3RYRA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ryrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ryrA01
3KSCA 2OA2A 4AVPA 3BZ6A 3F8BA 2ZKZA 1ZARA 1IRGA 3SCGA 1YYVA 2XKOA 1XB4A 2E1NA 5E16A 2VBZA 3ERED 2IT0A 2DI3A 3S2WA 4AQ6A 3F72A 3KP4A 3MEXA 3CJXA 1YWKA 1P4AA 5DCMA 1T2KA 3ULQB 2EFPA 1EYBA 1XN7A 2UY8A 2L3DA 3CUQC 3WGGA 2D40A 4L9VA 2IXJA 3SQNA 1RZ4A 2H94A 3F8CA 3G7DA 2CO5A 4KMUX 4QM9A 2CYYA 3K69A 4MTEA 2D45A 3QU6A 2Y0MA 1E2XA 3F22A 1DDNA 2FMLA 2DO7A 3I59A 3GUDA 1ONVA 4CDGA 5FQ0A 3M8FA 2FRHA 3D0JA 2NNYA 5K1YA 1LEBA 3RYKA 4N9IA 5JSRA 3IHUA 4L0YB 1YW9A 2VBYA 5DCFA 5D8KB 3HQXA 2IXLA 3CEWA 4KU7A 4HOBA 4KICA 3LAPA 1HBXG 1J3RA 1U5TC 5BV6A 2LDUA 4HX8A 3RDIA 1CF7B 2IXCA 2DPUA 4ORFA 5E1WA 1QZYA 1BI1A 1R23A 2JPCA 2F5DA 4KYWA 2W84A 5FPXA 2JRTA 2XIGA 3SCHA 4OIRF 2QNKA 3O3KA 3WW1A 2HDCA 4Q5SF 2JZYA 1JGSA 1B6AA 4IHTA 4HA8A 1REPC 1G3WA 1HSTA 5D6FA 3VB2A 1S6LA 2HWVA 3QPHA 4KWLA 4G9YA 2IA0A 4OU0A 1SMYF 1L0OC 1BIBA 5FGMA 4F8AA 4GYIA 4L5IA 1TQPA 5FD6A 2MNGA 5TJJA 2HS5A 2EAAA 4AIJA 2HR3A 3RYPA 2V09A 2CQKA 4DQ2A 3IKTA 1WKMA 4EJVA 2MLGA 4I09A 2GXBA 4TLFA 5J48A 4BQAA 4EMSA 1LEAA 1XCVA 4U0WA 2M1BA 1MKMA 2C0ZA 3DXJF 3WTYC 1DP7P 1YFYA 2OAZA 3MZYA 4I0BA 2J5PA 3DF8A 1TBXA 2ELHA 2NNNA 1QXJA 1GQHA 1Z6TA 4R52A 3F8MA 4ZU4A 3SXYA 4HDVA 1R22A 4H7LA 3KZYA 3V4GA 3JTHA 3J80Z 3UKTA 5DDGA 1T98A 1TNTA 4KWKA 2YX4A 2IC1A 3FFQA 3JSOA 4P96A 2FE3A 4L0ZB 3S0MA 2NAZA 5LHHA 1CAWB 2Q1ZB 2Y75A 3H1YA 5D6EA 2N7GA 4WK8F 2KKOA 1B1BA 2W24A 2B0LA 1R1VA 3W6JB 3NSTA 3WTVC 1J5YA 2D5FA 4XFBA 3E5XA 2ZKLA 4QGMA 1IZ1A 3OTFA 3HRMA 4I0AA 3WG9A 1W4MA 3LA3A 4WZCA 5HDKA 1P6RA 2HYGD 4U7DA 5JI6A 2ACJA 4DINB 1QNTA 3F8NA 2XUBA 2DPDA 3K0LA 3GZ6A 3GVAA 4L2NA 1IN5A 1A04A 1OYIA 4XSXF 3HRUA 4ENMA 4KUMA 5JR7B 3GZ5A 1CGPA 5CYVA 1W5SA 2RGVA 2Q2EA 4ESFA 2XROA 4NQWA 3WODF 2OPKA 1IN7A 5L3EA 3CLPA 4WF2A 4XFHA 2CG4A 3D0SA 2FA5A 2P7CB 2BNOA 2XLFA 4EM1A 4MGYE 3BPVA 2H0VA 3ETQA 3FHZA 2BEOA 1RUNA 4D0PA 1DGRA 3EQLF 3JZVA 3H1MA 2GAUA 1PP7U 2GA1A 1FNNA 1IN8A 1I27A 4HX4A 2B8MA 4HMZA 3U0ZA 2O61A 5FLJA 4XFIA 1YUDA 4PCQA 2PI0A 3ECOA 1DZRA 1Q1HA 3QAHA 4P9UA 3R4KA 3NKTA 4AVAA 2GXGA 2O03A 2LKPA 2NYXA 3CUQB 3ACLA 1ON2A 3SZTA 3V7CA 4WWCA 4MQVA 3MQ0A 1FBQA 2Q8KA 1LQ1A 3BROA 3CF6E 4OIOF 4IEXA 1YFWA 3F8FA 4KN4X 3IC7A 4HQMA 4XFGA 5CLSA 3QACA 5D4SA 3WTSC 4ZYEA 2XAFA 1ZNPA 5BY5A 1RL3A 4EV0A 4XFAA 1MJAA 1DUXC 1B59A 3E6CC 1W5TA 3FX3A 4EJWA 5LHGA 2EA4A 4FT8A 1FPQA 5D4RA 3E97A 3DL3A 3E5UA 1R1TA 4M6XA 3WTUC 4XLNF 5A2QZ 3BY6A 4WVZA 4ON0A 4YFKF 1RC6A 5F6FA 4YIFA 3I4PA 4J1WA 4MTDA 4G7ZF 2UWMA 1IXCA 1R58A 1O7FA 3V7SA 2EK5A 1ZZ7A 4HBLA 3ZQ7A 1FZPB 2V1DA 2LF8A 5JR3A 2FNPA 2XAJA 4PGGA 4HDUA 1QGPA 1W7PA 3KP3A 4KN7X 1O3QA 4UUVA 4ZZLA 1QY4A 3BU7A 2ZCWA 1UIJA 2VOOA 3ES1A 1V70A 5AONA 2O6GE 4G7HF 4Q47A 4OLLA 3L09A 2W25A 2EA2A 1FYLA 1Y9QA 5JHUA 4LB5A 5KHIA 4I98B 2P5KA 3BJ6A 4JK1X 1UD1A 3FMQA 2YR2A 2VC0A 1WI9A 2DK5A 3HHGA 3PLQA 1EY2A 1V3FA 3ST7A 1Z6RA 1VP6A 1WSUA 2O8QA 3JAMK 1P2FA 2MH9A 2IXHA 3QU3A 3LWFA 1J7KA 1RTVA 2ET1A 3CJNA 1BC8C 5KHKA 1ZAOA 2OA4A 2LSOA 4ZU5A 1G3SA 3C3VA 2GC0A 4S05A 4MNUA 1V4RA 2QLZA 2Q4SA 1P4XA 1TQ5A 2MPFA 3TOAA 4M9XA 4GYGA 4UVCA 4LK1F 3J81Z 2PAMA 5J6XA 1HQCA 2QENA 1KQ0A 3HOTA 1YQAA 1FBUA 2QVOA 1XCBA 4HAMA 2EFNA 3MPBA 3SXWA 1B4AA 4I01A 3BWGA 5ILUA 3VOEA 1J3PA 4LLOA 5BPXA 3I64A 3FXQA 3IL2A 1ZG5A 5L3BA 2XVCA 5LBQA 3OF1A 1USTA 3WW2A 2K0GA 4M74A 3P9KA 3TO6A 1FLIA 4IRHA 3I71A 4QXKA 3I54A 2J5OA 3WE3A 1OKRA 4B29A 5FLHA 3KEQA 2GH2A 2GWRA 2M30A 1LR5A 3GYDA 2L4AA 1DPRA 2K9ZA 3BCWA 5FD5A 2HOEA 3RZZA 4P55A 2PFWA 4WXHA 3H3ZA 2HZTA 5EEHA 5CJ9A 1E17A 2WFPA 4Z07A 5E18F 5BXXA 3ML6A 1YS6A 5ICEA 1R36A 2DQLA 1X8EA 4IXAA 2P7VB 5DD4A 1L3JA 5LGNA 2B5HA 2RKHA 4QGNA 2QVSB 1YG2A 4A12A 3S7EA 5CVIA 4L11A 1SQ4A 2PMUA 4CZZA 3R6SA 4E2GA 1CAUA 1NYWA 4BNCA 2DCTA 5LHIA 1FYMA 2DK8A 4R1HA 1VTNC 5L3CA 4Y13A 2FQPA 3TDUC 1EH6A 2XGXA 3L9FA 1FP2A 1G6NA 4XF9A 1TW2A 4KIFA 2OQRA 4MGRA 1R5GA 4HLYA 5LEKA 4WXDA 4HSLA 1Q43A 2DAOA 5L3GA 3ELKA 4OFGA 4S04A 1JHHA 3ZMDA 3HYIA 4J1XA 4O5VA 4HF2A 2E1CA 1U8RA 5KK1A 3FMRA 2IXIA 5FO5A 4UHTA 4EWAA 1TQIA 2MLKA 4HF1A 2QBYA 3FJSA 4XRFA 4L9NA 4UVAA 4PIYA 2HFHA 4LG0B 1CAVA 2D2WA 3OCPA 2GQQA 1MDMA 4M73A 3IBMA 2CAUA 2FBIA 3MFKA 5AVPA 2PAEA 4EGYA 1BI2A 2QJVA 1SFUA 4G94A 4WX9A 5HS9A 5K5RA 3GFIA 3KP5A 5BPDA 3SCFA 2O0YA 2ZJ2A 4KA4A 1RNLA 2VE8A 1YS7A 3EETA 2ETHA 1H1IA 1RGSA 2WWYA 4CHUA 1CAXA 1J1LA 3FHIB 3TKYA 1FYKA 4MUVA 1O7LA 4AVBA 4B09A 1J58A 2Y48A 2Q30A 2FBKA 1TLHB 5HS7A 3O2PE 3NW4A 1SFEA 4ASNA 3DFGA 4UXAA 3EYIA 1O3TA 3U9GA 1FWZA 3L7WA 1XSDA 1FBSA 1R00A 2FBHA 5D8LB 1S29A 4IJAA 3KP2A 4O9EA 2XL9A 1FSEA 1EV7A 5ICFA 2DBBA 3OOPA 2E7WA 1K79A 4IEUA 1T0FA 5CVRA 3HSEA 3EJKA 4LGWA 1SD5A 1TW3A 4LFUA 4QX5A 2RN7A 3Q9SA 3E6BA 4HZFA 1TQMA 1WQ2A 5IT9K 2F5CA 4HLXA 4L9JA 4IRGA 3REOA 2H6CA 1OD5A 3VFZA 2GU9A 1EP0A 1HW1A 4LJZF 3WTXC 2OQGA 4ENJA 2V6CA 3OD0A 4BIFA 1HW5A 1UFMA 3T8TA 4IEOA 1Q3EA 1ZLKA 2VECA 2PEXA 5DV5A 5FCCA 2IW5A 4NB5A 3LA7A 1B9MA 4OINF 4HX7A 4KNYA 2DLLA 4ENNA 4I02A 1X7NA 2OBPA 2KXLA 4KDPA 