3RYRA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ryrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ryrA01
1FYKA 4O3MA 4MGIE 3BU7A 2PHDA 4BHPA 4EJTA 1IN6A 4DQ2A 1L3JA 2D1HA 4FBFA 2R7DA 2X0LA 5L3GA 3R0AA 5KHIA 3HRUA 2QBYA 1IW7F 2D5FA 1BI3A 2UWMA 3C1DA 2EVXA 4XSXF 1XSXA 1KU2A 4M6XA 4IPAA 2K7LA 5I93A 3JTHA 3KCCA 3OOPA 3DFGA 1HW1A 3QOPA 3T5XA 5AVPA 2O3FA 1F4KA 3ABUA 2QBYB 3F72A 2PYTA 3F8MA 2GC1A 3BPZA 3WU1B 4TLFA 2K4JA 3FZ3A 4ESFA 4IEUA 4LK0F 3VFZA 3R60A 2AXLA 1I6XA 4G6QA 4G7OF 2HTJA 1S7OA 2ETHA 5KK1A 2QCSB 2EK5A 4LGWA 2PMHA 5DD8A 4KT5C 1VJ2A 4JK1X 4LD5A 3LAGA 3KP5A 5K5OA 1FSEA 4YSFA 3HOTA 1Y3TA 5JSPA 2PQ8A 3KP2A 4OU0A 3U10A 2IC1A 4RB1A 4Q47A 1OYIA 4AIKA 3ROUA 1H0MA 1Z6RA 4IEXA 3K69A 2EA4A 3WODF 1QXJA 3V8JA 4FX0A 3ELNA 1YIOA 5E16A 1R1UA 4I7HA 1W7PD 3S2WA 1XMKA 3M3IA 3ERED 4D7SA 5BOXA 1B9NA 4KIFA 4X6QB 5BS6A 2YSRA 3WTSC 1O5LA 4AVBA 5IT9Z 2IPQX 5FFXA 3WTWC 4JQFA 4JV4A 2DO7A 1JGSA 1KQ0A 4MQVA 3U1DA 2KIUA 1HBXG 4KN4X 2K02A 3H1YA 1Q5OA 3CUOA 4PIZA 2XLFA 2UYAA 4GO1A 4HYEA 4L0YB 3F23A 3RYKA 3DKWA 3IC7A 4XF3A 2EFNA 1VP6A 5FLHA 3C7JA 4YG2F 4IETA 5EFUA 1SFUA 4TV7A 1FP2A 3I58A 5KHGA 1ZRDA 4BHBA 4FT8A 2FBIA 3RKXA 5CLSA 3DN7A 3E6MA 2YR2A 1BIBA 4RGXA 2ESNA 1TLHB 3HRTA 2EAAA 4BHCA 4HN1A 5TRDA 1ZVFA 1O4TA 2MBFA 5I8YA 2QWWA 1KQ8A 4IRIA 3GLXA 2UZKA 1T6SA 2XL7A 3ST7A 3L7WA 1BI0A 3PFIA 2ACJA 1DPUA 1KYWA 5HS9A 4OIRF 3BOQA 4Q0PA 5I0UA 3OF1A 4WZCA 5IT9K 1U5TC 2P7CB 3UKVA 4MX3A 2QJVA 2NYXA 4ZZDA 4Q4ZF 5A2QK 5CVIA 3FF5A 2F5EA 3CLPA 2DPUA 2KRFA 4I3PA 1Z05A 4IEOA 2L4AA 1EH6A 2ZNYA 4HSLA 4G9YA 3FMRA 3TQNA 1RTVA 3CJXA 3SXYA 1YO5C 3HRMA 3JSOA 4UNOA 1UIJA 4XSZF 1LQ1A 4K8FA 1ULYA 3RI4A 4ZYGA 2UY9A 3HOSA 5ICCA 1R1VA 4LTAA 2E9QA 5JR7B 2FOKA 3LA2A 4Q0QA 1R23A 4UBHA 2K4BA 1OR7A 1PP7U 2P5LC 3E5UA 5DUIA 5CADA 2P8TA 4LUKA 4N9IA 2FQPA 4ZYHA 4AIHA 2CAVA 1H1MA 2W57A 1XDSA 2X4HA 5IT3A 1OYWA 4L11A 2Y0MA 3E6DA 2DBBA 3GW2A 5BPXA 1I27A 1HQCA 3TOBA 2A61A 3FZVA 4IEVA 1DGWA 2LKPA 4QLCU 5FQ0B 2NAZA 1O3TA 2HDCA 2DCTA 5FLIA 3KP7A 3GBFA 4A2UA 3ACLA 3BJ6A 1TNTA 3E6CC 2QYOA 3F21A 3GZ5A 3K1NA 4G7HF 1ZRCA 4HDUA 4MHGA 3PQKA 1IXSB 1KU7A 4FAGA 4OIOF 2MH2A 5C8WA 3IL2A 1RNLA 5E17F 2EV5A 1ZZ9A 2EFWA 2BE5F 4RAZA 4CICA 5JFRA 4HX7A 2PAMA 4BYYA 4B29A 2OU2A 3FMSA 1B9MA 2XKPA 3K0LA 3T1BA 4MEXF 4HVRA 2DAOA 2XV4S 3LA3A 1BIAA 4R79A 4KWJA 3R6SA 4ONUA 1J3RA 3B02A 3R0JA 3NSTA 3CEWA 5KHJA 1OI6A 2HYFA 2HOEA 1EP0A 5LGUA 1LEBA 2ATFA 1XCBA 4BH9A 4EVIA 4ENKA 2W84A 5EEHA 2XAHA 3DPLC 3KZYA 2IRFG 1KU3A 2Q0AA 3RIRA 1YFXA 4L9TA 1Q3EA 4OINF 4MGZE 2FU4A 4KMFA 3DL3A 3E5QA 4LEJA 3MAJA 1ZN2A 2VN2A 1E17A 1T39A 2HS5A 3ES1A 4I09A 3C3VA 4XFIA 3PQJA 2V1UA 1HSJA 4HF1A 2IXIA 1S6LA 2ZJ2A 3LSTA 4PIYA 1IRFA 3ZN0A 1DZRA 3HIFA 2JRTA 1ZHFA 2BNNA 3DV8A 1BI2A 2GIVA 3MZHA 3BWGA 2O1QA 2KIFA 1D8KA 4XLNF 1L0OC 2O8QA 3WW3A 2ZXJA 1OMIA 3IRQA 4D0PA 1ZZ8A 5JI6A 3J81Z 3GF2A 3K2ZA 4LB5A 4KYWA 1KYZA 2CWEA 2A6EF 2ET7A 1YFUA 5D4SA 1G3SA 1WQ2A 2W85A 3GFMA 2Q30A 3TDZC 5HI0A 2VBXA 3RNSA 1ON2A 1Z91A 2ZMEA 5LLQA 5LBQA 2LF8A 2M1BA 1J0RA 1K79A 5I8SA 2A69F 2JT1A 2RKHA 5HLIA 1XGOA 2G7UA 4I98B 3E3VA 5D5WB 4EMSA 3U0ZA 4OIQF 4AIJA 2IP2A 4EROA 4KICA 3CL1A 4Q48A 2ZMEB 2PLYA 1IXRC 1ZG5A 1FY7A 2M5WA 1J59A 4KUMA 2XUBA 5F64A 3TO6A 1Z9CA 1UPIA 5D6FA 3QACA 4X6RB 1EV7A 3BPVA 5D8LB 3RPUA 2GAUA 3HRSA 2V6CA 4CXFA 4XFFA 3JAMK 1ZZ6A 3FM3A 3IDBB 1FBUA 1V70A 1U2WA 4ZYDA 4QGNA 3RTRA 2MA3A 3FXQA 1O3QA 4J1WA 5C6CA 1AOYA 1XGMA 2B9UA 5HLHA 3QPHA 1UIKA 2HWVA 3E97A 3J81K 1XE7A 2H6CA 3PNAA 1U8RA 1WGPA 2DTRA 1F9NA 2BBYA 3GO5A 5FD5A 4U0VA 3FM5A 1UFMA 5ILVA 3UKTA 1LNWA 3KP4A 4UVAA 5D5XB 4GYGA 4N9HA 4IRGA 3C18A 1YQAA 3MCZA 4WXCA 2PG4A 5HDGA 4MTDA 2R7FA 5BPIA 5E1XA 4ON0A 3FFQA 3GYHX 2WV0A 2WWYA 3HSFA 3WE2A 2A6HF 3I53A 4OFGA 5HVQC 5H20A 3T8RA 5BMZA 3NRVA 4CO8A 3E5XA 2P7VB 1RUNA 4M72A 4JTOA 3MYXA 2CFXA 2CAUA 2M87A 1TNSA 1IZ1A 1TW3A 4L9VA 1CF7A 4Q5SF 2IXJA 2FNAA 5LGTA 3FHIB 2L02A 4HN0A 3SMHA 1X3UA 5CVUA 3H3ZA 2DK5A 3JZVA 3PLQA 4WXDA 2QQAA 1GHCA 1UHWA 1J3PA 3WTVC 1CF7B 2ZKZA 1TQMA 5BPDA 1W7PA 3VOEA 2EV0A 2V09A 1G3TA 2YPRA 5JHUA 4NB5A 1TTYA 1RI7A 3D0SA 4FX4A 1UW8A 3NL1A 3ZDSA 2QM3A 2PEXA 4KFCA 1W7PB 2ISYA 2H27A 1SMYF 1NE6A 1Y9QA 3I71A 3N97A 3GXOA 4M9XA 2C6YA 2XAGA 3V8KA 4EWAA 3EETA 4IRHA 4LA2A 4U88A 1QZYA 5FLJA 2HFHA 2MH9A 4P9FA 3B73A 4Q0SA 2RVCA 3U9GA 4AQ2A 3QU6A 1P4AA 4E70A 1MZBA 3SHRA 4IEPA 3RJPA 1ZH5A 4A0XA 1CAWA 4FHTA 3VHRA 3LOIA 5ICFA 1NYWA 3F8BA 5DV5A 4R1HA 4HOBA 4Q29A 1SD5A 3BJOA 5LHIA 2ETEA 1R58A 4DINB 2QENA 3LWFA 1CAWB 4XF4A 4HF0A 2H09A 1LKNA 2PFBA 4ZZLA 2RGVA 2XAJA 4AQ6A 2IXHA 3WGGA 3F8FA 1RC6A 2NRAC 1BOAA 2VBZA 5HS7A 1PP8F 4GULA 4HLXA 1QPMA 2HZTA 1XRUA 5AIPA 1YLLA 2BNOA 5HDNA 2GQQA 1WI9A 1QO0D 4JBAA 4RS8A 4E2SA 1I1SA 3DXJF 2VOOA 2FF4A 4IEQA 3U2RA 3TGNA 3F6VA 2E1NA 4LLLA 5J3UA 2TDXA 3KZZA 1J58A 2KKOA 4L9NA 2V79A 2F5CA 2W25A 3M1EA 4KN7X 3H8UA 1JHFA 5A2QZ 5FLXZ 3ABTA 1EH7A 3KLOA 1L3LA 1U12A 4XFBA 2KJBA 3CO6C 3IDCB 1LEAA 2Y75A 2VECA 1BC8C 2GWRA 3GVAA 4HA8A 2STTA 2HQRA 4AXOA 3WTUC 3HHGA 4BIFA 2P17A 4QX5A 4ZU5A 2VONA 2OA2A 