3RYRA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ryrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ryrA01
4IHSA 5DEQA 2XUBA 2YX7A 4KUMA 5HS9A 4JVAA 4GYGA 1YG2A 5ICGA 2EFPA 3FJSA 3KSCA 2M30A 4LGWA 4PGHA 1PP7U 1ZZ9A 2VOOA 3ZMDA 3GLXA 2K27A 1X8MA 4N9HA 3I53A 5EEGA 4HV5A 3E97A 1QBJA 1R5GA 2M5WA 1BI2A 4A0ZA 2ZMEA 4I2OA 1GHCA 5D1IA 1XMAA 2PHDA 2F5FA 1ZZ7A 4QXKA 2ET1A 1V70A 3S7EA 2F5CA 3FHZA 1UIKA 3EYIA 3GYHX 4H7LA 2KIMA 4EJTA 4IPAA 2VODA 5D5WB 1DP7P 2HWVA 4LG0A 3M70A 3JW4A 2FSWA 1VJ2A 1MJ9A 3C1DA 1CAUA 5FLIA 2COMA 1GQGA 3LWFA 2M45A 1YIOA 2XAJA 2MA3A 5HDGA 2IXCA 5L3CA 1IRFA 3ETQA 1YS7A 3MZYA 3KFWX 1YW8A 1ZREA 2EV6A 4IXAA 1IN8A 3GBFA 1C0WA 1XE8A 3IRQA 3GFIA 1V3FA 3P9KA 1X7NA 1ZZCA 3HTUA 3KP2A 5D5XB 3TO6A 4ENKA 4NB5A 3G73A 5EFUA 2JT1A 5BOXA 5H6QA 3EO6A 2WTEA 5H6RA 2PBIA 1ZZ6A 1U5TC 3R0AA 3BDDA 4P9UA 3TDZC 3T5XA 5D4SA 2P17A 1IN4A 3PLQA 3QOPA 1WSUA 1B1BA 3MEXA 3U9GA 3W6KB 3QP6A 2P6TA 4PCQA 3TO7A 1KU2A 1MJBA 3HT1A 1W7PA 1XB4A 3IWFA 4MGKE 4EJUA 4A5NA 4L11A 3FZVA 2P6SA 5I0TA 4KIGA 3SCGA 1SAXA 4ORFA 4PJYA 4HAMA 1MKMA 3BB6A 2KXLA 4OIQF 2OA4A 3ZPLA 3HT2A 4M72A 2R3SA 1BN5A 3HSEA 2FXAA 1NE6A 1ZZBA 1TQMA 4M6YA 4L0ZB 3LA2A 3MCZA 1L0OC 2GIVA 2IXIA 2PAMA 1SFXA 2IA1A 3H3ZA 1XSVA 4U7DA 4BYYA 4KA4A 1F4KA 4A0YA 4M6XA 2MBFA 5LLQA 2ET7A 3H3UA 5DCFA 3KZYA 1ZNPA 4JQFA 4BIFA 2VBXA 3GFJA 4RB1A 1RZ4A 1NE4A 4D0PA 5DD8A 3QP5A 1GQHA 5JVTA 1P4WA 4HMZA 2IXHA 1ON2A 4OIRF 1K78A 1SQ4A 4JV4A 3E6DA 1K79A 2LF7A 4M71A 2B5HA 1XDUA 2H94A 3JZVA 1LDKB 5LEJA 3RPQA 2DQRA 2VECA 2A69F 3TNPB 5K1YA 4G6QA 3LZZA 2Q0AA 2HS5A 1HKQA 3IC7A 2XAGA 3UKTA 3ZN1A 1R1VA 4BH9A 5JAXA 2XASA 2P7VB 2P5VA 2OQGA 1KYZA 1IW7F 1MDMB 2EJRA 2MH9A 1REPC 1O7LA 2Z5UA 1ZLKA 1PUEE 4MHGA 5D4RA 1UB9A 1CAWB 1VTNC 3E5UA 3F72A 3N97A 2EVXA 4ETSA 2VT2A 1E2XA 1J2XA 3F8BA 3RI4A 1QY4A 1IN5A 1KYWA 4YIIA 1UPIA 4B09A 4MQVA 3U11A 4G94A 2Y0MA 1JE8A 3K2ZA 1RNLA 2C0ZA 1S3JA 6PAXA 3M3IA 3ZP5A 2XIGA 3KP4A 3R61A 4G8XA 2XLFA 3WODF 1STZA 4Q0PA 4LB5A 1Q5OA 4BAYA 1Y9QA 2DCTA 2ESNA 3EHKA 4CDGA 4MH0E 3GX4X 1FXZA 3I0TA 3EBRA 3WTSC 1R58A 2ISYA 2QWWA 4P55A 1Q1HA 2GH2A 3MFKA 1K7AA 4E2QA 4L9NA 2EV5A 1JHFA 3EUHA 1DUXC 4XFCA 1USSA 4UNOA 2UWMA 5KVRA 4GXOA 2IC1A 3HSRA 1QQIA 3ES1A 1BBYA 5ICEA 4KYWA 1SD6A 3JTHA 4HLTA 3LFKA 5FO5A 4NVPA 1WI9A 1ZHFA 1IXSB 4U0YA 2FBKA 4LK1F 4M9ZA 2K9ZA 4QGNA 2Z33A 1YS6A 1O7FA 3OOPA 1AWCA 2PQQA 1MJAA 2ETHA 5L3GA 2UY8A 1U8RA 3SXWA 3FMSA 2JPBA 3L2CA 4WXDA 2A6EF 2IXLA 1WKMA 4MGYE 3GXOA 1KU9A 4LTAA 1LVAA 3ROUA 4IEQA 3OTFA 3WTZA 3ZN0A 4A0XA 2DPUA 3NKTA 4WVZA 4EJOA 4CICA 3TO9A 5I0RA 2FQ3A 1S7OA 1B9NA 2NNNA 1R36A 2CAUA 3BCWA 4FHTA 5ILUA 2ZKLA 1J9IA 4KN7X 4LLLA 5HLHA 3WW4A 3MQ0A 5FDBA 4ONUA 2BBYA 1IXCA 1OR7A 1QNTA 3Q5FA 5I8YA 2QENA 2J5OA 5BQTA 2V09A 3FX3A 1YW7A 4G7HF 1G6NA 3WW3A 4A6EA 3GUDA 4HN1A 1PMIA 1ZRFA 4KWJA 2XL9A 4ON0A 1RUNA 5FCCA 1EH6A 1XGSA 3COAC 2M8EA 1HW5A 1J5YA 2FMYA 1TQIA 1FPQA 1IXRC 4L9VA 4M73A 3QACA 5ILSA 4QLCU 3RIRA 4LK0F 4Q47A 1HQCA 2IT0A 1OPCA 4XFAA 5C8WA 3R0JA 3JAMK 2BV6A 2V1DA 4O9EA 3E3VA 5LHHA 1XD7A 5DUKA 3HSFA 2HQRA 1BOAA 4QWQA 2H0VA 4Y13A 4OINF 1KQ8A 3ZMSA 1FYMA 1ULYA 4RB3C 5HVQC 4UXAA 2E9QA 4DNCA 4U0WA 3AAFA 4EGZA 2J5PA 2PMHA 3KP7A 4L5IA 2P4WA 4PDKA 3HRUA 3I58A 3ACLA 4QGMA 4AIHA 2D2WA 1TTYA 4HX8A 4HV6A 1QXJA 3CUQA 4YFNF 1S29A 1T0FA 3BZ6A 4WZCA 1F9NA 2ATFA 4RGSA 1RUOA 3VOEA 4CO8A 4F7ZA 3Q9SA 5FD5A 3KMHA 4HW0A 3U0ZA 4UVAA 4RAYA 2L02A 2ZCWA 3BJOA 4IEXA 2Y0OA 2DK8A 4HF0A 1OI6A 4YG2F 3C7JA 3QU6A 2AS5F 1O5UA 2Z9OA 1U5TB 2H09A 1Z6RA 4KIBA 1ZAOA 4UUVA 4AXOA 3SZPA 5ICCA 3V7CA 2GXGA 2YSRA 2W84A 3GW2A 1BC8C 3LAJA 3NVCA 2EA7A 5BMZA 3GVAA 1ZRRA 1V4RA 3TQNA 4XEZA 4Q4ZF 4I02A 4JBAA 2MNGA 1X8EA 4L2NA 2EB7A 2HFHA 5BPIA 4E2SA 5CU1A 3DN7A 3NJZA 4QM9A 1U2WA 3BPVA 3L09A 2RVCA 2XVCA 1ZH5A 2ADUA 1P6RA 2CSOA 5E1ZB 4A12A 4LULA 4MZUA 5J7MA 4L9JA 2YPRA 2RKHA 4MGIE 4AQ2A 4KMUX 3BJ6A 1LEAA 2VONA 2CAVA 2V79A 1Z05A 3DKWA 1FBUA 3LSTA 4YFXF 3O2PE 2Q8KA 3H50A 4L5JA 4Y15A 3ZMVA 3PFIA 1XGOA 3I59A 3J81Z 1TW2A 2OA2A 5JSPA 3BY6A 4AVBA 2GC3A 3HHGA 1RGSA 2Z69A 3LAGA 2BNMA 5FLHA 3L2HA 3F6OA 2UY9A 3WGHA 2Z99A 4M9XA 1EY2A 5LGUA 3I5UA 4HQMA 3CLOA 3Q9VA 4LB6B 5K5RA 2PI0A 3IHUA 5HS8A 4WX9A 1UCRA 2KRFA 3LQRA 1FZPB 4IESA 1G3WA 5T3NA 4GCVA 2DAOA 4PGGA 1CX4A 4ENMA 2IXKA 3UKNA 2YX4A 3R60A 1BI0A 5J48A 1QGPA 5FFXA 2BNNA 2DLLA 5E16A 4Q48A 3V8JA 2RGVA 1H9TA 3HRSA 1ZG5A 1FY7A 2UYBA 4X6RB 2E7WA 4XFIA 4BQAA 2ZKZA 3ZQ7A 2IW5A 4WF2A 4YARA 1CAXB 1LDDA 1XN7A 2JPCA 5ERIA 5D8KB 1SFNA 3CLPA 1WA4A 3PNAA 3M8EA 3W6JB 2KIUA 1S7AA 1RL3A 5KHHA 4P9FA 4Q5SF 4S05A 2PAEA 4HVQA 1CGPA 4HX4A 3CEWA 1XCBA 4AIKA 2UXNA 3WE2A 3E6MA 3FXUA 2HYFA 3N4MA 4EV0A 1I1SA 1IRGA 3RNSA 2VE9A 2MLKA 4KU8A 1AOYA 2HOEA 4CZZA 5I8TA 1I5ZA 2BNOA 3H1MA 3V7RA 1BJAA 2WC2A 3PQKA 4U88A 5EEHA 3S0MA 4JK1X 1RI7A 4ZYHA 2K4JA 1EH7A 4HLXA 1QZZA 1FWZA 1IZ1A 1VP6A 1Z6TA 4AVAA 1Q43A 2N7GA 5JSRA 3KLOA 2BYVE 5J8FA 3CO6C 4HDUA 2XLGA 1KU7A 3V8LA 2XRNA 2O8XA 1LNWA 2R7FA 3T8RA 5KK1A 4IERA 3P7NA 2MC3A 4OOIA 3D82A 2L4MA 3ELNA 4UV9A 1O3RA 2KKOA 3KE2A 3D0JA 5HOOA 