1YLLA 4FAGA 1UPIA 3U10A 4G6QA 5CVUA 2YX7A 4QM8A 1J2XA 2PBIA 5JSOA 2QQAA 3V8LA 5BMZA 1ON1A 2M45A 1G4DA 4BHCA 6PAXA 5D5XB 2ZMEB 3GXOA 2VONA 3RYRA 4N0BA 3WTTC 1PM7A 1K78B 4WCGA 1FP1D 4EWEA 5FLXK 3ES4A 1Q5OA 3WTWC 5KHHA 1ZN2A 3UKNA 4LLLA 3K1NA 4XF4A 3K2ZA 4YFNF 3O14A 2ISZA 4XF1A 4UV8A 5D5UB 5H20A 2P6SA 5LRRA 4YRDA 5L3DA 1YTYA 4KIBA 3H9AA 1QWRA 1SAXA 5J7MA 3EDPA 4HLTA 4CXFA 3D5LA 4ZH4F 3WW3A 2STTA 3KE2A 2UY9A 4K8FA 3GLXA 4AIKA 1DZTA 2G7HA 2F5FA 3GX4X 4LUMA 3MYXA 4B8XA 4LD5A 4META 1CF7A 4RGUA 2M5WA 4IEVA 1KU2A 3DPTA 2E9QA 1JHFA 3T5XA 3ZN1A 3P7NA 5ED4A 4PIXA 1OYWA 2R7FA 5I0RA 1Z91A 4UVBA 2DW4A 5LGUA 2IJLA 4RAZA 1GHCA 2O3FA 1ZRDA 1P92A 2DT5A 3GF2A 2CGPA 4X6QB 3K1PA 4KMFA 5I0UA 2PLYA 3CO7C 3RJPA 1O57A 4PGHA 1MJBA 5ICCA 2VBWA 2GZWA 1UHMA 1FT9A 5KHJA 2IA1A 2D93A 2K4BA 3UKVA 3I58A 2FMYA 2QQ9A 3RKXA 3NQOA 1XE7A 2YU3A 4R8HA 2MA3A 5J8FA 2M87A 2EA7A 3HUGA 5L3FA 1D5VA 2KIUA 3M9AA 5E1RA 3WU1B 4GULA 2FF4A 2AXLA 4XF3A 3IWZA 2FSWA 4JVAA 4KWJA 3KFWX 4PIZA 3KP7A 2W57A 4XF0A 2HTJA 4LA3A 1ULYA 1YIOA 3F23A 1UCRA 1Z7UA 2MHFA 4X6RB 1IRFA 1BBYA 1UCXA 4Q0PA 5EZWA 2A69F 2COMA 2IRFG 3LA2A 1XE8A 3WE2A 2A6EF 5I91A 3R0JA 2H09A 2XAGA 1H9GA 3Q5FA 1MZBA 1ZVFA 3IIAA 1CAWA 1J59A 2BV6A 2CAVA 1EH8A 1U12A 4Q48A 4CICA 5E20A 2DFIA 4RB3C 4ONUA 1IN6A 3TNPB 3ZMTA 4CGZA 3FWEA 1U3EM 1IPKA 2EV5A 3C3WA 3W6KB 4G6DA 3N97A 3CTAA 2HTSA 2TDXA 2H27A 2K4JA 1FOKA 1XSVA 5HVQC 4HN1A 4UV9A 3WGHA 3H8UA 2FU4A 3JSPA 1KYZA 1O5LA 4FAHA 2V1UA 2Z9OA 2O1QA 3M7GA 3BP8A 1IW7F 5BPIA 5D1IA 1SEFA 4YIIA 4HF0A 2XV4S 3B73A 3HHHA 4M72A 3ECHA 3ZMVA 4MZUA 3NL1A 1JXSA 4GCVA 4GXOA 1LDJA 4K2EA 2HKOA 3TNQA 4HW0A 5E1XA 4RGRA 1U5TB 1UW8A 1GVJA 4A6EA 3WW4A 2ISYA 2EFWA 3ZPLA 2EB7A 3I5UA 4A0ZA 2XHKA 3EO6A 3GWZA 1OYYA 2QM3A 4IEZA 2V79A 2STWA 5CVVA 1AWCA 3RKWA 1IF1A 3L2CA 2V9VA 3R0AA 1XSXA 3BDDA 1OR7A 4Z2YA 2PN6A 3OV8A 2ZNZA 4A5NA 2VPVA 2R3SA 4WXCA 3NVCA 4L18B 1VR3A 3C1DA 4LMYA 1DGWA 3ISPA 5CVJA 2JPBA 3CUQA 3JTGA 4MHGA 3P9CA 4BH9A 2UYAA 4D7SA 2UYBA 1BC7C 2PA7A 4AD9A 5T3NA 1KGSA 3TGNA 5I8SA 4RB0A 1HSJA 5E8GA 4EJOA 2ZO4A 1HKSA 2EJRA 4F7ZA 2Z2SB 2GC2A 4A2UA 3EQEA 1GXQA 3FF5A 1RUOA 1RI7A 4HV5A 5C8WA 1LNWA 1VJ2A 3KGLA 1ZRCA 4ETSA 1Y0UA 5HLIA 2BGCA 4HYEA 2PAKA 3RPUA 4YFXF 3HIFA 2A68F 3B02A 1YFXA 4U0YA 3F6OA 3I53A 3CUOA 3T0YA 4Y17A 2BNNA 1S8NA 2ATFA 2OZ6A 4JV4A 3HRTA 3HT2A 1J9IA 2NRAC 1YLFA 1WWXA 3HTSB 1NE4A 1YW7A 3H3UA 4Q4ZF 3LAGA 4IEWA 1IUYA 4O9GA 4LULA 1G3YA 3MZHA 4XBFA 5H6RA 2PJPA 2PQ8A 1U6GA 4XLPF 3DP7A 1GXPA 5LLQA 1SMTA 4A0XA 1BI3A 3VEPA 3F6VA 4PJYA 2QQBA 2A5YB 4AXOA 1XDSA 4IPAA 3M3IA 4U7BA 4E2SA 3O6BB 1ZHFA 2HQNA 4LK0F 1ZYRF 2B9UA 1LVAA 3L00A 3H50A 4YYOA 2A61A 4IESA 3V8JA 3R60A 2XRNA 2JT1A 5I0SA 1BI0A 4CO8A 2VQAA 2IXKA 2G9WA 1Z9CA 3MWMA 1QZZA 4QMAA 4XEZA 5TRDA 1NXMA 3MAJA 2ADUA 2A07F 2P4WA 4M9SA 5AIQA 4JQFA 2C6YA 2F4PA 5DCMB 3J7AO 2KJBA 1O4TA 3KLNA 5HI0A 2OD5A 2G7UA 1XGOA 4IVNA 2FNAA 2VN2A 5JFRA 1FI2A 2DQRA 4LB6B 5ICGA 3J80K 3IKVA 2VODA 2RV8A 1ZH5A 3E3VA 5JCTA 4KU8A 2M8EA 1YO5C 1G3TA 5F1RA 2EFOA 3CLOA 3LZZA 5C6CA 2FXAA 3I59B 5FQ0B 1USSA 4R79A 2H6BA 1KA8A 4HBNA 4LEJA 4EM2A 4XETA 3KETA 1NHAA 4LA2A 1LDDA 3MCZA 1S7OA 2CW0F 1XGMA 1DPUA 2KIMA 2L02A 2ET7A 3RNSA 1EH7A 3U2RA 4RB1A 3F21A 2FEZA 4YSFA 2OU2A 1KQ8A 2XLAA 2OYZA 1O3RA 1O5UA 1XD7A 2GIVA 1WGPA 3LWCA 1F1ZA 2D1VA 1F5TA 4E2QA 5F64A 4HV6A 3SFZA 1R5HA 2PTMA 4NHJA 3KZZA 3SHFA 4QLCU 2PG4A 2MD5A 3R61A 3N4MA 1SD6A 3JAMZ 3M1EA 2AS5F 4M9ZA 2PMHA 1UIKA 2P8TA 2D5HA 4YG2F 3IDBB 1STZA 2QYOA 4EROA 1LDKB 4ZYHA 4AIHA 3H7YA 2PYTA 1Z1DA 5HLHA 1MJ9A 2WC2A 1ZLJA 5DEQA 2CWEA 3GFMA 3ZMSA 2A6HF 5I0TA 4MX3A 1XGSA 1ZX5A 5KBFA 1HW2A 3NRVA 5FLIA 1H1MA 1I1GA 2QZ8A 4PDKA 3HT1A 1S7AA 4LG0A 2D1HA 2NS0A 5FPZA 2ZBKA 3VODA 1LKNA 4AVCA 4JBAA 4P9GA 3G73A 1ZG3A 3IWFA 4QGLA 3WGIA 2BYVE 4U0VA 3TDZC 3GFJA 3H7JA 3DV8A 1KU3A 1MD0A 1F9NA 2LF7A 1CX4A 4ENKA 2XASA 4LUKA 3SZPA 4ESBA 1QBJA 1SD4A 3EYYA 2UZKA 4Q0SA 4LLNA 2Z99A 5ERIA 3ZMZA 5HDNA 3KMHA 1OI6A 2ESNA 4MEYF 2XL7A 3HTUA 5ILVA 4IRIA 5FDBA 1EPZA 5A2QK 2IVMA 1K6OA 5EEGA 5KVRA 2Q0AA 2K27A 1IPJA 2I45A 2IA2A 2HGCA 4CYDA 3D82A 3QP5A 1SD7A 3HSFA 4HVQA 4A0YA 4OMZA 1ZZBA 1BJAA 1FX7A 3LQQA 3DPLC 3KLOA 1U2WA 2XAHA 1RIOH 4EJTA 1W7PD 1IN4A 2KJCA 4H0EA 5ILSA 3DN7A 3CO6C 2E7XA 4M71A 3NJZA 2EV6A 2UXNA 2HQRA 1WLTA 3COAC 5HS8A 4RS8A 3FZVA 1HXDA 4LTAA 4Q0UA 3K1MA 3FXUA 1UB9A 1ZZ9A 2UXXA 3GEZA 1J0RA 4HVRA 1ZZCA 4FBFA 1T39A 1BN5A 1ZREA 3LQRA 1ZGJA 3HOSA 4TV7A 4QWQA 4A6DA 1PUEE 4XFCA 4AQ2A 5DD8A 1Z05A 4BHPA 3P9IA 2KIFA 3NEUA 1XRUA 3SMHA 1PMIA 3BALA 4IERA 1I5ZA 5LEJA 1B9NA 5E1ZB 2DTRA 4MEXF 3J81K 4P5OA 2ZMEA 1T38A 2HJIA 2EWNA 5CADA 4A5MA 3V7RA 3IRRA 3MDPA 2BE5F 1K78A 2OZUA 4Y15A 4RB2C 5K5QA 3CDHA 3QRFF 1BOAA 2ETEA 3GW2A 2MH2A 3WU0A 3OGJA 1IXSB 4RD7A 2RDPA 2Y0OA 2GA2A 4IEPA 2HYFA 1XMKA 4AWXB 3U1DA 2L54A 4IHSA 3M70A 1WRJA 2F2EA 4FX0A 1J75A 2VXZA 4EQQA 4FHTA 3RTRA 4KFCA 4XFFA 2L01A 2FOKA 4EWDA 1SFNA 3WTZA 4ESJA 3ABUA 2XKPA 2K7LA 3USSA 5HOOA 3BB6A 2QDRA 4BXUA 2RNJA 2A3SA 4ZYGA 2X4HA 1X3UA 2Z3YA 3PVBB 5IT3A 4Q0VA 2YSRA 4UBGA 2VOPA 