4UVBA 3TKYA 3ZMDA 1SFNA 4A5NA 3VODA 1OYYA 4RD7A 3D82A 4XF0A 1ZRFA 1W5SA 2IA1A 4G7ZF 5HLGA 2A5YB 3OTFA 4RGSA 4H7LA 1HXDA 1R7JA 4F8AA 4ETSA 5CVJA 1HKTA 3IBMA 3KETA 4CGZA 2W24A 2NS0A 3ECOA 2FXAA 1H9TA 4KL1A 4WF2A 2MNGA 1Y0UA 4HW0A 2ESHA 1MJ9A 3RKYA 1O3SA 3F3XA 1QWRA 4A5MA 4L9JA 1HW2A 4Y13A 4HV6A 2OA4A 3HTSB 5FLXK 4QMAA 5JSOA 1RUOA 1WLTA 5AIQA 3CO2A 3S7IA 3BDDA 3Q9VA 5DYMA 5LHGA 5CVVA 4YIFA 2QLZA 1GQGA 4WBBA 2CGPA 2BNMA 4M74A 3WW1A 2D45A 2HKOA 4LB6B 1UD1A 4Y17A 4XF1A 1IPJA 2JPBA 2DLLA 4LULA 1C0WA 5JR3A 2VE9A 5L3FA 2D93A 1ZAOA 1K6OA 4P5OA 5ED4A 4OMYA 4OIPF 2VBWA 3LA7A 1YFHA 4PJYA 2DU9A 4A6EA 4KIGA 1S3JA 1XGSA 3LQQA 2PN6A 2PHLA 1G3YA 5FQ0A 4GGGA 2FSWA 2MPFA 2VOPA 1QGPA 3H92A 2PAEA 4Z82A 2ELHA 3LQRA 4UV8A 4LA3A 1FNNA 2QQ9A 2Q8KA 2A07F 4RGRA 1GVJA 3ETQA 3KP3A 2XLAA 1LDKB 1W4MA 2F4PA 1S29A 2E7XA 2P6SA 1MJAA 2BYVE 2HGCA 1FYMA 2EB7A 2PFWA 1NE4A 1IAWA 3EQLF 2CYYA 2F5FA 5DEQA 4ORFA 2L54A 1YHFA 3J80K 2IA0A 4LLNA 4I2OA 2YU3A 3SCHA 1H9GA 3HHHA 3NJZA 4IVNA 1VTNC 5FCCA 3CUQA 4UXAA 2B5HA 2VBYA 2GU9A 2EV6A 2P5KA 1MDMA 5E1ZB 2PJPA 4R8HA 1KQ9A 1TBXA 4MZUA 2DK8A 3CUQB 1JHHA 1QBJA 2STWA 1QZZA 2XL9A 1MDMB 4HSJA 2VODA 3HSEA 4BNCA 2FMYA 2Q0OA 3CLOA 3W6JB 4QWQA 4RGUA 1HSTA 1WWXA 3TNPB 2IXLA 1X7NA 1ZG3A 3OV8A 5I91A 1E2XA 5BXXA 2COMA 3NEUA 3LWCA 2XKOA 5F1RA 4RAYA 3SQNA 1DPRA 1EPZA 1OD5A 3WTYC 3BY6A 2HKXA 3GFLA 3F22A 4A0ZA 4M73A 3P9KA 5H6QA 4ENJA 1DUXC 2G7HA 3EO6A 4LLGF 1SQ4A 4EJWA 4S05A 3BALA 2WTEA 2L01A 4PGGA 1XE8A 2C0ZA 2XGXA 1YLFA 1NZCA 2VC0A 2HEOA 4EJVA 1XD7A 3MWMA 4XEZA 4BAYA 4L5IA 1FYLA 3L09A 5CJ9A 3JAMZ 5DCFA 3FXUA 1IF1A 3PVBB 2ZO4A 4E2GA 3FX3A 4HF2A 1P4XA 1S8NA 1KU9A 6PAXA 3ISPA 1LRHA 2WC2A 3GWZA 3QP5A 1R00A 4XLPF 2JSCA 2OBPA 2QDRA 1SFXA 2VT2A 1GXPA 3K1PA 1RGSA 1XCVA 3WTTC 5ILSA 3RZZA 1LDJA 1SMTA 1YW9A 1OFNA 5DUKA 2A3SA 2HJIA 4MGYE 2BEOA 3LAJA 3HT1A 5JCTA 4P9GA 2PA7A 1IN8A 2Z2SB 4CYDA 2Q2EA 3GEZA 1K78A 4HV5A 1J7KA 3HT2A 4HX4A 2UXNA 1T0FA 3MEXA 3TO7A 1XDUA 4RB2C 3JTGA 3ZMTA 3BP8A 2OZ6A 3F6OA 3JW4A 1K78B 2YX4A 1U3EM 2GC3A 3FHZA 4IJAA 3KLNA 3M7GA 2LF7A 2CSOA 1J75A 2GXBA 3VB2A 3HSRA 1P2FA 4GYIA 4M9SA 5DDGA 2JPCA 3FJSA 1Z6TA 1J2XA 2HYGD 4S04A 1P6RA 3ZQ7A 5FFZA 2D1VA 4O6JA 5L3DA 4QM9A 1X82A 2MLKA 2P6TA 5JSRA 1CAUA 3H7YA 1FBQA 1D5VA 4EJUA 1BC7C 1TW2A 4A6DA 4HLYA 1YS7A 2FBKA 3NW4A 2J5PA 3REOA 1CAUB 4EGZA 5J6XA 2EFQA 1NXMA 2HTSA 4I0BA 4NQWA 4IF4A 4PIXA 2DW4A 3EBRA 4MGRA 4MTEA 4J1XA 1YWKA 1W5TA 4ZH4F 1B6AA 3V7RA 3WW4A 4EM0B 5ICGA 3WE3A 2XAFA 1FPQA 1FZPB 3GYDA 5JVTA 2OAZA 5K5QA 1RIOH 1CAVA 2RC4A 4R52A 1CX4A 2GA1A 3I64A 3OD0A 4JVAA 5LRSA 3I0TA 4HVQA 4HMZA 2K9ZA 4L18B 4LG0A 1R1TA 3D0JA 1B4AA 1CAVB 1SD4A 3MZYA 1MKMA 4ASNA 2O61A 3W6KB 1MD0A 4QGMA 5KHHA 1IPKA 5D5UB 4YFKF 3M8FA 1O7LA 1TQIA 4DNCA 4LG0B 1MGTA 3V7SA 2G9WA 4UBGA 1FBSA 1F1ZA 3G3ZA 4HAMA 4IHTA 1AWCA 2XHKA 1P92A 2OPKA 2VPVA 4IEYA 3EYYA 2KXLA 1GQHA 3WGIA 4LFUA 2Z99A 4XBFA 1A04A 4YFNF 3IWZA 3BB6A 3CO7C 5E8IA 3OGJA 3CF6E 3IWFA 4G94A 3FMQA 5K1YA 4AVAA 1ZLKA 1I5ZA 3SCFA 2RV8A 1DDNA 4U0WA 1WRJA 2ZCWA 1O57A 3RYPA 1JXSA 2A68F 1LDDA 1YW8A 5BUVA 5KBFA 1WA4A 3NVCA 3QU3A 3KEQA 2PAKA 2EWNA 3R4KA 4E2QA 1J9IA 4AVCA 2J5OA 4MH0E 4AD9A 1U6GA 4G8XA 3SXWA 2BV6A 1FSHA 4I02A 2XIGA 2FQ3A 2FMLA 2IW5A 4Z2YA 1R36A 4BXUA 3ZMUA 3IHUA 5L3EA 2UXXA 4BQAA 4AWXB 4OMZA 1G3WA 3GUDA 4MQ9F 4I01A 2HR3A 4MUVA 3EDPA 1YG2A 3MDPA 1DP7P 2XVCA 2D5HA 4UHTA 1OKRA 5DCMA 1T2KA 2Z3YA 5KVRA 3D5LA 3KGZA 2V1DA 1ON1A 3ELKA 2XROA 4O9EA 2DQRA 2HQNA 5D1IA 5E1RA 1CAXA 2GXGA 3QAHA 5DCMB 3I7DA 4LK1F 2DPDA 3LFKA 4XRFA 1J1LA 1ZNPA 1XSDA 2PQQA 3AAFA 1FT9A 1CAXB 1IN5A 2Z9OA 4L0ZB 2Y48A 5LHHA 3SFZA 2B0LA 4CZZA 3BCWA 4EWDA 4RB0A 3WW2A 3QRFF 1RZ4A 2IXKA 5BV6A 3L00A 1FX7A 3IRRA 1FWZA 1O5UA 3L2HA 4U0YA 3KSCA 1P4WA 2H6BA 4QM8A 1DGRA 2QNKA 3QP6A 3CUQC 1Q43A 5J7MA 2MC3A 3IIAA 4IEZA 2CO5A 2VC1A 2CW0F 1T98A 3H9AA 2RQPA 4MV2A 2EA2A 2D2WA 2BGCA 2IT0A 5J8CA 3I59A 1ZZ7A 2QUFA 1D3YA 1IUYA 3FXRA 1MJBA 5AONA 3KGLA 4NVPA 4EV0A 3ECHA 1IN7A 3DP7A 1B1BA 1ZX5A 2IXCA 3IKTA 1R5HA 5CU1A 1R22A 3I59B 1TQPA 2NNYA 5LGNA 2ADUA 2V1XA 4KMUX 2L4MA 3CJNA 2MHFA 5H6RA 4EM1A 1IN4A 1USSA 3M9AA 2NNNA 3COAC 2GH2A 3O14A 3TDUC 1VR3A 4IESA 2M45A 4QGLA 3KP6A 4O9GA 5LEKA 5FPXA 5HOOA 2O6GE 1SEFA 3RYRA 2JTVA 5LRRA 3P7NA 1WKMA 3BJAA 2L3DA 5D4RA 4UUVA 1ZZBA 3WG9A 4Q0VA 2CG4A 5ERIA 4L2NA 4ENMA 2ISZA 2ET1A 1G6NA 2E1CA 4NHJA 3KFWX 5J8FA 1K7AA 1EH8A 4AVPA 3I4PA 3DEUA 4KIBA 2KIMA 5E1WA 2LSOA 5ICEA 2ZKLA 3U11A 3S7EA 3O3KA 2LDUA 5TJJA 1RL3A 4LJZF 3ZP5A 1HW5A 1XB4A 3H50A 2QQBA 5CVRA 3J80Z 3R61A 5L3BA 5D8KB 4ESBA 4HQEA 1BM9A 5CYVA 3SCGA 4IXAA 1SD7A 1YFYA 2Y0OA 5T3NA 3T8TA 4PCQA 1YFWA 3NQOA 3P9IA 3G7DA 4YIIA 2Z33A 3GFJA 2M30A 4IEWA 2DQLA 5L3CA 1PM7A 4UV9A 2QVSB 3EYIA 3F8NA 3MQ0A 1UCRA 2WFPA 4EGYA 1SAXA 1FP1D 3HYIA 3LZZA 3OCPA 2O8XA 4OLLA 2EJRA 4XFHA 2Z69A 2R3SA 3EHKA 1ZREA 1V4RA 2DT5A 3CDHA 3FE5A 1IXCA 2FRHA 2Q1ZB 1PUEE 2N7GA 1XSVA 1QQIA 1CGPA 5E8GA 2K0GA 1EYBA 1FLIA 2IVMA 3M8EA 5HS8A 4B09A 1Z7UA 4XFAA 2P4WA 2MD5A 4KWLA 3ZMVA 1ZG1A 2ZFWA 4WWCA 3CTAA 3SHFA 4JTNA 4ENNA 