1O3SA 4G7ZF 3SZTA 1ON1A 1ZARA 2ESHA 1CF7B 1NXMA 5AVPA 2RV8A 5KHIA 2GXBA 1R22A 5LGNA 2P8TA 3V4GA 1T39A 1NHAA 4N9IA 3IL2A 3BJAA 3ZMTA 3DXJF 1MZBA 3K1MA 4NHJA 1W5TA 1ZYRF 3ISPA 4BXUA 4ZU7A 3RKYA 1L3JA 1GXQA 1D5VA 2YR2A 3TOBA 1ONVA 4HYEA 2V9VA 4RGRA 4XFHA 3K1NA 3LQQA 4HA8A 3RYPA 3WU0A 4DINB 4EJVA 3WGIA 1WLTA 1CAXA 1XE7A 4EMSA 2EFNA 3J81K 4P5OA 4UHTA 2FBIA 2DFIA 2B9UA 5CADA 2L01A 4XETA 3I4PA 2WV0A 4XFGA 1ZVFA 1J3RA 5I0SA 1J1LA 4GGGA 2DQLA 4YIFA 1IPJA 4K2EA 4MGZE 3NL1A 1SD7A 4P9GA 3ES4A 2VOPA 1YO5C 4G9YA 2A07F 3R4KA 2P7CB 2CWEA 2D1HA 1P4AA 1TQ5A 4AD9A 2AXLA 4LLGF 3HQXA 4FAHA 3MWMA 2XAHA 3T1BA 5CYVA 2OZ6A 2UYAA 3JAMZ 3FXQA 1BIBA 2RC4A 3VFZA 1OYWA 1ZRDA 4JTOA 4KN4X 3KP6A 3L9FA 4OU0A 3M7GA 5FGMA 4EJWA 1SEFA 3F3XA 1R1TA 2GC2A 4AVPA 3H8UA 2M1BA 4Q0VA 3E6BA 2G7UA 1XGMA 1ZN2A 2JZYA 2EFWA 1BIAA 4M9SA 5E20A 2V6CA 1FSEA 3LA7A 1U78A 2DK5A 3CJNA 4XF3A 2D93A 4ZH4F 4L18B 3IDBB 4HLYA 2HKOA 2FOKA 1UHMA 4HVOA 1IN6A 2HTJA 3EQLF 4XF4A 3CDHA 4EWAA 1YHFA 3DEUA 2FE3A 1CAVB 5AIQA 3BP8A 1QZYA 1MD0A 3VODA 4HOBA 1FYKA 2ZNYA 3MYXA 4RB0A 4ZZLA 2FA5A 2F2EA 4I0BA 3MPBA 3S7IA 2B0LA 3BPZA 3TDUC 1ZRCA 1Z1DA 2YU3A 5BUVA 3SMHA 3U2RA 3D5LA 3FM5A 3QPTA 1T2KA 2QYOA 1UIJA 2DU9A 3C3VA 4B8XA 3GFMA 2OPKA 2O03A 2CGPA 4RD7A 4HDVA 3ELKA 2XGXA 2O61A 1EP0A 1FNNA 4Q29A 4IRHA 3FXRA 2QM3A 2WFPA 2PA7A 4Q0UA 4XLNF 3IWZA 3ULQB 2OQRA 3ERED 3I7DA 5JR7B 4B29A 3BALA 2HKXA 4I09A 2K4BA 2E1NA 2QQAA 1YLFA 2DBBA 1K6OA 2PYTA 5JI6A 1R23A 1MDMA 1KA8A 1KU3A 2CFXA 2LF8A 4I01A 2RQPA 3WW1A 2KIFA 2ISZA 4LLNA 1ZX5A 1CAWA 3F6VA 5FQ0B 5HDNA 3WTWC 2XL7A 2MHFA 1YW9A 3WGGA 1XMKA 4QGLA 4LUMA 3MAJA 2O1QA 2M87A 1LDJA 2W24A 2QBYB 3RYRA 3F8FA 4KMFA 1W4MA 2W57A 4KIFA 5HLIA 3S2WA 3R6SA 3UKVA 5F6FA 2HEOA 2A6HF 3CUOA 1NZCA 1USTA 3T8TA 2VQAA 1ZG1A 1OYIA 2FMLA 2DW4A 3EETA 2HQNA 5BV6A 4H0EA 2DI3A 4AVCA 2IXJA 1XGNA 2JSCA 1DPRA 2XLAA 3BWGA 3RKWA 4MTEA 4L0YB 2EA2A 5J8CA 3HOTA 3KETA 3PVBB 4G6DA 1G3TA 1J59A 2TDXA 1Y3TA 2ZBKA 4RB2C 4MNUA 2PAKA 2HJIA 2VPVA 5HI0A 2IP2A 4IEOA 3IIAA 1TBXA 3T0YA 3EYYA 4CGZA 1VR3A 2CG4A 2HR3A 3J80Z 5DD4A 1RC6A 2ZNZA 3FF5A 1HSJA 5JFRA 3VEPA 1I6XA 3HIFA 4XF1A 1DGWA 1MGTA 2G7HA 4PIXA 3KP5A 3ML6A 1PM7A 4S04A 5DCMB 4A6DA 4KDPA 2BGCA 3SHRA 4META 3HTSB 5HLGA 4UV8A 1SD4A 2FEZA 2PQ8A 1T38A 5D8LB 4ZU5A 1SD5A 3FWEA 2FRHA 3TNQA 2EK5A 5DYMA 1ZLJA 4RGUA 1YUDA 1JHHA 2O8QA 4J1XA 1B6AA 4EGYA 5E17F 3O6BB 4WXCA 4Z2YA 2VBWA 1TLHB 1J3QA 4XBFA 2STWA 4KWKA 4IEYA 3CJXA 4HZFA 1Q3EA 1FBSA 2FF4A 2H27A 3DPLC 5ILVA 4IEPA 3PQJA 4IEVA 1LQ1A 4Q0SA 2O6GE 2PG4A 3FMQA 5I0UA 4EM0B 3QAHA 2QVOA 2PLYA 3F22A 1U12A 4UVCA 2P5KA 5ED4A 4PZJA 3HOSA 5KBFA 4MQ9F 2OZUA 2Q30A 4XFBA 4AIJA 2ZJ2A 4LJZF 2Y48A 1JXSA 1Z7UA 1H9GA 5D6FA 5D5UB 4MX3A 1IPKA 2RN7A 2NAZA 3KP3A 4CHUA 1YTYA 2K7LA 1D3YA 2QUFA 3H1YA 2L54A 4LG0B 2IA0A 4GO1A 4WBBA 1LR5A 1CAUB 4HF2A 1YFWA 1Z91A 4XLPF 3FZ3A 2K02A 5KHKA 5FD6A 1KQ0A 3CO7C 2OYZA 2K0GA 4MTDA 4TV7A 1O3TA 4KL1A 3CUQC 1UD1A 2XAQA 2X4HA 2EWNA 4O3MA 2VC1A 1FX7A 1HW2A 5CVVA 3ABTA 2IRFG 5BS6A 2IPQX 5J3UA 2VE8A 1DZRA 2ETEA 2DPDA 3QRFF 2D5FA 1HKTA 5BPXA 4ESFA 4XRFA 4LA3A 5TRDA 4BHBA 2VXZA 4XSZF 3BU7A 3DFGA 3BOQA 3E5QA 2STTA 5HDKA 2ELHA 2GA1A 3WTXC 5DV5A 1UHWA 1H1MA 1YFHA 3KCCA 4K8FA 3SXYA 2ACJA 4ASNA 3E6CC 1UCXA 3TOAA 3OD0A 1J0RA 2D1VA 1W7PB 1QXRA 1TW3A 4KT5C 2Q1ZB 2BEOA 3LOIA 4HBLA 3OCPA 3VHRA 4PIZA 1W5SA 5FPXA 3F8NA 1FI2A 1U5TA 4XSXF 3U10A 1OYYA 1ZZ8A 2LKPA 4WWCA 1ZG3A 3J80K 2PFWA 2UZKA 1J3PA 3I71A 1SFEA 1XCVA 3RPUA 2FBHA 2X0LA 1P4XA 3VB2A 1J58A 1FSHA 3LWCA 4ENJA 1FC3A 1LEBA 1DDNA 4HQEA 4UBGA 2Q2EA 2IA2A 1FLIA 4OMYA 4KICA 2ZFWA 4P96A 4IRIA 2B8MA 2FU4A 2HYGD 3REOA 4ESJA 2GZWA 2L4AA 3ZMUA 2EAAA 4YNIA 4HF1A 3DF8A 1K78B 1LB2A 1O3QA 3C18A 2A3SA 3OV8A 2QJVA 5LBQA 3USSA 1F1ZA 1TQPA 2DTRA 2QVSB 4CYDA 2VC0A 5DDGA 1W7PD 2LSOA 5FB2A 3ECHA 4E70A 2PN6A 3RKXA 4Z07A 4TLFA 4UVBA 3HRTA 2Z3YA 1JGSA 1I27A 5JSOA 1DPUA 5H20A 1IN7A 2V1XA 1HBXG 1DZTA 1ZGJA 3WG9A 3O3KA 2PEXA 4LD5A 1LKNA 4FX0A 4OMZA 3P9CA 3G3ZA 1B9MA 3WE3A 4KWLA 4O5VA 2NNYA 2LNBA 2I45A 3V8KA 3RTRA 4Z82A 3KGZA 1RTVA 1BM9A 1UW8A 4EM2A 2O0YA 4BNCA 5TJJA 1B4AA 1QO0D 3IKTA 4RAZA 4R79A 5J6XA 5LRSA 3KGLA 3I64A 3KEQA 5CLSA 4RGXA 3SFZA 1OMIA 2A5YB 3TKYA 2WWYA 2H6CA 3HUGA 4OLLA 1U6GA 4I98B 1WGPA 1LRHA 4MUVA 3GEZA 1T6SA 4ENNA 5FLXK 1IF1A 1B59A 1TNSA 1WWXA 5E8GA 2O3FA 4MEXF 2OBPA 4EROA 2W25A 3K1PA 3GWZA 2CV6A 3P9IA 2FNAA 4ZYGA 2VBZA 2GC0A 3ZDSA 2F5EA 4CXFA 2KJCA 1R00A 5F1RA 3F23A 1EPZA 2CYYA 5K8SA 1FBQA 3F8CA 3GO5A 1HXDA 5LHGA 1L3LA 5FLJA 3SCFA 4HX7A 5LRRA 4YSFA 2V1UA 2QQBA 4OIOF 2GQQA 4BHPA 2XKPA 4WK8F 2HTSA 1XDSA 2RDPA 3KZZA 4R8HA 2XAFA 5AIPA 5L3DA 3EJKA 4EWEA 1FP2A 1YYVA 3JTGA 1NYWA 4J1WA 3NW4A 5JR3A 4KNYA 2NYXA 3CTAA 1BC7C 1SMYF 4HSJA 3BROA 1O57A 2PMUA 5KHJA 1SMTA 2Y75A 4YRDA 1O4TA 2HGCA 1U3EM 1I1GA 2L3DA 4X6QB 1X82A 4HSLA 3ECOA 4MGRA 4D7TA 4QMAA 2ZXJA 4FT8A 2BE5F 5E1XA 3V7SA 5AONA 3RJPA 2F4PA 1XSXA 3M9AA 3NQOA 5K5QA 1IAWA 4XF0A 2F5DA 5CVRA 1Y0UA 3H92A 5CJ9A 2EFQA 3DQVC 2P5LC 1ODDA 3SQNA 2OU2A 2E7XA 3NEUA 1O5LA 4LA2A 3FM3A 2QLZA 1CF7A 