3RYRA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ryrA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ryrA01
2IXIA 1WWXA 5HLHA 2OBPA 1ULYA 5I8YA 3E6CC 3JAMK 4I0AA 1GHCA 2XAHA 1CGPA 5DCMB 5KHGA 1SD4A 2VQAA 4WZCA 1UHWA 5BXXA 1W7PA 1KQ0A 5FLXK 4QGLA 4LULA 2A6HF 2PYTA 2PQ8A 1O7LA 2JTVA 3WGGA 2D5FA 1J1LA 4L9JA 4GYIA 1ON2A 4KA4A 1Q3EA 4U0YA 3QAHA 2EFOA 2Y48A 4ENKA 1MD0A 3HSEA 4ZU5A 3SZTA 5E8GA 2FBHA 3PQJA 2OAZA 3MEXA 1FC3A 2MNGA 3F8FA 4EGZA 4A5NA 1FZPB 4NQWA 4IERA 1UCRA 2CAVA 5H20A 2O1QA 4LUKA 2DQLA 4KUMA 3L00A 1TW2A 1YLFA 3J81Z 1V3FA 2L02A 2OQGA 3OV8A 5JHUA 2XKOA 2VBZA 1R22A 3VOEA 3WE2A 3H92A 4DQ2A 2V79A 3L2CA 5J8FA 5DCMA 4KU7A 3E5QA 1F4KA 3R60A 4LTAA 4LEJA 3EYYA 1ZRCA 2FBKA 3IKVA 4K2EA 1VTNC 1R36A 5FLIA 3F6VA 5JAXA 2R7DA 4P9FA 4UVBA 1H9GA 2P8TA 2OD5A 2BV6A 1XSXA 5HDNA 3ZMDA 3BP8A 3Q9VA 3LOIA 4R1HA 2KIUA 2HKOA 1S3JA 2X4HA 2OA2A 4P55A 4E70A 2BNNA 2FE3A 3WG9A 3KP5A 4MTDA 4Y13A 4IEOA 3HT2A 4HN1A 2STTA 4IEUA 2W25A 5CVJA 4EV0A 3AAFA 3R6SA 4MGRA 2DK8A 2VOPA 2GC3A 2ESNA 4IRIA 3IBMA 3T8RA 3T8TA 3WTTC 2ETEA 4IEVA 3P9KA 1J3RA 2HR3A 2XAGA 4P96A 2PQQA 3F22A 5D8KB 2IXCA 3EQEA 1NXMA 4HF2A 3I59B 3IRQA 5LGNA 2A07F 2QDRA 3ETQA 4AVCA 2ZXJA 1J3QA 2DPDA 1KA8A 5HOOA 2G9WA 4RB3C 4LB6B 1OFNA 3U11A 3F8CA 4YRDA 1ZZBA 4AIJA 2ZKLA 1H9TA 2M5WA 2B8MA 3PLQA 4MH0E 2PJPA 3GXOA 3RKYA 4OIPF 4WBBA 2JSCA 3DPLC 4HSJA 1RI7A 2JZYA 1J5YA 1FLIA 3KP4A 1VR3A 5JR3A 2RKHA 1E2XA 4BAYA 5ILSA 4IEXA 2XAJA 1FSHA 4HVOA 3N97A 3FM5A 3KFWX 2DW4A 1UCXA 2XL7A 1IN5A 2MH2A 1KYZA 3NW4A 4LLNA 1B9MA 4XLNF 3CF6E 1R00A 4RS8A 4UHTA 2ISYA 2L4MA 3F72A 1IPJA 1W4MA 4JBAA 3CJNA 1YFWA 1LQ1A 3JTGA 3F6OA 1YS7A 3GVAA 4BH9A 5DD4A 1U78A 1U5TC 1P4WA 3O6BB 4PCQA 3WTUC 3FXRA 3KGZA 5CLSA 2HS5A 4KIBA 5KBFA 4WWCA 3FE5A 2F2EA 4QXKA 2BYVE 3I64A 2CAUA 1W7PD 4EWAA 4MEYF 1TQPA 2OPKA 4G94A 4U0WA 3BOQA 3HTUA 4IEYA 5D4RA 1CAXA 4I0BA 4CXFA 5I8TA 3G7DA 1Y9QA 4META 4UV8A 3LWFA 4XRFA 4CDGA 3HOTA 2P4WA 3ROUA 1MZBA 4QGMA 5ILVA 1J3PA 1KQ9A 3FZVA 3ZDSA 2DK5A 1ZG3A 5IT9Z 3BCWA 2A6EF 4XSXF 2W57A 3E5XA 1BI1A 5F1RA 4NVPA 2XIGA 2BBYA 1FYMA 4UXNA 4M9ZA 4Q5SF 1Y3TA 4M71A 4MV2A 1X82A 1LVAA 4HOBA 4IVNA 3LWCA 4JTNA 1MJ9A 4R79A 2ZMEB 1VP6A 3ZN1A 2V1XA 1O7FA 2J5OA 3BDDA 3FXUA 3K1MA 3RKXA 5A2QZ 2KIMA 4HX8A 3LQRA 4LK1F 3HRSA 4ON0A 2MHFA 4S05A 1STZA 3DPTA 3CUOA 3HQXA 5FDBA 4AWXB 2H6CA 4EJOA 1BJAA 3SMHA 3CL1A 4M72A 1A04A 2P5LC 5FQ0A 2R3SA 2XROA 2CSOA 1BIBA 1J2XA 4I01A 3FMQA 3QOPA 2O61A 2KJBA 3ES1A 1GQHA 3I59A 4LLOA 2O6GE 1I1SA 1DZRA 5HS7A 1Z91A 1KU9A 5BV6A 4KWJA 4EVIA 3C18A 4YYOA 5JR7B 2IXKA 5HLGA 3U2RA 4HN0A 4Q0SA 2V6CA 3B02A 2E1NA 2K4JA 2QYOA 3SXYA 3CUQB 1UIJA 4GULA 1IN6A 1P92A 3WE3A 5LRRA 4U0VA 1D8KA 4HA8A 4AD9A 5FO5A 1NE4A 3RDIA 2ET1A 5JSPA 5DUKA 2BNMA 4OIOF 1LR5A 1P4XA 4LUMA 3H3ZA 4EJTA 3MPBA 2V9VA 1PUEE 1TQMA 2XL9A 3WW4A 2K86A 4IHTA 1O5LA 1KU2A 3F21A 3TNQA 5LGTA 4XFHA 4RB2C 4L0ZB 2VECA 1EH8A 3EO6A 2MBFA 4UBGA 3EUHA 2A69F 4XFAA 2EFPA 4RAZA 1V70A 1SMYF 2MA3A 1UB9A 1P2FA 3MZYA 4WF2A 3PNAA 4X6RB 5FD5A 4MUVA 2ZO4A 3K69A 1L3LA 3C3VA 4PGGA 2CYYA 1EP0A 2DCTA 1LEBA 3KETA 4E2QA 2JRTA 1HSJA 4KNYA 4ZU4A 2PEXA 3W6KB 5BPDA 2IA0A 3KP7A 1CX4A 4O5VA 4G7HF 2DLLA 3I58A 5E20A 5BPXA 2QBYB 4GYGA 1QNTA 2OU2A 3CUQC 3SFZA 4Z2YA 1YO5C 3M70A 4XF0A 3EHKA 1QPMA 3V7RA 4FAGA 1HW2A 2OZUA 1O5UA 2K4BA 2C6YA 1YW8A 4IPAA 3ZPLA 2L4AA 1ON1A 1U5TB 4OOIA 4KFCA 4HX7A 4G7ZF 2XAQA 4YNIA 1FXZA 3H8UA 3OF1A 1U6GA 3RPQA 2GZWA 4UVCA 1BC8C 2LNBA 3O2PE 1Q5OA 1X8EA 3IWZA 5E1RA 1V4RA 2QZ8A 4I3PA 4ZZDA 2GQQA 2EA7A 1L3JA 3TDZC 2A61A 4IHSA 4M73A 5FQ0B 5DYMA 5AONA 3BPXA 4Q0UA 5BY5A 1I5ZA 1EYBA 4HDUA 3EDPA 5F6FA 5L3DA 3DV8A 2CWEA 1NYWA 3CO2A 5I0RA 5I91A 4ASNA 2RV8A 2HQNA 2CV6A 3BWGA 1OI6A 5L3GA 4U7DA 1EPZA 4L2NA 1S7OA 1EH7A 2RNJA 1J7KA 4BXUA 4HLYA 1B59A 3M7GA 4MGZE 4G8XA 4U88A 3ZP5A 1P6RA 3R0JA 3RYPA 3E5UA 1YG2A 5HVQC 2DQRA 1QQIA 3QU3A 5E1XA 1UIKA 2OZJA 2OYZA 1Q43A 4MQVA 1HKQA 5K5RA 3HHGA 3ECOA 2QVOA 5E8IA 4I02A 4XFGA 1B9NA 1E17A 4LK0F 2TDXA 3KP6A 5LBQA 2DPUA 4EWEA 4XSZF 3OD0A 2QNKA 4MHGA 1ZLKA 3R0AA 4AVBA 4LD5A 1FOKA 1DPUA 2LKPA 1CAUB 4ENNA 1YTYA 3ABUA 5BUVA 2O0YA 1MJAA 1B6AA 1I1GA 3GFIA 2JPBA 4JV4A 2B5HA 5I0SA 1ZZ7A 4XF9A 2QWWA 2D40A 2Z69A 2P6SA 4ZH4F 5ICEA 1I27A 4KMFA 4LMYA 2H0VA 3HRUA 4GCVA 3H7JA 1LEAA 2D1HA 1JUHA 3SZPA 3S7IA 2XLAA 1JHFA 1Z6RA 1DP7P 2GC2A 4M74A 4ENMA 4IF4A 4I09A 3H9AA 5J3UA 1FSEA 2IT0A 3SXWA 2KIFA 3HSFA 1IF1A 1YW9A 1XSVA 5I8SA 4IJAA 3H1YA 5EZWA 1NHAA 2QM3A 1TNTA 3RIRA 3HHHA 3TOAA 1IXCA 4MX3A 4HLXA 4NHJA 4WVZA 4ORFA 3ZMSA 3JAMZ 1CAVB 3WU0A 4GGGA 2AS5F 5E1ZB 5CADA 2ACJA 2NRAC 2NS0A 4LG0A 2FNAA 1YLLA 2L54A 3BJAA 4P9GA 1U5TA 3G3ZA 4M6XA 5L3BA 1G3SA 2LDUA 3LZZA 3G73A 1FYKA 2OZ6A 1TQIA 1S29A 2O03A 1ZX5A 4KIGA 3C7JA 1UFMA 3MZHA 4FT8A 2HYFA 1S6LA 2FU4A 1R58A 1O3TA 2QBYA 2FF4A 4L0YB 1FNNA 4IETA 4A0ZA 3NJZA 2B9UA 1FY7A 1KQ8A 2XAFA 1YFXA 2BNOA 2K0GA 2M1BA 1GXQA 2N7GA 2HGCA 3ULQB 5DV5A 2NNNA 1WQ2A 5KK1A 3USSA 3GEZA 3ECHA 4FX4A 4EJUA 2EAAA 1RIOH 1LDKB 2EFNA 5LHIA 2M87A 4UXAA 2QLZA 3DL3A 3I7DA 1CAXB 3K0LA 3VB2A 3ES4A 