5FDBA 3H3UA 4HBLA 1D8JA 2Q4SA 2K86A 4EWEA 4FAHA 4CHUA 2EFOA 2OZUA 3SZPA 4HBNA 2Z5UA 3MFKA 1O7FA 3Q9SA 4P96A 4EQQA 2OYZA 1Q1HA 4META 4M71A 2DFIA 2JZYA 5EZWA 4YFXF 3IKVA 5BY5A 2QZ8A 4RB3C 2XAQA 3GZ6A 5DD4A 4HLTA 3UKNA 4P55A 2CV6A 4MGKE 4L5JA 5LEJA 2RDPA 4H0EA 5FGMA 4ESJA 3ES4A 5D5VB 4XF9A 4G6DA 3HTUA 4YYOA 3K9TA 3C3WA 3ULQB 4MNUA 3ZN1A 3F8CA 4K2EA 2CQKA 1QY4A 1FXZA 1ONVA 2B8MA 3TNQA 5EEGA 4GCVA 1STZA 4WXHA 4B8XA 1QXRA 2PTMA 2F5DA 1KGSA 3RPQA 5E20A 2PBIA 2H0VA 4N0BA 2ZNZA 1QNTA 3H1WA 5I8TA 3O6BB 5ILUA 4EJOA 1JUHA 1USTA 3RKWA 1Z1DA 2H94A 4F7ZA 2DI3A 4HDVA 1J5YA 4IHSA 3V8LA 4A12A 4MEYF 4OOIA 4M9ZA 2O0YA 5K5RA 1HKSA 2D40A 2EFPA 3DQVC 2ZBKA 1GXQA 1BBYA 3EUHA 1BI1A 4UXNA 1T38A 2OZJA 4M6YA 1UHMA 1U5TA 4XETA 2QVOA 4GXOA 3HQXA 1OPCA 1U5TB 5D6EA 2VE8A 4YARA 4KU7A 3DPTA 2E7WA 3N4MA 1SD6A 2K27A 5FD6A 2UY8A 3USSA 1REPC 3V7CA 3J7AO 4HQMA 1ZZCA 3T0YA 4KNYA 4KA4A 2AS5F 1ODDA 4LLOA 2O03A 3LAPA 3ZMSA 5J48A 5K8SA 3K1MA 1V3FA 4Q0UA 3I5UA 4XFGA 5E18F 3ZPLA 1B59A 4KU8A 3EJKA 3SZTA 3KMHA 4ZU7A 5I0SA 3WTZA 4I0AA 4U7BA 5FO5A 3ZMZA 4XFCA 3BPXA 4LMYA 1H1IA 4WX9A 2V9VA 4UVCA 2MLGA 1XN7A 1UB9A 2XRNA 1LJ9A 2VQAA 3I54A 4YRDA 3H1MA 2EA7A 4WVZA 1ZLJA 4WCGA 4EM2A 2GC2A 3L9FA 3GFIA 1ZGJA 1LB2A 1YTYA 4ZYEA 1U78A 2LNBA 2OQRA 4HZFA 1XGNA 3WTXC 1JE8A 5FB2A 2I45A 2FA5A 2GZWA 1BN5A 2KJCA 2PI0A 2FE3A 4U7DA 4KWKA 2FEZA 1YYVA 2YX7A 1TQ5A 4CDGA 1F5TA 5I0TA 2RNJA 4QXKA 2UYBA 2F2EA 1ZYRF 1YS6A 2OQGA 2VXZA 1LR5A 2IA2A 3WGHA 1UCXA 1O3RA 4PZJA 3ML6A 1FI2A 5JAXA 1BJAA 3O2PE 4O5VA 3JSPA 4ZU4A 1YW7A 3M70A 3EQEA 1FOKA 3BZ6A 1X8MA 1ZGAA 4HVOA 2FBHA 5HDKA 3TOAA 3G73A 2GA2A 5BQTA 2OD5A 3V4GA 3FWEA 1KA8A 2FNPA 2M8EA 4YNIA 2P5VA 3BROA 2GC0A 3VEPA 1LVAA 1X8EA 4PDKA 2RN7A 5I0RA 1IRGA 1YUDA 4PGHA 3E6BA 1ZRRA 3KE2A 1I1GA 2PMUA 4Y15A 1ZARA 4IERA 3P9CA 1G4DA 4A0YA 3TO9A 3NKTA 1EY2A 1S7AA 4KDPA 5KHKA 4D7TA 1J3QA 3RDIA 3WU0A 3DF8A 4WK8F 1HKQA 1NHAA 1XMAA 2XASA 5FPZA 1R5GA 3QPTA 4HX8A 1PMIA 4LUMA 4P9UA 1SFEA 1PDNC 3S0MA 3HUGA 3GX4X 5F6FA 1WSUA 3KEOA 1FC3A 2IJLA 3L2CA 3H7JA 3Q5FA 2XLGA 1DZTA 2VT3A 3MPBA 4Z07A
chains in the Genus database with same CATH superfamily
1DGRN 3KM5A 3QODA 4JRAA 3GM8A 1PK6C 4YW6A 2VUCA 1POGA 2VKVA 4XN3A 5KHIA 2X0LA 2DTWA 5DXDA 1JS9A 1IW7F 2D5FA 2EVXA 4K8RB 3KX2A 4M6XA 2K7LA 4H3WA 1IS5A 3JTHA 3ECQA 1VB2A 3GHNA 3KCCA 4MLOA 3QOPA 3S32A 4KG8A 1UY4A 1DP0A 3V0AB 4NRMA 1MS1A 2DFFA 5FZOB 3F8MA 4ZY9A 5IW0A 2TNFA 1W9TA 4IEUA 1QDCA 1I6XA 1RUC2 5JXIA 5DZEA 2RS13 2AQEA 2IWGB 4LGWA 1FOD1 4JKMA 1OA2A 4A7ZA 1D0ZA 4C2MJ 4KT5C 1RUI3 1IQAA 1QXPA 2I07B 3LAGA 5K5OA 1VALA 1Y3TA 4B4CA 3KP2A 3WP4A 2OQ7A 2AC1A 2R063 4UOJA 3OBRA 4Q47A 2FCUA 1OYIA 1RESA 1FOYA 1O6UA 4RM3A 1BYHA 3H5RA 2WAQN 1S4CA 1HRV2 1SLAA 4K20A 3ELNA 5FKMA 3OIPA 4I7HA 1XMKA 2R7UA 2FDJA 3M3IA 4RFRB 2ECBA 1ZBA1 5BOXA 3VN4A 1B9NA 2DOAA 4KIFA 3HJRA 1CIWA 4X6QB 2VKDA 3S16J 4AVBA 1MNEA 1GKBA 1OQ1A 1JN2P 2DO7A 2XUEA 1JGSA 3BKZA 5FPVA 4AGRA 1HBXG 2IS4A 4XORA 2WV1A 1MVEA 3IZOA 4M3CB 5A7NA 2XLFA 3BZCA 3IV5A 4CXWA 1BK1A 4HYEA 1PGSA 4L0YB 3H3VK 3F23A 3RYKA 1C5IA 4XF3A 2EFNA 2IVIB 1OC1A 5FP7A 3OS1A 2OIIA 5FZ4A 5C8CB 4IETA 5EFUA 4A3JJ 4OI0A 5IP9J 1KJRA 4NPLA 4D69A 4A3BJ 1RINA 3I58A 3FISA 4P9WA 5GZFA 3MHZA 1GNHA 1AR63 5CLSA 3AFGA 3ILRA 4IDZA 2RVAA 2N8GA 1ZVFA 4KNCA 1O4TA 1OUSA 3S93A 2GBYA 4BJ6C 3UV9A 1QVTA 2UZKA 1GZCA 2JDHA 3OEAA 2XL7A 4QHZA 4XKVA 1JTZX 3PFIA 3P5JA 4KI5M 5LY2A 4OIRF 1AKHA 1QHDA 2WA4A 4RLQA 3VYRB 5IT9K 1U5TC 1EJ9A 5D8AA 1X2MA 3U1KA 1XTAA 5A2QK 3HB9A 4I30A 3ZFEB 2ZHMA 4BK4A 4CUBA 1MMNA 2VZVA 1EH6A 2ZNYA 4HSLA 4RHV2 5B4NA 4RDUA 3CJXA 3HRMA 3JSOA 3T2OA 4UNOA 3MFAA 1S0BA 4K8FA 3RI4A 4ZYGA 1SPPB 1VMJA 3PNYA 5ERLA 5JR7B 2XPJA 2FOKA 4Q0QA 1R23A 2ZMEC 2K4BA 5JXGA 1FTZA 3KV6A 4FO9A 2ZGNA 1CJDA 1YXWA 3HWJA 2FQPA 2ZC2A 3DLAA 2E36A 1LHWA 1H1MA 5EG0A 5IVEA 2X4HA 5IT3A 1VE0A 4XTMA 1J1TA 4L11A 2BUKA 3KZ4C 4CU7A 1V5EA 3HNYM 3KYLA 1MR5A 4AF9A 3GW2A 5L9BA 1BR2A 3HN3A 1I27A 1CVNA 2FDGA 2K2SA 4IEVA 4WM8B 4QLCU 3RGBA 5FQ0B 3A4CA 5FLIA 3TEWA 2GN7A 1G9CA 3GBFA 2E33A 3KIOA 3E6CC 2QQVA 3F21A 2VBPA 4PLMA 3ZQQA 3K1NA 5J1RA 4YVWB 1BVP1 1U5XA 5FZBA 4ASMB 2B9SA 4HDUA 1IXSB 2A3XA 1APLC 2OTJI 5FMBA 4BQNA 2EV5A 1UXZA 4A93J 2YC4A 4CICA 1UMQA 2PAMA 1K6YA 2DYCA 3FMSA 1G9AA 5FY7A 2ZSHB 4NE9A 4QTRA 4YVSA 1BIAA 3R6SA 3JRHA 4AI9A 5APAA 5IK8A 3ZN6A 3R0JA 5KHJA 2HYFA 3I56I 4NWVA 1EP0A 2HWF1 4CDUA 1Q8QA 2JWPA 4BH9A 5EEHA 1XNKA 2Q0AA 3RIRA 1YFXA 3AP9A 3ABMH 1Q3EA 4OINF 2D44A 2ZMKA 3HR9A 3ZYFA 5DS9A 4CDWA 2HS5A 1UXXX 4RA2A 4XFIA 2ZJCA 2VXRA 3LSTA 2LALA 4LO6B 1D4M2 3PUBA 2Y6JA 2V5DA 1AHDP 3VBOA 1N3OA 2O1QA 1UOGA 1W8ZA 4GIQA 2P0WA 4XJWA 1ULDA 1BKZA 1OMIA 4XABA 3VKOA 3TAYA 5JI6A 2JJ6A 3T0AA 3J81Z 3GF2A 3K2ZA 1W03A 3WD5A 4PJMA 1YFUA 5D4SA 3PTRB 2ARCA 3I2GA 3RI8A 2D6MA 2DVGA 1K42A 1IO2A 2Q30A 4XQWA 1QQP3 3ZYPA 1F5JA 3RNSA 2IGNA 2KRHA 1W2NA 1W0PA 3CBNA 2YROA 5C3SA 2IZWA 2L5QA 4Y24A 4EMSA 4OIQF 4AIJA 2IP2A 3ZMOA 2CFOA 4Q48A 2R7SA 3JCUC 4OMDA 2WS91 1DYPA 2BOJA 3K6GA 1Z7LA 5D6FA 1UPIA 1ZRIA 2RS32 3WF3A 3QACA 3BPVA 2Y64A 2AO9A 1FNYA 