4Q29A 2EFQA 5E8IA 1FXZA 3M8EA 3ZP5A 1JUHA 5BS6A 2BBYA 5FFXA 2VE9A 2IPQX 1W7PB 2K02A 1LRHA 3KP6A 2O8XA 4BHBA 1H0MA 5KHGA 1ODDA 1BM9A 4U88A 1XGNA 4MQ9F 3GYHX 4YNIA 2QWWA 4UBHA 4MGZE 3LFKA 5JSPA 5IT9Z 3KEOA 2PFBA 2VC1A 4XSZF 1ZRRA 3AAFA 4HN0A 4MGIE 1X8MA 4Q0QA 3U11A 3HSRA 3E6DA 5HLGA 2GC3A 1D8KA 1QXRA 3EHKA 1LB2A 3V8KA 1H9TA 4OIQF 4UNOA 5D5VB 4RGXA 2VT3A 1BIAA 2W85A 1NE6A 1UHWA 3FXRA 4JTNA 1R1UA 4MGKE 3ZN0A 4IF4A 2R7DA 3L2HA 4L9TA 1KQ9A 1Y3TA 4KIGA 1K7AA 3RIRA 1KU7A 2VBXA 1SFXA 5J3UA 4L5JA 3FMSA 4EGZA 5FLXZ 3BPZA 3E6MA 4BYYA 1S3JA 2RVCA 4MV2A 1OFNA 3QOPA 3TQNA 2BNMA 5JAXA 4ZZDA 2V1XA 2WV0A 1D3YA 1QO0D 4BAYA 2L4MA 4KL1A 1HKQA 1MGTA 1I1SA 4FX4A 4IETA 4EVIA 3I7DA 4N9HA 5AIPA 3G3ZA 1IXRC 4MH0E 5FB2A 4LLGF 2EVXA 4HQEA 3GFLA 3EBRA 2KRFA 2X0LA 2XAQA 3Q9VA 2HEOA 4HVOA 3VHRA 1WA4A 5BUVA 1HKTA 2P17A 2JTVA 1LJ9A 1ZZ6A 3LAJA 1I6XA 5LGTA 3F3XA 4G8XA 3PQKA 1FSHA 3JW4A 2QCSB 4IEQA 2HKXA 2DU9A 3BJOA 2JSCA 1CAUB 2CSOA 5DYMA 3DQVC 4KT5C 3QPTA 3ZDSA 3K9TA 2FQ3A 3SHRA 4GO1A 2RC4A 2PQQA 1OMIA 1P4WA 3E5QA 4EJUA 2Z69A 1U5TA 1L3LA 4P9FA 4EM0B 4OOIA 1YFUA 3DKWA 4Z82A 5I8YA 5LRSA 1QQIA 2IP2A 3LOIA 4I2OA 2P5VA 3TOBA 5K8SA 1R7JA 4UXNA 3EUHA 2OZJA 3FM5A 4OMYA 3C7JA 1ZG1A 2MBFA 1C0WA 5HDGA 3KCCA 1T6SA 5BQTA 1JE8A 3PNAA 1FY7A 1FC3A 2EV0A 4JTOA 1O3SA 1PDNC 2ESHA 2QBYB 1XDUA 3C18A 4G7OF 5BOXA 1YW8A 2K86A 5I93A 2F5EA 3RPQA 4NVPA 1J3QA 1CAVB 1YFHA 4PZJA 4RAYA 3GBFA 3BPXA 2YPRA 3TO7A 1D8JA 1MDMB 1KU9A 5FFZA 4E70A 5CU1A 4WBBA 2CV6A 5D5WB 2MC3A 2P6TA 1AOYA 2PHLA 1QPMA 1NZCA 1ZRFA 3KGZA 3ABTA 4ZU7A 4D7TA 3ROUA 1XMAA 3FM3A 2P5LC 1TNSA 4ZYDA 3RKYA 3TO9A 5H6QA 1X82A 5J8CA 3HRSA 2ZNYA 3LSTA 2WTEA 3ELNA 3BJAA 4O3MA 1KYWA 2LNBA 3IRQA 2RQPA 5EFUA 3RI4A 4OIPF 5K5OA 1OPCA 1CAXB 1PP8F 3PQJA 3GO5A 3IDCB 3CL1A 4I7HA 3CO2A 3I0TA 3BOQA 5JVTA 3H1WA 4YARA 2CFXA 1GQGA 2ZXJA 2VT2A 1YHFA 4HSJA 2PHDA 3PFIA 2Q0OA 3H92A 5DUIA 1U78A 1ZZ8A 4IEYA 4O6JA 4DNCA 1ZGAA 5DUKA 5E17F 1F4KA 3T8RA 2Z33A 3T1BA 4RGSA 4GGGA 3S7IA 2XLGA 5I8TA 3FE5A 1TTYA 2ZFWA 3FZ3A 3DEUA 1IAWA 4M6YA 3ZMUA 3QP6A 2GC1A 4I3PA 2QUFA 2Z5UA
chains in the Genus database with same CATH superfamily
2OA2A 4HEA2 4IGQA 5LA2A 4NHXA 3WXPA 2EIMH 1W9FA 3G4SI 5EHDA 2ZKZA 2CQNA 4A41A 2XUEA 4M3CF 2LVSA 3K10A 3JR9A 4CEYC 1K6YA 3S2HJ 1E5RA 5B4NA 1T2KA 5H9SA 5D2AA 1EYBA 3GMEA 2Y0SN 3X2QH 3ZFGA 3FL7A 2DU0A 3ZQFA 2VPRA 3WGGA 4Q4X1 2D40A 4JX6A 4Z6YA 2CJJA 4XAAA 3O0WA 2JK3A 5BNOB 1KJLA 2H94A 1SC7A 1U9OA 2XB6C 4CU9A 5F5IA 3W6VA 5B4XA 3QU6A 1OBNA 2DMTA 4D3WA 2UURA 4NMIA 2W82A 1G9DA 3J8F3 4W50A 5FZHA 3GUDA 1EV11 1V6OA 5IJRA 4CDGA 5FQ0A 1UOBA 5F9TA 3HMYA 4S2FA 1A6IA 4PJLA 5DG2A 3RYKA 4N9IA 5BNGA 2WR9A 4K9SA 2VBYA 5DCFA 3MUY1 2ADDA 3VKMA 4LO7A 1HBXG 3LAPA 5B1AH 1U5TC 3KS7A 2LDUA 3TOJA 2YU9J 1OVSA 5E1WA 1QZYA 1BI1A 3TEYA 1R23A 2JPCA 2F5DA 2KLOA 1T56A 1WCUA 3KV5A 5T5PA 4SBVA 3O3KA 2HDCA 4Q5SF 3KM5A 5A7WA 1X58A 4HA8A 2WO1A 5D6FA 4QB2A 4IQJA 5T54A 1GUIA 1X2MA 3ATGA 1SMYF 5E3NA 4GYIA 1MS0A 5FD6A 2AUYA 2MNGA 3RZJA 1OLTA 2QFEA 4MGQA 3KIOA 4Y7NJ 2CQKA 3DEEA 5F04A 1WKMA 4EJVA 3JREA 4TLFA 5J48A 4OI2A 4CDWC 5HODA 1NH3A 2COBA 4GJZA 4GH4A 4JQRA 1VQPI 2Z5WA 4WVMB 4Q4X3 3WTYC 2CYFA 2BZTA 1POGA 2F6BA 3MZYA 4BLIA 3DF8A 4II3A 2GNBA 1TBXA 2ELHA 1QXJA 1HB1A 2Y38A 4WZFA 4JP0A 2E26A 5K9YA 4QSHA 2ZAAA 3OUJA 1GLNA 1N1TA 4RLQA 4HDVA 1R22A 4H7LA 3V4GA 3JTHA 3J80Z 1EV13 2W1UA 3UKTA 4KWKA 1TNTA 3W5MA 2YX4A 3K4KA 4FTBA 2X5IB 4P96A 1DGLA 5DAPA 1VNDA 2NAZA 5LHHA 4BLJA 1AA7A 1QVTA 3H1YA 3LL7A 4QXCA 5D6EA 2N7GA 1VBD2 4WK8F 1PHMA 1ERDA 1XXNA 3WG2A 1WW6A 1G8WA 3QD6A 1IS5A 3EUAA 3WTVC 1PUFA 1AHSA 3WZ1A 2B45X 4XFBA 3UETA 4QGMA 1W99A 2OCEA 3OTFA 5KR7A 2ARCA 2K46A 2ZEZA 3K70D 1VIWB 5F0CA 1P6RA 1GYKA 3NJVA 3F8NA 3K0LA 3GZ6A 3POGA 1ND3B 1JXNA 1OYIA 3D1NI 3HRUA 4QXBA 3WF1A 2OUHA 2GALA 2JECA 2WINB 3PO3J 4UYBA 1XS9A 4E7HA 3KQRA 1H0BA 1S0CA 2K9LA 3FIWA 3BG3A 4S2DA 4CP0A 3FUQA 4ESFA 2K9MA 4AYBA 3HM5A 3C7HA 3WODF 2OPKA 5L3EA 4BU2A 2HWE1 4WF2A 4DXRA 2ECCA 2XLFA 3ETQA 5EWSA 1K12A 3OR2C 1PP7U 1W36C 1FNNA 1I27A 5BNPA 2ZGQA 3VBFA 3OUIA 2W48A 1K3IA 2EZHA 1FX5A 4B7KA 3AM2A 3RI8A 2WNUC 4B47A 3SEZA 3CD6I 3QAHA 2Y69H 2QE3A 3T2PA 4AVAA 2CV1A 2NYXA 3CUQB 4C3IJ 4QKDA 3SZTA 2R7SA 3MKZA 2RM22 1JU3A 3ZQHA 2QUOA 2Q8KA 1RUH2 2HEVF 3VBSC 4LHNA 1YFWA 3T4HB 2M9HA 4HQMA 4LHKA 2CH0A 3DU6A 2I07B 3QACA 4LIVA 3LIHA 3MMYB 1PJRA 4IHXA 4QPIB 2JE9A 3PIPF 3UNPA 3E6CC 3FX3A 4EJWA 2PELA 2EA4A 5D4RA 1R1TA 1Y56A 3BY6A 3WNLA 4YFKF 1H1AA 1RHI2 4MFEA 4CPBA 2WAFA 4K21A 3PUAA 4C8DA 5ERLA 1XE0A 4G7ZF 2UWMA 1IXCA 3V7SA 1GQPA 5BNQA 4BM8A 4FPCA 2VMHA 5DZEA 2KDOA 2FNPA 3C2BA 3SISA 1O3QA 3U37A 1ZTRA 3BU7A 2ZCWA 1UIJA 2E7AA 1SLIA 1V70A 2XVLA 1VQNI 4Q47A 3VYUB 3MI8A 3FBYA 3B6CA 1OPMA 2P3IA 1UD1A 1YHQI 2YR2A 2K9NA 2VC0A 2AACA 2GNTA 1WI9A 3HHGA 2MEV2 3QYEA 3UT0A 2P81A 4W6YA 3JAMK 2K40A 4GWIA 3QU3A 1ONAA 5FJKA 1JZ4A 2HNHA 1KXGA 1RTVA 2RMU1 3N9LA 2K9SA 5KHKA 3M8LA 5IVEA 5FOJB 5A3NA 2OA4A 3H0DA 3AMPA 2LSOA 1G3SA 3LEMA 3C3VA 4CDQC 1GZ9A 1NCRB 2QLZA 1P4XA 1TQ5A 3CZ6A 4FE7A 4F55A 4GYGA 4LK1F 5J6XA 4JRAA 