3RYRA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ryrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ryrA01
2JZYA 4M74A 1QO0D 3U1DA 2B9UA 4FAGA 4YSFA 4MGRA 3W6KB 3HIFA 4FT8A 2HS5A 1YW7A 4LFUA 4MEYF 3MPBA 4XRFA 5JFRA 4ESBA 5KHKA 1ZAOA 4O6JA 5F64A 2VQAA 2GC3A 4UUVA 5JCTA 2ATFA 1ZN2A 3DF8A 2H0VA 3CJXA 4IXAA 1BI2A 2FMYA 3I58A 2Q1ZB 4QMAA 4B29A 1DPRA 5FLXZ 2F5DA 1G6NA 4A6EA 1OYIA 3LQRA 4EWDA 2Z5UA 1G3YA 1R23A 3JW4A 4F7ZA 2H27A 1NE6A 5CLSA 4EM1A 4HW0A 4JVAA 1O5UA 1BM9A 3V7RA 4P9UA 2D40A 1S6LA 1JGSA 4P9GA 4NQWA 3EETA 1OI6A 5J48A 2J5OA 3N4MA 4ZH4F 4MGYE 4BYYA 2ZFWA 2PHLA 3V8LA 3HTUA 1YFWA 2YR2A 3WTWC 4OLLA 1Z6TA 4HQMA 1E2XA 3H1MA 3ZP5A 5L3DA 1NXMA 5BPXA 1R5HA 3M70A 2P8TA 4QM8A 2FU4A 5HDKA 3D82A 5FO5A 4FX4A 4E2SA 3PQKA 4S04A 3C7JA 3TOBA 2DK5A 4IEUA 4AWXB 1LQ1A 1O3SA 5ICGA 5JSPA 3TGNA 2C0ZA 1W7PA 1Q1HA 4JK1X 5I8YA 1NE4A 2FEZA 4MEXF 2UY9A 4A0YA 2E7WA 1IZ1A 2ZMEB 5C6CA 2C6YA 2LDUA 3LWCA 4YFNF 2XVCA 4QGMA 2VONA 5FDBA 3SQNA 4R1HA 1BJAA 1VR3A 4UVBA 4HLXA 4KL1A 1FBUA 3GLXA 4OMZA 2A5YB 4KNYA 2IXIA 4WZCA 3LFKA 1ZRCA 3GYDA 1K79A 3I7DA 3HHHA 1SFEA 4I02A 5DYMA 2VECA 4LLOA 3ZMSA 4WBBA 3QPTA 1PUEE 1ZZ7A 1S3JA 3FXQA 4BHBA 2K7LA 2QQ9A 2XL7A 3GEZA 2WC2A 1X3UA 3MFKA 5ILVA 5JR7B 3HHGA 3U2RA 3TO7A 1B59A 3SFZA 1EPZA 3QP5A 4KFCA 2HJIA 3BPXA 3CJNA 1P2FA 3VEPA 2XRNA 3RYRA 1JE8A 2Z2SB 2BBYA 4XFGA 1T0FA 3RTRA 1UIJA 1Y9QA 1IN7A 3LWFA 1OMIA 3PFIA 3RZZA 3PQJA 4LEJA 5F6FA 4Q0PA 2CGPA 5E1WA 3FWEA 5FLIA 2LSOA 3S0MA 2E1CA 3KLOA 2IA0A 2DQLA 3P9KA 1SD6A 4DNCA 2XLFA 3RNSA 4LD5A 2LNBA 4CZZA 4HDVA 2XKPA 4XSZF 4RAYA 1H1IA 3C18A 3J81Z 1S29A 2UYBA 3WTUC 2GAUA 2VBWA 4XBFA 3M9AA 3DPLC 1O3TA 5DUKA 3BPZA 5HOOA 1E17A 1J58A 3DQVC 4KN4X 5CU1A 5LGTA 2Q0OA 3J80Z 3W6JB 3O2PE 4MUVA 2O8XA 3L2HA 4L9JA 4PJYA 4XF1A 2FF4A 2STWA 2YX7A 3WG9A 1OFNA 4M6YA 4KIBA 2Q0AA 4OU0A 5J7MA 5DDGA 4KICA 4XF0A 2G7UA 1SEFA 4PGGA 2XAHA 2OZUA 2WWYA 3RPUA 1O3QA 5H20A 5J6XA 1YLLA 3K0LA 4YYOA 1LR5A 1AOYA 3TDZC 4XETA 5H6RA 2FOKA 3SMHA 2ZJ2A 4I7HA 2V79A 2P5VA 4ZZLA 2O0YA 1ULYA 3F3XA 1C0WA 2FA5A 2L02A 3I54A 3I4PA 3SXWA 2ZKLA 5K5QA 5CVIA 1R36A 5FPZA 4PDKA 1YQAA 2H6CA 1U2WA 1D3YA 2DLLA 3P9IA 2GZWA 1F4KA 2MLKA 3CTAA 1KU9A 5CVUA 3FMQA 4N9IA 2PBIA 5ILSA 2Z33A 2D5HA 3FMRA 2DTRA 3FF5A 1XN7A 2V1XA 3FHIB 1CAUA 1EH6A 5LHHA 4IEVA 2QWWA 1U8RA 5KHGA 2V6CA 1PP7U 1QXRA 2Z69A 4BXUA 1FNNA 1R22A 2EFPA 3R4KA 4IVNA 5F1RA 3ABTA 4ZU5A 5ICEA 2RV8A 4EVIA 2ADUA 4E2QA 4MGIE 5FGMA 3H92A 4P55A 3DV8A 4A6DA 1F5TA 4LA3A 3ECOA 5AIQA 1D5VA 4ENMA 3FHZA 3VODA 2EAAA 3K1NA 4YIFA 1SFNA 4I3PA 2XASA 3T8TA 3TNQA 3V4GA 5LHIA 2VN2A 1PP8F 1CAVA 1TLHB 3WGGA 2V09A 3WE3A 3I0TA 2Y48A 4JV4A 1FWZA 1JHFA 2KJCA 4HLYA 3U11A 3Q9SA 3SZPA 4Z07A 1HBXG 1MGTA 3ABUA 4KIGA 3RYPA 1FLIA 3UKVA 3L09A 4RGXA 4YG2F 2EFWA 2ZBKA 4QM9A 2Z99A 5BPDA 5FLXK 3HOTA 2OYZA 2OD5A 2PG4A 1I27A 4UVCA 1UCRA 4HAMA 4FHTA 3IKTA 1RL3A 3K69A 1OYWA 3KEOA 3QU3A 5JI6A 5L3FA 4FX0A 1IN5A 1BOAA 2OBPA 3SHRA 5E1ZB 3CUOA 2OPKA 1MZBA 3M8EA 4ENJA 3UKTA 3EQLF 4OMYA 5LRSA 2ET7A 1H0MA 4WVZA 4JQFA 2A6EF 1SMTA 3LSTA 2IXKA 1I5ZA 5FB2A 4M73A 2VOPA 3R0AA 2L3DA 3T8RA 3KSCA 4RB0A 4KIFA 3ZN1A 2FSWA 4G7ZF 2W84A 5K8SA 3COAC 1L3JA 3CLOA 1AWCA 4YARA 1XGSA 4E70A 4U88A 5FPXA 2IXLA 2ZKZA 3MQ0A 1ZRFA 1V70A 5BV6A 5FQ0B 2K4JA 3I59A 2K02A 3BY6A 2EA2A 1MKMA 4AVPA 3WTVC 3U10A 1PDNC 1ZZ8A 2XGXA 3P7NA 4GULA 1J3PA 2P4WA 2QQBA 2STTA 5LHGA 3ECHA 4GYIA 1P92A 1Z6RA 4KWJA 2EJRA 1O7LA 3GUDA 2G7HA 5DD8A 4LK0F 1WGPA 2PN6A 3K2ZA 2BV6A 3HSRA 4U0VA 1P4XA 3DP7A 3WTZA 1P4AA 1UB9A 4Q47A 1KA8A 3CUQB 1XCVA 4MQVA 1VTNC 1J0RA 2VT2A 3KLNA 5FD5A 2LF8A 2QBYB 2IVMA 4KDPA 2D93A 2GXGA 2HQNA 3I53A 1IUYA 3KP3A 1R58A 3E6MA 1BI0A 1DUXC 5J8FA 2QZ8A 1LJ9A 4TV7A 3H3UA 4YFXF 2MBFA 3B73A 1IF1A 4L0YB 2UWMA 1SMYF 3HRUA 1U78A 3HT2A 4HMZA 2PMUA 4HSLA 5BY5A 3LA2A 1O57A 1YUDA 3MZYA 3GXOA 3BDDA 1HW5A 5E16A 2ZNZA 1EH7A 4IEWA 4GGGA 1W7PB 4I0AA 3MAJA 4M9ZA 4Q4ZF 3NL1A 3WW1A 2DT5A 1R1UA 2DAOA 2CG4A 3OD0A 1XMAA 4GCVA 4BNCA 5KBFA 1IW7F 2IW5A 3IDCB 4Q0VA 5FFXA 2G9WA 4TLFA 5I8SA 5HDNA 2EA4A 4AIHA 3L9FA 3CUQC 2FNAA 1QNTA 1MDMB 3ZMDA 2ZMEA 1GVJA 2QBYA 1X8EA 1DP7P 4XF4A 1W4MA 3RIRA 3WU0A 1HKQA 1WSUA 3RPQA 5FD6A 3IL2A 4MQ9F 1TQPA 4EM2A 3FJSA 5KHHA 2MHFA 4HN0A 4L2NA 4KWKA 3NKTA 2ETHA 4XSXF 3LAJA 1WA4A 4KU8A 4HOBA 1H9TA 5A2QK 1SQ4A 5JSOA 3IWFA 4HVOA 4UBHA 4LUKA 4I98B 1YO5C 3F6OA 1OYYA 3EHKA 4I2OA 1WQ2A 5DCMA 4BQAA 5AVPA 4UVAA 3E6BA 2B0LA 2NNNA 2MC3A 1ON2A 3WTYC 3GFLA 4ZYEA 5K5OA 4MX3A 4ORFA 2H6BA 3S7IA 1DZRA 4HQEA 1IRGA 1ZGJA 1CAUB 2ELHA 1CGPA 3E97A 4L0ZB 1EP0A 5EEHA 3H9AA 1LRHA 3I59B 4S05A 1ZZBA 5JSRA 1RIOH 1YW9A 2E9QA 3C3VA 2VODA 1RI7A 3BWGA 1OD5A 4MGKE 2RC4A 2ZCWA 3CL1A 4AQ2A 3H50A 1RC6A 2XAJA 4RGSA 2XROA 5I0TA 1XGOA 1IXCA 5BOXA 2UXXA 1Y3TA 2CAVA 4NHJA 4KYWA 1CAWA 5DCFA 5D8KB 1J7KA 1B6AA 5AIPA 1CAWB 2QM3A 4M9XA 4Q5SF 4L5JA 4IETA 1P4WA 5HS7A 1H9GA 3LAPA 1YG2A 4AD9A 2GC1A 2HYGD 5L3BA 3HYIA 4X6QB 3BALA 2ZNYA 1U5TB 2Y0OA 2L4AA 1USTA 2RKHA 1USSA 3HSFA 4LB6B 4ZU7A 3F8FA 2ZO4A 1S8NA 1CAXB 4ON0A 2UXNA 1XD7A 2KIFA 4GXOA 2GQQA 3I5UA 3WW2A 