2V6CA 3JAMK 1MQTC 1TMF1 1A8DA 2LBFA 1FBUA 1KRIA 1GZTA 1V70A 4XDPA 2KFDA 4N53B 1MS9A 2MA3A 3RG0A 4J1WA 1AOYA 1HX6A 2H6CA 3B69A 2A71A 1U8RA 3HPHA 4AUXA 2XBO2 3CD6I 3AMQA 3JBG2 3FM5A 5ILVA 1W6QA 5F39A 4AFCA 4UVAA 1LOBA 3BOPA 4DEQA 5BNGA 4AVSA 3CZUA 1Y1VJ 4CE8A 1EV12 4MTDA 5CISA 1ASJ1 5E1XA 2ZEWA 3CP2A 1ULEA 3HSFA 4OFGA 5J1XA 1RC9A 1H9WA 3T8RA 3NRVA 1OA3A 2Y6LA 3VLBB 3A23A 4NHXA 5C8CC 3MYXA 2CAUA 1U8BA 3RVHA 2CH0A 1IZ1A 1CX1A 1CPNA 1CF7A 3OY8B 2FNAA 2HXIA 2ZTNA 3H3ZA 2DK5A 4WXDA 5GLZA 1PGW1 3GALA 5EYXA 2ZKZA 1TQMA 1QU0A 4OHYA 5FROA 4PDWB 1G3TA 3D8CA 5JHUA 2OUMA 1TTYA 3BTYA 4BEHA 3NL1A 3ZDSA 4QX8A 2QM3A 4CDQA 5A7PA 3C7EA 3I3MA 4KFCA 1W7PB 2P34A 1BW6A 3BTXA 1Y9QA 3ZFEC 2EICA 2F5VA 2BY0A 2X5IB 3T1MA 5IVBA 1SLIA 5J09A 3ZQFA 4IRHA 1W9FA 1QZYA 4JQTA 3AK0A 2Y9YA 3POBA 1Y8RB 4ATEA 4LT5A 5A1LA 1TWFJ 1MZBA 1KS5A 1VQMI 1VMFA 5JIAA 4C9YA 4HKWA 3RJPA 5F04A 1X4PA 3VHRA 1FOD2 1J83A 1COV3 4BS9A 1GYKA 5IYDJ 4C30A 5FP3A 3VDAA 1DQ0A 3F8BA 3B93A 5DV5A 3BG3A 2CJJA 4Q29A 1SD5A 3BJOA 5LHIA 2J7MA 3SEZA 3HOXJ 3PIJA 1CAWB 1SFYA 3TP0A 4AQ6A 1RXFA 1I1EA 4AAXA 1G9BA 3CCLI 3KF5A 2XSDC 4WM8C 4DBRA 3JD73 2HZTA 1V6MA 5AIPA 1YLLA 2FCTA 1WJEA 1ZBA2 2C9AA 1ULOA 2WY7Q 4IL6C 2WLPA 1D1BA 2CV0A 1POV1 4MHRA 3PNTA 3G1LA 4S0HB 4YVWC 3TGNA 3WUDA 4LOCA 3BR0A 3GCWA 4NRPA 2KKOA 4L9NA 1YC61 3LSMA 2F5CA 2E2IJ 4CP9A 3H42B 4AFDA 4B43A 1JZ5A 4AVTA 2HU9A 2KHMA 1Y8QB 1L3LA 2KJBA 2DVFA 2R7TA 1GUIA 1D2QA 3CO6C 2QQNA 4HK8A 2P3YA 3BC8A 2H1KA 3BU0A 1VBC3 2WN3A 1UKGA 2BBVA 2P17A 1DDLA 1UOFA 4NIIA 2BZTA 4URAA 1NCRC 3ZMDA 1SFNA 4A5NA 1OYYA 3D82A 2WWJA 1ZRFA 4NPMA 5A80A 2IA1A 5HLGA 1DGLA 2X51A 3VKLA 3OYGA 1Z7S1 5CFDB 3OTFA 2NP0A 3ENRA 3RQ0A 1K4TA 2W94A 3GZUC 4BWOA 2P81A 5FP9A 1HKTA 3MIDA 3KETA 1ACCA 2NS0A 3NJVA 2FXAA 1LHVA 4A7YA 4EN9B 1I3AA 4HW0A 2ESHA 3LEMA 2O14A 1MJ9A 4Y7NJ 5DAVA 3W9AA 3PIOF 5GZEA 5CKNA 1HB2A 5JSOA 5K0UC 2XGEA 1PVXA 1RUOA 3OGGA 2UWCA 2R7WA 1Y9GA 4KISA 3S6PA 3ZSMA 2BNMA 1RUJ3 3WW1A 2HKOA 1VPHA 1BHGA 1Q56A 1W8FA 2Y69H 4LB6B 2WADA 2IAIA 4OI4A 2JPBA 2DA3A 4LULA 3D5OA 3N9QA 4B3AA 4RR3A 2LVSA 1FX5A 4OMYA 4OIPF 3K51A 2XJUA 3ZMNA 4PJYA 2EIEA 2Q1FA 1S3JA 1XGSA 5A32B 4Z8BA 2PN6A 4IQPA 1JJ8C 1JKOC 3NNMA 2MPFA 3I4IA 4QX2A 4BQWA 2FOWA 4UV8A 4BY1J 1UHSA 3IAPA 2F4IA 3MZ8A 2VJ5A 4RGRA 3B01A 2XF7A 1DQ4A 1W4MA 2F4PA 1YNAA 1S29A 2C5DA 4B4PA 1DYOA 1JOJA 2P6SA 1MJAA 4QPIC 3KYCB 2PFWA 4HFSA 2P6HA 4LLNA 3OMYA 2YU3A 5A70A 5JMOA 2QQPA 4FOWA 3HHHA 4IV1A 4O61A 4Y1XA 4D94A 5FCCA 1REEA 4UXAA 1RJ8A 2R043 3TYJA 3N35A 2VBYA 1H6YA 3OYMA 2GU9A 1QHHD 2EV6A 4IQJA 3BG7A 4Z1VA 3A03A 3WX5A 3VBFA 1KQ9A 3TL4X 1GZWB 3WP3A 4CCDA 1GWKA 4F92B 2HWF2 1QZZA 1MDMB 1U5ZA 3WP6A 4AIDA 2Q0OA 5C3PA 2OX0A 4GWJA 3MLLA 4YG6A 1WWXA 1XNTA 2A6TA 1ZG3A 3OV8A 2COMA 3ZFGA 4KT6A 4Q2FA 4QQHA 3JU9A 1F15A 1YRNB 4B1RA 2F4MB 3WTYC 3BY6A 3GFLA 3HM5A 5H6QA 3BTIA 4PDWC 2Y6HA 1SQ4A 3BALA 2WTEA 2L01A 4PGGA 2XGXA 3H0GJ 2VC0A 1SHWB 2HYKA 2J1VA 1FYLA 2BZDA 2DA4A 1RUH3 5GAEJ 1SBEA 3FXUA 4A3EJ 4XQ4A 2X5IC 3AP5A 2ZO4A 3ZX7A 5E6HA 1W2OA 3GZNB 1BQPA 2MEV3 3ISPA 3WUCA 3GGLA 1AJKA 3CMMA 2JSCA 3IB3A 4CEWB 4P08A 3CJIA 2VT2A 5ILSA 3ZXKA 1YW9A 4II2A 2FDHA 1W06A 2XJQA 5LK5A 4E4ZA 4MGYE 3TEZA 1N77A 5JCTA 3HT1A 1RKWA 4B4RA 3HKZA 3WDUA 1MH3A 2JDNA 1O8SA 1LESA 4HV5A 3AM2A 3HT2A 4WZFA 2JE7A 2WS92 1T0FA 2RJKA 3TO7A 4RB2C 3TP3A 2JDAA 3PUFA 4NC8A 3ZMTA 2OZ6A 2Q2EB 3JW4A 2XC7A 4XL9A 3NAUA 2VH9A 2VBDA 5EPAA 3M7GA 1HKDA 1DCSA 1TMF2 3ZXJA 3OPZA 2GXBA 4DYQA 3HSRA 4GYIA 3CCYA 3WU2C 3FJSA 5IVYA 4QPWA 1QJZA 5FXWA 4S04A 3MUZ1 5FFZA 2VPLA 5F2WA 1TEIA 2GNTA 1X82A 1WW4A 5JSRA 1FBQA 1GWLA 4QD2A 1W9SA 3WDVA 1G86A 2YG0A 3PVOA 1JJ6C 3B9CA 2DMPA 1YS7A 1ASJ2 1XU1A 3FUOA 1V6KA 4CVUA 5J6XA 3ZYHA 1NXMA 2HTSA 4I0BA 2VOVA 4NQWA 1CR7A 4WVMA 5EDNA 4AC0A 1LE8A 3VSLA 4MGRA 4INDA 1YWKA 5GZDA 3V7RA 3WW4A 1XPWA 4GJYA 2YS9A 3WE3A 1JGGA 4JGYC 4ARXA 4ASKA 1FZPB 3GYDA 1H8AC 2X8KA 5JVTA 4Y33A 2RC4A 2BVMA 1X36A 3KCYA 3AFHA 4Y26A 3I0TA 3W21A 4HVQA 2PJRA 1NCQB 4QT6A 1PGW2 2MABA 4QIWN 4TWTA 4X1EA 2NXNB 2YFZA 4OI1A 4L18B 2L7ZA 1B4AA 1CAVB 1MKMA 2O61A 2X6OA 3W6KB 1IPKA 5CFDC 4FTEA 1O7LA 4IE5A 2EIMH 1X3WB 4LG0B 4ZZ8A 3OUJA 3HC7A 2D97A 1R081 1OLTA 3O1VA 4GRIA 4Y4RA 4J19A 1OFSA 1FBSA 4IHTA 1W6PB 4C2UA 2QQMA 1WJDA 2WFF3 1Y1WJ 4MXVA 2OPKA 2VPVA 2KXLA 5FXZA 2WNVA 1A04A 4YFNF 1OCRH 3KV5A 4G3YC 1QJU3 1XC5A 2W87A 4E7IA 5K1YA 4IXLA 1ZLKA 4E8CA 2DF7A 1DDNA 1O57A 4XMAA 1LDDA 2Y6KA 4C91A 3CESA 3KHCA 1H8TB 1W28A 5C9AB 4RAGA 1DU6A 3C2UA 2EWNA 4HL0A 3CCMI 2J5OA 1U6GA 2HZDA 5K7FA 4DB5A 1FSHA 2EPFA 2IW5A 4BXUA 4HG6B 2UXXA 2VM9A 4BQAA 1DP3A 5FO8B 4AWXB 1NK3P 2EAKA 1B35B 2ZHNA 1DQ1A 3D4KA 4MQ9F 3I8TA 2HR3A 4F52A 3RJRA 3FK6A 2VQCA 2VJ4A 3MDPA 3DEWA 5JVGF 4UHTA 1YI7A 1JH5A 3PMEA 1B72A 3ELKA 2VBBA 2XROA 1OHFA 2QSGX 5C33A 4O9EA 3VBRB 3T0DA 4FPLA 3OL4A 4XBNA 1SFKA 3POIA 2QUOA 3LFKA 5EHDA 4UFJA 2PQQA 2CMPA 1F31A 1V6NA 1ZGWA 1FT9A 1IN5A 2Z9OA 2OV7A 1R6RA 2A1XA 3QRFF 2JQ7A 2B39A 3P6BA 4C3JJ 1DYKA 3WV6A 2DTYA 3L2HA 4U0YA 2M0MA 4RFT0 1DGRA 1VBA3 4RQPB 2OC6A 3U21A 1RUC3 4CYCB 3J7YJ 1E5RA 