3RYRA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ryrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ryrA01
4I3PA 3SCGA 2QVOA 4L0YB 5ED4A 4X6RB 4R79A 1FC3A 2DTRA 2FE3A 1J3PA 2MH2A 1IUYA 1JXSA 4AQ6A 4NB5A 5A2QK 2XAQA 2QBYA 1DPUA 2HOEA 1ZG5A 5KHJA 4HAMA 3F8FA 5I8YA 5BXXA 5BPXA 4NVPA 4ZYEA 1U5TC 4EM1A 1UD1A 1P4AA 2PMHA 3V7SA 5JVTA 2ATFA 5JR7B 4ZU7A 3P9CA 1KU9A 4HX8A 2PEXA 3GUDA 5L3GA 2XIGA 1BI3A 4IHSA 2D1VA 1O7LA 2FOKA 1YIOA 2JT1A 2GC3A 5AONA 5ILVA 5HDNA 1GQGA 2XUBA 2ZMEA 3N97A 2UWMA 3PNAA 2XAGA 2CAUA 1OPCA 1FSHA 1U6GA 4EGZA 1AWCA 1TQIA 4EJTA 5KBFA 2YX7A 4HVQA 1YFWA 1ZGAA 1K78B 3EYIA 3T5XA 3IL2A 4LK0F 1SFNA 4RB3C 4MNUA 1X82A 2W85A 2Z2SB 1HSTA 1E17A 4LD5A 4M9ZA 4PGHA 3R6SA 4ORFA 1J5YA 4G7HF 1KQ8A 3SQNA 2A5YB 3E6CC 3QP5A 3FX3A 1YHFA 5F6FA 2FMLA 4KN7X 4I98B 5FFXA 4IEQA 2XAFA 3DP7A 3F21A 5BPDA 2XLAA 4RGUA 4M6XA 3RJPA 2YR2A 4GO1A 3V4GA 3CTAA 5L3BA 3CLPA 4WK8F 3G3ZA 4YFNF 3P7NA 4OINF 1D8KA 3MZHA 4MGYE 5F64A 4LG0A 3P9IA 5FLHA 5FPZA 1FXZA 3SXWA 1CAXA 2XVCA 1DUXC 4HDVA 4L2NA 3ZN1A 3HSFA 1XCVA 2DO7A 4KICA 2PAEA 4KL1A 4E2GA 3E3VA 4JV4A 1BC7C 5BY5A 1O3QA 2QCSB 2A6HF 3EO6A 4Q5SF 3LZZA 3SZTA 3U10A 1CAWB 5CADA 4A6DA 2P17A 4AVPA 4H0EA 1ZZ8A 1SFXA 4RB0A 4I02A 2D93A 3F8NA 3ECHA 1QXRA 3U1DA 4L0ZB 2J5OA 3F72A 2NNNA 4OMYA 4U0WA 2WTEA 3MEXA 3ABTA 4XF3A 3HRSA 2ZMEB 2UY9A 1IXCA 1YLLA 2M87A 2GA1A 3J7AO 2XGXA 2ADUA 1HW2A 2M30A 4E70A 2IXCA 1T98A 5E16A 1Z6TA 4L18B 3Q9VA 5ILSA 3F23A 1JE8A 3F6VA 4Q0SA 1X7NA 2OA4A 3O14A 3SCHA 2UXNA 2Z69A 2GIVA 2RGVA 1GXPA 2EA7A 3WW1A 2W84A 3OV8A 1LKNA 1Z6RA 4RB1A 1QZZA 3RYRA 5A2QZ 5FLIA 3WW2A 1HKQA 2VODA 3S0MA 5BPIA 3KGLA 4EWDA 1KA8A 2LDUA 1DGWA 1WKMA 1FWZA 5K8SA 3H50A 2XL9A 4IEUA 3BPZA 4EROA 3ELNA 5D8KB 4HQMA 3KMHA 1HKSA 4UVAA 2ISZA 2CAVA 5FO5A 3Q9SA 4LG0B 2RNJA 4F8AA 1P92A 2BEOA 4WXHA 2O8XA 4U0YA 2H09A 1ONVA 3KLNA 2IPQX 4R52A 2EB7A 3OD0A 1BM9A 4HW0A 5FFZA 2XL7A 1YO5C 1FPQA 2EA4A 4UV9A 2L54A 4HQEA 5HLIA 2FBKA 2E1NA 3C1DA 1ZN2A 2RKHA 3V7RA 4ESJA 3FMRA 1FI2A 1QO0D 4S04A 5EEHA 4HF2A 3GZ5A 1VTNC 5D8LB 3EUHA 4QXKA 1EH8A 1DPRA 2K7LA 3C7JA 4KWKA 4UVCA 1K7AA 3BY6A 3CO2A 1D5VA 2IXJA 1O5LA 3M3IA 4PIZA 4Z07A 3KEQA 4AWXB 2VN2A 5TRDA 3R0JA 4Y15A 3RYKA 2Q4SA 1J9IA 1WWXA 2VXZA 2FMYA 3P9KA 4LB5A 2PQQA 1ZVFA 4XF0A 1BIAA 2F2EA 1HXDA 4CZZA 2QJVA 1W5TA 4DNCA 2O8QA 3VHRA 3HRUA 3ETQA 3C18A 5KVRA 4XFHA 1YW7A 1ZYRF 3QOPA 1IXSB 2FNAA 4ESBA 3RKYA 4UUVA 1R36A 5E17F 3F3XA 4XETA 2FSWA 4LULA 2KRFA 1S7AA 3MQ0A 4R8HA 2L02A 1KU7A 5CU1A 4PJYA 1T39A 2R7FA 3WTUC 4LA2A 3HUGA 2VE8A 4EM2A 1XSDA 1I6XA 2PN6A 5LGTA 2D40A 2Z5UA 1MZBA 3WTWC 2PYTA 2BNOA 2E1CA 3B73A 2HQNA 1QWRA 1OD5A 2P5VA 4OU0A 1J2XA 3DPLC 3ISPA 3I59A 1DGRA 3M1EA 1WSUA 3NEUA 3ACLA 2ZKZA 1FSEA 3TO7A 1TLHB 2N7GA 3DN7A 4HDUA 2L4MA 5H6QA 3TO9A 1FNNA 4WZCA 4AIHA 4Q48A 5D1IA 5IT9Z 4ASNA 1YFXA 1ZZ6A 3FJSA 4RGXA 1RL3A 5J8CA 5D4RA 3ZPLA 3R4KA 3ZMUA 3BJAA 5LLQA 2VOOA 2MLKA 4QM9A 2A6EF 2KXLA 3FM5A 3IHUA 4XFCA 2RV8A 2XRNA 1MJ9A 3MFKA 1FX7A 4U88A 1IPJA 3F8BA 1CAVB 6PAXA 1TNSA 1IAWA 5CVUA 4G7OF 3LQQA 3WW4A 1OI6A 1LJ9A 5JI6A 2Q30A 2IXLA 2WV0A 2QNKA 3JTGA 3ZP5A 2QDRA 3ZQ7A 1G3WA 4J1WA 3CUOA 2Y0OA 3L9FA 2K86A 1USSA 3BPVA 5FDBA 4OIRF 3CL1A 1ZZ9A 1FLIA 2RC4A 1IN7A 3ML6A 1FY7A 4QGNA 4I2OA 3FE5A 3RKWA 5FGMA 3WODF 4GYIA 2MD5A 1UPIA 3BP8A 4M74A 4EJWA 2DLLA 1NHAA 5FCCA 4G9YA 3D0SA 3EJKA 1HQCA 1LEBA 4CO8A 4HBLA 1Z05A 1UW8A 3GVAA 3BROA 1ZAOA 4YIIA 1YQAA 2VECA 2Z33A 1KU2A 4IF4A 2QVSB 5FLXK 4D7SA 4HVRA 3CO7C 1SEFA 1G3YA 4EJUA 1B4AA 1S29A 5BOXA 1S6LA 2H6CA 1G6NA 4G6QA 4EWAA 3H92A 3FZVA 5E8GA 1XE8A 3QU6A 3DV8A 4ZU5A 2D45A 4RD7A 5JFRA 3R0AA 2IRFG 3U2RA 3K9TA 2F5EA 3TOAA 5FQ0B 2EK5A 3RKXA 4IERA 1RGSA 4KU7A 3ES1A 2MA3A 2HYGD 4N0BA 1O3TA 4WBBA 1IN5A 4G8XA 1SD4A 3TQNA 4XSXF 4U7DA 3ZMTA 2FQ3A 2TDXA 4P55A 1L3JA 5HLGA 2X0LA 4M6YA 2VPVA 2A69F 3L2HA 3NVCA 3V8JA 2L4AA 4XFFA 4OOIA 3ZMDA 1ZZCA 3IBMA 2GZWA 4MZUA 4YG2F 1CGPA 3CF6E 5LGNA 5F1RA 2CO5A 3KP6A 4IEOA 4G7ZF 2F5CA 1FYLA 1QXJA 1SMYF 1O4TA 2EFNA 1T6SA 2EV6A 5FPXA 3SMHA 2IXKA 4IPAA 1IN6A 1OMIA 2BE5F 2ZNZA 1D8JA 3WTYC 4Z82A 4WXDA 2I45A 2UZKA 1HBXG 4ZZLA 4GULA 5HDGA 4EJOA 1CAWA 3CLOA 2EFOA 3QPTA 4XEZA 1KYZA 1NE6A 4OIQF 4ZZDA 3EQEA 1B1BA 1UB9A 2H94A 4KUMA 4HLXA 4IEPA 4LLOA 3TO6A 1UHWA 4G6DA 4FX0A 1X3UA 2DT5A 3WU1B 1Z9CA 1EP0A 3H1YA 3U11A 1U3EM 3WE3A 4NQWA 3JSPA 3GFIA 2RDPA 3FWEA 1CAXB 4LLGF 3JZVA 3GXOA 5JR3A 3T0YA 1TTYA 3BZ6A 1BN5A 1QY4A 3MWMA 3J80Z 2Z3YA 1LVAA 5L3FA 1W7PB 3JTHA 3ABUA 1VR3A 1O57A 3K0LA 4UBHA 1QZYA 2JPCA 1MKMA 1B59A 3WE2A 1TNTA 2FNPA 2CYYA 1ZREA 1XE7A 2Y75A 2HTJA 1XD7A 1PUEE 2IP2A 2O6GE 1J0RA 5CYVA 2L01A 1J75A 4E2QA 4MTDA 5HOOA 2MPFA 5JSPA 3K1MA 3HRTA 3GX4X 5LGUA 2O0YA 3ES4A 3J81K 5K5OA 1EY2A 3L7WA 3DQVC 1IRFA 2PQ8A 4EV0A 5J7MA 3F6OA 1U2WA 3I71A 1ZLJA 2B5HA 1ZG1A 1BC8C 1BI1A 4WX9A 4XLPF 1CAUA 3M70A 2BGCA 3GYHX 5K1YA 2UYBA 3E6DA 2MBFA 1PP7U 3KZYA 3D5LA 1FT9A 4IEVA 1ZRDA 2BNMA 1EYBA 1WA4A 4HA8A 2OQGA 3DL3A 5JCTA 4AVAA 1CX4A 2PTMA 2YU3A 3PQKA 4R1HA 5AIPA 4U7BA 3SHRA 3B02A 1TQPA 3TNPB 2K4BA 3IWFA 5D5XB 3FMSA 2F5FA 2VT2A 