3WW3A 1D8KA 1TQIA 3VHRA 4HF2A 3GBFA 1ZLKA 3WU1B 3KP5A 1YFUA 2DO7A 3FX3A 2OQRA 2QUFA 5I0UA 3JSOA 2LKPA 1CAVB 3GFJA 4CHUA 2VOOA 1HQCA 3NW4A 2XLGA 3NQOA 3REOA 4EWEA 4U7BA 5J8CA 1ZVFA 5A2QZ 3BPVA 3CUQA 2QNKA 3E5XA 2PEXA 2RGVA 3FXRA 4YFKF 2NNYA 3RKYA 3E5UA 3IHUA 4HX8A 1RUOA 3F8BA 5D4RA 5E17F 1OKRA 2DQRA 3GFIA 3F22A 3ZMUA 3IWZA 3HSEA 1R7JA 3ACLA 4MV2A 5E1XA 1KQ0A 1JUHA 1YS6A 4R52A 4DQ2A 1R00A 2BEOA 3BJOA 2JSCA 3G3ZA 1J1LA 2KXLA 3H7JA 5HLGA 3V8KA 4F8AA 5L3CA 5E18F 2R7FA 3HRTA 1XB4A 3PVBB 5HS8A 4LUMA 2V1DA 2JRTA 2PAKA 1FSEA 4R79A 5LEJA 1QGPA 2KJBA 3HRMA 1J75A 3MZHA 2DK8A 2A6HF 2L54A 1Z05A 3OV8A 3M8FA 4L9VA 1OPCA 3E6DA 3MCZA 4P96A 3DL3A 3ZDSA 1HSJA 3T1BA 1LEBA 4HA8A 2GA1A 1NHAA 2MH9A 1SD4A 5IT9K 4WCGA 4JTNA 2DW4A 4HBLA 2MA3A 2HDCA 4LK1F 4A0ZA 4A5NA 3QOPA 4U7DA 2DPUA 1STZA 3GF2A 5LEKA 3LOIA 1T98A 2YPRA 2H94A 5L3GA 3HRSA 1H1MA 4XFFA 3VOEA 4HX7A 4XEZA 1CF7B 4KN7X 3WGHA 1S7AA 3B02A 1TQMA 1O5LA 1XMKA 4LG0A 4QXKA 2L4MA 1WKMA 4WWCA 4A5MA 5D8LB 1YTYA 1J3RA 2EA7A 4ZU4A 1LNWA 4E2GA 4R8HA 2E1NA 4AVCA 1Q3EA 2GC2A 1FYMA 4DINB 4QGNA 2PI0A 2AS5F 3NEUA 4L9NA 1HKSA 3KP7A 3JAMK 1OR7A 1B1BA 2UZKA 3LAGA 3L00A 3V7CA 1DGRA 5BUVA 1ZRRA 1T6SA 3ZQ7A 2Q8KA 3M3IA 5FLHA 5KHIA 2TDXA 4XFCA 4YNIA 3IDBB 4D0PA 4MTEA 3QRFF 4XFAA 3U0ZA 4QWQA 4HVRA 3BP8A 3DFGA 3H8UA 2VE8A 4D7TA 4IRHA 1FI2A 4I0BA 3QP6A 2Q2EA 1ZZ9A 2FRHA 4AXOA 2EVXA 3SCFA 1ODDA 4AQ6A 1KQ8A 4KUMA 4Q0SA 2FBKA 4EROA 2A68F 1ONVA 2M1BA 3JTHA 3CO6C 4BAYA 1FBSA 2DPDA 4LULA 4PIYA 5BS6A 2IRFG 2WV0A 4UBGA 2ZXJA 4KA4A 4OOIA 5E8GA 2EWNA 2VPVA 2JT1A 2W85A 4Q29A 2RNJA 3ZN0A 4Y15A 5E20A 1BC8C 1U6GA 2BNMA 5HLHA 2HEOA 4CO8A 3KMHA 3KETA 3GFMA 4IEPA 1TW2A 3WODF 1YIOA 2VC1A 3R60A 2IPQX 3RYKA 4IEQA 4HLTA 4HBNA 4IEOA 4P9FA 5D5XB 1XGMA 2BGCA 3WTXC 4UV9A 1TBXA 1TW3A 3GYHX 2MH2A 1DZTA 4EJTA 1IPKA 2K9ZA 3KZYA 4M9SA 1IN6A 4XFBA 1ZRDA 5E1RA 3WW4A 5CVJA 4O3MA 1KYWA 4LA2A 4I01A 2K86A 2PMHA 5CYVA 1XRUA 2JPBA 3KZZA 3OCPA 4RAZA 4WXDA 2DBBA 4HYEA 1XE7A 3KCCA 1IPJA 3LA7A 4ZZDA 2XLAA 4HX4A 3RKWA 2EFNA 2WTEA 3TOAA 1YHFA 1V4RA 4BHPA 3HTSB 1MJAA 4L9TA 4O9EA 2L01A 1HXDA 1QZZA 1ZH5A 3OOPA 3DN7A 4P5OA 4Z82A 3DPTA 3KP6A 4PZJA 2QVSB 3SZTA 4ZYDA 3F8CA 4OIQF 5IT9Z 1FT9A 5L3EA 1D8JA 4ONUA 5D6EA 1KGSA 4EV0A 4NB5A 4U0YA 4YRDA 3KP2A 3GZ5A 2F2EA 4LTAA 1VP6A 2Y0MA 5EEGA 4IRIA 2GU9A 3FZVA 5ERIA 3QAHA 4U0WA 1IXSB 2JPCA 2YU3A 2K4BA 2OAZA 4G94A 3DKWA 2HKOA 2HR3A 5BXXA 4IEYA 3KGLA 1R5GA 3ROUA 4CXFA 3R61A 4AVBA 3EJKA 1DDNA 4EJWA 1GQGA 2VBYA 5ICCA 3ERED 3O6BB 2HKXA 1QXJA 3EQEA 1EV7A 6PAXA 1ZARA 3S2WA 3IC7A 5D5UB 2COMA 3CO2A 4OINF 3WTTC 2KRFA 2E7XA 3DEUA 3CF6E 1XDSA 3BU7A 2OZ6A 1FYKA 1WWXA 1HW2A 3DXJF 5KVRA 5LGUA 2CSOA 4XF9A 5EFUA 3TO6A 3CO7C 2KIUA 1SAXA 1ZG3A 2O8QA 1YWKA 1QY4A 4K2EA 2PQQA 1CF7A 4IESA 1W7PD 2HWVA 1YFYA 4EM0B 3FZ3A 4BHCA 4L5IA 5KHJA 3QACA 4GO1A 2W24A 3MEXA 2PAMA 4MGZE 4AVAA 4IF4A 1B9NA 2W25A 4LLLA 2V9VA 1UW8A 1SFUA 2P7VB 3O3KA 5LRRA 1FXZA 1GXPA 3J7AO 4KT5C 2D1VA 1K7AA 2I45A 1A04A 2OA4A 5TJJA 1PM7A 5D4SA 4RB3C 1T38A 2D45A 3EO6A 2W57A 2V1UA 2Y75A 3U9GA 3EBRA 2O03A 2KIMA 1UHWA 4UXNA 3F8NA 4HZFA 1IXRC 3GVAA 1L3LA 4FBFA 1REPC 1X8MA 5DCMB 2JTVA 1LKNA 5FLJA 4G7HF 2ET1A 3F21A 4HSJA 3EDPA 3TNPB 1FPQA 1J3QA 2D1HA 4OFGA 5ED4A 3KFWX 4MNUA 3RDIA 2PTMA 2Q4SA 5CVRA 1RZ4A 3RJPA 3JSPA 2ACJA 3SXYA 3ETQA 4IRGA 1Y0UA 5DEQA 4RGRA 2CQKA 4CICA 2R7DA 2DFIA 3H7YA 2YX4A 1U5TA 2H09A 4RS8A 1KYZA 3H1WA 4IPAA 3Q5FA 1IN8A 3OTFA 1MD0A 4HDUA 2P5KA 3IIAA 3NVCA 4EJOA 4RB1A 1WLTA 3QU6A 4WXCA 1XSDA 1UPIA 4HV6A 2CO5A 2PYTA 5H6QA 1SD5A 4O5VA 2YSRA 2HYFA 2XAGA 3V8JA 3JZVA 5HDGA 1FYLA 2EFQA 1XDUA 2OZJA 1BBYA 2CWEA 2D5FA 1F9NA 2ISYA 4PIXA 2IA1A 2M5WA 1X7NA 5I93A 1XSXA 4Q0QA 1Z7UA 2FBHA 4D7SA 3VFZA 2QVOA 3BZ6A 5K1YA 4CYDA 3CEWA 4Q48A 5HLIA 2VT3A 1FX7A 4HV5A 2P6SA 3FM5A 1YLFA 1W5SA 2BNOA 2VXZA 3ULQB 1Q43A 2CFXA 4EWAA 2XKOA 4UV8A 5JR3A 1MDMA 2EV5A 4WXHA 4Q0UA 3D0JA 2O3FA 5LBQA 3F8MA 5DD4A 4BH9A 2QYOA 2HTSA 2RQPA 4QX5A 3OF1A 2HQRA 3I64A 5BQTA 3FXUA 2OA2A 3K1PA 5DV5A 3N97A 2ETEA 3FFQA 2VBZA 4EJUA 3L7WA 2IC1A 3O14A 3SHFA 1ZGAA 4G6DA 4EQQA 2OQGA 5ILUA 4LMYA 3CLPA 3BOQA 4WX9A 2KKOA 2GC0A 4G8XA 3PNAA 2PLYA 3FMSA 1LEAA 1BC7C 1BIBA 1ZX5A 2XHKA 3ST7A 3K9TA 3E3VA 2A07F 3J80K 4M72A 1YW8A 1DGWA 3KEQA 3F6VA 4META 4L18B 1Q5OA 2IA2A 4I09A 2QENA 2IT0A 4MZUA 2LF7A 4J1WA 3JAMZ 2MPFA 3E5QA 4FAHA 1V3FA 2XAQA 3TDUC 4HN1A 2VC0A 4IJAA 1I1SA 2WFPA 4RGUA 3F23A 4HF1A 2BYVE 1FSHA 2EFOA 5BMZA 4HVQA 2UYAA 4UNOA 2K0GA 3HT1A 4PCQA 1L0OC 1XE8A 1FBQA 2N7GA 1O4TA 1LDJA 1YYVA 5KK1A 3RKXA 4JTOA 1CX4A 1DPUA 4X6RB 2IP2A 2M30A 1R1VA 3M1EA 3BCWA 2RVCA 2R3SA 3ELKA 5C8WA 5HS9A 2GXBA 1XGNA 3C3WA 4BIFA 1QBJA 5E8IA 4PIZA 1B9MA 2FQPA 3KE2A 5HVQC 5CVVA 5JHUA 3F72A 4XFIA 3IRRA 1KQ9A 5I91A 4LLNA 4ESFA 4O9GA 3K1MA 4WK8F 2XUBA 5I0SA 2UY8A 1FY7A 3LZZA 3G73A 4ENKA 1ZZ6A 2X4HA 1ZHFA 1GHCA 1ZLJA 2A3SA 1K78A 5K5RA 1UD1A 4XFHA 1NYWA 3RI4A 2XIGA 1QPMA 1PMIA 3WTSC 2FXAA 1SFXA 3ELNA 4KMFA 4EMSA 1I1GA 4H7LA 3I71A 2BNNA 4M6XA 1YFXA 4QLCU 4EGYA 4ENNA 4M71A 2MD5A 1EH8A 4UHTA 1FZPB 3BROA 2GA2A 4CGZA 