 2DVGA 4K6BA 2DWRA 4E8CA 2GC1A 4NHKA 1UKGA 1LHOA 2PHTA 1XYNA 4ZS2A 3PUHA 4AI0A 3RQ0A 4IEYA 4IEVA 3BOPA 2CDOA 3KV6A 1NX9A 1FOD2 2E53A 4JDMA 4LK7A 4TWTA 1RVF1 1SPPA 2VD7A 4ISRA 4QX8A 4XACA 3MHZA 4BYYA 4HVQA 2FCVA 5L7OA 2W1QA 4HPKB 1UCXA 2HWB3 1IQAA 2VECA 5CIRA 3RNSA 2RDRA 1G9BA 1UYZA 4ZZ8A 5F5IA 2C9AA 3CDZB 3NMBA 3MW3A 2VO5A 2AH2A 4CCMA 5BNNC 2H0BA 3OB8A 3GJBA 4NJ4A 1FPN2 2ZAHA 3J9SA 5EYYA 4AHXA 1JZ2A 1YQCA 4LXLA 4QGNA 2KD7A 5LRRA 3OOXA 2VAUA 3ZIWA 3J26N 3TNPB 4I09A 5FP3A 2GALA 5E88A 1EAH2 1TMF1 2JIJA 3RVHA 1CAVB 1W6PB 2YUEA 1IHMA 3I54A 5E89A 1QXPA 3AYCA 4FPYA 3AMQA 3U14A 4AE2A 5FQ0B 4XFBA 4QDRA 5KHJA 5KXCA 2QUOA 4FTEA 1VRH2 1ZZ7A 5F5CA 1H8TC 3C8XA 4Y4RA 5LA0A 3C7GA 3RZKA 1UZ0A 3FBYA 2ZMKA 5G05L 5FMCA 3ZYHA 3LF7A 2W0XA 2BDRA 2P4EA 5HCHA 2ZA9A 1HRV1 2XBO3 4MZUA 1VLNA 3B5LB 4C0HA 1QY4A 1HB1A 1OXCA 3GZEA 1NCQC 4Q4Y2 1LOCA 1PNFA 3POWA 4CE8A 5IW0A 2VUJA 1SCSA 3Q8BA 3LFIA 4XMIA 1AR72 1BVP1 1CAWB 1GICA 4MGKE 4CDQC 1JOPA 5A6YA 4LIVA 5HV4A 4FFIA 3VZMA 1DLLA 2ORZA 4LORA 5CB7A 2W68A 1YFYA 4LTAA 3ZFFB 1KGYA 1PO13 4O9EA 4BB3A 1PIV1 1LOAA 1UXXX 1OPMA 2OQ6A 1G6NA 3VZJA 1T2XA 3AZZA 4JHZA 4N90A 4DXTA 2XB6C 4OVEA 2Q8CA 5A6XA 3WW3A 2EA7A 1MZEA 2QTWB 3DYOA 5JVVA 3UT0A 5JXIA 2WT2A 3IMNA 3ACHA 2D6OX 1L3JA 5DN2A 5EHDA 4Q0UA 3S57A 1QOOA 1WA6X 4CP0A 4GH4B 1VR3A 1FXZA 2PFWA 3WP3A 2HBUA 4A42A 4CTEA 5IVCA 3HMYA 4CCDA 1TE1B 2JDNA 4I30A 2WNEA 1WLDA 3NNFA 1K5JA 3QBQA 3VBOB 1RUG1 1SDWA 2CNAA 4IV3B 4AFCA 4CP9A 3AZWA 1UNBA 5JXGA 1ZBE3 2Z79A 2PHDA 4CDXC 4WM7C 3INAA 4PT6A 3RWKX 5GZDA 3SEPA 3IPVA 1UZVA 4LHLA 4RHV3 4NIHA 4FTSA 2WNVB 4UFLA 1K42A 3VBUA 2QVSB 3AX4A 3P1IA 4O65A 2HWE3 1ZBA3 2P1BA 1QIQA 3GHMA 3VBSC 2W08A 4A44A 3MI8A 3PJQA 1MS4A 1Y9QA 2CSGA 1VP6A 3CL1A 1SQ4A 4L11A 3D4KA 1J83A 1KFXL 4L99A 4IV1B 1EUUA 5JUVA 4Q4V3 2WZPP 4XJ9A 2RS33 1C1LA 1K12A 3KQRA 2ZMNA 1T6BX 4GWMA 4L92A 5J09A 1W2TA 4I02A 1WW4A 4FSJA 2C4XA 3GM8A 3ZSJA 5T5LA 4DRVA 4R4ZA 3OPZA 3T0AA 4QWNA 1WW5A 1W3XA 2VNOA 4XEZA 5FBZA 3S5QA 3EHKA 4D7YA 4BA6A 2D40A 2ZTNA 3PDQA 1S55A 2XJQA 2W5FA 2OZ6A 4LO7A 1VAVA 2ET7A 1O4ZA 2VG9A 1TVGA 5A7WA 5DDJ1 1LEDA 2VE1A 4H14A 3U0ZA 5FY7A 2CAVA 3OD0A 3NJVA 3WV6A 1FX5A 3U11A 3UYJA 1JZ3A 1BMV2 4XC9A 