2QENA 4P14A 1UG2A 1NXD1 2VG9A 4DBQA 4HAMA 3SXWA 1B4AA 2YU1A 2E5NA 1XNBA 2NXNB 3MD2A 4I01A 3T0AA 5J3LA 2LRDA 2R0FA 2B4KA 3VOEA 2QQPA 3TN92 3SFIA 4QU1A 2A70A 2QQLA 1PO13 5FKKA 4MHUA 2R7UA 5LBQA 1F5JA 4XLCA 4M74A 4LIUA 4J00A 4AOCA 3S16J 3FHNA 3VKFC 4IRHA 3CCMI 3I54A 1OKRA 3QPSA 4FTHA 2GWRA 2M30A 1JS9A 3POEA 2OKXA 4F92B 3BCWA 2HOEA 1LCLA 3VBUB 4CTEA 4WXHA 1YJWI 1OQDA 1CX1A 1E17A 3VYTB 4IQPA 2DQLA 2VQLA 1LHWA 3I3QA 1L3JA 2B5HA 1NK2P 3NAUA 1POV0 4A12A 4L11A 4RQPB 3AKQA 4E2GA 4PQQA 1SVLA 1LHNA 4BNCA 1SBDA 2WT0A 5T5OA 4XLFA 2VMGA 4QX1A 1SFKA 1AL23 1VTNC 1BK1A 2FQPA 3TDUC 1EH6A 5FTTC 4MG2A 5E79C 2PHTA 2YROA 1HLVA 2KQRA 1G6NA 2TUNA 4WM8C 4MGRA 1MQTA 5LEKA 4HSLA 2L7MP 1AR72 3GGLA 1Q43A 2DAOA 1FEXA 1OCPA 2IAIA 4IOAF 3HYIA 5EV7A 3NQHA 2VCBA 4LORA 4HF2A 5KK1A 2VW2A 2Y33A 5LBCA 5A6XA 4V2WA 4L9NA 2XPJA 1C8M1 3ZFEA 4PIYA 1HJGA 2LBFB 2HFHA 3V42A 5FY9A 2W4SA 4E9KA 1MDMA 2L9NA 3RJ2X 2WA0A 2FBIA 4GALA 5IP7J 2L9SA 4EGYA 2V1NA 5CFDC 3CKHA 1SFUA 3UGHA 5FIXA 5HS9A 1YJLA 2QSFX 3KP5A 1A34A 4I0WB 4LKDA 1LOGA 2O0YA 1CN1A 2ZJ2A 4KA4A 1RNLA 3PFYA 5EIYB 2ETHA 2M34A 3H35A 4CHUA 3PU8A 2WA3A 4FTSA 2KHMA 3PO2J 4DZPA 4B09A 1J58A 3WDWA 2X10A 3LF7A 4OVEA 4YG3A 3S5AA 3ZXDA 4ASNA 1R1ZA 3BIWE 3DFGA 1CZTA 2X9DA 1O3TA 4N4NB 5D8LB 3EXUA 1ETQA 5FRAA 4IJAA 2XL9A 4UW4A 2H8WA 1Q8VA 3W20A 3JRAA 4OAZA 2JG9A 3EJKA 1SD5A 2DUQA 1E3HA 3K3OA 1TQMA 5IT9K 4Y20B 1R4MB 4NWVA 2NVQJ 2J1UA 1OSGA 3HN1A 1OD5A 2XF5A 4BQYA 2SBAA 1EP0A 4QQ2A 4G6TB 2DVFA 3JBG2 2B39A 4FPGA 4GXLA 3T8TA 3AZXA 1X4PA 1Q3EA 1DGRM 2VECA 5DV5A 2JRMA 3W2AA 3PVNA 2IW5A 2JB4A 3LA7A 4OINF 2NS8A 4XJZA 5DM6F 2NP0A 5FKBA 3VD9A 5CVUA 4DOUA 4XJ8A 1J2XA 2PBIA 5JSOA 2QQAA 5BMZA 4YZ1A 1G4DA 6PAXA 3GXOA 5APAA 3VKNA 4E4HA 1K78B 5EYXA 5FLXK 5FYVA 3ES4A 3BZKA 2ZS6B 1SAUA 3B69A 4JX4A 3WTWC 5KHHA 2VZTA 1ZN2A 3UKNA 3K1NA 3DXTA 2RJ2A 4W1UA 5FYTA 3CESA 3O14A 5H20A 1REEA 5IVBA 5LRRA 5L3DA 4KIBA 4HLTA 1W9SA 5LK7B 3OY8A 1W0PA 3DCQA 1RESA 1RVF1 2P34A 2Y26A 2JA5J 3GLXA 5JVGF 2F5FA 2XC7A 4PLOA 1AKHB 2OTJI 4H55A 4Q4Y1 2M5WA 2Q1MA 3T5XA 4PBPA 1ULCA 4PIXA 4IL6C 2R7FA 1C8M2 5I0RA 1HOMA 1LUJB 3VBRA 3JD73 5FP8A 4AI8A 1ZRDA 1Y9MA 1PIV2 5C7GA 1MVEA 1RETA 4LBOA 3K1PA 3OYNA 4YGCA 1W05A 3CO7C 3RJPA 1MJBA 2VBWA 1UAAA 1D0YA 5KHJA 4ZTJA 3AP5A 2D93A 2K4BA 1HQNA 1K42A 3I58A 2DDUA 3NQOA 3MIDA 2YU3A 2B46X 4F91B 4R8HA 2MA3A 1GBGA 1V9U3 4NHKA 3HUGA 5C3OA 3WU1B 2WNEA 2VD7A 5H9RA 2AXLA 2HBUA 4PIZA 4LNVA 3IPVA 4P9YA 3F23A 3AFHA 3ZGKA 1UCRA 1WFXA 1UY4A 4X6RB 1K5MB 4PF1A 1LEMA 5DM7F 2XVKA 3DKQA 2VJ4A 2IVIB 3NNGA 1XE8A 4CUCA 2A6EF 1POQA 1FPN3 4LQRA 5I91A 1Z3YA 5C9AA 3LSPA 1G9FA 3X29B 1MZBA 2YUEA 3AVRA 4CEYB 3S14J 3JRFA 1EH8A 2HXOA 1OQYA 2NYYA 4CICA 2DFIA 1GKBA 4K7JA 1IPKA 3WDXA 3W6KB 3N97A 2OCCH 4BQNA 3CTAA 1QDCA 4YGBA 1F2NA 2HYKA 1GANA 3HPHA 3VDAA 4LE4A 1WBFA 5GLVA 1S55A 3OOUA 2MYSA 3HBKA 1PGW1 1NG0A 3HNMA 2Z9OA 3B7MA 4NRQA 5CKMA 5BPIA 1FMD2 1CONA 2D3SA 2ZX1A 1JTYA 4LITA 4XBQA 4HF0A 1WWYA 4Z2WA 5ABJA 1WUVA 3NL1A 1UU6A 1UX6A 1LDJA 5E1XA 1U5TB 3DEMA 2BVBA 4QHBA 3G71I 2YC2A 4A6EA 3WW4A 2ISYA 1W3VA 3CCLI 2EB7A 2XHKA 4PT6A 3AYDA 5FYYA 5IP6A 4IEZA 4EN0A 3RFRA 3NV3A 4ES9A 1AWCA 3R0AA 2K5CA 3WG7H 4Z2YA 1X36A 2ZNZA 1EPWA 3ILNA 2IXSA 4WXCA 3NVCA 5E89A 2PX9A 4L18B 1RVF2 4AHWA 3DU5A 4LMYA 5LZ6A 5DUUA 2R7TA 4RBOA 2IS1A 1A5JA 4HL0A 4WVVA 3URFA 4D7SA 3S57A 2UYBA 4XRMA 2IGKA 4AFCA 4ZYAA 3LSGA 2PA7A 1JZ3A 2Y9YA 5E8GA 2VZSA 2QQVA 2ADEA 1HKSA 2R30A 3FXOA 4A2UA 2IWGB 4BUPA 1GXQA 3FF5A 3BGAA 1UELB 2IGMA 1F9KA 4YW4A 5J4YA 3VYSB 3KGLA 4YZ5A 1ZRCA 1Y0UA 4BBSJ 3ACFA 4YFXF 1YRNA 1YEWA 5LATA 1X1BA 3NARA 4AHZA 2EINH 3U1KA 5J1XA 3L2RA 4U0YA 3EB7A 1EKEA 3T0YA 5F27A 1S8NA 2AEZA 3KYDB 1BBT1 3GZUC 1J1TA 2LOOA 5JXGA 4KQ7A 4C0BA 3T0DA 1NE4A 4J01A 2VQ0A 4GB31 4IEWA 4XHXA 4LULA 2VUDA 3E1SA 3DP7A 5LLQA 1BI3A 4PJYA 3HNYM 3GDBA 2QQBA 2A5YB 5A7SA 1CJPA 4YELA 4U7BA 3Q9OA 3NJXA 5L7OC 4E2SA 3O6BB 3A2KA 1D0GA 1S5LC 1ZHFA 1TP4A 2HQNA 4M6VA 3UESA 2J1TA 1E5SA 4CDWA 1LVAA 3L00A 1NLSA 2IS6A 1QJX2 3BTXA 2YPJA 3J7LA 5DXDA 2M7BA 4ZKTB 2RDQA 2RG4A 4N90A 3ZXSA 1BI0A 4CO8A 3JQWA 1QJZA 1MEC1 1GOGA 2G9WA 2NVXJ 5FV3A 1QZZA 1A8DA 1DYKA 2VZOA 1VE0A 2QGUA 2A07F 1R091 1IKQA 1R1A1 2P4WA 4M3BA 1C28A 3KCYA 1TWFJ 1HQWA 1W90A 2E32A 5C4WA 3M3OA 3A01A 5IYYA 1XGOA 4IVNA 2A6XA 2VH9A 1TVGA 2PHUA 2VN2A 5JFRA 2XMLA 5FKNA 1Z67A 2JWTA 2J22A 3IKVA 1T2XA 3OUHA 5IAVA 1SLBA 1STMA 1J09A 1FAYA 2QQOA 5F1RA 2EFOA 3CLOA 4SLIA 5C6CA 2FXAA 3I59B 2CGOA 5JLXA 1USSA 1W6PB 4COYA 2H6BA 1R64A 1KA8A 3I2KA 1JT6A 4EM2A 4LEJA 2W1QA 3VBSB 4NR1A 4URTA 4P08A 4XAEA 4XUQA 5J98B 3PURA 1YOVB 4JGZC 2R5ZA 3U2RA 2W47A 3S1QJ 3F21A 2FEZA 1JZ2A 2ICWG 3CHXA 5IVYA 1W8FA 1O5UA 2GIVA 4UOJA 3ACGA 4Y5SA 1PVC2 4HV6A 2PTMA 4NHJA 1I9RA 3FFZA 2R072 5GADJ 3H42B 1SCSA 1AHDP 5FZBA 2VOXA 2QZ3A 4P9XA 1VPHA 3LSRA 1ZBE1 1SD6A 3ZOBA 2DCZA 3TWIA 2WAEA 4A7KA 3ZM8A 1TZOA 4CDUA 3M1EA 1UIKA 2VVDA 4L0PA 3QH6A 4Y1ZA 4LMFA 4NNJA 1IQAA 5JZGA 1LDKB 2XSDC 3H7YA 2IEKA 1R093 2FZ1A 1R1A3 1DLCA 4FI9A 2LROA 2DCEA 2VB6A 3ZDVA 1BLZA 2WC2A 1Z78A 4N43C 4KWUA 2BWCA 