3TKYA 4YIIA 1O3RA 1WI9A 3T0YA 2CV6A 4Y17A 2MNGA 2F5CA 3GWZA 1UCXA 3G7DA 3GO5A 3IBMA 1Z91A 1T39A 1I6XA 2DI3A 1GQHA 3S7EA 2QDRA 2PFBA 2P17A 3KGZA 1K78B 3FE5A 1KU3A 4G9YA 3BJ6A 3LQQA 1U3EM 3C1DA 1KU7A 4ZYGA 3USSA 3NSTA 4N0BA 2QQAA 4ASNA 1FP2A 1MJ9A 3V7SA 2NS0A 4XLNF 4KWLA 4G7OF 2FMLA 2J5PA 4RB2C 2QCSB 3GW2A 1RUNA 3AAFA 4PGHA 3E6CC 1W5TA 4B8XA 5T3NA 1Z9CA 1HSTA 2QLZA 5ICFA 2OU2A 3IKVA 4MHGA 1IAWA 3P9CA 2IXJA 5CADA 2F4PA 5IT3A 1RTVA 3ES4A 1XSVA 2VE9A 1G3SA 3TO9A 1J59A 1WRJA 2F5EA 4Y13A 1FP1D 4IHTA 3T5XA 5LGNA 2ISZA 3D0SA 4HF0A 2HFHA 1JXSA 2EV6A 4RD7A 1J5YA 1BI3A 3ZMTA 2XAFA 1G3TA 3L2CA 1BN5A 2O1QA 4EGZA 3MWMA 4IHSA 2PQ8A 1YFHA 1K6OA 3D5LA 3EUHA 3ES1A 1SD7A 3HOSA 1TNTA 1LB2A 3R0JA 2GWRA 4G6QA 2O61A 5AONA 2NRAC 2Z3YA 2FQ3A 2IXCA 1U5TC 2QJVA 5FCCA 2HGCA 2XL9A 2M87A 3M7GA 1TTYA 4JBAA 1ZYRF 4LG0B 2A69F 4QGLA 5I0RA 3FM3A 2EK5A 2NAZA 1EYBA 1S7OA 5D1IA 2P6TA 5EZWA 2MLGA 3GZ6A 1HW1A 3NJZA 3ZMZA 2O6GE 4J1XA 1YS7A 3IRQA 3OGJA 2PAEA 4IERA 1J9IA 2F5FA 1QZYA 3J81K 3MDPA 3ML6A 3QPHA 1RGSA 2B8MA 4A2UA 1ON1A 2GH2A 1LVAA 5D5WB 1IRFA 1UFMA 3EYYA 1QQIA 1X82A 2HZTA 1LDKB 3H1YA 4ETSA 4ESJA 4K8FA 3SCHA 3KP4A 1FC3A 5JVTA 3Q9VA 3UKNA 4GYGA 3SCGA 2DCTA 1IN4A 3WE2A 2AXLA 4H0EA 1MJBA 4UXAA 3TQNA 2EB7A 3ZPLA 2FBIA 5LLQA 5TRDA 1T2KA 3VB2A 2B5HA 2RN7A 1B4AA 2FE3A 2CW0F 2PJPA 1NZCA 5HI0A 2BE5F 1UHMA 2ESHA 4CDGA 3BJAA 2VBXA 2PA7A 2HOEA 4N9HA 3MYXA 3HQXA 2A61A 4LGWA 5D5VB 4L11A 4ZYHA 2PHDA 4WF2A 4OIPF 5J3UA 1R1TA 2ESNA 1LDDA 3EYIA 3WGIA 2Z9OA 5I8TA 4KU7A 4NVPA 1BI1A 4LJZF 2PFWA 2D2WA 5FQ0A 1JHHA 2NYXA 1UIKA 1ZREA 1P6RA 2HTJA 3ISPA 4LB5A 2X0LA 3BB6A 2XV4S 2CYYA 4OIOF 2EV0A 1ZZCA 2P5LC 1G4DA 2IJLA 4IEXA 4MH0E 2K27A 5DUIA 1ZNPA 3LA3A 1RNLA 1TNSA 5BPIA 4AIKA 1GXQA 5JAXA 2RDPA 3GX4X 1BIAA 1J2XA 5D6FA 1HKTA 2CAUA 3R6SA 2FNPA 3ZMVA 2GIVA 1G3WA 1FOKA 5CJ9A 2M45A 1O7FA 3HUGA 1TQ5A 4EJVA 4A12A 1EY2A 1ZG1A 2Q30A 3H3ZA 3NRVA 4B09A 4AIJA 2P7CB 5FFZA 3PLQA 1QWRA 1KU2A 1ZG5A 1Z1DA 1VJ2A 4XF3A 3JTGA 4OIRF 3CDHA 4XLPF 1CAXA 2M8EA 4Z2YA 1XCBA 1U12A 2IXHA 4LLGF 4IEZA 1F1ZA 2DU9A 4MTDA 4KMUX 4A0XA
chains in the Genus database with same CATH superfamily
1X1PA 2JZYA 4DEVA 4M74A 2B9UA 4FAGA 3ACFA 4MGRA 1K83J 1POQA 4FT8A 2HS5A 1YW7A 4LFUA 1AXKA 1Z78A 4TYSA 1DLCA 3ZYFA 5IT6A 1ZAOA 4O6JA 2P3IA 4EN0A 5FZBA 5F64A 4X8PA 5CFDC 1ZELA 4UUVA 2BFUS 2H0VA 4LBQD 4YW2A 1S1AA 2Q1ZB 2F5DA 1G6NA 3I3LA 2Z5UA 3FUOA 3JW4A 2MSYA 3O1PA 2W82A 4HW0A 3OYGA 2M8GX 4COYA 2ZX2A 2ZGQA 4N4NB 1PGL2 1U9NA 2D40A 2CYFA 1S6LA 3PM1A 4IHVA 1C57A 1UN1A 4AFCA 3N4MA 4HETA 4WVMA 2R7ZJ 3OYMA 2ZFWA 3AL6A 2AZ5A 1YFWA 2YFUA 3OR1C 1NCQA 1PVC3 4CCDA 3TEYA 5GADJ 4YG3A 5DABA 2WBMA 5L3DA 2CRGA 2K40A 3JQWA 3M70A 2FU4A 4ZC3A 3THCA 4FX4A 4E2SA 3PQKA 3BT9A 4S04A 1NX9A 2DK5A 1WCQA 3WHTA 4CUCA 1O3SA 5ICGA 2XJSA 1Z77A 1GDTA 3KV5A 2C0ZA 3D5OA 1A6QA 1W7PA 3HPNA 3WNXA 3VZKA 3GTQJ 4Y22B 3OBTA 5AVAA 2FEZA 1IZ1A 5A70A 1BJZA 3CCJI 1H8AC 4QGMA 5E8AA 4R1HA 4HLXA 1PGW1 5A7PA 4OMZA 2A5YB 4UUTA 3N05A 3ZMSA 4WBBA 3QPTA 1DGLA 2D43A 1S3JA 4BHBA 3J7AY 2VG9A 1RUG3 5ACA3 3Q3SA 4RAGA 2XL7A 3KYLA 3GEZA 5B4NA 3ZQHA 5JR7B 3U2RA 2HNHA 3TO7A 3SFIA 1SDWA 1BHGA 3N9OA 3T09A 1U0AA 4KFCA 5GZEA 4IX7A 4RA0A 3VEPA 1VBC2 2XRNA 3RYRA 1JKRC 2W1QA 1MMSA 1IS4A 4FQ4A 2E34A 3PQJA 2JDNA 5F6FA 2E7QA 3KLOA 2IS4A 2GNDA 4DNCA 5FBJA 4XSZF 5IP6A 3DUIA 5IVFA 2UYBA 2EIKH 2X85A 3TWIA 1YQ8A 1FJLA 4EN7B 3M9AA 3GTKJ 3BPZA 1E17A 2KZVA 4NRMA 3DQVC 3H36A 2VXJA 2WZ8A 4Q2FA 4CEWA 2XRLA 4MUVA 2LBFB 3MLJA 2FF4A 5IAVA 4NAOA 4CP9A 4OUMA 3RZOJ 3H8OA 2HQ5A 4OU0A 3TYJA 1DP3A 4XF0A 4LHKA 4FPKA 3E0JB 1SEFA 5B4XA 4M3CF 3HAGA 5GLTA 2WWYA 1ETWA 3F95A 4BJ5C 1OQEA 2GP3A 4FASD 4CCCA 4Y4RA 3OYAA 5J6XA 2MEV2 3I97A 4P9YA 2A6XA 3K4JA 4JDNA 4YYOA 2PHXA 3K4KA 1GQPA 1WGXA 5A3NA 2P5VA 4ZZLA 1NCRC 1W03A 3AG2H 3F3XA 2XJUA 2RS53 4V1PA 1VBA1 4ZTFA 5CNAA 2ZKLA 2D6OX 1JKOC 4BKXA 4C0HA 1MS9A 2RM23 4RL7A 1D3YA 5FV3A 3P9IA 1ACIA 3R0RA 1Z3YA 2MLKA 4YELA 5A1LA 3B7MA 4N9IA 1XSRA 1OKOA 3K3NA 2FHRA 2JEMA 2DTRA 5FPVA 4GWNA 1UMQA 2A6VA 1MBJA 2VD7A 3FHIB 1UYYA 1YIPA 3WG2A 3UKGA 2L0KA 5EYRA 1U8RA 1V6IA 1PP7U 2YGLA 4BXUA 1VQPI 2BOJA 2Z16A 4CH7A 4XJ8A 2BP6A 3ABTA 4ZU5A 2RV8A 2VJIA 3VV1A 1LGNA 2NVTJ 2O5RA 4MGIE 4P55A 4JOMA 2KRHA 4JKLA 3ECOA 3OYHA 4X0GA 5JUVA 1D5VA 1AR61 4ENMA 3FHZA 2EAAA 4YIFA 2I5UA 1A6CA 2KM2A 2JG9B 3TNQA 4CE8A 2XOMA 2VN2A 2VVEA 4CU9A 3MKYB 4ZHNA 1TLHB 1QQP1 2CGNA 3C2HA 3RFRA 1SANA 2V09A 3I0TA 2DCZA 4AFMA 1C5IA 1G8XA 3FUQA 3RCOA 4ZY9A 3U11A 1HBXG 4KIGA 4HKLA 2YXSA 5F3IA 2EFWA 4BXSV 4L5EA 2WY7Q 1PK6B 1F2NA 4B1RA 2OYZA 2OD5A 1BA5A 1CD3G 2WNVC 4RS5C 2LTNA 1IZ3A 1RL3A 2OW4A 3K69A 1MNDA 2A70A 1W8NA 1YIJI 3I2DA 3QU3A 4AI3A 1BOAA 3LCPA 3WHCA 4NRPA 2VCMA 3CUOA 2VQLA 2OPKA 2Y9YA 3M8EA 1NCQB 2PX9A 3NNGA 5HV4A 2ET7A 3ZM8A 1HX6A 1ULFA 2TUNA 2A6EF 1KONA 5A3OA 3W59A 3CDIA 4B4PA 1YJLA 4W6YA 2M0CA 3DTIA 5DPNA 1U5YA 1FYUA 4RB0A 3URFA 3NNLA 3ZN1A 1VAKA 1WJBA 5K8SA 3CLOA 4MYEA 1VBD2 3B9IA 5FPXA 2ZKZA 3MQ0A 3HWJA 1AYM2 2F6BA 2JG9A 1VBE1 2J22A 4N53C 3JRBA 5H9QA 1US2A 1REFA 4RFT0 3UL2A 1MKMA 3WTVC 