1NLQA 1R082 5A1LA 1UKRA 5FXWA 5IVEA 4XBLA 3NL1A 1CZTA 5A32B 4YVWB 3ECQA 2ZEWA 4XYXA 2ZACA 2CY6A 4S2FA 1W28A 3GZUC 2R7EB 5I91A 3KHCA 2BNMA 3AJYA 3ZPOA 4AOCA 5C5TA 1QJY2 2DURA 3P3PA 4CU7A 5CG9A 2QCSB 3VKLA 2VOXA 3O0WA 5FIXA 2J1VA 1AR61 5FZFA 2VOKA 2ET1A 2UWBA 1AX0A 1IKPA 4JTNA 3BTAA 4Q1PA 1XNTA 5JXHA 5G04L 1OPOA 2G9GA 2ZAAA 2E7TA 2WNUC 2W3JA 4BOWA 1EV11 5K0UA 1JH5A 1RUI2 3ABZA 3MO4A 3M1HA 4OUEA 1F4AA 5EJZB 4I3GA 3CLPA 3ZN6A 1AYM2 5H9PA 4PQQA 3FFZA 3RS6A 1GZTA 3CHXA 4AVCA 1W6NA 4XFHA 4YSFA 2PQQA 3W9AA 5F9TA 5CKQA 3POYA 4CUCA 2UU8A 3FMGA 2AR6A 4QPIA 1SBDA 3PUIA 4AQ6A 4OI0A 4JDOA 3M4FA 1ZA4A 1ZZ6A 3DL3A 5FZMA 2DV9A 4YG0A 1V6JA 3PVOA 5IVVA 1O3TA 1G9DA 4LR4A 4QX2A 4CPBA 4OI4A 1QJFA 4BQ1A 3BODA 3N9OA 4FPKA 1X36A 5GZCA 3I3DA 2QKDA 3ZSLA 4AI8A 1TNFA 3POSA 1OF3A 1D2QA 2P17A 3O1MA 4B8EA 1LTEA 1DFQA 4X6QB 4M3CE 2Q8DA 1XU1A 2YPJA 3HNMA 2YBPA 1D0GA 3BCWA 3VBUB 4E27A 4YARA 3RZGA 1W3VA 4F3JA 2SBAA 1CIYA 3LFMA 4HOOA 2E6VA 2PHUA 2JE7A 2OX0A 4C0BA 3AK0A 3K48A 4MYEA 3H50A 5JZGC 1WBFA 1KDKA 2JDHA 2QZ3A 2WR9A 1QWRA 1RUC2 1QJX1 2RMU3 5FYTA 3ZPYA 4O61A 3KT1A 4D7TA 1PGL1 2FZ1A 3LA3A 1DGLA 2AEZA 4FCAA 3NAPA 1WCQA 3WNNA 5F32A 3NW4A 1V0AA 4XTMA 5HI0A 5L7OC 1US3A 4XURA 3TYJA 2VQAA 4QGMA 3D0SA 4QKBA 3RZJA 4Q0VA 2RVAA 1R1A3 3W5NA 2BERA 5B4NA 4D6SA 4M3CA 2V5YA 3J7LA 3UKTA 2P37A 2VZ1A 5M0TA 1W2NA 5I0TA 3POBA 4MGYE 3M3QA 5C3SA 2WFF2 2VMHA 3ZR5A 4Q8KA 4QD2A 3EO6A 1QDCA 2VH9A 1VAMA 2XOMA 1DGWX 3B9IA 5A3MA 1PZ9A 2C9KA 3IIAA 5T5OA 4Y20A 3HR9A 2Y38A 1FI2A 3BUCA 3ILRA 1W8FA 1VMJA 4NE9A 4U36A 4C91A 1RJ8A 1XB9A 2XUEA 3HVDA 2GMPA 3ELNA 3H3LA 1ZRDA 1D0HA 1PMJX 1Z7S1 3H3ZA 3TN92 2F17A 5FP4A 3T1LA 3VDDA 4CRQA 5KXEA 2NM1A 3BYWA 2W95A 5LZ6A 2VZOA 4BE3A 4AAPA 3VBRC 3I2KA 3WINE 2V5DA 1MS5A 2G4IA 2Y33A 2W91A 3VUOA 2Y64A 4Z2WA 1PX4A 2HBTA 1DIWA 4INDA 2VQUA 2JB4A 3U1XA 2VOVA 1NXMA 4YZ2A 5JMCA 2VZUA 1RUH2 5AC91 4XAEA 1MZ5A 2JKXA 3HN3A 1Q56A 1VB2A 1SHWB 1F31A 3BPZA 5FMBA 4OI2A 1GZWA 1OQDA 3BN6A 4YZ4A 1ZBE2 2WZEA 4YVSC 4CEWB 1LOEA 3WNOA 2BNNA 5HPOA 1UXZA 2PN5A 1JZ7A 3DGTA 3MUY1 4BK5A 1F4HA 1LCLA 2X29A 3U10A 2IFRA 3MIEA 3LA7A 4DFSA 4LKFA 3C3VA 4CCKA 4HMZA 3ZYIB 1AYN3 5FAXA 4D8MA 3WHTA 3TRSB 3H8XA 3KT7A 1RUD1 