5SV8A

Crystal structure of the catalytic nucleophile and surface cysteine mutant of vveg16 in complex with a xyloglucan oligosaccharide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
198
structure length
198
Chain Sequence
AQPLKFIAVDYSPESCTHSPESSTITLTFDHRGGSRWRSTTRFQYGTFSSLIQCPKGNTSGLNFNIYLSSLEGDKSQDEIDFEFLGKDKRIVQTNYYTAGTGNREAIHDLGFDCSDGFHEYVIKWGPDLIQWLIDGKVIRSVRADGEGFPQKPMFLYASVWDASYIDEGRWTGPYVGSDAPYICLYKNVNVPVGTAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords probable xyloglucan endotransglucosylase/hydrolase protein 1
publication title Crystallographic insight into the evolutionary origins of xyloglucan endotransglycosylases and endohydrolases.
pubmed doi rcsb
source organism Vitis vinifera
total genus 47
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2016-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5sv8A00
4GWNA 2WT2A 2DUOA 1Q8SA 1BQPA 1G9BA 5JVVA 1YXWA 2AR6A 5DG2A 4L8QA 1LTEA 3HR9A 1QNWA 4WV8A 3UK9A 5T55A 1RITA 1H30A 2DVBA 2E51A 3OYWA 1GZCA 4FOQA 1NXD1 4YG0A 3AP9A 1FV3A 3ZXKA 4UW4A 5KXEA 3M3EA 3SH4A 1AX1A 3JUUA 2R49A 2ZGTA 3OY8A 1FV2A 5E88A 3O12A 4FPYA 2A3XA 4ATFA 4Q1RA 4XMIA 1WLCA 5T50A 1LEMA 1AXZA 1UKGA 5T5OA 1SLCA 1XQNA 4YZ4A 1IOAA 5GLWA 2HYKA 5CBLA 4XIOA 3LSDA 1FAYA 3B69A 4YM0A 4YW2A 3N7MA 4P9WA 4YW5A 1QKQA 1URXA 2PHXA 4XILA 2ZGMA 2A75A 3D6EA 4HANA 1CESA 2A6WA 1CQ9A 2DU0A 2ZHLA 3OGGA 5GZDA 3LSEA 3UJQA 2ZA9A 2R0FA 4NO4A 3WCRA 3RG0A 3RSJA 4UW3A 2A70A 4GA9A 2WT0A 4YGBA 5DZFA 3RRDA 3IPVB 1GANA 1LGNA 5EWSA 1QDOA 1G7YA 1A8DA 4FP3A 3T1MA 1LOFC 2UWBA 1IS5A 4FVVA 4XYXA 5IK7A 3ENRA 2ENRA 4XJAA 2CY6A 1DQ6A 2V73A 1JBCA 1DFQA 1WD4A 3NV2A 1N1YA 1N3OA 3ZYRA 5CA6A 3JU9A 5JOZA 3AZYA 3KQRA 3BOPA 1HQLA 4LBLA 3WCSA 3WDUA 1DHKB 5H9SA 3N36A 1ULFA 2C5DA 2JKBA 4YM3A 1DQ1A 1JUIA 2D43A 1SLIA 2A5ZA 2W08A 1DLLA 