3U10A 4MHRA 2I8DA 1I5PA 2HWE3 1K42A 1J3PA 2P4WA 4PLMA 1P8JA 2ZGPA 1LECA 4W8JA 2KDZA 3R4DB 1RUJ3 1J83A 1RUI1 5LHGA 2XMLA 2MD0A 4GYIA 1X3WB 2E33A 4LK0F 5J1RA 4YVWA 4U0VA 4B48A 1P4AA 1YI2I 4XJAA 4EZHA 2BV4A 5F5IA 2MFZA 2RJLA 2HWC3 4N8MA 1J0RA 1WPKA 3THTA 5FD5A 3OYWA 2W1UA 4KDPA 5C33A 1R58A 2PLV2 2JECA 4NHYA 4FCAA 5FZLA 3O0VA 1QU0A 2QZ8A 3HNYM 4TV7A 3BTIA 3RJRA 3BTXA 4QQLA 5FYBA 1D5YA 1IF1A 1SMYF 1U78A 1VBA3 1AR63 2VQTA 4HSLA 1E5RA 3QCWA 3BIEA 4IO9F 3MZYA 1EH7A 4GGGA 4AYBA 4I0AA 2VCAA 4Q4ZF 3NL1A 3MD2A 2DAOA 1QJY1 5SV5A 3VBHB 1OF4A 4CDWA 1PO21 3IDCB 5A3TA 2G9WA 2KRCA 1MBGA 3M2MA 2EA4A 1CIYA 1QZEA 2OVUA 5DG2A 2V72A 3T1LA 3VBSB 3ZSLA 2QBYA 3K4BA 2VW2A 2ZXHA 1W4MA 5IVCA 2R7OA 4CA0A 1BEV3 4XDQA 4XUNA 1AR82 2D98A 1PZ8A 3U21A 1TQPA 4EM2A 1UY0A 4D69A 2GMPA 3SJMA 3ZN6A 4BIOA 2BGOA 3NAPC 4QXCA 4XSXF 2DWRA 4LT5A 4BXXJ 3LAJA 4HOBA 4DS0A 3J9SA 3I2FA 3OGGA 4UFMA 1OUXA 3IH3A 1YO5C 1RETA 3PO2J 4KGQA 3EUAA 4ARYA 2JE8A 5IYDJ 5AVPA 1UOBA 5FY7A 2B0LA 2NNNA 2FDFA 3GFLA 3HKZN 3S7IA 4HQEA 3UNGC 1IRGA 5DAVA 1CAUB 1CJDA 4KG8A 3N3HA 2JA8J 4FCYA 1US3A 1U5ZA 3SDBA 2E9QA 5CAZA 1RI7A 1N3QA 4TTGA 1XB9A 4M0HA 2QUOA 1Z7S2 2ZCWA 4AQ2A 1TZOA 2QZ2A 2XAJA 2R062 3CQZJ 1OC1A 5BOXA 1KS4A 1X1BA 2VBDA 4KYWA 5DCFA 2LH9A 1B6AA 2JD4A 2AEYA 1NZIA 2PQSA 4K1ZA 2W1WA 5BNOC 3ZMNA 1BR1A 1H9GA 2LVSA 2Y34A 1LHOA 3WV6A 4P9WA 1MS0A 1WMDA 2VZSA 2ZNYA 1U5TB 2Y0OA 3ZFEB 2WRAA 2JN6A 1USTA 1PZ7A 4B1LA 3HSFA 4LB6B 4KNCA 4D7NA 4C9YA 1SAUA 1R1A3 1LU1A 4ON0A 4FP2A 1IKPA 2BW3A 4BQ1A 1WW7A 3VBUC 4GXOA 2GQQA 1D8KA 1R1A2 1TQIA 4S2DA 4BS9A 4UB8C 3GBFA 4NNJA 1ZLKA 2VUAA 3FX3A 2OQRA 5FIXA 4QPGC 1Q8QA 5I0UA 3BTAA 3GFJA 4EATA 5FUPA 4EWEA 1IOAA 5JI9A 1HDPA 5A2QZ 3CUQA 2ME6A 2WNOA 4B43A 2PEXA 3VYTB 4XONA 2NNYA 3M3QA 4HX8A 4BY7J 5D4RA 4XHBA 5ERLA 3FKJA 2DQRA 5LB6A 2Q2EB 3IMMA 4DBRA 2HWD3 2KQRA 3H9GA 4FFGA 3M1HA 4MV2A 3VBHA 3OYEA 5IJRA 3CCRI 4R52A 4S2HA 2VL4A 5DM6F 4LKFA 5FP3A 2WAEA 1ZK8A 4RQPB 2P1BA 2TRTA 3VBOA 2NZ9A 4CCJA 3IZOA 2WLPA 3PVBB 5DUUA 5JIAA 2E2IJ 2PAKA 3ZXJA 5LEJA 1KFUL 2VKHA 3MZHA 4X1EA 2XXZA 3DTEA 1OPCA 2ZJQF 1LEBA 1BK0A 1RVF3 5F27A 2GA1A 1SD4A 2DW4A 3WNOA 5J1XA 2WT2A 2HDCA 3JBG2 2V5DA 2RS13 5FZEA 1X3ZB 2KMUA 1WCKA 5L3GA 3VZNA 3VOEA 1XU1A 3AYAA 1OCTC 3RZKA 2DA1A 4IHWA 4WWCA 1YTYA 2RJKA 5KR7A 4CP9B 3FXLA 3JRIA 5GPCA 4R8HA 1QJFA 1MMNA 3KS7A 4DUVA 3KB5A 1FYMA 4ASMB 4DINB 1F15A 4QGNA 2AS5F 3NEUA 2VQUA 3BR3A 5FUIA 4PFPA 1MR5A 3GM8A 4V2GA 1H30A 3LAGA 4DYQA 3V7CA 3LB9A 1T6SA 4D5CA 4YW3A 1ULCA 1W5CC 4AOCA 4AG4A 3BG5A 3IDBB 4D0PA 1QNWA 4XFAA 4FE4A 3W2AA 1EAH3 3OEAA 4CEYB 1HB2A 1W8UA 3H8UA 5A7NA 1B72A 2Q2EA 3S3MA 4RA2A 3ZOIA 4XJ9A 1K5JA 1LU2A 2EVXA 5F5CA 1WCDJ 1KQ8A 1SVLA 2DDBA 4KUMA 1W99A 4Q0SA 5IK8A 3K75B 1K12A 3LFMA 3LMMA 4RMNA 2M1BA 1Z67A 2JDKA 5FY5A 2Y30A 3TN93 3HBZA 1NLRA 5BS6A 1FAYA 2IRFG 4ITVA 2IGOA 3CQOA 5IW0A 3SKJE 3D1NI 5LA9A 3ZN0A 4EJRA 2CUFA 2XBO3 4LKSA 3HD8B 4Y15A 5E20A 1H8TB 1BMV2 5BNPC 1AUYA 4IEPA 4KQ7A 5T5JA 4BPZA 4QX1A 5HBAA 3G6EI 4YGBA 3OWTA 4V2VA 4IEQA 1Y6IA 4IEOA 2BGCA 1OQYA 4B7EA 4AHYA 4I3GA 3KZYA 1X2MA 4XFBA 3HJEA 1ZBA2 1UY1A 1R4NB 2D6PA 4O3MA 3Q8EA 2KA3A 4XJUA 3WDXA 3VGIA 3WHUA 2KL4A 1XRUA 3G1LA 3UNPA 2JPBA 4QU2A 2Z1DA 4WXDA 5IP9J 2WQ4A 3N9PA 4OUEA 2DBBA 5CFCB 2ELJA 1XE7A 1IPJA 3LA7A 4XTPA 1R093 1QJX3 2XLAA 4BQOA 1YHFA 2XG3A 2OPWA 4E4SA 3G71I 2LKSA 4YLZA 4O9EA 2JSPA 4JYKA 4FPEA 2WIIB 1K6YA 4Y5SA 5CA6A 2AH2A 4Z82A 3DPTA 2CS3A 1UY3A 2C5DA 4LBQA 5FZHA 3AP5A 3WU2C 2EZKA 3I2JA 3B01A 1VQ4I 4FPYA 1D8JA 4ONUA 3RGBA 2YUEA 4U0YA 2FCUA 4IUGA 1AYN1 3VYRB 3CBNA 2X6YA 3WEZA 2X51A 2QEXI 3KWVA 2ZGKA 1DU3D 3QAHA 1KJRA 1KQRA 2JPCA 5JXGA 1GYKA 2OAZA 3B5LB 4B4CA 4XCBA 1GWLA 2EINH 2HR3A 3CMAI 4IEYA 5K7HA 5FYIA 1R5GA 4CXFA 1H2LA 3WDWA 3EJKA 2JQ7A 2AR6A 1UQXA 3ERED 5D8AC 1ND3B 5D5UB 3KYCB 4OINF 1MIJA 4ET7A 2RDNA 3FN9A 4AEMA 1JZ4A 3CCYA 3VBRA 1QIQA 3TO6A 5H2FC 3NWSA 1Y8QB 3CC4I 1QY4A 3NMBA 4LO8A 1D0GA 2YV8A 4XMAA 3S1QJ 2DOAA 3PHMA 4BHCA 2ZFUA 3K6GA 4L5IA 5FYTA 4QX0A 2R7XA 2Y6HA 3T0DA 4CCLA 2DA3A 2DA5A 3U07A 3ZQIA 4IF4A 2XR4A 2EF6A 1IDZA 1UW8A 3A21A 1Z7LA 2P7VB 2XBO2 4RHV3 1TT5B 3CJIC 3M3CA 2IAIA 1GXPA 3J7AO 1V00A 5DUXA 4PDWC 2W9XA 3AM2A 4Z2WA 5TJJA 2E7AA 3EO6A 2RM21 2W57A 5LBFA 5C44J 2MEV3 2IBDA 1PVXA 1TL8A 2O03A 1M4WA 3RQIA 2UWAA 4CEWB 4UXNA 1GP6A 3SEEA 3WNNA 3F8NA 3TP3A 4HANA 4K7JA 3KZ4C 5B1AH 1ULPA 1REPC 1MQTA 4OI4A 4ZS3A 5FLJA 1JJ8C 3K4MA 3F21A 1YC61 1QQP3 1J3QA 5FO9B 3MIGA 4QPYA 3QWLA 3J8F2 3C7HA 4C2MJ 3RDIA 3DU5A 4AVTA 4NIHA 1LGCA 3ZYIB 3SXYA 4RYDA 4CXXA 1Y0UA 1WHUA 2R7DA 4FO9A 2DFIA 1QJX1 4AK3A 3FFZA 1U5TA 2I07B 4MOAA 5TSWA 4IPAA 3BR5A 1IN8A 3OTFA 2GMEA 4OZOA 1MD0A 1LCLA 3CJIB 2ZSIB 2P5KA 5DTDA 4M3FA 4ZTJA 3FXMA 2VUCA 1JKQC 4XZPA 3QU6A 2W1SA 2R0HA 4UFJA 1RUD3 4DY5A 5J98B 1XSDA 4FFFA 1K5MA 1BW6A 5EDNA 3L1PA 4DUXA 3GZEA 3V42A 2XUEA 2CO5A 5H6QA 5T50A 4O5VA 2TNFA 3V8JA 4DJAA 3JZVA 2QZ3A 1BYHA 1AYN2 2OZJA 2D5FA 2V4VA 1MS4A 3VKFC 2DA2A 4A6OA 3LEGA 5DZFA 2M5WA 2ZS6B 1Z7UA 1I9RA 2PHWA 4UAPA 1YOVB 1Q8OA 4OMDA 3BR6A 3S1MJ 2QQWA 3HNBM 4Q48A 1FX7A 2HYKA 