1G3YA 3KLNA 1SD5A 5D6EA 4ETSA 1I6XA 4Y15A 4AQ6A 2ZCWA 3RKWA 4L9VA 1ZRRA 1BI3A 4OIRF 2P7VB 3TOBA 4KYWA 1UD1A 1LKNA 3GX4X 5E1WA 3J80Z 1HQCA 5D1IA 3MFKA 4JTOA 4HW0A 2PAKA 3U10A 2EV5A 3HT1A 1QZZA 4QM9A 5K1YA 2ZFWA 4ZZLA 1O3SA 4FBFA 2GWRA 4KL1A 2RGVA 1FP2A 1PMIA 1ZZ8A 4ONUA 2QCSB 1HSTA 1S8NA 4HDVA 3I71A 1J9IA 2X0LA 1FBQA 1TLHB 3TO7A 5CU1A 5LHHA 4OMYA 4OINF 5L3CA 1RZ4A 1J0RA 4F7ZA 1T0FA 4JQFA 2A3SA 3HYIA 1SFUA 5D5WB 4HV6A 5LEJA 1UW8A 2K9ZA 2H09A 1ZARA 1KU3A 4R52A 5TRDA 3HUGA 5AIPA 2Z3YA 3GZ6A 3H1MA 5D5UB 4BNCA 4B09A 5AVPA 4EM2A 2IXJA 2BEOA 5K5OA 4KWKA 4RAYA 3HOSA 1O3RA 5LRSA 3K9TA 3E97A 2VC1A 4G6DA 3BROA 1YW7A 5ERIA 2STWA 1CF7A 3GFJA 2XLGA 2IRFG 3EBRA 4XFCA 3DP7A 2YX4A 3QP6A 1T98A 2E1CA 1FT9A 2WFPA 1CAWA 1REPC 1XE8A 3D0JA 1HXDA 3GZ5A 3C1DA 1OYWA 2ATFA 1K79A 2PAMA 4RGSA 5LGUA 1WA4A 5I0TA 4HF1A 1D5VA 2Z5UA 1MJBA 3LA7A 4KICA 2MLKA 1T39A 1XMAA 1ZZ6A 4QWQA 2EV6A 3KEOA 5J48A 2PG4A 2EJRA 3RNSA 4KMUX 3I53A 5FLHA 3CO6C 1FYLA 2HDCA 5E16A 3L9FA 2CO5A 3WGHA 5FFZA 1HKSA 2K02A 3PFIA 1IUYA 2F5DA 1ZAOA 2COMA 1FBSA 4CICA 4XF1A 5FLJA 4FHTA 2VE8A 3BPVA 3MYXA 5JFRA 1XE7A 2MC3A 1NZCA 1RGSA 3SCHA 5JVTA 4YSFA 3HRMA 2VONA 4EM0B 4HZFA 2EV0A 2QENA 3LQQA 4PGHA 2KJCA 5DD8A 4IEWA 2FOKA 1WI9A 1G6NA 2Q0OA 4O6JA 2XUBA 1RNLA 3B73A 2R7FA 3FX3A 3TDUC 4XBFA 3OOPA 2Z9OA 3WW1A 2RDPA 1U3EM 2EB7A 3RJPA 4Q4ZF 1DDNA 3VHRA 5D5VB 1OR7A 3OCPA 4M9SA 4N0BA 3MCZA 1X3UA 1SFEA 2PFWA 1OPCA 4HLTA 1JHHA 2EWNA 3KZYA 1XGOA 4XLPF 4ZYHA 3GYDA 4NB5A 3TQNA 4IEQA 2F5FA 5CVVA 1IPKA 3WTXC 4R8HA 1KYWA 2M45A 3WTWC 5JSRA 5CVRA 2EK5A 2GH2A 3P7NA 3SCGA 1B4AA 3UKNA 3E6DA 3M3IA 3QPTA 3JW4A 1SMTA 3H1WA 2HFHA 2VODA 4ZU7A 4UVAA 1MKMA 4A0XA 2Q8KA 2GA1A 3F8BA 3NQOA 1SAXA 1WKMA 3RZZA 5CVUA 2FNPA 3F8MA 1USSA 1T2KA 2FA5A 1T38A 2W85A 1IN4A 2M8EA 5HS8A 1IAWA 1MGTA 3EQLF 2DU9A 3KMHA 3WU1B 2QVSB 3RI4A 3RYKA 2W84A 2UYAA 1IN8A 3WGIA 3ZMUA 2HWVA 2NYXA 4WK8F 4U7BA 5E18F 2GC0A 3ERED 4MGYE 2RQPA 5FB2A 3DQVC 4PZJA 1U8RA 1QBJA 4G9YA 2VOOA 1BN5A 4HX4A 1VJ2A 1ODDA 4YFKF 5L3EA 1WSUA 3ZN0A 3U9GA 3VEPA 5I93A 2F5EA 2FRHA 2HTJA 4IRGA 4L11A 4YIIA 2YX7A 4BHBA 3SCFA 2HJIA 1OYYA 4H0EA 4LLLA 2XLFA 5H6RA 1B1BA 1XB4A 2ESHA 2IXLA 2Z2SB 3BZ6A 1PP7U 4LGWA 4D0PA 3DFGA 2XKPA 1XRUA 2UWMA 3V7SA 5JI6A 2XRNA 3IIAA 1PDNC 5IT3A 4HV5A 1HW5A 4Q0VA 3CUQA 2VXZA 4OFGA 4DINB 1DGWA 2K27A 3QRFF 3REOA 3IKTA 1UHMA 3O14A 4J1XA 2ISZA 1FI2A 4LFUA 4QGNA 3C3WA 2PHDA 5ICGA 3EYIA 4GXOA 1AOYA 1BI0A 4FX0A 4QMAA 4K8FA 2OA4A 2C0ZA 1BI2A 1Z9CA 1W5TA 3M1EA 2FMLA 2MD5A 4PIYA 1ZGJA 4A0YA 1J75A 4J1WA 4ZYDA 2WWYA 1Y0UA 5J6XA 2O8XA 2GC1A 4BQAA 4RD7A 2V1DA 4OIQF 2P7CB 1L0OC 4EJVA 2PMHA 2XV4S 3FMRA 5HDGA 3NKTA 3TO9A 1H1IA 1AWCA 1XDUA 1X8MA 4BHCA 4PIZA 3P9IA 5KHKA 4IRHA 5K5QA 3NSTA 2PTMA 2ZKZA 3KP2A 3CLPA 2EA4A 1R5HA 4LLGF 2P5KA 1F5TA 5J8CA 3IDCB 4ESBA 1CF7B 4LB5A 4RGXA 3O3KA 1DUXC 1OYIA 3KEQA 4M9XA 2GU9A 5C6CA 3E6MA 4RB1A 4CHUA 2VBWA 4H7LA 1IRGA 4RB0A 4O9GA 3ISPA 2XVCA 1LDJA 3J81K 1GQGA 2FQPA 4JVAA 3HIFA 4CO8A 3QP5A 4O9EA 3T1BA 5CYVA 4EWDA 3W6JB 4B29A 4KIFA 3I5UA 4AXOA 3FWEA 5HS9A 2GXGA 5J7MA 3FXQA 1XN7A 1YWKA 1YFUA 4N9IA 4YG2F 5AIQA 1LB2A 1H1MA 1H0MA 2HKXA 4M6YA 2GIVA 2CW0F 2XGXA 2A68F 2ZBKA 2PA7A 5KHJA 4P5OA 3ABTA 2O3FA 4UV9A 3R61A 3MDPA 5FPXA 1O57A 2CFXA 4I98B 2FBIA 3T0YA 3UKTA 1LDDA 1Z1DA 3WTZA 5C8WA 4EM1A 2ELHA 1K78B 4MGIE 1XD7A 2ZNYA 1RUNA 3LAJA 1D8JA 3GUDA 4D7TA 1SQ4A 1OMIA 3WTSC 1TNSA 1ZN2A 3I0TA 4AIKA 4EMSA 3JTHA 1QXJA 3LA3A 2VC0A 1UPIA 2QJVA 1SFNA 1F1ZA 2HZTA 3F23A 5E17F 3BALA 1XSDA 3WODF 3LAPA 2Y75A 4XF4A 1YIOA 2YU3A 3L7WA 4L9NA 4EQQA 2CGPA 2KXLA 5FPZA 2VE9A 1R1TA 2XHKA 2D2WA 3ML6A 3VODA 3J7AO 4KWLA 1YFYA 5BS6A 1YQAA 2VPVA 4HMZA 4ENJA 3UKVA 2FXAA 3ZMVA 5EFUA 1XGSA 2UXXA 2QQAA 1HW1A 2GXBA 3ACLA 4D7SA 3GBFA 4P9UA 3BPZA 2PAEA 2MPFA 1S7AA 3FMSA 1PM7A 5LEKA 5H6QA 4EJWA 4UUVA 4ESJA 3CO7C 3DF8A 2H6BA 5BMZA 2IA2A 2Z99A 4KU8A 3BJOA 5KHHA 4Q0PA 4Q48A 1U2WA 2PBIA 3OGJA 4HSLA 1TBXA 1XGNA 2IC1A 1CAWB 2DFIA 1BIAA 4XETA 1FBUA 1R5GA 5D8LB 3BY6A 2LF8A 1K78A 5LLQA 3IHUA 1IN7A 1TTYA 4WCGA 4QX5A 3N4MA 1C0WA 3IL2A 4HQMA 4MZUA 3BB6A 3PVBB 5TJJA 1QZYA 3KLOA 2F5CA 2NNYA 2RVCA 2Q0AA 3DEUA 1ONVA 2Q30A 1QWRA 2J5PA 2YR2A 1XMKA 1BOAA 3LA2A 4GO1A 3V8LA 3U1DA 1LNWA 4AVPA 3KCCA 1WGPA 1LJ9A 1ZRDA 2RC4A 1G3WA 3IRRA 4XFIA 1RUOA 5HI0A 1W5SA 4HAMA 2E9QA 3FM3A 3FHZA 1ZG1A 5HDKA 4XFBA 4KN4X 4QM8A 2YSRA 5ICCA 2KKOA 4Z82A 1Z6TA 1XGMA 2EVXA 5FD6A 2IA1A 5EEHA 4TLFA 2HEOA 5D6FA 5KVRA 2L01A 4CYDA 2YPRA 1ZNPA 4S04A 4X6QB 5EEGA 4AQ2A 3FFQA 3H7YA 3D5LA 3GF2A 4G6QA 3V8JA 2UY9A 3WW3A 1D3YA 3GWZA 1YFHA 3F8NA 6PAXA 1T6SA 2ZNZA 4FAHA 2ZJ2A 1P4AA 2P5VA 3MAJA 4A12A 1QY4A 4HF0A 2VT2A 5IT9K 2PHLA 5D4SA 1R1UA 1TW3A 4BYYA 3L2HA 1BC7C 4Q29A 1FWZA 2WV0A 4PJYA 1ZLJA 3KE2A 2PI0A 3DKWA 3K1NA 3NEUA 2IPQX 1WRJA 1MDMB 5CVIA 1JGSA 3KSCA 2NAZA 1K6OA 4OLLA 2AXLA 1QXRA 2PN6A 3JSPA 1QGPA 4LA2A 2K7LA 4Q47A 2CG4A 3K1PA 1IRFA 3GFLA 1YUDA 3LAGA 4CGZA 2EA2A 5DUIA 1DPRA 4RGRA 2Q4SA 3Q5FA 1IZ1A 1ZREA 1W7PB 3EJKA 4WX9A 4A6EA 2GA2A 4UBHA 3JZVA 2LSOA 3RTRA 1EY2A 2MLGA 3WTVC 4ESFA 3SHFA 1WLTA 