5AC93 2BY1A 2XWJB 5J8CA 3K75B 1D3YA 3CCQI 3ZFFA 2GSYA 1MJBA 1Z7S2 1UY0A 1SLLA 4XQDA 1K5MC 2IXCA 5FYZA 4UW6A 3M3CA 3DXTA 3EXUA 1ENQA 5L36A 2WAOA 1HRV3 3PJYA 2ADUA 2V1XA 4CXXA 4KMUX 2MHFA 1USSA 2NNNA 1MMDA 4IESA 3KP6A 4LBNA 1GV5A 2CQNA 2JTVA 1XG1A 5A3MA 1HXS1 5D4RA 3WG9A 3AMNA 4JC1A 2CG4A 5LA0A 4PCRA 4ENMA 2ISZA 1G6NA 3KFWX 3UGHA 4PFPA 2H0BA 3K4JA 3G2BA 4KJZA 2LSOA 1NZIA 1CWPA 3HAGA 4HEA2 3U11A 1HB4A 5GJ6A 4TYSA 1V00A 2IVJA 4CEWC 4SLIA 4LJZF 1W99A 1JU3A 1JZ2A 1XB4A 3H50A 2QQBA 3J80Z 3R61A 3L2UA 2R5YB 4JX5A 3T8TA 1TZLA 4PCQA 1O8PA 3NQOA 2WB1A 1AKHB 4FPHA 2CQQA 2AEZA 3IAM2 3TBDA 4IEWA 2DQLA 1MEC1 1PM7A 1A6IA 2W48A 2VZSA 3EYIA 4MSVA 2Z16A 4FXGB 1M4WA 4EGYA 5FPLA 4COYA 3GF6A 3ZN5A 1NLRA 1LPQA 3PUSA 2W4SA 2O8XA 4QDRA 2JE8A 4S2HA 4FP2A 4XFHA 2LW8A 1YQCA 2ADEA 4S2DA 2P2KA 2R3SA 3EHKA 2VMCA 1ZREA 4Y1UA 3SQOA 3LSDA 4SBVA 2K0GA 1FLIA 2E7TA 2IVMA 3OGSA 5HS8A 5KXEA 1Z7UA 3CJRB 4MG2A 2MD5A 1HRI1 3ZMVA 1ZG1A 4KWLA 4RHV3 4MADA 3IKWA 1UN1A 1GNYA 4JAAA 4HT1T 4LOTA 1YQ2A 2K86A 2EFOA 4XAAA 3BCAA 3PVEA 5C4WB 4AYBN 4IHVA 2XVLA 2Z5UA 3Q9SA 4IW3A 1EAH1 4H7MA 3ALQA 2DFIA 2LRPA 3VBUC 2QZ8A 2XAQA 4NHYA 4HLTA 3AXEA 3V64A 5FPBA 1Y39A 2CV6A 1NAEA 2W92A 3HTUA 3K9TA 4YFWA 2R5ZA 4UT5A 5KHDA 5G05L 4WVVA 2D6NA 1FXZA 1KJLA 5FY4A 2VUJA 1SANA 3ZR8X 1STZA 4FPFA 4WXHA 1EUTA 4A4AA 2WZ8A 4XRSA 1K3IA 1UMZA 4N0BA 3H1WA 4LBLA 3UJOA 3GJBA 3OSGA 4EJOA 1UZVA 1IS4A 3KT4A 4FP3A 2EINH 1USTA 5IOZA 2H94A 2HNHA 2LK2A 4HDVA 5B1AH 1J5YA 3POYA 4IHSA 3GBGA 4MEYF 2R16A 1PMJX 2DMTA 3JXSA 3Q0VA 4W6WA 1OOPB 2EFPA 3J7ZI 3OEBA 3BR6A 1OVPA 5FKCA 4IOAF 4UXNA 1T38A 3JB4C 2HEWF 4M6YA 1UHMA 1H8TC 1U5TA 5C9AC 4XETA 3WDXA 2WUHA 1OF3A 2KMUA 5EZGA 4UAPA 2O8OA 5IP6A 4XN0A 4J6GA 3AP4A 2E1OA 3S14J 1W8HA 4A3CJ 1W9YA 2XGDA 3IN9A 3H0OA 2VKEA 2YBPA 5D6EA 2VE8A 5JLWA 3JUUA 1IKPA 1B35C 4OWRB 1XB9A 1SD6A 1Z3YA 1X50A 3K1MA 2HI3A 2WN2A 4JDMA 1CPMA 4HSRA 5E18F 3V0BB 2B9VA 1D4M3 3WTZA 3VBRC 4V2FA 4U7BA 3GMEA 4XFCA 3K77A 1N1TA 3BPXA 1H1IA 2DTZA 1MSEC 2VMFA 2XRNA 4FFGA 2DCJA 3I54A 1P7IA 3H1MA 1LECA 4P5YA 5FPUA 2VLAA 5HCBA 4Q4W1 4EM2A 1DF0A 2QSHX 3WHCA 1ZGJA 2GXAA 1YTYA 2P6CA 1WJBA 3R05A 2HEVF 1JE8A 3PSIA 4R9AA 3H35A 2KRCA 5DAWA 2KJCA 3SLIA 4XILA 1D0GA 2QEXI 4CDGA 4RQPC 3CCUI 3VBHB 3C2BA 4QXKA 2VQUA 2LBFB 5FZEA 3C8XA 3FXOA 2OQGA 2RHPA 2JJ7A 2CS3A 1LR5A 3WGHA 3WEZA 3DBHB 2YXSA 5A7WB 4PZJA 3ML6A 4D0QA 1CZVA 2RMU1 4UY8I 2L2OA 3O2PE 3O1UA 1YW7A 2VD7A 2RS33 1VLNA 1WUVA 2YFUA 2DJIA 3BZ6A 1ZGAA 2FBHA 1H2MA 5F5CA 3OBTA 1ITYA 2K85A 1W6QB 2OD5A 4QKBA 4KITB 1KA8A 2M8EA 2P5VA 3GTPJ 5DUVA 1R082 1R092 1X8EA 3E0JB 4FOYA 2HOSA 1IV6A 4OUEA 1HN0A 2XBO3 3JBG3 4XONA 4UF0A 4Y15A 2F4LA 1WCUA 1G4DA 3OYJA 1S7AA 2X05A 4UUTA 3SEPA 2FD5A 3ZR5A 1R5ID 2WT0A 4AI2A 1UYPA 4OUSA 4UUSA 4JX4A 1ZYBA 3WU0A 1HKQA 1E3PA 1M1EB 4W4ZA 4HX8A 5HXMA 1SFEA 2LY9A 1PDNC 5LBBA 5F6FA 4EATA 1W8TA 1TC3C 3ACFA 1RHI1 1S0JA 3K70C 1PNFA 2CL2A 3MPBA 4B48A 4Z07A 3TN91 3R4UA 3WNNA 3WG2A 5D8AC 2VNGA 5LBCA 4BQ1A 2I10A 2JDKA 1RIRA 3IDAA 5F5QA 4JZRA 1C28A 2R7DA 4QSHA 5L3GA 1LOEA 2VZPA 1KQRA 3V0AA 2WQ4A 2HWE2 3WNXA 1BI3A 2LD5A 1XSXA 3P1IA 1KU2A 2PHRA 1N78A 4AG4A 5I93A 1V6OA 2LH9A 1X1AA 4K9SA 4W8JA 1HW1A 3T5XA 3NNJA 2LREA 2O3FA 1F4KA 2QBYB 3HGYA 5B66C 3WU1B 2K4JA 3FZ3A 2ID6A 4ESFA 1TP4A 4BQ5A 3VFZA 4L97A 2AXLA 3FK7A 3MIBA 4G6QA 5B1BH 1MS3A 2ETHA 3I2HA 3SITA 2EK5A 2PMHA 4RS5B 2VB6A 2VUMJ 1CZSA 2I2SA 4NHKA 1DQ6A 1DGWY 3HOTA 2QQIA 1RR7A 2PQ8A 5C4WC 4YW4A 4OU0A 1WMDA 2VE1A 2IC1A 4AQTA 3A0HC 4RB1A 3PL8A 5JWPA 2PHTA 5JI9A 4RYDA 3U75A 1Z6RA 4IEXA 4L99A 3K69A 2EA4A 5I0DA 4LIUA 1FOD3 3OB8A 1OCCH 1K61A 2X1EA 5E16A 1R1UA 1W7PD 4XLAA 3ERED 4CUAA 1WMEA 4ZHNA 1OT5A 3D6EA 5BS6A 2W5FA 4KGGA 1AX1A 3WTSC 5A6YA 1O5LA 4M3CA 3RI9A 5FFXA 3WTWC 2R0HA 1ETXA 1KQ0A 5JMCA 5DQ0A 3U1DA 2K3FA 2KIUA 3FL7A 5KR7A 4KN4X 2QZ3A 4LORA 3PO3J 2DBNA 5LY1A 2BGOA 1QVUA 5C8CA 5GPCA 5FV3A 1ZBA3 3PU8A 3VB9A 1Q8OA 2V73A 5E79C 2ID4A 4MXWB 4AL9A 1HXS2 4BXSV 1SLTA 3B9IA 4YVSC 2D43A 2XB6C 1SFUA 1AL21 3IDEA 1JZ7A 4QB6A 1XMXA 4I99C 1FP2A 2Y26A 3HEFA 4R4ZA 1S2BA 3RKXA 1OOPC 3DN7A 3E6MA 3WDYA 3DUIA 1BIBA 4MFDA 4CDUC 2VVFA 2EAAA 5JLVA 1F4AA 3UGGA 5I8YA 2QWWA 1KQ8A 2A5WA 3N05A 2X6XA 4FFFA 5FY0A 4AFBA 3L7WA 2BVBA 2XVKA 4TN7A 2ACJA 3ZFEA 1KYWA 4IHYA 4YM2A 5F08A 1P9QC 4Q0PA 5I0UA 4WZCA 3UKVA 4ISQA 1MEC2 4ZZDA 4Q4ZF 4PK4A 2K9LA 5CVIA 2F5EA 3WG3A 5A7OA 3VBOC 1IZ3A 1ND3B 1Z05A 3N9NA 1W39A 3IM0A 4IEOA 3N3HA 2L4AA 1BL0A 3O0XA 4ZDLA 3MLJA 2XWBB 1SPPA 3FMRA 4E6KG 5FZGA 3TQNA 4LBQB 1TT0A 2JDPA 3SXYA 2V5YA 1YO5C 5E3LA 2X10A 3UNPA 4LBKA 5FZKA 1UIJA 4XSZF 5H2FC 1ULYA 3HD8B 2K40A 3HOSA 5ICCA 1R1VA 1EUUA 5BNNB 2ZJRF 1ST8A 2E60A 3HG9A 5EJCA 4UBHA 4CCOA 1OR7A 1PP7U 1HRI2 4XK4A 5CADA 2CAVA 1JT0A 3O1TA 2W57A 3OS2A 2ZX3A 4WM8A 3HN1A 2Y0MA 4IHXA 1S0CA 1NY71 1EAH2 2YHJA 3NNFA 4M0HA 2DBBA 4IE7A 3M2MA 1C5HA 1F5FA 1W6OB 3LSIA 1FATA 1NKGA 1O4YA 3FZVA 2LKPA 4QPOA 4YVWA 3VBHC 1PVC1 5L73A 2HDCA 4QQLA 2AYHA 2JXAA 2W39A 3KP7A 2MG4A 4CZCA 4E9KA 3TEYA 1LOCA 2M4KA 3BJ6A 1A35A 1TNTA 2DV9A 5LD2C 4Y1ZA 1JYWA 2DMUA 