5A3PA 4PIZA 1RINA 4XDQA 3H7YA 3T08A 4ZU4A 3ST7A 4GALA 3NSTA 4CDUC 2B7YA 4JGYA 1TG7A 2IXJA 2RS32 1S0JA 2AC1A 3PUSA 5FZ6A 1JZ6A 3PHMA 4CUBA 3JD72 2FBEA 2B4KA 1XRUA 4LKEA 5A7OA 4CA9A 2XWBB 4FOQA 2GP5A 1Q8VA 4NN0A 3MPBA 4P9WA 1IGOA 2ZOEB 4COZA 1CN1A 3THCA 2Y0IA 2CHHA 3P6BA 5FREA 2TUNA 4UFMA 1D2SA 1VIWB 3E6CC 3RZMA 3WQ7A 1ODMA 1TME3 1AHSA 2WDBA 4BIFA 4FP2A 3WNLA 3NAPB 3WDUA 1LHUA 4UAPA 2BGCA 4GB31 3H8RA 1XOYA 3MIGA 3OBAA 3UJQA 3A7QA 4Q4X2 4CVUA 4NPMA 1HV1A 5GLTA 4R8HA 5I0DA 5A3OA 4A7KA 1GU3A 4XUNA 5DUUA 5FYSA 2HKXA 1B35B 1VBB2 5LK7B 3V0AA 2IVJA 1JYWA 1VE0A 1H30A 4OUMA 2JG8B 2R063 2A3WA 1DZQA 3HD8B 4Y3OA 3TAYA 1DQ4A 5FZ4A 1ACCA 5C6CA 3LEIA 4ZONA 1RUF3 1GP4A 2XMLA 2A6XA 3IAQA 4NROA 4MG2A 2IC1A 2VZPA 2WAAA 3AXEA 1JZ4A 1IS5A 3EJKA 3N4MA 2VMIA 5FZDA 2QQOA 5IVJA 4Q4W2 1H1MA 3HOBA 4KWUA 4XABA 4UW6A 3P3NA 1ZZ8A 1CPNA 3NJXA 3T4VA 4KI5M 1IZ3A 2LW8A 4DIQA 1YI7A 4RD7A 1ND2B 3RSJA 4MGTA 1RHI3 1L7RA 3S7IA 4QMAA 1JTZX 2P6HA 1YUDA 3DPRC 1V9U1 3H1WA 1UY4A 4FI9A 3WNKA 4AGGA 1OOPB 3POJA 4AQTA 2D6KA 4KNCA 2ZABA 1MEC3 3WR0A 2RS13 3MIDA 4PJYA 2DFBA 1MR5A 3KM5A 4LO8A 3BU0A 1W6OB 3NKTA 1W8ZA 3H9AA 3VZNA 3WDXA 4EV0A 2VW1A 1G7YA 4IERA 5FZHA 5K0UC 1CONA 2PTMA 1A6CA 1MQTA 2XJVA 5FPBA 1J3PA 2IFWA 3IDAA 1ULEA 4PBPA 5FP8A 3ZSEA 2WSVA 3DXUA 3MPPG 1JW6A 2R041 1TMF3 2FMYA 3DCQA 4HONA 5ACA3 4F8AA 4RS5A 3AFGA 2YC2A 3I7DA 4CZSA 3AKQA 3FLRA 3Q8AA 1A8DA 1KITA 1DZTA 4LBOA 4N43B 4QPIC 3WDYA 5IK7A 2ZKNA 4UXAA 4Y26A 3HT1A 4BM8A 2VCCA 2RS51 1BCXA 4YM3A 5BNPC 5FUPA 1OKQA 4OHWA 4K1YA 4AFMA 3IWZA 4XDOA 2D7FA 3NJYA 4HSLA 2X5IC 4TLFA 4PHZA 4HFSA 4DINB 5CKNA 1HRV3 2UURA 4PDWB 1QGLA 4WM8B 5FZKA 5T54A 3ACLA 1EYBA 1OURA 2CU5A 3AXDA 5IT6A 1YJLA 3I49A 2A7AA 1QQP2 3OY8B 3UJOA 1XC6A 5A3LA 2B46X 2JDMA 1V70A 3OBRA 2XPJA 3WLUA 1U5XA 1A8MA 4GMP1 1YQ8A 2WYSA 4I01A 4E2QA 4YFZA 5HBAA 4RA0A 3AYEA 3H3UA 1A78A 4GWJA 4COWA 3VZOA 3SQOA 1D4M2 2XJPA 3ETQA 3IZOA 1PIV3 1H4GA 2GN3A 5FZ1A 3T2QA 3PL0A 2W1WA 4YG3A 1RUE2 2XG3A 3R0RA 4CCNA 4HK9A 1NCRA 3Q8EA 1OT5A 1GR3A 4LHNA 4UFKA 5TSWA 4IE0A 2ARBA 3JCIA 1QJEA 3ILFA 4DEQA 4GWIA 3ES1A 1C8NA 1GQPA 1VMFA 5CNAA 3ZYFA 4QM9A 4GMP0 4K40A 2P34A 4IGPA 1Z78A 1UN1A 3ZFEC 1FYUA 4X6RB 4D94A 3O1OA 5C4WA 