2HZTA 3CL1A 1YLLA 3K69A 1BI3A 3WW2A 2A61A 2MH2A 2DT5A 3GYDA 4MV2A 3GF2A 5FFZA 2PTMA 2CO5A 3LA3A 1QPMA 3H9AA 4LMYA 5DUIA 3F21A 4AQ6A 3WTUC 1D8JA 3IRRA 4UXNA 5I93A 2QQ9A 4LUKA 5L3EA 4I3PA 4O9GA 2PJPA 1Z9CA 1TNTA 1FYLA 3M8FA 4PIYA 3F8MA 1S8NA 4OFGA 1GVJA 5E1WA 4KFCA 5LEKA 3SHFA 2OD5A 1EV7A 3B73A 3IBMA 1GXPA 4RS8A 2NRAC 4IJAA 2XV4S 5D5VB 2QDRA 4R52A 4IHTA 4A2UA 1S6LA 4M74A 2D5HA 2EA4A 3FMRA 4HBNA 2HDCA 1FP1D 3NRVA 2GU9A 5F64A 2JRTA 2G9WA 2PFBA 1IUYA 3DL3A 4GYIA 5CVUA 3IDCB 4ZZDA 2CQKA 4FAGA 4LFUA 3J7AO 3QPHA 3OF1A 1R5HA 4IRGA 1XRUA 2D45A 2JTVA 4ZYEA 1DGRA 4Q0QA 3ST7A 3L7WA 3BPXA 3WTVC 1J7KA 3H1WA 5A2QZ 4D7SA 3SCHA 4YYOA 5IT9Z 3WTTC 2GWRA 3RZZA 3NSTA 5JCTA 3CUQB 1P92A 2FQPA 5JHUA 1F5TA 2E1CA 2CW0F 5BXXA 3GFLA 1UFMA 3O14A 5C6CA 2XHKA 4U0VA 1FT9A 2XROA 5LHIA 3H7JA 1CAVA 1YQAA 1LJ9A 3D0SA 2DO7A 2H6BA 4HN0A 4IVNA 4R1HA 3ZMZA 1XSDA 1HSTA 5I91A 3M1EA 1OFNA 4FX4A 4NQWA 1G4DA 3RDIA 5BPDA 2EV0A 1E17A 4OIPF 4E2GA 1H0MA 3OGJA 2UXXA 3JSOA 2MPFA 4AWXB 1HKSA 4DQ2A 4IEUA 4ZYDA 1R1UA 3HRMA 3FFQA 2GA2A 3CF6E 4O6JA 2Q0OA 2GAUA 2XKOA 3HYIA 5E8IA 3L00A 4BHCA 3MZHA 4KU7A 4U7BA 1YFXA 2FNPA 1OD5A 1PP8F 3WTYC 5BY5A 4I0AA 2K86A 4F8AA 2QCSB 1PDNC 4UBHA 1EH8A 5IT3A 1YFUA 3JSPA 4L9TA 5FPZA 2PHLA 3ABUA 1BI1A 4EQQA 3WU1B 4LLOA 1RIOH 3I59B 3DV8A 5FQ0A 1WQ2A 3GZ5A 3KEOA 4YFKF 1X3UA 5L3FA 5LGTA 5K5OA 4XFFA 4JTNA 5KHGA 2VBYA 2QBYA 2KJBA 4IEWA 1G3YA 5ICFA 1A04A 3DP7A 5CVJA 5D6EA 3EDPA 1KGSA 5I8SA 2QZ8A 5HS7A 2C6YA 4XF9A 3QU3A 4A5MA 1T98A 3U1DA 4I7HA 1YFYA 2ZMEB 3GZ6A 4EVIA 3EQEA 3IKVA 2LDUA 4QX5A 2NS0A 4Y17A 4MEYF 3LAPA 3C3WA 1R7JA 1FOKA 1P2FA 2A68F 1J75A 2W85A 1OKRA 2MD5A 5E18F 3RYKA 1QWRA 1WRJA 4ZU4A 4WXHA 2Z2SB 1H1IA 3H7YA 2IVMA 2RNJA 2MLGA 4ESBA 4IETA 3DPTA 2OZJA 4IEZA 3MDPA 3HHHA 2IJLA 1D8KA 5FLXZ 2GC1A 3G7DA 3FE5A 2R7DA 1JUHA 2VN2A 5DCMA 5L3BA 3FHIB 5CVIA 4WCGA 3B02A 5EZWA 2ZO4A 2Q4SA 3KLNA 1YWKA 5A2QK 4HVRA 3K0LA 3E5XA 4G7OF 5IT9K 3I54A 1HW1A 1SFUA 3K9TA 4LEJA 4FBFA 1G3SA 4QM8A 2QNKA 2EFOA 1EYBA 3CO2A 4GULA 1KQ9A 2OAZA 1ZGAA 3TGNA 5E1RA 4IF4A 4EWDA 2D40A 2VT3A 4N0BA 4EM1A
chains in the Genus database with same CATH superfamily
5AC91 1N1TA 3CDIA 1JGGA 5TSWA 2GP3A 1PO21 4K1YA 4JVAA 5FROA 1PYVA 3AMNA 4PGHA 3KSCA 1ZZ9A 3O1RA 1W8NA 2VOOA 3S5QA 4YG6A 2X1EA 3TBDA 4HV5A 3FXLA 1R5GA 4I2OA 3WG3A 2Y6GA 3BGAA 1ZZ7A 4QHOA 2F5CA 4LBQD 3RFRA 3EYIA 5IK4A 2LS6A 2RS11 2WN3A 2HVSA 3KVAA 3PUFA 1KFXL 1OSGA 5FLIA 4ARXA 1QMJA 1GQGA 1LGNA 2BUKA 5KAIC 3WG4A 5HDGA 4RHV2 3ETQA 2V7FA 1UOFA 4DUXA 1TWCJ 5FFOC 3BTXA 1VALA 3LSKA 1AHDP 4QX0A 4DXZA 1VFCA 1IN8A 5IUQA 3K7AJ 3IRQA 4PUSA 1G2HA 3P9KA 5JXGA 1X7NA 3MVPA 1WW4A 1UYZA 4LBQA 1ZZCA 4Y1UA 3KP2A 5E3NA 1VBE2 5JXJA 2SBAA 1C8M1 1W0UA 5D5XB 3TW7A 1LOBA 3TO6A 3A2KA 5GPAA 4ENKA 2CU7A 1KS4A 1JS9A 1ZZ6A 1R1A1 4P9UA 1GMMA 1DGRM 1FMD2 3TDZC 2P17A 1UJ8A 1SCSA 2VNOA 3AVSA 1WSUA 3U9GA 3SQOA 4N7UA 4Y1XA 1IZ3A 4I99C 3A02A 2WADA 2F48A 3JD73 5B5EC 1LFBA 3IWFA 2H0BA 2QQ8A 2O14A 3M3YJ 1K5MB 1Z0HA 2FDGA 2VMGA 1SAXA 2WSVA 4ORFA 4PJYA 4G4FA 5C9AC 1GNHA 4II2A 3KYDB 2EZLA 4X1EA 1R9TJ 3PO2J 2UWCA 2FXAA 3ZXFA 1QJFA 2VQGA 5K0UA 4NHLA 1TQMA 1TMF3 5FY8A 4W1UA 3CCJI 2GIVA 2C24A 4UW3A 3H3ZA 4BIOA 4U7DA 3G1LA 3GTKJ 5FZMA 1F4KA 3WF0A 4XQ4A 3J7HA 3H3UA 1V0AA 5DCFA 5F5QA 3KZYA 4JQFA 3GFJA 5FBZA 3CZJA 1APNA 1RKWA 2XC7A 2BY1A 4PBPA 4D0PA 5FY0A 5DM6F 1QKQA 2IXHA 4OIRF 1K79A 4M71A 3DCQA 3O0XA 2H94A 4TWTA 5LEJA 3GALA 1EAH3 3RZOJ 2W7NA 3I97A 5CIRA 2LD5A 2A6YA 4S0HB 1UELB 4XAAA 3V64A 2YU2A 4BE1A 5FWJA 3ZN1A 5EJ3A 1HF0A 2CH0A 4KWUA 1A6QA 1D0GA 2BZTA 2P5VA 1WCDJ 4LIUA 1YEWA 5FY1A 1IW7F 2JE9A 2MH9A 3PL0A 3ZYIB 5F39A 4K40A 1ZLKA 3DF0A 5A7QA 2WSUA 3WSOA 1PGL1 3PFYA 2DFCA 4YEJA 3F72A 1I6HJ 5FZ3A 3SZGA 3N97A 2VT2A 1E2XA 1QY4A 3RI4A 2P2KA 5FOBB 2CRGA 4MQVA 4RM2A 1ETQA 1V55H 1JE8A 2VW1A 1RNLA 3K48A 3JRFA 1S3JA 3VYRB 4BM8A 5A7SA 2ZZJA 3VDXA 3M3IA 3AP7A 2NS7A 1PO12 4AI3A 4LB5A 2WQ8A 1Y9QA 1RXFA 2ESNA 3EHKA 2FZ2A 5JMOA 3GX4X 3EBRA 1ZA4A 3A0BC 4TSVA 3AM2A 2ZXQA 2QWWA 3OS2A 2ZGQA 4IV3C 5E3MA 5I0DA 1KITA 3I2GA 5JVVA 1S2BA 4L9NA 3EUHA 1QHDA 1YQ5A 1HRI3 4XXPA 3QODA 5DDJ1 2VZUA 4GXOA 2IC1A 3PO3J 4NE9A 4CP0A 1H0BA 4ZY9A 3K2OA 1ZM1A 5CFCC 5ICEA 1JBCA 4EE2A 1SD6A 5A7WA 1BEV1 5KXEA 2DXIA 1ZELA 3OSFA 3LFKA 4CCCA 2F4OB 5FO5A 4NVPA 4OUSA 2L7FP 4E4SA 2E33A 4QPQA 2BGPA 4DGWB 2ZABA 5FJKA 2F6CA 3LPFA 1DYPA 2J22A 5JUVA 1YS6A 1QPIA 4QPOA 1UX7A 2PQQA 5EGOB 1HN0A 3M4FA 4E9KA 4AVTA 2UY8A 4ZYAA 5J09A 2JENA 3SXWA 2BRTA 3FMSA 5K7PA 3L2CA 4MHUA 3O1MA 1AYM2 1NQDA 4WXDA 1DQ5A 4NPMA 2IXLA 1WKMA 3HBKA 1XTAA 2TBVA 4F93B 4CA0A 2R072 3NKTA 1VMHA 1GP4A 4LE4A 4A4AA 4FQ4A 3BCWA 3BZKA 4FHTA 1YIFA 4ZXEA 5FYVA 5C4XJ 4KN7X 3WW4A 5FDBA 4ONUA 2WZR3 1IXCA 1OR7A 5DG2A 5F32A 2CTVA 3LOBA 1SEUA 3NV2A 1SBDA 2QQJA 1WJCA 5FUIA 3ZQFA 2JG8A 1X4OA 1JYXA 4HN1A 1ZRFA 3VZLA 4BDYA 5GZCA 1JTXA 4WZFA 1O6UA 1RUNA 3AVRA 1XGSA 2W39A 1HW5A 4IE5A 3JREA 1AL0G 3DYMA 4H2AA 4K1ZA 3CCSI 4FFGA 4JGZC 3OY8A 5C8WA 4CEWC 3JRHA 4A7YA 3JAMK 4BZ4A 2DU1A 2W1UA 2VCCA 5LHHA 1XD7A 1BA5A 1BOAA 4QWQA 4GDFA 4PQ9A 4Y13A 3I4NJ 