2QYOA 3Q0UA 3GZ5A 1MVQA 5FFOC 4FCAA 1LFBA 4G7HF 1ZRCA 2HYJA 5IY5H 1N3QA 4FAGA 1C8M1 3ZXEA 2QGUA 3OY9A 4AEJA 2GP5A 3OYKA 2V4VA 2ZEYA 5IK7A 3SDGA 4QPYA 4LO8A 4BYYA 4B29A 1HDDC 2OU2A 3LIGA 3VD5A 5CKMA 4QWNA 3ILNA 2XKPA 3BQZA 1K4SA 2WSUA 4IV1B 1LGBA 1Z21A 3SH5A 4C1XA 3S2HJ 1JI6A 2ZAHA 4HVRA 4R79A 4ONUA 1J3RA 1URXA 2B63J 3GTLJ 2QE3A 3NSTA 3CEWA 2KPMA 3I4MJ 1W2UA 1OI6A 1AX2A 4NWWA 3H5NA 2HOEA 1HIXA 2QBXA 5LGUA 3DTEA 1FOXA 1XCBA 4EVIA 4ENKA 2X53S 2W84A 2XAHA 3K4MA 1X1BA 2MGQA 2JB8A 2IRFG 1QA6A 1OQYA 2HWC1 1LOFC 4MGZE 4KMFA 3DL3A 1RVF1 4LEJA 2HXOA 1T39A 2HWF3 4IOCF 4I09A 2DCKA 3ES1A 3OYWB 3PQJA 4O65A 3BR2A 2PXJA 1HSJA 3WHTA 5DDJ1 1LU2A 2ZJ2A 4PIYA 1IRFA 1S0IA 1C8NA 1SZBA 2DOEA 3HIFA 1DZRA 1US3A 1BI2A 4Z6YA 2GIVA 4A44A 1D8KA 2PELA 2F6CA 1L0OC 4V2GA 3K4KA 5L7OB 3BG9A 2YU1A 2YB7A 2LMDA 4LB5A 4KYWA 1KYZA 1QH6A 4NHLA 5CQEA 1WQ2A 2TEPA 2RNGA 3GFMA 4A3GJ 3PNVA 2VBXA 4LHNA 4Y5SA 1ON2A 3NAPA 4B8EA 2LF8A 1K79A 2RQQA 2RKHA 2ID3A 1R64A 4Q4W2 2ENRA 4OQ8A 2R1DA 4KICA 4RS5C 4NC6A 3ASNH 3CNAA 4IX7A 3S1QJ 1FY7A 4QX3A 4I3GA 5FR3A 1J59A 4KUMA 2XUBA 5F64A 4Y1VA 4N53A 1YX5A 2GAUA 3HRSA 4XFFA 1Z78A 2PQSA 4AEKA 3RZMA 4D7YA 3LEKA 2WS93 1O3QA 1XGMA 2B9UA 5HLHA 2VCCA 2RMU2 1UIKA 2JIGA 3E97A 3J81K 2IUWA 1XOYA 4FQ4A 2IGMA 3H3LA 2ZOEB 1OURA 3WF2A 2DTRA 2ZAAA 5L9RA 1UFMA 3LD8A 5CEHA 1LNWA 1TMF3 2Y8KA 4L5EA 4FFHA 3WNKA 5A7SA 1C3HA 1YQAA 3SH4A 4UWDA 5F0FA 3FFQA 1S5LC 4A3ZA 1UY2A 2WWYA 1LJ7A 1E5SA 1V6LA 3I53A 3OY8A 5HVQC 3FUQA 5J4YA 3W2VA 5H20A 3E5XA 4DOUA 4FTBA 1X1CA 1OCOH 4M72A 3BIWE 3AYEA 2CFXA 3B00A 2JN6A 2M87A 1TNSA 3Q8BA 4CA0A 2LY1A 5K7HA 1RRJA 4XVHA 2IXJA 5LGTA 3DXUA 3FHIB 1ASJ3 4DJAA 1LAJA 5J1YA 1UHWA 5F1JA 1FPN1 3WTVC 3MIEA 2JA2A 2KZGA 3L9JT 5BPDA 1W7PA 3WZ1A 2G4IA 4BA6A 1IG7A 1RHI2 4AQSA 3D0SA 4FX4A 3HDDA 5KXBA 3TN92 2PEXA 4NR1A 2VMEA 1SMYF 3FXJA 1BA5A 1NE6A 3I2IA 5EF6A 1ETVA 2E71A 4XUOA 3N97A 4MOAA 1ND3C 2XAGA 4P1WA 2VAUA 3J8F3 3UYJA 1UY1A 4LA2A 4OHZA 4D8MA 1W3VA 4U88A 3VBSB 2DUOA 5M3FJ 2BPA2 3B73A 3DPUA 3WY6A 2ZJQF 1J84A 5FUNA 1WH5A 1UX7A 1P4AA 3N7LA 5CB7A 2YU2A 1F35A 4OI2A 4D3WA 5BNNC 5FREA 4P00B 2XB0X 1H4GA 3POGA 1CAWA 4FHTA 1HV1A 2Z1DA 2LG4A 4LIVA 3MV01 3I9V2 4R1HA 3RZDJ 2ETEA 4DINB 4Y20B 2QENA 4JGZA 4RR3C 4XF4A 4XTPA 4UFHA 4CA9A 2PHUA 3F8FA 1B8IB 1RC6A 2G0EA 2NRAC 1BOAA 3OBAA 1UMIA 1Q1VA 2R7ZJ 1PP8F 4AW7A 4AU7A 2BNOA 1NUKA 1B72B 1O4XA 5HDNA 2GQQA 1QO0D 1VQKI 2VOOA 3PTYA 4YW5A 3LFMA 3U2RA 1UU4A 2E1NA 1K12A 2WWSA 4IKFA 1A78A 1DIWA 2V79A 3O5SA 1YYNA 1UKRA 4XJAA 2X1DA 3S1NJ 1UZZA 3H8UA 1JHFA 1HQNA 5JI7A 5A2QZ 4IV1C 1GZ9A 1POV3 5FLXZ 3I55I 3ABTA 2EZKA 1U12A 3LGRA 1AL0G 3K3NA 2UWAA 2JDMA 4LITA 1AL22 1ZBE1 1PZ7A 3AMHA 2IFRA 4AYUA 2X29A 2HQRA 3VPRA 4QX5A 1E0EA 3H0DA 3AZYA 2JG8A 5T5LA 2BWAA 4UVBA 4PSWA 1Y43B 4RD7A 3CKHA 1UZYA 2ADDA 1RITA 2ZJPF 3KB5A 3AYCA 4EYUA 2FUG2 3S17J 1BK0A 4H7LA 3VDBA 1HXDA 4A3XA 1BLZA 2TUNA 4PFOA 3UK9A 1SCSA 5JDBA 3IBMA 4TXWA 4CGZA 2WO1A 2WNOA 5FTTC 4YZ2A 1Z7S3 5M5WJ 3KHBA 5L7OC 4L9JA 4HONA 3HTSB 5FRAA 3U07A 5IFPA 1WLTA 2PN5A 4N90A 5AIQA 3CO2A 1BVVA 4CSWA 1S2EA 4LO7A 2B7EA 4LO4B 5LHGA 3CDZB 2QLZA 4WBBA 4M74A 4XRMA 2BWCA 2WZEA 1I39A 3HZJA 1UD1A 9ANTA 1SEUA 2VQLA 4XF1A 3BIEA 1FIPA 3GTQJ 1IPJA 2FMDA 3F9KA 2DLLA 2JUCA 1AU7A 5A32A 2D93A 2RR11 1EPWA 4II3A 3ZQHA 3PJQA 4P5OA 2KT0A 3AZWA 5HCAA 1NY72 4A3KJ 2CDOA 2DU9A 4IEJA 1GLHA 4L92A 1IJWC 3H9JA 3I2DA 5D2AA 4GGGA 5EJZB 3DWLE 2VOPA 1QGPA 3H92A 2PAEA 4Z82A 3N7JA 3LQRA 2V72A 1FNNA 2Q8KA 1GVJA 5AFEA 3ETQA 3KP3A 4AGVA 1R1ZA 1LDKB 3WQ1A 2GMPA 2E7XA 1W05A 1FYMA 2B7YA 5J96B 2EB7A 2LKXA 1C8M2 3NV4A 3EQLF 4ORFA 2IA0A 3ABKH 3PURA 4W65A 4BACA 2Y6GA 2XB5A 1ETYA 3RZGA 2WAEA 2HWD1 1QDOA 3NJZA 1GZWA 2K9MA 2BJSA 1POQA 3JRGA 1MDMA 5GZCA 3U4SA 3WSOA 2UWBA 2YDEA 4Q4Y1 1TBXA 4MZUA 1QBJA 3TEXA 4XJUA 3VZOA 2XL9A 3A01A 2G19A 3K70D 3HSEA 4LMFA 4OAYA 4BNCA 3W6JB 1GVDA 1PO11 4RGUA 1HSTA 1OD3A 2M7AA 1E2XA 3I2FA 2HWC2 2XKOA 2R5ZB 5F1RA 4RAYA 3KV9A 1DPRA 1RVF2 2L9RA 3ZR6A 2HKXA 3K4LA 3P9KA 4ENJA 1W5CC 1TWGJ 3UESA 5DDJ2 4LLGF 4S05A 2VW1A 1Z3XA 2C0ZA 2YU9J 1YLFA 3T2TA 5T54A 4AM3A 1N25A 2HEOA 5FYCA 2WYSA 2I74A 2NVUB 3MWMA 4XEZA 4BAYA 3WF0A 3C7FA 3ZN4A 4JDNA 5CJ9A 2ARAA 3JAMZ 5DCFA 2HQAA 4CEWA 1IF1A 1JOPA 1DZQA 4BDVB 3TB0A 2WNVC 3FX3A 3MKWB 4HF2A 1GNZA 3VBSC 1S8NA 3ZXLA 2RG4A 4OUMA 3C7HA 2CNAA 3HOYJ 2XDVA 5FRNA 2BW3B 1RGSA 3UJQA 1PUFB 3MICA 4DUWA 3OR1C 3TRSB 5DUKA 2BEOA 3LAJA 5IAXA 4GA9A 3JREA 1IN8A 4CYDA 1UF2C 2Q2EA 3GEZA 2ZGLA 1IQDC 3MIFA 2W9XA 4H14A 5A1FA 1A34A 3L2YA 2W1SA 4CCJA 1K78B 1GOGA 1U3EM 2GC3A 5JR2A 5CPRB 3KLNA 4DMIA 2LF7A 5KWRA 1DGRM 3HOBA 1VQNI 1DG6A 5JHFA 2W0XA 2GP3A 1J2XA 2HYGD 1P6RA 2JDZA 2CDPA 4NIHA 4LOSA 2MLKA 2P6TA 3M1HA 3DKXA 1ODNA 4FFIA 1BC7C 4G9SB 3PO2J 1WCSA 3KS7A 4LKDA 5FYMA 3KT1A 1FOWA 2TBVA 1TWHJ 1JU4A 2EF6A 4PIXA 5DAQA 2H8RA 1R4MB 4XOGA 1PGL1 1W5TA 4ZH4F 2K46A 3KYDB 5HCFA 1NCQA 2XAFA 1FPQA 5FO9B 2AUYA 1IPSA 2ME6A 3FKIJ 1CAVA 2XJPA 1CX4A 3W59A 2GA1A 1Z0XA 4XOTA 3I64A 1BEV1 1F2NA 2RS51 5GAGJ 5JXHA 2EQRA 1OISA 2MFZA 4HMZA 1FPN2 3W2WA 4BMEA 1T6GC 2JKBA 