2VMEA 2X05A 2HWD1 1RUG3 1S1AA 4LBKA 5BXXA 3W59A 5C8CB 5FP7A 5B4XA 5A7SA 4RGKA 2JXAA 1C8M1 1UZZA 3A21A 4R9AA 1AL21 1AF9A 1O4YA 2R49A 5HCFA 1KEXA 4BZ4A 4FQ4A 3AVRA 4AHWA 1XQNA 2F4LA 3WDTA 2DCTA 3DF0A 2GMMA 2XJUA 3WD5A 4AVVA 1RMU3 1S2KA 1FMD1 4XVHA 3PJYA 1R091 1UPSA 1CAUB 4G3YC 5CVRA 4RQPC 4IEZA 1QJU1 4WV8A 4CEYA 1NA1B 4IW3A 4FAGA 3I2IA 5EFUA 5LK5A 4YG6A 5ISLA 4LLOA 1WMDA 4PLNA 1XJAA 3KWVA 1NOVA 3N9QA 4YZ5A 2NYYA 1YFWA 2RG4A 4XXPA 2YU2A 5A3WA 4YM1A 2DTYA 4BQ2A 1BBT1 3HBKA 4FT8A 2OQ7A 4Z2AA 3QH7A 1X8EA 2YC0A 4MXWA 3LB9A 2MHFA 3J8F2 1ULFA 3DV8A 4EN8B 1VAKA 4HANA 4QX0A 1UU5A 4RS5B 1AX1A 4YZ1A 1X9TA 1W04A 4LOTA 5F1RA 5IHRA 4HPKA 4XETA 3VGIA 2FD8A 5FZ7A 4X8NA 4XJZA 3KT4A 1W6MB 4A4AA 4YW3A 4AI2A 5JSOA 2G9ZA 4XJAA 5FY8A 2FMDA 1PVXA 4ISQA 4K21A 4CP1A 3FJSA 4XQ4A 5D8AC 1OLQA
chains in the Genus database with same CATH topology
2MNGA 2RM21 4Q0QA 1DGRA 4WZFA 1COV3 3WOGA 1KQRA 4URTA 2HYKA 1FT9A 1TME2 5BPXA 3JB4C 2VMGA 1PZ8A 1WMEA 1Y7BA 1PO22 1CAVA 1W6PA 3AKRA 2GU9A 5BNNB 1JN2P 4YM2A 4HN0A 1J59A 2JICA 2R0FA 1ENQA 2X8KA 2NZ9A 4XIOA 5H9SA 3CJXA 2YHJA 3ASIA 1EV13 3JUUA 3MW4A 1GFF2 1S2BA 4GXLA 2YGMA 2ZX1A 3WG1A 1LESA 3MEPA 4AEKA 2VQ0A 4C1XA 1F2NA 4EWEA 4A2UA 1GZ9A 1ZNPA 2QNKA 4MUVA 1HXS1 2RJKA 4XJWA 3LSDA 2WC2A 2GSYA 5DZGA 2O8OA 3AMNA 3SXWA 4GA9A 5L73A 1CAWA 2E7AA 5J3UA 4BIOA 1OA3A 5J7MA 3VL8A 1NLSA 5C4WB 3ZFFA 1NCQB 4DPNA 3J8F1 4HL0A 1RHI2 5JIUA 3RYKA 5GM0A 1GBGA 4QQHA 2VXRA 1HIXA 1VBC2 5FO7B 5IK5A 4L2NA 1MEC2 4Q29A 2RS12 4Q0PA 1X8MA 3PMEA 3JBG1 4YZ3A 2D3RA 4GH4A 4EWDA 3AP6A 2W52A 4YW1A 2CGOA 1AR81 1K5MC 2I2SA 2RR11 3VBOA 4LBQD 1Q8SA 4IV3A 1UU6A 3MF6A 4XF0A 1VBE2 5KHHA 4FOWA 5ACA2 1ZRFA 1BXHA 5JPMB 2WS92 3FUQA 2VW2A 1PGW2 2PYTA 5JI7A 2WNVA 2IXCA 4FPEA 4LBJA 4KU8A 5FRAA 1PVC1 5C9AC 1KS4A 2E7QA 3I2DA 3UKNA 4MXWB 1OI6A 1VBA2 3DN7A 3CJIB 1G9CA 4LUMA 4CDXB 1Y3TA 4DZGA 1X7NA 1UX6A 3ZX7A 4IV1A 1U0AA 2CWSA 2GC3A 1FATA 4LUKA 3ZSKA 3VKOA 3GZTB 3VBSB 3ZXFA 4QPGC 2VNRA 2DF7A 1ENXA 1HKDA 3ZXEA 2PAMA 4K7JA 1M06G 3V56A 1OQEA 3OGGA 1ULGA 3OF1A 4ASLA 4J1WA 3GNEA 3B02A 2PLV2 3AFKA 4LLFA 4P5HA 1MZ6A 4LA2A 1Z7S3 5H9RA 2EVXA 2VUAA 1BJQA 1H2NA 3D6EA 1H9WA 5DXDA 2ZGNA 2ZGMA 2SLIA 1JYCA 2O0OA 