2DCZA 4NIDA 1ULYA 2R1DA 1UMIA 4XCAA 3WP6A 1A3KA 4XUTA 1GUIA 1HV1A 4U0WA 5GLZA 3KZIC 2EZIA 2VO5A 2KLOA 2J5PA 4P5HA 4RR3B 4LBJA 1SLCA 2PMHA 3M1CA 4XOPA 3JRBA 1JW6A 3GM8A 2DA7A 4PDKA 2ZHKA 3HRUA 3J7LA 3USUB 3PJRA 4HX8A 3SKJE 4A3GJ 5FZFA 5KC5A 4HV6A 2VCAA 1E3OC 4RGSA 3RG0A 1C5HA 3AKSA 2OVUA 3I3DA 2W3JA 2L02A 2ZCWA 3BJOA 4IEXA 4AI2A 4LKSA 4XKCA 2DK8A 3BG9A 1OI6A 4PDWC 5IYDJ 2H09A 1ZAOA 2VASA 1OLMA 3CJRB 2X05A 3NAPC 4AXOA 3V7CA 1CWPA 1M1EB 3VDDA 1ZQ3P 2NLRA 1QU0A 3ON7A 1H4HA 2JDMA 2Z42A 1OQEA 1R6RA 2VMHA 4EYUA 3I49A 5C44J 2EA7A 2E60A 4BQWA 4Q4ZF 4JBAA 4WM8C 1JYCA 2A71A 2HFHA 3DN7A 4YW7A 3BPVA 4A3EJ 5GLWA 5GLVA 4COVA 4BBSJ 4CCJA 2SLIA 4X6AJ 2VUMJ 1RPWA 3BR3A 1X3WB 1SPPA 3BJ6A 1ENXA 2R6QA 1OVSA 2CAVA 2YXSA 2TNFA 4FPOB 3MW4A 3LSTA 4QKDA 3GZEA 3O2PE 2Q8KA 4L5JA 4Y15A 3ZMVA 3WDYA 1NCQB 3I59A 2IGKA 4JDMA 4XNFA 5JSPA 4UB6C 1VQ5I 3PVNA 2M7AA 3DKXA 4RR3A 2K9QA 1CJDA 3F6OA 4FE7A 2UY9A 1V54H 5FAXA 2WFF2 2RDQA 3I5UA 4HQMA 3CLOA 3Q9VA 5J96B 3WZ1A 1W8FA 2XR4A 5HS8A 1UCRA 2KRFA 4NJ4A 1CPMA 5FLMJ 4AEMA 4LKDA 1VQLI 1SVOA 4HPKA 4D6QA 1TWAJ 5EV7A 2VQCA 2DVDA 2YX4A 4INDA 3ZDVA 1BI0A 5M3FJ 3NWKA 5FY5A 1WMXA 2ILMA 5FFXA 5FYHA 2GOMA 4UW5A 3VZJA 3ZR8X 2DLLA 4Q48A 3V8JA 3RSJA 1Z3XA 1C8M3 2WS92 4ES8A 1W6NB 2BDRA 1AR93 4QX8A 2ZKZA 4WF2A 1XN7A 2JPCA 5D8KB 1SFNA 1WA4A 3PNAA 4RGAA 1MQTA 3W6JB 2KIUA 3MKYB 1RL3A 3VV1A 4R9CA 3HL2A 4EATA 2QQMA 3OBRA 1W6OB 2H8WA 3J7YJ 5HCHA 3VBFA 2UXNA 3E6MA 5DTDA 4UAPA 3UGHA 3HEIA 2HYFA 2JK3A 2XJSA 4PSWA 1KFUL 1I1SA 2R30A 4IGOA 3RNSA 4Y5SA 3LSPA 1AOYA 3OGGA 2JECA 2V26A 3TN91 2DYSH 3UNPA 4RBOA 1X36A 4XQFA 3H1MA 1BYHA 2A05A 2WWUA 5EEHA 3ZFFA 3S0MA 3SLIA 3WNPA 1RI7A 1H2NA 3KT1A 4X0GA 3ZCOA 1IZ1A 5T5PA 4PJJA 3G6JB 2VKDA 3HN1A 4DIQA 3K2AA 4DMIA 2GSYA 4M0HA 2N7GA 4HDUA 2XLGA 1LAJA 3T8RA 3AG2H 2DURA 4XDOA 1UO9A 1DYOA 4XE9A 3FBIB 2Z5WA 1URXA 3GTMJ 1VBC3 1EV12 3D0JA 5HOOA 4G7ZF 3SZTA 1ON1A 4RDUA 4LIVA 1OVPA 1R22A 3C2UA 1YCIA 5LGNA 2QQVA 1VBB2 1T39A 1NHAA 1YQ2A 4FPCA 3DXJF 1G59A 3ZXLA 3FHAA 4NHJA 4UI9L 3HXLA 3MW2A 1W5TA 3ISPA 2KHMA 4CCNA 1GXQA 2XG3A 1IGNA 1O59A 4HYEA 4RGRA 4HA8A 1UAIA 3RYPA 2C6SA 2L2OA 3OYWA 2VC9A 4AM3A 3J81K 3CJTB 4NHMA 1ETVA 2FBIA 4C8DA 1K45A 2YROA 4AEDB 2DJNA 5I0SA 4GGGA 2KDZA 3HN3A 2JA6J 3J7AY 2IVIB 1X1AA 4G9YA 3PU3A 1K3IA 3R4KA 5IK5A 4XYXA 5K0UC 1P4AA 4F3QA 4AD9A 5LY1A 4LLGF 4J00A 4RGKA 5HV4A 4HONA 2I10A 1VF9A 3HD8B 2W94A 5B1BH 4ZTFA 3CQOA 5IHRA 2NYYA 1ZRDA 4JTOA 2PHFA 4WV8A 2HWB2 2BP6A 4OU0A 1FTZA 2HVQA 4ZTJA 1ETYA 1ULOA 4BJ6C 3H8UA 5BNOA 3E6BA 5CFDB 4KBBA 4PCRA 1XGMA 1ZN2A 1HCRA 2BWAA 2V6CA 3LA7A 5JOZA 2D93A 3PUSA 4ZH4F 1V6NA 2LFBA 4LT5A 3K51A 1VQ8I 1RMU3 3PUAA 4DXRA 2BVBA 2XXZA 2HTJA 5DDJ3 4XF4A 4EWAA 3DEUA 4IGPA 4CPBA 5AIQA 2WB1N 3BP8A 5F0FA 3K75B 4Z1VA 3BI3A 1FYUA 1S2KA 2F2EA 4I0BA 2WNVB 2B0LA 1ZRCA 2ZEZA 3U78A 2JN6A 2YU3A 4WVWA 3ZGKA 3LSGA 3U2RA 1V6MA 4Q4V3 1T2KA 3AZXA 2ZEWA 2OPKA 3U1KA 4RD7A 3ELKA 1JODA 5FYBA 2A5WA 2O61A 1EP0A 3UYJA 3BT9A 1I3AA 4Q29A 4IRHA 3FXRA 1FIAA 2PA7A 3OYDA 4ARYA 4XLNF 2FD5A 2OQRA 3ERED 3I7DA 5DABA 3DXTA 4B29A 3BALA 5FPUA 2L7MP 2E1NA 2EALA 1YLFA 1PM4A 5JI6A 1BJZA 4RQPA 1MDMA 3MLKA 3KYCB 1KA8A 3J7ZI 1KU3A 4NRPA 4G3YC 5JR2A 3ZSLA 4I01A 5JI7A 5F27A 3ZMOA 1YC61 5JOWA 5FQ0B 5HDNA 5B1AH 3KV6A 3DTIA 4Q4W1 1AR81 1GZCA 2M87A 5FZOB 2W24A 2QBYB 1BR2A 3EUHC 5DN2A 2M2EA 2W0XA 4LO7A 2ZGUA 1T95A 4MLOA 3VZKA 3ZSEA 5HLIA 1S2EA 3R6SA 4AYBN 1C4RA 1S5LC 1RUD1 3D3AA 1NZCA 2OIIA 3BOPA 1ZG1A 5JDBA 1OYIA 2FMLA 2HQNA 2WLPA 1VPHA 3JU9A 3DPUA 2XLAA 3BWGA 2VQHA 4A3BJ 5M5XJ 2GXAA 3GF6A 2EA2A 4G6DA 3ITQA 3OL4A 4QTRA 4Q8LA 1D0HA 1Y3TA 2PAKA 4RB2C 2MEV1 5GAHJ 2XPJA 4OUEA 3IIAA 1TBXA 1H89C 4COWA 4ZXKA 4CGZA 1UN1A 4B4RA 2HR3A 2LR8A 5K7HA 2JICA 4DYQA 3K4LA 4YVSB 3V0BB 5JFRA 1I6XA 2YC4A 4XF1A 3BUCA 4I6ZA 3VB9A 4Y7NJ 2WAQA 1YXWA 2BGCA 5C8CA 1JU3A 3HTSB 1M06G 1OR7C 5HLGA 1RUG3 1SD4A 2QQUA 4IOAF 2F6BA 2ZA9A 1SD5A 2G0EA 2W48A 3TNQA 2JG8C 2M4GA 3DBLB 3CP2A 3OPWA 5E17F 3O6BB 5IP6A 3PM1A 4GJYA 4UUTA 1Y0NA 3DPLC 4L97A 5C3PA 5BNGA 2BY0A 4PJ0C 1X50A 2WKKA 3LB9A 3AZYA 3BLYA 1FOD1 3K4KA 5E8AA 4LG3A 3FMQA 5I0UA 2VMDA 3KPHA 1BOBA 4XRMA 2QVOA 4HG6B 3SYTA 1OC1A 2RDSA 2XJUA 4XHXA 1AL23 2OZUA 1TC3C 2Q30A 2E1OA 2Y48A 1Z7UA 5D5UB 2A3XA 2NAZA 1FV3A 1RHI2 2K7LA 1D3YA 3LFUA 1QJU2 2LVSA 2XBO1 4WBBA 1IS5A 1VIWB 5IP7J 5FD6A 1KDMA 2HOSA 1W6MA 4FFHA 1JOJA 2XVKA 4MTDA 3MV01 4NC8A 1R64A 4B3XA 1O3TA 2XHNA 3CBNA 3OMYA 2DVFA 4PJMA 1BL0A 2XAQA 2X4HA 1MVQA 3JRCA 1IJWC 2XRLA 2HWC3 1RC9A 5CVVA 4N53B 5J3UA 2VE8A 1I9RA 4XKWA 2ETEA 4B48A 2DPDA 3QRFF 4LHSA 1SVLA 4LA3A 5H9SA 5LB6A 5CKTA 1W0TA 4BHBA 3PURA 3VDDC 2HBUA 4A6SA 5M3MJ 2CGNA 1KJRA 1IG7A 4P00B 3E5QA 2YFZA 2STTA 4GJZA 5LK7B 2GA1A 3ZFGB 4D69A 2X6WA 1UHWA 3NMBA 4ASNA 3E6CC 1UCXA 4HPQA 3OD0A 1ENHA 2CV2A 2IGOA 4KT5C 2MABA 1JHJA 2BEOA 4HBLA 5LASA 3VHRA 4PIZA 5FPXA 3MIGA 2BY2A 1U5TA 3O8GA 2ZHNA 1R71A 5H9RA 1TZOA 1OYYA 1ZZ8A 3J80K 3SISA 2LM3A 3H3LA 3DEMA 1BKZA 4PHZA 2HOTA 3K4MA 2E6VA 5FZ9A 1R5ID 2JSPA 1FSHA 1IHMA 1MS0A 1VRH3 4XRSA 1FC3A 1WCUA 1DDNA 1OCTC 4RR3C 4UBGA 