1C1LA 2ZMNA 3AZZA 3IN9A 2AYHA 4WVVA 2RHPA 1QU0A 4R9AA 1GV9A 4XMAA 2DVGA 3RS6A 3BODA 2CNAA 1W6QB 5E8AA 2NP0A 1HLCA 4ATEA 1Q8PA 4IQPA 1QOTA 4FPOB 4YG6A 1UMZA 4DQAA 1QOOA 2E53A 1BZWA 5DUVA 2P37A 4FPFA 1DZQA 2P34A 2OVUA 1GKBA 1N3QA 2NN8A 2W68A 1S0FA 1N47A 3FFZA 1MR5A 4DRVA 1LHVA 5DUWA 2ARXA 4YZ1A 1MS5A 2PHTA 2YZ4A 1JN2P 1JYCA 1BXHA 1DQ0A 3AZWA 1LHUA 4M3CA 1GNHA 4Y22B 2AENA 3WG2A 5CB7A 1Q8OA 1W6OA 1LENA 1GNZA 5H9QA 3ZYPA 2PELA 1CONA 3W58A 1V6JA 3IMNA 5JOYA 4XE9A 3A4UA 2G4IA 2WSUA 4K21A 1G9FA 1GZWB 3AZXA 3QCWA 1NLSA 2NM1A 3FBYA 3B00A 2TEPA 1JW6A 4BMBA 1ULCA 1FX5A 1LHOA 2ZGPA 3NV4A 5F9TA 3WHTA 2DYCA 3FLTA 1SLBA 2DUQA 4XTMA 3ZXJA 4AYUA 3OJBA 1QNYA 2EIGA 3WDVA 5GLUA 2E6VA 3VV1A 3BTAA 5DZGA 4LBQD 2D3RA 3ZPYA 1WLWA 1YIFA 3POSA 1AF9A 4CZSA 1ONAA 1S0JA 2PHRA 2EF6A 2GMPA 2VW0A 5GLVA 4YZ5A 5GZCA 3OBTA 5FRAA 4BOWA 2E7QA 4ITCA 4C1XA 4KBBA 3ZXEA 4PBPA 3SNMA 2D3PA 1DIWA 1F5FA 1WBFA 2DU1A 1PZ9A 3SISA 1O4ZA 1FNYA 1AZDA 1LU1A 3WUDA 4XJWA 3WG4A 3V0BB 3ATGA 2WQZC 1JXNA 2OW4A 1JYIA 5KXCA 4XTPA 2YY1A 4XHBA 4AGGA 3SH3A 1A3KA 1QMJA 1ENRA 2GALA 1Z0HA 2WLQA 3WDYA 3ILRA 4I30A 4FQZA 2UURA 3MW2A 5GJ6A 4YZ3A 1ENSA 3A0NA 3OPZA 1S0DA 3FLRA 2P3JA 4XJZA 4YM1A 1N1VA 3R4UA 2WJSA 3WG1A 1WW6A 5IK8A 3N35A 4M01A 4BMEA 4FPHA 3V0AB 2C9AA 3V0AA 2JE9A 1IS3A 5T5LA 3ZXFA 1UL9A 3LCPA 4YLZA 2A6ZA 3OBRA 3N7KA 3PVNA 3T1LA 3ZSMA 3AYAA 3CNAA 4Q27A 2P3KA 3WDTA 4DPNA 1G9AA 1PZ8A 2ERFA 1C4RA 5IT6A 2EALA 2WKKA 3TAYA 2JJ6A 1VAVA 2A7AA 2AREA 2EXHA 2JD4A 3N3HA 1W6PB 2LALA 2R1DA 4TYSA 1C1FA 3ASIA 3GALA 5EYXA 4Z8BA 5EXOA 1KITA 4XJ9A 1KJLA 4RA0A 5T52A 4TZDA 2VU9A 2A3YA 4FPKA 4SLIA 2ZGKA 5GLZA 4R9DA 1KDMA 2EAKA 2D6MA 3IPVA 3VUOA 2AH2A 3APBA 4PBOA 2DVAA 4XBQA 4Y24A 3RMYA 3ZVXA 3WDXA 1AVBA 3O0VA 4LBQB 1DQ4A 4JC1A 1LEDA 3ILNA 1CPNA 2D6KA 2VXRA 1WBLA 3AYEA 1MZ5A 4D69A 4DFSA 1Y7BA 4BLIA 1LCLA 