4LG0A 1UMHA 3D0JA 2MC4A 3G6JB 1SD4A 5C5UA 4NOTA 4AAPA 3WDWA 2W47A 3S5QA 3KVBA 3M8FA 3B3QE 2YV8A 1TQIA 4DNCA 1WMFA 1OBNA 4W6YA 2RREA 4F83A 1B09A 1UOBA 4LBOA 3POEA 3T4VA 4K1YA 3SISA 3V7SA 4AK3A 1F1ZA 5GLTA 4HAMA 2E6VA 1AWCA 3M3EA 4RGGA 2KQRA 4G6TB 2VCBA 4NPRA 4IEYA 5CG8A 2Z99A 4XBFA 3DTIA 4NRQA 3VZJA 3OGJA 2DJNA 3U1XA 5FMOL 2GIZA 5C9AA 3I3LA 1UL9A 3CDLA 1JYCA 1QOOA 1R093 1AVBA 1R083 1WRJA 5FP8A 2ZCWA 3CLQA 2A68F 1H1AA 4UUSB 2AH2A 1SBFA 2BERA 2RM21 1WA4A 2HDWA 1REDA 3PUHA 2JG9B 3NVCA 4JRLA 3QU3A 5BNOB 3KEQA 1POV0 1NQDA 4AVCA 2DODA 1VBD1 1B35A 4G8XA 4I02A 3AZXA 2XIGA 1GT0C 2FMLA 2EBIA 1GFF2 5JZGB 3HEIA 3IHUA 2QQUA 5L3EA 4DS0A 4OMZA 1ONAA 3GUDA 2P3KA 1YI2I 1QJFA 3A0KA 3QWLA 3PMSA 3S2DJ 1BBT1 1X2NA 3VBRA 4B1MA 1DP7P 2XVCA 1S7EA 1PVEA 3RS6A 3ESWB 2D5HA 4WVWA 5ACA1 2W1QA 1T2KA 3D5LA 3KGZA 4I0WB 1UU6A 1XC6A 5JOWA 2HQNA 2CUFA 4GH4B 2YPJA 3QAHA 3LDKA 5DCMB 2Q8CA 2NS8A 2W1WA 3S3NA 4MHUA 4FSJA 3FDYA 1ZNPA 4XCBA 2JA7J 1KONA 3AAFA 2W08A 2ZGSA 4HKLA 2HWE3 1FIAA 4L0ZB 2Y48A 3KQRA 3SKJE 4CZZA 1QRYA 1LHNA 4RQPA 5BV6A 2DFEA 1FX7A 3CU7A 5FY1A 4NC7A 4CYCA 4N4NB 4Q4V1 4BPZA 2M34A 3IH3A 3IRRA 1AYN1 4LBMA 5HLTA 1ZBE2 4RSUA 4AI0A 3KSCA 1WBFA 4NAOA 2H6BA 5HV4A 4QM8A 2JSPA 1GV2A 2QNKA 4M01A 3HNBM 5J7MA 3IIAA 4IEZA 2HVSA 1W1WE 4N8MA 2CO5A 2VC1A 4QPGB 1NLSA 2RQPA 2PHWA 2XXZA 4MV2A 3S30A 1MIJA 5F7UA 2IT0A 1ZZ7A 1IUYA 1VAKA 2XUMA 3FXRA 2OQ6A 5AONA 4WM7B 4JX0A 3ECHA 4AEDA 1ZX5A 3CIHA 2LYCA 1R22A 3I59B 2NNYA 5LGNA 5TSWA 2GM4A 2WQZC 2L4MA 3RZHA 2VJJA 1RPWA 3TDUC 1VR3A 2DFBA 5LEKA 1WJ5A 3TMOA 3P7NA 1WKMA 2JWTA 3POFA 2L3DA 3KV4A 4Q0VA 1T8IA 2KR2A 4L2NA 3AP6A 4NHJA 3WG7H 4QXHA 5GPAA 1P8JA 2C26A 1EH8A 4CU9A 2EILH 4AVPA 3I4PA 4HXCA 2XHNA 3DEUA 5J98B 2O9LA 5DM6F 4J25A 2R5YA 5E8AA 4CDXB 3OYFA 2VC9A 5DUXA 4FVVA 4YZ4A 1HXS3 5L3BA 5D8KB 5CKTA 5CYVA 1G9FA 4Z2WA 4YGEA 3EYPA 1VQPI 3KPHA 1YFYA 3AG3H 5T3NA 5DM7F 1VBB1 2RR12 4C3HJ 1JUSA 3P9IA 2R7VA 1YOVB 3F95A 2Z33A 2L7MP 3G71I 2BV4A 3RRDA 2QVSB 4QAWA 2K9SA 1US2A 5FOBB 4DOZA 2WFPA 4XLCA 2WZR1 2JA5J 4XLEA 3HYIA 3LZZA 3VL9A 2VCMA 1A31A 1YHQI 2CU7A 1H89C 1WZXA 4XBLA 5EQUA 2EJRA 2A5ZA 2XQXA 3OOXA 1MEC3 1XSQA 2D98A 4LNVA 3DPRB 3IAS2 5E3NA 3CDHA 3FE5A 3K7AJ 2FRHA 4JX6A 2OF7A 2VUDA 4N43B 1CGPA 4RAFA 5FZ3A 1EYBA 3OOUA 3K2OA 4P9IA 5C4WA 3PVNA 3V56A 2HWD2 3CP8A 1YE9A 3CTAA 1XS9A 1ZA7A 3SHFA 5FDBA 1A36A 3H3UA 2KP6A 3FMGA 4FQGA 4CHUA 3SZPA 2E34A 4XRSG 3MFKA 2O5RA 3FKJA 4P96A 2FZ1A 4Q4Y2 4EQQA 1Q1HA 4META 2AENA 2ERFA 2JZYA 1JXNA 1IS3A 4AGGA 3FN9A 4D1QA 1H6XA 3A0BC 1HRI3 3GZ6A 2NMNA 5E3MA 5C3EJ 4AEMA 1PO12 3DCQA 4L5JA 5LEJA 4H0EA 4ESJA 5FGMA 2YC0A 4BK5A 3ZN1A 3F8CA 4K2EA 5LBEA 1EAH3 4YZ3A 5ABJB 4NN0A 2R7OA 1QXRA 3CZJA 3LFUA 2F5DA 5DG2A 5F0HA 1S9HA 5E20A 1RUH1 2PBIA 2CSGA 2Y2ZA 2ZNZA 4FE7A 5D21A 2K9NA 3APBA 3OYBA 3O6BB 4GB31 1OOPA 1QJEA 2MEV1 1X3ZB 4QB1A 1PX4A 4YM3A 3BR3A 3RKWA 2E1MB 1Z1DA 3IT8A 1D2SA 1DLCA 2J1EA 4XJ9A 4M9ZA 3BUCA 2O0YA 4DQAA 4DYRA 2D40A 2W3JA 3N9OA 3DQVC 2XPWA 2ZBKA 1BBYA 3FHAA 2HWB1 4UFMA 1Z0HA 2JG9C 2LUWA 5BNOC 3KLSA 2VQTA 4ZXKA 2E51A 2B4KA 2D6LX 2BDRA 1JKRC 2WDBA 4ZZ5A 3QLQA 5JZGC 1OPCA 3ZQGA 3WNOA 3S3OA 2QTWB 2QQJA 1NX9A 4YARA 1OJLA 5FYSA 2FJ1A 3LCPA 3V0BA 2QF7A 1REPC 3V7CA 3ZYBA 3T0YA 4X6AJ 4ITVA 4KNYA 4KA4A 4LLOA 1W0OA 5J48A 4H55A 3M07A 1OLQA 1B59A 3POWA 1E5IA 3RKQA 3EJKA 3SZTA 4ZU7A 2VJXA 4H4KC 1IDYA 1CN1A 4GH4C 4XE9A 5FO5A 4UFKA 4UVCA 4BQQA 4IGOA 4C2TA 1FJLA 2VQAA 2J1SA 2DCEA 1U9OA 3NAPB 3U14A 1ZLJA 1WCKA 4GDFA 3L9FA 3CCVI 5JOZA 4ZYEA 2LNBA 1OQEA 2AACA 1TL8A 4QQPA 3VBHA 2KLOA 5CZKA 4BZ4A 2I45A 2ZGQA 1PGL2 2FA5A 3PIPF 4XYXA 2WJSA 2ZGUA 4MYEA 4LHLA 5DUWA 2PI0A 4F91B 1MS4A 4M3CE 5LK7B 4KWKA 3LDRA 1D5YA 5A7WA 4Q4W3 3KZIC 2RNJA 2UYBA 3L2WA 2JX9A 4Y22B 2F2EA 2A7AA 3B94A 1BEV2 1YS6A 2RS52 5L9VA 5FZ7A 2ZEZA 1UCXA 1HJGA 2D3SA 1VAVA 1W90A 1JMUB 3LSJA 1ENSA 2Z4FA 1AX0A 4ZU4A 2YC2A 2LTPA 3EQEA 2XJRA 1X8MA 1T33A 3QYEA 5HDKA 4KQ7A 3LSPA 3G73A 4LHSA 1LGCA 1UNBA 4A3FJ 3H1CA 3RQ4A 3HPNA 4NROA 2GNDA 3BROA 3CZ6A 2GC0A 4ITCA 3VEPA 1LVAA 2GLOA 3C2HA 4P14A 2RMU3 1VAMA 5A33B 4DNYA 4PGHA 3ZQCA 1GOFA 1ZRRA 4COUA 4IERA 3MLKA 4ZS2A 3P9CA 1XYPA 3TO9A 1EY2A 4U87A 4GWMA 1LOFA 4LG3A 1SC7A 4UW4A 3VKNA 5GLUA 2RM22 5FMCA 5FZCA 4WK8F 3AX4A 1VBD2 3FHQA 2XOMA 5FPZA 1SG3A 3K48A 4DXZA 2J1RA 4AVVA 3PFYA 3L2VA 3S0MA 1C1LA 3GX4X 2IJLA 1R1A1 5IT6A 1JUMA 3ZPOA 1MACA 1BXHA 1L7LA 4GMP1 5IATA 3CCJI 1FYKA 4MGIE 4XICA 3BU7A 4BHPA 3HUGB 1BBT2 3T3YA 5JLXA 2D1HA 2CV1A 2FDIA 1SLBA 1VNDA 3R0AA 1WH7A 4L9BA 5ACA2 4ZTJA 2ECCA 2QBYA 2UWMA 3C1DA 4XKBA 2CUJA 4XSXF 1RHI3 2ZSIB 4IPAA 1UO9A 1KZHA 5FYTA 3TN93 3DFGA 1EA3A 4AVZA 1MBJA 3ABUA 2J1UA 2PYTA 3MUY1 4RS5A 5DZGA 1VF9A 1WLWA 4Q27A 4TLFA 1MW7A 5FZHA 2RJ2A 2JD4A 2VU9A 1VBE1 4N43C 3JB8A 3ITQA 4G7OF 1S7OA 3VZKA 2VVEA 2QZ2A 5KK1A 1OR7C 2VUAA 2OJED 3Q8EA 5DD8A 2V4AA 4YRVA 4JDOA 4LD5A 1VBA1 1VI0A 3UKGA 2MD0A 3PUQA 4Q4V2 1AXZA 1FSEA 4YSFA 1AYN2 5JSPA 4NAMA 1RKTA 5AC91 5EZHA 2ILMA 2NQYA 4JGZB 3EB7A 1YQ6A 3TOJA 4HNVA 1BR1A 3ROUA 5DTDA 1HCRA 2YUSA 5B2GB 2OCEA 3SDBA 5FMDA 1LUJB 4FX0A 