1SFXA 1TQ5A 4E2GA 4LG0B 1IXSB 1XDSA 4O3MA 2QQBA 2I45A 4KDPA 5CJ9A 1FP1D 2G7UA 3E6BA 4LA3A 2D5HA 2UYBA 2D1VA 3QPHA 3S7EA 4HYEA 5ED4A 3TKYA 3Q9SA 2H27A 3WW2A 2FQ3A 1NE6A 1RL3A 3P9CA 3FJSA 2L3DA 4I2OA 3SQNA 1GVJA 3ST7A 3K2ZA 5DCFA 3RPUA 1ZZCA 4EGYA 5JSOA 1F9NA 4ZYEA 3COAC 4DNCA 5FCCA 1CAUA 1MDMA 2Y0MA 2HYGD 5KHIA 4XF3A 4IEZA 4XEZA 2Z33A 3R4KA 4Q0QA 2HTSA 5DDGA 3U0ZA 2G7HA 5FLXZ 1ZZ9A 2F4PA 1ZYRF 2P6TA 3ELKA 3FZ3A 5ICFA 2B0LA 1SD6A 1IXRC 3M8FA 3H3UA 4L5JA 1PP8F 3FF5A 3ELNA 3MWMA 2JT1A 5FGMA 1JXSA 4HVQA 2RN7A 2HOEA 2VN2A 5HLIA 4A2UA 4LJZF 3SHRA 1O3QA 2ADUA 2WC2A 1Z05A 5FFXA 1Z7UA 3KZZA 1YS6A 4KN7X 3TNPB 2IW5A 2V09A 2QQ9A 2BE5F 2ZMEA 2O8QA 3I54A 1SD7A 1XCVA 3NRVA 3V8KA 3KP3A 4MEXF 3ZQ7A 5F64A 5BQTA 3HSRA 2WTEA 3GO5A 1EV7A 4QLCU 1X7NA 1IW7F 4Z07A 2P17A 2MH9A 2E7WA 2OQRA 1G3TA 1ZH5A 2FSWA 5DEQA 2JPCA 3GLXA 2IXHA 3S2WA 2UZKA 2ET7A 5JCTA 1BBYA 5L3FA 5D5XB 4L5IA 2Y0OA 3CEWA 5BPIA 2FMYA 4EROA 1CAVA 4HVRA 1FX7A 1J59A 4YFXF 2DBBA 1BM9A 2D93A 1YHFA 5T3NA 2BGCA 4PIXA 2XASA 4L9TA 4YARA 1ZG5A 4AVAA 5K8SA 1Q1HA 4XFFA 4L18B 3I4PA 4G7OF 2UXNA 2CQKA 3TGNA 3E3VA 3BJ6A 3V4GA 3GYHX 1U12A 4MTEA 2PLYA 4MNUA 2DT5A 2FEZA 3HRTA 1RC6A 5LHGA 3D0SA 3OTFA 2IJLA 4E2SA 4HQEA 3LSTA 2HQRA 2VBXA 3TO6A 3NVCA 2ETHA 3T5XA 1J58A 2Q2EA 3DXJF 3GW2A 3QU6A 1ZRFA 4B8XA 1OD5A 4A5MA 4F8AA 3BU7A 3DN7A 3CDHA 2M30A 4BHPA 2IP2A 1O4TA 2DI3A 3M8EA 1LRHA 1YYVA 4YFNF 1XCBA 4WXHA 2E7XA 3S0MA 5A2QK 2IVMA 1ZVFA 4BIFA 1G4DA 3IDBB 3CJXA 2PFBA 1GXPA 1DZTA 1OKRA 3PQKA 1DGRA 3CLOA 4UNOA 1SEFA 4WXCA 3ZMTA 4CZZA 1R23A 2EFWA 4KT5C 2H94A 4N9HA 3D82A 3L09A 2UY8A 4HBLA 4A6DA 4JK1X 4TV7A 3LFKA 1JE8A 4YIFA 3WTYC 3J80K 3JSOA 1ZHFA 1R1VA 3H50A 3IC7A 2QUFA 4IESA 2PMUA 3FHIB 4I7HA 2W24A 1KGSA 3MQ0A 2Q1ZB 1ZGAA 1HKTA 4OMZA 3HTSB 4MGKE 3V7CA 1RTVA 1QO0D 4IXAA 3CTAA 3KGLA 5BOXA 3M9AA 4WXDA 2A5YB 4Y17A 2DAOA 2LF7A 1EH6A 2GAUA 4PDKA 5I0UA 2V1UA 4HBNA 3VFZA 4IEPA 3RYRA 5ILUA 2KRFA 3GFMA 1R7JA 1FPQA 2D45A 4MQ9F 2EFQA 3NL1A 2VT3A 1K7AA 1USTA 3IWFA 3ZMZA 4ZYGA 4RGUA 4OU0A 3EETA 1HBXG 2DTRA 1KU7A 2DO7A 4AIHA 2VBYA 3F3XA 3QACA
chains in the Genus database with same CATH superfamily
3MIGA 2HVSA 3O12A 2XF6A 3DPRC 3LQCA 5DCMB 2L2OA 1KQ0A 5FLXK 2A05A 4QDSA 2W3JA 2WBKA 2R0HA 2W1WA 3C7EA 1KS5A 4A3BJ 2ENRA 2JTVA 3WGGA 1SPPA 3B01A 1J1LA 4NN0A 4BWOA 1UMIA 2AO9A 5F5IA 4KA4A 3PJQA 3QAHA 1QJU1 2Y48A 4ENKA 5FZ7A 1LOAA 2UU8A 4UW3A 2DCJA 1T95A 5HBAA 1FC3A 3ZQIA 1MBEA 3F8FA 1FZPB 1XXNA 4B3AA 3MF6A 2CAVA 3HWJA 5H20A 1HA8A 1WVRA 4LUKA 4KUMA 1TW2A 3H0GJ 2L02A 1JU3A 2X48A 1QU0A 3OV8A 5C3PA 4NR1A 3WE2A 3WINE 5ISLA 4YGDA 2O7OA 3QWLA 3E5QA 3D5RC 1T33A 4OUEA 4LTAA 2VL8A 4K6BA 1ZRCA 5J4VA 4K2EA 1VTNC 3O1MA 1BYHA 4AVVA 2IBDA 2R7DA 4P9FA 5FZOB 1S2KA 3CCRI 2J1VA 4QX3A 3KVAA 3K2OA 3RMXA 4B47A 5FAXA 2NOGA 2HKOA 3DBLB 1ST8A 5K7ZA 1I9RA 1HN1A 4X8PA 3HT2A 3QH7A 3LSJA 2STTA 1AXKA 4IEUA 1ND2A 3NJXA 2XVKA 3AAFA 3M3YJ 4MGRA 2VOPA 4LBQA 1SEUA 2GC3A 1C8M2 3WTTC 2ZGMA 3B94A 5BNQA 1AZDA 2XAGA 3JBG2 4Q8KA 1D1BA 5D8KB 2F48A 3NNFA 2CU5A 3EQEA 1VBD1 2D6NA 4O7XA 1JUPA 2JB4A 5E89A 4CU9A 2LYCA 3ETQA 4PCRA 1ZM1A 3DU6A 4XW3A 2G9WA 4RB3C 3T2PA 1W36C 3OYJA 4LB6B 4K7JA 1T6GC 2VZRA 3J7NA 1VB4A 4LR4A 5I0DA 4D3WA 4D6QA 2O9LA 2PJPA 5JVGF 3HKZN 4JDNA 3KHBA 1J5YA 3KP4A 5GTHC 1PYVA 2VJIA 4NROA 1QQP3 4H14A 4HVOA 5FIXA 1VZ0A 5FY1A 5DN2A 1KXGA 3LD8A 4XYXA 4RLFA 3RQ4A 3CF6E 4DOZA 4RS8A 4UHTA 1MVEA 2WAFA 5GM0A 3CQZJ 1OURA 5IUQA 4UW4A 3F72A 3KF3A 1IPJA 5FZGA 1W4MA 1YFWA 4LK6A 5GTIC 1RKWA 3F6OA 3GVAA 4HONA 4MADA 4BH9A 3PDQA 1U5TC 2WLQA 3KYDB 3WTUC 1I1EA 1RMU2 1CONA 4OVEA 2VNVA 1GV5A 1YHQI 4BJ6C 5ACA2 5C4WC 5GAHJ 4WWCA 2F2EA 2WDBA 2BYVE 3I64A 4MEYF 2JXAA 2SBAA 4E7SA 2DYSH 2Y0SA 4FPGA 2OUJA 3BOQA 3HTUA 2VJJA 5J3LA 3ZXSA 1EKEA 5LA9A 2K9NA 1FMWA 4AFCA 4META 2NQYA 1RIRA 4XOPA 2EXKA 3GCWA 1MZBA 3LF7A 1J3PA 3PJYA 3ZDSA 2DK5A 4BQOA 3VBFA 1COV3 2DU1A 4YW6A 3R05A 4XSXF 3PUIA 3E5XA 5DAWA 2WL1A 2Y9YA 5B4NA 5HLTA 1FYMA 2XMLA 1PMJX 4GB31 2DDBA 2ELJA 3HGYA 3WVJA 1W2NA 2YB7A 2XWBB 2ZA9A 2V1XA 2J5OA 1NQJA 3BDDA 3PVNA 3FXUA 3RKXA 5KXDA 1GWMA 2KIMA 3BTIA 4LK1F 1C5IA 3DXUA 1NCRB 4AI2A 3DPTA 4XN0A 3OGVA 2XB5A 3VB9A 3CUOA 3HQXA 5FDBA 1T08B 2NYYA 2B7EA 3CL1A 1Q8SA 1VBB3 2VKVA 1UZWA 4G12A 2R3SA 2ZEYA 3PUSA 2XROA 2CSOA 4MO7A 2R6QA 3I2FA 2ICWG 3PM1A 1UQXA 3LSDA 3QCWA 4FQGA 2HWD1 1L7RA 1XB9A 3OS2A 3CJIC 3PUQA 1RUH2 4A3LJ 4D69A 4Y24A 1ZBE2 2B45X 5EIYB 4NC7A 2VI6A 2AENA 5HLGA 2P6HA 3B02A 4NPMA 3DGTA 4OUMA 2K4JA 1O4ZA 4TLGA 2DBIA 1IKPA 2MC4A 3TAYA 5FRAA 3IMNA 4JX5A 3WE3A 1D8KA 4HA8A 3N9MA 5F5QA 3JBG3 4AD9A 5FO5A 1NE4A 2RDNA 5FMOL 1UU4A 2JD4A 4QXCA 2CUEA 2LUWA 3HOVJ 4EJTA 2RMU3 3O0XA 4LHSA 2R92J 1DGRM 1EV12 2OVUA 2ZGPA 3WEZA 1X9TA 4IHTA 5A1LA 2PX9A 3TNQA 3IH3A 1YI9A 1IS5A 4RB2C 3PNVA 4L0ZB 4RFRB 1EH8A 1VE0A 3EO6A 4BQNA 2JA6J 3EUHA 1O8SA 5CKQA 4YFZA 2A69F 1KFUL 2EFPA 1RJ7A 4RAZA 4RBOA 3M1HA 1V70A 4KH9A 3GZNB 2ZGOA 4Y22A 3K4BA 2W2IA 4PF5A 5A33B 4X6RB 2ZB9A 3MLLA 1ETKA 4PGGA 1EP0A 4CUGA 4BJ5C 3MKLA 1UAAA 3CKHA 4I30A 1HSJA 3QLQA 2OXBA 5J98B 1YE9A 4BPZA 3UKGA 4ZU4A 