1ULGA 2CWSA 2ZHKA 4ZKTB 4PCRA 1HQWA 3O0WA 1I3HA 1QGLA 1ULDA 3M3QA 3ZSJA 1AX0A 3MEPA 4FPJA 1CPMA 2ZKNA 1UZZA 3KM5A 2E7TA 4FPGA 4Q1PA 5CAZA 2AUYA 4AVSA 4YGCA 1FNZA 1W6QA 4Q8KA 4R9BA 3WV6A 5H9RA 5IUQA 1W0PA 4YM2A 1G86A 4YGDA 5H9PA 4LBOA 4ISQA 1MS3A 2ZHNA 2DTWA 3O5SA 1WW7A 4CRQA 2H0BA 5GM0A 4R9CA 3W59A 2CL2A 1MVQA 4FP2A 2A6YA 2I2SA 4XZPA 4PQ9A 1VLNA 3AXEA 4H55A 5HCAA 2GN3A 2ZGLA 1W6MB 2ZGOA 1OKQA 2D3SA 1GLHA 1S1AA 1S0CA 3RMXA 4XBNA 4Y20B 3SITA 1DBNA 1YRZA 1CJPA 4Y22A 5JOWA 4FOVA 1G8WA 3M1HA 3A0KA 1UPSA 2NMOA 1MS9A 3POYA 4BLJA 1W0OA 3M3OA 4FPEA 1WW4A 2SLIA 2ZHMA 1MS8A 5LK5A 4Y1UA 5DZEA 1GZWA 2B7YA 4YZ2A 5JMCA 2R0HA 1Q8VA 4UW5A 3USUB 1W6NB 5KXBA 1WD3A 1Q8QA 3AYDA 5HCBA 1KRIA 3I4IA 3ZSLA 4Y1XA 2VW1A 1SLLA 4M3CF 3R05A 4GKYA 4AGRA 1J1TA 1SCSA 2WT1A 1DQ5A 2WSVA 3ILFA 3AFKA 1DGLA 3RQ0A 4FOYA 4XIKA 2ZGQA 1OQ1A 1LHNA 1KQRA 1IKQA 2A6XA 2WNEA 3AZVA 2CTVA 1LOCA 1GICA 2YROA 2ZZJA 4AGVA 3AP5A 2W39A 3WHUA 3L2YA 2JE7A 1BJQA 1LESA 2DVFA 4NOTA 1SLAA 5F5QA 2DURA 4AWDA 4W65A 4YGEA 4Y1YA 4Y1VA 2W52A 1BYHA 2R1BA 3R4SA 3V0BA 3U4XA 2D6LX 2EXJA 2ARBA 2ZGRA 2ES3A 4FPLA 1UZYA 1PZ7A 2D6NA 4P9YA 2OUJA 4ISRA 4U36A 5T5PA 3MW3A 4XXPA 1JHNA 3UL2A 1LODA 1BKZA 4P9XA 1S0BA 4XHXA 3M3CA 3WOGA 1O4YA 3T2TA 4WVWA 1Q56A 2NYYA 3AP6A 2KM2A 1ENQA 2OUHA 2PHWA 5GLTA 1DYPA 3VKLA 1S0EA 1Z78A 4LBMA 3OYWB 1AX2A 1KDKA 1LOEA 1MACA 1ZA4A 1APNA 2UWCA 5DUUA 4YW3A 4XOGA 5DXDA 4C1WA 2CWMA 5GZFA 1WCSA 4RL7A 4Q2FA 1F31A 2YXSA 2ZABA 1JOJA 1MZ6A 1A78A 3OY8B 5T5JA 3WLUA 4GWMA 3AYCA 4ZXKA 2VUAA 1W6PA 4LBJA 2GDFA 1SBFA 4XJUA 1ZM1A 2ZAAA 1ULEA 1IKPA 4BPZA 4Q26A 1LOBA 4F83A 3FLPA 5JDBA 1UN1A 1V6KA 2ZGNA 3B9CA 4YW4A 1LGCA 2FHRA 1KJRA 4MYEA 4CTEA 1U0AA 3PVOA 1LU2A 4AVTA 1C57A 3HMYA 1MS1A 1N1SA 1LOAA 1GZ9A 1V6NA 2BQPA 3FUOA 4OZXA 5GZEA 2ZMLA 2D44A 3O0XA 4GALA 3WG3A 3B01A 3SLIA 2JECA 4LBQA 4FPCA 2GMEA 