1W04A 1W5SA 2HYJA 3SEQA 1GU3A 4XPVA 5CYYA 3VKLA 1JH5A 4UV8A 1MDMA 3JQXA 1KRIA 4Q0UA 1WMFA 3D0JA 1L7RA 2O3FA 5LBQA 3ZFGB 3QYBA 5JVGF 2RR12 3F8MA 4YGCA 5DD4A 2QYOA 1FOYA 2HQRA 2Y38A 5L73A 3J8F1 5FKNA 3FXUA 4M3CA 1XNTA 4CVUA 2OA2A 3VBUB 4AE2A 2ETEA 3FFQA 2VBZA 3L2WA 5DUVA 4JKKA 3FBIB 2L7ZA 2CV1A 3BR2A 1MBFA 4QQ2A 3SHFA 3VBRB 1CX1A 4PBPA 5F9TA 3VZOA 2VMGA 1UZCA 4G6DA 4AL9A 2WS93 1PGW2 1PVC2 2GC0A 4G8XA 4LLFA 4IGQA 2G9ZA 2YUSA 4CDQA 1BC7C 3UR3C 1ZX5A 2XHKA 3IAPA 2A07F 3J80K 4M72A 1YW8A 4H3WA 2J7MA 1YRNA 1WJEA 4Y1ZA 5J96B 2IT0A 2LF7A 4U87A 4J1WA 3JAMZ 1V3FA 4A42A 3CCQI 4CCMA 3TDUC 3T4HB 1VQNI 3KT4A 2VC0A 3KF3A 4PJ0C 3RPUD 1S4CA 5FYUA 2X9DA 4R9CA 3CD6I 5A1FA 4XOPA 4RGUA 3F23A 1PNGA 1FSHA 2EFOA 1Y43B 3KCYA 1RUH2 2J1EA 2UYAA 4UNOA 3HT1A 1FBQA 2DJNA 1OR7C 2VQGA 1LDJA 5KK1A 3I56I 1GOFA 2WZEA 3BCWA 1RMU2 2RVCA 2R3SA 1NA1C 2ZGSA 3W5NA 2DBNA 4BE0A 1SLBA 2HWB3 3HVDA 3C3WA 3FHAA 4RHV2 4M0NA 1B9MA 1RUD2 4MO3M 4PUSA 4RR3B 2QKDA 2BY2A 3WP6A 4ESFA 1E5SA 5TGTA 1I50J 2CUJA 1FY7A 4XQWA 1I3HA 4ENKA 3GCWA 3LKJA 2Y6GA 1QVTA 1ZLJA 5LCWL 1ETVA 3TB0A 4Q8KA 1JYCA 4LOTA 2B9SA 2O8KA 4M71A 3OOXA 2XVLA 5EJZB 2J42A 4CGZA 3A01A 2BY3A 1O3RA 1DU6A 4Y17A 2MNGA 1MH3A 4LPLA 5KWRA 3IBMA 3HGGA 5IOZA 2Q5TA 1H4GA 3ASOH 2P17A 3FE5A 1KU3A 2GMMA 3FBNB 3SEZA 4UUSA 5C71A 1U3EM 3USSA 2VCCA 5F39A 3WT3A 4DQAA 4XLNF 5K9YA 1D7PM 2BBVA 1KXGA 3KM5A 4Z6YA 3HOUJ 3GW2A 2J1UA 2VZ1A 3T0AA 2CHHA 3GMEA 4Q4V3 3N9QA 4NWWA 3LGRA 1JUMA 3ZQCA 1VAVA 3PTRB 2AYHA 5ICFA 2ZX3A 2DCJA 2IXJA 5CADA 3JBG3 1IJWC 1RTVA 1O91A 2JDZA 2VE9A 2G4IA 4HFSA 2HYXA 1AX1A 1MQTB 2XPWA 5FZIA 2F5EA 1UOJA 1LESA 4Y13A 4IHTA 3IPVA 3K4NA 3T5XA 5LGNA 3D0SA 1HRV1 3B6CA 2R6QA 4A41A 4M00A 5FYVA 1QJY2 3LOCA 1OOPA 3L2CA 5JLXA 3JRDA 5EHDA 2QCOA 1YFHA 1IS6A 3ZYPA 1K6OA 3HKZA 2E32A 3G6JB 3MIBA 1U0JA 1BCXA 3LSDA 1FPN1 1LB2A 1X1DA 3SZGA 1H6YA 1RIRA 3RJ2X 4II2A 2GWRA 4G6QA 4LO6B 3DBLB 2FQ3A 5EG0B 3OGSA 4E4ZA 4BDYA 5FPBA 2M87A 2BJSA 1JHJA 1UU4A 3M3OA 3VSLA 1ZYRF 5I0RA 1PYVA 1UO9A 4PLNA 4QB2A 2P6TA 4I99C 1G9BA 2MLGA 1PMHX 1W8WA 1HW1A 3H0GJ 1WW6A 2LD5A 3W6VA 1LENA 1YS7A 1YRNB 2RS11 5F37A 4A3MJ 1IGNA 1JZ6A 3AP4A 1E3HA 1TC3C 3J81K 4CYCA 3SH3A 5GZGA 4A2UA 1ON1A 2EIMH 1JKPC 2K5CA 5JXHA 4GH4C 3EYYA 2R7TA 1QQIA 3NV2A 5M5YJ 3MMYB 4UWDA 4ESJA 1C28A 4YVSA 5JVTA 3ZQGA 4DNYA 4C1WA 1HDKA 1BLZA 1RMU3 5EG0A 2IVIB 1ZM1A 5FZFA 2EIEA 2AXLA 2DUQA 3JXSA 3TQNA 5FPAA 3WDVA 5LLQA 1SLAA 2D3RA 2B5HA 3UGFA 4M3CB 1B4AA 1DGWY 4HNVA 5HI0A 2BE5F 1UHMA 3ALQA 3CZJA 3V0BB 1KS5A 2E71A 2BFUL 5IK4A 4XRSA 2ZB9A 5LASA 1A8DA 4II3A 2D5VA 5E3LA 1JZ3A 4WF2A 1R1TA 4FOYA 2ESNA 2IVJA 2B39A 3QPSA 3WGIA 1WCSA 1WD3A 2YPJA 4KU7A 4WM7C 2H0BA 4LJZF 2D2WA 2QQNA 1JHHA 4AEDA 2OC6A 1FOXA 5FYSA 3O0XA 4CPBD 1ZR2A 2XV4S 2CYYA 2AGSA 5LA2A 3RWNA 1S0JA 4QXBA 5JMOA 1ZNPA 5LBCA 2WT0A 5BPIA 3ERMA 3ME2A 3I4NJ 3OY9A 5D6FA 4KBZA 2ZJCA 3R6SA 3HOZJ 2WS92 4MGSA 5EJCA 4FTEA 3UT0A 3OS2A 2M45A 3PU3A 4UW3A 1RVF2 1UX6A 3OOUA 4A12A 3WDUA 4QHOA 1MNEA 2VVFA 2IS1A 3F0CA 2C4XA 4D0QA 4A93J 4RM2A 4AW7A 4F3JA 4JRAA 2SLIA 1WW5A 1KU2A 4C0BA 1VJ2A 5K4LA 1NTCA 4XC9A 4QDSA 3JTGA 3OL3A 2DMQA 1RUH3 1QJU2 1WMEA 2NVUB 2M8EA 4Q27A 1N47A 5LWBA 4J00A 3ZFEA 1C1FA 3JR9A 4XHXA 2D97A 1TWFJ 2W2IA 1TNRA 1UZVA 4NHKA 3U1DA 2DUOA 2W92A 3A0HC 2RS52 1LKXA 1D1CA 5E3NA 1W6OB 3MPBA 5JFRA 5KHKA 3ZN4A 3UGHA 2HWF3 2GC3A 5JCTA 2ATFA 1ZN2A 3DF8A 5IVYA 2VW0A 4QMAA 2ARXA 1JHNA 4A6EA 1OYIA 3WR0A 4M3GA 4MXWA 1R23A 2H27A 4QTRA 4W97A 1W9SA 5LBBA 2L9RA 4EM1A 3FKIJ 4OQ8A 9ANTA 1PIV1 1O5UA 3ITQA 3ZVXA 3V7RA 2QQMA 1T6BX 4P9XA 4NJ4A 5FMDA 4KG0A 3T08A 4LKDA 1JGSA 4NQWA 3P5JA 4ZPIA 4MGYE 4CDUC 3OGVA 3IIIA 2PHLA 4Y1YA 2DCKA 2YR2A 2UWBA 4OLLA 4BBRJ 4XZUG 1FPN3 1VB2A 1P7JA 1L7QA 1OT5A 5FZ9A 1PO23 1GZWA 4L0PA 3C7JA 3TOBA 3WG7H 4IEUA 4QDRA 5IVJA 3H42B 4GWJA 4DO0A 3TGNA 3V0BA 1QNYA 3R05A 5I8YA 1HQWA 3ZQLA 1AYM3 2XC7A 2UY9A 2Y0SN 3B00A 5F5AA 5C6CA 4FXGB 2LDUA 4YFNF 2VONA 4E6KG 1RC9A 2Y2ZA 1AYN3 4KL1A 4MHUA 5FZKA 1ZRCA 2NMNA 1K79A 3HHHA 1VMJA 2HH9A 5DYMA 4CU8A 3WNLA 4GZ9A 1VI0A 2DXIA 5DDJ1 3PFYA 3FXQA 2DBIA 1LODA 1IG0A 2XF6A 1OH4A 3TEDA 5GAHJ 5H9PA 1W2NA 1RMU1 2OXBA 3MFKA 3BN6A 2HVRA 2VMEA 1Y0NA 1JN2P 1B59A 3OS0A 3QP5A 3BPXA 2WYSA 3CJNA 1OFSA 2D44A 2RDQA 2Z2SB 1T0FA 2BRTA 1Y9QA 4HT1T 3LWFA 3M8JA 1OMIA 2HWF1 4Q0PA 3PO3J 2CGPA 5C4JJ 1L7LA 3S0MA 4D7YA 2X1DA 2HI3A 2WINB 3DPRC 3P9KA 1SD6A 3JRGA 4Q1RA 3RNSA 4LD5A 5FY1A 3HN3A 1A3KA 4CZZA 4HDVA 4RAYA 2GH8A 1H1IA 3FXJA 3C18A 2Y6LA 5FZ6A 4AGVA 4QHZA 1XU2A 3IDEA 2V1NA 3RZGA 4K20A 2JWTA 2CMPA 4IE4A 4E27A 1J58A 4AGGA 4KN4X 5LGTA 2VJXA 1QPIA 2ORZA 3J80Z 3RKQA 1R082 3W6JB 4A3IJ 3O2PE 4F91B 2R5ZB 1NA1B 4XF1A 2LRDA 1S2KA 3WZ1A 3WG9A 2VMCA 1OFNA 2WR9A 4M6YA 4KIBA 5FK8A 2Q0AA 1XMXA 4O7XA 4PGGA 2E53A 3MW3A 4UF0A 3HEFA 3ZLIA 2OZUA 1BEV2 1O3QA 1K3IA 2VMDA 1AR73 4LJHA 4CPBA 2A5ZA 2X6WA 2EXHA 2ECBA 3K0LA 1LR5A 1X50A 3TDZC 5H6RA 4GRIA 3SMHA 2FBEA 4IV3C 3S93A 2V79A 2O0YA 3PIPF 3M1CA 1C0WA 4OHYA 3I54A 3CJIA 3SXWA 4BE1A 4LIUA 3ZKYA 2WL1A 5FPZA 2IXSA 1YQAA 4IQ4A 4YG0A 1U2WA 5A7OA 3VZMA 3VBFB 