4FQ4A 2CWEA 4XCBA 1RR8C 4IE0A 3ZMSA 2A6HF 2L9LA 1XGSA 2WNUA 5FZAA 5IHRA 1V00A 1H1MA 1JW6A 1I1GA 2JA8J 2DDBA 2BVVA 2CWMA 1S7AA 2NS0A 4I99C 1POV1 2ZBKA 2M4GA 1AX0A 4ISRA 1R6RA 1VBD3 3T3YA 1A6CA 1DQ6A 3BQZA 2BYVE 4U0VA 5HLTA 2VAUA 2VZQA 4CDQB 4GB32 3DV8A 3FLPA 4EYUA 4Z92B 4ENKA 5F3EA 4QX8A 3HPNA 4BQQA 3LKJA 2UZKA 1WJAA 2LR8A 1AYM1 2NN8A 3FMGA 5A1AA 5HDNA 3FUOA 3KMHA 2RS52 1W0NA 2XL7A 1SFPA 4XURA 5A2QK 2BRTA 2OX0A 2Q0AA 1TNFA 1IPJA 4XIKA 4C3JJ 2ZTNA 4HVQA 4A0YA 1K5JA 1U0AA 4TWTA 1ZZBA 3A7QA 2BY3A 5LA9A 4URAA 3KLOA 1JYVA 4TYSA 2ENRA 2VCMA 3C7EA 1IN4A 4ZTFA 5F08A 1UOFA 5A32A 3DN7A 3W5NA 3CO6C 2E7XA 4YM3A 4AGGA 2G1MA 4NQWB 5DS9A 2ZPXA 3FZVA 1HXDA 4Q1PA 3UYJA 5IAXA 2WLQA 4YG6A 1YX5A 5FZ9A 4QDRA 3ZXGA 1ZZCA 5GP9A 1POV3 4MXWB 2SLIA 2RM23 3HOSA 4TV7A 2BW3B 4N53C 4DZJA 2RREA 3BG6A 2AENA 2KIFA 2WWSA 3SMHA 3BALA 4XKBA 4IERA 3OYHA 4D8MA 4M3CB 2YPDA 5LEJA 3KEYA 3C7OA 3NWKA 5DAWA 4P5OA 4QPWA 2HEYF 5AC91 3AL0C 1PO21 4BEHB 3PMSA 5K5QA 5H9QA 1J83A 1RHI3 5CFCC 1AYM3 4RD7A 2LREA 3AFKA 3UL2A 2QKLB 2NMNA 1XMKA 4DY5A 3LFUA 3U1DA 3S6PA 4IHSA 2Y2ZA 3OS1A 1J75A 2VXZA 2W3JA 4EQQA 3JRGA 5A3TA 4RDUA 3LEGA 2JDPA 4PBOA 1AU7A 2FOKA 1GV5A 1SFNA 2XKPA 4CCLA 1OH3A 4BXUA 1GV2A 2R4GA 2HVSA 5FXXA 1QEXA 2Z3YA 3LEKA 4JQTA 1GZCA 2YSRA 3S3MA 2GDFA 4UBGA 3W2VA 1FXZA 3M8EA 3ZP5A 2WNVC 2E33A 2VKVA 2BBYA 2MEV3 4JAAA 2LY1A 3RG0A 1W7PB 2R7XA 5KHGA 4C1WA 1OCZH 4WM8A 4ES8A 3GYHX 2XGEA 2LYCA 3LFKA 1Y1VJ 3THTA 4XSZF 2CV0A 5LBEA 3OSDA 1W9TA 4MGIE 2VZ1A 1X8MA 4OAYA 3A22A 4IE7A 4AQTA 2D7FA 3WHTA 3HSRA 5DUVA 4DZGA 1OA4A 3AK0A 3N9QA 4AWDA 4XQDA 1D4M1 5HNFA 5B5EC 1D8KA 4V2VA 3EHKA 2HWC1 5KAIC 4XORA 4OIQF 1VAMA 4RGXA 1NE6A 3WDTA 1UHWA 3I2IA 1QVUA 5JDBA 3TN93 1UMZA 1R1UA 4IF4A 5FPLA 1W8WA 1RPWA 4L9TA 2Y0IA 4HANA 4X1EA 4RGAA 3HNBM 4EGZA 3BPZA 5C8CC 3O7OA 2VOVA 2VU9A 5CFDA 2CY6A 5JAXA 1X9PA 3SEPA 3FDYA 3WHBA 1G59A 1D3YA 2R6QA 4IETA 4EVIA 3O1TA 1NCQC 3J7MA 5AIPA 3L2QA 5FB2A 1LTEA 5KWRA 2VJ5A 1GP4A 1YIPA 3EBRA 4G9SB 2XAQA 1BA5A 2YGLA 1U5XA 1WJCA 1LJ9A 3N35A 3H8XA 1IGNA 1I6XA 1PVXA 1SDWA 3F3XA 4KMQA 1FSHA 2VE1A 3I3MA 4ATFA 4AIDA 1XNTA 3BU0A 4A3DJ 1ETWA 3BT9A 3PVOA 3NMBA 2J1EA 3QPTA 3ZDSA 3CCYA 4JX5A 4W97A 3OBTA 4AEDC 2EILH 1D4M3 3NNFA 1MBHA 2FCVA 2EZLA 1P4WA 2E2HJ 2ZX0A 3OL4A 2VJJA 4OOIA 3DKWA 3H9JA 3H9QA 3KVBA 3BR3A 3THDA 1S1AA 4OMCA 3LOIA 4HG6B 3RWKX 1FYUA 1QIQA 3V0BA 2OZJA 4OMYA 5C3QA 2MBFA 3AZVA 4N7UA 4KT6A 1DU3D 1R49A 2QBYB 4B43A 2WFF1 2QSHX 4G7OF 4AFAA 2DFFA 5A7PA 2F5EA 4QT6A 1O4YA 2QZ2A 2VJIA 3HZJA 4NVPA 5FZFA 3THPA 3Q8AA 4ZONA 2ZEYA 3D4KA 1X3WB 4FPEA 4G12A 4RAYA 5GLTA 4M01A 3QH7A 4Q27A 3TO7A 3VD7A 1KU9A 3AZYA 3IB3A 5FFZA 4E70A 5CU1A 5D5WB 1UZ0A 2V26A 2MC3A 1MIJA 2JDNA 4YLZA 3TL4X 4IHYA 2VM9A 4RS5C 4E8DA 3VZKA 2VUAA 4YW7A 1MSEC 3OYWA 5TISC 4ZYDA 3RKYA 2YC0A 3TO9A 1YYNA 1YCIA 2VUJA 3LSTA 4V2GA 2Y6KA 2WTEA 3BJAA 5L36A 4O3MA 1KYWA 1A78A 1MMAA 2LNBA 2RQPA 1AYN1 4OIPF 2VCCA 3SITA 1PP8F 3PQJA 3GO5A 2AC1A 2XUMA 3WQ1A 2CQXA 5ISLA 3CL1A 2VZVA 2X8KA 4AR2A 2GN3A 4L8QA 5JHFA 3I0TA 2ZACA 1HRI2 2OQ7A 1T08B 2ZJQF 4XXPA 4YARA 2CFXA 3CNAA 1UZCA 5FXWA 4HSJA 3NV2A 2HOSA 2PHDA 1RUC1 2XQXA 5DUKA 4XMAA 4PHZA 3T8RA 3GALA 2VJXA 2YY1A 3KQ4B 4U2AA 4NJ4A 4Q2FA 1TTYA 2ZFWA 3Q8EA 1IAWA 1REDA 2J1RA 3UJQA 2GC1A 2X6WA 3IH3A 5FZ7A 1GFF2 4B48A 2BV4A 1IRGA 1YYVA 4QKBA 3USUB 2XKOA 3ZKUA 3CJTB 5E16A 2VBZA 3RZMA 1LODA 4ZXKA 4AQ6A 3DBHB 3MEXA 1HX6A 2R041 2WIIB 2X85A 2HXIA 5DCMA 1WD3A 3ERMA 2WS91 2XBO1 5HCFA 1NA1C 3UV9A 4XR6A 1SFYA 3KT1A 3BCAA 3FKJA 4L9VA 2RS12 3RQ4A 2IXJA 1XTAA 2C9KA 3F8CA 1Z0XA 4DUWA 1BEV1 2KFDA 3APBA 1W2AX 3OPWA 4QM9A 1W8HA 1OVPA 2Y0MA 2HWD2 4OHXA 3HBZA 3L2WA 4LJHA 1DDNA 3AMQA 1RUF1 1S2EA 2DO7A 1K45A 1ONVA 1B72B 5E3LA 4FPKA 1RUD2 3D0JA 3QWLA 2NNYA 5FZCA 5K1YA 2ZA9A 4L0YB 1M06G 1W6OB 5D8KB 4M0NA 4NPMA 3RS6A 1PIV3 4HOBA 3GCXA 1J3RA 3INAA 1WW7A 3MIBA 2PMZN 1CF7B 3RDIA 3P3NA 4WV8A 2DPUA 3NV1A 1AX1A 1TE1B 2WNOA 5FPXA 2JRTA 2RNGA 2XIGA 4OIRF 2DOFA 2CQ7A 4UUSA 1DHKB 3WW1A 2ZZQA 2DV9A 3WG4A 4IHTA 1B6AA 3VD3A 1REPC 1W39A 1FOWA 3QPHA 4KWLA 4GRIA 2HOAA 2IA0A 4OU0A 1HXS2 2VTFA 5CQGA 4F8AA 1XYPA 4L5IA 4WVWA 1W2TA 2JG8C 1PZ7A 4Y1VA 2IS2A 2EAAA 4FCAA 2WYFA 3K4ZA 1KS4A 5F6KA 1JODA 2A1XA 1WKYA 4BQAA 1WZ2A 1P9QC 1RUJ1 2XBO3 4U0WA 3GBWA 3CMAI 3B6AA 1DP7P 3FC0A 1YFYA 2J5PA 3AYEA 4RHV1 3QCWA 1Z6TA 4R52A 1RUI2 2L5QA 2VUCA 1JHJA 4RM2A 1RUF3 1R5ID 4GAZA 3KZYA 3UR3C 3HGYA 1CPMA 1P8JA 4DUXA 2BERA 3FFQA 3OPTA 1CAWB 4ASLA 2Q1ZB 3OSGA 3L2VA 1Y6IA 1KZHA 3WR0A 5EF6A 4FETA 1GUUA 5JLWA 1UL9A 1FMD3 2PLV2 3NSTA 3TAYA 5DN2A 1V55H 3E5XA 2ZKLA 1MNDA 3GZTB 1COV1 2Y6GA 4NUBA 2EXJA 2CW8A 2NOJB 2LD5A 3WG9A 4WZCA 4B7EA 4YVWB 2HYGD 4U7DA 4IO9F 3CCQI 2XUBA 2DPDA 3I3DA 1MMDA 1A04A 1HJFA 3ZSKA 1MMSA 3TW7A 5JR7B 5IP9J 2HYXA 2WWUA 3ZR8X 2BUKA 4K8RB 4L99A 3EPZA 1JZ8A 4FXKB 5EJ3A 5F1JA 3FKIJ 2XROA 5L7OA 3POBA 3BQYA 3KLSA 2E7TA 1WJ5A 1RUJ3 3J7YJ 3N05A 5HNHA 4XFHA 5IVVA 3WY6A 2CG4A 3D0SA 5FYHA 2FA5A 2BNOA 4C91A 2F4MB 4MGYE 1OOPB 5FO9B 2EIDA 2BEOA 4RHV3 5F32A 1PK6A 1DGRA 3CCSI 3ZFGC 3AVSA 3EQLF 2PMWB 