1GSLA 5KXDA 1R1ZA 2DTYA 2LTNA 5CNAA 3UJOA 3AXDA 2ZMKA 3GNEA 1WUVA 4AVVA 3NWKA 2ZGSA 3TB0A 4DS0A 5T54A 3WDWA 5BYNA 5AVAA 1YYNA 1D0HA 3FUQA 1DQ2A 1X50A 1WLDA 3B3QE 4GXLA 3INAA 1YO8A 1CIWA 4FOWA 3D5OA 4GKXA 3V64A 1HKDA 1TEIA 2YMZA 3I8TA 3DUIA 3V65A 4Q8LA 1UAIA 1VAMA 4K20A 1MS4A 4K1ZA 1IS6A 2GNBA 3M2MA 1CN1A 2EXIA 1SLTA 1GBGA 3QLQA 4M3CE 4Y26A 4K1YA 2XG3A 1SBEA 4YW1A 2D7FA 3PVEA 4YG3A 1LECA 3AJYA 2VH9A 3D4KA 3NV1A 3H0OA 4M00A 4LBKA 2PHFA 3MPPG 5JLVA 1LOFA 1N3PA 1RINA 2DWRA 4XBLA 1HDKA 2GNMA 4JCKA 4ASMB 5IK5A 2SBAA 4XJ8A 4P14A 1S0IA 1WW5A 2Q5TA 2UU8A 5FREA 1W6MA 1N1TA 3AJZA 3NV3A 4PF5A 3WVJA 1S0GA 2A71A 3AP4A 3PJQA 4Y20A 1MVEA 1V00A 4U2AA 3ZXLA 5GALA 4Y1ZA 2Z42A 2D6PA 2ZBJA 2VY0A 2JDZA 2GNTA 3VKOA 3BIWE 1B09A 3HN1A 4HL0A 4BQ1A 3MW4A 1UX6A 1CR7A 1OFSA 1AXYA 2VW2A 3VKFC 1AJKA 1LGBA 2A6VA 2GN7A 3WZ1A 1D2SA 1SFYA 1W6NA 2DUPA 2FMDA 3USUA 1MS0A 3WUCA 1I1EA 1SBDA 1V6LA 2R16A 3DGTA 1VALA 3N7JA 2A3WA 2NZ9A 3IM0A 3WNXA 5SV8A 2DV9A 1H9WA 2PHUA 2UWAA 3N7LA 4BM8A 1EPWA 4M3CB 1QOSA 2P3IA 1W6OB 1CVNA 2XB6C 4XDQA 1VIWB 1LOGA 1F9KA 1FATA 1AXKA 2NMNA 4YFWA 3IKWA 4UW6A 4WZFA 3SH5A 2DVDA 1RIRA 2EXKA 5DG1A 1AJOA 1V6MA 1YI7A 1LJ7A 4JRAA 1H9PA 1DYKA 3C2UA 3VKNA 1G9CA 3AK0A 5DUXA 5EYYA 1SACA 2GMMA 5L73A 3AX4A 1QDCA 1IS4A 3VKMA 2V5YA 2ZGUA 2P2KA 4DRRA 1LHWA 4LBNA 1V6IA 3ZSKA 5E89A 2ZACA 2D6OX 3AP7A 3POWA 2YV8A 1QF3A 5IK4A 2AGSA 4YFZA 1LULA 3PMEA 1G9DA 5GZGA 2CYFA 1SCRA 1GYKA 3Q9OA 5JOXA 2GNDA 1FYUA 4XXAA 1V6OA 4FQ4A 5HCFA
chains in the Genus database with same CATH superfamily
1G6NA 4GWNA 5A3OA 2WT2A 2DUOA 5JWPA 2QCSB 4RFRB 5FYBA 5JVVA 4L8QA 4WV8A 4EV0A 3H3UA 3LIHA 5T55A 4K7JA 3POGA 1H30A 2PN5A 1ND2A 1RVF2 2E51A 4FOQA 4Q4X1 1QXRA 5EFUA 5K4LA 5CADA 5IVBA 2HWE2 3AP9A 4PIYA 5AC92 3T2PA 4A7KA 3GJBA 2YB7A 5A7NA 1BVVA 3M3EA 3ZDVA 1RUE2 3JUUA 2VOTA 3OY8A 1SPPB 