4ES8A 1R4NB 5FO7B 3S2WA 4DFSA 1UZCA 4CCEA 4HETA 4XHXA 4DXSA 3UR3C 2IPQX 3LSKA 4JV4A 4DXTA 1S0EA 3RSNA 2VOKA 4DRRA 2E2JJ 4MXWA 1QU3A 1Q5OA 3CUOA 4PIZA 2UYAA 5DAPA 4DY3A 4GO1A 1OFCX 3BLYA 3UNGC 1VRBA 2OTLI 4BJTA 1WWYA 5FLHA 3C7JA 3LQCA 3FBYA 4YG2F 5KHGA 1ZRDA 2A73B 4Y52J 4X8PA 3PHMA 1OKOA 2L9LA 2YR2A 4RGXA 1X4OA 1X1PA 2JG8B 2WNUB 1LKXA 2MBFA 1JBCA 5K9YA 4IRIA 2P37A 3GLXA 2DFHA 4JP0A 1T6SA 1AL23 1YIPA 3BZKA 1BI0A 3CF5F 2OUHA 4NDLA 3GTKJ 1VBB2 1G59A 5FZIA 1BMV1 3K4AA 5H9PA 1MZ5A 1ND3A 1LCLA 2DURA 2Q8DA 2RV9A 2NN8A 2QJVA 4MX3A 4RBOA 3T09A 4LBQA 1LTEA 2WKKA 3FF5A 2XJSA 3V65A 2XRLA 2LOOA 2DPUA 3N7KA 2KRFA 4FQZA 3I3BA 2HDDA 2WZR2 3GTOJ 1QHGA 4DY5A 3ONQA 4MVTA 4G9YA 2X09A 4XXAA 3UT0A 5CNAA 2YY1A 3O1PA 1RTVA 5T52A 5BNNA 1JZ3A 5A3TA 4CUGA 5L19A 4N4OB 5FAXA 5KC6A 4A69C 2F48A 2JVGA 2IBDA 1JYXA 2IS6A 2UY9A 4KH9A 3WG1A 2E9QA 2W46A 2Y0SA 2EXKA 1SMVA 1GLNA 4KBZA 2H8WA 5CG9A 3NAPC 1NG0A 1GP6A 4E7ZA 1XX5A 2P5LC 3E5UA 3HQRA 1PIV1 2P8TA 4LUKA 3FIWA 4N9IA 1PHMA 4ZYHA 1W6OA 1RMU1 1XDSA 1OLMA 4FCYA 2Y0IA 5FUIA 2PMZA 5LATA 1IGOA 3AJZA 2E63A 3AL6A 5GTIC 2BU9A 1SLCA 4NNJA 1HQCA 4N53C 2R93J 3TOBA 4DPNA 5KXCA 1DGWA 2NS7A 2NAZA 1O3TA 2IS2A 1N1SA 1ZELA 3RSJA 3PU3A 2DCTA 4JHTA 4A2UA 3ACLA 1LOGA 5CBLA 1FTTA 1YRZA 4Y1YA 2A75A 2R1BA 2GALA 4DYCA 2ZA9A 1H0BA 1RB8G 2MH2A 3IL2A 2BP6A 3HKZN 4ZJZA 2F6BA 1ZA4A 3N9MA 3ZSJA 2L9VA 5JFRA 4HX7A 1X9PA 4M3CF 5FY8A 3T1BA 4MEXF 3SNMA 4GB32 2DAOA 1G2HA 4OZOA 2VZ3A 3ZXSA 4KWJA 1PZ9A 2CV2A 4BXXJ 3B02A 1YJKA 1T95A 1LEBA 2ATFA 3A01B 2HLEA 5FZ9A 1AR81 4A42A 4HPKA 3ZSEA 2HWB2 3W20A 3KZYA 4M4RA 5FOJB 1KU3A 3OYWA 4YEJA 2ME0A 4L9TA 4BLJA 3HBZA 1I3HA 2FU4A 3RMYA 3E5QA 3H36A 3MAJA 5GLWA 2WT1A 4OMCA 5FUPA 3ZN0A 3LOCA 5L7OA 2DT6A 3J9SA 1ZHFA 3DV8A 5TISC 2WR9A 3MZHA 3W58A 2HWC3 3VD3A 3DEMA 4BM8A 4LK7A 3WW3A 2ZXJA 4IGQA 2D6KA 1RVF3 2DWRA 1ODMA 4D0PA 1ZZ8A 5IVVA 1UZWA 1XE0A 2NMOA 1WHUA 4CU6A 1VRH3 2R7RA 5DDJ3 2CWEA 2ET7A 4DUXA 1X9TA 2P3IA 2ZB9A 2LTNA 4E7HA 2BFUL 3BG6A 4OQ9A 1HB3A 2XR4A 3BODA 3GLLA 1ZM1A 3NWTA 1J0RA 3BT9A 5I8SA 2C6SA 5SV8A 2A69F 2JT1A 1CIYA 3EPZA 2WAFA 2W91A 2G7UA 3E3VA 5A3NA 5D5WB 3BPSA 3U0ZA 1VQ5I 2WL1A 4TSVA 2YBSA 1TNFA 4EROA 2ZMEB 4JHZA 3K2AA 4XKWA 1ZG5A 2HVRA 2AGSA 3D1NI 4FPYA 5BNPB 1W6MB 2OPWA 4JGZC 3RPUA 1FV2A 3ACIA 4EN7B 1SDWA 1VZ0A 5FWJA 4RA0A 4XC9A 1K5JA 1U2WA 4ZYDA 4QGNA 3FXQA 4IO9F 2B46X 3WHUA 3QPHA 1OSGA 2HWVA 3OJBA 3FC0A 1D1AA 1OUXA 1LEDA 2CQXA 5FD5A 4BJ0A 4LO5B 4MIMA 5D5XB 3GCMA 4GYGA 4DUVA 4LE3A 4GXLA 2BOLA 5HDGA 1IGNA 2R7FA 5BPIA 4ON0A 3GYHX 5K4LA 2LFBA 2BOIA 2ZHKA 1PMHX 4LK6A 4P02B 2A6HF 1S55A 2NZ9A 5BMZA 3VYSB 2A6ZA 2P7VB 1RUNA 3CJQB 4JTOA 1JUIA 3AXDA 3GTMJ 3WNMA 4F3JA 4Q5SF 1W0NA 2CUZA 1X1DA 1C4RA 4AHYA 4XDOA 2L02A 5CIRA 5FYIA 4HANA 3SMHA 4UFIA 3ZDVA 5CVUA 2O8KA 2JG8C 2WNUC 3JZVA 3PLQA 2VULA 3BN6A 2QQAA 3I3DA 1WLCA 3WLUA 1D4VB 1JUPA 1OCZH 3VOEA 2V09A 4CCNA 1R1A2 4YIRX 2YPRA 4NB5A 4XQFA 1RI7A 1IOAA 3BTCA 5A3LA 3LOBA 2ISYA 3VBSA 2H27A 3IH2A 2Q1MA 3X29B 1JODA 1FPN3 1WA6X 4CH7A 2ZABA 3U78A 3GXOA 4M9XA 2C6YA 2KA3A 3EUAA 5FLJA 4P9FA 3T0BA 4HG2A 3ZLIA 2PX9A 1OQDA 4Q0SA 2RVCA 1OCTC 3G6EI 4FPOB 1LOAA 1D1CA 5HXVA 1UU5A 4BJ5C 1REFA 4BCUA 4GWIA 2EIBA 1I5PA 1T2XA 2VZTA 1VBE2 4IGPA 5EGOB 4Y20A 4A0XA 4BISA 4AI1A 1VQOI 2ZXHA 3A21A 5ICFA 2QQ8A 2CRGA 2DXIA 1B8IA 1VBA2 4RLFA 3I49A 1DQ5A 3LWFA 1IS6A 2DOFA 1YITI 1G7YA 5AC92 4CZSA 2PFBA 4ZZLA 4NIDA 1Y6IA 3C7OA 3WGGA 2VBZA 3MKZA 1UY3A 4D7MA 1SACA 4GULA 4HLXA 2CUEA 2X6YA 3DBLB 4A3DJ 1XRUA 4KWUA 1MQTB 4RS8A 1I1SA 1UOJA 3DXJF 2FF4A 4IEQA 3GTGJ 4X0GA 1R49A 3LE0A 2Z79A 3F6VA 1E57A 5F5AA 4LLLA 3CMEI 4Z92B 3KZZA 4BE2A 1J58A 3DYOA 2W25A 1N47A 2CU5A 1NK2P 4YELA 3VYUB 2WB1N 3USUB 1ENHA 4BQ4A 5DUUA 5FKLA 1EH7A 3KLOA 1HQLA 4XFBA 4KMQA 4IE4A 2VTXA 3SFIA 3JRDA 1LEAA 4K3UA 2Y75A 2VECA 1BC8C 2GWRA 2R7QA 1HLVA 3GVAA 4HA8A 1LHUA 2STTA 1V0AA 3AKPA 4EN0A 3WTUC 4B4QA 1A6CA 3HHGA 4BIFA 3WQBA 1MS0A 2VONA 2HBUA 3TKYA 2X1CA 2JENA 3PUIA 1SVMA 3VODA 3BYWA 4A3LJ 2NVXJ 4BE1A 1W5SA 3OYDA 1ZBE3 4G7ZF 4D5FA 5T50A 2A5YB 1QJY1 1FAYA 4XIDA 4RGSA 4OAZA 4AEDB 1BMV2 1R7JA 4NHMA 2NPIA 1U5IA 5J40A 5E89A 1H9TA 4UB8C 4WF2A 3HBKA 4XIKA 2MNGA 1Y0UA 4J01A 3DF0A 4P5HA 1O3SA 1J09A 3I2JA 4A5MA 1LHOA 4Q1PA 2D3PA 4XJZA 2WAQA 1HW2A 4Y13A 1MBEA 4NBQA 5FLXK 1DHKB 4QMAA 2V6EA 4UYBA 2VZ1A 3GHMA 3MW3A 2WNEA 3PSFA 1O4ZA 3BDDA 1MBKA 2RDQA 5DYMA 5CVVA 1GQGA 4UB6C 3ZIWA 1XNAA 2D45A 1T08B 1KD7A 2E2HJ 4Y17A 1PIV2 1UYYA 5IVCA 1C0WA 5JR3A 4I6ZA 1E3HA 5ANQA 5L3FA 1RMU2 3R4SA 3UL2A 2BTVC 1SFPA 2BXZA 3Q0WA 1WZ2A 1TNRA 4Q1RA 5ED4A 3HOVJ 2VBWA 3LA7A 2WO3A 3HQUA 4PJJA 2JUGA 4PUSA 4KIGA 4MO3M 2YGLA 4F93B 5BNPC 1MS5A 1G3YA 1AYM1 3QYFA 5FRMA 3FLRA 3LNQA 3THDA 2RR13 4H2AA 3CC4I 4OVEA 4PSXA 3ZYGA 2QKDA 1AA7A 3IMMA 4U36A 3ME2A 1HN1A 1WBLA 3H8OA 3NARA 1RYYA 1ALYA 3ASIA 2BYVE 2HGCA 3WNPA 1U9NA 1NE4A 1IAWA 3BI3A 2E35A 2CYYA 4YM1A 3JRAA 3VDDB 1W04A 3W2AA 1S0FA 4COVA 3CHXA 4BQ3A 1VTNC 1BW5A 1XJAA 1RUE1 4A3MJ 5GZGA 2B5HA 1WGXA 2P5KA 3DKQA 3LFIA 5E1ZB 2BFUS 1BZWA 3NV1A 4FXKB 4PI0A 1UELB 3CUQB 1JZ6A 1JHHA 5KAIC