3R4DB 2FZ2A 3MLJA 5A32A 5JIAA 4YVWA 1BEV1 5D1IA 1AUYA 5FDBA 4XFFA 3B9CA 2GNTA 3KMHA 2B9UA 4E4DX 4WVVA 2QQPA 3L9JT 1S0EA 3VBHB 2KM2A 2IZWA 2WS91 4WVMB 2ILMA 1J3RA 3AMHA 4H7MA 5FMOL 1QOSA 2HEWF 4R9BA 1GZCA 4MLOA 2CAUA 1NCRC 1OLRA 4EROA 2FQPA 1BMV1 2XUMA 1F5JA 2D93A 1FOD1 1RMU2 3VHPA 1WCSA 4GULA 2NP0A 3WP6A 1QJZA 1M4WA 2WNUB 4OZXA 1SLAA 3VLBB 1F8VA 4R9DA 1N1TA 1YRZA 3AKTA 4CDWA 3ZFGC 3NV3A 1FPN1 2PAEA 1MS0A 4XXAA 3WW2A 5FO9B 4QHBA 2ZX2A 2XVGA 3MIBA 1EAH1 2LM3A 1SLCA 4NHMA 3HAGA 1ZRCA 2MPFA 4IEUA 1FV3A 4DNYA 5ABJC 4IQPA 1NY72 2Y0OA 4P14A 1VRH1 4HZFA 4B3NA 3EQEA 2JEMA 2VY0A 4FPLA 4LHKA 4QM8A 3O14A 4XQDA 1QMJA 1IS4A 4ONUA 4FXKB 3ZN5A 5KHKA 1COV2 1PHMA 1RUJ2 2PAKA 2TEPA 3AKPA 1ASJ3 3QLQA 4Q4Y1 4W65A 2NMOA 3KGZA 1C57A 1AR71 2ZZQA 3Q9OA 3URFA 4DY5A 1WW6A 4RR3C 2ZS6B 5A33B 1WD4A 5JZGB 3L2HA 1VBD3 4HVRA 1CIWA 1XE8A 2ZGTA 5JOWA 1JUIA 2MEV2 5CFDA 1QH7A 3MFCA 3K51A 2R0HA 4KGGA 2OIIA 3FUOA 3H8UA 1LOFA 2ATFA 2JX9A 1MVEA 3APBA 1ULDA 2YYOA 4HK8A 2OA2A 3CEWA 1DQ6A 3I59B 1YWKA 4AEDB 4Q27A 2CL2A 3B94A 2JE9A 1AZDA 2DUOA 3RPQA 2DU1A 1W0OA 5GLUA 1G9FA 1BQPA 2A6WA 2R073 3THPA 1ND3C 1Q3EA 1I6XA 2CWMA 2R043 3PTYA 1IS6A 5K7PA 1XNKA 3E97A 2GH2A 1AR92 4OHXA 3KS7A 3LWCA 2GNMA 2IXKA 2RS53 3OD4A 2XWJB 3JQXA 1LKNA 4B4QA 3VBRB 1RUJ1 1GYKA 1LGBA 3ZFFC 3HBZA 2HEVF 1N47A 4N7UA 1QOTA 4CEWA 3THTA 4QQOA 1LHNA 4CDWB 1YJKA 1PK6B 3TOJA 4BLJA 2CGNA 1XE7A 1E57A 4FO9A 4GMP3 3G7DA 3H7JA 5B2GB 3OCPA 2TBVA 3VHOA 1S0CA 2RE9A 4RGGA 3TNQA 4Y1VA 1SMVA 4HN1A 3RMXA 4KU7A 4YVSB 4D3WA 5K9YA 3LKJA 2CTVA 4Y24A 1QHDA 3IT8A 4FOVA 1CAXA 4Y1XA 3RG0A 4KH9A 2Z69A 3L2YA 4META 3IM0A 2XJTA 3VBOC 2JD4A 3SMHA 2UWCA 1WLWA 2HWB2 1ZRRA 2YROA 4IV3C 3WHUA 4HSJA 1R081 3H1MA 5JAXA 5LEKA 1S0DA 3N3HA 1KRIA 3V65A 5T3NA 2OPKA 4P9XA 1V6KA 2V73A 4W6WA 1YFUA 2WNVC 1LODA 5JCTA 4CDUB 4B29A 1NXD1 2WA3A 4U2AA 4Y1YA 4AFAA 1QJY1 2HWD3 4COVA 5KBFA 1HRI3 2JG9B 1NQJA 1U5YA 1QKQA 3VKFC 1DGRN 3WW4A 3MLKA 2HWC3 3ZXKA 2GDFA 4BPZA 2K2SA 5C8WA 1RUI1 4E2SA 3FHIB 2WINB 5CFDB 2DCZA 3V0BB 1B35A 2DU0A 1AYM1 2ARXA 3FLTA 3OYWB 4KGQA 2JG8A 4ZXKA 2ZZJA 2WZR3 2XBO2 1QJU3 2QDRA 1DHKB 1REEA 2YXSA 3WXPA 4MH0E 3AMMA 4Y1UA 5J48A 4JAAA 2WA4A 3MLLA 4YGBA 3N7LA 4YW4A 