3BTIA 1S0EA 3MIFA 2IA2A 1FLIA 1W36D 3AFGA 2ARXA 4KICA 3WUDA 4Q4Y3 1LOGA 2HWE1 2ZHLA 3REOA 1KZHA 4OMCA 2GZWA 4NAMA 4QB2A 5F5CA 3ZMUA 4F91B 2R49A 4YNIA 5A7NA 4HK9A 2QJVA 1VQ7I 3F2ZA 4LBMA 3TWIA 4HNUA 2DTRA 3W2WA 2VC0A 3BN6A 4FXGB 4E70A 4N53A 3I3QA 3RKXA 3RS6A 4TLFA 5F7UA 4UVBA 2ZHMA 3T1MA 1MS4A 1I27A 3WU2C 3KD4A 4Q4X3 3QCWA 5AFBA 5L9BA 4BUPA 4CRQA 3WG9A 3O3KA 3HQRA 4UFKA 2KM2A 1HDKA 2B45X 4OMZA 3ZFGA 3G3ZA 3VDAA 4FCAA 4KWLA 5HODA 5LATA 2R041 4UFHA 2LNBA 3I2FA 1VQOI 5DAQA 2XWBB 1R092 1RTVA 3OYCA 3RMYA 1BM9A 1UW8A 2RS33 4P02B 5TJJA 3VBFC 2VXJA 1XE0A 3KGLA 1UWWA 1W99A 1XYOA 5CLSA 1OMIA 4CCOA 2WWYA 1H2MA 2H6CA 3HUGA 4OLLA 4I98B 1LRHA 2GP5A 1I39A 1Z0XA 5FLXK 1IF1A 1FPN1 2VJIA 1S0DA 2BHZA 1NCQC 2WBMA 2GC0A 1GR3A 2ZGMA 2WO7A 1QJX1 2DA3A 2F5EA 4CXFA 2GNTA 3KT4A 3D1NI 1LKXA 4JGYB 1EPZA 2WAOA 1YJNI 3RZLA 1FBQA 3F8CA 5LHGA 4LO6B 4HX7A 1BK0A 4YSFA 1KXGA 1OOPB 1HC8A 4D8MA 3KZZA 3AL0B 4XDQA 2ZSHB 4GB32 3L1PA 5JR3A 3ZQHA 2HOAA 2BJSA 3JBG3 3CLQA 1SMYF 1O57A 2DJIA 2YC2A 2Y75A 2ID6A 3HJRA 5HNHA 1I1GA 4MG2A 3OG2A 2BTVC 3A22A 5T5JA 5CZKA 4FT8A 4BE3A 5AONA 2F4PA 2R7TA 2WN2A 3M9AA 3NQOA 2YPJA 1IAWA 3LPGA 4CUGA 2P3YA 4JHZA 1S72I 2WY7Q 1LHUA 1CR7A 2R062 2J1TA 4LA2A 1RUC2 3A21A 3O8HA 2VB6A 1BI3A 2DOEA 1S0JA 2H1LA 3GYDA 3GF2A 2PTMA 5FFZA 1WJBA 1UYYA 1QPMA 1H4GA 5DUIA 4XIOA 3F21A 4XJ8A 2Y31A 3WTUC 2HEVF 3SH5A 1D8JA 4UXNA 3MPPG 3I2DA 2L5QA 2QKLB 4N90A 2A3YA 3QH6A 3F8MA 1S8NA 2VKVA 2TRTA 4R9BA 1B72B 5E1WA 3IP4B 4O7XA 4PFPA 4E4ZA 2IXSA 1GV2A 1MR5A 2EIGA 1EV7A 4EN6B 3B73A 3PIGA 4IJAA 1PIV1 4C2MJ 1SZBA 3GCWA 2MFZA 5BNOC 4CDWA 4LBOA 4BK4A 4OULA 2JX9A 1WH7A 4A2UA 5K7ZA 2QQPA 4AGGA 3URFA 2DA4A 1SLAA 1G86A 1LE8B 1WVRA 2IAIA 2G9WA 3PUBA 1CD3G 5F8PA 1FNZA 4QKFA 4Q27A 4GYIA 3IDCB 3BG6A 4FAGA 3QPHA 4CCKA 2JTVA 4Q0QA 4RHV3 4XABA 1AXYA 2IS1A 4LHNA 5M5WJ 5A2QZ 4JRLA 3Q8CA 3WTTC 4P9JA 2RR11 3ZOBA 3GTGJ 5GALA 2W1SA 3RZZA 3L2WA 5JCTA 3CUQB 1QEXA 5JHUA 1AF9A 1VBE3 4AI0A 5HXVA 4Y3OA 1NA1A 4U0VA 3MKWB 4P1WA 1EUUA 2YUEA 1N78A 4WVVA 4XOTA 1CAVA 2Y60A 5TISC 1NY72 1XXNA 3D0SA 1SFPA 2DO7A 1FMD3 2H6BA 3UJOA 3ME2A 4HT1T 2IS2A 2IFRA 3N9QA 4N43B 1XSDA 3LCPA 2DCYA 1F15A 4XORA 4YW6A 2D6MA 1MS8A 1E17A 4I76A 1H0MA 3OGJA 5CKMA 3M1HA 2MPFA 1OXCA 4IE6A 3ESWB 1PGW2 5FZKA 4ZYDA 5EQUA 5JXHA 1NQJA 4O6JA 1VQPI 1XQNA 3L00A 2XF6A 2JDZA 1W8ZA 5ACA2 3HNYM 2LBFA 3IMMA 1PP8F 4OI4A 2GM4A 3WTYC 4AAXA 4C90A 2CV0A 2K86A 3KCYA 4F8AA 1MH4A 1YFUA 4M4PA 4XJ9A 2PHLA 1MBGA 1BI1A 1NK2P 4EQQA 5EG0A 2BHYA 2YBPA 3RZKA 4JTNA 5KHGA 1Y39A 2WJSA 4Q8KA 3NNLA 2DA5A 1G3YA 3DP7A 5D6EA 5LA0A 2QZ8A 2C6YA 2A3WA 1GZTA 1VRBA 2QQOA 1Y1VJ 3GZNB 1OISA 2CS3A 2R5ZB 2ARCA 1UOJA 3N7JA 5C71A 1YFYA 2ZMEB 4XQWA 4QX5A 3AZZA 3V56A 2QQKA 1UG0A 3GXUA 3HMYA 1DU3D 2VW0A 5C8CC 4TN7A 2K9SA 3IZOA 3O7OA 4LJHA 1R7JA 5FZ1A 2W85A 2VOXA 1D4M1 3B01A 2MD5A 5E18F 3RYKA 1QWRA 1WRJA 3OY9A 3H7YA 2R5YA 3VKLA 3DPTA 1LOEA 4Y1ZA 3HPHA 2GC1A 2VQUA 2R7DA 2K5CA 1JUHA 4BQQA 1HN1A 5JIAA 4RS5B 2OCEA 3FHIB 2HPIA 4MO3M 2X1CA 1VB4A 5EZWA 2ZO4A 2YGLA 2G4IA 4GD4A 1C3HA 3CJIB 1P7JA 3DWLE 1CZSA 5EYXA 2WNUB 3OYIA 2WZ8A 4QKNA 1HW1A 2JMWA 5E3OA 3ZPOA 2HWB1 2QNKA 1PO13 2EFOA 1EYBA 3CO2A 3THCA 5JMCA 1ZGAA 3TGNA 4E7LA 5E1RA 2HXIA 2VT3A 4EM1A 4IHSA 2DT6A 2XUBA 3VBHB 3CCLI 4FFFA 4IE4A 4AFDA 2UURA 5FZLA 1YG2A 3ZRGA 5ICGA 2GOXB 5EJ1B 3ASOH 1PP7U 5FYIA 4O65A 5KC6A 3ZMDA 2E36A 2K27A 3W5NA 4Z2WA 1XNBA 3E97A 2NVUB 1QBJA 3K3NA 1BI2A 4A0ZA 2ZMEA 2LY1A 4ZKTB 4QXKA 2ET1A 3S7EA 4N4OB 3I8TA 3FHZA 1S0GA 2LKXA 2XWJB 5IJRA 4IPAA 1VB2A 5D5WB 2HWF1 3LDKA 4LG0A 2X8KA 1VJ2A 4RYDA 4KG8A 2COMA 3LWFA 2M45A 2MA3A 4M0NA 5L3CA 4MXWA 2ZJPF 3UKGA 1RUE1 3PIOF 4AW7A 3KFWX 1YW8A 1ZREA 3ABLH 3RMXA 1AYM3 3FBMA 3WEZA 3NJYA 1OF4A 3LSEA 4H55A 2R073 2DUOA 3HTUA 5FZBA 2VZTA 1OA2A 4NB5A 2J1VA 3AZVA 3G73A 2ZAAA 5H6QA 3EO6A 2GIZA 1L7RA 5H6RA 1YJWI 2WNUA 5T54A 1U5TC 5J1UA 3WDUA 3TBIA 2R043 2RJ2A 2GBYA 3BDDA 4YW3A 3T5XA 1IN4A 3QOPA 2VNRA 3HR9A 1F43A 3MEXA 4OCTA 3BTZA 1ASJ2 3HOYJ 3VBOA 2P6TA 3Q8EA 2VZSA 2BERA 3V65A 3P3PA 5C4WB 5SV5A 1KU2A 3HT1A 4V2FA 4CCMA 3CESA 4QDQA 3HEFA 4P9IA 1DP0A 4L11A 4ZC3A 4OQ8A 2YS9A 1W2UA 2A7AA 4KIGA 2KPMA 4GWIA 5FXVA 2X10A 4XLFA 1SLIA 1C57A 3BB6A 5J1XA 5BNNB 5BYNA 1AUYA 2OA4A 5KHDA 3HT2A 2ICWG 4OVEA 1REDA 4A6OA 2EZHA 1REFA 3O0VA 3AYEA 2CWSA 1ZZBA 4DJAA 1XNKA 1VQ4I 2AEZA 4N53C 3V42A 1L0OC 2JE8A 4RL7A 3BG7A 5FUPA 3J8F2 1RUI1 1JZ2A 2NVTJ 2OTLI 1LHVA 1RVF1 4BIFA 2VBXA 2D7FA 2CQQA 1CZVA 5D8AB 3ZYHA 4RB1A 1U5YA 3OGVA 3CDLA 2KD7A 3ZFGC 3OSGA 1GQHA 5CQGA 3HBZA 1P4WA 4AF9A 1SQ4A 1WMDA 3MIBA 4LLFA 3M3EA 1YIPA 3JZVA 4XMYA 1MS9A 3RPQA 4C3JJ 3BR2A 2ZGLA 3VBRB 1W2NA 2VECA 4LNVA 1YI2I 3TNPB 4YW5A 2H8RA 5K1YA 4G6QA 2P6HA 1MNEA 5FWEA 4CCEA 1XC5A 1CQ9A 3THPA 4MOAA 1X1DA 1ZK8A 2XAGA 1ULDA 4NWWA 3VUOA 1R1VA 4BH9A 1T2XA 4COYA 5FK7A 5IYCJ 4CDXB 5GKAC 2VG9A 4G6TB 2XASA 2P7VB 3OD4A 4FPFA 2VZOA 2JRMA 1LJ7A 4UFMA 4XLCA 2Y64A 2GMEA 3TP3A 5A3WA 1PHMA 1ZKGA 2MG4A 1QNWA 2V9KA 1UKGA 4COZA 2KP6A 2DDUA 3JQWA 2BOIA 2Y38A 5D4RA 2CJJA 1OF3A 4M3CB 4AFAA 3MKLA 1J2XA 3VDCA 5C3OA 