2HEWF 4WM8A 4CP1A 3O12A 4FPYA 3S57A 1GQHA 2A3XA 3PUQA 4ATFA 1U12A 1WLCA 3WQ0A 1EV11 1UKGA 4ES8A 3HPNA 5F5AA 1SLCA 4YZ4A 3RZZA 1C8NA 3GZTB 3USSA 4XIOA 1FAYA 4YM0A 5FP8A 4IEZA 5FTTC 4HG6B 2BGOA 2FDKA 1QKQA 2PHXA 1UXXX 5IW0A 3D82A 5C6CA 1B35C 3D6EA 3BUCA 1FOD3 2A6WA 4GH4C 4LO6B 4A3ZA 1ZZ7A 1NE6A 3E5QA 1ZBA2 2ZHLA 2XJTA 3OGGA 5GZDA 2R063 4CUGA 3H8UA 3CQOA 4C0HA 4NO4A 3RG0A 4GD4A 2VXJA 4BQWA 4IV3B 2BVVA 2CGOA 3VBOA 1PM7A 1W03A 2WZR1 5DZFA 5FPUA 3U4SA 5EWSA 2ZX3A 1F5JA 1A8DA 4FP3A 2UWBA 2Y33A 1ULOA 3KLSA 1R1A3 4A45A 1EAH3 4Y5Z0 2XLFA 5A6XA 1NZIA 2X09A 1N1YA 1N3OA 3ZYRA 1JZ7A 2ZPXA 3JU9A 5J98B 1K3IA 4IV1C 5FYZA 5JXHA 5LCWL 5FZ9A 2W5FA 2WNUA 2WS93 2ZEXA 2JKBA 4H7LA 1AYN1 4URAA 1JUIA 2XR4A 5I0RA 3RZKA 1W2AX 5JMOA 4L92A 5BNOB 1DLLA 1C1LA 2EA7A 2OPWA 2WO2A 3E6DA 1E57A 4KU8A 4D6RA 2AYHA 4WVVA 4AVBA 2RHPA 2VOKA 1BVP1 4R9AA 2QDRA 4XMAA 1ZZ8A 3BODA 4XF0A 2CNAA 4FT8A 4QQHA 1J1LA 4ATEA 4D6QA 3TYJA 3MIGA 4FPOB 4XDPA 1KGYA 1RUJ1 3K4DA 3HJRA 4QPIA 3B94A 3I3MA 3NW4A 5FUIA 1QOOA 2BNOA 3ZLIA 4NN0A 4YW6A 4CVUA 2QQPA 2ARCA 4AHWA 1IQAA 4NPLA 1DZQA 5L9VA 2R6QA 2P34A 1YI9A 1VBE3 3ZXDA 1H4GA 5I8SA 4DXTA 5C8WA 1J3QA 1S0FA 2ET7A 4PT6A 4F8AA 4OHXA 1LHVA 4DRVA 1TMF2 2XMLA 4MLOA 2ARXA 1KEXA 4XFGA 2ADDA 5A7WA 4J1XA 4YZ1A 3TEZA 2PHTA 1W06A 5KHJA 4O65A 3ZFFC 4AHXA 1DQ0A 3WG2A 1LHUA 3MPBA 1GNHA 2D97A 2AENA 4D7YA 3RI9A 1W6OA 1LENA 5LATA 5H9QA 1XE7A 5JSPA 1CONA 1FMD2 2Z4FA 4DUWA 5I8YA 1TVGA 4XE9A 1COV3 1POV0 1XNKA 4K21A 2HWF2 1FOD1 4FXGB 1GZWB 3E1F1 3QCWA 5CKNA 2W0XA 4JDNA 3B00A 1D2QA 4P9JA 2R061 5CVRA 4BMBA 1Y9QA 5A3PA 2PHDA 4R4XA 1QXJA 3NNFA 3WHTA 4GWJA 2WNVC 3FLTA 4XTMA 3WP4A 4AFBA 3JCIA 4AYUA 4BQ5A 3OJBA 1J58A 1QNYA 3VV1A 2RV9A 3CZJA 5L19A 2V5DA 2D3RA 3H8OA 3O1UA 1WLWA 4E8CA 1AR62 1QEXA 2QZ3A 2PHRA 2GMPA 3S7EA 1PO11 1RMU3 4WM7A 4YZ5A 4A41A 2W1SA 3DPRA 5GZCA 2P6CA 