2QE3A 3FMQA 4RHV1 4A7YA 1RITA 4OMCA 2XSDC 3IUOA 5ILSA 4X8NA 1BQPA 3H0OA 3BKZA 2EBIA 1AR81 2WFF1 1CAUA 2RMU3 4Q4W1 5LHHA 2Y26A 1LE8B 3NWKA 2XAUA 5KHGA 2VNOA 1QOSA 2Z69A 1LTEA 2J1TA 3R4KA 5F1RA 3S30A 5FOJB 4ZDLA 5FZ8A 4YZ4A 2YYOA 2DVBA 5EPAA 2C26A 1KD7A 1F5TA 1FPN2 2JG8A 4LA3A 2X5IB 4CDXB 2YC0A 2NOGA 3NNJA 3POIA 5JOWA 3VODA 3UYJA 2VO5A 2XASA 5FKKA 2R49A 4I3PA 1CQ9A 4OAYA 5L7OB 4C2UA 4INDA 4W6WA 2HOAA 1REDA 2WADA 3VBFC 5T54A 3I3QA 2Y48A 1FWZA 2KJCA 3Q9SA 2W48A 2LM3A 1MGTA 3ABUA 1UXXX 2PLV1 3UKVA 5B5EC 4OCTA 3I4MJ 2VKEA 1VMFA 2JDYA 2ZBKA 3DCFA 4QM9A 1D2SA 2VGDA 1ULEA 5F0HA 5BPDA 1W36C 3VD9A 1I27A 4Z1VA 1UCRA 4FHTA 3PJYA 1EA3A 3TN92 2K9SA 2RQQA 3KEOA 2JUCA 3J26N 1ASJ3 5L3FA 3GZUC 3DLAA 2CQ7A 4ENJA 3EQLF 4FTSA 1WKYA 5HPOA 3UV9A 1H0MA 2EIGA 4FOQA 5KCMA 4K9SA 2NPIA 3ZR5A 3OYBA 1I5ZA 2VOPA 3R0AA 2L3DA 3T8RA 4NC8A 1Z21A 4KIFA 2FSWA 4G7ZF 1GZCA 3PNVA 1L3JA 1AWCA 4YARA 1T56A 3DXTA 4E70A 2IXLA 2JD9A 5C4WB 1X36A 2H1LA 2K02A 1KDMA 5L9BA 4AVPA 1ENSA 2ZA9A 4FPHA 1JOJA 3MI8A 1XPXA 2XGXA 4I30A 2X6XA 1SDDB 1W90A 5EGOB 3ZMOA 4IE5A 1EV12 2QQBA 2STTA 4IZZA 2LALA 1Z6RA 4KWJA 3WSOA 3TEZA 3BG3A 2WS91 4G12A 1VFCA 1OFCX 3BPSA 1O7LA 3N7LA 3GUDA 2G7HA 5DD8A 1DYPA 1SFKA 2XWJB 3TP0A 2WSUA 2BV6A 4HXCA 2L9NA 1UB9A 4PK4A 4Q47A 2DFBA 1R091 1XNCA 1W6NB 4PLOA 2WSVA 3KLNA 3MFCA 4QU1A 2WBKA 3PVEA 4CSWA 1N78A 2GXGA 3I53A 1IUYA 3HUGB 4YFZA 5DAPA 3E6MA 2WZR2 1A34A 4LR4A 2F4LA 1GUIA 5FP4A 1DUXC 5J8FA 3W58A 4CU7A 4B47A 1V6MA 3CJRB 2PJRA 2YFZA 5CBLA 3GXUA 5FMBA 4XUOA 2MBFA 1NOVA 4K40A 3B73A 1C4RA 1TNFA 4E4DX 1RUE1 3V0AA 1TEIA 1O57A 5APAA 2E19A 2CUZA 4GMP1 4I0WB 5E16A 3OUJA 1AR93 3WW1A 5FP8A 1S2EA 4A3KJ 1XMAA 3ENRA 5KBFA 5HNFA 3RZDJ 1IW7F 4GJYA 3HDDA 5DZEA 1ZA7A 4BACA 3N9LA 2ID3A 4Q0VA 2GM4A 3WNKA 4TLFA 5HDNA 4DMIA 4AIHA 3L9FA 2PELA 5GLUA 5IYCJ 2ZAHA 2Z42A 5T5OA 1HKQA 1O4XA 3IL2A 4XLFA 4M01A 3CP2A 4MQ9F 4IL7A 5KHHA 2MHFA 2CQQA 1VBD3 4HN0A 2EZHA 2O8OA 2LFBA 3NKTA 4KWKA 4AEDB 2OF7A 2KISA 1VQ8I 1H9TA 3GZNB 1OH3A 1XE0A 3MHZA 5C4XJ 5JSOA 3IWFA 4HVOA 4B3XA 4LUKA 1J84A 3JCIA 3EHKA 4I2OA 1WQ2A 4Q4X2 1YE9A 5B3SH 3E6BA 1UU6A 3N35A 4MX3A 4ZYEA 5C9AC 3BTCA 2BOIA 2H6BA 1PVEA 1DZRA 2V4AA 3E97A 4BISA 3NKGA 1VBE3 4L0ZB 1HCRA 2CV0A 2R92J 4JAAA 4LOCA 2A05A 5JSRA 1MS5A 1YW9A 2KP6A 3C3VA 2VODA 3FC0A 4MGKE 1OD5A 2VBPA 2XDVA 4S2FA 3H50A 5C3RA 2ZGOA 1RC6A 4M3CE 1PUFA 5FZOB 3O5SA 4CCEA 2KHMA 5FPUA 4RGSA 2BXYA 5I0TA 1S5LC 1XGOA 1IXCA 5HCAA 2CAVA 4NHJA 1CAWA 1CN1A 2XSJC 1DBNA 5D8KB 1J7KA 1CAWB 4QPWA 1PO11 2C6SA 2NS8A 1GOHA 1G9AA 3BCAA 1HJFA 2RS31 1U5XA 4K6BA 2L9LA 4WM8B 4Z8BA 1YG2A 2GC1A 5I0DA 2HYGD 1F8VA 1G7YA 5L3BA 1GZWB 2DA6A 2YC4A 1AHSA 4NIDA 5IATA 2RKHA 5IY5H 3H35A 3F8FA 4N43C 1S8NA 1CAXB 5F04A 5M3FJ 3WW2A 4CU6A 4JGYA 4HF2A 2M4GA 2DDUA 3LDRA 1HIXA 2DO7A 4JGZC 2XH6A 2OTLI 2RHPA 1AL22 4L8QA 3CMEI 3A0KA 3HM5A 3NQOA 3REOA 2P6HA 5J8CA 3BPVA 3DF0A 2VXDA 4AF9A 2RGVA 3FXRA 3K4DA 5HCHA 3I2KA 1A31A 3DYPA 1RUOA 4UW5A 2XJPA 3H5NA 5E17F 3GFIA 3F22A 1YCIA 1ND2B 3IWZA 3VDBA 1N1TA 1R7JA 3NNMA 2R073 5IFPA 5E1XA 3ACHA 1JUHA 1R00A 2BEOA 2KXLA 1APNA 5HLGA 3V8KA 4N43B 5L3CA 2DURA 1GV5A 2BVBA 3HRTA 5HS8A 1ORKA 2V1DA 1FSEA 5JVVA 3VDXA 2JWPA 3HRMA 4JGZB 3BI3A 5F0CA 2DK8A 2L54A 2WO3A 3ZPYA 3DL3A 4P96A 3MCZA 3T1BA 2IZWA 2MH9A 1NHAA 5IT9K 4LK1F 4CDUA 1HB1A 5CFCA 4U2AA 4A5NA 3WVJA 4O61A 4N53A 2W91A 4G4FA 5LEKA 1KZHA 3LOIA 1T98A 4N7UA 1G9DA 1H1MA 1CF7B 5AFBA 3B02A 5EQUA 1C5HA 4QXKA 2L4MA 1BVVA 3WOGA 2FDGA 5D8LB 1J3RA 1T6GC 3CLQA 3S32A 2RNGA 1LNWA 4D9JA 3BU0A 2LW8A 3WQ7A 2BUKA 4UW4A 4AVCA 5A3MA 5FMOS 1VQLI 4Q4Y2 2FCVA 1ENHA 4LO5B 4YZ1A 1F43A 1FMD3 3D5SC 3ZOBA 4IV3B 3LSPA 1SLIA 3ASIA 1XX5A 3HGYA 1DGRA 3L9JT 1A36A 1I39A 5KHIA 2B7EA 2TDXA 2QGUA 1IRZA 4YNIA 3K4ZA 3AXEA 1WJ5A 5BNOB 4QWQA 1AL21 3DFGA 3TOJA 2DYRH 4D7TA 2Z79A 2GNTA 5EYYA 3QP6A 3NWTA 2DMNA 4IE7A 2QQLA 2FRHA 4OUSA 1ODDA 5DAQA 4AQ6A 3MO4A 2R7RA 1FEXA 2P3JA 2DDAA 4MXVA 1MZFA 5BNNA 4A3LJ 2X1EA 1DLLA 4LULA 2D6NA 4GAZA 3SC7X 5IPAA 3BTLA 4LOSA 4JHTA 2ZXJA 4KA4A 1W05A 2EWNA 2VPVA 4MO7A 1GT0C 4XJZA 2RNJA 1RUE2 1VALA 4BQ3A 1U6GA 2BNMA 5HLHA 3AP7A 4CO8A 3RMYA 1NG6A 3KMHA 2JUGA 3VPRA 3KETA 2WUHA 3GFMA 2V6EA 2JG9C 2B9VA 3DYMA 3WODF 2LG4A 2VC1A 3R60A 2IPQX 3RYKA 2F48A 2EZIA 3BOWA 4HBNA 4P9FA 1XGMA 3WTXC 3VBOB 1N25A 2R071 1U5IA 3ABLH 2VZQA 2K9ZA 4M9SA 5E1RA 1H9WA 1QHDA 4FTBA 1BR4A 3LSHA 5BNGA 3D5RC 2K86A 5CYVA 2Y8KA 3TBDA 3ZSEA 1WLCA 3DXUA 1TMF3 5JOYA 3ORJA 2RVAA 1HA8A 1PM4A 4ZZDA 1UKGA 3AL0B 4P1WA 3RKWA 2ZGTA 2EFNA 4GD4A 1OD3A 1V4RA 4L92A 1GNHA 1LOEA 1MJAA 3I2IA 4L9TA 4LE3A 2A3WA 4P08A 1ZH5A 3DN7A 1VQ5I 1GP4A 1KITA 4CTEA 3KP6A 4BGDA 3SZTA 2VOKA 1F31A 4OIQF 5IT9Z 1FT9A 2D6MA 5FKLA 4DXRA 2M34A 5CKNA 2VKVA 4NB5A 3GZ5A 3PVOA 4A44A 4YVWC 3WG4A 4E8CA 3AMPA 5J4YA 1VP6A 1UZ0A 2VULA 5EEGA 2ZBJA 5ERIA 3AK0A 1IXSB 4PSXA 3LEIA 2K4BA 1STMA 2VBBA 3MW4A 1BBT3 1WWYA 5JZGC 3KGLA 2M0MA 4N53B 4AM3A 2GOMA 1R9TJ 1W6MA 1RXFA 1D0HA 4EJWA 1XXNA 4OHWA 3MFAA 2VBYA 5ICCA 3ZCOA 3O6BB 3SEPA 2HKXA 1OISA 3ZPOA 2ADEA 1YRZA 2P37A 3EQEA 1TZLA 2VJ4A 2Y0SA 1H89C 