1BCXA 4A3MJ 1JUMA 1UPIA 2XAUA 3B5LB 3WVJA 3K2ZA 2VZRA 3QPSA 5DAVA 5AC92 1YHQI 2C0ZA 3G71I 4B4CA 6PAXA 3AMHA 3H36A 5IYBJ 3G2BA 3KP4A 3FBYA 1PO22 2XLFA 4Q0PA 1STZA 4GZ9A 4XM3A 4BAYA 2HWD1 3WV6A 4COUA 3CP8A 4FQGA 4PF1A 5F5AA 1GWMA 2BV4A 2P1BA 3I0TA 3Q0UA 3WTSC 5JHFA 4QWNA 1N1YA 1Q1HA 4AR2A 1MEC1 1DGWX 2GH2A 3MFKA 3IMNA 1RJ7A 4M6VA 1DGRN 1DUXC 2WFF3 4UNOA 2GN7A 3JCIA 2RS12 1RUF2 3KM5A 1E3PA 3B69A 3ES1A 2R7OA 5HPOA 3MFAA 3CKHA 3L2VA 2JD9A 2CL2A 1T6GC 1RUJ1 2JJ7A 1HLCA 1MPXA 4YZ2A 2VTXJ 4FOYA 3VL9A 4U0YA 1BBT1 1J1TA 2W82A 2EF6A 2W4SA 2K9ZA 2Z33A 3F9KA 1O7FA 1AWCA 2TCTA 2GNDA 3C7OA 2ETHA 5L3GA 2WS93 1C8M2 4GWJA 5LY2A 1U8RA 1XSQA 3JB8A 4DPNA 1IS3A 4JKMA 4CA9A 3C8XA 3UETA 4Z2AA 3AG4H 2F4MB 2ID4A 1R1A2 1AKHB 3NNMA 2ZXIA 4M3CA 4A0XA 1AXZA 2D44A 4WVZA 1ND3A 4AHYA 1FV2A 3PNTA 4LQRA 5I0RA 4BQOA 2FQ3A 1MBJA 4GMP3 4RN5A 4AWDA 2D97A 2R0FA 1CX1A 5ILUA 5HLHA 3FC0A 2EXJA 1QNTA 3Q5FA 1CIYA 2J5OA 3P5JA 5EZGA 5F2SA 1G6NA 4CUCA 2DV9A 2XJPA 1Z21A 1PMIA 5LBCA 2VR4A 5SV8A 2Y6LA 3COAC 1J5YA 3WNKA 3AP4A 3S3OA 5ILSA 5TGTA 3RIRA 4LK0F 5DAXA 4IL7A 2FHRA 4E4DX 2IT0A 2I5UA 3SEEA 3ASIA 1OPCA 4W65A 4PJNA 1HA8A 5A7OA 1LHWA 4IHYA 4JOMA 3VD3A 2XUMA 1EV13 1LFUP 2Z4FA 3IDAA 2HQRA 3FLPA 1MS3A 4ZZ5A 4RGGA 1NA1C 4YGCA 2BBVA 1FYMA 2FDFA 4GKXA 1VBB3 4UXAA 4MHRA 1Z7S1 3MFCA 5FO8B 3WQ1A 3DPRA 3AAFA 4B3AA 1TWHJ 5FMCA 4BEHB 3INAA 3ACLA 4DEVA 1AR61 4QGMA 2ZXWH 2D2WA 3IN9A 1QXJA 3IAQA 4YFNF 1QDOA 4ZDOA 1T0FA 2R7SA 4QX7A 1NK3P 3VOEA 4HW0A 3N05A 4UVAA 1V5FA 2Q1FA 2R16A 3LIHA 1UZZA 1IG3A 2B7EA 2ME6A 3J9SA 2AS5F 1O5UA 4YIRX 3BKZA 3CIHA 4BQNA 4YFZA 2IWGB 2PJRA 2O8OA 5ICCA 4NIAA 2XF5A 2HH9A 3HAGA 2ZGNA 2W84A 3OUIA 3LAJA 1MMDA 2AQFA 2AACA 4UFJA 5BMZA 4AFCA 3TQNA 4QQPA 4I02A 2MNGA 5C3RA 2AZ5A 1LODA 5BPIA 1VQKI 5CU1A 2HWB3 1U2WA 2CV1A 1WZXA 5E1ZB 4A12A 3DTEA 4Y33A 4I3GA 4YRVA 4MZUA 5J7MA 5FMBA 3W20A 1NG0A 5C9AB 2RS51 4KMUX 4AQ2A 3DU6A 5EYYA 2WQ4A 1FBUA 3R4SA 2M9HA 2XQRA 2Y34A 2NOJB 3GLLA 3J81Z 1HXS1 1SBEA 5DDJ2 2OA2A 4AVBA 2Y69H 5DZGA 4C91A 4N43C 1CESA 2VBBA 2Z69A 1BEV2 4XW3A 3L2HA 2Z99A 4M9XA 1OCCH 1EY2A 3WT3A 3CMGA 3RPUD 4YM3A 1FZPB 2O9LA 4IESA 1PNGA 4GCVA 1LUJB 1CX4A 4FPGA 4ENMA 2YZ4A 1S0CA 2Q8EA 4BQ1A 4XKVA 1OLME 5F5IA 4E8CA 4D5FA 3I4IA 5FJHA 1S7EA 5GADJ 3N9PA 3K4ZA 3U1XA 2BNNA 3PUQA 4U2AA 1QHHD 4DEQA 3AL6A 1IV8A 2RGVA 2P5BA 3HPNA 4GIQA 1JXNA 2OX0A 2VCMA 3I2KA 3VHOA 4PK4A 1V5GA 4YARA 4GH4A 2N8GA 3CLPA 1AYN1 2P37A 4NO4A 5KHHA 4P9FA 4Q5SF 2VIXA 1CGPA 4CDQA 4A42A 3CF5F 5A32B 5FXZA 4AIKA 3S93A 5IVCA 5EEAA 3H8RA 3OIPA 4YWAA 3IPVB 2VE9A 2MLKA 2RMU1 4KU8A 4AQSA 5I8TA 2ZMEC 4FPKA 2F4IA 4CP1A 3S30A 4CXXA 2WC2A 3A01B 4U88A 1U5XA 1V9U1 3ZMNA 4ZYHA 1QZZA 1FWZA 3U37A 1Z6TA 4IV3B 4AVAA 4XLHA 5JSRA 3ECQA 1TL8A 4XPVA 5DUUA 1JT0A 1MBEA 2LC2A 5ISLA 2YB7A 4DZPA 2MC3A 3WDTA 3LEMA 2DOAA 3OPTA 3AL5A 1O3RA 5A6ZA 1RVF3 4RS5C 5CFCB 3WXPA 5M0TA 5J3LA 1VNDA 2ZTNA 1NXMA 4AQTA 3KCXA 1AR71 5FZEA 2ZSIB 4UY8I 1WLCA 1FOYA 2WNUC 2VVEA 3IL2A 2ZX3A 3BJAA 2L7KA 4ZPIA 5F04A 1MZBA 2ZX4A 5A33A 1US3A 2LK2A 1PGW1 4UF0A 2GMMA 1H8TA 2GLOA 5A3PA 4ZU7A 2EIJH 2YR2A 4IDZA 2V9VA 2RM21 2ZEXA 3VBOC 3WU0A 4DINB 2DA2A 1GNYA 4EMSA 3VBHC 4P5OA 4NR1A 2JWTA 4LBKA 4MYEA 3I4PA 4XFGA 1F4HA 4OI1A 4DYCA 1D1CA 2XSDC 1J1LA 1MACA 2DQLA 4YIFA 1MNMC 1HOMA 2XPVA 1W9TA 4BACA 1IPJA 3BC8A 4K2EA 3RJ2X 3ZQGA 3ZO0B 4MGZE 3NL1A 1SD7A 3ES4A 2J1UA 4YG0A 2D3SA 2LALA 1YO5C 1COV1 1X33A 2P7CB 1FJLA 1AX0A 1TQ5A 2FZ1A 4MFDA 3A01A 4FAHA 4G9SB 2L9LA 3T1BA 4Y22B 2OZ6A 1RHI3 3FXQA 5GAEJ 1VQMI 3VFZA 5LK5A 1OYWA 1QJU3 2MD0A 4JX0A 4K20A 5BNPB 4BISA 3KP6A 3M7GA 1SEFA 2HQ5A 2WA0A 1QJY1 5A1FA 4M3DA 1QQP1 1ORKA 4Q0VA 5FUNA 2AXTC 4CEWB 2ZOEB 2JZYA 1D0XA 3G6EI 1FSEA 3CJNA 4XF3A 4EN7B 4OI0A 4L18B 4HLYA 2HKOA 2FOKA 1G9FA 5FXXA 2EXHA 3KQRA 1BVVA 1IN6A 4BQXA 1N1VA 5E3LA 3JXSA 3LSHA 2IGMA 1MD0A 3AC0A 2ZNYA 2HNHA 3MYXA 4ZZLA 3JQXA 2FA5A 3S7IA 3PUHA 1MZ6A 3TDUC 5C4WC 3LEKA 1Z1DA 5BUVA 3CCUI 3QPTA 1UIJA 3C3VA 4B8XA 2O03A 3ATGA 5JI9A 2XGXA 3C7EA 4N4NB 2PMZN 5LA9A 2ELJA 4AGRA 5FRAA 2WFPA 3UNGC 1WWYA 2Q5TA 3PJQA 3IWZA 5A3UA 4PDWB 2CDOA 2HKXA 4I09A 2A6WA 2QQAA 4CP9A 1K6OA 3N9OA 5J37A 4XZPA 3NAPB 4AI1A 2WA4A 3FUOA 1WZ2A 4PSXA 3S16J 2CFXA 2LF8A 4AC0A 5EF6A 3AKPA 1YRNB 2RQPA 2A6XA 4LLNA 3GZAA 1OLQA 1CAWA 2XGDA 3FK7A 3CCVI 3F6VA 4WM8B 4R4ZA 2MHFA 1YW9A 3TN92 1XMKA 1UY3A 5F37A 1UU5A 1IG0A 3RYRA 4NRQA 4F52A 1W4MA 2W57A 2X9DA 3S2WA 5FY4A 1VAVA 3ZYPA 2M8GX 3UKVA 5F6FA 2HEOA 1YE9A 3H5AA 1VZ0A 3CUOA 2QGUA 4RMNA 3F0CA 4XK4A 2R7UA 4B43A 4UUSB 2DW4A 4WM7A 4H0EA 2JG9A 2JSCA 1XJAA 3WDWA 3RKWA 4MTEA 4L0YB 1JZ8A 5A80A 4QQOA 3I3EA 1G3TA 1J59A 2ZBKA 4MNUA 2R7QA 4Y4RA 3D4KA 5HI0A 5IVFA 4A3ZA 5FZHA 3EYYA 2ZGSA 2BOJA 1O8PA 3J80Z 1KGYA 1E57A 2ZNZA 3FF5A 2YV8A 4MGSA 2BFUL 1WI3A 3HIFA 1R093 1MSFC 1DGWA 5HV0A 1TP4A 1CJPA 2VTFA 1PUFA 1GT0C 4PIXA 1JUIA 3ML6A 5KNLA 1TG7A 1IS4A 4A6DA 4YPJA 2V4JC 4Q5OA 1JI6A 4Z6YA 4KDPA 2DMUA 3F95A 4ZZ8A 1P7IA 1X1CA 2LKSA 3AFKA 4ZS3A 4CYCA 4UV8A 4YZ1A 2FEZA 1C1LA 2PQ8A 3QYBA 5D8LB 4HNVA 4BMBA 1RRJA 3FWEA 2V9PA 4KI5M 4RGUA 4C1XA 2XH6A 