4UOJA 1QHGA 5KXBA 3W6KB 2WZ8A 3KP7A 4QPOA 1VQ4I 2JDAA 3N9NA 1W9WA 4O5VA 4G7HF 2DLLA 4IHWA 1QJY3 1RUF2 3I58A 5E20A 5BPXA 2QBYB 2VJXA 4GYGA 1LENA 1REEA 3S2HJ 3SFZA 4Z2YA 2WAAA 3EHKA 2GN3A 1O5UA 2C6YA 1YW8A 3VZMA 5A3PA 1ON1A 1U5TB 4LE4A 3ACFA 1WGXA 4AI1A 3OYCA 1RUJ1 1BC8C 3O2PE 4UI9L 3RCOA 5JZGC 4KITB 1VQ5I 4E7IA 4CSWA 1XX5A 2WSVA 2ZSHB 3A02A 3IB3A 2WT2A 5LY2A 4XLFA 1MMGA 4M73A 3AZYA 2WUHA 2YFZA 1I5ZA 1GMMA 1EYBA 1WHUA 2J22A 2P34A 2BJSA 5I0RA 2RV8A 2CV6A 4W8JA 1OI6A 2NMOA 4EN7B 2PHWA 4YVWA 1YJ9I 4A44A 1CD3G 1WLWA 3MICA 4NPLA 4YGCA 4OUSA 4BXUA 1UY2A 4CU8A 1SBFA 4MGZE 1VAVA 1C57A 1G7YA 3RYPA 2VBDA 4IV1B 4NQWB 1PVC1 3QU3A 2TNFA 1PZ9A 1GKBA 5J09A 3T0AA 1CQTA 4MQVA 2IS1A 1HKQA 3HHGA 2VBBA 5E3MA 4I99C 1OA4A 5IK4A 4XSZF 2QNKA 4MHGA 4CDQB 4YG6A 5EYRA 3OUJA 2GIZA 4PUSA 1OCRH 1CAUB 5HNFA 2WZR1 4ENNA 2JJ6A 2WQZC 1I3HA 1I1GA 2B5HA 2RM21 1ZZ7A 3O1RA 1HDDC 2O5RA 1RUE3 5FKMA 2Z69A 4FOYA 4DGWB 1I27A 4KMFA 4LMYA 3HRUA 4GCVA 1HKDA 1OOPA 1LEAA 2QFEA 2Q8DA 3R4DB 4QB6A 3S7IA 4AEDA 4YVWB 4PJ0C 1DP7P 1CESA 4L9BA 2GMEA 2GC2A 5JOWA 3S1NJ 2Q1MA 4BMBA 4P5HA 1G9CA 1APLC 1OSGA 2KIFA 3HUGB 4YRVA 3I8TA 1XSVA 3H1YA 5EZWA 5LB6A 4XLAA 1ERDA 1DGRN 2XRLA 4MX3A 4R9AA 1S55A 1APNA 5FPVA 3AMNA 3NNMA 4WVZA 3ZMSA 4Y26A 4ZPIA 3GDBA 4LXLA 1AHDP 1S0DA 2AHQA 2DA5A 3CMGA 4BGDA 1MEC3 2VKHA 5E1ZB 3BTXA 4XR6A 2ACJA 2L54A 3WUDA 1U5TA 1X3WB 2EXIA 5L3BA 2LDUA 4XN3A 1U5ZA 1WD4A 4LITA 4K21A 2O03A 1ZX5A 1AF9A 3C7JA 1UFMA 2NS7A 3RMYA 1R58A 1O3TA 3PO2J 3KZ4C 4Q26A 3BOWA 3W3CA 1ONAA 4HANA 1UMQA 4DB5A 2VZPA 3WG7H 5GPCA 3FBNB 1MBKA 1FMVA 1F4AA 1NA1B 4BE1A 3WHCA 4IXLA 2NNNA 1DYOA 3FN9A 1HLCA 5A3OA 4JDMA 4DBQA 2JKXA 2EAAA 3ZQFA 5T5JA 2M87A 2IGMA 2O8KA 4Y1ZA 3SNMA 3HC7A 3LOCA 3ZXEA 3ASNH 3K0LA 1EUTA 1H2NA 4F3QA 1H9WA 2ZCWA 2W82A 3JCUC 2RS32 1ND3A 2P7VB 2M0CA 3TOBA 3BR6A 2R5ZB 1UD1A 3GX4X 5D1IA 4GMP1 2ZEWA 2I8DA 1TL8A 1DHKB 3ZFEA 3U10A 5GZFA 5FMCA 4CCCA 1UNBA 4QM9A 3ZSLA 2VB6A 1ZZ8A 2W1OA 4ONUA 4BXSV 3O5SA 5FZBA 1J9IA 2PXJA 3BU0A 3VDDC 4FTHA 3JB4C 3S5QA 3WG1A 5CU1A 5GAGJ 4X6AJ 2VZ1A 1J0RA 4BB3A 1T0FA 2A3SA 1LGCA 5D5WB 4TTGA 2EICA 2QDNA 2WAEA 1ZARA 2WNUA 2VIXA 3ETPA 1IS6A 2R7TA 5AIPA 1V9U2 2KZGA 4XJWA 3GZ6A 2QQUA 5LFAA 4BNCA 4KG0A 4EM2A 3ORJA 3TN92 2RJKA 2Y6JA 2ZPXA 3E97A 3D5SC 4PLOA 1YW7A 4A4AA 4QHBA 2E36A 2STWA 4IGQA 3GFJA 3CF5F 1FX5A 2IRFG 4AEDB 3OSFA 3FK6A 1T98A 1QOOA 3J8F3 2BXYA 4LKSA 3WG2A 1CAWA 5FLMJ 1XE8A 1NLSA 3GZ5A 3C1DA 3SH5A 3ACGA 2K40A 3ENRA 3RWNA 5LGUA 3R4SA 2R5ZA 4IV1A 1H30A 1S1AA 4C8DA 2LS6A 1V5FA 2MLKA 4GQ7A 3KEOA 3RNSA 2WWJA 3VBHA 4KMUX 3I53A 5CQGA 3GZUC 4RQPA 1AKHB 3WGHA 4HPQA 3CCUI 1HN0A 1QDOA 3WCSA 4QU1A 1PO22 3DF0A 2XUEA 4XF1A 4LIUA 2L7ZA 1Q8QA 5F5AA 2W00A 4PI0A 3DUIA 4YSFA 1VI0A 5E79C 2QENA 4FPHA 1AL23 4O6JA 1PVC3 5FUNA 3B73A 2CUFA 2HDDA 1OCOH 3LSPA 3K70C 1DGWX 1KITA 4Y1VA 3QODA 4CXWA 2EH3A 1JKPC 1VIWB 4QKBA 3TEWA 4Q4ZF 1DDNA 4AK3A 3N35A 4M9SA 5CPRB 2HEYF 4E4SA 4FPKA 1R4MB 5IVYA 2ZAAA 2VZVA 1ND3B 4QSHA 3GZTB 2IGNA 2AH2A 4HOOA 4OI4A 1H4GA 1SVLA 4NB5A 3QH6A 3RJRA 4JGYC 1OKOA 4IEQA 5CVVA 5SV5A 3CCLI 4XTPA 4A7KA 3ZFEB 3JRBA 4COUA 2GH2A 1F15A 4XAAA 3SCGA 1LAJA 2VASA 5DS9A 3M3IA 2JJ7A 3JW4A 2YHJA 3H1WA 3BG7A 1AR72 4CDWA 1QJEA 1WBLA 3L9JT 2C4XA 1HDPA 2Q8KA 3FLPA 3NQOA 1SAXA 5BNOC 5F32A 2MFZA 2E2HJ 4XIKA 2FNPA 1VMFA 3T09A 2FA5A 2D3RA 1T38A 2W85A 1IN4A 2VTXA 3W5MA 3OPZA 3ACHA 4COYA 2WAQA 2DU9A 1DZQA 3RI4A 3WGIA 2HWVA 4N8MA 3L2QA 4UW5A 3LEGA 2DYCA 1UZ0A 2RQPA 1GANA 1GOHA 4PZJA 1IV8A 1U8RA 4NRMA 4G9YA 3WF3A 1PGSA 2VOOA 2DVGA 3NNJA 5GZDA 1MMAA 2HWC3 2WFF2 1RXFA 1W03A 2FD5A 1W2OA 5FUPA 1OC1A 2M8GX 4IRGA 4L11A 3PHMA 3A7QA 1F43A 2BFUL 2JKBA 2VTXJ 3D6EA 1PO11 1HQWA 2VC9A 2Z2SB 1PP7U 4TXWA 2RS11 3MW3A 1PVEA 2V9KA 4BQ1A 4U2AA 1D0YA 4CCMA 3V7SA 2XRNA 3PU3A 1SBDA 1PDNC 4HV5A 1GP6A 3CUQA 3AG1H 2VPLA 4RHV2 4OMDA 4DINB 3CZJA 1US3A 1PUFA 2JDNA 2F6CA 2ISZA 3O8HA 4Q4W1 1SDDB 5JVVA 5DZGA 1W0TA 1LOEA 2UWCA 5ICGA 1BI0A 3PIJA 4L99A 4QMAA 3M8JA 2E34A 5C8CC 4GAZA 1PHMA 4DZGA 3M1EA 1BHGA 1X2MA 2MD5A 4GA9A 4A0YA 1J75A 2B39A 1EJ9A 3D8CA 1Y0UA 2GC1A 3ATGA 5LA1A 2ECBA 2BZTA 1T2XA 2KL4A 1AUYA 1AWCA 3ZXAC 5E8AA 3ZN6A 3P9IA 3ABMH 1K6YA 1NT0A 3ILRA 3IIIA 1UG0A 2L7FP 5J8CA 3KVBA 1XNTA 1CF7B 4M3GA 1A36A 3CBNA 3DEEA 1KRIA 2VPRA 1DUXC 4M9XA 1RRJA 1MBJA 1IQAA 4MXVA 4RAGA 4H4KC 2LKSA 3DTIA 4AQTA 4H7LA 3GTMJ 4FFIA 4B4CA 3ISPA 2XVCA 3H8OA 4AC0A 4CO8A 3HEFA 4CDXB 5CYVA 4RN5A 4LBQD 4B29A 2FJ1A 5E3NA 5HS9A 4ZZ5A 4GH4B 5J7MA 1KEXA 5AIQA 1LB2A 5CIRA 2GIVA 2A68F 2PA7A 3RFRA 2E35A 1YI2I 4P5OA 2VXJA 2CFOA 2QQIA 3THPA 3QYBA 1G8XA 2ZGLA 3T0YA 1LDDA 2UURA 3OY8B 5C8WA 2GNMA 2GALA 5DDJ2 5B2GB 2K3FA 5EDNA 1RUNA 1IQDC 1AYM2 2DA7A 3M3QA 2WS93 4PLMA 1HRV2 1WMEA 5FWJA 4JGYB 3IPVB 1UZYA 3VZNA 4EATA 3N9OA 1ZN2A 1S0CA 4AIKA 2VW1A 4BQ4A 1PIV1 1OR7C 2GOMA 4CXXA 1SFNA 3OEAA 3F23A 1N1YA 2JX9A 2LY2A 4CDXA 2YYOA 4C2TA 1LPQA 3WNNA 3WODF 4CEYA 2E1MC 1ODMA 4Y1YA 4XF4A 2YU3A 4Y5TA 2KXLA 2CGPA 3BG3A 3J7AO 2D2WA 5CA6A 2W08A 5A32B 4BK4A 2Z16A 1QKQA 2XONA 2FXAA 2NZ9A 1LGNA 3HJEA 5ABJA 1LEDA 1UG2A 4P9UA 2A6TA 1GICA 2MPFA 4YW2A 3W21A 3VHPA 1W8NA 2LVSA 5H6QA 5EXOA 3ILNA 2H6BA 3H36A 1J83A 5KHHA 4HRIA 1E5SA 3S3MA 1RUE2 4HSLA 1GWLA 4MGSA 3IDEA 1Y9MA 5D8LB 4LORA 4LT5A 2ZZJA 1F2NA 2VMGA 1JJ6C 1BEV2 3IHUA 5FV3A 3Q8FA 4PFPA 2VZSA 1VQPI 2CRGA 4LBJA 3Q0UA 4QX5A 5FZHA 3N4MA 3L2UA 4ZTFA 3CCSI 5SV8A 1G9DA 4XDPA 3PIPF 4CCEA 3T2QA 3D3AA 2F5CA 3DEUA 1ONVA 3TN93 3VDDB 4GKYA 3LPFA 5LWBA 1K5MA 3MUZ1 1QWRA 3OPTA 3NQHA 2YR2A 1VBC2 1U8BA 2V5DA 3FHAA 3V8LA 2ZAHA 5LBEA 1XMXA 2ZGKA 3KCCA 1ZR4A 2VJ4A 1YYNA 3F0CA 1G3WA 4GRIA 3AL6A 2VZUA 4C30A 1KD7A 4CH7A 4A3ZA 4A3EJ 1XBFA 3FHZA 2Z42A 4DJAA 3EUHC 3QQAA 4V1PA 4CZCA 2KKOA 1Z6TA 5LZ6A 5FD6A 1NCQC 1OOPB 2M4KA 5KVRA 1ZNPA 3K70D 4AHWA 3OEBA 3POYA 3H7YA 3Q8CA 3ZOIA 2YU2A 2GMPA 3GF2A 4R9DA 4GMP0 4G6QA 3V8JA 2PHUA 4IZZA 1L7LA 2G0EA 4IQ4A 2Z4FA 5JI7A 1P4AA 4XKWA 2VT2A 2Y64A 3NV2A 5D4SA 1FIAA 1A8MA 3GCMA 1RUF1 1BC7C 4Q29A 3KE2A 3MIEA 3DKWA 5KAFC 5E88A 3NEUA 3DTKA 3JXSA 5EQUA 1UZVA 1VRH3 1HX6A 3HG9A 2QQLA 3RGBA 2KISA 4J00A 3RWKX 3AKSA 1K6OA 1VQLI 2AXLA 2X5IB 2PHRA 1QOSA 1IO2A 3B7MA 3V42A 4JQRA 3PL8A 2CS3A 4CEYB 4F83A 5EYYA 2IGOA 4RGRA 2OS2A 3Q5FA 1ZREA 5EJ3A 4C1XA 1LOFC 3OS1A 1H9PA 2JQ7A 4YM2A 1EY2A 2JDYA 4ESFA 4BS9A 2R043 1TQ5A 1S0IA 3NWSA 2BGOA 1XDSA 1XYPA 3SEEA 4QPYA 4O3MA 2I45A 3QYFA 4KDPA 1FP1D 3E6BA 1NOVA 4LA3A 2D5HA 2V4JC 2UYBA 2D1VA 4B8EA 3M2MA 1E5IA 3Q9SA 1F4HA 4PSXA 4IQPA 3WW2A 1NE6A 1RL3A 4XQDA 1ETYA 2CUJA 3FJSA 4D7YA 3RVHA 2RE9A 4I2OA 3SQNA 1OVPA 1ACIA 4XVHA 1GVJA 4EGYA 3DKQA 4RFT0 3Q9OA 4DNCA 2VZOA 5FCCA 3NARA 2MG4A 2HYGD 4IKFA 4IEZA 4XEZA 1GU3A 4Q0QA 3HOXJ 1ZZ9A 4N53B 3PNTA 5ICFA 3JRDA 2XPUA 1YOVB 1IXRC 2X05A 1R091 2E7AA 3ELNA 5F3EA 1JXSA 2DT6A 1OKQA 3FFZA 2RN7A 1BJZA 4FPJA 2PJRA 2JDMA 4A2UA 4CPBD 1O3QA 2OTLI 3HN1A 1SC7A 2KQRA 4JZRA 1YQ2A 4FPYA 1AYM1 1YS6A 2IW5A 1TWFJ 2VUAA 2DMQA 3POBA 2ZMEA 3I54A 1SD7A 1XCVA 2EINH 4JQTA 1IJWC 4D0QA 5BQTA 3HSRA 4LNVA 4N7UA 3GO5A 3HOYJ 2VQTA 4QIWN 3BR2A 4QLCU 4LE3A 3FKJA 1MVQA 1VB2A 1ULOA 1IW7F 4QPWA 5LK7B 1BK0A 3GTOJ 1WCKA 4Z07A 1G3TA 3W2AA 1N75A 1FOD2 2IXHA 3GLXA 3QPSA 3O1TA 3K51A 4OI2A 4L5IA 2FMYA 1CAVA 4YFXF 3QD6A 2DTZA 3ABKH 3V0BB 5FYCA 4P9XA 2WT0A 1Y8QB 1RUD3 3P5BA 1VBE2 2XASA 4L9TA 2KA3A 3HJRA 1VAKA 1Q1HA 4XFFA 1P9QC 4L18B 1J09A 3V4GA 1SFKA 5B4XA 3DBHB 1W6QA 2QBXA 3U1KA 3CIHA 3CD6I 3OTFA 5GZCA 2B42B 1N77A 4NAOA 2VBXA 4RQPC 4QPIB 3ZR5A 2R4GA 3CESA 4JCKA 1Y56A 3NVCA 2ETHA 3IH4A 3ZQQA 2X85A 4B8XA 5KNLA 1JHNA 3WF2A 3A01A 3MHZA 4F8AA 4SBVA 1O4TA 3KCYA 3M8EA 5DAVA 1YYVA 4YFNF 3HOWJ 4FFHA 5CG9A 3WF1A 5IP6A 3DLLF 3H3LA 3FHNA 3PQKA 2AQEA 1DGRA 5EZHA 1S9HA 5BNPB 3ZMTA 2HWC2 5D2AA 2OW4A 2AR6A 3QBQA 1MZEA 2NVYJ 2BY1A 4N9HA 1K4TA 4KJZA 1FPN3 3D82A 1JHJA 3ZKUA 2UY8A 2DCKA 2WYSA 4Z2AA 1NY72 4IL7A 4XOGA 3ZYHA 1C3HA 1RHI3 3LEKA 1R1VA 3H50A 4IESA 2L9NA 1KGSA 3MQ0A 2Q1ZB 1ZGAA 2D3PA 1BR1A 4JP0A 3HTSB 5L7OB 1NZIA 1RTVA 5FBZA 5F08A 4I0WB 2VOTA 3A23A 5BOXA 2XC7A 3K75B 3DPRA 5TGTA 3DPUA 1BLZA 4F91B 3POGA 1EH6A 2GAUA 1SVOA 1W6PB 4RHV3 2V1UA 4HBNA 3VFZA 3CU7A 3RYRA 2KRFA 4RGKA 3OSDA 3NWKA 4OCTA 2QCOA 3G1OA 4OU0A 2ORZA 2M4GA 2VBYA 2HWF2 3VL9A 3DWLE 1ULYA 5JLXA 4W6YA 1ZBE3 1SFYA 4AI0A 4LOCA 2FD8A 1GHCA 3WNLA 1CGPA 1HRI3 5KHGA 2VQAA 3T3YA 3ZSKA 5BXXA 1W7PA 1KDMA 4LULA 4OZXA 3NAPC 4ZJZA 1W6OB 5A1AA 1V6JA 2CW8A 3KS7A 4GYIA 1V9U1 2BW3B 1D2QA 3HSEA 2BRTA 4GWIA 2V5YA 2E26A 2ZHKA 4NHYA 3PQJA 4B3NA 3MEXA 1AR82 1HQLA 3BR5A 3KV6A 4FQZA 5K0UB 3OB8A 2PELA 1ETQA 1KGYA 4DFSA 3MKYB 5HCBA 4A3DJ 2DQLA 5M3FJ 1REFA 4BZ4A 2A6ZA 1NCRA 1V3FA 2GNBA 4GZ9A 3VOEA 1R6RA 1OCZH 2ZGTA 3H92A 1IG7A 1POV1 4XURA 4OULA 3H0DA 5K7FA 3T30A 1F4KA 4KMQA 1SACA 1R36A 1K3IA 5FLIA 2KRHA 2OC6A 1PUFB 1H9GA 2OD5A 4AI8A 2BV6A 3OYHA 1XSXA 3L1PA 5GLVA 1BVP1 2FDIA 3MF9A 3HKZA 3LOIA 2LBFB 2XJQA 1VLNA 1X4PA 3B69A 4B44A 2OA2A 1W2AX 2BNNA 2LFBA 4GALA 1SANA 5A80A 1B35C 3AYEA 1B8IA 4AVZA 3G1MA 1FTZA 3OYAA 2FOWA 1AXZA 3RZJA 4Q1RA 2K85A 3IN9A 1IGOA 4EV0A 1RUG2 2WFF1 3R6SA 2HEVF 2HH9A 4IRIA 3WDVA 4AHYA 3T8RA 4V2GA 2HPIA 5J40A 4IEVA 1H88C 1J3RA 3U75A 5CFCA 2HR3A 2AEYA 5FO9B 4XLEA 3WP6A 1GYKA 3HXLA 4NMIA 1W6PA 4HF2A 5FKOA 5LGNA 2A07F 4EYUA 2VCAA 4XK4A 4W65A 2VMDA 1LOCA 5CEHA 4YGEA 4DYCA 1VNDA 5HOOA 3AL0B 5FY8A 4LO7A 2J1UA 3T0BA 1K5JA 4AIJA 2ZKLA 1NH3A 2M5WA 2B8MA 1RUD1 2WZR3 2BWAA 3RKYA 1FEXA 4XRSG 4A3GJ 4HSJA 2D7FA 2HOTA 2VMIA 1FLIA 3EB7A 3BTAA 1GNHA 1FIPA 1LHOA 3I2IA 1JYCA 5ILSA 4BQWA 4UFJA 1FSHA 4QX2A 3N97A 2HWF3 3RPUD 1DU6A 2DW4A 3I3LA 1UCXA 4PFOA 3J8F1 3WU2C 1IN5A 3MVPA 1GV2A 1AR71 4LLNA 3OGSA 2DFFA 5KC6A 4BJ0A 2ISYA 3MPPG 5DUUA 2WY7Q 4MO3M 4AEKA 2VCMA 3JQXA 3USUB 2E5NA 4JBAA 4IE4A 1ZKGA 1W9YA 5FP4A 4YG3A 1YS7A 2E19A 4LHNA 3V64A 2JWTA 2R063 2VQLA 1ND3C 4IE6A 3OMYA 4AHXA 1P4WA 4PCQA 4FI9A 3FXRA 4NIDA 3PTYA 2Y30A 2XUMA 1W0PA 2RS31 2DA3A 3NAUA 1T6BX 4G94A 1S5LC 4BQQA 4IEYA 1CAXA 1OLME 3VV1A 1WJFA 3NAPB 4JX0A 3HOTA 5JLWA 2P2KA 1TT0A 5ILVA 3KX2A 5B5EC 5IT9Z 2BP6A 2O14A 1BI1A 3BTLA 5F1RA 4NVPA 2XIGA 3VSKA 4UXNA 4LLFA 1ZBA1 1X82A 1LVAA 4RDUA 1B72A 1UU6A 4N43B 5A2QZ 3K1MA 2A3XA 3H8RA 2BVBA 4NOTA 