6PAXA 4QPOA 2L7MP 3RI9A 1ZARA 5H9SA 1JI6A 1AR71 3X29B 3QYFA 2WAQN 2KRFA 5A6XA 2R043 1XDSA 4QPQA 1K5MB 3BU7A 2HEVF 4XORA 1FYKA 1NKGA 3LIGA 3VB9A 1AL23 5LGUA 2HWE1 2CSOA 4IDZA 1IO2A 4RN5A 4P5HA 2O8QA 2BWCA 4COWA 4JHZA 3AYCA 3T2QA 1QXPA 1CF7A 1YFYA 4Q4V2 3HPHA 2R5ZA 2R32A 3FZ3A 1SC7A 3OUIA 2AACA 1FV3A 1KGYA 2HVQA 1GVDA 2W24A 2EXIA 4LBOA 1B9NA 2JRMA 5J1YA 3WHBA 3O3KA 1YEWA 1SPPA 4F55A 2CWMA 3HNMA 3DPUA 4KT5C 2OA4A 5D4SA 4RB3C 2D45A 1RHI3 3POYA 3SNMA 4A45A 3AKPA 3ZSMA 3AB0A 4QIWN 1UHWA 3T4VA 1RUJ2 3Q0VA 4FBFA 4AHWA 1ACCA 4A7ZA 2JTVA 4YM0A 4G7HF 2ET1A 2VY0A 2RMU2 2OQ7A 4LQRA 1HQLA 3AYEA 3SISA 4KBBA 1FPQA 4ZDOA 1W2UA 3K3OA 2W68A 3WF1A 2FZ1A 3OSDA 4CDQC 1B35A 4YZ3A 2DFEA 2OV7A 3JSPA 3ETQA 4IRGA 4CCOA 3PDQA 3AG3H 4RGRA 1HRI1 5CISA 2CQKA 2QQVA 1MEC1 3GTGJ 2YX4A 1JYXA 2H09A 1COV2 4RS8A 3H1WA 3Q0UA 4P14A 5DG1A 5GTHC 1JU4A 4EJOA 1OOPC 5EZHA 5FWEA 3O1SA 2VM9A 3VHPA 5LFAA 2W4SA 4WXCA 4D94A 2ELKA 4RGAA 1UJ8A 3K4LA 3ZX7A 1SD5A 1XNAA 5A6QA 3AZXA 1RINA 1R081 1RUI2 4B8EA 3POBA 4ZS2A 2EALA 2WB1A 2EFQA 1XDUA 4M3EA 1RUC2 4FE7A 2NN8A 5LATA 1BBYA 5F3CA 1PVC1 1EJ9A 4HSRA 2OUJA 3GZAA 1LOGA 1F9NA 3P5BA 2R7SA 1S7EA 2IA1A 1VQKI 1HB3A 4XKCA 4Q0QA 4BJ0A 3N9MA 2OUMA 2QVOA 2PHRA 2VT3A 2HOSA 2DOFA 2RJ2A 2BNOA 2K3FA 3ULQB 3S16J 1Q43A 2CFXA 3WNPA 4XAEA 2AXTC 5JR3A 3QYEA 2EV5A 1ZBE3 1VBB1 1OBNA 5KC5A 5FZ4A 3ZFEC 3PIGA 2VH9A 4P9IA 4A3ZA 4MIMA 4DYCA 4BQ4A 2RQPA 3OF1A 3FIWA 1EAH2 3JRCA 1MZEA 1VQOI 1YI9A 3AP9A 4UFIA 3L7WA 1NY72 4DXSA 2IC1A 1H8VA 1GSLA 3TL4X 4COVA 3PNTA 5JLWA 4BE2A 1ETYA 4CP0A 3WQ1A 4LMYA 5DDJ2 3NV1A 4AAPA 2PJRB 3PNAA 4L97A 4OI0A 2D7FA 2PHTA 1LEAA 4XACA 1V6OA 3U4SA 1Z0XA 2WY8Q 3ST7A 1Q8SA 1LNSA 4OZXA 5C3SA 3KEQA 1O59A 1COV3 3POSA 4L18B 1Q5OA 2B46X 4MZUA 1RPWA 3E5QA 4FAHA 5C5TA 1CR7A 1QEXA 3NNFA 4NC6A 4HN1A 3H8RA 4GB32 4UUSB 2V4JC 4XYXA 2JE7A 1YHQI 2V26A 4BQNA 2ZXQA 4HF1A 2BYVE 5FYHA 4XLEA 5HNHA 1XNBA 2JJ6A 3IT8A 4AZZA 2DT7B 1TWHJ 1YYVA 3RKXA 4AI9A 2CTVA 3KQ4B 1DPUA 4X6RB 2IP2A 3DECA 5IVBA 1LOCA 3M1EA 2BY0A 5A3WA 2Y6KA 1C8M2 4UFLA 4ATFA 1QBJA 5E8IA 5K0UC 4PIZA 1N75A 5HVQC 5JHUA 1WZ2A 1VIWB 3F72A 4XFIA 3IRRA 4A3EJ 4JDMA 2DFFA 5I91A 2HWD2 3J7YJ 1W2TA 2CQNA 1QRYA 1ZBE1 3G73A 2X4HA 2X09A 1W0PA 2A3SA 1K78A 4GB31 4QX2A 1F4HA 5K5RA 1V9U2 1UD1A 4XFHA 3RI4A 1QPMA 3QOEA 3WTSC 1ULDA 2WAQA 1SFXA 2GN3A 3ELNA 1T0FC 4KMFA 1HKDA 4TZDA 5K7PA 3NAPA 2EPFA 3FLPA 4HRIA 4QLCU 4EGYA 3VKNA 3PSIA 2QKMB 4UHTA 1AKHA 1W6QB 5HCBA 1FZPB 3BROA 2GA2A 3OR2C 2HLEA 1M06G 1BXHA 4PQQA 4H2AA 4C1XA 1URXA 4Y4YA 2F5CA 4QXHA 1UCXA 2E1OA 1W8TA 4RGGA 3U78A 4HK8A 1GQHA 2DI3A 3S7EA 2QF7A 3H5RA 2PFBA 3KGZA 1K78B 3OYLA 1VBB2 2DMTA 3T1MA 3C8XA 4ZYGA 3BC8A 3OYWB 4JDOA 1MJ9A 1R1A1 3ETPA 3ZFGA 1MMGA 2ZHNA 2BGPA 5FZ3A 2R072 4ES9A 1RUNA 4IXLA 1W5TA 3BIWE 3GF6A 4M3BA 1GNZA 3O8HA 2QLZA 2DCEA 3IKVA 4MHGA 3P9CA 1I3AA 5IT3A 2ZX4A 1GANA 3PUBA 5BNOA 3LD8A 5FLMJ 4GJZA 2LC2A 1J59A 2COBA 4N90A 5FROA 2OQ6A 4TN7A 2RM22 3K4AA 5FKBA 2WLQA 4D8MA 3NV4A 2YS9A 1BI3A 3RSJA 2XAFA 1AZDA 1DQUA 4C30A 4YPJA 4EGZA 3VBUA 3QPLA 4ZZ5A 2ZKNA 3D5LA 3EUHA 5F6KA 1SD7A 3I9V2 1NUKA 4PF1A 3WF4A 5GTIC 3I3MA 2NOJB 5FZ1A 3LF7A 2YG0A 2LYCA 1MS1A 2HGCA 2WZR1 3J4UH 4FISA 3LSJA 1S7OA 4M3DA 4F3QA 2JG8C 1GWMA 4ZJZA 3RZJA 3KYDB 2O6GE 1KDKA 3OGJA 4V2WA 1JJ6C 3IAS2 2V5YA 1B09A 1TMF2 1J9IA 1HRI2 1R1ZA 3MDPA 3QPHA 1SZBA 3MIDA 4RQPC 4PI2A 4E4HA 1SLLA 4NPRA 4XIDA 1UZWA 1V6NA 1VQMI 3VBFA 1HN0A 4LK6A 2K9LA 3RS6A 1ITYA 4K8FA 5C3EJ 1HXS1 2L7KA 2FQ4A 3I3DA 1JZ5A 2ZX1A 1FC3A 5FXVA 5ISLA 5FY4A 2DCTA 5FZCA 5CG8A 2CDOA 3MLLA 3H9JA 1D0YA 2O7OA 4TLGA 1SFYA 1UELB 3ZPLA 2D6LX 5TRDA 3VB2A 4D5FA 1MACA 3S2DJ 1G9CA 2CW0F 4YEJA 2UWCA 2PJPA 4Q4V1 3JD72 2YGMA 2CDPA 1UHSA 4CDGA 4O65A 5GAGJ 5JWPA 5FZ0A 3HQXA 1XJAA 2A61A 5SV8A 1DQ0A 2HWE2 2PHDA 5J3UA 2PXJA 1OSGA 1NK3P 2CUEA 4B4QA 4GALA 3BR1A 4LBKA 3OL4A 4RAFA 1ZREA 3ZN6B 3LFUA 4OIOF 4C3HJ 1ZZCA 1G4DA 4IEXA 2K27A 5EWSA 5A32B 1OLRA 3LA3A 4WM7A 2Z5WA 1RNLA 1TNSA 4GA9A 3TW7A 2AHQA 3ZXGA 3GX4X 2DYCA 1AXYA 1HKTA 2CAUA 2YY1A 5FP9A 4FI9A 2JVHA 2XVKA 4E7SA 3WINE 3IP4B 1O7FA 4WM8A 4EJVA 1OXCA 3SKVA 3H3ZA 2JB8A 5FFZA 3PLQA 3ZQQA 5FJKA 1Z1DA 3WLUA 2IEKA 4XF3A 3LSGA 4OIRF 1ZQ3P 1VAMA 2NM1A 4XLPF 4Z2YA 4NIGA 2RG4A 2OKXA 2VMHA 1F1ZA 4CDQB 1WJDA 2R5YA 5FYMA 4A0XA 3LDBA 5IYYA 4IW3A 3PL8A 2LUWA 3W6KB 3T30A 1DYOA 3HIFA 2CH0A 4LBQB 5DAWA 1NG0A 2DVFA 4K8RB 2L7FP 2XF7A 1ULOA 3VL8A 5F32A 3AKSA 2ZJRF 2JA2A 4DW6A 4IXAA 1YQCA 3S1RJ 4NPLA 2FMYA 3I58A 4FPCA 4B29A 5BNPB 4EWDA 3LQRA 2DMUA 2DCYA 2HBTA 3OY8B 4OAZA 1TME2 1DGRN 3T3YA 2UUZA 4HEA2 1JT0A 4XBQA 1BVP1 1SBEA 1G2HA 2M2EA 2GN7A 2DOEA 5A6YA 3HC7A 2EILH 3EETA 2J5OA 1WA6X 4M4PA 1V54H 1NXD1 1HDDC 1LJ7A 4DGWB 4GH4B 2V9PA 3DYOA 4H14A 1N77A 5FO8B 5JPNB 4KITB 1Z6TA 4HQMA 3GNEA 3H1MA 1NXMA 3TW6A 5BPXA 3CF5F 2P8TA 4QM8A 5HDKA 1HV1A 3D82A 5FO5A 2ZACA 1LFPA 3KD4A 4QB6A 4Y1VA 5C9AA 1AA7A 4AWXB 1LQ1A 3B69A 4X6AJ 2DVDA 4FVVA 4XICA 5A3PA 3A1YA 2KZGA 2A6YA 1OLME 1EV13 1Q1HA 5GALA 4JK1X 3TRSB 1AXZA 2K2SA 5AC91 4MEXF 1UG0A 4A0YA 2E7WA 5M0TA 4W6XA 2L9VA 5T52A 2XVCA 3CDLA 