4J6GA 3ZXSA 4J1XA 4K8RB 1POV3 3VBSB 4XXAA 4EGYA 5F9TA 4QQLA 3CZ6A 4Z2YA 2W2IA 2VBWA 2VQ0A 1J3QA 1JKQC 3ZPYA 4IEYA 3AP9A 2FF4A 2H27A 3GCXA 1NH3A 5A6YA 3LNQA 1IGOA 2Y2ZA 2R7EB 3UL2A 2O6GE 2PG4A 4CH7A 2VAUA 4BU2A 3S14J 2WA3A 4UVCA 4GB33 1RXGA 1B35A 4PZJA 4PF5A 3HOWJ 5KBFA 2NXNB 4MQ9F 5FYUA 3BR6A 2ZJ2A 3M3CA 1XNTA 1JXSA 1HRV1 1JH5A 4BE0A 4M3EA 3DECA 3NKGA 2VJXA 1JYNA 1BR1A 3M2MA 2DDBA 3WHBA 2VPRA 4DYRA 3DPRC 4W8JA 1LR5A 1L7QA 3CMMA 1ODNA 2DYRH 1UZWA 2VY0A 2DUQA 1W1WE 4QDRA 4NC6A 3CO7C 1YNAA 4LO4B 2OYZA 2FD8A 1CN1A 2PHWA 5HCAA 1Q1VA 3BQYA 3CQZJ 1R081 2O5RA 3S1QJ 2Y9YA 1T0FC 2R063 4XTMA 1NKGA 1W9SA 3CMYA 2BFUS 4LBQB 4O3MA 1RUC3 2VC1A 4SBVA 4A3KJ 2VVFA 3AMMA 1HW2A 5GZEA 3ABTA 2IRFG 2IPQX 5IVVA 2JWPA 1E5SA 3BPSA 1XNDA 2W91A 3N36A 2D5FA 1HKTA 2CQXA 4D7NA 4XRFA 4A7ZA 1L7LA 2EH3A 2M0CA 3BOQA 4QU2A 1LEDA 3VBSA 1SHWB 4DXTA 1NLRA 1H1MA 4K8FA 1QA6A 2ECBA 4F3JA 2V6EA 3S5AA 3TOAA 4IO9F 1Q56A 1BMV1 3C2BA 1H2KA 1S0FA 3K10A 2AH2A 3ORJA 4XSXF 1O4XA 1VBA1 3RCOA 3VZMA 1V6JA 2X5IA 3HDDA 1PNFA 2W95A 3ZN6A 5CEHA 5K0UB 4Q4W2 4Q1PA 5FR3A 1AR82 2FBHA 3VB2A 4A44A 1RUF1 3K4AA 3MMYB 2V5DA 4ENJA 4WVMA 4KBZA 1LEBA 4AIDA 1RUD2 4HQEA 1SLTA 5CA6A 2Q2EA 1WA6X 1LPQA 1MMGA 5IOYA 2EXKA 1NCRA 3NNJA 1T8IA 2JA5J 4FETA 3ZXAC 1LB2A 2JVHA 2D3RA 1UHSA 2A3SA 3OV8A 1X9TA 3W59A 3USSA 2K9LA 2CUEA 1OD3A 1TNFA 4FTSA 5FZ0A 2MEV2 2LSOA 3ECHA 4CXWA 2BXZA 2PN6A 4B1MA 4Z07A 1MBKA 1H30A 3FLRA 3S8PA 4IOCF 3S1NJ 1VBD1 1DZTA 4OZXA 4UOJA 5A6QA 5JZGA 2PEXA 4Q26A 1IUFA 1KDKA 1WW5A 1K61A 3AJYA 4M00A 4RFRB 2CU5A 4YVWA 1W8UA 3S1MJ 2I45A 4GH4C 3POWA 3VHNA 2OC6A 2DMQA 2M7BA 2O0YA 1QO0D 1YQ6A 5L36A 3B6CA 5J6XA 2AUYA 2HPMA 1A5JA 5EHDA 2A5YB 3TKYA 2ZMNA 4D3WA 5ACA3 2JB8A 3RZMA 5EWSA 1T6SA 1HB1A 1U0JA 4MSVA 4KJZA 1B59A 4MEXF 2RDRA 1T08B 3SDBA 4JDNA 1JHNA 4CEYA 3DKYA 4QT6A 2KA3A 3K1PA 2J1EA 3P9IA 1FOD2 3QD6A 2FNAA 4NIGA 4PQQA 1R00A 5F1RA 4DZGA 5C3QA 2EIEA 4DS0A 1HXDA 1L3LA 2VULA 5LRRA 1D0YA 3CMEI 1NX9A 3GJBA 1GOHA 5IATA 3TRSB 2V1UA 2GDFA 3K77A 1PMHX 4R8HA 5L3DA 3N9MA 3NO8A 2XBO2 3JTGA 2XQXA 2FX0A 1V5EA 2PHXA 5A7WB 3CD6I 1DF0A 2NYXA 1BC7C 5EIYB 1QJY3 1US2A 2CDPA 1SMTA 4ET7A 1ACCA 2C1FA 4GA9A 2L3DA 1X82A 1Z3YA 2ZXJA 5E1XA 2BE5F 1H8TC 3WINE 5A3MA 3RJPA 1I1EA 5M5YJ 1UAAA 2B4KA 4XF0A 5CVRA 2EILH 3H92A 5JPNB 1JYTA 2P5LC 3SQNA 3BTYA 3AYAA 2OU2A 2E32A 1O5LA 3FM3A 1CF7A 1PMJX 2HZTA 2XJVA 1UZ0A 1YLLA 4DB5A 2HEWF 3AMQA 1D0ZA 2DT5A 1VE0A 3SC7X 2WT1A 1BW6A 1RUH1 1OLRA 4DO0A 1TEIA 2HYJA 3BIEA 2GNBA 3H9AA 4LMYA 2ZS6B 4P08A 2BW3A 4AQ6A 3VHPA 1E0EA 2VBPA 3IRRA 2NVXJ 2JG8B 2PLV1 5L3EA 2VKHA 2VVDA 4UT5A 2DUPA 1FYLA 4BS9A 3BTLA 4AEJA 5IAXA 2AQEA 4KFCA 5LEKA 3ZN4A 4FVVA 3AP5A 3BTAA 3IBMA 4RS8A 2W5FA 2YGMA 3GTLJ 4QPGA 1JYIA 4V2WA 3T0BA 2QDRA 4R52A 3POIA 2DF7A 1PVC1 3OY8B 4FP3A 3GZUC 3SFIA 3SJMA 2EA4A 3FMRA 4QX3A 2K2SA 1FP1D 1DBNA 3NRVA 2E5NA 3MO4A 4XCBA 1ZBE1 5F64A 2X09A 2HWE2 1WGXA 3DL3A 4PFOA 3FLTA 4LFUA 4Q1RA 3C7HA 2DOFA 1XRUA 2D45A 1MZEA 3L7WA 2ADEA 4ZONA 3LSRA 3BPXA 1FIPA 2WZEA 2GN3A 4I0WB 4YYOA 2CUZA 3NARA 1P8JA 5GTHC 4AHWA 1P92A 4GMP0 3H0GJ 2ZXHA 5HNFA 3WNXA 2CW0F 3GFLA 3CDZB 3N7MA 1TWFJ 2HDWA 1PK6A 1WCMJ 2XHKA 1JZ7A 3NV1A 1YQAA 1LJ9A 3KIOA 2R042 2HXOA 5FZCA 1AVBA 4R1HA 2Y0SA 5A6XA 4BK5A 2JVGA 3H5NA 3M4OJ 1ASJ3 1HSTA 3M1EA 3M8JA 3VDDB 2DODA 1OFNA 4XJWA 1ZGWA 2BU9A 4Q2FA 5LD2C 4NQWA 1G4DA 4GRIA 2HLEA 2G9FA 5FO7B 1YYNA 3PIJA 2EINH 5BNPC 4AWXB 1HKSA 1FPN2 3OL3A 4M3BA 1OH4A 3CF6E 2XB6C 5E8IA 4BHCA 1KD7A 1UOGA 2Z16A 2CQ7A 3KQ4B 1SPPB 1K6YA 3RZGA 1OD5A 1QJX2 5LCWL 4I0AA 4WM7C 3BVCA 2B9SA 2QCSB 2VJ5A 1OFSA 2K40A 2JG9C 4CCLA 3J8F3 5FPZA 2QQLA 1GWLA 5FMDA 4FE4A 2PHTA 3I59B 1ZR2A 3GZ5A 1W39A 2L9VA 5K5OA 1ITYA 4B8EA 3TEXA 2VBYA 4NAOA 4IEWA 3A4UA 1GKBA 5CVJA 2OF7A 4D6SA 1VAMA 1KGSA 3AJZA 2D6PA 5HS7A 4XF9A 5FKNA 1LVKA 4QXCA 1HQWA 2A5ZA 1W8WA 3QU3A 4A5MA 4W50A 1N77A 4AGVA 3U1DA 4IV1A 4I7HA 3LGRA 4NHXA 2WO1A 3EQEA 2JE7A 3GMEA 2NS0A 4HPKB 4HEA2 3O1OA 3BCAA 4YZ4A 1UG2A 3U4SA 4MEYF 3QQAA 3ZSJA 2P0WA 3ABKH 1QXPA 1ULEA 2VE1A 3POBA 1GP5A 2W00A 2MC4A 3S1RJ 9ANTA 1J75A 1OKRA 3JR9A 3K4JA 2LLKA 2Z2SB 3VLBB 3D5SC 4ESBA 1QJZA 3T08A 2RREA 1XX5A 3V0AA 2OZJA 1JT6A 4LHLA 1W6QA 4BOWA 4HKLA 3TB0A 1MQTB 3R05A 2UV1A 5DCMA 5L3BA 1TME1 3B02A 3VBFB 4GKYA 1WJ5A 4J19A 3KLNA 2X6OA 3H42B 3Q8FA 2HZDA 4HVRA 4IW3A 1EA3A 3E5XA 4NPRA 3ZSKA 3NRUA 5AC93 5IT9K 1DQ0A 1LHNA 3I54A 5IYYA 1SFUA 3K9TA 4LEJA 4W6YA 1B35C 1PO23 4QPIA 4IX7A 1KQ9A 1PIV2 1I5PA 2D40A 1MZFA 2KFDA 5DEQA 3ZFFB 1VBA3 3PHMA 2YX7A 2OTJI 4DRVA 2C4XA 1IQDC 1GYKA 3AG1H 4QKBA 3WNOA 4XURA 5HS9A 2ARBA 1QNYA 3J4UH 4YM0A 1Y7BA 4AHZA 3ZM8A 4M3FA 4LGWA 1W06A 4UWDA 2RS13 3BODA 3GLXA 1OQDA 1RUF3 1WLWA 4N9HA 3QH7A 3I53A 4H7MA 2OW4A 2XGCA 3VDBA 5D1IA 2VUAA 1LFPA 2W9XA 2PHDA 4MXVA 3LIGA 1U0AA 1REEA 4NOTA 1OCOH 1UIKA 3GYHX 4H7LA 2KIMA 4EJTA 3CCMI 2VODA 2RR12 3MIHA 3VZNA 3ZYFA 2HWVA 1BLZA 2FSWA 1IV6A 1CAUA 4IZZA 4AVVA 2WR9A 3SDGA 5C3SA 1IRFA 1H6XA 1OLTA 1UNBA 2QSFX 5FYZA 3MZYA 3K46A 3VBSC 1QZEA 1UMQA 2E71A 2D43A 1C0WA 4E6KG 1R1A3 1WCQA 1XE8A 3OYWB 2PX9A 3GFIA 5DQ0A 