5FBZA 2HVQA 1IN8A 2XRLA 4HMZA 5FLJA 4XFIA 3KZIC 4AGVA 1SPPB 3ECOA 4MGTA 2JJ6A 2KT0A 3WDVA 2RJLA 4P9UA 3R4KA 3NKTA 3SKVA 2GXGA 2IS4A 4A3CJ 5H2FC 4X8PA 3PUQA 5CB7A 3MQ0A 1FBQA 2L9RA 1HDDC 2C5DA 1LQ1A 1UYYA 3BROA 1GT0C 3PUSA 4OIOF 1OA2A 2ZHLA 4IEXA 3THCA 2NVYJ 2R1BA 2K3PA 1COV3 1X4OA 3F2ZA 1XG1A 2LKXA 1WMEA 3S15J 5BY5A 5EYRA 2YFUA 2YG0A 2JDZA 5IATA 1DUXC 4DYCA 1W5TA 3GTJJ 1N1VA 1S0EA 3DL3A 1FPQA 3E97A 3B93A 3E5UA 5KXBA 4M6XA 4XLNF 4WVZA 1RC6A 4CCNA 4JGZA 5F6FA 1W8NA 1ZQ3P 2ZJRF 1W6MB 4YIFA 3CLQA 2JD4A 4W6WA 5FO8B 2I74A 2EK5A 1LGCA 3ZQ7A 1RITA 1TNRA 1YJKA 2XAJA 4XUNA 2W5FA 2LMDA 3S1MJ 2ZMLA 5IPAA 2WDBA 5GTIC 3ES1A 4FPFA 2CDOA 5M5WJ 5F2SA 1YI2I 3ZMNA 5A1FA 2W25A 5JHUA 1NT0A 5A80A 1WGXA 5LY2A 1V6NA 1W06A 4MGSA 3CDZB 2DK5A 2GXAA 4BL0B 3VBOC 1VBA1 2J7MA 2O8QA 4FP2A 3M4OJ 1QHDA 1IV8A 1P2FA 2IXHA 3BG5A 3O1SA 3SH4A 4N43A 4EJRA 1LOEA 3CCUI 4GQ7A 1H8VA 3NNMA 2XWBB 4IHWA 4L97A 4ZU5A 2EIEA 1APNA 4MNUA 5HXVA 2Q4SA 2C24A 9ANTA 4M9XA 4UVCA 2Y31A 5ANNA 1HQCA 2V6EA 2Y60A 3HOTA 1YQAA 1JOBA 5JVVA 2EFNA 1DQUA 2P6HA 1WH7A 3U4SA 2ZGRA 5C3EJ 2X1DA 1J3PA 2NPIA 5BPXA 2ZHKA 3IL2A 2LM3A 4P9WA 3WW2A 5B66C 4CXYA 2RS31 5FKLA 1FLIA 1TME2 4QXKA 3AL6A 3KEQA 2GH2A 1RUE2 4NAMA 1LR5A 4ZY9A 4LBNA 1H8TA 2V4VA 1RUG2 1PVC3 1SBEA 1HLCA 2O5RA 1GMMA 5CJ9A 3CCEI 2WFPA 5BXXA 1HV0A 3LSJA 4AFDA 4E7SA 4PUSA 5ICEA 2WT2A 4NO4A 4DJAA 3WNKA 3R4DB 1SQ4A 3ZXLA 4UFMA 1CAUA 1IG3A 5KC5A 2DCTA 1FYMA 2DK8A 1AR92 1GSLA 1PNFA 1BCXA 1VBA3 3RVHA 2W7NA 1W8TA 5F7UA 2ZGPA 2VW0A 4NROA 4XMYA 4UY8I 2F6CA 1TW2A 4KIFA 4IW3A 5L9BA 2GM4A 4HLYA 1WCMJ 4BPZA 4YVSC 1VBE2 1N3QA 3UGGA 1G86A 3B3QE 3OEAA 4S04A 2G9GA 4Z2AA 3ZMDA 4JC1A 3M4FA 2FZ2A 2BHZA 1BK0A 3JCUC 4O5VA 2E1CA 1U8RA 1QJU1 3HL2A 4N53A 3FMRA 3ZXKA 2IXIA 5GAGJ 4CUBA 1GNHA 3R4UA 1FV2A 3FJSA 2PJRA 2I2SA 1FIPA 1DYPA 1PZ9A 4AEJA 1UY2A 3RZOJ 4LG0B 1CAVA 4AI0A 2YHJA 2ZSIB 2RS33 4XRSG 3IBMA 5CFCA 2YC4A 4O65A 3MFKA 5DDJ2 2XH6A 3ZN6B 1JKRC 1ULOA 1BI2A 1H9PA 1QQP2 4LBQA 5A33B 3SEEA 2R5YB 2WA4A 4WX9A 2NOGA 4FASD 3GFIA 5BPDA 3MO4A 2LH9A 4WM7C 1W0OA 3F95A 3F0CA 5A3UA 4OCTA 1ETYA 3ZVXA 1YQ6A 4HKWA 5CPRB 2WWYA 1CAXA 5A3PA 4XL9A 4XCAA 4XILA 2Q30A 2XHNA 2WNVA 1OC1A 3HEIA 5K0UB 3V0AA 1WW4A 1W8OA 1SFEA 1NCQB 4Q1RA 3EYIA 3ORJA 3L1PA 1DG6A 1VQ8I 2WB1N 3ZIWA 5F8PA 5BNNB 1S29A 2JD9A 3KP2A 5DTDA 3GCWA 3VDDB 1K79A 1R081 4IEUA 3S5QA 1T0FA 2ZGKA 5CVRA 5LB6A 4LGWA 4LFUA 1MBEA 4YFWA 3E6BA 3N3HA 1S0BA 5HCAA 1WQ2A 3BG9A 3N9NA 2PQSA 2F5CA 3OYDA 3REOA 5K7PA 3KYCB 3VFZA 2GU9A 2Q8EA 1HW1A 4LJZF 1QJY2 3AL5A 3WF0A 2OQGA 3OD0A 5FR3A 3LEIA 3GBGA 1HW5A 3Q8BA 2ID3A 1YRZA 5EG0B 2IVJA 5FCCA 4NB5A 4E7ZA 3T0BA 1B9MA 4BMEA 1VQ9I 2KXLA 2O7OA 4KDPA 1UPIA 4RSUA 4J19A 3U10A 4MVTA 5C8CA 1HB3A 2A5WA 3V8LA 4S0HB 5J4VA 2M45A 1IJWC 2LTPA 2R7ZJ 4BHCA 2ZMEB 1HN1A 3WTTC 1NAEA 1PM7A 5FROA 3HVDA 2ZHNA 2WAAA 4HK8A 1NY72 4A3JJ 5K7HA 1LE8B 3B00A 3K2ZA 1H89C 5A6QA 4CRQA 2O8KA 4UV8A 1DQ1A 2EIGA 2X51A 3HG9A 4GDFA 3WW3A 3RQIA 1REFA 5FJHA 2Q8CA 5LA0A 1FIAA 4AIKA 2YYOA 1QJU2 1JYCA 4IV1A 2DOEA 4RS5B 4META 1MQTC 4RGUA 2WKKA 4IEVA 1OFCX 1C4RA 5EJCA 4B3NA 3BTJA 2E9QA 3VHPA 1FMVA 5ACA1 1TZLA 1JHFA 3ZN1A 2K3FA 3P7NA 4PCRA 4AEDA 5C5UA 4ITCA 1CPNA 1N77A 1HDKA 4AVTA 4XOTA 2O3FA 2ME6A 3ZSLA 1S0FA 1P92A 2DT5A 4HT1T 1AX2A 5FP3A 2JE7A 5KAFC 5I0UA 1GWMA 3AG2H 3JQXA 2PLYA 1YJNI 4PGHA 2GZWA 2VGDA 2CQQA 1UHMA 1FT9A 2RR11 5E8AA 1FJLA 2JIGA 4AYUA 3OBAA 3UKVA 4A3BJ 3PL8A 3POFA 2QKMB 1W9WA 4C0HA 5J8FA 2EA7A 3QPLA 1H2MA 5L3FA 1D5VA 4V19K 4Y22B 3ZFFB 4XF3A 2A3WA 3HB9A 4ANJA 4JVAA 3OYCA 3KF5A 2DJIA 3K6GA 3LMMA 2DTYA 5FREA 2W57A 3RSNA 2HTJA 1U5IA 2MHFA 1IRFA 4Q0PA 1ZR4A 4IUGA 2COMA 1DP0A 2DWRA 2R062 3Q0UA 1NOVA 4B3XA 1YQCA 3GJAA 5FZDA 3H36A 1VQ7I 2NS7A 4BK4A 5CNAA 2XAGA 1H9GA 3LDBA 2V7FA 1QU3A 3IIAA 3BODA 4BQXA 1LNSA 3EMRA 2KR2A 2YB7A 4OI0A 5E20A 2ELJA 1VQOI 4ONUA 1IN6A 5IOYA 4CGZA 1MR5A 1U3EM 3TNPB 2EV5A 3RWNA 1W6NA 1W5CC 5FPBA 2HWB2 2H27A 2TDXA 4UF0A 4S2GA 2WBKA 3BR1A 2BWAA 1FOKA 1XSVA 1NLRA 4HN1A 4UV9A 1QZEA 3AJZA 3RZDJ 1NK3P 1O5LA 2V1UA 1BYHA 5FKCA 2JUCA 4IGOA 2E31A 5D1IA 5GAHJ 1PGL1 2ZJCA 3ZO0B 3HHHA 4M72A 1V6KA 5FZOB 3WU2C 3PDQA 4CP1A 1JXSA 2HWF2 4IE5A 4RFT0 3MIFA 3WNMA 3PTYA 2HKOA 4D9JA 4I3GA 3TNQA 4BQWA 1DYOA 4RGRA 2H8RA 5IVJA 2VXDA 2VO5A 3MPPG 5GM0A 1Y9GA 4BA6A 3KB5A 1MNMC 2X05A 4KITB 3IDEA 2XSJC 4XLEA 1TMF2 1OYYA 1O4XA 4DB5A 2V79A 3WEZA 2STWA 5J1YA 2WL1A 2KZGA 4JHTA 2G0EA 1VF9A 1XSXA 2J1SA 2IBDA 1Q8SA 4A5NA 1XOYA 2VPVA 3D6EA 3AP9A 2VOKA 4BJ0A 3VWBA 3DPRB 2KL4A 3OBRA 1MS8A 1W0UA 1A31A 5HV0A 2JPBA 2JG8B 3I2JA 1NA1A 2FBEA 1OCTC 1WJBA 4P1WA 3ZRGA 2L7KA 4DXTA 1TWAJ 3MBWA 5T3NA 4ATEA 2D6MA 5JMOA 5F37A 3CCJI 2XJTA 5FBJA 4A6SA 4F7ZA 2Z2SB 5GZCA 1LGNA 1DLLA 3POYA 1LNWA 1VJ2A 2FQ4A 4ETSA 1UOJA 2AREA 4HYEA 2PAKA 3SQOA 2O14A 3DGTA 4BQ5A 4AVZA 3I55I 2YV8A 4CEWB 2A68F 2RR12 4BZ4A 3B02A 1VFCA 4IV3B 4Q4V2 3FXJA 1DFQA 4CUGA 2HYJA 1YFXA 2UUZA 2DVBA 3F6OA 3CUOA 1HRV3 1VLNA 4Y17A 3AX4A 1UXZA 4FFHA 5CZKA 5IFTA 3BOWA 1UAIA 1B35B 2OZ6A 3HD8B 1W04A 3HT2A 2D6LX 2NRAC 4OYUA 3I49A 4BE0A 3HTSB 3H3UA 2ZMNA 