3UL2A 4UW4A 3MYXA 1MS8A 3PLQA 2A70A 3RYRA 2PELA 1YHFA 5L36A 3SLIA 1PO12 3RDIA 3I4IA 4AVTA 1ND2A 4UW3A 3RI9A 5JDBA 3KB5A 4JGZA 1O5LA 1WMFA 3B01A 1C1FA 4YGEA 3ZYRA 1GLHA 3RJRA 1OOPA 2WT0A 1PMIA 2HWF3 2ZKLA 4OI1A 3VBFB 4LEJA 1W6OA 3QOPA 1JOJA 5J37A 1RUC1 4FPCA 3DPRB 4KQ7A 2RM23 2CYFA 4AHZA 4FPFA 2ES3A 4P9GA 4K1ZA 4QGLA 1DQ0A 1MACA 4YW2A 4NVPA 4S2HA 4FTBA 4RHV2 1D4VB 4Z82A 4F7ZA 4N43A 2WKKA 3ZXDA 4E4SA 2HWE2 1ZBA2 3VV1A 4ZU5A 1SACA 1CVNA 2D97A 2XLAA 1CAXB 2WFF1 1Z0HA 3RI8A 3E6DA 2ZGUA 4MSVA 4Q4V2 1HXS3 4PDWA 4WM8A 1S0BA 1ASJ2 4I0BA 1SCRA 1S0GA 3OY8A 3R4UA 2LALA 5IUQA 4LBMA 5GALA 2D98A 3FWEA 4JC1A 1NLRA 1VBD2 3VBUC 4YYOA 3WT3A 2X5IB 2PHFA 5FPXA 2VVDA 3VL9A 3TN91 1UAIA 1DQ2A 2D5FA 3AKSA 2BEOA 5LRSA 1ONAA 4AXOA 2GN7A 2Q1MA 1YYNA 2ZCWA 3B69A 4AF9A 1F9KA 3GALA 4ZU7A 4OUSA 1RUH1 4HETA 3WDWA 3ROUA 3PVEA 1V6LA 3WG4A 2YY1A 1H0BA 5J96B 1AR83 4XFCA 2Y26A 2YDEA 1O7FA 2LTNA 4H55A 1GNHA 1ZBE1 2VU9A 2ZMLA 4YW5A 2R1BA 5C8CA 2DVAA 1IS3A 5GJ6A 1LOFC 4QU2A 4YLZA 3NV2A 3CU7A 1CQ9A 5DUVA 1PZ7A 1HQLA 3KD4A 1H2MA 1CAUA 2QZ2A 1RVF3 3D82A 4JGZB 4S2GA 2RS31 4QQPA 5BY5A 4GWNA 2P3IA 3AMPA 1NA1A 2ETEA 1MS9A 3WCRA 3JD71 2QFEA 4OHVA 3BU7A 1U5ZA 1IPJA 4AYUA 3USSA 3KZ4C 4RQPB 2A6VA 1NYWA 1H1IA 2UY9A 3FZ3A 4D69A 2PHXA 1KD7A 4JRLA 5EZWA 4MV2A 4TYSA 5FMOS 1WA4A 3ZN4A 1LB2A 2D43A 4Q4X1 1YLLA 1ZX5A 4EWAA 1JBCA 4DMIA 1TQ5A 2OVUA 4IEPA 1W6MA 5FCCA 4X8PA 2AREA 5GLWA 4UBGA 1VBB1 1BEV3 4AVBA 3FE5A 4AVSA 1LOBA 3ZXGA 4Y5Z0 2DUQA 1OHFA 2RMU2 3PVBB 1JYIA 5DUWA 4Y22B 1DQ1A 1A3KA 1UL9A 2DVBA 2V09A 4FVVA 1HRI2 3M3OA 4D7SA 3EBRA 5DG1A 1O3SA 2IXHA 4Q4W1 5BNNA 1DBNA 1S0IA 1ZZCA 2HWC2 4R4XA 4L97A 5D8AB 1R1A2 2BNOA 4M0NA 5BNOA 1EPWA 4C1WA 1Q8QA 3MICA 1OFNA 1FOD3 4MGIE 5CFCB 5T50A 3TWIA 3ALQA 2WZR2 4CP2A 3ZXAC 5C33A 2GC0A 4BMEA 4N53B 4FPGA 3SHRA 2DVFA 1W0PA 3NAPC 1C4RA 3JB8A 4ASMB 1H8TA 2NPIA 2Z42A 4HBNA 4F83A 4LO6B 4M00A 5K8SA 4G9SB 4XIKA 3E6BA 2WFPA 1NCQA 3TBDA 1O4TA 5BNOB 2JG8C 3ILNA 3VN4A 5IK4A 2G9FA 1NE6A 3SCHA 4N7IA 1XXNA 2R16A 2D3SA 2VNGA 3SH4A 2A6ZA 1VRH3 2HWF2 3FC0A 5E1RA 2K0GA 4Z8BA 4RSUA 1QF3A 5JR7B 3SCFA 1KJRA 1RGSA 1GQHA 5JI9A 4QQ2A 5EYXA 1UF2C 2LUWA 1QQP1 3VDDC 1AR73 3SH5A 4BCUA 5GLVA 1WGPA 1K5MB 