1ON1A 4XRFA 1P2FA 1YFYA 4K2EA 3F8CA 1R22A 1FZPB 2XLFA 1XSXA 3FHIB 4HBNA 3GFJA 1H1IA 3I7DA 4L5IA 3BJOA 3LWCA 2X4HA 3E5QA 2FRHA 3I59B 1DDNA 1LDJA 1XRUA 1OYYA 2MLGA 4MV2A 3ULQB 4Q4ZF 2VT3A 2YX4A 1W4MA 2HR3A 4A0XA 1KQ9A 2E7WA 3EHKA 2STTA 1O7FA 5LEKA 1ON2A 2DW4A 4LUMA 2MC3A 2LF7A 2P7CB 3HQXA 3HYIA 2KKOA 1SAXA 3MAJA 5JSOA 2DK8A 3UKVA 5DCMB 2V1DA 3PLQA 1P6RA 2O3FA 4O6JA 1WRJA 5L3DA 3IKVA 4I01A 4IRHA 1UFMA 5I0TA 2VC1A 3H1WA 1ZRCA 4Q0QA 4LTAA 4KIFA 2BV6A 1F4KA 1JUHA 5JHUA 4Q0UA 4HN1A 2QQBA 1LB2A 5I0UA 4A2UA 1KYWA 3FFQA 4UHTA 4XLNF 1J58A 1ODDA 3NRVA 3LFKA 1ZX5A 4F7ZA 1V70A 2Q0AA 3LA3A 1MDMB 2DPUA 3BB6A 1H0MA 3NQOA 5DCFA 2KIFA 4XFIA 4P9FA 1IXRC 3GBFA 2XASA 2P5KA 3CDHA 1R5GA 2CV6A 4P5OA 2VBWA 4EQQA 4A5NA 4Y17A 1SFEA 1MGTA 4XF9A 1P4XA 2RQPA 2NYXA 4UV8A 1YWKA 1CF7B 3CUQC 3GFLA 5I91A 4O9GA 4N9HA 1YS6A 2GXGA 3H7JA 1YS7A 5K5RA 2P7VB 1SFUA 3KEOA 5CJ9A 4DQ2A 3IDCB 3FHZA 2EV5A 1XDUA 4HSJA 2LKPA 1IZ1A 1Y9QA 4PIXA 5I0RA 3QACA 4CICA 4RGRA 4JK1X 1B9NA 3DFGA 3O3KA 1H1MA 3BPXA 4BYYA 3BOQA 1VJ2A 2DK5A 3QAHA 4KFCA 1YW8A 4ZYHA 1MJBA 4MGRA 3HT2A 3DPTA 1IRGA 2FXAA 1UHMA 4HF0A 3H1MA 1T2KA 2BNNA 1JHFA 3HTSB 2V79A 2ZJ2A 1Z7UA 3H3UA 5BV6A 3U0ZA 4YYOA 2K02A 1ZGJA 1FBSA 3L2CA 3IRQA 1IF1A 5BQTA 4HN0A 2GA2A 1J59A 2OZJA 2P8TA 5CLSA 4K8FA 4BIFA 3F22A 4PZJA 1RIOH 1D3YA 4HVOA 4HV5A 3HOSA 4LA3A 2JSCA 3QPHA 1PM7A 2MHFA 2ZXJA 1CAVA 5ICGA 2ZBKA 4L9NA 3V7CA 2GQQA 1OR7A 2LSOA 3NSTA 4HZFA 1XMAA 5HS7A 1FP1D 1KGSA 3AAFA 3HHGA 1UIJA 4CXFA 1SD6A 4EWEA 2QM3A 3TNQA 1F5TA 3RDIA 3BCWA 2XV4S 2NNYA 2EV0A 4WXCA 2A68F 4JBAA 4KYWA 5DUKA 4LUKA 3SHFA 2MNGA 4IETA 3TOBA 2FF4A 4ZYGA 2ZO4A 2P5LC 4G94A 1YTYA 2OU2A 1R58A 2LF8A 4I0AA 1W7PD 4MTEA 4QX5A 3OF1A 4AVCA 2D5HA 2L3DA 4JTNA 5E1WA 5FLJA 4JVAA 2IT0A 4KA4A 3BALA 4AD9A 2JPBA 4BH9A 4KMUX 4XF1A 2FU4A 4YIFA 1KU3A 2C0ZA 2B0LA 3FZ3A 3BU7A 1BI0A 4FHTA 3M7GA 2WFPA 3M8EA 2K27A 1ZZBA 2B8MA 3SZPA 2O1QA 1ZARA 4MUVA 4TV7A 4ENMA 5J3UA 1W7PA 5E1RA 1RI7A 1AOYA 2PA7A 5E1XA 1OYIA 4KNYA 2ZNYA 1IW7F 5TJJA 1HW5A 5IT3A 5ICEA 2VBYA 4X6QB 4D0PA 3MYXA 1GQHA 4EVIA 1KQ0A 4MQ9F 2STWA 1Q3EA 3JAMZ 3ZMZA 5LEJA 2V6CA 1PMIA 3O2PE 3K2ZA 1BJAA 4QLCU 4ENKA 5D6EA 1LDDA 1NE4A 4PCQA 1S3JA 3HTUA 5I8SA 1S8NA 5L3CA 2QLZA 2V1UA 4LK1F 2NRAC 1XB4A 3MDPA 5HI0A 1OYWA 1ZZ7A 4IXAA 2GU9A 4FAHA 3T8TA 1SQ4A 3L00A 3ZDSA 2PFBA 3V8KA 3K1NA 2JTVA 3JW4A 4LMYA 3SFZA 1ZLKA 5KHHA 4WCGA 2IXHA 3LOIA 2EJRA 5I0SA 3BWGA 2EA2A 3WU0A 4PDKA 4L11A 5DCMA 4BQAA 1E2XA 2Y0MA 4I09A 5ILUA 2OZUA 3VFZA 3LSTA 2CW0F 3QP6A 1RUOA 2XROA 1TW2A 5KK1A 2OYZA 4ONUA 4A0ZA 2GXBA 3GYDA 1QPMA 1U5TB 2VBZA 3WTTC 2CGPA 2XKOA 4ESFA 3WTXC 3RYPA 5CVIA 4GGGA 2OZ6A 1I27A 5LHIA 3TKYA 3EBRA 4XFGA 5EEGA 4A12A 3E6MA 5HLHA 1LEAA 4EMSA 1XDSA 1LNWA 2PHLA 2YPRA 1DP7P 1O3RA 3PFIA 4KWLA 2KJBA 1RUNA 3FM3A 2DFIA 1ZRFA 2AS5F 4N9IA 1TW3A 3I4PA 4MGZE 2VONA 5ICFA 4FAGA 1L0OC 1HW1A 4XSZF 3EDPA 4KDPA 2XAHA 2DU9A 1Z1DA 4P9UA 5J8FA 3KLOA 1ZH5A 3RZZA 3WTZA 2M45A 4PIYA 3ECOA 2RVCA 4HSLA 4LJZF 5FLXZ 5FD6A 3LAPA 1XSVA 1F9NA 3RPQA 3QU3A 1J1LA 1U12A 4CGZA 3KZZA 2DAOA 2PJPA 2FA5A 1XGSA 4B09A 3KP7A 4M9XA 1R1TA 2OQRA 3FXRA 2J5PA 5AIQA 3CJXA 3CEWA 4EJVA 5D6FA 2EFWA 2V1XA 3VB2A 4LLNA 1HKTA 3IKTA 2A61A 4LGWA 3KCCA 3I64A 1TQ5A 3RNSA 3I58A 1BI2A 1P4WA 3LA7A 1BOAA 5I8TA 3LQRA 3CJNA 4QGMA 2G7UA 1NYWA 1G4DA 4XBFA 1QBJA 3GFMA 2OPKA 5HS9A 1PDNC 3NL1A 1Y3TA 4KN4X 3NW4A 3ROUA 3HHHA 3KP3A 4OFGA 1CAUB 1S7OA 4HOBA 4RB2C 3REOA 1TBXA 1X8EA 4BXUA 4YSFA 5EZWA 4A5MA 3I0TA 4WF2A 4Z2YA 5DYMA 2ZFWA 3CUQA 1ULYA 2KIUA 2BBYA 2Q2EA 3D0JA 3W6JB 1LRHA 2E7XA 1ZNPA 2P6SA 1K6OA 2ELHA 2XKPA 2COMA 4OIPF 2QYOA 5IT9K 2D1HA 2FBIA 3UKTA 1NZCA 3WTSC 4M71A 2VC0A 2UYAA 2PHDA 4IEYA 2IA1A 3QRFF 1QNTA 4MHGA 2LNBA 4E2SA 4CDGA 1T0FA 5C8WA 1YYVA 2YSRA 4PGGA 3U9GA 2ISYA 1YG2A 2QWWA 3KETA 4AVBA 2R3SA 4LFUA 2QENA 1FBQA 2QQ9A 2QUFA 1U78A 3KSCA 4D7TA 2CQKA 2ETEA 3M8FA 2UY8A 3FF5A 2HDCA 4JQFA 4IEZA 5FB2A 2QQAA 3IDBB 3J80K 5ICCA 3WGIA 5J48A 4IVNA 3H8UA 1B9MA 5D4SA 4HX7A 4O5VA 3GW2A 3R60A 2CFXA 1Q43A 4YARA 1WI9A 2WWYA 1R23A 3GO5A 5KHKA 2CWEA 2H27A 4MGKE 1J3RA 2FQPA 1YUDA 3ELKA 4LB6B 3J81Z 4YNIA 3Q5FA 3S2WA 4Y13A 1MD0A 2ETHA 2K0GA 4FX4A 1GXQA 2ZCWA 1OFNA 4I0BA 2XHKA 2V9VA 2JRTA 4BHCA 1I1SA 2GWRA 4HYEA 1H9TA 2EWNA 5DDGA 2G9WA 2AXLA 4ZH4F 4B8XA 5I93A 3TDZC 4MGIE 2A3SA 4UVBA 3E5UA 3RTRA 3OCPA 3L09A 3ZN0A 2WC2A 4HX4A 5EFUA 3S7EA 1ZHFA 1JHHA 2ZKLA 5D5WB 1IN4A 4M9SA 2Q8KA 3ZMVA 3HSEA 4A6EA 1O3SA 3KE2A 2DCTA 5CVVA 2M1BA 3G73A 3E5XA 4MQVA 4RAZA 2PAKA 1Q1HA 1RNLA 3DXJF 2PAMA 4ETSA 3OGJA 4IESA 3D82A 1FOKA 5LHHA 1A04A 1R1VA 3I53A 5LRRA 1X8MA 3GZ6A 4YFKF 2G7HA 1HSJA 1XN7A 1T38A 1FBUA 3H9AA 4XFBA 4NHJA 3LWFA 4M72A 1LR5A 3WG9A 5ERIA 5HDKA 4WWCA 5BMZA 3LA2A 4HV6A 2P4WA 3FMQA 1XGNA 3H3ZA 3KFWX 4KT5C 3HT1A 1WQ2A 3W6KB 4IHTA 2EFQA 3E97A 1MDMA 2HZTA 3R61A 2F4PA 4GXOA 2Z99A 2GH2A 5CVJA 3JSOA 4IEXA 3T1BA 5LHGA 5CVRA 5DEQA 2DQLA 3C3WA 2ACJA 1USTA 5H6RA 4XFAA 3BDDA 3FXUA 1WLTA 3OOPA 1Z91A 1V4RA 5LBQA 4L9TA 4XF4A 1XGOA 4HMZA 4LEJA 4AXOA 2W25A 4L9JA 1YFHA 2IA2A 4HLYA 1UIKA 1ZRRA 3VODA 2ESNA 4ZU4A 4GCVA 2IA0A 5J6XA 4Q0PA 1OKRA 4IEWA 1SD5A 2EFPA 3HRMA 1PP8F 1MJAA 3LAGA 4EM0B 3UKNA 3O6BB 3MCZA 3C3VA 1STZA 4O3MA 2ET7A 2HFHA 3EETA 1G3SA 1SMTA 1K78A 2W24A 4Q29A 2HQRA 3FXQA 2M5WA 3DF8A 2P6TA 1BIBA 5DV5A 2Q0OA 2Q1ZB 4HF1A 4UXNA 3K1PA 4U0VA 3NKTA 4O9EA 5FD5A 4Q0VA 5K5QA 3ERED 5BUVA 2Y48A 3KGZA 5KHGA 4Q47A 1JGSA 2KIMA 1REPC 3VEPA 3F8MA 3GWZA 3TDUC 1CF7A 5D5VB 4ENJA 3PVBB 4KU8A 3MZYA 5H20A 1I1GA 4MEXF 5DD4A 4AIJA 2PG4A 2IC1A 4ENNA 4MX3A 4UBGA 2FBHA 4MH0E 2H6BA 3IRRA 3SCFA 3I5UA 5LRSA 2HWVA 2PMUA 2PBIA 1YW9A 2HEOA 1V3FA 2IVMA 1NXMA 2VE9A 5DUIA 4QWQA 3CO6C 1TQMA 3USSA 2QZ8A 3HSRA 2IXIA 2A07F 1IN8A 4J1XA 1I5ZA 5E1ZB 5HS8A 5DD8A 4B29A 3HIFA 1IPKA 4DINB 1B6AA 2DPDA 4BAYA 1J3QA 1R7JA 3S7IA 4UXAA 3H7YA 3RI4A 4IRIA 2W57A 2GC2A 3DKWA 4QM8A 1Q5OA 1RZ4A 3KP2A 2EVXA 1VP6A 4WVZA 2NAZA 2VQAA 2HGCA 1LQ1A 5T3NA 4OLLA 2DBBA 4A0YA 4KMFA 3N4MA 5E18F 3JAMK 4KWJA 4HLTA 4QGLA 3GEZA 2HJIA 1R1UA 2RN7A 4KIBA 2Z9OA 1EPZA 2BYVE 2HS5A 1G3TA 3HOTA 2H0VA 2FEZA 5C6CA 4P96A 3I54A 2HYFA 4GYGA 2ESHA 3KP5A 5BS6A 1Y0UA 2F5DA 5E8IA 1J7KA 1EV7A 1LDKB 2NS0A 4FBFA 2PLYA 2M8EA 2C6YA 4IRGA 4FT8A 2GAUA 1K79A 4CHUA 2HTSA 5AVPA 3MPBA 4LLLA 3WTVC 1FYMA 3SXYA 3T8RA 3PQJA 4KIGA 1RC6A 1WGPA 4H7LA 3GLXA 4TLFA 4ZYDA 4OIOF 1YFUA 2K9ZA 1GVJA 3DEUA 3VOEA 2R7DA 4YFXF 1SD7A 3ST7A 5FQ0A 4META 2QBYB 3NJZA 2UXXA 3RPUA 2K4JA 2OA2A 3ZMSA 2HKXA 4JTOA 2OD5A 1QGPA 2E9QA 1O5UA 4ON0A 4P9GA 3KP4A 4QMAA 2EAAA 3COAC 4BHBA 2KJCA 4RGSA 3WGHA 2GC1A 2OBPA 2MH9A 1UCXA 3EQLF 4CYDA 1XGMA 4AQ2A 2DI3A 4EGYA 3K69A 3M9AA 3CUQB 2D2WA 2HKOA 5JAXA 1FYKA 2D5FA 2PI0A 5HVQC 3WGGA 2B9UA 2IJLA 1GHCA 2CSOA 4IJAA 4RAYA 5D5UB 2DQRA 3IIAA 2VOPA 2PFWA 1BBYA 2GC0A 1U5TA 2VBXA 3GF2A 3IC7A 3IWZA 3OTFA 3BJ6A 4L5JA 4RS8A 5JSRA 2V09A 1UCRA 1DZRA 3TGNA 3WW3A 4M73A 4YRDA 1W5SA 4AIKA 1R5HA 1XMKA 4UNOA 4OMZA 2JZYA 1QQIA 3RIRA 2XLGA 5L3EA 3LAJA 4I7HA 1FP2A 4L9VA 3V8LA 1DZTA 1F1ZA 1XCBA 1H9GA 1YLFA 3E6BA 2CG4A 3G7DA 4S05A 2OAZA 4BHPA 4MEYF 5E20A 3EYYA 1EH7A 2O03A 5KHIA 1ZG3A 2IW5A 2O61A 2XAJA 1RTVA 1EH6A 2ET1A 1C0WA 1R00A 4BNCA 1U8RA 1L3LA
chains in the Genus database with same CATH superfamily
2QVOA 1VBB1 2E63A 2WN3A 4X6RB 2P3YA 4R79A 2W1SA 4GA9A 2DTRA 2OC6A 2BY0A 1W05A 4CDUB 3AFKA 2VY0A 1L7RA 4Y22A 3JRAA 1IUYA 5JI7A 4AQ6A 1ULCA 5FZGA 3SLIA 5C4WB 2CYFA 5IYCJ 4BIOA 1HC8A 2OTLI 2BFUL 5JVTA 4KNCA 3ACHA 2ATFA 1GWMA 4OHWA 5L73A 3ZIWA 1KU9A 4HX8A 5HNFA 2E2IJ 3GUDA 2LBFB 4A44A 3LEIA 2BBVA 2XIGA 5JVVA 1POGA 2D1VA 1O7LA 1A34A 2FOKA 2FBEA 2JB8A 2RE9A 1UMHA 2GC3A 5AONA 3RGBA 4JHZA 2DMUA 1CIYA 2A71A 2CAUA 3AKZA 4PF5A 1U6GA 4FTSA 3KYDB 1TQIA 5KBFA 4PI0A 1RUG3 2K9NA 2JA7J 1ZGAA 3BN6A 4GJZA 1WBLA 4PUSA 1SFNA 3KCXA 1KFXL 2W85A 3B7MA 1CD3G 2WN2A 2JQ7A 2Y26A 5FYZA 2KDOA 3MKWB 2V5DA 4N4NB 1NA1C 2VR4A 3AKQA 3SQNA 1O8SA 3T2TA 4I99C 2A5YB 2IGNA 1DGWX 1MNDA 2E36A 4CCOA 3TOJA 3BIEA 4M6XA 2RM21 2YR2A 4Q4Y3 3OR1C 4PJJA 4GO1A 1AR92 5BNPA 1D8KA 1FOWA 1G9DA 1PK6B 1UAAA 5FXXA 5EJZB 3ZXSA 4JHTA 2YG0A 3W5NA 5FPZA 3BG9A 5M3MJ 1UOJA 3LIGA 4P5HA 1CAXA 4JRAA 1C8M3 4AL9A 2SBAA 1UYPA 1VAMA 1DUXC 1JYNA 1RC9A 2NVXJ 2PAEA 3F9KA 1C5IA 2VCBA 3OYEA 2W48A 3FL7A 4WVMA 1U5ZA 2WAFA 4XR6A 3OD4A 4JV4A 4YG0A 5BY5A 1O3QA 2QCSB 4Q8LA 3VBRB 3U10A 2BPA2 5CADA 1DQ1A 3HC7A 1DYKA 4H0EA 1ZZ8A 5L7OA 1SFXA 4I02A 1RUC3 2ARBA 4HETA 1QXRA 2P81A 1RITA 1OOPA 4DZGA 2LFBA 5EZGA 1HRI3 3ZX7A 1TT5B 3F72A 4M3FA 1D1CA 3PJQA 3MEXA 4XQFA 1SEUA 3DTKA 5A33B 2CGNA 2UY9A 3WCRA 1YLLA 1JZ4A 3J7AO 2ZPXA 2AYHA 1PNFA 2Y60A 2M30A 2IXCA 1W9TA 1T98A 1A8DA 1T6GC 2W9XA 4L18B 4FO9A 2Y2ZA 5ILSA 2WLQA 1FV3A 3VDDB 1W9WA 3F6VA 3S1QJ 1WCQA 2RM23 4RS5B 2OA4A 3FFZA 3O14A 3SCHA 2EA7A 2W84A 3HJEA 4MFDA 1Z6RA 1WCDJ 1LAJA 1YJWI 5A2QZ 1WWYA 5FLIA 3SITA 4FOWA 3KGLA 3WP4A 2DU0A 4JX6A 1U5YA 3GALA 1FMWA 3AG2H 1V9U3 2WSVA 3ELNA 5E3LA 3KMHA 4A69C 1CIWA 3PU8A 2CAVA 3Q9SA 4O65A 3OYLA 4G12A 4EEFG 4AGGA 3U1XA 1P92A 1QJEA 2O8XA 4U0YA 3G6EI 3AP9A 2O0OA 2MW8A 3VD9A 2P0WA 4B1LA 4R52A 5IAXA 2EB7A 3OD0A 5FFZA 3LSRA 1UU4A 3DEMA 1W6MB 4UV9A 4HQEA 5E89A 5DABA 4ZONA 1ZN2A 5LK7B 3E0JB 1C8M1 1V00A 2BOLA 2VUMJ 3U78A 4QXKA 2HZDA 5C71A 3BOPA 2E32A 4HOOA 4KWKA 2VAUA 1ASJ1 2ZGTA 2BY1A 1LGNA 3T0AA 1DQ4A 4ZS3A 3WV6A 4OMCA 4Y1XA 2VN2A 4CCKA 4OVEA 5F5IA 2K5CA 4IW3A 2FDIA 1WWXA 2VXZA 2PXJA 4LB5A 1VQ5I 1ZVFA 1BIAA 2HVSA 1HXDA 4K21A 2QJVA 4CXYA 5LB6A 1W5TA 4UAPA 2O8QA 4A4AA 3VHRA 1LHOA 3KYLA 2IZWA 1HB4A 4AEMA 5KVRA 1ULEA 1FV2A 1YW7A 4IL6C 3ME2A 3QOPA 4ESBA 3RKYA 2LALA 1P7IA 2WLPA 4XETA 3WR0A 2E60A 3ESWB 2CV2A 4QX2A 4OUSA 1KU7A 1CONA 2ZHLA 2UUZA 3GGLA 1T39A 3THPA 3WTUC 4LA2A 1J1TA 3L2UA 1JU4A 3V56A 1I6XA 3Q8EA 4U2AA 5LGTA 3FLPA 1DU0A 2PYTA 2JIJA 1XBFA 4I6ZA 2BNOA 2E1CA 1DHKB 4QQPA 2W00A 2YY1A 5ABJB 1OD5A 3A0HC 2P5VA 3S32A 3KPHA 3ZQLA 3DPLC 3URFA 3VDCA 1PO12 2Q5TA 1DGRA 2DJNA 2VB6A 5FZBA 1VAKA 5F08A 4Y7NJ 4IGOA 2J42A 3TO7A 4L97A 3DN7A 4HDUA 5FOJB 3K4BA 5FZKA 1OA4A 4WZCA 3NNLA 2WQZC 1ITYA 5D1IA 4CZCA 1OF4A 4AAXA 3FJSA 3DXUA 2YGMA 3JD72 3R4KA 3ZMUA 2GALA 3W58A 5E3OA 2XJQA 3K2OA 1AR72 2A6EF 2C24A 2KXLA 3QYEA 3IHUA 1R1ZA 2RV8A 2XRNA 3CESA 1VALA 3G2BA 1CZVA 4XN0A 1IPJA 3S15J 4Q4W2 1IAWA 1B72B 1XX5A 4B7EA 3DUIA 3HQUA 5KNLA 4A3DJ 3GMEA 1R082 2WV0A 2HU9A 4B1RA 3RSJA 3CCQI 3ZQ7A 4JKLA 3L9FA 3SNMA 2OIIA 1FLIA 2P6HA 4MXWB 5F5CA 3AYAA 4I2OA 4PFOA 2OTJI 3FE5A 2VMGA 1K4SA 1FTTA 3WODF 3I56I 2YS9A 1VMFA 3DTEA 5FZFA 5GZGA 1NHAA 2VW0A 5FCCA 4XL9A 1P7JA 2E1MB 4G9YA 3D0SA 3VBUC 1BMV2 4AIDA 1YHQI 2GOMA 2P3JA 5FZ4A 2JKBA 1Z05A 1BW6A 3GVAA 4OI1A 5TSWA 5IOZA 4YIIA 2D5VA 1UNBA 4XXPA 4XBQA 3N9LA 3Q8FA 2VECA 2Z33A 4IF4A 2QVSB 2RS13 1QJX1 4AI3A 4IZZA 2H6CA 1G6NA 4G6QA 1MS3A 1IGOA 4J19A 4EWAA 1EAH2 3WUDA 1XE8A 3QU6A 1BEV3 2D45A 1FPN1 1W8FA 1V55H 1VBD3 5JFRA 5J1UA 3LEKA 1FNZA 4EJRA 4Q4V1 2MFZA 3ES1A 4DO0A 1O3TA 4G8XA 2TDXA 1SDWA 5TGTA 4IE6A 2FDKA 1O59A 1AYN2 5FKBA 4AHXA 3ZFGB 3L2HA 3NVCA 4C8DA 2VJJA 4FE7A 4PJNA 2ZX0A 4A6SA 1R1A3 2LD5A 4XFFA 1Z21A 4OOIA 3IBMA 2XC7A 3P5BA 2XQXA 2FMDA 4YG2F 3NAPB 2VIXA 1QA6A 3KP6A 1MVQA 2E19A 4N43B 4AGRA 2ARXA 1SMYF 4C2UA 1T6SA 1PO13 2EV6A 4GXLA 5J98B 4IPAA 1FX5A 3CP2A 1YCIA 4L8QA 2K9SA 4R9BA 4UFHA 5IFTA 4Z82A 3WEZA 4C9YA 2R7OA 2I45A 2GMEA 4UFLA 3NJVA 4GULA 1DIWA 3CLOA 4XEZA 2P3KA 1NE6A 3OYIA 2Q8EA 4A3XA 2AEZA 5FP8A 3VBSA 1GNZA 2R062 4LLOA 3I4IA 1UHWA 3K4ZA 3JBG2 3E7LA 1BVP1 1DFQA 1EP0A 4HFSA 5L19A 4NQWA 2DTZA 1CAXB 2NXNB 2UV1A 1MZFA 1W06A 1BN5A 1PK6A 5L3FA 2A6XA 2VQ0A 5CFDC 5GLVA 3JTHA 3N3HA 4ITVA 4JGYB 1MS1A 2W92A 4Y20A 2IXSA 3PNTA 1ZR4A 2CNAA 4SLIA 3VBRA 2JDHA 2BGPA 5KWRA 1MKMA 4QQ2A 3WE2A 1TNTA 2FNPA 1XE7A 1TME3 2V6EA 3KV4A 4DXTA 1PUEE 3AYCA 3Q8CA 2VQGA 1S0BA 2L01A 3RZOJ 3ZFFA 1UY0A 2ZGMA 4ASLA 1LUJB 1U5IA 2WR9A 2R7SA 3K1MA 1BEV1 3GX4X 5DTDA 4J25A 4K8RB 4MIMA 3S17J 3ES4A 2JRMA 3M8JA 2DFHA 2WINB 3FHQA 3OPZA 3VDBA 3J81K 1VQ8I 1EY2A 5A7NA 5DMYA 1TWFJ 4EV0A 5J7MA 1JHJA 1HQNA 3F6OA 1Y39A 1U2WA 3I71A 1ZLJA 1O4ZA 4RAGA 3BR0A 2B5HA 3K4JA 5D8AC 1BI1A 4DRVA 1PGW2 1ZRIA 3B6CA 3GYHX 2Y9ZA 3I3DA 1SBEA 3BVCA 2DUOA 2X8KA 3V0BB 5F0FA 3KZ4C 1EYBA 5JCTA 3PQKA 1AX0A 2DVFA 3SHRA 1T33A 3HNBM 4MSVA 3K3OA 3TNPB 2K4BA 2PMZN 1ZKGA 3FMSA 1AR71 5EP9A 4XRFA 1YQ8A 1YFYA 4ZC3A 1FZPB 2XLFA 2YC4A 5F2WA 3RJRA 4AFMA 4BISA 4B7KA 4Q4V2 3J7NA 2QSFX 3J9SA 3LWCA 3HOVJ 3I59B 3PURA 4MV2A 1XRUA 1EA3A 1OYYA 2AO9A 3PIJA 2VT3A 4RA0A 4KT6A 4QX7A 2HR3A 2KD7A 4A0XA 3S2DJ 3EHKA 2STTA 1XYOA 3UJOA 2ELKA 2DW4A 2VZVA 1W6NB 5LBEA 4PK4A 1N78A 2HNHA 3HOWJ 1CQ9A 1WMDA 3LDBA 4AEKA 2LVSA 3HYIA 1OJLA 2KKOA 1JKRC 2RR11 1UG2A 4A93J 4HKLA 2DK8A 2C26A 2WWJA 5IK7A 3ACGA 1YI2I 1YNAA 1C1LA 3PLQA 2O3FA 2HEWF 4A3LJ 4JX4A 3GHNA 3IV5A 5L3DA 3N35A 3IDEA 1UFMA 1IS4A 4LO5B 3DKQA 1SC7A 2QSHX 5FPLA 2OT7A 2W2IA 4KIFA 2MYSA 2QZ3A 1JUHA 5FV3A 4C30A 4HN1A 2QQBA 5GZFA 1GZ9A 4XLNF 5K7HA 1ODDA 4BBRJ 3A7QA 3WNMA 2R7RA 4OQ8A 3LA3A 2DPUA 2HQAA 3AVSA 3NQOA 1AR62 3VZJA 1EAH1 4R9AA 1JN2P 4P9FA 4D5CA 3GBFA 3HD8B 1YC61 3CJIA 4C0BA 1D0GA 2E33A 1VQ9I 3QPLA 1R5GA 3RWKX 4L9BA 2VBWA 1QJY3 1X19A 2WZR2 1JODA 3AX4A 2VZUA 2NYXA 1US3A 3AZXA 4Y33A 1VE0A 2HDDA 1E57A 2AENA 1JUPA 5I91A 3TBIA 4N9HA 2ZHKA 3H42B 3FHZA 4Y1ZA 2M4KA 4Q27A 2EV5A 4HSJA 1Y9QA 3Q8AA 2DYSH 2RS53 3KQRA 4MHUA 4DOZA 3ZR8X 2R043 1WUVA 3O3KA 5J37A 3AMHA 2A3YA 1JZ5A 4K1YA 4KFCA 3LOBA 1GUUA 4MGRA 2R073 3A22A 3HT2A 2QF7A 3DPTA 4Q4W3 1IRGA 4IX7A 2FXAA 5FTTC 1BBT3 4QAWA 2X5IA 4NR1A 4AR2A 1RUJ2 3DWLE 1PO21 1R71A 4YYOA 2AQEA 3G4SI 1RUE2 4A7KA 1FBSA 2XOMA 1U9OA 1JKPC 1UMIA 3ABKH 2BW3A 4HN0A 2MD0A 5EEAA 1DZQA 3F22A 1RIOH 5FUPA 2RM22 5C4JJ 3MV11 2ZX1A 3HOSA 3GTOJ 2ZABA 4Q4V3 1H89C 1GANA 4ATFA 2F48A 5LBBA 3QPHA 1PM7A 3SISA 2ZXJA 1XG1A 4L9NA 1D1AA 5LWBA 5D8AA 2LSOA 4HZFA 4FQZA 4H3WA 1LHUA 4XRSG 3ZR6A 3VZLA 3HHGA 3TW7A 1SD6A 3EB7A 4EWEA 5J3LA 3BCWA 2KRHA 4OI4A 3CU7A 2VXRA 2ERFA 3TOBA 2FF4A 2P5LC 5IP7J 4G94A 2CDPA 1OOPC 4CP9A 1POV0 1YTYA 3V65A 4JGZC 3VBRC 1BEV2 3MIFA 1WCKA 4QX5A 5FLJA 4AK3A 2IT0A 4KA4A 2JPBA 4BH9A 5A70A 3K70D 4YIFA 5LY1A 1KU3A 2C0ZA 4DBQA 5EGOB 2ECBA 5FROA 3HN1A 3GCMA 1BI0A 2XGCA 3M7GA 2WFPA 3M8EA 1GR3A 1A5JA 1F8VA 1SBDA 3LB9A 1XQNA 1PVXA 2RS32 2PA7A 2ZNYA 2P34A 5TJJA 5JXHA 1ZBE2 1HW5A 5IT3A 5F0HA 2VBYA 1YO8A 4E7SA 4D0PA 3MYXA 2GNMA 1OR7C 4FPYA 5FO8B 4CUCA 3JAMZ 3ZMZA 4K7JA 1FNYA 4FPCA 3O2PE 2M2EA 2R7VA 1BJAA 4EN0A 3CMGA 5I8SA 5IJRA 5L3CA 4LK1F 3IAQA 3H0GJ 2LTNA 2XJSA 3NWTA 4QX1A 3PMSA 5HI0A 5C9AC 3ZXDA 1QDCA 5E6HA 2DXIA 3T8TA 3L00A 1D0HA 3ZDSA 3K1NA 3SEEA 4ES9A 5JXGA 3OYWB 3HM5A 2GIZA 4YW7A 1F31A 2EA2A 3S30A 2WQ8A 4DYCA 5C70A 5DCMA 4MXWA 1AA7A 1ASJ2 2OUMA 3DPRA 5ILUA 3LSTA 2NVUB 3QP6A 1OBNA 3ZFGC 3ZXFA 2JIGA 4YVSB 2RJ2A 1W9FA 1TW2A 2O7OA 3M8LA 2OYZA 4ONUA 2GXBA 1VPHA 3ZYHA 1QPMA 1U5TB 2VBZA 4MGQA 5GKAC 3FN9A 1QQP3 4AWDA 4D69A 3FKJA 1R5ID 1D0XA 5JPMB 2XF6A 1NOVA 3VSKA 1JGGA 5C4WA 2NVTJ 4FE4A 2Y0SA 1FTZA 5C5TA 3FM3A 2DOAA 2ZMKA 3FBIB 1Y9GA 1RHI3 1ZRFA 1TW3A 3I4PA 4MGZE 5ICFA 4XSZF 2XAHA 3KLOA 1QJU1 5CAZA 5KAIC 3G1OA 3ECOA 2RVCA 1YXWA 4KMQA 5CB7A 5FY7A 4B44A 4XLCA 1GWKA 3QU3A 2F5VA 4BACA 1HA8A 1J1LA 4CGZA 3K77A 1E5RA 4B09A 2OQRA 1OA3A 2J5PA 5HXVA 1TEIA 5T5OA 3CC4I 1KFUL 4QT6A 5J1RA 1HKTA 4XQWA 1QXPA 5JOZA 4LGWA 3TB0A 1FOD2 3M3YJ 4HSTA 1H8TA 3D5OA 3CDIA 5I8TA 4XBFA 1OCCH 1QBJA 2VMHA 1IOAA 3NL1A 2VOVA 1VBA3 4AVSA 3ROUA 4OFGA 4RN5A 1LOCA 2GN7A 2XVLA 3REOA 2X6YA 3PFYA 4BXUA 1DG6A 1G2HA 3I0TA 3WQ0A 5LBCA 3ZQHA 2LOOA 5DUWA 4U87A 2V9PA 4X1EA 2KIUA 2K9QA 4NAOA 4LK6A 4AVZA 1MNEA 3NRUA 2VMDA 1NY72 2ELHA 3CCMI 2XKPA 1HXS2 1QJX3 3WF4A 4DRRA 2QYOA 5F1JA 5EYYA 5IT9K 1U9NA 1PZ8A 2Y8KA 4Z8BA 2W0XA 4IEYA 2HWC2 1T0FA 2IFRA 5C8WA 3W2AA 1YYVA 3I2IA 4ZDPA 1ETWA 2QWWA 3KETA 1EF4A 2CQQA 3K4NA 1FBQA 2QUFA 1GUIA 2CQKA 2ETEA 2XVKA 4LHNA 2DVAA 4RL7A 1M06G 4JQFA 2QEXI 3IDBB 4LMFA 5ICCA 3WGIA 3HEFA 1RUH1 4IVNA 1AYN1 3H8UA 4NDLA 1IC8A 3VL9A 4HX7A 4BEHA 4WVMB 2YPJA 3ITQA 2Z1DA 1WI9A 2WWYA 4AHWA 1TMF3 5KHKA 2ME6A 2CWEA 5A6XA 1XU2A 1B35A 4MGKE 4PJ0C 3ZRGA 5EJ1B 4XCBA 3MLKA 4AYUA 3OYGA 3MF6A 4EN7B 1YUDA 4LB6B 2BXYA 3DYMA 3Q5FA 4Y13A 2JA2A 4FX4A 1GXQA 4DFSA 1OFNA 1WW7A 3B3QE 3DEWA 4BHCA 3HQRA 2DMQA 1AJKA 2IFWA 4ZH4F 3CF5F 3ZFEC 5I93A 4BQQA 3WHBA 1Z78A 2HWF1 3ABMH 1YEWA 3E5UA 5A1FA 3RTRA 3ZSKA 3I3MA 1VBC1 4E7HA 4HX4A 5EFUA 3LSEA 1ZHFA 1NG6A 2ZKLA 3NV1A 1DYPA 1IN4A 1TME2 4M9SA 2DT7B 3ZMVA 3HSEA 4QIWN 1O3SA 3TEYA 5GLUA 4UFMA 3JRCA 2A6YA 2QKDA 4ETSA 3OGJA 3IP4B 1JT0A 4LBQD 2WSUA 1XSRA 2XPWA 3AG4H 3EXUA 5CA6A 4B3XA 2YC2A 1X8MA 2VC9A 1MPXA 1HQWA 4XZPA 4DGWB 2MC4A 1T38A 3HNYM 4XFBA 5IK8A 4QQOA 1RUJ3 1AR91 2JECA 3L9JT 5HDKA 5FYUA 2L9RA 2CW8A 1AL23 2W91A 2HWB1 3R05A 3DCQA 1XGNA 4ISQA 3KFWX 3W6KB 1ZQ3P 5FBZA 4BQ1A 2EFQA 1MDMA 2EAKA 4QXBA 2HZTA 2BHZA 1UX7A 5DQ0A 2ZACA 2GH2A 5CVJA 3J8F2 3Q9OA 4IEXA 4DYQA 3HOUJ 1G59A 1UY3A 1NUKA 3CJIB 3GTQJ 4XFAA 4CDWA 5A1AA 3WF3A 5A3MA 2MG4A 2ZGPA 4LEJA 4DYRA 5FR3A 4L9JA 1YFHA 3HAGA 4HLYA 1RHI1 1HXS1 2W52A 2ESNA 1MVEA 4ZU4A 5A3WA 2XJUA 1FAYA 1H2KA 2RS33 1SCSA 2KPMA 4CH7A 4Q0PA 1SD5A 1PP8F 4KH9A 2E71A 4YM0A 3HOXJ 3C3VA 1Y56A 4A3IJ 1SMTA 2YU2A 1HIXA 2W24A 3FXQA 4FPOB 4RGGA 1E5IA 3BG7A 5DV5A 2R7TA 4UXNA 3K1PA 3CC7I 5T54A 1TNFA 1J09A 4O9EA 1KEXA 3OYCA 2D6KA 3NNJA 1QJY1 4Q47A 2ZMEC 1OLTA 4I76A 3VEPA 5D5VB 3AKRA 4ENJA 3PVBB 3OYWA 4KU8A 3FDYA 3MZYA 4BBSJ 2PG4A 5ACA2 5BNQA 2OVUA 3PO3J 4MX3A 4W4ZA 1AL21 2FBHA 3MVPA 1VQKI 5LRSA 4WZFA 1NLRA 1YW9A 1CPMA 4YVSA 1NXMA 4Q5OA 2MEV1 1N75A 1EPWA 1E5SA 4QWQA 1OQYA 3CO6C 4PQ9A 4PBPA 2QZ8A 3HSRA 1XMXA 5E1ZB 2EXIA 4B29A 3GZEA 3HIFA 1R083 4DINB 4BE0A 4A45A 2DPDA 1D0YA 1GFF2 3S6PA 4EQVA 4UXAA 3H7YA 3VD4A 3N9MA 4HRIA 2JDNA 4IRIA 2TEPA 2W57A 2GC2A 3DKWA 2ZX3A 4CP0A 1RZ4A 2OCCH 2EVXA 1VP6A 2NAZA 4N8MA 4A3KJ 3EUKL 3VD7A 1IKQA 2ZX4A 2UWCA 5HCHA 1BK1A 5E18F 4A3MJ 1QHHD 2HH9A 4HLTA 1R1UA 3ENRA 2RN7A 1OLQA 1A3KA 5GTHC 2Z9OA 2BYVE 3KS7A 3T2OA 3WG4A 5IYBJ 3HOTA 2HYFA 2ESHA 4IE0A 5F04A 4QX0A 1Y0UA 2F5DA 5FKKA 1LDKB 4E7KA 2M8EA 4FTBA 4B1MA 3BR1A 1X36A 5AVPA 3MPBA 1FYMA 5CFCA 3SXYA 1POV3 4TLFA 4NC6A 1H9PA 4LHKA 2K9ZA 1W8OA 3BT9A 1D4M1 4QPGA 3VOEA 4V1PA 2R7DA 4YFXF 1UG0A 1XNBA 2P4EA 3NJZA 5AC92 1C3HA 1H8TB 1Z67A 3RPUA 1LFPA 4E7ZA 2HKXA 1HRV3 1W6OB 4IV1A 2X6OA 4XONA 5FUNA 2LK2A 1QGPA 2DT6A 3PMEA 4ON0A 4CDWC 4YM2A 2WO1A 3COAC 2ME0A 3RVHA 1MQTB 4LBJA 2GC1A 1VBA2 2XJPA 2ZEZA 2OBPA 4XLEA 3Q3SA 2LLKA 4AQ2A 3K69A 4S2GA 4XJAA 1M1EB 3K2AA 3FXKA 3ZSJA 5EHDA 4QDQA 5AFEA 3VBHC 2D5FA 3LFMA 3CD6I 5EXOA 1GHCA 2CSOA 4IJAA 1H4GA 5CQEA 3HGGA 2HLEA 4KG8A 4XURA 1DQ5A 2GC0A 4W65A 2R0QC 2Y6LA 1U5TA 3GF2A 3OTFA 3IC7A 3IWZA 3BJ6A 3HBLA 1PJRA 4HSRA 2HEYF 2R92J 1UCRA 2X29A 4Z1VA 4AIKA 1R5HA 2PHTA 4P9LA 1V5FA 3D6EA 2VCAA 4UNOA 4N4OB 4FFHA 1Y1VJ 4DXSA 3CIHA 3AXEA 4H14A 3AC0A 4BZ4A 1V6NA 5FKOA 5T5PA 3QH7A 4GALA 4TXWA 3E6BA 3G7DA 3MPPG 1R081 5J36A 5J47A 5FBJA 4BHPA 1GP5A 5FMOL 1QH7A 3RCOA 4PLNA 1AR73 2ZZQA 2HWF3 3IMNA 3LFUA 1EH6A 1SLLA 3QH6A 4BNCA 4BQ2A 4M3CE 1OQ1A 2BZTA 2VKHA 4L0YB 2O5RA 2JG8C 1RR7A 1FC3A 2WY8Q 3LNQA 2FE3A 2XAQA 1DPUA 1GDTA 2VG9A 3F8FA 1JS9A 5I8YA 5M3FJ 2R0HA 5BXXA 1Q8VA 5KXDA 4AYBN 1X1BA 4EM1A 4H2AA 1S0JA 4WM8B 1DQ6A 2PMHA 2Z42A 3BCAA 4OUEA 1RUE3 1ZBE1 5F37A 4ZU7A 3POGA 3K4LA 3P9CA 2WRAA 3OOXA 1KDMA 2PEXA 3UT0A 4V2VA 4HK8A 5L3GA 1HRV1 3RZLA 1YIOA 3AP6A 1POV1 1GZTA 1B35B 4RR3C 4CZSA 5HDNA 2XUBA 3N97A 3B94A 2D44A 3PNAA 2XAGA 3A0NA 3W21A 2XONA 2YX7A 5LK5A 4HVQA 1UL9A 4RM3A 2EIGA 5JMCA 1GZCA 1XC6A 5TISC 1K78B 2EIMH 3T5XA 1G9CA 1NTCA 4RB3C 4XJWA 1X82A 1RUF3 4RS5A 1E17A 3C7FA 3GJBA 5GZEA 4LD5A 1K3IA 3JQWA 3GZTB 4ZTFA 3OBAA 3AG1H 5B1AH 1NZIA 2WNVB 1R6RA 1KQ8A 4P00B 1EV13 2CS3A 5F6FA 2HDWA 1D4M3 5FFXA 2HYKA 4IEQA 3I55I 1QOOA 3DP7A 5BPDA 4RGUA 3ASIA 1PGSA 1OXCA 5CKMA 4NBQA 4LHLA 3MV01 3A02A 3PDQA 1FPN2 3Q0UA 5L3BA 3CLPA 4V2FA 3G3ZA 4YFNF 4N43C 3P7NA 4W6XA 4LG0A 3P9IA 2GLOA 2WS93 4MVTA 3FBMA 4UT5A 5LASA 4YFZA 3JB8A 3B69A 1QPIA 1GOFA 2ADEA 3ZFEA 4L2NA 3HSFA 1XCVA 4KICA 3PIGA 1VZ0A 1JZ7A 4BK4A 5GJ6A 1LE8B 5EV7A 1BC7C 3VPRA 4YM3A 2Y33A 2F4OB 1F5JA 1CAWB 4WV8A 3V0AB 2XHNA 3L2RA 4D1QA 2QZ2A 2WAQN 4RB0A 4M01A 2ICWG 4BDYA 1W36D 3CCRI 1PO11 2YC0A 5DAXA 3T2QA 4ZDLA 2J5OA 2E26A 4F3QA 3AL6A 2L7FP 4E4HA 4Q4Y2 3RI9A 1OLRA 1R4MB 3HWJA 4XMYA 4XDPA 4JX5A 2ADUA 1JUMA 1QU0A 3O0VA 3VBUB 3ATGA 5F7UA 2DTWA 1WW4A 3Q9VA 5C5UA 3F23A 3IIIA 1JE8A 4RA2A 2UXNA 1R64A 2Z69A 2IS4A 2RGVA 2F4MB 4N53A 1MW7A 3TMOA 3THDA 4TWTA 3UETA 5CG9A 1QZZA 2VZPA 2RNGA 2I2SA 4FOYA 2DCEA 1WKMA 1FWZA 4C3HJ 4F91B 3H50A 1HDKA 3ZMNA 4YW4A 4UUSA 4NOTA 4XAAA 4JC1A 5KCMA 5FY8A 4IL7A 3LSMA 5I0DA 4UVAA 2ISZA 3FIWA 4LO7A 1FATA 3I3QA 4PHZA 4LG0B 4F8AA 3HBZA 2ZBJA 1BLZA 4RGAA 3GTGJ 1LEMA 2OW4A 1ENHA 2IPQX 3H0DA 1SLBA 2XR4A 4LIVA 5FYTA 1FPQA 2QCOA 3AP7A 2L54A 5K0UB 4PSWA 2RKHA 3V7RA 3FMRA 1JMUB 3O1OA 2VUDA 4HF2A 1JU3A 3EUHA 1DPRA 3O5SA 1WCSA 1TWAJ 1V5EA 3C7JA 5CFCB 2LG4A 4UVCA 1K7AA 4LKFA 3BY6A 3CO2A 3PTYA 1D5VA 2IXJA 1O5LA 2BRTA 1ODNA 1MZ5A 4AWXB 2AR6A 3FBNB 1HN0A 2E2HJ 3D4KA 2FMYA 2JE7A 4XF0A 2XRLA 2ID3A 2F2EA 4CZZA 2RMU3 3IB3A 1F15A 1VBC3 4XFHA 2VW1A 2DA3A 2FNAA 3RZGA 2V7FA 1R36A 5E17F 3PL0A 3ZYFA 2DVDA 2FSWA 4HK9A 5CNAA 2KRFA 1I3HA 2Y9YA 4DIQA 4PJYA 2QFEA 4YRVA 2R7FA 4BDVB 5HNHA 2JA6J 4KGQA 3R4UA 2WB1N 3HUGA 3TEZA 4CXXA 4NHKA 4BOWA 4EM2A 1XSDA 1YITI 5A3UA 3DGTA 1HV0A 2D40A 4A3JJ 4Q1RA 3HOBA 3GTJJ 3EMRA 3UKGA 3B73A 1QWRA 4WVVA 1V5GA 2YU1A 3VBOA 5GAEJ 3M1EA 3WP3A 3NEUA 4HANA 2VKVA 5FYBA 1EUTA 1MS0A 3DXTA 5C3QA 1W2OA 3S1RJ 1RUC1 3OIQA 1FNNA 4NIIA 1HRI1 4HG2A 2RG4A 4AIHA 3PO2J 5BNGA 4PQQA 2DA5A 5IT9Z 4RGXA 2ZZJA 5LLQA 2VOOA 3O1PA 2R1DA 3DKXA 3B9IA 4E8CA 4CRQA 3FM5A 1V6MA 2HOSA 1SPPB 1F43A 4AEJA 2R5ZA 4HKOA 1CAVB 6PAXA 4AHZA 5CVUA 5A7WA 1IKPA 4AFCA 1RVF1 3LQQA 2JE8A 4Y22B 4FOQA 3OYJA 2JG9C 2DODA 2Q30A 3AKTA 4LPLA 2QNKA 2HOTA 3BOWA 1ALYA 3ZP5A 2CHHA 4RQPC 3CUOA 3BPVA 1RHI2 3VBSB 1N1TA 2RDSA 4DXRA 2V4VA 2GM4A 4IO9F 1UPIA 5FO7B 4EJWA 2ID6A 2WAOA 1C1FA 4EN9B 2CUZA 1HQCA 3EJKA 4HNTA 1S2KA 1UW8A 3VUOA 1ZAOA 4L5EA 1YQAA 3WCSA 2A5ZA 4PSXA 5HV0A 1AYM3 3MKYB 1SEFA 1X4PA 1S29A 4LQRA 4AYBA 1WJ5A 2X1CA 4CCLA 1NK3P 3I2JA 3ZQIA 3K9TA 4RAFA 1S72I 5FQ0B 2ZX2A 2EK5A 3RKXA 1RGSA 4BM8A 4DUXA 3GTPJ 1IS3A 2WAAA 3ZO0B 5FJ8J 2HYGD 4X8NA 2VZSA 1IN5A 2C4XA 3K4AA 4XSXF 4U7DA 1GNHA 4P55A 1L3JA 5A3TA 5A33A 1OH3A 2MEV2 1ZGWA 1SVOA 1JKQC 2A69F 1P8JA 1W9SA 3ZYPA 5HLTA 1AR82 2GZWA 4IQJA 1YYNA 1ODMA 3VZKA 1CGPA 5EPAA 3CF6E 5LGNA 5F1RA 4IEOA 1QXJA 2COBA 1VBB2 5ABJC 1TT0A 2Y6KA 3SMHA 4AAPA 1IN6A 1OMIA 2BE5F 4LBQA 2XPJA 3WG2A 4NPMA 4DW6A 1HBXG 2JA5J 4ZZLA 4C3IJ 1MH4A 5HDGA 2VCMA 1CAWA 2EFOA 3QPTA 4OIQF 3RRDA 1KGYA 2BU9A 4IEPA 3AP4A 3VDAA 3OEAA 1X3UA 1TZLA 2E35A 5AC91 4BU2A 3H1YA 4CDQB 3U11A 3ZGKA 2XDVA 4XYXA 2FQ4A 3GFIA 2FZ1A 2VI6A 1X2MA 1T2XA 2WWUA 4RS5C 1W6QB 4XPVA 1RVF3 3KV5A 3O1SA 4I30A 2OX0A 2R041 3ZXEA 1LULA 1VR3A 1O57A 3K0LA 3QYFA 2JPCA 3K51A 1OCPA 4KJZA 1ZREA 3W6VA 3ZXKA 5B2GB 3ZFEB 1X1PA 1Z3XA 5CYVA 4PFPA 4E2QA 5JSPA 2DOEA 5C8CB 5LGUA 3H35A 2F4LA 3M2MA 5K5OA 4NJ4A 1JYWA 4B4CA 1QHDA 3TEWA 5M5YJ 2X6WA 1X1CA 2VUCA 1ZG1A 5AVAA 4WX9A 1SAUA 4XLPF 1CAUA 4M3BA 1PP7U 3KZYA 2ZEYA 5C7GA 4IEVA 1VMHA 2KIQA 4KISA 4AVAA 4NIDA 4E4DX 4U7BA 3JRFA 2WFF2 2WZ8A 4Q4X1 3DKYA 1UYXA 5CKQA 3OYKA 3KT1A 5BNNA 5K0UA 1UY2A 1PK6C 3TWIA 5F0CA 2RS11 4LOSA 2VT2A 1ON1A 2K46A 1UOFA 1P2FA 4QU1A 4MHRA 2WFF3 3G1MA 4K2EA 2XG3A 1NA1A 1HLVA 2YU9J 4HBNA 3GFJA 3BJOA 3E5QA 1LDJA 4Q4ZF 1AXYA 5JLWA 2JDAA 1DQ0A 2QE3A 1RUG1 2ZMLA 4BDZA 3O12A 2LM3A 4XVHA 2P7CB 2ZKNA 4XUPA 5A80A 1JOJA 2B7EA 3MAJA 3UKVA 5DCMB 2AQFA 3PM1A 3N05A 5HODA 2V1DA 2GP5A 2ZA9A 3PUQA 3OJBA 4MO7A 3IKVA 4IRHA 5I0TA 5SV8A 5CBLA 1Y43B 1W2AX 2RS31 2X1EA 2WO2A 4GH4A 3PJYA 4M3CF 1KYWA 4UHTA 1J58A 3NRVA 5LBFA 1ZR2A 4D6QA 3RZJA 3LFKA 2FUG2 3VSLA 1ZX5A 4F7ZA 2Q0AA 1MDMB 2IWGB 2JENA 5KR7A 4XFIA 5B4NA 4D7MA 4XJUA 4AUXA 3VBOB 2EZKA 3CDHA 2L9LA 1VI0A 2RMU2 1YJKA 2BERA 2CV6A 4Y17A 4S2DA 1QVTA 1N77A 5B4XA 1P4XA 5FJKA 3MW3A 4OYUA 2QGUA 3QBQA 4BJ6C 2J1UA 3ERMA 4O9GA 5IVBA 1Z3YA 4AEDB 3C7GA 3WNNA 4WM7C 4R9DA 3N9PA 1AVBA 2VZQA 4BY1J 2K3FA 2A70A 2LW8A 2WAQA 2EBIA 2AREA 1XDUA 3ZXJA 2LKPA 2DCYA 4HL0A 4J01A 2Y6GA 4HPKB 1TVGA 3HR9A 1TC3C 3M3CA 3UV9A 5I0RA 1WH7A 1GU3A 5EZHA 5A6ZA 5FZ7A 4QKBA 5GZDA 1WD3A 1Y9MA 3ILRA 3BKZA 4XDOA 1H1MA 2VOXA 4BYYA 4JGZB 4D0QA 3BOQA 1VJ2A 2NQYA 1WMXA 2DK5A 2JD4A 1YW8A 3ZIXA 2VZRA 3ZQFA 1T2KA 2LC2A 5GADJ 3HTSB 1M4WA 2V79A 1QJFA 1Z7UA 3H3UA 3PIOF 2K02A 2VZ1A 5LY2A 3V42A 1Z7S3 2JX9A 3VBFA 2OZJA 2P8TA 2V5YA 4K8FA 1VQLI 3GNEA 2P3IA 4FETA 4Q4X2 1D3YA 3IZOA 1O4XA 1MSEC 2QSGX 4NMIA 3CBNA 2WKKA 2JSCA 2Y38A 1CAVA 3DBHB 2ARAA 4QPIB 4GWMA 1OR7A 3PSFA 2QDNA 2WZR1 3NSTA 4W6WA 4H4KC 5JLVA 5IVYA 2HWD1 3N36A 5F8PA 3AAFA 3TAYA 5CISA 3B5LB 1AL0G 3DBLB 2QM3A 3WG3A 1RINA 3RZKA 3FXOA 4D7YA 4JBAA 1AX1A 1Q8PA 3WF1A 2E51A 5DUKA 2WO3A 2V1NA 4DPNA 5ANQA 2ZO4A 3VBHA 3ONQA 5FZEA 3TN92 2LF8A 4Y52J 1NAEA 1QOTA 4MTEA 2R0FA 3OF1A 4AVCA 2L3DA 1OA2A 4JVAA 4KMUX 2E53A 2YPDA 2QA4I 3INAA 2KA3A 2EXHA 3LDRA 1SFYA 4FHTA 2Y6HA 1IG0A 4MLOA 4M00A 5F2SA 2K27A 2B9VA 3SC7X 4ZKTB 2O1QA 4MUVA 5J3UA 4Z6YA 1FPN3 1RI7A 3BQYA 4Y4YA 1AOYA 1XTAA 5DZEA 1JT6A 1IQDC 1IW7F 4NHLA 3OBTA 4QQHA 1GQHA 4MQ9F 2STWA 3SFIA 1UKGA 5LEJA 4DB5A 3CQZJ 2R7EB 2Z4FA 2GNTA 4FTEA 4CDQC 1TL8A 4QLCU 2ZXQA 5LD2C 5FUIA 5GTIC 4RQPA 2XWJB 5DZGA 1S3JA 3HTUA 2JA8J 1PIV3 4LT5A 1S8NA 2UWBA 3MDPA 3RI8A 2RREA 5FFOC 1PM4A 1IGNA 4IV3A 3DU6A 1F5FA 3WDYA 2VPLA 3CMEI 4COYA 4QKFA 2JTVA 5DAVA 3SFZA 5FO9B 4WCGA 1K45A 4CDXB 1R1A2 3WQ7A 3ZN6B 5I0SA 2VE1A 4A3EJ 1W0TA 1E2XA 4A7YA 2ID4A 1ZYBA 4P1WA 4W8JA 1RUOA 4FXKB 4B3AA 1Y0NA 3WP5A 4IQ4A 3GYDA 1CQTA 5DUUA 2YGLA 2Y6FA 2CGPA 2XKOA 1CN1A 5FMOS 2VMFA 3OSGA 3WTXC 2BY2A 3EUHC 1Z7S1 3WNXA 2KZGA 3SDGA 4OWRB 5LHIA 1KQRA 1AXZA 3APBA 2R071 3EBRA 3POWA 3E6MA 1V0AA 1RMU1 5HLHA 1ENSA 4ZS2A 4YM1A 4EMSA 3PNVA 3GXUA 1DP7P 1E0EA 4QX3A 2KP6A 1O3RA 2XBO3 2QQMA 5HCAA 4QPGB 5GAHJ 4XUTA 3PU3A 2F6BA 2DU9A 2WUHA 3C2HA 3VL8A 4GDFA 1W36C 1XSVA 3OYBA 3BCBA 2VH9A 1RUI2 1DYOA 1R1TA 1UPSA 1UWWA 4INDA 2W3JA 4EATA 2EIKH 4AI8A 1I1EA 2CW7A 4CU8A 5D6FA 2EFWA 3ZFFB 1LKXA 1YQ2A 1REEA 2V1XA 1JYVA 1CR7A 4NRMA 3JBG1 3KCCA 4BQOA 3I64A 4BXFA 1TQ5A 4XABA 3RNSA 3I58A 1BI2A 3OMYA 3LQRA 5IWFA 3POJA 5HXMA 3GZAA 4BK5A 4AFAA 3FXLA 5HS9A 1UX6A 5GP9A 1GZWB 1APNA 1C4RA 3KP3A 4RB2C 2PLV3 3A0KA 2AHQA 4QPIC 2FX0A 4D5FA 3AJYA 4WF2A 4Z2AA 1JUIA 1AUYA 3MUZ1 4UF0A 1BKZA 1ULYA 5E3MA 2C5DA 1VBE2 3BYWA 1MBHA 3I2HA 4QHOA 3GZNB 2YBSA 2GBYA 3ZOIA 2I5UA 3H9GA 2ZHNA 2COMA 4OIPF 3T30A 2FBIA 3UKTA 2DYRH 3WTSC 1OHFA 1RRJA 1SMVA 1W6PB 3NKGA 4HXCA 4C0HA 3VYUB 2UYAA 4XKCA 2PHDA 1LNSA 3QRFF 5K7PA 2A1XA 4CDGA 2H8WA 2VTXJ 4YZ4A 3H8RA 1D1BA 3U9GA 1YG2A 4Y5Z0 1C8NA 1XSQA 2R3SA 1W04A 2W94A 4LFUA 2VJ4A 2QENA 2G9GA 4D7TA 2E7TA 3KF5A 2CMPA 1ND3C 1HRV2 2QQAA 5J48A 1VRH3 5DPNA 5EYRA 4O5VA 1SANA 3R60A 1QJZA 2CFXA 4YARA 5LW9A 1XOYA 1R23A 2CTVA 4FTHA 5FK7A 1GBGA 4YGCA 1S0DA 4X8PA 1NG7A 5C9AB 3ELKA 3J81Z 1UOGA 4YNIA 3BR6A 2KM2A 3AYEA 2ETHA 1MEC2 2K0GA 4LHSA 1QF3A 3LEGA 1UMQA 1X9TA 3THTA 3OR2C 4XZUG 4GB31 2XHKA 4RMNA 2ELJA 2GWRA 1EJ9A 3BGAA 2EWNA 3CF2A 4B8XA 1REFA 4RDUA 3TDZC 1W6OA 4IV1B 2ZFUA 2A3SA 1AJOA 5D2AA 3ECQA 2EZHA 3L09A 2HWC1 4QB6A 4QB2A 4FASD 2DCTA 4YVSC 2YFZA 4GH4C 1PVEA 1RNLA 4LORA 1NQDA 1FOKA 2ZSIB 3ABLH 1KDKA 2LTPA 1A04A 2W82A 3T4HB 5LRRA 2DOFA 4YFKF 2G7HA 1HSJA 2WO7A 4COVA 1FBUA 2A7AA 3DYOA 3LWFA 2BVVA 5ERIA 3H9JA 4JDOA 1WFXA 3T0DA 3LA2A 2JK3A 4J6GA 2VQLA 1LJ7A 1FOYA 4ITCA 4NO4A 3H3ZA 4KT5C 1JUSA 2LYCA 3J7YJ 1YQ6A 3E97A 1VF9A 2WV1A 2F4PA 2XUEA 5FZIA 4GXOA 2Z99A 3JSOA 1TME1 5CVRA 4FCAA 5DEQA 3DLAA 1ST8A 3BDDA 1JYCA 3FXUA 1BR2A 4AZZA 1WLTA 1RKWA 1E3HA 1WW5A 1Z91A 3IPVB 4XF4A 4HMZA 4AXOA 4QPOA 1FOXA 1H88C 3R4SA 2JEMA 2PHWA 1UIKA 1W28A 4QHBA 1PNGA 3J8F3 1OKRA 2JWPA 1ACCA 3UKNA 2A73B 5FYHA 3ALQA 5FP3A 2HFHA 2BVMA 2DMNA 1G3SA 5FZ8A 5FYCA 4RHV1 1C28A 3DF8A 1EUUA 3POSA 3SDBA 2C6SA 2Q0OA 3AZWA 4HF1A 5JUVA 2M0CA 4U0VA 3HOZJ 5FD5A 4Q0VA 4YELA 4AW7A 1U0AA 2VTFA 4FSJA 4RLFA 5CKTA 3V64A 3X2QH 5B1BH 2RVAA 4CPBA 3PUHA 3F8MA 3TDUC 1CF7A 2CU7A 2JD9A 4JQRA 5C4XJ 3WOGA 1I1GA 2RV9A 4ZJZA 3EYPA 2IC1A 2F4IA 1NCRC 2ENRA 4UBGA 2VBDA 4MH0E 2ILMA 3SEZA 3SCFA 3WHCA 1OKOA 1N3PA 4MGTA 2PBIA 1UZZA 1V3FA 2NOJB 2IVMA 1ZTRA 1PGL2 2MSYA 3JCIA 2GSYA 2J1AA 4ZPIA 3USSA 2RDNA 2L0KA 3AJZA 3UR3C 5FZCA 5T5LA 1VRH2 2IXIA 5FXVA 4XE9A 3MIHA 5F6LB 1VQMI 1G86A 4BXXJ 2NM1A 1H6XA 4XUNA 1I5ZA 1UF2C 5DD8A 1IPKA 2HWB2 5A7QA 4CEWC 4CDXC 3QOEA 2M3AA 3UJQA 2P2KA 2L7MP 4OI0A 1PVC3 4XIOA 5KXCA 5FKCA 2DFEA 2AH2A 2O9LA 3AFGA 4AI0A 3RI4A 1QJY2 2YROA 4CYCA 2IUWA 4CDXA 4QM8A 1SG3A 4DEVA 2WNVC 1WMFA 2WYFA 1RUD2 4IE5A 1WZ2A 1YRZA 1CZSA 1GV5A 5T3NA 4OLLA 4R4ZA 4KMFA 3N4MA 1T56A 2QKLB 3S16J 1HV1A 4XJ8A 5LZ6A 1A6QA 3GEZA 1W0UA 5CZKA 4DXZA 5FIXA 3W2WA 4KIBA 2VNGA 2HS5A 1W8HA 4K40A 1U8BA 2WA4A 2H0VA 3S2HJ 1YIPA 5BS6A 3KP5A 1DQUA 1QGLA 1J7KA 1LESA 3DPRB 3OGRA 4FBFA 4PLOA 1S4CA 3SKJE 3WZ1A 2PLYA 3NMBA 2ZB9A 5JIUA 2OF7A 3V0AA 3PQJA 1RC6A 1WGPA 3K4MA 1GV9A 1OT5A 4XMAA 4D8MA 3KYCB 1ZA7A 4OIOF 4M3EA 3AXDA 3OEBA 2QQLA 1GVJA 3ST7A 5FQ0A 3GDBA 4OHXA 3I3BA 3MLJA 4AI9A 3OIOA 2VKEA 2P1BA 4GB32 1Z0XA 2OA2A 4BLJA 3VHNA 4OHYA 1KS5A 1GZWA 2ADDA 2E9QA 3I4NJ 2KJCA 4RGSA 3M3OA 1UCXA 3BC8A 3EQLF 2IGMA 3BTIA 3AMQA 1XGMA 3QD6A 4E7JA 1LENA 1HJGA 3WX5A 3S14J 1MBKA 2QQOA 1ZELA 2B9UA 2IJLA 2DF7A 3VYSB 1W2NA 5D5UB 4V2WA 1D7PM 1DLCA 2DQRA 2VOPA 2H0BA 1MMGA 1DZRA 3TGNA 1GYKA 3MI8A 2NLRA 3JREA 4QU2A 4OUMA 3JR9A 1T8IA 2M7AA 1K5MB 5CFDB 3SZGA 1RUJ1 2DYCA 2M0MA 2JZYA 3I49A 1QQIA 4YW3A 1UHSA 3LAJA 1VFCA 1F1ZA 1FMD2 3ZPYA 5IYYA 1XCBA 1YLFA 1RVF2 4IOCF 4MG2A 1RUG2 4ZTJA 1Y7BA 3LKJA 1TWHJ 2ZXWH 3N7KA 1HJFA 2O03A 1ND2B 3CKHA 2O61A 3ZPOA 4BQYA 4JGYA 2XAJA 4Y20B 4G4FA 4LKSA 1C0WA 3ZYIB 4A3BJ 5DUVA 1U8RA 3HPHA 2WL1A 3SCGA 5JLXA 5F32A 1J3PA 3VZNA 2R5YB 2MH2A 1JXSA 5A2QK 2HOEA 4NHXA 3MIEA 2LP0A 4NPRA 1U5TC 4PJMA 2WIIB 1P4AA 4PJLA 5ANNA 2Y69H 1ACIA 1NLSA 5JR7B 3W5MA 3T08A 1W0NA 4QQLA 1XS9A 4F3JA 1BI3A 1ORKA 3WU2C 3S5QA 2JT1A 1VLNA 4X6AJ 5FRNA 1GQGA 1H6YA 2UWMA 2DU1A 3MEPA 4Q26A 3POIA 1FSHA 1S0GA 3N7JA 5J40A 4BY7J 1ETXA 4S2FA 1Z77A 3EYIA 1X9PA 4UUTA 3IL2A 4OAZA 3K4KA 4LK0F 5F9TA 4MNUA 3WQ1A 5C4WC 3FHNA 1QZEA 1S2EA 1PGL1 3J7HA 2A3XA 2ZAHA 4PGHA 4ORFA 2ZHMA 3IAS2 1HB3A 3JBG3 3P3PA 1J5YA 1W8ZA 2RS52 3WVJA 4G7HF 4IKFA 1DGLA 4IE4A 3N9QA 3JRHA 3E6CC 5H9RA 3FX3A 2FMLA 1DLLA 4I98B 1LHWA 2XAFA 2XAUA 2XLAA 5KHDA 3RJPA 2YFUA 1ENQA 3ZFFC 2Z16A 5BNNB 