1UQXA 2VC9A 3JUUA 1B09A 2D43A 4O9GA 2I5UA 2XJPA 1ASJ1 5H6RA 4XLPF 2ZSHB 5JOYA 1ZBA2 4N4OB 3FBIB 4E7JA 2ES3A 3VEPA 2EXHA 2XOMA 1AR61 1OCCH 1RYYA 3TYJA 4ZJZA 1HB2A 1RMU2 4IPAA 3M3IA 2Z16A 1VBC1 5GZFA 5BYNA 4LK0F 1ZYRF 3GHNA 1CJDA 2XB5A 3OD4A 4YYOA 4IESA 3V8JA 3R60A 2JT1A 1VMFA 3D3AA 4II2A 3FK7A 2VQAA 2JA7J 3RCOA 5C9AC 1AXKA 4QMAA 5TRDA 3RZKA 4Z1VA 2ADUA 1GWLA 1MBGA 5AIQA 3DXUA 2C6YA 1AXZA 3OGGA 2VI6A 1YNAA 4GA9A 1BXHA 4YFZA 2OD5A 3ZFGB 1FOD2 1RUD3 2FNAA 3ME2A 3N7JA 1FI2A 1F8VA 1VB2A 3H0GJ 4LB6B 5ICGA 3J80K 4F52A 4D5CA 2X09A 2RV8A 1ZH5A 1GDTA 4J6GA 1DCSA 4KU8A 2M8EA 1YO5C 2KM2A 2ERFA 2MFZA 3S2DJ 5J09A 4W8JA 5FQ0B 3MKWB 2E36A 1G2HA 1J84A 1GNYA 4NHMA 4UFKA 2C9AA 2WY7Q 4XETA 1JYXA 4NRPA 4XBNA 4XLAA 1NHAA 4PLNA 5F0HA 1S7OA 1DPUA 5L9RA 2L02A 1ASJ3 2ET7A 2DYRH 5FZ8A 3RNSA 2LK2A 2A05A 3HWJA 4RB1A 1HXS3 4YSFA 1HCRA 1NKGA 2QF7A 1WCDJ 4Q4W2 5JI7A 1XD7A 3HOXJ 2XDVA 3PU3A 5F64A 1VBC3 3SFZA 3NAPC 2YMZA 4HFSA 4FO9A 3E0JB 1W3XA 3SHFA 2E1MC 4QLCU 5A7WB 1PMHX 1WW5A 2X48A 2PG4A 2MD5A 3R61A 3S1NJ 4AGRA 1IS4A 3BR6A 5FPVA 4M9ZA 1CZVA 1I3QJ 2R7EB 2PMHA 2R16A 1QJFA 3RKQA 2D5HA 4YG2F 3IDBB 1KFUL 2NVTJ 1KITA 1RIRA 3MEPA 2OIIA 4AIHA 1P7IA 4LO6B 3LOBA 4M3CE 4RL7A 1MJ9A 1ZLJA 3Q8FA 2W1WA 2ZB9A 4CDXA 1O8SA 4GH4B 4MX3A 5FLIA 5ANQA 3JXSA 4CVUA 4P9GA 4CCOA 3BKZA 4MOAA 2DMQA 3SKJE 2PLV3 3WGIA 1XSRA 2DDAA 2DFCA 1AJOA 3O0VA 4CU8A 4NIDA 3PJQA 4EN9B 4CCDA 4JGYA 3AG3H 2XASA 4HETA 4ESBA 3J4UH 3AG1H 3WNPA 2R7OA 3POIA 2XJSA 3P5BA 4Q0SA 2A6YA 2Z99A 1RC9A 1WLDA 3ZMZA 2VL8A 3W3CA 2ESNA 1PUFB 2O9LA 3IT8A 1DQ2A 3BIEA 2IVMA 3K2OA 3A0KA 5KVRA 2K27A 3K48A 3AG4H 2CSGA 2IA2A 3RSJA 2HGCA 4CYDA 1MS4A 2WUHA 3KPHA 4TN7A 2CUJA 5FK7A 5LCWL 3ZN4A 1BJAA 5FAXA 1FX7A 4CYCA 3LQQA 4JCKA 4CH7A 4H0EA 1NTCA 4AI3A 1SLTA 4MHRA 3VBOA 5JWPA 1VQ6I 2HQRA 2RV9A 4KBZA 4XYXA 5HS8A 4DXSA 3J8F2 4CE8A 1UKGA 2M3AA 4Q0UA 2FDKA 1E3PA 1WMDA 1UB9A 2RAEA 1YIJI 3SJMA 2WBMA 1OPOA 5FKMA 5C4WC 3N9OA 4YM0A 3LSHA 3LQRA 2ZXQA 4QWQA 4A6DA 1PUEE 4GMP0 5BNPB 2WZ8A 3JRBA 1VQ4I 3P9IA 3VBFB 5HPOA 2VMCA 2JQ7A 1PMIA 3ZYIB 1Y4WA 2WZR2 2V9KA 5M0TA 4I76A 1GZTA 1T38A 1LKXA 2HJIA 2EWNA 3V7RA 2BE5F 2EQRA 4Y15A 3QQAA 3K4BA 2QQJA 1C1FA 3CDHA 3OOXA 1BOAA 2MH2A 3WU0A 2WZEA 4N7IA 5D8AA 3OPZA 1KEXA 2HYFA 4AWXB 3ZKYA 1AR81 3NJYA 4FX0A 2ZABA 3RTRA 2L01A 3QBQA 4EWDA 4AF9A 5L73A 4ESJA 1OLQA 3ZSMA 2Q8DA 3BC8A 5HOOA 3CJIC 2YBPA 3PVBB 4Q4X2 3MLJA 3WDUA 2LY2A 2LUWA 2YGMA 1FNYA 2R92J 5IWFA 2KISA 4CDUC 2IPQX 2W52A 3PUFA 1H88C 3T2QA 2ARBA 4A3XA 5JZGC 3KP6A 2CW7A 3RQ0A 1EV12 2CFOA 3GNEA 1XGNA 4MQ9F 4UBHA 3WG1A 5IYDJ 2RDRA 4GWMA 4YVSA 1S2BA 2PFBA 1N3OA 2WAOA 2EZKA 3AAFA 1IRZA 2R7WA 2B63J 1W28A 4XVHA 3U11A 3MIHA 5EDNA 3LSMA 3GZNB 5JLVA 4D6SA 1OT5A 2GC3A 1LHOA 1XX5A 4OZOA 2YBSA 5FZ4A 3MKYB 4AVVA 1LB2A 1BQPA 4L9BA 3V8KA 1H9TA 4UNOA 1UZZA 2ZKNA 2W85A 5LBBA 1ST8A 4BIOA 4AEKA 1SLAA 2WABA 1DU6A 3MHZA 3ZN0A 1NG6A 2WAQN 1QMJA 5TGTA 2W1OA 2K9QA 4XDQA 1KQ9A 3Q8CA 1CVNA 1Y3TA 2QDNA 3BYWA 3DPUA 1AR83 2VBXA 2BPA2 1SFXA 5J3UA 3H5AA 1PO11 3IDAA 1RUE3 5FUPA 5JR2A 2DCKA 4MV2A 3QOPA 3TQNA 2VY0A 1RUG3 4DRRA 4XONA 2VBDA 1BZWA 2WV0A 4WM7A 1QO0D 1CQ9A 2L4MA 3I3LA 4K1ZA 5F5CA 1I1SA 4LBQD 3A21A 2E2JJ 1X1PA 3DUIA 3SLIA 4FQZA 3I2HA 2X0LA 4BK5A 2HEOA 5BUVA 1HKTA 2GMMA 2F48A 2OUJA 2JTVA 2P4EA 3ON7A 2XJUA 1IOAA 4NC8A 1WCQA 4PDWA 3RZHA 2R93J 1AL21 4O61A 2QCSB 2NZ9A 2Z4FA 4QHOA 4ARXA 1VBE3 5M5XJ 4MADA 3OYIA 1GICA 1UU5A 3TB0A 3SHRA 3HOWJ 4XC9A 2E51A 4GO1A 1QPIA 1OMIA 5FY8A 2CGNA 2DVDA 1MQTB 1D4VB 3N7KA 4Q8KA 2A6ZA 2O0OA 5I8YA 2MABA 3I2GA 3IM0A 3ETPA 3GF6A 1UMHA 4I2OA 1ULFA 2DA3A 2BY0A 1V5FA 3EUHA 3J26N 3OSFA 4IOCF 3FM5A 4BDZA 3O1OA 3C7JA 3ASNH 5HDGA 1T6SA 1XB9A 1JE8A 1PDNC 2ESHA 2WO7A 2P2KA 4YZ2A 5BOXA 1JUPA 3H5NA 5I93A 3ZFEB 3FXMA 2HWE2 2CL2A 1ENXA 3I4NJ 5FZ3A 1LJ7A 2YPRA 4QPGA 2DURA 1D8JA 1MDMB 3WVJA 4B4PA 1S0GA 2CV6A 1X1AA 3V64A 2BVMA 2P6TA 4FPYA 1AOYA 2GNDA 3LOCA 4NIHA 3KGZA 2X5IC 1ETXA 4F3JA 3AXDA 1MH3A 3IAPA 5A7OA 4D7TA 3NKGA 3RZLA 3VBHA 3FM3A 2P5LC 2CDPA 3BR0A 4A3GJ 1TNSA 5H6QA 3I2DA 3HRSA 2ZNYA 3SH5A 4XKCA 1D0HA 1ENRA 4YW3A 3H8OA 3LB9A 2Z42A 1UY3A 3IDCB 3CC2I 3KWVA 3L2YA 1JI8A 4I7HA 3MF9A 1OF3A 5JVTA 5C3SA 3H1WA 1EAH3 2ZXJA 4BDYA 1ND3C 1YHFA 5TSWA 1G9CA 1U78A 4IEYA 1SANA 1QJY3 4O6JA 3OWTA 1EUUA 4DNCA 1H2LA 2VKHA 1YC61 1F4KA 3T1BA 1MBKA 1PO12 5KNLA 3KV6A 3OYAA 2JG9B 3O1RA 4GGGA 1N47A 2Q8OA 2D6OX 1RXGA 3FZ3A 3DEUA 4XUOA 2EALA 1ENSA 2KIQA 1NUKA 2J1VA 2CNAA 4AVPA 3BZ6A 3F8BA 1IRXA 4QPQA 2QEXI 3OG2A 3HAGA 2JE8A 1U5YA 1XB4A 3ERED 2IT0A 1DIWA 2DI3A 3S2WA 1OR7C 3F72A 4C9YA 2F5VA 3VHNA 1P4AA 3ULQB 3KV9A 5FK8A 1C1LA 1X50A 1XN7A 2UY8A 2L3DA 3CUQC 2D3PA 1YIFA 2VTXA 2QKDA 3ZSEA 2FJ1A 3OIPA 2RMU2 4QQLA 4M4PA 4K20A 4KMUX 3K69A 4MTEA 2D45A 5IK8A 3RZGA 3F22A 2Y8KA 4ZZ5A 3ABKH 2FMLA 3C7FA 4E7KA 3WF3A 3A0HC 2E19A 3M8FA 3K51A 2M7AA 2FDHA 2HOTA 1NG7A 3NV4A 3OY8B 1LEBA 2VQHA 4UFHA 3HQXA 2WSUA 2W08A 5A70A 3HOYJ 4KU7A 2R7QA 4E4DX 1PYVA 4KICA 1UXXX 3M1CA 1XU1A 2BGOA 5BV6A 4HX8A 4XIDA 3FN9A 4LKSA 2IXCA 4EZ4A 3JD71 1LFUP 3ZXEA 3OR1C 4KYWA 2W84A 1H9WA 3LE0A 4XJAA 3QOEA 2QNKA 2JZYA 3ZSJA 4XUPA 3DTEA 3VBRB 3PM1A 2F4OB 1G3WA 1HSTA 3VB2A 1S6LA 2HWVA 4A69C 4QKFA 1PM4A 3RGBA 1BIBA 1DQ5A 5FGMA 1V9U1 3PUHA 1BOBA 5TJJA 4QD2A 4E8CA 3GHMA 2HR3A 3ZCOA 4DQ2A 2MLGA 2V73A 4I09A 2GXBA 1XNAA 1GVDA 2EPFA 3HUGB 4EMSA 3MIEA 1XCVA 2C0ZA 4P5HA 1SG3A 2DFBA 2OAZA 4I0BA 1NCRC 4COUA 1QDOA 3IPVB 4XQ4A 1BJQA 2PHRA 1GQHA 1FPN1 4FPHA 2XWJB 2PHWA 1GP5A 4H4KC 5GZGA 5F5QA 4B4QA 5CAZA 5DDGA 3P5JA 1T98A 3DCFA 2ZGNA 3MW2A 3JSOA 2D98A 5C9AB 4DPNA 4L0ZB 2E63A 3IH2A 2KA3A 1AL0G 1W6QA 4FE4A 5FPAA 4AUXA 3WOGA 3TP3A 2KDZA 1B1BA 1R1VA 3W6JB 2VXJA 5CG8A 3VZLA 5FY1A 1MZEA 5FMBA 2D5FA 1Y7BA 3DTIA 1IZ1A 1VQLI 3NNJA 4BDVB 3VBUC 4I0AA 1W4MA 3CC4I 3HKZA 5HDKA 2DA5A 2JXAA 1AVBA 3I3BA 2I10A 4DINB 1QNTA 3I4MJ 4BXXJ 5HBAA 4UFLA 3GVAA 4A44A 3IMMA 5C5TA 1IG0A 4PJJA 4KUMA 4K3UA 2QQNA 1CGPA 5ABJB 2RGVA 2BHYA 2Q2EA 1KDKA 4M3GA 2E2IJ 4NAOA 1IN7A 5M3FJ 2R32A 3CLPA 4DS0A 1OISA 2GOXB 3DECA 4LBJA 2WT1A 2XJQA 2H0VA 4ABZA 1RUNA 4XIOA 4D0PA 3ASIA 2GAUA 1VBB1 2GA1A 2E1MB 4HX4A 2DTWA 3ZQIA 1YUDA 2BFUL 4PCQA 2PI0A 2W87A 1OF4A 3N36A 4YM1A 1Q8OA 1DZRA 1Z7S1 1Q1HA 1BKZA 2ZX2A 3WCRA 5FYBA 1GZWA 1ZKGA 4M3EA 5E3MA 2DVAA 2WWJA 2O03A 2R7RA 2LKPA 5JMCA 2DBNA 3ACLA 1ON2A 1IKPA 4WWCA 3V7CA 1FMWA 3BZCA 4EATA 4MQVA 1O6UA 4CP9A 4KG0A 3G1OA 1V6IA 3F8FA 2CS3A 2OUMA 4D5FA 3HBLA 1M4WA 3IC7A 2Z79A 4Q4V3 5CLSA 5JIAA 2MSYA 2A6TA 1IQDC 2XAFA 1L7LA 1ZNPA 4GKXA 4EV0A 4CUAA 1MJAA 3G1MA 2LLKA 1ULDA 4JYKA 1ULPA 1YRNB 3WTUC 3WQBA 3VL9A 4ON0A 2DXIA 1BMV1 2DU1A 2FD5A 2X6XA 3I4PA 4J1WA 5CIRA 4AI1A 3PHMA 3ILRA 1O7FA 1VRH1 4GMP1 5FZKA 1HQLA 4HBLA 1FZPB 1EF4A 4NOTA 5DPNA 1RMU3 2Y9ZA 4GD4A 4PGGA 4IX7A 2JKXA 4HDUA 4RAFA 3NAPA 5FZGA 3KP3A 4UUVA 2DYCA 2R0HA 1QY4A 3K7AJ 2HPMA 1WMFA 4JOMA 2VOOA 1IUFA 5AONA 2O6GE 2TEPA 1A3KA 4C2MJ 1AXYA 3GTGJ 1FPN2 3L09A 4NBQA 4LB5A 1I39A 5KHIA 4IE6A 4A7YA 2P5KA 3VYRB 1C8NA 1VBB3 3OYJA 2KMUA 3PLQA 2JEMA 1V3FA 3ST7A 1LOCA 2D6NA 3CP2A 1VP6A 1WSUA 2MH9A 4G4FA 4Q4Y2 1Z7S3 3LWFA 3J7NA 4YWAA 2ET1A 3CJNA 4CDWB 1BC8C 4AFBA 4FFGA 1ZAOA 4K40A 1FOD3 3N7MA 4S05A 3JB4C 3HQRA 2MPFA 4QX0A 1VZ0A 5DG1A 3J81Z 3NNLA 1RJ8A 1WJEA 2DTZA 3TBDA 1B8IA 1KQ0A 5EGOA 4Y1XA 3ZPYA 2QVOA 1XCBA 2CRGA 3CJRB 3MPBA 3QYFA 2OVUA 5C4WB 1O4ZA 3A01B 3HC7A 2UWAA 3GTOJ 3FXQA 1ZG5A 5L3BA 2XVCA 4PF5A 2A5ZA 2K0GA 2XPWA 3P9KA 3FLTA 2DODA 1JKPC 1E0EA 3U75A 1HV1A 2J5OA 3WE3A 4B44A 4GMP3 1VRH3 4LKFA 4B29A 1C5IA 4PQ9A 4Q4W3 3GYDA 2L4AA 4A93J 2JMWA 2EIJH 2K9ZA 2ZX3A 4HPKA 4K1YA 5FD5A 1ND2A 2VQGA 2OPWA 5E18F 3ML6A 1YS6A 1R36A 5DD4A 4P02B 3JU9A 5LGNA 4QGNA 2RKHA 2R5ZB 1YG2A 3OYBA 5CVIA 4BJ6C 3WP6A 2PMUA 4CZZA 4CZSA 3R6SA 5LHIA 4B4CA 4YW2A 4D6RA 4R1HA 2VMIA 3CJQB 4Y13A 1PK6C 2XGXA 3OEBA 2IZWA 4XF9A 3K4CA 3H1CA 2OQRA 1R5GA 4QTRA 1UMIA 1IS6A 2R0QC 2BU9A 3ITQA 3UK9A 2YU2A 2AEYA 4XXAA 4CDUB 4BACA 2P5BA 1JHHA 3K4DA 4HG2A 1PGW2 4J1XA 5JZGB 5L9VA 2EAKA 1SVOA 1E3OC 4CSWA 4EWAA 5CKQA 2VMFA 5EYYA 4HF1A 4XRFA 1IDZA 2WNUB 1VBD1 4OQ8A 4LOTA 4Q5OA 1BMV2 4R4XA 3WUCA 3WLUA 4D7YA 1K5MC 2GQQA 3BPSA 3N9MA 2DA7A 4M73A 3AKTA 2CAUA 3MZ8A 2IGOA 4IEJA 5AVPA 4BQOA 4Q8LA 4Y33A 3JRHA 4G94A 5K5RA 1ODMA 4U87A 3WF4A 3FHQA 3H9GA 2H1KA 4FOQA 2X29A 1CIYA 1QJEA 2PXJA 2VE8A 1YS7A 1URXA 1H1IA 3LSEA 3ONQA 3CJIA 3DKXA 3ZQGA 1FYKA 4NIAA 4DEVA 5EJ1B 1YJ9I 1YQ8A 3WD5A 1V54H 2FBKA 2RVAA 2L9VA 3O2PE 3NW4A 3U9GA 1S2KA 1OLRA 3L7WA 1XSDA 4R9CA 1FBSA 1R00A 2FBHA 2M2EA 4O9EA 1CR7A 1UZVA 1EV7A 4MIMA 2DBBA 3OOPA 5FYCA 3M2MA 3HSEA 2DJNA 1EA3A 4QX5A 5EXOA 5A32B 4ZS3A 2ECBA 3Q9SA 3FK6A 4HZFA 2JDUA 5DMYA 3WG3A 4P5YA 5LFAA 1APLC 3VSKA 2RM21 4DO0A 5EJZB 4L9JA 4IRGA 2H6CA 4KNCA 3CCRI 1RUH1 2WZR3 5GLWA 1BBT2 1NZIA 5FMOS 4QAWA 3K70C 3WTXC 5CG9A 5T55A 3VDCA 3WNXA 4BIFA 2CV2A 4IEOA 5FUIA 2CWSA 2RQQA 1ZLKA 2LW8A 1EUTA 4LBMA 3BI3A 4KNYA 4HX7A 5K7ZA 3K3NA 4H7MA 4I02A 3ZPOA 1X7NA 2OBPA 1S4CA 3PJYA 4FAGA 2CUEA 2VZ3A 4G6QA 1RHI1 5FRMA 4QM8A 1ON1A 5J1RA 2AHQA 2BOIA 4TZDA 4N0BA 1KQRA 1H8TC 5BNOA 4A7ZA 1FP1D 1AF9A 4EN7B 2VQUA 4AAPA 4TTGA 4MYEA 1Q5OA 3CMMA 4CXWA 4XF4A 2CU7A 1MEC2 2A6VA 4XF1A 5D5UB 2X53S 2ILMA 4J25A 1QWRA 1R092 5J7MA 3EDPA 1R1A2 3D5LA 2STTA 1EJ9A 1A36A 2GSYA 2MD0A 1X1DA 3IAQA 1MMNA 2MEV1 2G7HA 2Q1FA 2VCAA 3GX4X 2DBIA 2CHHA 4RR3C 4BJTA 4ISQA 1KU2A 3DPTA 2B42B 3K4MA 4LBKA 2YDEA 4E4SA 4W65A 1R9TJ 5IYBJ 1JBCA 4UVBA 2DW4A 2UWCA 4F83A 1DGWY 5HCBA 4QX7A 1CZSA 4WM8B 1GHCA 1RUH3 5J96B 4X6QB 3GF2A 2CGPA 3RPUD 4KMFA 1O57A 5ICCA 3O1MA 2XG3A 2IA1A 3LQCA 4B3AA 2QQ9A 3RKXA 3TN91 4CA0A 1X19A 4A3IJ 1XE7A 1IPSA 2M87A 3AZWA 2ZFUA 3M9AA 4WVMA 5E1RA 5JXHA 2JN6A 4IL7A 4GULA 5JXJA 2FF4A 1YQ2A 3J7AY 4QWNA 4XZPA 2FSWA 5FP9A 3IKWA 3KVAA 1XPXA 3KFWX 1IHMA 5JPMB 3FBNB 4XF0A 2X1CA 3S8PA 3WUDA 1ULYA 2CTVA 3MKLA 1ZBE2 5FOBB 3OYFA 1UCXA 4Y3OA 4A3EJ 5FZ1A 1N1SA 2A69F 3K4LA 3K4AA 3CU7A 3LA2A 4NIIA 3R4SA 2JVHA 4YEJA 3WE2A 3NRUA 5CFDB 2X5IA 1XMXA 3IIIA 2H09A 1HF0A 3Q5FA 1ZVFA 5LBFA 4E27A 1V6MA 2Y0SA 1OLME 4B4RA 2BV6A 2CAVA 4JKKA 2VKDA 4Q48A 2V4AA 3OYLA 4RB3C 3AKRA 1ENQA 3FWEA 4FQGA 2W68A 2YUSA 4G6DA 3PIGA 4ET7A 3I4IA 1QGLA 4HXCA 3T4VA 3OY9A