4DB5A 3AZVA 1AYN2 4JRAA 1REFA 1D4M1 1GV9A 2DCYA 1AXZA 3CJIA 4FP3A 4CDXA 3CNAA 5DDJ3 5J36A 1RUE1 4Q2FA 3HN1A 5DUXA 4XJUA 3WQ1A 1LR5A 4BMBA 4GKYA 3MDPA 4EN0A 2OYZA 2Z5WA 2AYHA 2NQYA 5C9AB 4AFBA 3VBSA 5HCBA 1VJ2A 4N43C 2EALA 1QU0A 3R6SA 1S0FA 3S0MA 4XOGA 3AZXA 4XILA 4I0WB 3M3IA 5GKAC 3B3QE 2O8QA 2P3JA 4I0AA 4QPGB 3RRDA 1AR63 2ZGPA 2ZGRA 4JGYC 4PDWC 2DTWA 3PVNA 4P9YA 4HVOA 1DYKA 3AYAA 1X50A 4RL7A 4IEOA 3BIWE 3NV4A 4AQSA 2R062 4QPYA 3SCGA 2I07B 2BVBA 1HV0A 3LZZA 4KL1A 1RUF2 1XU2A 3VBHA 3O0VA 2JDZA 1LGNA 3MGUA 4WVMA 4B4PA 1H8TB 1Q43A 2ENRA 4DY3A 4AI3A 4XMAA 4DQAA 3HWJA 1ZM1A 1SLLA 2WJSA 1W6QA 2VULA 2D3PA 5J98B 3HT2A 4XTPA 1LENA 3LOIA 3N7MA 4WVZA 1RVF2 2WQ4A 1SLIA 1RUNA 4CDQB 4XHBA 1JXNA 1HQWA 2IWGB 2KA3A 2WNUA 4B7EA 5EXOA 3ZVXA 1R083 3FLPA 4MGZE 4NWWA 4AHYA 5EJ3A 3IBMA 2JENA 4AWDA 3M8LA 2QE3A 5GZEA 1G8WA 2PHRA 4B4RA 4WBBA 1X33A 3I8TA 1ZVFA 2OW4A 5KC6A 3U4XA 1QJX3 1TME1 1KJLA 1PM7A 2Q8OA 4COYA 1LEMA 1QJY3 1WD3A 2ZGSA 3BOWA 1PO21 1TMF2 3M2MA 3ZFGB 3AJZA 4ES9A 3BALA 1SBFA 5I8YA 1R1ZA 2A6YA 2X53S 4PLOA 1YFXA 1CGPA 4BWOA 1RUI3 4KWJA 3TB0A 3WNXA 1XNDA 2E63A 1AYM3 4HKWA 3E5XA 3EXUA 4WM7B 4QT6A 1HRV2 5ABJB 1MQTC 4UBHA 1N3OA 4PQ9A 5T52A 4FAHA 1HX6A 4RS5C 2H6BA 5A33A 5JZGA 1AXYA 1UD1A 2XLGA 4HKOA 4YFWA 4TZDA 3UK9A 5DZEA 1RHI1 1PIV2 5DZFA 1PNGA 4RR3B 3B93A 1VBC1 4FBFA 1REDA 3BB6A 4V1PA 1MEC1 1XNBA 4Q1RA 2RS11 4R52A 4TSVA 1X82A 3I59A 4AEDA 4AW7A 1LOGA 2PHLA 1YCIA 5AC93 2H6CA 3GBWA 1RUC3 2VOWA 5BNOC 5JWPA 1KDMA 1RUG2 1VBE1 2XGXA 4AEJA 5ACA1 1C3HA 3IDEA 1ALYA 1PGW1 4KBBA 3NWKA 2D6MA 2EXJA 3O5SA 1UIKA 1W6QB 3WW1A 3JZVA 1TEIA 3RYPA 5HXVA 2VPVA 4LT5A 1VBA1 1BVVA 3FFQA 1U12A 3VZLA 4I2OA 1RUD3 1OSGA 1GNZA 1ND3B 2D6NA 4XF9A 3RMYA 1CPMA 1EY2A 1NG0A 2WFF3 3VBRA 2VVFA 1G86A 1CX4A 1EP0A 1OA2A 2A3YA 5C4WC 2DYCA 2N7GA 1GSLA 1POV1 1UPIA 4XFIA 1VALA 3WP4A 1I9RA 5I0UA 1PK6A 4E9KA 2B8MA 5F6KA 1WLCA 1XYOA 2PLV1 4N9HA 4YVSA 5JSPA 1FNYA 2R32A 3TN93 4LA3A 5DDJ2 2XL7A 4YNIA 1DZRA 3UKVA 2PA7A 3VKNA 2B5HA 4GB33 1V6OA 4CEYC 2WT1A 3U07A 3O0XA 2QJVA 3ZO0B 2VW0A 1LHWA 1WLTA 1POV0 3KLSA 3RZZA 1RUH3 3J4UH 1HLCA 4HT1T 3C2UA 3MIHA 4CDUA 5JLVA 3RJ2X 4PF5A 1SLBA 5GZFA 2Q0AA 3CJIC 3CF6E 2YGLA 2JG9A 1YO8A 3AM2A 