The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
200
|
structure length |
200
|
Chain Sequence |
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Catabolite gene activator
|
publication title |
Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb |
source organism |
Escherichia coli
|
molecule tags |
Dna binding protein
|
total genus |
60
|
structure length |
200
|
sequence length |
200
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-05-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00027 | cNMP_binding | Cyclic nucleotide-binding domain |
A | PF13545 | HTH_Crp_2 | Crp-like helix-turn-helix domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |