3RYRA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ryrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ryrA01
3MCZA 1FXZA 3WW1A 1J5YA 1YLFA 1OI6A 2PAEA 2JPCA 2P7VB 3TO9A 4O5VA 2BBYA 4AWXB 5LEJA 3WGIA 4MH0E 2R7FA 1OR7A 2OBPA 3KE2A 4IJAA 4ENNA 4XF4A 1F5TA 2QJVA 5DUIA 1EV7A 2CWEA 2PAMA 1SMYF 5J3UA 1GXQA 2V1DA 1ZX5A 3FMSA 3GF2A 4Q48A 2VBWA 3ELKA 3F8MA 3E5XA 4UNOA 4ON0A 2QLZA 2VC1A 4WXHA 2H09A 4KMUX 5AIPA 2M5WA 3PQJA 3K0LA 3R4KA 4XLPF 1IN4A 1LEAA 3U11A 1NXMA 1MGTA 1USTA 1R23A 5E8GA 1YFXA 2ZNZA 4IERA 2FMLA 4M9ZA 1HXDA 3CLOA 3F3XA 5E1WA 2EFWA 4LG0A 3BPVA 3FX3A 5DD8A 2DQRA 5D8LB 1UPIA 2FF4A 1YS7A 4FBFA 1DPRA 4EROA 1E17A 3GYHX 4JV4A 2RGVA 3CF6E 3QP5A 1L0OC 2HDCA 3WTZA 3HT2A 1TTYA 3U0ZA 3USSA 2EVXA 2HKXA 1XSDA 4PIZA 1O7FA 1ZLKA 3P7NA 3CUOA 1NHAA 1X3UA 3H3UA 4ZU5A 3HRMA 4CHUA 1GQHA 2PMUA 3BZ6A 3RKWA 4P9GA 4PZJA 4MV2A 3RZZA 4LK0F 3TDZC 3KP3A 3TOBA 1K78A 1MZBA 1ON1A 1CAXB 3JAMZ 2EA7A 3UKTA 2O61A 2EB7A 5BPXA 3DXJF 2O8QA 4XLNF 2XIGA 4Z07A 4IEOA 3R6SA 4D7SA 1NYWA 5E1RA 4RGXA 4MUVA 5JSRA 3L09A 2HJIA 1YO5C 2KJBA 4N0BA 1DUXC 1S8NA 4MNUA 3QU6A 3BP8A 1FP2A 2QYOA 1CAVB 5F64A 1QY4A 2MH9A 3ZDSA 2VONA 3RKYA 3WE2A 1YFHA 2JTVA 4HLYA 4DQ2A 6PAXA 1YYVA 2GXGA 4E2QA 1ZVFA 3MFKA 1O5LA 4LLOA 2MHFA 1HBXG 1XN7A 3RYRA 4KMFA 2H27A 4MQ9F 4E2GA 2XGXA 2FNAA 4YIIA 3LQQA 2BV6A 5HDKA 2F5DA 3H1WA 4WK8F 4HLTA 3I5UA 1X82A 3IWFA 3HTSB 4G8XA 1FYMA 1IRFA 5L3DA 1RUOA 4HLXA 1Z1DA 1FP1D 5J48A 4JVAA 2QCSB 1S29A 4I01A 3DFGA 3RPQA 3L7WA 1P6RA 1R7JA 4JQFA 3V8JA 2UWMA 1JGSA 3DV8A 4A5MA 5F1RA 1Z6TA 5E8IA 2VBZA 2V6CA 4LEJA 4Y13A 2IJLA 4XF1A 2GH2A 3BJAA 3JZVA 1IUYA 4HA8A 1IZ1A 4IEUA 1ZH5A 2Y0OA 4I02A 3MEXA 2ZNYA 5HLIA 2XL9A 5ICEA 3ABUA 5EEGA 2PFWA 1W5TA 1TW3A 2MC3A 4IESA 4TV7A 3KP2A 3MDPA 3LSTA 4EJTA 4AXOA 2XLGA 2PBIA 3ULQB 2YU3A 2PQQA 1O5UA 3FZ3A 1VP6A 3PVBB 4IRGA 1CAWB 4XSZF 3LA2A 4YFKF 4YIFA 2K02A 4LD5A 2UXXA 4ESBA 1CF7A 1HKQA 1YUDA 2L01A 1XCBA 3BJOA 4IF4A 5D6FA 1MDMA 3GFLA 2EFNA 3CO7C 4EM1A 3J7AO 3C3VA 4FHTA 3CLPA 4BNCA 4HF1A 3ROUA 3WG9A 2R3SA 3WTTC 1SD4A 2V09A 4IEWA 2KXLA 4Q5SF 2HTSA 1XCVA 2NNNA 4OU0A 4ZZDA 4EJUA 4ZU7A 3I0TA 4P55A 3GZ6A 2ELHA 3FM5A 2Z3YA 4KNYA 4AIHA 3IDBB 2O8XA 3WODF 4HF0A 2PLYA 2RVCA 1IPKA 5FQ0B 5ERIA 1ZZCA 3ELNA 5DCMB 4U0YA 1WQ2A 3R0AA 1YWKA 3WTWC 3NKTA 2A5YB 4KL1A 3M7GA 1T2KA 3GX4X 1PP7U 3I71A 3TOAA 4RAZA 5L3EA 1LVAA 4HYEA 1JE8A 1DDNA 3GEZA 5TJJA 4IETA 4OIOF 4LLNA 1U12A 2GC1A 5A2QZ 1RC6A 1ON2A 5E1XA 3H7YA 4CYDA 1XSVA 4A6DA 2EFOA 3IDCB 5EZWA 4I3PA 3J80Z 4CZZA 1IXRC 1EP0A 4Q4ZF 4A12A 1O3TA 3JSOA 5ICGA 3LAGA 3C18A 2KIMA 3ES4A 3F22A 2K7LA 1ZG5A 3H3ZA 3NJZA 4YSFA 1FBQA 2GA2A 3RYPA 2P4WA 4EV0A 2WTEA 4XFHA 5K5OA 4KDPA 5BXXA 1SD5A 3K1NA 3ES1A 5BPIA 2FBHA 2ESNA 2F5FA 3E6CC 3SXWA 2OZ6A 3KCCA 3I53A 2KRFA 3G3ZA 4LG0B 2MBFA 1LKNA 5ILSA 5KHIA 5I8YA 1FZPB 3M70A 1ZHFA 1IN7A 4R8HA 2HYFA 3F8FA 1F1ZA 2Y0MA 4RD7A 2ZJ2A 2A61A 1AWCA 3WGGA 4P5OA 2EV5A 3SMHA 3HTUA 1R22A 1FOKA 2QUFA 2A68F 3MYXA 1UFMA 4EWDA 1QNTA 3WTYC 1IN5A 4QM9A 3P9IA 3U1DA 4HF2A 1R5HA 1EYBA 3E3VA 2DTRA 2EV0A 4AVBA 2HS5A 2DI3A 1U5TA 1K78B 1BIAA 4D7TA 3PLQA 2LNBA 5ILUA 3S7EA 3V7CA 1L3LA 4GO1A 1ZZ9A 4J1WA 3NW4A 4B09A 3I58A 3K1MA 3RNSA 4LB5A 3GFJA 3ZMVA 1QWRA 5FLIA 1LDDA 1XDSA 3C3WA 3LZZA 2CGPA 5HVQC 2IRFG 3QACA 1FT9A 4EGZA 2XHKA 3TNPB 1WWXA 1P4WA 2FNPA 2UXNA 2ZBKA 5I8SA 3T8RA 2K9ZA 1YG2A 3HRUA 4HBLA 4IRIA 2ET7A 1B6AA 2D40A 2QENA 4P9UA 3IHUA 5L3FA 5J7MA 2RKHA 1SAXA 1LEBA 4XF9A 5L3GA 1TQPA 4FX4A 5FFZA 1TQ5A 1D8KA 4LLLA 2OQGA 1U5TC 3CJXA 2STWA 3MZHA 1R00A 4M6XA 5I0UA 3GLXA 4H7LA 2CW0F 2ADUA 1Y9QA 4A0XA 4X6QB 2ZKZA 2PEXA 5I0TA 4NVPA 1XD7A 2LDUA 3G7DA 3P9CA 4N9IA 3GFMA 4M72A 4XFAA 3E5QA 4BHPA 3TO6A 1SEFA 4MEYF 1J3PA 4WBBA 1L3JA 4IEVA 4LTAA 4XEZA 3C7JA 2MLKA 2COMA 4HAMA 3U2RA 1UD1A 1UW8A 3WTUC 4P9FA 1HSTA 2Q2EA 2VODA 5D1IA 1USSA 2FMYA 1WLTA 4FX0A 4ENKA 3J81Z 1LB2A 4XETA 1NZCA 1OPCA 2STTA 1KU2A 5C6CA 4L5JA 3EYIA 4X6RB 3RKXA 5FD5A 3ECHA 5CVRA 1TNSA 1D8JA 2A69F 3EETA 2PI0A 1CGPA 2DK8A 3F8CA 2RDPA 3EBRA 4L18B 1O3SA 2RNJA 1GXPA 3S0MA 3NRVA 3BPXA 5FFXA 5LHHA 4A5NA 1BC8C 1MKMA 4OIPF 4LA2A 4I7HA 3C1DA 2P6TA 1KU9A 2BE5F 3ZQ7A 1CF7B 1YW7A 1P2FA 2KKOA 1MDMB 2PJPA 2HQNA 1Q1HA 2K4BA 2M8EA 1U78A 4HX8A 1YW9A 2LKPA 2VBXA 5I91A 4GYIA 1ZRCA 4ZYEA 2UY9A 4CICA 4RB2C 2PMHA 1IAWA 5J8CA 5IT9Z 5EEHA 4ZYDA 1YW8A 5E1ZB 1B59A 2C0ZA 1IPJA 4EWAA 3EQLF 2HKOA 4ESJA 4GCVA 2XASA 4ZYGA 4KIGA 4FAGA 4MGZE 3U10A 4HVOA 2GAUA 2PQ8A 2ATFA 2D1VA 3OV8A 1ZARA 1TNTA 2XAJA 1ZAOA 3QP6A 1XGMA 2F2EA 1HKSA 3KETA 4QGNA 5I8TA 4Q0SA 3ZMTA 3E6DA 4B8XA 2MH2A 3NEUA 2V1XA 4KYWA 4NB5A 4ZU4A 5JHUA 1BM9A 2VT3A 4RGUA 2W24A 1ZZ8A 4L9TA 4WXDA 2RQPA 4KWJA 1KQ9A 4WXCA 3F23A 3B02A 3IIAA 2DO7A 4E2SA 5AIQA 1O4TA 2FQ3A 3I54A 1FLIA 5AVPA 3HSFA 5DDGA 3WW3A 4IEQA 4KA4A 4BHBA 3QOPA 3G73A 1J58A 2H0VA 1J59A 1JHFA 2M87A 3HHHA 4AIKA 3M1EA 1MJ9A 4Q0VA 3F21A 5FDBA 1V4RA 4XF3A 2ISYA 1ZYRF 4Z82A 3HRTA 4HQMA 2YX4A 2JPBA 4R1HA 5C8WA 2FEZA 5JR7B 3SHFA 2VOOA 2GC0A 4KIFA 5BUVA 1JHHA 2MLGA 4KICA 5EFUA 4UVAA 3ZMDA 1PUEE 2P5KA 1KYZA 5FD6A 5BS6A 2ET1A 3EJKA 3KLOA 3OTFA 3PNAA 1YIOA 3WU1B 5BY5A 1DP7P 2GC3A 2RN7A 1ZREA 4Q0PA 5BV6A 2W25A 2PHLA 4L0YB 1Z91A 1FSHA 2PN6A 2PHDA 1W7PA 1AOYA 5CADA 5BMZA 5JR3A 2RV8A 1UCXA 2J5OA 4L2NA 2Q0OA 5KHHA 1EH6A 1Z9CA 5D4RA 4J1XA 4EWEA 1FI2A 4B29A 3QU3A 2ISZA 3O6BB 2W57A 5H6QA 1U5TB 4HN0A 4MGIE 5L3CA 3KLNA 4Y17A 3L2CA 2G7HA 4XFCA 4DINB 2PFBA 5CVVA 2M1BA 3H9AA 3VEPA 4EVIA 2K4JA 5TRDA 1QO0D 2DT5A 5FLHA 2FOKA 1NE6A 1PMIA 3IRQA 3LWCA 5CVJA 1C0WA 5I0SA 2AS5F 1D5VA 4GGGA 2D1HA 2UZKA 1H0MA 1RZ4A 2OU2A 1XE7A 1OD5A 2DBBA 3L9FA 1OYWA 2EFQA 1S7AA 5LGTA 1P92A 3OOPA 3RDIA 3ZN0A 2Z9OA 3PQKA 2EJRA 3IKVA 3DF8A 1EPZA 2K86A 1SFXA 3KFWX 5BQTA 1OMIA 4QMAA 4RAYA 1WA4A 1R36A 5HLGA 4KIBA 1H9TA 5HI0A 4I2OA 3FFQA 3CUQA 4EJOA 5KHJA 3WW2A 1LDJA 3Q5FA 2XRNA 1P4AA 3GZ5A 2VOPA 4RB0A 1H1MA 4O6JA 5CVIA 3JTGA 3CTAA 1ZZ7A 1R1VA 2MNGA 2HOEA 4HX4A 2IA1A 4L5IA 3ML6A 3I59A 3HHGA 1F4KA 3O3KA 3NL1A 2QNKA 3I64A 1UIJA 1VR3A 3O14A 2CO5A 3BY6A 4CDGA 2EK5A 4HBNA 1G3TA 2M30A 2QDRA 1ZRFA 2D93A 1WRJA 4UXNA 1KA8A 1FNNA 1Z7UA 2Q8KA 3BCWA 4UBGA 2P6SA 4AD9A 4XBFA 5JSPA 2VXZA 3BJ6A 3MZYA 3WU0A 1PM7A 2GXBA 3EO6A 1I27A 2ZMEA 3IKTA 4IEYA 2E1NA 3CUQC 2OA2A 4UVBA 2CAUA 3M8FA 3V7SA 4NQWA 4YFNF 2NNYA 2V79A 1STZA 3OD0A 1GHCA 2VN2A 5JCTA 1BIBA 5ICCA 3N97A 2EA4A 1LJ9A 3VHRA 4PGHA 3JTHA 1J75A 5D6EA 3T5XA 4BYYA 2K0GA 1DGWA 2DCTA 3HSRA 2X0LA 4QX5A 4CGZA 2XAFA 4HV5A 4KUMA 3KP5A 1HW1A 4KFCA 4HN1A 5H6RA 1ZZBA 3FXUA 4YARA 1H1IA 2H94A 3M8EA 3RPUA 4HSLA 5E18F 4WF2A 5HS8A 4UVCA 4CXFA 5ICFA 1R1UA 4Z2YA 4ZYHA 5A2QK 1RI7A 4UXAA 2DU9A 3IWZA 1G3WA 4M9XA 2ACJA 5D4SA 2B0LA 3GXOA 3V4GA 4HDUA 1EY2A 1IXCA 3LQRA 3M3IA 2F5CA 3SQNA 1T0FA 2QBYA 5DV5A 1ODDA 2TDXA 2DK5A 3P9KA 1ZGJA 3ISPA 4ZZLA 3H50A 2CG4A 1ZZ6A 3GFIA 4HV6A 2UYAA 2HTJA 2Z99A 1U2WA 5DD4A 2ETEA 1O57A 4UV9A 3EQEA 2P17A 3KGLA 2OAZA 2E7XA 1FPQA 1HW2A 4KN7X 3QPHA 1FYLA 3SHRA 1DZTA 4WX9A 3ZMZA 2B8MA 2Y75A 2XUBA 2VE9A 3DL3A 1KQ0A 4IPAA 4QM8A 2OQRA 3SZTA 4EGYA 2QZ8A 1FC3A 3MPBA 2XAGA 4AQ2A 4OINF 4MTDA 4ETSA 1BI3A 5LGUA 4U7DA 1YTYA 2O0YA 1Y3TA 5DCFA 5FCCA 5HOOA 1J9IA 1RIOH 4RGRA 2HEOA 1BN5A 2FU4A 4MZUA 1HKTA 1SD6A 2QM3A 5DEQA 3H1MA 1R58A 5FB2A 1DZRA 3KSCA 3KZZA 3SXYA 3LFKA 4G7OF 3DEUA 4P96A 2JRTA 3ACLA 1J3RA 1R1TA 3F72A 1SFNA 3JW4A 4O9GA 1P4XA 3Q9VA 1W4MA 2Q1ZB 2MD5A 5K8SA 2GZWA 1B9NA 5D8KB 1CX4A 4AVPA 2LF7A 2GIVA 1W7PB 3T8TA 3RYKA 1Y0UA 4MTEA 3VODA 3I7DA 4GXOA 1HQCA 4Q47A 3ZMSA 2JT1A 5JFRA 2Z69A 4IRHA 1W7PD 3HIFA 3EYYA 2IXJA 3K2ZA 4U0WA 4UHTA 3ABTA 4OLLA 5JI6A 2JSCA 1Q43A 1EH7A 2DAOA 4M6YA 4M73A 2Z5UA 3CL1A 3FE5A 1ZG3A 1H9GA 3AAFA 2ZFWA 4MGRA 4EMSA 4HW0A 1XMAA 5J8FA 4EM2A 2BEOA 5LHGA 1I1SA 1U8RA 4S04A 3HOTA 5LEKA 2L54A 2PAKA 2WFPA 2BNNA 4PDKA 5FLXZ 2YR2A 4KWKA 3BROA 3UKVA 2BNOA 3RI4A 3W6JB 4KU8A 3EUHA 2O6GE 2QWWA 2IA2A 3L2HA 1UHWA 3DN7A 1JXSA 4OFGA 2KIFA 3LA3A 1T98A 1S7OA 2DFIA 3E6MA 1K7AA 4K8FA 3HOSA 4HMZA 3SCHA 2MPFA 4YNIA 2OPKA 5K5QA 2CYYA 3OF1A 2H6CA 2OA4A 3COAC 2IXHA 3CEWA 3CUQB 3J81K 2XV4S 2QQBA 1RL3A 5KBFA 1SFUA 4YRDA 3TNQA 1BBYA 3GBFA 2BYVE 2H6BA 2IXCA 1ZRRA 2ZKLA 3JSPA 2NRAC 3FHIB 2JZYA 1CAUA 1XMKA 2HZTA 3I59B 4MHGA 2Q30A 2AXLA 5J6XA 2A6HF 4G6QA 3WTVC 4LMYA 1FYKA 2O1QA 2XKOA 2L4AA 2W84A 4F8AA 4LJZF 5KHGA 4DNCA 3BB6A 5AONA 5LLQA 3GO5A 3E6BA 2EA2A 1TW2A 1T6SA 3SFZA 5HS9A 1LRHA 2OYZA 4M9SA 1J0RA 1ZGAA 4BHCA 1DPUA 3EHKA 3D5LA 5H20A 4MQVA 1G6NA 1QXJA 3E5UA 2ZMEB 4MGYE 3VOEA 2C6YA 4PJYA 4G9YA 5IT9K 3KEOA 1SMTA 3R0JA 2A3SA 1IXSB 2EV6A 3BPZA 4M74A 4RB1A 3DPLC 3DQVC 4MEXF 1MD0A 2DW4A 1BI2A 5HDGA 4MGKE 4GYGA 5LBQA 3GW2A 1HSJA 3FM3A 5K1YA 4XFFA 4PIXA 2D5HA 4G6DA 2HGCA 4HOBA 2IXKA 1OYIA 4U0VA 3VB2A 2CV6A 3DP7A 4BAYA 2CSOA 1OFNA 2XVCA 4QGLA 4G7ZF 1X8EA 1KGSA 3LWFA 4KN4X 2HWVA 1FBUA 5JSOA 1XGNA 3KP6A 3MAJA 1G3YA 3D82A 3K69A 3ZP5A 3TO7A 4A0ZA 2P5LC 4HVRA 4BH9A 1FSEA 4YG2F 1G4DA 1TQIA 5CU1A 2NYXA 1I5ZA 4LA3A 1J7KA 1YFWA 4ESFA 1E2XA 2QBYB 4Q0QA 2KIUA 4META 1Q3EA 5IT3A 3FXQA 2FXAA 2GA1A 3JAMK 5FGMA 3N4MA 4UBHA 3BU7A 5HDNA 4YFXF 3TDUC 1K79A 1GQGA 5ILVA 2RC4A 2UYBA 1O3QA 3HRSA 3ECOA 4EQQA 3DKWA 4FT8A 1QQIA 2IA0A 4JTNA 2IXLA 2IXIA 4IXAA 1SFEA 4HQEA 1WSUA 2VECA 2V1UA 4IEPA 3ZMUA 1UIKA 4XFGA 3F6VA 2B9UA 3MWMA 1U3EM 1BC7C 5LHIA 2GC2A 2A07F 2P7CB 2K27A 3I4PA 4A2UA 3OGJA 4BXUA 2OD5A 4I0BA 4PGGA 4IVNA 5LRRA 4ENJA 1WI9A 5KHKA 1JUHA 4R52A 1W5SA 4OOIA 3TKYA 5D5WB 2VQAA 3W6KB 4EM0B 2IPQX 4K2EA 3WW4A 1QZZA 3FF5A 2WWYA 4PIYA 2DLLA 3M9AA 1BJAA 2G7UA 1FX7A 4I0AA 4JK1X 4GULA 2LF8A 1YS6A 2GU9A 4JTOA 2PA7A 4RB3C 4NHJA 3CO2A 2O3FA 1VJ2A 3HSEA 1XB4A 4CO8A 4AVAA 1QXRA 4LUKA 1SQ4A 4XFBA 2DQLA 4LFUA 2PTMA 3H7JA 3K9TA 3E97A 2PG4A 3RIRA 3PFIA 5FPZA 2L02A 1SD7A 4L11A 1V3FA 3H1YA 3LAPA 3GUDA 1PP8F 4MX3A 4QGMA 4U7BA 2I45A 4IHTA 5KVRA 2M45A 4ONUA 5JAXA 4XFIA 3NSTA 2GQQA 2R7DA 1V70A 2E9QA 4HVQA 4HZFA 1WKMA 3F6OA 2QQAA 3HT1A 3HUGA 4Y15A 5T3NA 3F8NA 3NQOA 1IW7F 3LAJA 1X8MA 3FJSA 1BOAA 3S2WA 2IVMA 3KEQA 4KU7A 3BDDA 3SCGA 2O03A 2FQPA 4AQ6A 1A04A 4WCGA 4BQAA 1YFUA 3WGHA 2IP2A 3T0YA 5CJ9A 2XAHA 1X7NA 3GWZA 2FBIA 1R5GA 2D5FA 3HQXA 3ZPLA 2ZO4A 2L4MA 1KYWA 2XLAA 4LGWA 3IBMA 1Z6RA 3WTXC 2IW5A 3TGNA 2OZUA 2D45A 4LUMA 4OIRF 1ZLJA 1J3QA 1BI1A 1ZNPA 2QVSB 3IRRA 4LULA 1XE8A 1QZYA 1MJAA 1DGRA 4E70A 1YQAA 1YFYA 2FBKA 2LSOA 2HYGD 2D2WA 2ESHA 2X4HA 3EDPA 1CAUB 3KZYA 2Q0AA 2CAVA 2WC2A 1I6XA 4ZH4F 2YX7A 2CFXA 1WGPA 4AVCA 3FMRA 4EJWA 1J2XA 4S05A 1ZRDA 3CO6C 3SZPA 5JVTA 4IHSA 5K5RA 1B1BA 1S6LA 1O7LA 1XSXA 3RTRA 2Q4SA 4L0ZB 1I1GA 3MQ0A 1VTNC 5D5VB 3GVAA 5LGNA 5DYMA 4G7HF 1QPMA 1IRGA 3ST7A 4WVZA 3IC7A 2F5EA 2P8TA 3KGZA 3LA7A 3J80K 1B9MA 3RJPA 4QXKA 1ULYA 4IEXA 1LQ1A 3OCPA 1MJBA 4OIQF 4EJVA 2WV0A 1CAXA 2VC0A 5F6FA 1XDUA 2B5HA 1GVJA 4KWLA 1EH8A 1LNWA 5HS7A 1Z05A 3FWEA 4OMZA 2FE3A 2BGCA 1REPC 2E1CA 4N9HA 5FLJA 2GWRA 2HFHA 3SCFA 1RNLA 4LLGF 3QRFF 2ETHA 2QVOA 3H8UA 2XKPA 2YPRA 1RUNA 1CAVA 3V8LA 1TLHB 3D0SA 2E7WA 1FBSA 4QLCU 2W85A 1D3YA 4TLFA 2QQ9A 3O2PE 3HYIA 5ED4A 1QGPA 1RTVA 3FXRA 4PCQA 3WTSC 2FRHA 4A6EA 3TQNA 2NAZA 1OKRA 2VBYA 4ENMA 1KU3A 4A0YA 3T1BA 5FO5A 1O3RA 1U6GA 3ETQA 2HR3A 4D0PA 3QPTA 1YHFA 2L3DA 2EAAA 2FA5A 3KMHA 1ZN2A 1G3SA 3BALA 5I93A 4O3MA 4Q0UA 2PYTA 3NVCA 4UUVA 4L9NA 3FMQA 3IL2A 2XROA 2ZXJA 3DPTA 4HSJA 5KK1A 4G94A 4L9JA 4OMYA 5BOXA 1T39A 1XGOA 4RS8A 3WE3A 2VT2A 2HQRA 5E17F 1F9NA 2MA3A 1RGSA 1TBXA 3Q9SA 4LK1F 1TQMA 4L9VA 3R61A 4H0EA 2NS0A 1PDNC 4XSXF 5L3BA 2A6EF 4QWQA 5D5UB 5E16A 3LOIA 3KP7A 3L00A 4U88A 3REOA 2IT0A 1T38A 1LR5A 4ORFA 2FSWA 1IN8A 3CJNA 4JBAA 5CLSA 3V8KA 2EFPA 3H92A 2UY8A 2Z33A 3D0JA 3S7IA 3BWGA 4XF0A 4RGSA 1ONVA 1S3JA 4HDVA 2CQKA 3UKNA 1NE4A 3B73A 5LRSA 2N7GA 2YSRA 4M71A 2G9WA 2VPVA 2VE8A 5D5XB 1FY7A 1K6OA 1J1LA 1CAWA 2BNMA 3F8BA 4O9EA 4Q29A 2EWNA 2Z2SB 4YYOA 1OYYA 1UCRA 1QBJA 1XGSA 1B4AA 3VFZA 4AIJA 3K1PA 4LB6B 1IN6A 5FPXA 1ZG1A 5E20A 1IF1A 2DPUA 2DPDA 1KQ8A 2F4PA 3CDHA 2V9VA 3U9GA 1FWZA 5HLHA 2XLFA 1HW5A 2IC1A 3QAHA 2ZCWA 3BOQA 3GYDA 1KU7A 5FLXK 5DUKA 4WWCA 2KJCA 3ERED 4BIFA 1UHMA 4WZCA 1YLLA 2P5VA 4R79A 3KP4A 4XRFA 5CYVA 2OZJA 4IEZA 5BPDA 4F7ZA 4ASNA 3ZN1A 2Y48A 5CVUA 1BI0A 4UV8A 3R60A 3V7RA 1LDKB 4FAHA 3FHZA 5FQ0A 4I09A 4I98B 2XAQA 5DCMA 4HX7A 1XRUA 2J5PA 1UB9A 5I0RA 3FZVA 1Q5OA 2XL7A 4KT5C
chains in the Genus database with same CATH superfamily
4DUVA 3HN1A 5L73A 2VZUA 1KJRA 1YLFA 2JPCA 3OYCA 5CYYA 2P7VB 4AWXB 4O5VA 2QQJA 1AHSA 5LEJA 1RUI2 4MH0E 4XAAA 1W06A 3MO4A 3SH4A 4EATA 4AI3A 2QJVA 5DUIA 1EV7A 2PAMA 4WVMA 4LKDA 3T1LA 1ZX5A 2V1NA 1GANA 2VBWA 3F8MA 4UNOA 4ON0A 2CH0A 5A7WB 2JDAA 4OAYA 1W6QB 2H09A 4YW5A 5AIPA 1C5IA 2J7MA 4XACA 2R5YB 2XBO2 4RLQA 2RS32 1IN4A 1MR5A 4UAPA 1NK3P 5A3NA 2NZ9A 1NXMA 1QJU2 1MGTA 1JN2P 3RQ0A 1YFXA 2ZNZA 1FIAA 2PHXA 4AEDB 2FJ1A 1UF2C 5EIYB 5HODA 1IS6A 5D8LB 1UPIA 3GTPJ 3CC4I 3RCOA 4J25A 5IW0A 2NS8A 3ZVXA 1R71A 5EDNA 4QKBA 3IMMA 4FQ4A 2DWRA 3CF2A 2Y9YA 1YXWA 1H9WA 1TTYA 2HKXA 1XSDA 1ZLKA 4BJTA 4FI9A 2ZS6B 4ZU5A 5FYVA 4CH7A 3SDGA 3HRMA 3BZCA 3NKGA 1GQHA 3BZ6A 5DUWA 3B6CA 3TDZC 2ID3A 2RQQA 4IXLA 4YW4A 4M0NA 4FPYA 3O7OA 1CAXB 1JYXA 4LOCA 2OXBA 3OGGA 3DXJF 5DM7F 1LHWA 3HN3A 2JA6J 3GHNA 1DFQA 4IEOA 4LBQB 1AJKA 1NYWA 1T8IA 4XUNA 5E1RA 5JLVA 1YO5C 3N05A 3ACIA 4PJMA 3QU6A 3BP8A 4NWWA 4MXWA 4IV1B 1QY4A 4NNJA 3RKYA 1YFHA 2D6LX 4HLYA 1PGL2 4LE3A 4E2QA 1ZVFA 1JGGA 1OURA 1IV6A 5ISLA 1AA7A 1HXS3 2AQFA 1HBXG 5KR7A 4KNCA 4BQ4A 4ARXA 3RYRA 4KMFA 2H27A 3MIHA 2XVLA 2YFZA 4DOZA 4B3AA 4BMEA 1H88C 5FYUA 1ULPA 2Q8CA 3M7AA 1OQEA 3I5UA 4YW1A 1ZBA2 3PO3J 5LK5A 3VBOB 2MFZA 1RUOA 1Z1DA 1IOAA 2BVVA 1N78A 5J48A 4CP9B 3FHNA 1XYNA 1GFF2 1N1YA 5DTDA 1SCRA 4Y1YA 3VL9A 4A7KA 2QTWB 2FD5A 2IGNA 3RSJA 2UWMA 2TRTA 1XSQA 4Q4V1 3ACFA 4QXHA 2IBDA 3F2ZA 3DKXA 3JZVA 3GTJJ 3TN93 1QVUA 1IZ1A 1ZH5A 2Y0OA 2BBVA 4I02A 2XL9A 2IVJA 3ABUA 4F52A 5EEGA 3EXUA 1TW3A 2MC3A 2BZTA 3J8F2 2CDOA 4XHXA 1VMJA 2XLGA 2EZKA 4XLHA 1GQPA 1YI2I 2JVHA 1VP6A 3PVBB 1CAWB 1FMD2 3GZAA 4DOUA 4LD5A 1IGNA 5DXDA 1YUDA 3HOUJ 2J1AA 2L01A 1MDMA 4B4CA 2WLQA 4MYEA 1MVQA 1WCSA 1NQJA 3NWTA 1W6NB 4RN5A 3ZXSA 4XJ8A 1W2NA 4CYCB 1KS4A 1P8JA 5FKLA 1W0TA 4M3EA 3OYAA 2WINB 4URAA 3EUKL 3K7AJ 1MMDA 3DEWA 2NNNA 4OU0A 2X53S 4EJUA 4ZU7A 4AYBN 3VBUA 2LROA 3GZ6A 3FM5A 1BVVA 1I3QJ 1JZ3A 1C1FA 5T5LA 1ZZCA 5DCMB 4U0YA 1WBLA 1AX1A 2A6VA 1LGNA 1KS5A 2RDSA 4DUWA 3NKTA 1S0GA 2QEXI 2A5YB 4KL1A 1RUC3 2Y6FA 2NM1A 4LHNA 1T2KA 4FPJA 2HOAA 3I3DA 3UGHA 1LVAA 4HYEA 1DDNA 1Y0NA 3AVRA 4AAPA 4YZ5A 2EXKA 4A6DA 5C9AB 4WVMB 2BDRA 4JP0A 5FYHA 3PUQA 1U9NA 4Q4ZF 4IE7A 4N4NB 3VBUC 2ZGKA 4LG3A 1R1A3 3LAGA 3ES4A 1R083 5JZGA 3N9OA 3F22A 2QF7A 3SDBA 3NJZA 1RUF3 3S15J 4F92B 4EV0A 1H0BA 5A70A 4KDPA 1H2KA 5BXXA 3ES1A 1IUFA 3HPNA 1QQP1 2ARXA 3I9V2 2ESNA 1AYM2 4SLIA 2F5FA 1AR82 2OZ6A 2KRFA 2MBFA 1LKNA 3CBNA 1EKEA 4O61A 3S1RJ 1MEC1 2DVBA 4MVTA 1UOBA 2HYFA 4RHV1 4NRMA 5CKNA 2Y0MA 4RD7A 3BR3A 2A61A 3ZYIB 3K2OA 3VL8A 5IAVA 3BG3A 3O12A 5FZ8A 2EV5A 1JZ5A 4MGTA 1UY0A 2A68F 3IN9A 5JZGC 4XK4A 1QNTA 3WTYC 4DNYA 3U1DA 4HF2A 1POV1 2VULA 5F5IA 2UV1A 3V65A 2HOSA 2EZIA 1BIAA 1WJEA 3ZDVA 2VXRA 3PLQA 2RE9A 2XPWA 1A8DA 1E5HA 4BQYA 3NW4A 4B09A 5FO8B 3J26N 3KLSA 4AC0A 5FWEA 2R93J 3RNSA 3A22A 4OHVA 1D4M2 4QPGA 4PHZA 3I3MA 4MXWB 2H8WA 2JD4A 3X2QH 1FTTA 3HR9A 5T55A 1KRIA 1DQ1A 3LD8A 5F9TA 3FUQA 1CWPA 1WVRA 3LOBA 3TNPB 1S9HA 2IFRA 2P3IA 3T8RA 5I8SA 1JI8A 2D40A 2QENA 1OA2A 4Y7NJ 1LEBA 4P9YA 5L3GA 4XF9A 3WQ0A 1RUG1 1D8KA 2OQGA 2E5NA 2DBNA 4BQ2A 5F8PA 3GLXA 3UGFA 2ADUA 3KCYA 1UZWA 3LSDA 2DA2A 5I0TA 4GKYA 3VWBA 2X09A 1KONA 1RUI3 4NVPA 5AFEA 3LGRA 1XD7A 2P3KA 3OYWA 4QPGC 4YGEA 2CWMA 3G7DA 4YM3A 2K85A 5ABJA 4M72A 1KDKA 4UI9L 2O8KA 3L2RA 4IEVA 3P5BA 4XEZA 4E4DX 4HAMA 1ULCA 1AR91 4P14A 2VODA 5J1YA 2XBO3 3J81Z 2RS33 3I4NJ 2ZABA 2LLKA 2STTA 1KU2A 3OGRA 1Q8QA 3PMSA 1QJU3 3EYIA 2VKHA 3ECHA 4Y1XA 3GBWA 1OCPA 4GD4A 1VI0A 4XICA 3SEZA 2EIEA 3JD71 1O3SA 4NN0A 1GXPA 3BPXA 4YM0A 5LHHA 3BYWA 1BC8C 2VUAA 3ENRA 5FV3A 1EA3A 1MKMA 1LGCA 5F5AA 4E4ZA 2BOLA 2PN5A 5ABJC 3K75B 2PJRA 1MDMB 1Q1HA 5FZ1A 2K4BA 4AYBA 1BEV1 4PJ0C 2VBXA 3DEEA 5I91A 2GN7A 5M3MJ 2TBVA 3KYCB 5T5OA 4ZYEA 5DZFA 3LEMA 1IAWA 5IT9Z 1QJEA 2COBA 5EEHA 3MKWB 1WFXA 2GP5A 1IPJA 2RDNA 4NHMA 3PL8A 4NAOA 2KIQA 1CPNA 3VBUB 3WEZA 1Y7BA 4D69A 3VD3A 1LEMA 3U10A 2GAUA 4G6TB 4WVWA 1W2OA 3VSLA 3JRHA 1ZAOA 2X85A 2HWE2 1LEDA 4QGNA 5I8TA 4Q0SA 5CFCA 4LR4A 3ZMTA 4A7YA 1V54H 3GBGA 4B8XA 4KYWA 1ETOA 3BR0A 4NB5A 5J36A 3ESWB 3B93A 1Y4WA 3B94A 1WW7A 2D5VA 4C0BA 4RGUA 2W24A 2B45X 3W5MA 4WXCA 4TN7A 3B02A 2ZJCA 4L99A 5K9YA 4E2SA 3AZWA 4LO8A 2FQ3A 3BUCA 2CHHA 2X5IA 2JDPA 3K6GA 1IDYA 5DDGA 4IEQA 4KA4A 4AAXA 1DYOA 3G73A 4YFWA 1JHFA 2M87A 1A3KA 1ZBA3 1OPMA 2EPFA 3F21A 5FDBA 3MV01 4W8JA 5JZGB 1ZYRF 2I8DA 4QDSA 4W1UA 1S0EA 5FP4A 4XLCA 4Y4RA 2HYKA 5C8WA 2WB1A 3WNOA 4YVWA 2XJSA 4DZGA 1NA1A 4MG2A 1JUSA 5CFCC 4KIFA 3AJYA 2MLGA 2PMZN 1JHJA 2VUCA 3BTJA 3FBYA 2P5KA 5A7OA 1JOPA 3DU6A 1XNAA 2VQLA 3IUOA 3EJKA 3P3NA 3PNAA 3VGIA 2QKDA 5H9QA 1DP7P 2QSHX 5FPUA 4AG4A 1ZREA 3AMMA 3K3OA 2VU9A 2X5IC 1GYKA 4Q0PA 4ZXKA 5BV6A 1Z91A 1FSHA 1UG0A 1POV0 4W6YA 3V0AA 3J8F3 4MFDA 4G12A 5C3QA 4PLNA 5H9SA 1LCLA 4GKXA 4LBJA 5BMZA 3LEGA 4LBKA 1T6GC 2VUJA 1XU1A 3M3CA 2E35A 1FMD3 4J1XA 4HRIA 3HB9A 1FI2A 2Z1DA 3O6BB 4YVWC 4OMCA 1NA1C 5L3CA 3KLNA 1BCXA 3W59A 2XOMA 4DINB 3WG3A 3MW3A 2PHUA 4QB2A 2BVBA 2A75A 5J09A 4FPGA 1VQLI 1IZ3A 3QPLA 1PMIA 4Q8LA 1C0WA 1OF3A 4PT6A 2AS5F 4QPGB 4QIWN 3BTYA 1T08B 2RS12 3L9FA 1U5XA 5JI7A 5A3WA 1OYWA 2VKEA 5LGTA 3RDIA 2V72A 3CJTB 3MF9A 2ZC2A 3PSFA 1IS5A 2V73A 4RFT0 3JQXA 3DBRB 1WA4A 4AI8A 4ISQA 4IX7A 4H2AA 4KMQA 2HWB2 4PI2A 2LVSA 1ND3A 2XRNA 1P4AA 4RB0A 1COV2 4XMAA 3CTAA 1ZZ7A 2DU1A 4OUSA 2MNGA 2HOEA 2PMWB 4HX4A 4MIMA 2CSGA 2EH3A 4A3KJ 4OWRB 2BVMA 3ABZA 2CL2A 4XCBA 3NL1A 3IAQA 3OYWB 3I64A 1UIJA 4M3CF 1CONA 3O14A 2NVTJ 4A3FJ 5ABJB 2NVQJ 5CPRB 2M30A 2QDRA 4BE3A 2Z79A 1KA8A 2C26A 2P6SA 4XBFA 5T52A 2VXZA 3KM5A 4C3JJ 2J1TA 4H3WA 1XSRA 2HLEA 2GXBA 2D3SA 4DZPA 1EUUA 1SCSA 1QNYA 2A1XA 2CAUA 2G9ZA 3V7SA 1ND3C 4NQWA 3K4KA 2DVAA 4YW6A 1AYM3 3ZSEA 1AR83 3K70D 1E3HA 1IQAA 2DV9A 4HEA2 3N97A 2EA4A 1LJ9A 3VHRA 2F4IA 3HGGA 3WNXA 5D6EA 4RAGA 1DGWA 4QX5A 2PJRB 3AG1H 3HNYM 4SBVA 3RSNA 2FD8A 3SYTA 3FXUA 5A3TA 1YRZA 1H1IA 2WFF2 3M8EA 4XUPA 5E18F 3K2AA 1H30A 5HS8A 5ICFA 5KWRA 4Z2YA 2XG3A 5K4LA 3MFAA 3IWZA 2A5WA 5D4SA 2WWJA 3APBA 3TRSB 4RGKA 5KCMA 5JLWA 2F5CA 2WZEA 4LO4B 5DV5A 1ZGWA 2W2IA 4XJZA 3H42B 1D4M3 3ISPA 3Q8BA 4LOTA 4XN3A 2RM23 2ID4A 1W8UA 1FJLA 2ZHLA 2CG4A 5CFCB 1ULDA 3AP6A 2UYAA 4UFIA 1MS3A 5DZEA 1BW5A 5A3UA 4K21A 1Q8VA 2RS52 3LSJA 3EQEA 3VLBB 3VD4A 4E7LA 2KISA 5ANQA 2E7XA 3KV4A 1WH5A 1BA5A 5C4JJ 2EQRA 3THTA 3U1XA 2X5IB 3CMAI 3QWLA 1FYLA 4A93J 3ZMZA 2PMZA 1SZBA 3BIEA 2Y75A 1UU5A 3H8OA 2XUBA 2VE9A 2HXIA 3WHBA 1W1WE 1X9TA 1H4GA 2VUDA 1UXZA 2LW8A 4QX1A 4GZ9A 2CRGA 4QM8A 3KYDB 3AZZA 2R062 1V6OA 1RHI1 4EGYA 3FISA 1FC3A 1YRNA 4OINF 3WG4A 3I2IA 1ETWA 1BI3A 1SFOJ 4YVWB 5J3LA 1RETA 1NA1B 4B4QA 2O0YA 1HRI2 3LIHA 2IS1A 4GJZA 5FCCA 3T4VA 1J9IA 1OBNA 1Z78A 3GGLA 3OSFA 1SLIA 3ILRA 2FU4A 5GLWA 4MFEA 1CD3G 1WI3A 1X1CA 3H1MA 5FB2A 2WNOA 4G7OF 2FDGA 3DEUA 1W3VA 3A23A 3ACLA 3KVBA 1V9U2 3VYSB 1NX9A 3DYMA 3F72A 3JW4A 2AUYA 1P4XA 1TWFJ 1GP5A 4CEYA 4XKBA 1B9NA 5D8KB 2W94A 4XZPA 3QH7A 3I7DA 2GBYA 2HWD2 2F48A 3I56I 2JT1A 4RDUA 4X0GA 4A45A 4EN7B 3MMYB 3HIFA 2SLIA 3K2ZA 4U0WA 3U4SA 2NXNB 3ABTA 3VD7A 1DP0A 2VPLA 3OY9A 1Q43A 1H9GA 2F4MB 3AAFA 2DU0A 2ZFWA 3CDLA 2Z16A 4MGRA 3F95A 1ZR4A 1JOJA 2RNGA 3FKIJ 4EM2A 2WA0A 4OI1A 4IE4A 1I1SA 4M3BA 1U8RA 1Y8RB 1XOYA 4S04A 3HOTA 3E1SA 2L54A 4QXBA 3ZYPA 2YYOA 3ZIXA 3PUSA 1SEUA 3W6JB 4CEYC 1AKHA 4F93B 2CQNA 1UHWA 3AYCA 1WJDA 4UB6C 1JT0A 4M4PA 3WG1A 3L2VA 3H5RA 1K7AA 2IEKA 3HOSA 3SCHA 2MPFA 4YNIA 4X6AJ 1AL21 1QOOA 1JUMA 3X29B 1OCCH 4E4SA 1ZR2A 2A7AA 3AJZA 3C7EA 5FZ7A 3D1NI 1S1AA 3AMPA 1SFUA 3OOXA 1ZRIA 1WPKA 3IKWA 2B63J 1BBYA 3GBFA 3LFMA 3IH2A 2D3PA 1W9YA 2JDUA 1LUJB 5F32A 4M3CE 3WV6A 3FXKA 4G3YC 3ZXJA 1W6PA 2VJ4A 4LJZF 5FP3A 3OPTA 5CKTA 5LLQA 3GO5A 2ZGMA 3AKPA 5DQ0A 2UWCA 2YBSA 1TW2A 3PFYA 3SFZA 4BHCA 4BWOA 3OY8A 5SV5A 5EEAA 3ZCOA 4XJAA 5T5JA 4C2UA 1PZ8A 4PFOA 1UYPA 1H2MA 4PJYA 4CP1A 4FPEA 3KEOA 4MO3M 1SMTA 4NQWB 2R072 2QBXA 3DQVC 5IP6A 2J22A 1MD0A 1RC9A 2DW4A 1BI2A 4GYGA 5LBQA 1SDWA 2XUMA 4MOAA 5K1YA 2K9NA 3WP5A 1DHKB 1UPSA 3WQBA 4DEQA 3ZQHA 2D5HA 4G6DA 2HGCA 1WW4A 2DA1A 2IXKA 4DO0A 4U0VA 2ZAAA 4E7HA 3H1CA 4OCTA 3EB7A 5GZFA 2BY0A 2CSOA 1OFNA 1S0JA 1UYZA 4EQVA 3MD2A 3LWFA 2HWVA 3ZFFA 1J83A 1WZXA 4DY3A 2Y0SN 2DJNA 5LA1A 3ZGKA 1FBUA 5JSOA 3GZTB 1XGNA 1G9BA 4BDVB 5FMOS 2UWBA 3MLLA 1BQPA 1V55H 1MH4A 3BC8A 1TEIA 2P1BA 3TEWA 3S30A 5FP8A 3U4XA 1J7KA 1LHVA 1YJLA 4BKXA 2WO7A 1FEXA 4BQ3A 4F3JA 2KIUA 3H9QA 2PHFA 4GMP3 3CMEI 3C7HA 2DCEA 3VDBA 3FXQA 2FXAA 2K9MA 3S3MA 1LFUP 4Y1ZA 3BU7A 5HDNA 4YFXF 3TDUC 1K79A 1PJRA 1WZ2A 2RS13 4BU2A 4RAFA 3M3QA 3DKWA 4EQQA 3HOWJ 4GAZA 3ZFFC 4FOYA 4Q4W2 1UAAA 4HQEA 1QPIA 5L36A 3VHNA 5IWFA 4IEPA 1DQ6A 2B9UA 5AC91 2HWB3 3KV5A 3MWMA 1U3EM 1YX5A 1PGW1 1BC7C 4E9KA 1AX0A 5LHIA 1COV3 2QQMA 2A07F 1MSEC 3I4PA 4A2UA 2Q8OA 4I0BA 4AYUA 3PJYA 1Z7S2 2ZGTA 1OUSA 4XM3A 2KL4A 1YRNB 4LNVA 1GNHA 4R52A 5A7PA 5IVBA 3TKYA 2DTWA 2M2EA 2JDYA 3W6KB 3RMYA 2VJ5A 2HEYF 3WW4A 5B2GB 2WSUA 1LAJA 1F4HA 5FZHA 1FMVA 2D44A 2EXHA 4JK1X 5EWSA 1YI7A 2LF8A 1YS6A 2GU9A 2WY8Q 3CO2A 1SLTA 4BDYA 4GRIA 1VJ2A 4CO8A 1AR62 4AVAA 4CEYB 3O0VA 2F6CA 4AI1A 2ZMLA 3H7JA 1JYCA 4DMIA 2KPMA 2PG4A 2PHRA 2A5ZA 2ZXIA 2LS6A 1MZ5A 4Y24A 2KMUA 1E0EA 1HDPA 2J1EA 3K4CA 4IDZA 2DCJA 2V9PA 4QGMA 3KHBA 5D21A 1OLMA 1RUD1 1JUPA 1BW6A 5HCAA 4N8MA 3NSTA 2GQQA 1V70A 2VZRA 4HPKA 4HZFA 1DGRM 1OT5A 3F8NA 1NUKA 3FJSA 4LO5B 2WFF3 5DAXA 3SEQA 4IE0A 2IVMA 3KEQA 4KU7A 4CU8A 2L9VA 1S5LC 4HKOA 2L7MP 1W9FA 3DCQA 1QU3A 4RLFA 4BQAA 2XWBB 3T0DA 2IP2A 2C5DA 1AKHB 3A7QA 3ZR8X 3GWZA 2FBIA 2D5FA 1IJWC 2L4MA 5HV4A 4IQPA 1XMXA 1UMQA 3WTXC 1QJX1 2QQLA 4UWDA 1SACA 4GFBA 3I3LA 2LYCA 2IW5A 4LT5A 2QQIA 1IKQA 4DRRA 1ZLJA 1KZHA 1JJ6C 1J3QA 5JHFA 1N25A 1ZNPA 2M3AA 2RV9A 1GZCA 4E70A 1YQAA 2OVUA 1YFYA 1CIWA 2RS53 1GWMA 4ES8A 4C1WA 4ZH4F 1ZBE1 2YB7A 2WR9A 3BR2A 3BOWA 3ZQLA 1FOD1 4YM1A 1W6PB 4UFHA 1QDCA 2DVDA 2GOMA 5JVTA 4M01A 1B1BA 3C2BA 1XSXA 3RTRA 1WJ5A 1S0DA 2R063 3ZXEA 1VTNC 2R49A 2MEV1 1W0NA 3WCSA 2HEWF 2DCZA 3OY8B 3ST7A 4WVZA 5F08A 3LA7A 2OW4A 1D7PM 3JRDA 3RJPA 1HRI3 4QXKA 4AHWA 1O4YA 2Y0SA 2B46X 2DMTA 2Z5WA 5FZMA 1GVJA 4YGBA 3S3OA 2AEZA 5A33A 3GNEA 3KV9A 1CPMA 2FE3A 3W3CA 5E3LA 2BGPA 4LBLA 2GWRA 1RNLA 1V9U3 3ZSKA 4LO6B 4EN6B 4LLGF 2XF5A 5F0HA 1T33A 3OEBA 1RUNA 1CAVA 2XGEA 3D0SA 1FBSA 3ZFFB 4QLCU 4IO9F 3NNFA 4TLFA 3VZJA 2HWD3 4BIOA 1RTVA 3FXRA 4A69C 2P3JA 4PCQA 3WTSC 4A6EA 1GLHA 4ENMA 2KP6A 2VBYA 1OQ1A 3T1BA 1O3RA 4EZ4A 2HR3A 2BOIA 1YHFA 3LEKA 3POWA 1R49A 1RKTA 3K4AA 1ZELA 1SBFA 2VE1A 2ZGLA 4UUVA 2PHWA 5IUQA 1NZIA 4Y4YA 4INDA 5FR3A 2F6BA 4NIIA 2QCOA 5KK1A 4G94A 5FPVA 5IAXA 1WLCA 3F0CA 1XGOA 3WE3A 5F6KA 5JOXA 2VT2A 2VOKA 3K51A 2R041 2MYSA 5E17F 3S1MJ 2FDIA 3VKLA 1VBB2 4LK1F 4QT6A 2WYSA 2JA7J 2D6PA 2E60A 4BQWA 1N75A 2A6EF 4QWQA 1NY72 3KP7A 2Y31A 3IMNA 3O5SA 3L00A 2HEVF 5JPMB 1XNTA 2HBUA 4FFHA 2IT0A 1LR5A 4LO7A 1IN8A 4JBAA 3BR5A 3NNLA 4C2MJ 2YV8A 3PVNA 4RGSA 1ONVA 3UJQA 2E2HJ 2CQKA 3LDRA 1MS9A 2WA4A 3CQOA 1GBGA 1X19A 4YVSB 2X29A 3V64A 2LOOA 2VNGA 4MO7A 2ZX1A 4Q29A 5LB6A 4KI5M 3WF3A 2EWNA 2VCAA 3LFUA 2K3FA 1OYYA 1TMF2 5DZGA 4AIJA 4Q4X1 3SH3A 4CCLA 5F1JA 5APAA 1IF1A 2DPDA 2DBIA 2F4PA 5KAIC 4M00A 3U9GA 2VMGA 1LHOA 1HB2A 4ZTJA 1HW5A 2WZ8A 3QAHA 4W97A 3MIBA 2VOWA 1K4TA 2R073 2DMNA 1HXS1 2P5VA 2W68A 3KP4A 4DBQA 5CYVA 4GA9A 4IEZA 1WW5A 4F7ZA 2YUSA 4O7XA 2DF7A 3V7RA 2XONA 4I98B 3MZ8A 1JZ6A 4HPKB 3AC0A 4XKVA 3DYPA 1VQPI 2XL7A 1DIWA 5FZ3A 4X8NA 5CBLA 4CXYA 2CS3A 3MCZA 4UYBA 2GMMA 1F31A 3GTGJ 1FXZA 3PU8A 4XTPA 2PAEA 2I74A 1TNFA 2ZSIB 2BBYA 1VBE2 3NV4A 4ENNA 2OBPA 2VG9A 4R4XA 4BJ0A 1F5TA 3FLTA 3THDA 2FHRA 1PVC1 1XNBA 1SMYF 3BQYA 4KISA 1YO8A 4XRSG 1ZM1A 3ELKA 3A0BC 3JRBA 2QLZA 2K9SA 1T56A 2FZ1A 3PQJA 3K0LA 3R4KA 1LGBA 1LEAA 3WVJA 1HV0A 4URTA 1G59A 3RZKA 2ZEWA 3CZ6A 5DUVA 2NVYJ 2FMLA 4Q4W3 2DT6A 5FLVA 3CLOA 1D1BA 2EFWA 1JJ8C 4FBFA 3KEYA 1F36A 1DPRA 2VPRA 3RWNA 4OI0A 4EROA 3JB4C 3N3HA 3BG9A 4ZKTB 5A6YA 2RGVA 3CF6E 5IYYA 3QP5A 1L0OC 3SH5A 4Y33A 4P9XA 2Y6GA 3OYNA 1JYTA 3WTZA 3L2WA 5FZAA 4UB8C 2ZJQF 1A5JA 1PIV1 2HWF3 3CCMI 1QKQA 2VNRA 1O7FA 1X1PA 1Z7S3 1I5PA 1NHAA 3H3UA 4K3UA 2RJ2A 1FTZA 2K2SA 1VB2A 3NNMA 4NC6A 4PZJA 4MV2A 4TSVA 2CW7A 4OVEA 3KP3A 3KT7A 3TOBA 1K78A 1MZBA 3VBHA 2EA7A 3S2DJ 3VUOA 1H89C 3PU3A 5A33B 3BR1A 2O8QA 1SHWB 4CP0A 4XLNF 2R7ZJ 1JUIA 3ERMA 3HDDA 4RA0A 5JSRA 4X8PA 5FXXA 3NO8A 1FP2A 5B4NA 1CAVB 2RHPA 3ZDSA 2VONA 4IE6A 2OX0A 4DQ2A 6PAXA 2GXGA 4QSHA 3MFKA 3GZNB 4LLOA 1JYWA 2WRAA 3A2KA 2W1OA 3AX4A 2IS2A 3J7LA 2VZSA 2P37A 4E2GA 4HL0A 1U9OA 5A32A 2CV1A 2WAQA 1IS4A 5FBZA 3VBHC 5FZCA 1R081 2VC9A 1YX3A 1TP4A 3PM1A 3WOGA 3IWFA 2H0BA 4G8XA 1IRFA 4HLXA 3AXEA 4PQ9A 5EPAA 4JVAA 2QCSB 4I01A 3DFGA 4Y5TA 3I4MJ 3RPQA 3L7WA 1R7JA 1JZ7A 4Q5OA 1JGSA 2RR11 4A5MA 5F1RA 2MD0A 1FOWA 1V00A 5ACA1 2GH2A 3ZN5A 2NN8A 1SANA 2WWUA 3U1KA 4P5YA 3MEXA 1Y9MA 5ICEA 4EYUA 5CG8A 4UUTA 3MFCA 1WW6A 3FHQA 4N4OB 2PFWA 1YQ5A 1G7YA 4XJUA 3WY6A 4IESA 2X6OA 2FZ2A 4B7KA 4B1RA 3MDPA 4EJTA 1APLC 3HNBM 2X1CA 5C4XJ 3ULQB 2YU3A 3Q0VA 2PQQA 3WDXA 3FZ3A 3HBLA 3WDWA 1J1TA 5JLXA 4UW6A 2K02A 4ITVA 2V4VA 4ESBA 1CF7A 1XCBA 3BJOA 3GFLA 3VBSA 1CJDA 5FREA 4V2VA 4DB5A 1YI9A 1VQ4I 3CO7C 1CZVA 5GLUA 4DBRA 1FNZA 3UL2A 4FHTA 5C4WA 4BNCA 4NWVA 3ROUA 3DU5A 4DPNA 4AGRA 3WTTC 1SD4A 1BK0A 3NMBA 4NIGA 1HX6A 4IEWA 4ZPIA 4A3XA 3FXLA 3ATGA 3RQ4A 2R0FA 1X1DA 4ZZDA 3ZR5A 2W39A 2LKSA 2WIIB 2ELHA 3GMEA 2Z3YA 4KNYA 1DLLA 4OQ8A 4AIHA 3C2GA 3WODF 5L9BA 1MS5A 1IPKA 3W21A 3K4LA 3INAA 1LOFA 3HOZJ 3Q9OA 3WTWC 2LALA 3VDCA 1RUI1 3GX4X 3VDXA 2CW8A 3I71A 3TOAA 1G9DA 5L3EA 1JE8A 5C4WC 4YZ3A 4IETA 4BBRJ 4OIOF 4YLZA 2GC1A 5A2QZ 4AFAA 1TZLA 5E1XA 3H7YA 1XSVA 3C7GA 1MS8A 5EZWA 4XQWA 1IXRC 2WN3A 1YQ8A 2W46A 1NH3A 3JSOA 3W2AA 3C18A 4HXCA 5GALA 4V2FA 2XR4A 4FPHA 1LOFC 3RYPA 5IT6A 3I2FA 2VASA 2P4WA 2AYHA 2AREA 1SFPA 4AFBA 1YCIA 5GZEA 3DYOA 2A6WA 2WN2A 3KCCA 3OGSA 3IM0A 4OI2A 4CU9A 5KHIA 4QQPA 3PIGA 5FMBA 3AP5A 3IPVA 2WAEA 4GH4A 3T2TA 4R8HA 1OCOH 4WM8B 2ZJ2A 3RG0A 1AWCA 2ZHNA 4P5OA 3OWTA 1BK1A 4JX4A 3SMHA 1EAH1 3KYLA 3OSDA 1UZVA 3HNMA 3MYXA 3VYTB 5BNOA 4I3GA 1UFMA 4JKKA 4QDRA 1JZ2A 4QM9A 2WL1A 4COYA 2CV2A 3J7NA 1OFCX 1S4CA 3E3VA 2DTRA 2EV0A 4AVBA 2HBTA 1DGWX 2DI3A 1K78B 4BQQA 3VBHB 4ZZ8A 4COUA 1VBA3 2LNBA 3V7CA 5FRMA 4BGDA 3USUA 2BQPA 1XX5A 4QPIB 1H9PA 4GH4C 4QTRA 1PGL1 4LB5A 3N7JA 3MBWA 1XDSA 4Q4V2 1QU0A 5HVQC 1WWYA 3AL5A 4PFPA 2VBDA 1ODMA 4KQ7A 1UXXX 5CFDA 3K77A 1WWXA 5IOYA 3ON7A 1P4WA 2UXNA 2ZBKA 5BNOC 2XJVA 1YG2A 3HRUA 4IRIA 2Q1MA 5FJHA 1OPOA 1NTCA 5J7MA 1SAXA 5FFZA 5A32B 5J37A 4AE2A 4LLLA 2JENA 2E33A 1KITA 2VW0A 3MZHA 2E71A 4M6XA 2XF7A 5I0UA 4H7LA 4A0XA 3DPRA 3HM5A 4HETA 4X6QB 2ZKZA 3TAYA 3J9SA 1Z3YA 5IK8A 4GJYA 3PVOA 1VBE3 4HONA 1U5ZA 5E8AA 2EXJA 1HKDA 4HK9A 5JUVA 3BTIA 5GAGJ 1J3PA 3PUFA 1L3JA 3K4NA 4LTAA 2OPWA 3WF2A 3C7JA 2COMA 5CFDC 3WTUC 4P9FA 4IZZA 1USSA 1WLTA 2BW3A 3WG7H 1LB2A 1NZCA 1OPCA 1OSGA 3BR6A 5C6CA 1VNDA 3NWKA 2RDQA 5EJ3A 5FD5A 1OF4A 1VIWB 2HH9A 1D8JA 1FMD1 2A69F 5FZIA 3DPRC 3F8CA 2QKLB 5IY5H 1YC61 2L7FP 3DXTA 5FFXA 1B09A 4A5NA 1Q56A 3SKVA 4LA2A 3C1DA 1KU9A 3AP9A 1WKYA 1CF7B 5J47A 1GKBA 4XBLA 1W28A 4K7JA 2M8EA 4QQ2A 4AQSA 5CQGA 2ZSHB 4HX8A 1AR72 1YW9A 4LXLA 2XH6A 2ME0A 2G19A 5C4WB 2CTVA 4A42A 2Y0IA 3RMXA 1M1EB 1NOVA 4RBOA 4A6SA 4CICA 2PMHA 5EYRA 4MSVA 5FZKA 3SLIA 4ZYDA 1B59A 1EPWA 4CCMA 3EQLF 1POGA 2HKOA 4LQRA 3ZR6A 5A1FA 3AG3H 2V9KA 4KIGA 3VYRB 1ZTRA 2W52A 2ATFA 2D1VA 3OV8A 3CCEI 1TNTA 4ZONA 1MBJA 1XGMA 1HKSA 3KETA 2EIMH 3TEXA 5DG2A 1QQP2 4GB32 2MH2A 3QLQA 2VT3A 2PLV3 4A7ZA 4L9TA 2XWJB 2RQPA 1V6IA 3ZMNA 1MEC2 1KQ9A 3MI8A 1V6MA 4RHV2 2QE3A 5IK4A 1WH7A 3HQUA 3I54A 1LOBA 9ANTA 4C1XA 1C8M1 2Q8DA 1K5MA 3MW2A 3KCXA 3M1EA 4XUTA 1DG6A 3MVPA 1UYXA 1V4RA 4XF3A 2ISYA 3CCSI 1APNA 4QXCA 3SHFA 3KS7A 1ZQ3P 4QDQA 5GZCA 4DS0A 2GC0A 5EFUA 1H6XA 1PUEE 1KYZA 5FD6A 1KDMA 2V6EA 1V5EA 4XCAA 3FIWA 5BY5A 3IPVB 4HT1T 4GH4B 2GC3A 4EN9B 2ARAA 4TWTA 4B3XA 2BWCA 2PHLA 1K5MC 4JRAA 4FPFA 1XPWA 4LJHA 3DXUA 5JPNB 1W7PA 1V0AA 1AOYA 5BNOB 2J5OA 2DUPA 4L2NA 2Q0OA 5KHHA 1EH6A 3SITA 1GOHA 4IOAF 4M3GA 2ISZA 2W57A 5C3SA 4HN0A 3AZXA 2F17A 4NUBA 3Q0UA 4RMNA 4Y17A 1WJAA 1ASJ1 3L2CA 2Y6KA 2GLOA 4XFCA 1RUJ1 3VEPA 4NBQA 4EVIA 2K4JA 5TRDA 1QO0D 4IHVA 1XNDA 3USUB 5L7OA 2ZMNA 3BG5A 1AF9A 4L0PA 2L9NA 1RZ4A 4IUGA 1GVDA 5IYDJ 1AYN1 3MN2A 2XPJA 2VW1A 1W03A 1S7AA 3OOPA 3AMQA 2OQ7A 4QX0A 3TYJA 1YYNA 1Y43B 3PQKA 5CFDB 4K9SA 3O1VA 2EJRA 3CP2A 5LASA 1NCQA 5DG1A 2R30A 2AXTC 1R36A 4HSRA 4KIBA 3S8PA 2L9RA 1JKOC 3A0KA 1H9TA 2B7EA 3OYFA 1Y8QB 3N9LA 3FFQA 2DFBA 2RAEA 5F27A 4ZJZA 1VRBA 4DGWB 3ILFA 4IHYA 4YIRX 1DYPA 2VOPA 3JD72 3TP3A 3JTGA 2B9VA 1OVPA 3DPRB 1R1VA 1HCRA 4D94A 2IA1A 5L7OC 4L5IA 3KT1A 3I59A 5KXBA 3HHGA 1MW7A 3O8GA 2CO5A 3BY6A 2LC2A 1VBC1 4HBNA 2JQ7A 1VBD2 2HQ5A 1WRJA 4UXNA 2E7QA 1BEV2 4Q8KA 1CIYA 1NQDA 1FNNA 1YQ6A 2Y33A 4UBGA 3FK6A 5JSPA 1NCQC 3BJ6A 1GT0C 2BW3B 1PM7A 5JVGF 5JWPA 3EO6A 3IKTA 2B39A 2CNAA 2DN0A 4FTSA 3M8FA 4JQRA 2NNYA 4HKLA 3OD0A 2XC7A 1GHCA 2VN2A 2GSYA 1IRZA 5LD2C 4LKFA 4XLEA 1QMJA 3M3EA 4PGHA 3JTHA 3H0GJ 5A7QA 3R4SA 2K0GA 1Q8SA 4OUMA 3DCFA 2XF6A 1IC8A 1DQ0A 4QKFA 2H94A 4HSLA 2VY0A 4H7MA 3MUZ1 2UWAA 1R1UA 3L9JT 4M0HA 2XXZA 4UXAA 2DU9A 1VZ0A 1SVLA 3NQHA 3OBAA 3SFIA 2QQKA 4XDQA 3OIOA 2HWE1 2O0OA 5F0CA 2BOJA 3N7KA 5LK7B 4XONA 2WNUA 1ZGJA 4IEJA 2HDWA 2KR2A 4AHYA 4OI4A 2XDVA 1W8FA 4IGPA 4Q4V3 1ZZ6A 3QCWA 4BEHA 3PO2J 5C44J 2HTJA 4AHXA 1U2WA 5DD4A 5HV0A 1XJAA 1J84A 2VOVA 2ETEA 4UV9A 3ZQIA 3PUIA 1W2UA 3UYJA 4XBNA 5LY2A 4IV1A 4NHKA 3G4SI 5DUXA 3QPHA 3BTZA 4WX9A 1K5MB 3K4BA 2EICA 4Z1VA 1JTXA 1YOVB 5F7UA 3KZIC 1LHNA 3DL3A 2Y69H 2VO5A 2WS91 1OQYA 2QZ8A 5FFOC 1AUYA 1F4AA 4PBPA 3K4MA 2WNUC 4AQ2A 4ETSA 3LSEA 2DUOA 2WYFA 2BVLA 2WZR1 3T0BA 2BU9A 1SPPA 2ELJA 5HNHA 2RMU1 2HEOA 2QM3A 2AZ5A 1R58A 1DZRA 5B3SH 4IV1C 4P96A 2JRTA 1WMFA 1J3RA 3IAS2 1LFBA 2QFEA 2B7YA 2OCCH 2VZOA 2L9LA 5K8SA 1R4MB 1BR4A 4DFSA 3OIPA 2LF7A 1W7PB 1QJY2 1XYPA 3RYKA 3HD8B 1PO22 2R1BA 3WU2C 2ARBA 2DCYA 2Z69A 2QDNA 2IXJA 5FRAA 2YBKA 5JI6A 1TWAJ 1HRV1 1EH7A 4M6YA 3S14J 2Z5UA 3CL1A 4MGQA 5F3CA 2CU5A 1E5SA 4CUCA 5J8FA 1HDDC 3RZHA 1VQ7I 3E7LA 1AR73 1CJPA 1UWWA 5FO7B 5LHGA 3JXSA 3WSOA 1ZA7A 3FC0A 5L7OB 3VBFA 3OYGA 2PAKA 3S57A 2R7RA 4PDKA 4FPKA 2WJSA 5LBFA 3UKVA 4XQ4A 1GNYA 4YWAA 3CJRB 1Z7LA 2QWWA 3DN7A 1JXSA 4C2TA 2GP3A 4LHLA 1NCQB 2R6QA 5M3FJ 1RB8G 2HWB1 5HXVA 2OA4A 4FTBA 1COV1 3UETA 3UT0A 2IXHA 2JSPA 3CJIA 4EZHA 2XV4S 2J1RA 2XGDA 1QQP3 4GB33 2FBEA 3ZXFA 4QHBA 2YPDA 2IXCA 2A6TA 2NRAC 2B9SA 3NAPA 1OLTA 2JZYA 3ZFGA 4ARYA 4FTEA 1MEC3 1XMKA 2X05A 3ASIA 3VBFC 4YW3A 3I59B 3WQ1A 3OL4A 4RHV3 4G6QA 1HB3A 4LMYA 1FYKA 1VF9A 2BY1A 2L4AA 2XKOA 4S2HA 4F8AA 3VV1A 2LRDA 4M3CA 4XMYA 1LOEA 5E88A 4DNCA 5FYYA 3ECQA 2XAUA 3E6BA 3MLKA 1UY4A 1WLWA 1WD3A 3M3YJ 4WVVA 1W2TA 4AEJA 3GM8A 3CCQI 5E3MA 1POV3 1BKZA 5C9AA 3D5LA 4MQVA 3V42A 3VOEA 4XOGA 4G9YA 3CJIC 5F04A 2ZX0A 4CSWA 3R0JA 2BV4A 2EV6A 4M74A 4RB1A 2M7AA 3NAPC 3ZFGC 2KDZA 4MGKE 3GW2A 5DDJ2 3OEAA 1GOFA 1MZFA 5FZ0A 3POBA 2WA3A 4BM8A 1OYIA 3VB2A 1MH3A 4BLJA 1RUE1 2W0XA 4Q27A 2XVCA 2CY6A 1PMHX 4KN4X 3POYA 3GALA 1G3YA 5F2WA 5C9AC 2LR8A 3K69A 2WWSA 1W6OA 2P5LC 2X8KA 1NKGA 4JDMA 5CB7A 4N90A 3RPUD 2HZDA 4JHZA 2NYXA 4E7SA 4XQFA 3D5SC 3B9IA 4XRSA 1E2XA 3VZKA 2O9LA 1RHI2 3ABLH 1Q3EA 1V6KA 3MKYB 4ZHNA 2I10A 1PX4A 3GHMA 2WNUB 4UBHA 3AZYA 4H4KC 2RC4A 5FZDA 2GNTA 4BEHB 1O3QA 1H1AA 3HRSA 3GCXA 2BGOA 1AR93 3RJRA 4AI9A 4X1EA 2IXIA 4IXAA 2DVFA 2E51A 1MBKA 1F35A 2VECA 2VZQA 2CQQA 3OYIA 3ZMUA 4I0WB 3F6VA 1AXYA 1XG1A 2Y34A 4CU6A 1DF0A 4Z6YA 3JD73 3OGJA 3CMGA 2L9SA 5LRRA 2KFDA 4WV8A 1RESA 3K46A 5FUIA 1PYVA 2D98A 5D5WB 5IVFA 3MF6A 1QA6A 4EM0B 1VBD3 1BEV3 2JA2A 3FF5A 1SPPB 5EV7A 4PK4A 1BJAA 4I0AA 1G9FA 2V7FA 5F5QA 1IO2A 3TBIA 2P3YA 3PIJA 4NHJA 4IHWA 2WAOA 1F2NA 3LSRA 1GICA 1G9AA 3VSKA 3S93A 2NLRA 4XFBA 2JIGA 3H3LA 3K9TA 1BL0A 5I0DA 3PFIA 1AL22 2W1QA 5JOYA 2L02A 2XJRA 1SD7A 1POQA 1V3FA 3H1YA 3LAPA 3AMNA 1PP8F 4RL7A 4MX3A 2IWGB 4IHTA 1VQ6I 5KVRA 3WZ1A 2M45A 5IP9J 5L9VA 2BWAA 2R7DA 4AU7A 3OR1C 3F6OA 3O1MA 3J7ZI 3WNMA 2QQAA 3HUGA 5T3NA 2VMDA 1IW7F 3UNGC 3S2WA 3VBFB 4OHWA 2DMUA 3VZNA 2O03A 4R9BA 5J96B 4AQ6A 5FZFA 4WCGA 3WGHA 1SLBA 3T0YA 2KZGA 1DBNA 4AI0A 5FKBA 1R5GA 3NV2A 4XNFA 2R4GA 4W6WA 3WD5A 2ZO4A 3RRDA 1OISA 2XVKA 2ZZJA 1GV2A 4CRQA 3IBMA 2BP6A 1Z6RA 3CCRI 2WQZC 1LNSA 3NNJA 4NOTA 3CJIB 2VGDA 4NDLA 1R9TJ 4FCYA 2QVSB 4LULA 4LLFA 3OIQA 2YGLA 5IYCJ 2YXSA 1MJAA 5E3OA 4XDPA 4NAMA 2LSOA 2D2WA 3NAPB 3ZFGB 5JMOA 2X4HA 4ZDPA 1XC5A 2CAVA 1I6XA 2CFXA 1WGPA 3N9QA 2ZBJA 4S05A 2VD7A 3CO6C 1W0PA 4M3CB 2Y6HA 1S6LA 1O7LA 3QYEA 5FUNA 1O8SA 3GCMA 4L0ZB 3GXUA 5CQEA 4XR6A 4HPQA 1H8AC 3BQZA 1HOMA 4NRQA 4UOJA 4G7HF 3IC7A 3KGZA 1JU3A 4OUEA 5GTHC 1ULFA 1LJ7A 2M4GA 1ULYA 2VMFA 4OIQF 1FAYA 4XDOA 4Q1PA 4AL9A 3B5LB 5F6FA 3PIPF 2ZAHA 2HQAA 4KWLA 1A31A 2J1SA 4ZS2A 2JDZA 2BGCA 4XPVA 2E1CA 3MEPA 5JIAA 1ENXA 5FLJA 5FK8A 4UT5A 3BIWE 1U0AA 4C3HJ 4ISRA 5GLZA 2ETHA 2QVOA 4F55A 1QJY3 3HJRA 1MBEA 2E7WA 1KEXA 1N1VA 2WKKA 5BNPB 2P2KA 3O2PE 1PO23 1YQCA 1QGPA 3O1OA 4Y20B 3I2GA 3S32A 3ZYBA 2FRHA 1W6OB 2OUJA 3O0WA 3TB0A 1L7QA 4AFDA 2NVUB 2NAZA 1PGW2 1OKRA 5HNFA 1KU3A 1GU3A 5FO5A 1HLCA 1DQ5A 1I9RA 2VBBA 4D0PA 5KC6A 3QPTA 3TP0A 3H0DA 3WINE 4RM2A 1UYYA 1A6CA 1GWLA 1ZN2A 2CQ7A 3OYKA 1G3SA 3BALA 1BBT1 2W1UA 3OYLA 5SV8A 2I07B 3FMQA 5FY0A 3IL2A 2YDEA 3JBG1 2D6KA 2NOJB 4Q4W1 3DPTA 4L9JA 2R7SA 5FXZA 3ZMOA 3DUIA 3CQZJ 3FLRA 1HV1A 4Z92B 1WCUA 2TCTA 1A36A 1F9NA 1RGSA 1TBXA 1HJGA 5M5XJ 2OKXA 4CTEA 3AKSA 2RM22 2NS0A 4XSXF 3LOIA 3LSPA 4K8RB 2IGKA 4PJNA 2OCEA 3ALQA 5FXVA 4U88A 5FYBA 3JREA 2EILH 1T38A 5CLSA 3V8KA 2EFPA 1OXCA 3BTCA 1FPN1 4XF0A 1PO12 3UKNA 3VKOA 5LRSA 2N7GA 2YSRA 2G9WA 2VPVA 2VE8A 5C3RA 1RUD2 3CC7I 4L8QA 3AYEA 2XJUA 4ZXEA 2BXZA 5JXGA 5JIUA 4O9EA 1RITA 4EE2A 1XGSA 2R7XA 3OUJA 5GAHJ 3H36A 2C24A 5BNNA 5E20A 3O8HA 2QA4I 5FMCA 4E7JA 5LY1A 1AR61 3CDHA 2WV1A 4KT6A 3UR3C 2V9VA 2VCBA 2R32A 1UZYA 1MMSA 5FJ8J 2HU9A 5FLXK 1F43A 3AYDA 2KJCA 3S17J 2R7VA 2CFOA 2HVRA 1TNRA 4WZCA 3HBZA 5DDJ3 5BPDA 2Y48A 5J4VA 4UV8A 1LDKB 4AGGA 2IZWA 4W6XA 2XAQA 4HX7A 1XRUA 4QX2A 1D1CA 5I0RA 1T95A 3HUGB 5LA9A 5BNNC 1A6IA 4DYCA 2IVIB 3GCWA 1MNEA 1J5YA 4XW3A 4KBZA 4V19K 1G9CA 1DGRN 5IFPA 3WGIA 2R7FA 4XF4A 1QF3A 1WCQA 5FYMA 1SMVA 3CCUI 1PMJX 2QQWA 3TWIA 1ALYA 5J3UA 1GXQA 5H2FC 1RHI3 2GNBA 2MEV2 4CDWA 4FASD 3TBDA 3E5XA 2VC1A 3SEEA 3WX5A 4KMUX 4KITB 4XLPF 3U11A 4UY8I 4IV3B 2WQ4A 3W6VA 1JTZX 4IERA 2TUNA 2YFUA 1HXDA 1RMU2 3F3XA 2HYXA 4LG0A 1JI6A 1YS7A 2VB6A 4D6QA 3D4KA 2BPA2 4FO9A 3POIA 5EJZB 1ETXA 1E17A 2MSYA 1D5YA 4IGOA 4AK3A 4BXXJ 2EIBA 1PZ7A 3POJA 4UFKA 1XNKA 5EXOA 3T1MA 4HANA 3HT2A 3USSA 3LSKA 4CDWC 4PIZA 5GAEJ 2NS7A 1TG7A 3P7NA 1X3UA 1HQNA 2JDNA 1I3AA 3VB9A 3S5QA 2ZGPA 5D8AA 3RKWA 4P9GA 3P3PA 1UMIA 1W3XA 1Z3XA 4ET7A 3UKTA 5EYYA 2EIKH 2X6YA 5BPXA 3ZQFA 2KM2A 4YZ4A 1BMV2 2XIGA 4Z07A 1XB9A 1MSFC 4XYXA 2XRLA 5EJCA 3D6EA 4D7SA 5GLTA 4RGXA 4MUVA 4CPBD 3W20A 4HG6B 4BXFA 5C33A 1FOXA 2QYOA 1YQ2A 4LBQD 5FPAA 1S2KA 3WE2A 2JTVA 1X36A 1AL23 2XQRA 2D43A 4XURA 1O5LA 2MHFA 2VH9A 3BGAA 3MV11 1YE9A 5HCBA 5D8AC 3GTQJ 4QB1A 1XN7A 3I2KA 4MQ9F 4CE8A 2XGXA 2FNAA 2R16A 1LFPA 1BYHA 3WXPA 2WADA 5HDKA 2XJPA 3GTOJ 1Z21A 4HLTA 1AXZA 2FDKA 3JRCA 3RKQA 5T5PA 5TISC 1FYMA 5L3DA 3LOCA 1V6LA 4JQFA 1VBB1 3DV8A 3JR9A 4BJ5C 1Z6TA 3RWKX 2LM3A 2PELA 1CZSA 4G9SB 1GV9A 3BOPA 2DFFA 2O5RA 2XPVA 4LEJA 2IJLA 3BJAA 1IUYA 2JDHA 4HA8A 4BS9A 4IEUA 1W0OA 2BERA 1M4WA 2ZNYA 5FROA 1D1AA 1TWHJ 3DKYA 5KHDA 5FKKA 1V6JA 2VQGA 2KA3A 1W5TA 3KQ4B 5C3EJ 2QKMB 2VNVA 1OHFA 4TV7A 3LSTA 4AFMA 1S72I 2IFWA 2YC4A 2DYRH 4IRGA 1TMF1 3TOJA 1BJZA 4XSZF 2O7OA 2K5CA 2WZPP 2UXXA 2VVEA 4Z8BA 4AW7A 4QX8A 3W58A 2KQRA 3QPSA 4IF4A 5A1LA 5BNNB 3QQAA 5KXEA 5IATA 4EM1A 4B43A 3J7AO 3C3VA 2E31A 1JH5A 4JRLA 3LIGA 4GWJA 4HF1A 2JG8A 2PQSA 2ZJRF 2R3SA 4L97A 5J98B 3AMHA 1D2QA 1PVC2 2YC2A 4FOVA 5EQUA 2KXLA 4Q5SF 1NCRA 2KLOA 2HTSA 1CQ9A 1CR7A 5FZEA 3I0TA 4P55A 2BFUL 3GTMJ 1DCSA 1LTEA 4YELA 2R7WA 2OQ6A 3IDBB 1GNZA 4CDXA 1IDZA 2PLYA 2RVCA 2FX0A 3PDQA 5ERIA 1VQNI 2AH2A 1K83J 2VQ0A 1SBEA 1YIFA 2VMIA 3R0AA 4FCAA 3RZLA 4UW4A 3ZN6A 2W92A 1GOGA 4BE1A 2XHNA 4QKNA 5FMDA 1PP7U 1OCTC 3ZYFA 4RAZA 3GEZA 5TJJA 5GM0A 4Y5SA 2JG8C 1S0IA 4CA0A 1ON2A 1D0XA 1WMEA 1BZWA 4NJ4A 4IQ4A 1JKPC 3S2HJ 2IXSA 3MGUA 4S0HB 3IDCB 2EIGA 5J4YA 4I3PA 1PIV2 1NCRC 3PVEA 3SNMA 1EP0A 5LBEA 4CDWB 3RZDJ 4A12A 1O3TA 4LORA 2R92J 3SC7X 2K7LA 1MMNA 1G8WA 4CDXC 2PXJA 3H3ZA 3DTEA 1LKXA 1ACCA 4COZA 2GA2A 4YSFA 3HKZN 2JUCA 5DAVA 1SD5A 2VMEA 5BPIA 1PVXA 1Y39A 3E6CC 3SXWA 2Q8EA 3G3ZA 4LG0B 3NJXA 2W5FA 2VTFA 4XOTA 5ILSA 1V6NA 5I8YA 3OYJA 3I3QA 3CP8A 4D7NA 3FXMA 1FZPB 1ZHFA 1CVNA 3AB0A 3NARA 3T08A 5K7FA 4LHKA 5JXJA 1NT0A 4B8EA 4CA9A 3WGGA 3AFGA 2DA5A 1PNFA 1UN1A 1PO13 1DGWY 3VYUB 5GADJ 1RUD3 4XRMA 1K42A 4EWDA 3ASNH 3D3AA 3AM2A 3GJAA 3KB5A 3P9IA 5D8AB 1R5HA 4MLOA 2HVQA 4J01A 3SKJE 3U37A 1REDA 4KH9A 2LD5A 4PF5A 5FYCA 5D2AA 4Y52J 2K40A 1QEXA 5CKMA 4GO1A 4XLAA 1UZCA 5KC5A 3I58A 5B1AH 3PUAA 2O14A 3ZMVA 4KBBA 1QWRA 1LDDA 3C3WA 2RR12 4QX3A 2CGPA 1ENSA 1GP6A 3QACA 4RFRB 2IS6A 5ACA2 1QJX3 3BT9A 4EGZA 2XHKA 2K9ZA 5FY5A 3BI3A 2ET7A 3FFZA 1B6AA 4I6ZA 4C90A 2R7OA 4IHXA 3IHUA 4I30A 1TQPA 4XABA 4FX4A 1TQ5A 1WJCA 1RVF1 3CJXA 3HPHA 4OHYA 2W1WA 4AEKA 1R00A 2ZGOA 4LIVA 3OBTA 2VL4A 4PI0A 2C9KA 2CW0F 1Y9QA 2RG4A 2D6MA 1E57A 2VOTA 2WLPA 1FOD3 3G1MA 4ZS3A 4QWNA 4Z2AA 1FYUA 4N9IA 3ZQGA 3GFMA 4BHPA 3TO6A 1SEFA 4P9WA 4WBBA 5B5EC 2MEV3 1G86A 3KV6A 4YG6A 2MLKA 3U2RA 1UD1A 1UW8A 5F6LB 1B72B 4F91B 1HSTA 5D1IA 4RGAA 1S7EA 4DYQA 1FNYA 1XQNA 4L5JA 4WM7A 4GIQA 3UGGA 5CVRA 2W95A 2JX9A 1TNSA 1RMU3 3LCPA 3EETA 2D97A 4L18B 4CXWA 1N47A 2RNJA 5IFTA 3S0MA 1VQMI 4QPQA 1MVEA 4CUBA 5FRNA 1UY3A 2ZFUA 4XXPA 2XSJC 2MG4A 1AU7A 1YW7A 2KRCA 2ZKNA 2KKOA 2AQEA 4C9YA 2HQNA 4UW3A 5C5UA 4JKMA 2MABA 2VIXA 2DCKA 1X1AA 2LKPA 1YIPA 4GYIA 2DFEA 4B44A 1ZRCA 4CUGA 4E6KG 2JG8B 2RJLA 1F5FA 3K70C 1UELB 1YJNI 1YW8A 2RDRA 5E1ZB 4A3GJ 4WM7C 4EWAA 1IG3A 1NCRB 1HLVA 3S1QJ 2E7AA 4DY5A 2VNOA 5C8CA 2WT2A 4ZYGA 4FAGA 5A6XA 3WDTA 2AO9A 1ITYA 4C3IJ 4HVOA 4CDXB 2PQ8A 2ADDA 1ZARA 5B1BH 1RUH1 2F2EA 1PNGA 1LE8A 3B00A 4FVVA 4D5FA 5LA2A 3OL3A 4M3DA 3ZN6B 2R043 4PBOA 1D4VB 3OBRA 5FO9B 5J1RA 1HQLA 1BM9A 2E34A 1ZZ8A 4KWJA 2OC6A 1TWGJ 4K1YA 2HYJA 3IIAA 3HKZA 1O4TA 3ZXGA 3G1LA 3FMGA 4NC7A 3C2UA 3HSFA 4BHBA 3QOPA 1VQ5I 1EAH2 1X3WB 2DA3A 2H0VA 3B6AA 1J59A 4P9LA 3HHHA 3FDYA 4AIKA 3QBQA 4E4HA 2C4XA 5C8CC 4HK8A 2D6NA 4NPMA 3JRIA 4HQMA 2P0WA 1WBFA 2LTNA 2YX4A 1WD4A 1BJQA 2JPBA 1YJKA 3AL0C 2FEZA 3URFA 4QB6A 2YU9J 2VOOA 3JRGA 5DUUA 4Q4X3 4FXKB 5BUVA 1JHHA 4IL6C 4DRVA 3LSIA 1UZ0A 1I6HJ 3N35A 1KFXL 2ET1A 2JKXA 4BXSV 5LATA 2Z42A 3KLOA 1Y56A 5B4XA 3VKMA 4BE0A 2ZZQA 2ELKA 2XPUA 4MGSA 4UFJA 2DFCA 1VRH1 3B69A 4W50A 2DURA 2ZJPF 5CZKA 4OZOA 1W04A 3HG9A 1LPQA 3CU7A 3WNLA 3OOUA 4CZSA 4U87A 4A3JJ 2FCTA 5BYNA 3UJOA 1UCXA 5FLMJ 3QYBA 2GMPA 1X50A 2JXAA 2NYYA 2DA7A 4EWEA 2JE8A 4B29A 3C7FA 5H6QA 2Y6JA 4MGIE 2HWF2 3MIDA 1JTYA 5FMOL 2WABA 4QHZA 3JU9A 2DTYA 1LVKA 2PFBA 4YVSA 5CVVA 5FZBA 2VCMA 3H9AA 5JVVA 1DYKA 2DT5A 5FLHA 3IRQA 5CVJA 1D5VA 1Z0XA 2D1HA 2CU7A 1UY1A 1PVC3 2DBBA 5F3EA 2VLAA 1LU1A 2YPJA 1P92A 2W9XA 2Z9OA 4IKFA 4Q1RA 2K86A 3I2DA 2E53A 2VJXA 3KFWX 5JR2A 1OMIA 2TNFA 4QMAA 2AHQA 5HLGA 1B35B 3WQ7A 1VPHA 5KHJA 1MMGA 4BBSJ 3OYDA 1UJ8A 4YVSC 4O6JA 2VI6A 2DT7B 3LKJA 1OCZH 3WNKA 4E7IA 4XJ9A 3ML6A 2QQ8A 1NK2P 1F4KA 4XQDA 1VR3A 1KGYA 2JK3A 2VAUA 3DGTA 2EK5A 3JCUC 1EJ9A 4YW2A 2AEYA 1PIV3 1ZRFA 3POFA 2ZPXA 4FISA 4EEFG 1W5CC 4B47A 1OKOA 5F5CA 3BCWA 1XBFA 2BHYA 4BY7J 4AD9A 1E3OC 3DWLE 5LZ6A 2X10A 3CDZB 1I27A 2ZMEA 1LECA 5ANNA 4WM7B 2YMZA 4IEYA 2OA2A 4JDOA 1HQWA 5GTIC 4YFNF 1TME1 1STZA 5EP9A 5KXCA 5JCTA 1BIBA 3ZO0B 4A3IJ 4CCOA 1O4XA 4OZXA 1SFYA 3GZUC 1J75A 1LESA 1BVP1 1QXPA 3WT3A 3T5XA 1Z77A 1AR71 2VUMJ 4CGZA 1DGLA 2XAFA 2JIJA 4HV5A 4JQTA 3KP5A 2OPTA 1HW1A 2HWC2 4KFCA 4HN1A 4RR3A 5H6RA 2BW8A 4YARA 3WNNA 4ASLA 3OMYA 3O1RA 3HL2A 2GALA 1C5HA 3S1NJ 3ZRGA 2VZVA 4CXFA 5JOZA 3A4UA 2ZMEC 1C8M2 1RI7A 4M6VA 4M9XA 1G3WA 2ACJA 2VZ3A 1IXCA 1ETQA 3LQRA 2LREA 3M3IA 2QBYA 5C8CB 2DOEA 4FE7A 3HOYJ 2A3WA 2TDXA 3JUUA 2DK5A 3P9KA 4JX5A 1OD3A 4AVVA 4GB31 3U75A 1S2EA 4Q4Y2 3AL0B 1NAEA 1WHUA 3N7LA 2RR13 3WF0A 1OOPA 1LE8B 3CHXA 1NLQA 3NNGA 5ACA3 1X9PA 3W5NA 2WQ8A 4RR3C 2WB1N 1O57A 3S6PA 4K40A 3ITQA 4BLIA 4D0QA 3KGLA 2WY7Q 1FPQA 3CCJI </