1X9PA 1BJAA 3POGA 2ZPXA 1FBUA 2V73A 3GLXA 4RLQA 3K7AJ 1UU5A 3IB3A 3LFKA 3M8LA 3PIOF 2A75A 1LHUA 4MFDA 1SFEA 5EJ1B 2W39A 2VECA 3GBWA 3INAA 4AYUA 1OCOH 1ZZ7A 2SBAA 5J4VA 2K7LA 4CEYA 2QQ9A 2E2JJ 1PK6A 1ULGA 4XLHA 3FMGA 3DEWA 5LY2A 4GMP0 2L5QA 3IH2A 3SFZA 1RJ8A 2HJIA 5G05L 4N43A 3SH4A 4BQYA 3L2QA 4UW6A 2ZABA 1Y4WA 4XFGA 2BBYA 2Y64A 3GZTB 3W21A 2R041 1QHHD 1UIJA 4NOTA 3HJRA 4PF5A 3PFIA 2I74A 4BB3A 3A22A 5E1WA 3FWEA 2ZMEC 1JOPA 1WI3A 2M9HA 5FLIA 2HZDA 2LSOA 2FJ1A 3JD73 5DM7F 1XPWA 4MGQA 1I6HJ 1ND3C 4QAWA 2ZGRA 3J81Z 4RLFA 4A4AA 1S29A 4Y7NJ 2ME0A 3NAUA 1WCUA 2RS51 1BBT1 2BVLA 1AF9A 1PHMA 2WNUB 1O3TA 1DDLA 1NQDA 4COZA 5CU1A 3DGTA 1XG1A 2O8XA 3L2HA 4L9JA 4ARXA 1WLDA 2DF7A 2ECCA 2STWA 2YX7A 1HRI3 2CQXA 1QMJA 4KICA 2ZC2A 2OIIA 2XAHA 4IEJA 5K0UB 2QQUA 4FXKB 1RHI1 3CDZB 2X10A 5IWFA 3H1CA 1YLLA 3AKQA 1RVF1 4AI0A 4XTMA 4EE2A 1S0GA 4QHBA 1AOYA 3WG1A 4Q5OA 1EV11 4XETA 1RUG2 5ACA2 3VD3A 4I7HA 4NO4A 1ULYA 1IKQA 3AXDA 3I4PA 3OYFA 3A0BC 2W46A 1PUFB 2QQIA 3QD6A 5CVIA 4PDKA 2H6CA 5GP9A 2DLLA 4I6ZA 5FUNA 1WD4A 3CTAA 1JZ7A 4ZKTB 5JI7A 2JMWA 2KT0A 3PVNA 5DDJ3 2DTZA 4CYCB 2PBIA 2D5HA 2Z33A 5C8CB 4HG6B 2DU0A 1DQ1A 2VUJA 2WABA 1POV3 1XN7A 3DTKA 4BBSJ 4QQHA 4W65A 3RQ0A 3WP4A 2LREA 1EH6A 1R64A 4IEVA 3WXPA 1K45A 3TN91 4FOVA 3MKWB 1RKWA 1QXRA 3VDDB 2J1VA 1FNNA 1R22A 2ZZJA 1OA3A 5ICEA 2JX9A 2ADUA 1XTAA 5FGMA 3DV8A 4A6DA 1E0EA 2Q8OA 5AIQA 2CFOA 4Y26A 3AYDA 3PUQA 3LSEA 1E5HA 3RMXA 4BOWA 2DN0A 3JRAA 3H0DA 3KVAA 3T8TA 2JJ7A 4ZDPA 3V4GA 3M07A 5LHIA 1DQ5A 1CPNA 5F8PA 4FFHA 1PP8F 1CAVA 4HL0A 3OJBA 3WGGA 3VBHC 2LTPA 1WJCA 1YJ9I 1T2XA 1YJKA 3WE3A 3FXKA 1S0BA 1QHGA 4JV4A 3SZPA 4K1YA 4Z07A 1BJQA 1FLIA 1IPSA 3A02A 3L09A 4RGXA 2UV1A 2Z99A 4QPIB 5BNNC 1VBB3 4LIVA 3EYPA 2DMPA 5FLXK 4SBVA 2PG4A 4FSJA 2AC1A 4IOAF 1YITI 3JD71 4HAMA 3HN1A 3IKTA 1ONAA 4ASKA 5JI6A 4NN0A 3BZCA 1IN5A 3BCBA 2OBPA 1VRH2 4PT6A 1Q56A 3EMRA 1Y9MA 4LHLA 3UKTA 1LUJB 4OMYA 3FK7A 2Q1FA 4WVZA 2IFWA 3J7ZI 1PX3A 4JQFA 1SLCA 5M5XJ 1GZ9A 4NC7A 2ZSHB 5GAEJ 4FQGA 5DMYA 1QJY3 1Y7BA 4QB1A 4M73A 3ACIA 3ZR8X 1IG3A 1HN1A 3KSCA 3PSFA 2W84A 3COAC 2DUPA 1B8IA 1FMD2 1XGSA 1E3PA 3M3YJ 1ZRFA 3IM0A 1V70A 2WAFA 5BV6A 5FQ0B 2K4JA 3CCVI 3IKWA 4AEJA 3OGRA 4P9JA 5JOXA 4XURA 1ZZ8A 3LPFA 2JIGA 3P7NA 3FXOA 4GULA 3JUUA 1OURA 3A0NA 1Q8VA 1XNDA 1DQ4A 2RREA 3OPTA 4A3XA 2EJRA 3NJXA 3POFA 4Q4Y3 1CONA 2GSYA 3L2VA 2EICA 1OLMA 2BHZA 2LS6A 4YW7A 2YU9J 1RUF1 2PN6A 4QDQA 3LSIA 4RBOA 5F7UA 5C3QA 3DP7A 1Q8PA 2ZOEB 1VBC3 1N1SA 1XCVA 1SFOJ 5A33A 1GBGA 1JMUB 1COV1 4MQVA 2VT2A 5JZGA 2LF8A 2QBYB 2IVMA 4Y5TA 2HQNA 3B6AA 2ZXIA 4C91A 4L99A 4HPQA 2YU1A 1LJ9A 3H3UA 4YFXF 4DPNA 2QBXA 2M7AA 4L0YB 2PMUA 5GLVA 1HV0A 5C3OA 1W3VA 3ZFFB 2YMZA 2Q8EA 3BDDA 2TEPA 4IEWA 1DU0A 4J6GA 2MEV1 3S5QA 1KFXL 1H9PA 5K0UA 2NS7A 3MAJA 5FMCA 1R1UA 2GALA 3GTLJ 4NMIA 5FXWA 2K9NA 5ANQA 3KV6A 2IW5A 5CQEA 1RKTA 1W9YA 1OUSA 2DFCA 1T33A 4LXLA 1MDMB 2ZMEA 1GVJA 1B35B 1UAIA 3LIHA 1UYZA 1IRXA 3WU0A 1WSUA 3RPQA 4K3UA 2VOWA 3D4KA 3MPPG 3OBZA 4L2NA 2X05A 3CCSI 2WNVB 4RS5B 3AC0A 5IK7A 2VLAA 2DTWA 4KI5M 5FRAA 2BBAA 3Q0WA 1SQ4A 3EUKL 4PJLA 4I98B 3BODA 1OYYA 1RUH1 4MXWB 5DCMA 4IV3A 4UVAA 1FOD3 2MC3A 1S0DA 2ARCA 4ORFA 1SCSA 2CSGA 2R0FA 2BTVC 5KNLA 3I49A 1ZGJA 1CGPA 5FMOL 3MN2A 2CV2A 4V2FA 2B45X 3S3OA 5FZMA 1LRHA 1JTYA 2O14A 4S05A 1WJFA 1ZZBA 2HWC1 3LE0A 2PHFA 1RIOH 4FFIA 4LKEA 3AZVA 1B35C 1OCPA 4E7JA 3BWGA 5J47A 1E3OC 1DYKA 3CL1A 5HCFA 4A3FJ 2XROA 1OVPA 4PFOA 4Y22A 3UK9A 5C4WC 4H7MA 1JUPA 2UXXA 1JZ8A 1PIV3 5AIPA 4B4RA 2N8GA 2QM3A 4Q5SF 2B42B 4L5JA 1ND2C 1RHI2 3LAPA 2KLOA 2LY2A 4WV8A 1W39A 3HYIA 1VBA2 3PIJA 4ASLA 3BALA 2L9SA 2MYSA 3PJRA 5DUWA 3D6EA 3AG4H 5FY0A 4ZU7A 2F5VA 2XONA 4PHZA 1XD7A 4XABA 1AR91 4FPJA 3ZYHA 4LE4A 3I5UA 2WFF2 3HOWJ 2WV1A 2R1BA 1LULA 5L19A 4DRRA 3KP5A 5ANNA 2QUFA 3AJZA 1N3OA 2JKXA 1ZR4A 1CAVB 2JB4A 3NW4A 4CHUA 2VOOA 1HQCA 2JVGA 3DPRA 3VD7A 4U7BA 5F1JA 3BTZA 1H8TC 4KT6A 5C3PA 3VKMA 3I2GA 5H9RA 1ZGWA 2IS6A 3OYNA 3RKYA 3IHUA 4RM3A 3F8BA 1KJLA 1R092 1VMHA 1OKRA 1JOBA 2ZEXA 3WDTA 1C3HA 2HEYF 3HSEA 3ACLA 4Q26A 4ZONA 1KQ0A 2R4GA 2H8WA 3BJOA 2JSCA 5J36A 2QQPA 4GKYA 2X53S 1RUF3 5E18F 2R7FA 1XB4A 3MZ8A 4LUMA 1EF4A 2LOOA 2RV9A 4R79A 3Q8BA 3I3BA 3MUZ1 1VRH3 5CFCC 1QGPA 2VW1A 4S2GA 1YNAA 2A6HF 1Z05A 3OV8A 1AR92 3M8FA 4L9VA 4RS5A 3E6DA 4JQTA 3GTPJ 3ZDSA 4HA8A 4XIKA 3J7MA 1VF9A 2XPVA 2P34A 4AEDC 2X8KA 1QA6A 3NAPB 5FYYA 3I2HA 3Q8AA 1SFPA 4W4ZA 2DPUA 2ZHMA 1SACA 5AC92 2H94A 3HRSA 2VC9A 4JRLA 4XFFA 1O6UA 4XEZA 1W3XA 4KN7X 1S7AA 3WGHA 1TQMA 1AHDP 2BXZA 3AFHA 3OSGA 5F3EA 3NQHA 4NWVA 3OSFA 4A5MA 1W36D 5FJ8J 4XXPA 5KXEA 2VCBA 5LY1A 4E2GA 1RB8G 2P3YA 4XLCA 2E1NA 1Q3EA 4KMQA 4YM2A 5J09A 1TE1B 2F4OB 5KXBA 1HKSA 3LSMA 2QSGX 5FZDA 1GUUA 1S2BA 1W9WA 4MLOA 1B1BA 3OPZA 4BA6A 3CCEI 3OD4A 1VPHA 1XQNA 5BUVA 1OVSA 4QKDA 1HB4A 3M3IA 5FLHA 2R7VA 3R4UA 1H2MA 4RGKA 4MTEA 2LP0A 1CWPA 1MBKA 2WJSA 2L2OA 4HVRA 1W0TA 4AEKA 2C9KA 4IGPA 1BK1A 4I0BA 4UI9L 4ITCA 1EPWA 4AVSA 5LA1A 2FBKA 4EROA 2A68F 3RI8A 3ASNH 3VDDC 1FBSA 3HOBA 3N7KA 2OS2A 3HOYJ 4UBGA 2VMIA 3AL0C 4OOIA 2D3SA