1QXJA 3QD6A 1V6NA 2XHKA 5JOYA 1AR62 2HEYF 1AL0G 2Q5TA 4AQ2A 3ZMOA 5I0RA 4NOTA 2WL1A 1EV12 5BNQA 1RMU1 4LULA 2B39A 3ZIXA 3V0BA 1UMZA 1YIFA 2ZX0A 3WY6A 3OYWA 2YMZA 3LOBA 5SV8A 5KC5A 4IEXA 2H0VA 5L7OB 3ZXLA 1RTVA 1V9U3 2E51A 4OFGA 1N3PA 1SEFA 3JD73 3LSEA 2P3KA 3HIFA 1UZYA 2XJRA 2GNDA 1DU3D 5CADA 3LAGA 5LEJA 4UW5A 4PIYA 2WIIB 2W39A 4RGAA 1GQGA 5FTTC 1SFNA 3VHNA 2BUKA 2DCKA 2EXKA 4BHPA 4DOUA 1ZZBA 5CA6A 3M7AA 5KXDA 1O5UA 4Q4X3 1NY71 1BK1A 3VBHC 4W6XA 2D6LX 4PCRA 2ZGOA 1VBB3 4BH9A 1N1YA 3VBFA 2WWSA 3OJBA 1EPZA 2WLPA 1O3RA 1COV1 3DPRA 1QJX2 4W6YA 5AFEA 4XF3A 1HW5A 1PGL2 2ZGKA 4ATEA 3KCYA 4NPRA 4Q4W3 4AI1A 5T5PA 3SISA 2JJ6A 2UWAA 3WCSA 1WCDJ 4R9CA 4Y4YA 2K9ZA 5T55A 2MEV1 2JKBA 5BUVA 3D8CA 1IKQA 4GH4C 4BLIA 3SH3A 4N9IA 4XBQA 3VZKA 5AFBA 1GKBA 5BNPA 1KXGA 1AXKA 2X5IA 2XKPA 3ZMNA 3KCXA 2AENA 5BV6A 1H9PA 4E4ZA 1SFYA 1Z7S2 3JQWA 2BTVC 1C8M3 4QQLA 1FAYA 3FBMA 5I93A 3IPVB 3ATGA 4IV1C 1AX2A 1RITA 5HCAA 1AL23 1AR91 4Z92B 1URXA 5H9QA 3KSCA 4GKXA 2ERFA 1YI9A 3ZYJB 5GLZA 4NWVA 2AZ5A 4IL7A 3SNMA 1GANA 1SBEA 2HJIA 1CR7A 1FMD3 5AC92 1R093 3W58A 4IXLA 3ZXJA 2ZX4A 2XVLA 1QQP3 3D5OA 4M0HA 2XLFA 2GZWA 2NN8A 5L19A 1CJPA 3WUDA 3H1YA 3ZFEA 1G9AA 1C5IA 1T6GC 2Q30A 2XJSA 1BBT3 3A0KA 4GIQA 5T5JA 1D4M3 4AEDC 3AZYA 1N3QA 4A7ZA 4YVWC 4AG4A 1RUD2 1KS5A 2FHRA 2XVKA 1ENRA 1AJOA 1DG6A 4A7YA 1RUE3 2DVDA 4QXKA 3AB0A 2HWB1 1OMIA 1LULA 4FPOB 1IOAA 3ZYPA 5JPNB 3LA2A 3PNAA 4K3UA 4L9BA 4ATFA 1PGSA 4RQPA 3MW2A 3QACA 2DFCA 4O9GA 3RWNA 5FPZA 1ZZ9A 3NVCA 2UYBA 3O12A 1UU4A 1H4HA 3UV9A 1ZREA 4GB32 4DRRA 2CGPA 3AP4A 4LBQA 4RFT0 4SLIA 4YRDA 1DDLA 2Z2SB 3B00A 2UY8A 2GNBA 4DS0A 5K0UB 3E5QA 5KWRA 3GF6A 1DF0A 2NMNA 3E5UA 4CDWC 4I3PA 4XF4A 1I3HA 1PK6C 3ZN6B 1APNA 4EN7B 1W6NB 1XYPA 1ZYBA 2XBO1 2YZ4A 4C90A 1O3QA 4HLTA 3GZAA 4ES8A 2EAKA 4XZPA 4QPIB 3NO8A 4Y22A 2ZHMA 1SLTA 2P2KA 4ITCA 4OLLA 5GZGA 5BNPB 5CAZA 3M3CA 2BYVE 2DCJA 2A3XA 4K8FA 4LNVA 3WG3A 5D8AA 2C5DA 1PO11 4XPVA 3J8F3 2WQZC 5I0SA 5CFCA 1W39A 5JOZA 2GMEA 1V9U2 2Q4SA 4N53A 1I1EA 2C0ZA 3R4SA 4YM0A 4IETA 3KCCA 4AEMA 4XBNA 2JG9C 2BW8A 4H7LA 3JBG3 2IXIA 2BFUS 5CBLA 4Q8LA 4XW3A 1RL3A 1YNAA 2QDNA 1I5ZA 3N7JA 4AGVA 5CFDC 1NE4A 2RR13 1Q8PA 1WCKA 2R072 3M3EA 5JSRA