3SKVA 3LQRA 2V26A 3HRSA 4ON0A 4S05A 1RUC3 1STZA 2R16A 2KMUA 4B4QA 3N9LA 2WWUA 2M9HA 1A04A 3KF5A 5FQ0A 2IGKA 4LBQB 2WADA 3FMQA 3QOPA 4GXLA 5A32A 3KPHA 1PZ8A 3PUHA 2BU9A 4BUPA 3H5NA 1DZRA 2WWSA 5HS7A 1Z91A 1GVDA 1KU9A 1LCLA 4AYBA 1HV0A 2GP5A 3C18A 3MW4A 1QJZA 3AFKA 4W6WA 4HN0A 1SVMA 2GLOA 3UV9A 2V6CA 4CEWB 3EYPA 3H0OA 5J1RA 2XJRA 1TT5B 2QE3A 3SH3A 4C1WA 4QT6A 1YNAA 2O8OA 5C8CB 5LW9A 5IK8A 1W9SA 2K2SA 2QKDA 5L7OA 3RDIA 4OIOF 1LR5A 1P4XA 1UXZA 2HWE3 4JX4A 1NG7A 3BIEA 1RUC1 2Z79A 5T52A 3MPBA 3LE0A 5FPBA 3I97A 2RR12 4ZHNA 1NCRC 5K4LA 3WW4A 5FKCA 3F21A 4FO9A 3VD4A 5FY4A 3JBG1 1OXCA 1I6HJ 2MGQA 4UBGA 3TW7A 2DU0A 3CLQA 1L7QA 1W6NA 1VBD2 3FLRA 1SMYF 2MA3A 3HPGA 4CCLA 1UB9A 1RETA 2NOJB 1IRXA 4LHKA 4B48A 4WF2A 1CZVA 3WQ0A 3KIOA 5FD5A 4MUVA 2ZO4A 3C3VA 1RMU3 5KR7A 2LR8A 2EF6A 1I50J 1WBFA 5IVFA 4YW1A 2PEXA 5A33A 5CFDB 3F2ZA 5F0FA 2L7MP 3AMHA 2IA0A 2XSDC 5J36A 2CU7A 1UXXX 2FBEA 3AK0A 4H3WA 2BW8A 4P00B 3FBYA 3OJBA 2J1AA 1WMDA 1S0GA 3JCIA 2FZ1A 1RPWA 1YO5C 1R1A1 1DGLA 2VUCA 1TMF3 4XF0A 1HW2A 1ND2C 2K4BA 3WR0A 4HG6B 4IPAA 1YQCA 3P3PA 3WNXA 4KFCA 4HX7A 4CP9B 1AR61 3H8UA 4MXWA 2QTWB 4AEJA 3RPQA 2VBPA 2GZWA 1X8EA 5E1RA 5B1AH 4PJLA 1V4RA 4Z8BA 3KYCB 2BHZA 4I3PA 4ZZDA 2VD7A 4IOAF 3ZFFC 2BUKA 1CR7A 3TDZC 4IHSA 3K4KA 2PHFA 4PDWA 4P08A 3O1UA 3LSRA 3K3OA 5FQ0B 3K4NA 1UELB 5AONA 5BY5A 2AC1A 2RJ2A 1WPKA 4K20A 4HDUA 3OGRA 3EDPA 2CWEA 3MN2A 1TP4A 4OHYA 3BWGA 1A31A 5EPAA 4OWRB 4EN8B 4U7DA 1A3KA 5JXIA 1EH7A 2RNJA 3FUOA 1J7KA 4D6RA 1FMD1 4HLYA 4JOMA 4XONA 4G8XA 2M2EA 3ZP5A 4M3CF 2AUYA 5HVQC 1UIKA 4N43C 5E1XA 5A3TA 2I10A 1Y4WA 2YBKA 5EJCA 4MFDA 5IAVA 3FXKA 5K5RA 3ECOA 2PQSA 1IC8A 1B9NA 1FJLA 3I49A 4ITCA 4LK0F 3KP6A 2DPUA 5LBQA 3OD0A 3HPNA 2YXSA 1UYXA 4AVBA 4LD5A 4D5CA 1DPUA 5H9RA 2DCYA 1YTYA 2W39A 2JENA 1BA5A 4ISRA 5DZFA 3GFIA 4C0BA 2WNVA 1K5MC 1ASJ1 1PK6B 4XF9A 2QWWA 2YUSA 2D40A 2QZ3A 3OG2A 1Z0XA 5F3GA 3O1OA 5CISA 3WY6A 2H0VA 3A4CA 4D94A 4CDWB 3N9QA 2XB6C 1JUHA 3SZPA 1JHFA 4BEHB 1B09A 1Z6RA 4BDZA 4M74A 4ENMA 3K4AA 1MMDA 4IF4A 4NRPA 3OPWA 3VD9A 4CEWC 1FSEA 5FYTA 1TNRA 3HSFA 1IF1A 2XH6A 4IJAA 1TNTA 2DT7B 3HHHA 3TOAA 1HOMA 4BACA 2ZX4A 1TZLA 2IUWA 3POJA 1OOPC 2A5WA 1I5PA 4M4PA 4U87A 1R9TJ 1CAVB 2MW8A 2NS0A 4LG0A 1YLLA 4Y5Z0 3BJAA 3L2YA 3CDZB 2KIQA 2VO5A 1RXGA 4J25A 2AZ5A 3MFCA 1G3SA 3OL3A 1MMNA 3JR9A 1QNWA 3R0RA 4JRLA 1UX7A 2XPJA 2IAIA 2PLV2 1S29A 1WWYA 4FT8A 2R073 1SLAA 1S6LA 2FU4A 2QBYA 2FF4A 4L0YB 2I74A 4F52A 4DXZA 3NJZA 2B9UA 4JKLA 1KQ8A 1YEWA 1YFXA 5DUXA 4KGGA 3OOXA 4DOUA 2PN5A 4OHWA 1H0BA 2ARBA 3USSA 4O61A 4FX4A 4QQPA 1LDKB 2EFNA 1PZ7A 3OYLA 2QLZA 4YVWC 2JK3A 3I7DA 1CAXB 1RVF2 4FFFA 1MS5A 3ES4A 2IWGB 1QRYA 4Q8LA 1OF4A 1XJAA 1DLLA 2WLPA 1R092 1ZRRA 2VW0A 1BI3A 1HB1A 3HQUA 5IYCJ 5E1WA 1MEC1 2MD0A 3MFKA 5A6XA 1JU4A 1LHUA 2EV5A 3S32A 5EJ1B 3DEMA 2PLV1 2HWC1 5K1YA 1FYUA 5FZCA 2GWRA 3BTYA 2RGVA 1WCSA 1FP2A 1LESA 1PMIA 5FREA 5HV0A 4HDVA 2R7EB 4LO8A 2X0LA 4GB32 1TLHB 3TO7A 1QPIA 5E3OA 3HZJA 1VQ8I 4F7ZA 1EAH1 5A1FA 2EQRA 1QEXA 4PLNA 5FXXA 2K9ZA 2H09A 4RS5A 2YY1A 3LIGA 1KU3A 3GNEA 4MFEA 2C24A 2Z3YA 4IGPA 1DG6A 5D5UB 3OUHA 4B09A 2IXJA 1F35A 2HWB2 4RAYA 2LM3A 3W5NA 1O3RA 1POQA 5LRSA 4QU2A 1ZR2A 3K9TA 1V6OA 2UWAA 2VC1A 3ACIA 2M7AA 2LBFA 2XJPA 3W2VA 2NVXJ 2BOJA 1ZQ3P 4XFCA 4DNYA 2TCTA 3B9CA 3DP7A 3QP6A 1FT9A 4M3DA 1REPC 1LGBA 3D0JA 1D1CA 1QJX2 1ZBE1 2E60A 4JKKA 1QJFA 4V2WA 4A3CJ 4X8NA 3I4IA 4OMCA 5HV4A 1VMJA 4DXRA 5JOXA 1HRI2 1XMAA 5IPAA 1DQ4A 2H1LA 1ZZ6A 3MZ8A 4R4XA 2R061 1W28A 4IUGA 1DDLA 5FFZA 2K02A 2BTVC 3ASIA 4H7MA 1IUYA 1GZWB 3SISA 2JG8C 3SJMA 2J1EA 1MACA 2ZACA 5IYDJ 1C8M1 3S3NA 5FLJA 2BW3A 4R4ZA 1AVBA 2A1XA 5GLTA 2VE8A 1AR73 2VE1A 4GWMA 1NZCA 3SCHA 1W6MA 2VONA 4EN6B 2GSYA 2EV0A 4Q4X1 5DD8A 5JPNB 3IV5A 1G6NA 3MKZA 4FPCA 1X19A 2OX0A 1S4CA 2R7FA 2JDPA 1RUD2 3OOPA 2RDPA 1HXS3 5F39A 4AEDC 3WNPA 3VHRA 4PK4A 4B4PA 4FTEA 3HAGA 4N0BA 3MCZA 3JRHA 1X3UA 1CJPA 1E0EA 3VBUB 2XVGA 4NHLA 1GDTA 1JHHA 5CFDA 1UOJA 3KZYA 4ZYHA 4FPOB 3GM8A 3TQNA 3CCYA 2F5FA 2DV9A 3M07A 3PNYA 5C4WB 2XSJC 4BQXA 1WMFA 3GBGA 4CYCB 1B4AA 1DQUA 1S2BA 1WW5A 3C8XA 3G6JB 1BW6A 3QPTA 4H2AA 4ZU7A 3SKJE 4UVAA 2GBYA 2DURA 4A0XA 1LU2A 2LY1A 1RUG1 2VG9A 3F8BA 2ZZQA 4XJ9A 5CVUA 2RMU2 2YPDA 2DMNA 1ITYA 3AZVA 1U9NA 1FAYA 2M8EA 5HS8A 1POV3 1IAWA 3EQLF 2W46A 3BOPA 4W50A 3LSKA 4C3HJ 4F93B 3RYKA 2W84A 3S30A 3A01B 3I2GA 4U7BA 2LRPA 4MGYE 4ZKTB 3SDGA 5FB2A 1F5JA 1Z78A 5C5UA 2CH0A 1BN5A 3J7ZI 4RR3A 1QJY1 1SLIA 3KQ4B 3H5RA 4NIIA 3TEXA 4Q4X3 5B3SH 1WW4A 1V55H 2JDZA 2YV8A 4DIQA 3L2RA 3UGGA 4HSRA 4IV3B 1R64A 3RJ2X 1WSUA 3U9GA 2FRHA 5EG0A 5F8PA 2HOAA 5JZGA 5CG8A 4YIIA 2YX7A 3VD7A 4I3GA 4BE3A 2CMPA 4LLLA 1AR81 1HV1A 5FKLA 1B1BA 3HNBM 3WT3A 2EIDA 3S16J 1R093 1XC5A 5T5LA 4LGWA 4D0PA 1PVC2 2HWE2 4OZOA 1XRUA 1GV9A 1D4VB 3E7LA 4CDXC 1D0XA 4U36A 3AB0A 4XUNA 1AYN3 2A6VA 4G9SB 4Q4V3 2XPWA 2K27A 3QRFF 4E4DX 1ASJ2 2YZ4A 3VDDA 3IKTA 3O14A 1UHMA 4A3MJ 4FE4A 1KS4A 5BYNA 3OYMA 1JXNA 3JD71 3I2KA 1W8FA 1WJBA 1MMSA 1W2TA 2QQJA 1N25A 2OA4A 1BI2A 1W5TA 5IVEA 2HLEA 1YRNA 4BISA 2WWYA 3G1LA 1NAEA 4C9YA 4WVMA 2P7CB 1JI8A 1L0OC 1ETXA 2PMHA 3TO9A 1H1IA 2BVLA 4AAPA 1X8MA 2YC4A 3VDAA 4ZDOA 4J6GA 5HODA 1QOTA 4IRHA 5K5QA 3NSTA 2PTMA 2ZKZA 3FISA 2EA4A 4LLGF 2P5KA 1F5TA 3IDCB 2B7YA 4RGXA 1JW6A 3KZIC 5C6CA 1OPOA 4DUXA 3O7OA 4NPRA 3LFUA 2G1MA 2WQ4A 4CHUA 3BZKA 4RB0A 2R1DA 1MNEA 1UOFA 4JVAA 4DY3A 4V19K 2X6WA 5L73A 1TWGJ 4KIFA 4AXOA 5FJKA 1YXWA 1X1BA 2X51A 2WSUA 2HXIA 1XN7A 4N9IA 2C1FA 2JE9A 1H0MA 2HKXA 1MSFC 2XGXA 2B9VA 2ZBKA 2QUOA 2O3FA 4UV9A 2VUMJ 1X1PA 3C2GA 3MDPA 2CFXA 1UF2C 3ZXKA 3UKTA 3K10A 2OPWA 2V7FA 3WTZA 4LKDA 4YVSB 4Q5OA 3LDRA 2W1UA 4OI1A 2ZNYA 4RR3B 3AZWA 2A6WA 1WW6A 3GUDA 1E5RA 1EUUA 5FMOS 2KD7A 4D7TA 1SQ4A 1IRZA 1OMIA 1V00A 3WZ1A 5GZGA 3WTSC 3POWA 1TNSA 2YDEA 4CEWA 4EMSA 3JTHA 1H1AA 3I2OA 4IX7A 1UPIA 3DYPA 1F1ZA 1QF3A 1AXYA 1OQEA 1S2EA 3I9V2 1XSDA 2Y75A 1UAIA 1YIOA 4L9NA 2A3WA 5FPZA 1R1TA 2JG8A 4RYDA 3ML6A 4KWLA 2WO3A 2Y9ZA 3KHCA 3LCPA 1EF4A 1OH4A 2K9LA 4AUXA 3ZMVA 5EFUA 4D1QA 3U21A 4GH4C 2ZXIA 4IGOA 4NIAA 5IP9J 2PAEA 1S7AA 1JZ7A 2VL4A 1IG3A 4XJAA 4G3YC 4EJWA 4OHVA 4UUVA 1V6IA 4ESJA 1MS3A 5BMZA 2Z99A 4Q0PA 1JZ8A 1U2WA 2XF5A 5A7OA 2PBIA 2Y0IA 5IOYA 1WJCA 3KD4A 3WHBA 2LF8A 4P9IA 3MMYB 1K78A 1K4SA 1CVNA 4URTA 3WNKA 2CV1A 4BQYA 2VZQA 5EGOB 1Q8VA 1D0ZA 3JB8A 4LHLA 5FYBA 4AFAA 3MEPA 4HQMA 3Q8AA 3WUCA 1NCQA 2VZTA 2DA6A 5TJJA 1QZYA 2YBSA 4AR2A 3KLOA 3ZYRA 2NNYA 2Q0AA 2AEZA 4CDUB 9ANTA 2WKKA 2L9SA 2JUGA 1FTTA 1RESA 2Q30A 2FDFA 1XMKA 3TWIA 3LA2A 2V1NA 1OD3A 3VD5A 2OF7A 4MSVA 1WGPA 1ZRDA 1JUMA 1DQ6A 3IRRA 4XFIA 1RUOA 3ZQLA 5HI0A 4I76A 4TYSA 1AX2A 4HAMA 4BKXA 2WNVB 3M7AA 1H8TB 3GTPJ 4AW7A 5D8AB 5HDKA 3GHMA 1VBD3 4S2GA 4KN4X 2JIJA 5ICCA 2Y6GA 1RUJ3 4Z82A 1XGMA 2EVXA 3OD4A 3BLYA 2OUHA 2VOVA 1D1AA 2Z5WA 5EEHA 3EUKL 4E7KA 4MHUA 2KRCA 2YPRA 4MGTA 5LCWL 4S04A 4DQAA 1ENSA 4X6QB 1NX9A 5EEGA 4AQ2A 3RI8A 3WP3A 2KHMA 4NUBA 3DYMA 1H8AC 4HSTA 3WSOA 2UY9A 4Q4W2 3WW3A 3THTA 2GXAA 2ZNZA 4HF0A 5IT9K 2PHLA 2X1DA 1HB2A 1C5HA 4BYYA 1RVF3 1FNZA 2XB0X 3VZOA 1N47A 1X50A 2ZXQA 3K1NA 2P4EA 1X2NA 1WCDJ 2R041 2WNOA 3ZQGA 3KSCA 4SLIA 2HWB3 1H8TA 4KISA 2ZHNA 5L19A 2MABA 5IVCA 4HNVA 1FMD2 1I39A 3H42B 4M3CA 1QXRA 3N05A 2JIGA 2DOFA 3JSPA 1EPWA 4LA2A 1G86A 2CG4A 2VQUA 1HXS2 4AU7A 1IRFA 4QPQA 1WH7A 3CP2A 1XYNA 4CGZA 1DPRA 2NVQJ 1OFCX 3CCQI 4ES9A 2E63A 5AC93 1PO13 3W58A 2MLGA 3WTVC 2IVJA 2DFEA 4LPLA 5A7SA 5G04L 2PMZN 4KQ7A 1IXSB 3ZQHA 3Q8BA 2VW2A 2A70A 1K61A 2QSHX 4YZ5A 2G9FA 2AYHA 4BEHA 5IYBJ 3QPHA 4RGGA 1UU5A 2H27A 2CWSA 2SLIA 1VRH2 1U5XA 3I3QA 1TNFA 3P9CA 3IDAA 2FCUA 2L3DA 1QH7A 3AG2H 1ENXA 4QKNA 1W39A 3A03A 3ST7A 3K2ZA 5DCFA 3RPUA 3F95A 5LATA 4ZYEA 2VKEA 2QF7A 1MDMA 1VRBA 2YUEA 4TWTA 2Y0MA 5KHIA 4XF3A 2R5YB 5DDGA 1QJX3 3CJIA 1M06G 2G7HA 5DAQA 5FLXZ 1PO23 5EJZB 1TWCJ 3ELKA 5DUWA 3HVDA 4AEMA 1SD6A 2BVMA 2EPFA 2IS4A 1ETOA 3M8FA 4LKEA 3LDKA 1DIWA 1UPSA 1A34A 3GCXA 2ZMKA 1OQDA 5IJRA 5DPNA 5FZ6A 4LG3A 4LJZF 2YMZA 1W8HA 2ADUA 3OBZA 4QPIA 2WC2A 5FOBB 3HDDA 5FFXA 1SG3A 2CW7A 2RDSA 1MBGA 1HDKA 2BXZA 2WO7A 5JXHA 4ZZ8A 2RS33 3K4MA 3VBSB 5G05L 4IL6C 3GALA 4MEXF 2QZ2A 1R1A3 1BKZA 2RV9A 3ZOBA 4LBNA 4PDWB 2YROA 4C0HA 4L8QA 1E3PA 4ZXEA 2E7WA 1KDKA 1ZH5A 2FSWA 1OHFA 4HKOA 2WN3A 2JPCA 3SQOA 1B35A 3S2WA 2UZKA 2ET7A 3ABLH 1JZ4A 1RB8G 4RMNA 2LC2A 3U4XA 4BL0B 2Y0OA 5BPIA 3WDYA 1FX7A 5L9BA 3K4DA 1W9FA 2D93A 4OYUA 4PIXA 1WJEA 1H6YA 4ARXA 3VZJA 2CWMA 1OPMA 1ORKA 4YARA 1DGWY 4AVAA 3GBWA 5K8SA 3I4PA 1IOAA 3TGNA 1GZWA 1BQPA 1U12A 2E7QA 1E3OC 2XF7A 2PLYA 1AYN2 1VBC1 3M1CA 2DT5A 2RS52 2W5FA 2VXDA 1RC6A 2D6MA 2E2JJ 2IJLA 2D43A 3RG0A 1MW7A 5FKNA 4UFIA 1XOYA 3GF6A 1J58A 2Q8EA 1OD5A 1ZRFA 3QU6A 1FPN1 1K83J 1WZ2A 2GP3A 3SITA 3R4UA 3U4SA 4UFLA 2HWD3 3BU7A 5IFPA 3CDHA 4BHPA 2PJRB 2DI3A 1LRHA 3URFA 2NXNB 3S0MA 5FYVA 5FPLA 3O8GA 2XXZA 3IDBB 4BIFA 3CJXA 1FOXA 2PFBA 1SZBA 1DZTA 1OKRA 1BEV3 2QQ8A 4DZJA 1SEFA 3J26N 4M3BA 3EXUA 2OT7A 3ZR6A 2HWB1 1COV2 2EILH 5JLVA 3VKFC 2ORXA 1QXPA 2H94A 5FKKA 3POIA 2RS13 4TV7A 4YIFA 3HM5A 4JGZC 3WCRA 3WTYC 5C3RA 3JSOA 2W68A 1HRV1 2QUFA 2Y38A 1AYN1 3FHIB 4I7HA 3KB5A 1RUI3 3TRSB 4NNJA 1HKTA 4DZPA 4WM7A 2LP0A 5ANQA 4XUPA 3WX5A 4BXXJ 4IXAA 2ZOEB 2A5ZA 3ZDVA 4Y17A 2CTVA 3UYJA 4URAA 2DAOA 4NDLA 2ES3A 2LF7A 4XMYA 3C2BA 4AVSA 4IO9F 4IEPA 4A6SA 4A42A 3GFMA 3ZIXA 1FPQA 4MQ9F 2J1TA 1K7AA 1RVF1 2VH9A 4KT6A 4QX1A 1H4HA 1KFXL 3ZMZA 4XORA 4A3IJ 2VVDA 5FMBA 4RGUA 1MS0A 3AKRA 3J7HA 3C7HA 4DY5A 2DTRA 2DO7A 2VOXA 4XCBA 1JZ3A 4RA0A 2IXIA 2ERFA 1WWXA 3N9PA 3E6CC 4Q27A 5BNPC 4Z92B 2GNTA 2YGMA 3BN6A 4I0AA 2XAHA 2HVRA 1QQP2 1SD4A 4XRSA 4WZCA 4DUWA 3ZQCA 4QGLA 2A6HF 1O7LA 3I56I 2LKXA 4U0YA 2DCEA 2JA7J 2EFOA 3A4UA 1MD0A 2WIIB 4ZU5A 4BA6A 3SZTA 2JA5J 3MIFA 5IY5H 3KCXA 2FBHA 5FZIA 4YZ3A 1XSRA 3P6BA 5L7OC 2X6XA 2MNGA 4A5NA 4NQWA 2VJ5A 4IERA 4AIDA 4F92B 3HR9A 3E0JB 2OKXA 3OBAA 1RMU1 3J7LA 1G9BA 1YLFA 3J81Z 1CN1A 5M5XJ 2VBZA 2NVUB 3S1QJ 1U0AA 3BIWE 5D8AA 5FY0A 5A3LA 5BNOA 2V79A 3UR3C 5J8FA 5FWEA 4KU7A 1X1DA 2EIGA 4LEJA 4CP2A 4FVVA 2CNAA 4JDOA 4XJUA 1YX3A 4UVBA 2ZX1A 1LOBA 1WH5A 3ZMDA 4UWDA 3BP8A 3Q8EA 4XBLA 1SCSA 4YGBA 2KIUA 4JC1A 1S3JA 2X4HA 4P55A 3B6CA 2EIEA 3WG9A 3PURA 3ZPYA 3KP5A 5HPOA 2ZMNA 4Y13A 4IEOA 3GMEA 1FOD3 2W25A 5CVJA 2ZGSA 3GTGJ 4KI5M 5HCFA 5IATA 3RSNA 2DK8A 2RG4A 3IBMA 2E5ZA 4BE2A 1JYNA 3HOZJ 1UJ8A 3T8TA 3P9KA 2DYRH 4JHZA 1GP5A 1FV2A 2PQQA 4YLZA 2IXCA 2EIJH 5FBJA 5KC5A 1Z67A 2OQ6A 1NXMA 3I59B 4PJNA 2XR4A 3IRQA 1OLTA 2D98A 4AVCA 2ZXJA 2D44A 2DPDA 1KA8A 3WDWA 1W8OA 1GNZA 1OFNA 3F8CA 4PT6A 1NA1C 4YRDA 1R4NB 1W8WA 3AVRA 2VLAA 1ZZBA 2RR11 5C71A 2DOAA 3INAA 2W87A 4MH0E 1UL9A 2JSPA 3GXOA 2TUNA 1N3OA 3NAPA 2JSCA 3DPLC 5GAEJ 4XQWA 4HKWA 4PQQA 1RI7A 2JZYA 3N3HA 1F36A 5A6QA 1VR3A 1GR3A 1O59A 2LROA 1AL21 1X1AA 1E2XA 2WV1A 1M4WA 5FZKA 4IEXA 2QEXI 3FM5A 4DXSA 1YX5A 2XL7A 4Y33A 4NWVA 1LKXA 5F7UA 3NW4A 4XLNF 5IVBA 1AA7A 1R00A 3LNQA 4MVTA 5FZMA 2A7AA 2ZS6B 5APAA 4M0HA 1LULA 5FYZA 4B7KA 3CJNA 3JQWA 5CBLA 1LQ1A 3RZKA 3VBUC 4Y4RA 1G9FA 3O6BB 3U07A 1POV0 3KGZA 2XOMA 3ZXGA 3VBFC 1WD3A 2HS5A 4KIBA 3VGIA 5KBFA 5IW0A 1LHVA 3MFAA 4QXKA 4NRQA 2L0KA 4W97A 2CAUA 3LDBA 3S8PA 5T5PA 2ARXA 4P9YA 1NG6A 5F6KA 1UZCA 4I0BA 2OV7A 4CXFA 3G7DA 1Y9QA 3LWFA 4CDGA 4GKXA 3MBWA 3GTLJ 3VD3A 2CSGA 4NC8A 5IOZA 4QGMA 1JYVA 3FZVA 1JTZX 1X58A 1P8JA 4RM2A 4MHRA 1BEV1 2BBYA 4UUTA 4YZ4A 1FNYA 1BBT1 1GBGA 2HQ5A 4M9ZA 1BK1A 4M71A 5T55A 3AG3H 3MV11 4FCAA 4MV2A 3PJRA 1V6MA 4HOBA 4QPGB 1DQ0A 3SH4A 3LWCA 1WCUA 1MJ9A 2MEV2 4R79A 1FMD3 4L92A 2Q2EB 1BW5A 3GXUA 4N90A 3VBRC 4W6XA 2MHFA 3ALQA 1XQNA 2K9QA 4AWXB 2H6CA 5BNGA 1BJAA 3SMHA 5EYXA 1AR83 4LK7A 5FXWA 5K0UA 3ZFGC 1BIBA 1PNGA 1I3AA 4I01A 4DUVA 2KJBA 3BQZA 2X1CA 1N1TA 3I59A 2DVDA 4PDWC 1RUG3 1WJAA 1HLVA 3GTQJ 2O6GE 3TB0A 1I1SA 1OFSA 2ELKA 3KT7A 5CKNA 2L9VA 1R083 5BV6A 5F9TA 2EIMH 2IXKA 3U2RA 3ZFGA 4MLOA 3AFGA 4Q0SA 4XZPA 2WT1A 2XGDA 4COWA 3SXYA 3C7FA 4GULA 1PGW2 2VCBA 3OUIA 2VNGA 2QSFX 5LRRA 2OIIA 4OQ9A 2ET1A 2X6YA 5DUKA 4D7MA 4Y5SA 3VN4A 2Y69H 4LUMA 3H3ZA 3W2WA 2K46A 1QH6A 4COZA 1QHHD 1TQMA 5JMOA 2Q8OA 1A35A 3OIQA 1LNSA 1W05A 2IFRA 1OUXA 1B72B 2XL9A 4UF0A 4XZUG 4FETA 3CC4I 3FUQA 1KU2A 5LGTA 2WYFA 2W52A 4IQJA 2XAUA 1BCXA 3S14J 1SLCA 4OAZA 1P2FA 2YBPA 1Z21A 3MZYA 1CZTA 1DYKA 2ZEZA 3K69A 1L3LA 4W4ZA 1LEBA 3LFMA 5DXDA 2F4IA 2YU9J 2JRTA 3VBHB 2FDGA 5C33A 1LOGA 1PGW1 4HK9A 5BPDA 1LFUP 1U0JA 1CX4A 4D5FA 5L36A 4NC6A 1X3ZB 2OU2A 4Q4Y2 1JS9A 5FMDA 3CUQC 1YIJI 1FOWA 4ZY9A 5FYHA 3WQ7A 5FZ8A 3V7RA 3UT0A 1XU1A 5FXVA 1YJNI 2TEPA 3ZPLA 2XBO3 4PI2A 1W1WE 4RR3C 4OOIA 2HNHA 5IYYA 4G7ZF 2DN0A 3JREA 1R082 1D0GA 1AR91 1YQ8A 1U6GA 5F27A 4UVCA 4YPJA 1K5MB 5CZKA 3V0AB 1UKGA 3WXPA 4CPBA 2GMMA 3BPSA 4HNUA 4BDVB 1D0HA 2KP6A 2QZ8A 2Q1FA 1Y43B 2GQQA 2LG4A 1L3JA 4FXKB 2AXTC 2ZX0A 1LJ7A 3BODA 1JJ8C 2E31A 1EAH3 3H1CA 3DPRB 4Q0UA 1Y6IA 3T1LA 5FP9A 1JTXA 5F6FA 2DUOA 5L3DA 2BDRA 3HB9A 4ASNA 1SDWA 1EA3A 3BG9A 3WDXA 5L3GA 4YEJA 2HQAA 1EPZA 4L2NA 3H9JA 5FP3A 5GP9A 2BOLA 3VYRB 3M7GA 4PJMA 5EZGA 2LOOA 1G9AA 1WFXA 2R042 1MQTA 3E5UA 1QQIA 3A22A 1ZTRA 2OZJA 2RM23 3LMMA 2YC2A 2OYZA 2DCZA 3CF2A 4GDFA 2JDUA 1W99A 3TEYA 2QVOA 4Z6YA 2C9KA 2HVQA 3RQIA 1RUI2 4BU2A 3OSGA 1W06A 5GLZA 4HXCA 1RINA 1ZLKA 4EN9B 1SFOJ 3RZGA 4NAMA 3DYOA 4DO0A 3KQRA 1D4M3 1VMHA 2DJNA 3ABUA 4XC9A 5BUVA 2O0YA 4XL9A 4N43A 1MJAA 2JPBA 4JV4A 3N7JA 4S0HB 3CJIB 4PJJA 4YW3A 2P6SA 4ZH4F 4QX0A 4QKDA 3CHXA 3CDIA 1WJ5A 2QKMB 2D1HA 3WV6A 4Z2WA 1OLMA 3VKOA 1OQ1A 4CP0A 1QZEA 2WN2A 5J3UA 3H9AA 5KXEA 5M5YJ 1VAMA 1R71A 3T08A 2IT0A 2WNVC 1YW9A 2B46X 1SMVA 2XG3A 5D8AC 3RIRA 2HBUA 1IXCA 4RS5C 2VNOA 4XLCA 4HLXA 3DTEA 5EGOA 4ORFA 4A7ZA 1FOD1 2FCVA 3FXOA 3VHOA 3JAMZ 2EXJA 4HETA 4GGGA 2AS5F 3OYGA 5FP7A 4MG2A 2NRAC 2KPMA 4A93J 1XYOA 3G3ZA 5C4XJ 1TME1 1Q8PA 1CWPA 3LZZA 1PO21 5A6ZA 2V4VA 3G73A 3ZXLA 4AVTA 2OZ6A 4XJZA 2D5VA 2XJSA 4NHMA 2R062 1J1TA 4KIGA 2WS92 4A45A 2EZKA 3T2TA 3HL2A 1K42A 1ZA4A 1Y9GA 1FNNA 1TWAJ 2XAFA 2E1MB 5KAIC 2ZJQF 2R7OA 1VBC3 2N7GA 2HGCA 4QAWA 3ULQB 5H9PA 1LECA 3Q0WA 3OYEA 4M01A 4GFBA 4B3XA 2ZGRA 3PL0A 3CC2I 4CDWC 1RIOH 5J1YA 4UXAA 1F8VA 1AKHA 2C5DA 1G3YA 4CU7A 2WINB 1YRNB 3WQBA 2OCCH 4A7YA 4ETSA 5FFOC 1I6XA 1UYZA 3UJQA 3KT4A 4G6TB 4LMFA 3OBRA 1C1LA 4W1UA 1QQP1 5FK7A 4OIRF 5AC92 4K40A 1LKNA 3J80Z 3S1RJ 1TME2 2R49A 1G59A 4YVSA 1A6IA 4DMIA 4JTOA 1MQTB 4HW0A 1XNCA 3N7KA 2PAKA 2EZIA 3RZMA 3HT1A 3D4KA 2VVEA 4ZZLA 1IPSA 1O3SA 4KL1A 3BR0A 4P9JA 2N8GA 2VR4A 3I71A 4AI9A 5F3IA 2L5QA 4RL7A 4FTBA 4FP2A 4JQFA 4XLHA 3HYIA 4FOVA 1SFUA 4HV6A 5LEJA 4HNTA 5F0CA 4M3CB 1X36A 1A6QA 3HUGA 4X0GA 2L9RA 4XTMA 2L7KA 1RC9A 2ZSIB 2BEOA 5K5OA 2NMNA 3HOSA 5IWFA 4Y20B 1SHWB 2TBVA 4G6DA 3KYLA 1NY71 2XLGA 4BBRJ 2Q8CA 2YX4A 1A8DA 2E1CA 2F17A 2ME0A 2WFPA 4QPGC 2ATFA 1K79A 1AR93 3ZMOA 1GLNA 4EZHA 2PAMA 2Y31A 4UYBA 3VBSC 4KICA 5ABJB 3O1PA 3NJYA 4QWQA 3K48A 3JRFA 2EV6A 4XKCA 5J48A 2PG4A 2X09A 3OL4A 4LQRA 5FLHA 3CO6C 1FYLA 4HK8A 4AAXA 4CCJA 5B1BH 2A6YA 4P5YA 3OYNA 1HKSA 3AKPA 3PFIA 3U1XA 4M0NA 2F5DA 3H8XA 1QDCA 3RS6A 4Y22B 3GJBA 3BTCA 4AM3A 4CICA 4KWUA 2R7RA 1OH3A 3HBLA 5CKMA 4M6VA 5DZEA 1RGSA 3OR2C 1T56A 4HZFA 2ZKNA 3LQQA 4PGHA 2DFCA 3FXMA 2FOKA 1PIV2 4BY1J 2Q0OA 3H35A 5LD2C 3FX3A 4XBFA 2Z9OA 1MZ6A 4DBRA 1OCPA 1KJRA 1U3EM 4YFWA 2MEV1 2EB7A