4V19K 3V4GA 3CTAA 2A75A 4LJHA 3VB9A 3MZHA 1WZXA 2X10A 5FLHA 4XORA 4UW4A 1FXZA 5CYYA 3I2OA 1I9RA 1X33A 2GNDA 2ZGSA 5SV5A 3MW4A 3WP6A 2VM9A 3ZN1A 1VBB3 3GTMJ 4XJ9A 1W6QA 2YZ4A 1GWLA 1BQPA 3E3VA 5H9QA 2W95A 5G05L 3OBZA 3LZZA 3SZTA 3G6JB 5BNOB 4P14A 3OG2A 2YUEA 2VNRA 4EN6B 4BMEA 4A6DA 2P17A 3RJ2X 4ASKA 3F8NA 1MS9A 3IPVA 2G1MA 3TN93 3ECHA 3RSNA 5IYDJ 1GOHA 1D4M2 3U1DA 4L0ZB 3T3YA 4Y5TA 4IHYA 2NNNA 4OMYA 3PJRA 4IHVA 1XU1A 3WG1A 2WZPP 3ABTA 4XF3A 1LOFA 5F5AA 3HRSA 2ZMEB 3OSDA 1IXCA 2GA1A 1JOPA 3L2WA 2WT0A 1HW2A 4ZZ5A 4E70A 4BJ5C 5E16A 1AR93 1CX1A 1Z6TA 1NK2P 1H0BA 4GFBA 1NCRB 3F2ZA 4XC9A 2VVDA 4A3ZA 1WPKA 4Q0SA 1X7NA 3MN2A 2GIVA 5A32A 1W2UA 3WW1A 3HJRA 3B01A 2FDHA 4IOAF 3KB5A 1LKNA 2CL2A 5IVEA 4RB1A 5EWSA 3WW2A 3OGVA 2IGOA 4EWDA 1JBCA 1N1YA 3R4DB 4OULA 3ZLIA 4NWWA 4AEDA 1LCLA 3H8OA 4IEUA 3IM0A 2VXDA 4EROA 4JX0A 4Q4Y1 5D8KB 4YW6A 1HKSA 3MIDA 3H36A 3BTYA 3PSIA 5LA2A 3K4CA 2GXAA 1X1DA 2D6MA 2BEOA 4WXHA 5ACA3 2H09A 1LHVA 2PN5A 3KLNA 3Q8BA 4Y1VA 5J96B 1YO5C 2I74A 2EA4A 4QXCA 2VQHA 1IS6A 4LXLA 4XKVA 3W3CA 4XIDA 5G04L 4S04A 5EEHA 1VTNC 1EH8A 4TLGA 3WINE 1F9KA 1TE1B 3C2BA 1H8AC 1R092 3MHZA 1V6JA 3VHPA 3M3IA 1ETVA 4Z07A 3KEQA 2HI3A 4LKDA 5TRDA 1P9QC 4Y15A 4NRQA 4M3DA 4CDQA 1KD7A 1BR4A 3U4SA 2JG9B 4QX8A 1COV1 4TZDA 2EIBA 4DNCA 2EZLA 4DUWA 2OUJA 3JQXA 2R072 2P6CA 1BOBA 1IXSB 4JAAA 2LS6A 3SH5A 3VD5A 4UUVA 3GBWA 1XNAA 1LU2A 3POBA 4C91A 3BR3A 4LULA 4P02B 1S7AA 5FY1A 4R8HA 4LNVA 3LPGA 1BXHA 4UOJA 1AYM1 3C8XA 2NN8A 2HEVF 2RDQA 1VNDA 4CDUA 1VBE3 4II2A 5BNPC 1IRXA 3K7AJ 2KRCA 4CU9A 2Z5UA 3TRSB 1MZBA 3WTWC 3P6BA 1IZ3A 4X0GA 1OKQA 4QHZA 4OU0A 1J2XA 2A6WA 3WDUA 2CU5A 1W8WA 5HCFA 2D3PA 3ISPA 3I59A 3VBSC 3K6GA 3VGIA 5AC93 5DG2A 1WSUA 1RUI1 1QNYA 2L9SA 4GAZA 3ACLA 2ZKZA 1RESA 1FSEA 1IG7A 2W08A 4IV3B 1TLHB 2NOGA 2OS2A 2N7GA 2L4MA 2KL4A 5CFDA 1WBFA 1N3OA 5GZCA 2JUGA 1VB4A 1GT0C 2CWMA 4Q48A 1V6IA 5CQGA 1YFXA 1Z0HA 3A01B 4BUPA 1CESA 5C44J 5J8CA 5D4RA 1QJU3 1W8TA 3S3MA 3BJAA 2J7MA 1AZDA 2DA2A 4QM9A 1W5CC 2M9HA 2WNEA 3AMNA 1W3XA 4CPBD 4XFCA 5IUQA 3U4XA 4LITA 1NKGA 4A42A 1WCMJ 1FX7A 2JXAA 1TNSA 3S5AA 4G7OF 3WW4A 4Q1PA 1LJ9A 2R16A 5JI6A 4LE3A 4BQWA 2IXLA 3FUQA 3ZN5A 1AU7A 3JTGA 2G19A 2QQWA 2YBPA 3L2QA 2QDRA 2W39A 1G3WA 1S2BA 1USSA 2D6OX 5GLTA 5FDBA 3T1LA 2XGEA 3CL1A 1SVLA 2QQJA 3ML6A 1IN7A 3RMYA 1FY7A 4QGNA 4LOTA 3W9AA 2M4GA 1KZHA 4CEYC 2PHRA 4GYIA 1QMJA 2JG8B 2W7NA 1OOPB 2JDPA 3VKOA 1H9WA 1LGCA 4CO8A 2VU9A 4XQ4A 5JR2A 2YXSA 1KJLA 5A7OA 4B4PA 5FLXK 4D7SA 5CG8A 3H5RA 3NAUA 1B4AA 2VQTA 3I2GA 2AGSA 3ACFA 3N7LA 3FZVA 5E8GA 4J00A 2MGQA 2EIDA 2VMCA 4ZU5A 3CCVI 3R0AA 4K6BA 1US2A 3TOAA 3AYDA 5FREA 5C33A 2DA6A 4IERA 4KU7A 1PVC1 2MA3A 4XICA 2R7WA 4WBBA 5DG1A 3MD2A 3NV3A 2WZR3 3O1RA 2FQ3A 2WWSA 3LDKA 3TP0A 2NS8A 2X0LA 2XVGA 5EJ3A 4M0HA 3ZSLA 3OOUA 3ZSEA 4U36A 2BZDA 3A01A 4FI9A 3V8JA 3ZXLA 2L4AA 1UXZA 2DVBA 3ZMDA 4COZA 3CCEI 1TG7A 2ZTNA 1JZ2A 4JGYC 3AZYA 4L92A 3WNOA 2W1WA 4PLMA 4G7ZF 2N8GA 4NE9A 4YPJA 4GIQA 5FWJA 2DUQA 3ZN6A 4XMIA 4LE4A 5FPVA 5FPXA 3WDTA 4FPLA 2TNFA 1D8JA 2IBDA 3WTYC 4WXDA 2UZKA 5APAA 3OYAA 1BK0A 4XOGA 4EJOA 3BUCA 5FZOA 5F3CA 1KYZA 4ZZDA 4XCAA 3EQEA 1TZOA 1B1BA 2H94A 4KUMA 4HLXA 4W50A 2DV9A 3TBDA 2HOAA 5FP4A 4G6DA 1KRIA 4MFEA 3WU1B 3D3AA 5FYIA 3WLUA 2JG8A 2R49A 3WE3A 2G9FA 3HEIA 3MMYB 3FWEA 3HB9A 4LLGF 2L9VA 5D8AB 3T0YA 1SLCA 1GSLA 1TTYA 1RUF1 2X1DA 3MWMA 1QJX2 3J80Z 4MADA 2YUSA 1W7PB 3ABUA 2GMMA 1PUFA 4BB3A 1UO9A 1XNDA 4UBHA 1QZYA 3HKZN 1B59A 2HTJA 1XD7A 3GTKJ 1EV11 4NC7A 1R9TJ 3SQOA 4IGPA 2IP2A 1J0RA 1J75A 1WH5A 2ZEXA 4MTDA 5HOOA 2MPFA 4C2MJ 5DAPA 2JMWA 3VHOA 5K4LA 3L7WA 2R4GA 1IRFA 2WB1A 1NT0A 4MXVA 4DNYA 2VOTA 3HPNA 1FIPA 2WBKA 5A3PA 1R1A1 4XIKA 3M70A 2BGCA 5K1YA 1JZ6A 1QH6A 3FBYA 2UYBA 1IG3A 3E6DA 4XUOA 2MBFA 5FZHA 4XJZA 2VPRA 1ZRDA 2BNMA 4HA8A 4LK7A 3DL3A 1CX4A 2PTMA 2TUNA 5A32B 4FQGA 4GWNA 2BVBA 3JB4C 4AGVA 2CUFA 3B02A 3A1YA 1TQPA 5K7ZA 3IWFA 1OUSA 4YW1A 1ETKA 5FJHA 2Y34A 4KBZA 3I3EA 1G8XA 3JU9A 3WDVA 4ASMB 2BY3A 3VBFC 4L5IA 4FP3A 3DEEA 2FRHA 2XPUA 5DM7F 1DDNA 2QUOA 3ULQB 1NXD1 2YX4A 5DAQA 4OAYA 1AKHA 2ZJCA 3DCFA 1OPMA 4LO4B 1W4MA 3B93A 1O7FA 5LEKA 1T08B 1SACA 4LUMA 1GNYA 1AX2A 2LF7A 5EQUA 1SAXA 5JSOA 4CA0A 3WUCA 1WCUA 5DAWA 4XOPA 4BL0B 4DJAA 2BW8A 1YX3A 1P6RA 4CSWA 2VJIA 4KGGA 1ASJ3 2NYYA 1HF0A 4I01A 1Y4WA 5FKNA 4NROA 2R32A 2VC1A 2VZ3A 4LO6B 4Q0QA 4LTAA 1JZ3A 2BV6A 1F4KA 4GJYA 5JHUA 1YJLA 5A7WB 5I0UA 2G4IA 4A2UA 2IS1A 1UN1A 3FFQA 4XHXA 3HG9A 1OCZH 3B00A 4R4XA 4XOTA 1URXA 2GH8A 3I2FA 4XKWA 1WLCA 3P1IA 2KIFA 1IXRC 4YVWC 1JOBA 4LBNA 3NARA 2FCTA 5C9AA 2VUAA 5CFCC 2ZGLA 3GCWA 4YVWA 4P5OA 4EQQA 4WM8C 4A5NA 1MGTA 4UFKA 1FJLA 2PHUA 2TCTA 2RQPA 1YWKA 1CF7B 3KVBA 4E7LA 1RUF2 5FY0A 1VBC2 3GFLA 2V9KA 5FKMA 3H7JA 1YS6A 2GXGA 2P7VB 1SFUA 3KEOA 2MABA 5CJ9A 1K12A 3IDCB 3WNLA 1DP3A 2B4KA 4AFDA 1JI6A 1IZ1A 4CXWA 1EV12 1YRNB 2PX9A 5JHFA 4PIXA 3QACA 4CICA 5FZAA 4RGRA 4JK1X 1B9NA 2KISA 2NVYJ 2LY2A 2WNUA 3DFGA 1ZBA2 3WNKA 2VNVA 1RB8G 1E5HA 3QAHA 4W97A 4L99A 1MJBA 3WF0A 3OUHA 1XB9A 4NIGA 3S57A 2FDJA 2BNNA 1PIV1 5J09A 5BV6A