2ZBJA 3B9IA 3NJXA 1OQ1A 3VBUB 1KJLA 3ETPA 5FIXA 1YI9A 2JT1A 5BOXA 2DMNA 2PMWB 4KT6A 2PBIA 3R0AA 1U5IA 1JU4A 5B4XA 2IZWA 3TMOA 5D4SA 1W8TA 5F3IA 4JX4A 3UV9A 1B1BA 3X29B 4Y26A 3QP6A 1HDPA 2ZC2A 2M34A 4QHBA 1WMEA 2VBDA 1A8DA 3HPGA 1W7PA 4MGKE 2R4GA 1GSLA 5FP4A 2BY3A 2R0HA 3MLLA 2RAEA 5F6LB 2P6SA 1NLQA 2W92A 3FKIJ 3SCGA 1ENQA 1Y6IA 1NCRC 1K12A 1ZRIA 3TEDA 3JD71 4OIQF 3VD7A 5BNOB 4M72A 4DRRA 2RDNA 3HSEA 3VL8A 3MW3A 4M6YA 3LSIA 2B63J 4BA6A 1Z7LA 3LA2A 3MCZA 1SFXA 3OEAA 2WV1A 4KA4A 4YGBA 4A0YA 4M6XA 5EDNA 2MBFA 2ET7A 5DUWA 1ZNPA 4FTEA 5JZGC 2UWAA 1TMF1 1JMUB 1RZ4A 1NE4A 2ZFUA 5JVTA 4HMZA 1K78A 4JV4A 3TEWA 3E6DA 1GANA 1U9NA 1MS1A 4YVWC 4V2GA 1DG6A 2WAEA 3TYJA 1DU6A 3HG9A 4BY7J 5KCMA 3OYMA 5APAA 2LY2A 2DQRA 2AHQA 3VBUA 1D4M2 3RSNA 4LE3A 2YBKA 5JVGF 2Q0AA 2HS5A 2AENA 3MF6A 4TZDA 1HKQA 3IC7A 4BDZA 1GZWA 1E3HA 1I3HA 3OYNA 1EAH1 4HRIA 2KZGA 3HOVJ 2DN0A 5LA2A 5EJZB 4RQPB 1XC6A 1MDMB 4CEYC 4NRMA 1O7LA 3OYHA 1WHUA 3PVEA 4UFLA 4MHGA 4AFBA 3LMMA 3E5UA 2DMPA 4JX5A 4CPBD 2EVXA 1W0NA 4KMQA 1IN5A 2F17A 4B09A 3D6EA 2L9SA 4G94A 5DUXA 2IEKA 2C5DA 3CC4I 1A34A 4MO7A 1TWGJ 2ZKNA 4FXKB 4D7YA 3BQZA 1IKQA 4D1QA 3J7MA 2XIGA 2R0QC 1B8IA 4M3CF 3R61A 4G8XA 4X8NA 3WODF 4K9SA 4EZ4A 1Q5OA 4Y5Z0 3M8LA 2QKMB 4CDGA 4B3NA 4MH0E 1I3QJ 1G9BA 4P5YA 1FXZA 1RJ8A 3OYAA 2ISYA 3SEZA 2VMFA 4JKLA 4EN0A 5CQEA 4RLFA 3AKTA 1BEV3 1K7AA 4E2QA 4AYUA 2EV5A 1JHFA 3AK0A 4DOZA 2UWMA 5KVRA 1G9AA 3BTJA 3R4DB 2HWF2 4L99A 3M07A 5J4YA 1ACIA 2XB0X 3JTHA 1WJAA 2ME0A 4HLTA 4PLNA 1HRI1 1RUE2 1WPKA 1WI9A 5JOYA 1ZHFA 3GBWA 2FBKA 2WB1A 4LK1F 4M9ZA 3Q9OA 2QTWB 5C8CB 3OOPA 4JQTA 1MJAA 1WD3A 3K3OA 4XOGA 3KF5A 3B6AA 4IQPA 2YPDA 4KNCA 2X29A 1GOGA 1IQAA 4ZHNA 1V6IA 3JB4C 2A6EF 5IAVA 4LR4A 2RVAA 1LEMA 4LTAA 1LVAA 4IEQA 3OTFA 3RVHA 3ZN0A 3OYFA 4AAPA 3U4XA 2KRCA 3S6PA 4CICA 3TO9A 3KV4A 1NT0A 5IT6A 1S7OA 3E0JB 2NNNA 4JZRA 1DQUA 2V4VA 5LWBA 3MN2A 1DLCA 3PUIA 1UU6A 2LRDA 3MUY1 4AFMA 2QENA 1HLVA 3W5MA 2VOVA 5FPBA 3ZFEA 3WW3A 4QDSA 2V1NA 3ZKUA 4YZ5A 4ISRA 4HSRA 1SG3A 1U5ZA 5FCCA 3WF3A 2WZR1 2FMYA 3H5RA 3S32A 2JDYA 4CU6A 1TQIA 1ND2A 1FPQA 2E1MC 4M73A 2Y6FA 1AZDA 4BXXJ 4Q47A 2XPUA 1HQCA 2OPWA 4V1PA 2ZACA 1FTTA 1EF4A 1W6MB 2QZ2A 1RUI2 1Y8RB 1IO2A 3R0JA 4HL0A 2BV6A 4AI8A 5K7FA 1YJ9I 2V1DA 2ZEYA 4O9EA 1RVF2 4YM1A 5DUKA 2YY1A 1JUSA 4QHZA 4OINF 1KQ8A 3B7MA 1PK6C 4XJZA 1HQLA 4RB3C 3PDQA 1R1ZA 2VMCA 5IK7A 3HVDA 1UF2C 4FOWA 4F55A 4EGZA 3NJVA 2P4WA 2E51A 1POV0 3I58A 1J09A 5E88A 4AIHA 4M3CE 2VZVA 2WINB 1TTYA 5J1YA 5CKQA 1OUSA 2OCCH 4HSTA 2EAKA 2Z1DA 1S29A 3A1YA 3BZ6A 2Y33A 4HANA 2ATFA 4CO8A 4F7ZA 3Q9SA 5FD5A 3U0ZA 4RAYA 1GP6A 3BR1A 3HNMA 2QQWA 4A69C 1FMWA 3C7JA 3ERMA 1U5TB 1Z6RA 4KIBA 1WW6A 2A1XA 4PLOA 3UGGA 3S3MA 4PBOA 2GXGA 1C1FA 4CUAA 2YSRA 3X2QH 3GW2A 5EXOA 5HCFA 3DXUA 5GJ6A 3NVCA 3GVAA 1KRIA 3JCUC 2BBAA 4LBLA 4XEZA 5A3OA 4L2NA 4YW4A 2EB7A 4E2SA 3WF2A 4AL9A 4QM9A 3L09A 2RVCA 1ZH5A 1P6RA 2CSOA 4L9BA 1OH3A 2HWD2 1W05A 1Y4WA 4LULA 3DLLF 1A8MA 1DGWY 5KXCA 3DLAA 4BJ0A 2V79A 1Z05A 3NWSA 1MEC2 4IV1C 2QUOA 3I2HA 5B4NA 4F92B 1SBFA 3OJBA 4XR6A 3FXMA 3PFIA 1XGOA 4XTPA 4FP2A 1TW2A 4YGEA 2DCJA 1SVMA 4Y52J 1WFXA 2JIJA 3O5SA 1LTEA 2GC3A 4P9YA 1F31A 1GICA 4N8MA 3SEPA 5FLHA 1RUJ2 2NMOA 5LBEA 4OQ9A 1BBT2 1N3QA 4BQ3A 2GH8A 2PI0A 3IHUA 3LQRA 4UW4A 3BG5A 2ZJQF 1AU7A 5B66C 1G3WA 5T3NA 4Y20A 1PGSA 2DAOA 2C9AA 4PGGA 5FZGA 5T50A 1OA4A 4P9XA 4BQ2A 4LOTA 4Z92B 2HEYF 2X53S 3R60A 3IIIA 4FCYA 3ASNH 3FXOA 4P9WA 3HUGB 2XJQA 4DBQA 1QGPA 4Z8BA 2XPWA 4JHTA 1W3VA 3H9QA 4RAFA 5E16A 4HG2A 3C7GA 4QPIC 3HRSA 1ZG5A 3MUZ1 1FY7A 2UYBA 2JDHA 3DU5A 4XFIA 3MEPA 3CHXA 5FOJB 3ZQ7A 2IW5A 4RFT0 1RITA 5FYTA 5ERIA 4NNJA 3M8EA 3Q3SA 1S7AA 3TN93 1WJEA 2PAEA 4HVQA 1ZBA1 3H3VK 3CEWA 3CZUA 1POGA 2FJ1A 2UUZA 2O8KA 1HJFA 1AR91 3FXUA 1EJ9A 3N4MA 4CDUA 4A3IJ 1LECA 4IUGA 3O1VA 5EP9A 2CSGA 3GHMA 3Q8AA 2VOTA 4CZZA 4G12A 4IL6C 4BWOA 3WHTA 1I5ZA 4HK8A 3ZYJB 3V7RA 3PQKA 2RG4A 4DQAA 5CNAA 1EH7A 1MIJA 2R32A 2JD4A 3LSJA 2NM1A 3CCRI 2FMDA 4CZCA 4IKFA 1Q43A 3KLOA 2BYVE 1MNDA 1A36A 2P3IA 3V8LA 2XRNA 2JDPA 2YMZA 2R7FA 5JXIA 4IERA 1Z7S2 3P7NA 4OOIA 4CCDA 2LOOA 2L4MA 1MQTC 4UV9A 2WBKA 2KKOA 3KE2A 2J1SA 1O3SA 1ZARA 3RJRA 1WBLA 5KHIA 2GXBA 1AR62 3KWVA 3V4GA 2BVLA 4N9IA 3H0DA 4L0PA 5FZ7A 2KT0A 3HOXJ 2EIMH 3K1MA 1PZ9A 1VBC1 3KT7A 1V6OA 4BXUA 5DZEA 3OYKA 1L3JA 3LDBA 1D5VA 3TOBA 3LQQA 2QA4I 3NNFA 4EJVA 1WLTA 3Q0VA 2WYFA 3PMSA 1LESA 3ZR5A 3KX2A 1XE7A 2ARAA 3ZFFC 4NN0A 2EFNA 1UZYA 1Y9MA 1WKYA 1J83A 3ZYGA 5CADA 2Y8KA 2L01A 3TEZA 4K7JA 2WV0A 1GZ9A 1ZVFA 1I50J 2VZ1A 2ENRA 2J42A 1TT5B 3TOJA 4Y24A 3WP4A 4CDWB 2A07F 1F2NA 3MV11 3WG7H 3OSDA 1ALYA 2JKXA 3HQXA 4W6WA 4R4XA 3CCEI 1NLSA 2YU9J 5CYVA 3OBTA 5FJ8J 1BIBA 2RC4A 2RS52 1IPSA 3WNNA 1K5MA 4KN4X 2HVRA 3L9FA 4ANJA 3OBZA 2FUG2 2ORZA 5FGMA 2NPIA 4EJWA 2ES3A 2ZZQA 2GC2A 2M1BA 1C8NA 1HXS2 1PVEA 4GWMA 3BIWE 3S15J 3P3NA 3KHCA 4M9SA 5L9RA 5E20A 1YITI 2X51A 1U78A 2FDJA 3VBUC 4AUXA 4B1RA 3GDBA 1D2QA 3WQ0A 3C2HA 1UHMA 4HVOA 2OQ7A 3G1MA 1NA1B 1WH5A 1JJ6C 3EQLF 1DCSA 1YHFA 4C2TA 2FE3A 3WNLA 1CAVB 4QX2A 1QZYA 3VODA 2DCKA