1H1MA 5FZ3A 5CFCB 2IC1A 2KD7A 4GB32 4S2DA 5CFDB 3POJA 4EN6B 3LE0A 3PVBB 1LRHA 4LO8A 3SNMA 2YBSA 2WDBA 1F5FA 1OD3A 2MPFA 1DDLA 1HW5A 1O4ZA 4XJWA 3JB8A 2EIBA 4UBGA 3V0BB 1OOPC 2Y0OA 2OW4A 1GWMA 3K48A 2CSGA 3ZN6A 4CP0A 4XTPA 1ASJ1 2YY1A 3B9IA 3RJRA 1OHFA 1U5XA 3F2ZA 1OLME 1UZWA 4I30A 5FY7A 4N9IA 1JI6A 3OGRA 3EYPA 3VZOA 1K42A 3A0NA 3WSOA 3I3EA 3SCFA 2Y64A 1S0DA 3FLRA 1VBB3 1S55A 1N1VA 4YM1A 4LK7A 3LFMA 5IK8A 4M01A 2JE9A 2Y6LA 3LCPA 1AR81 3FZ3A 1GP6A 3T1LA 1GOHA 4ZY9A 4AVAA 1W2OA 3CNAA 1WMFA 2P3KA 4DPNA 1WCDJ 1YQ8A 5IT6A 2XJSA 2XBO2 5FLJA 1Y43B 3FBMA 1JZ8A 2A7AA 1W6PB 4XQ4A 1X36A 1NAEA 5F3CA 3VHRA 3GALA 1H8TA 1HB2A 1M4WA 1XNAA 5DABA 5EXOA 2Q8CA 4O61A 4RA0A 3NAPC 4LJHA 2VU9A 3MZHA 3JB4C 4SLIA 4AF9A 2RM21 1KDMA 3VLBB 3E97A 3VUOA 1GQPA 4FFGA 4Z82A 2QBXA 2Z2SB 1NY72 4DEQA 4LORA 4LXLA 1OLMA 3ZFEA 3C7OA 5D1IA 4C90A 1K12A 1OUXA 3SQOA 1X82A 1YQ2A 3VZNA 2VXRA 5IHRA 1WBLA 4D69A 4XDOA 3W5NA 1AR71 2VMHA 1ULGA 4JGYC 1GUIA 4CEYC 1HQWA 1HV1A 2HWB3 3H1YA 3O1MA 5LEJA 3PNAA 4UAPA 5FYTA 5I0UA 3ZSJA 2OXBA 1AX0A 1W3VA 4WZCA 3TNQA 2FCUA 2PA7A 2JWPA 4IE7A 5BNNC 3VBHA 3O1TA 3WP5A 5IATA 3T0BA 2RDSA 1R64A 3W20A 5CAZA 2AUYA 1PGL2 1UU4A 1W6QA 4I02A 1GP4A 4R9BA 2X5IB 2OT7A 5FZEA 5IUQA 4P00B 1W0PA 4ARXA 4D0QA 5CU1A 1ZRFA 3MIEA 2WINB 5C8CB 2ZHNA 4L0PA 3J8F3 4AI3A 1MVQA 4NIIA 2I2SA 1OLQA 4B4PA 4EWDA 4PQ9A 4I01A 3LPGA 5C7GA 1VBB1 3AXEA 5HCAA 1KXGA 3PU8A 1W9FA 2W91A 3O7OA 2WAOA 1OKQA 1ZZ6A 1GLHA 2D3SA 5C3PA 3RMXA 4XBNA 5JPNB 3RZMA 3SITA 4BISA 4Y22A 1CJPA 5JOWA 1JZ2A 3ZN5A 1H2MA 1UPSA 1UU6A 1MS9A 2NMOA 2OYZA 1WGPA 3POYA 4QDSA 2XUEA 1H2NA 1GU3A 2Y6GA 2GP3A 1PX3A 2NLRA 3IDAA 1WW4A 4LLOA 5JMCA 5DZEA 4YZ2A 1CX1A 2ORZA 2R0HA 1Q8VA 2XJUA 4CDUB 5IVCA 1W6NB 5DDJ3 3ZXAC 3KT7A 5FXVA 1LR5A 3CMGA 4EQVA 4H7MA 3OBZA 5LB6A 5HCBA 1KRIA 4LMFA 1Z7S1 3R05A 1HIXA 2YU1A 4HFSA 1REEA 2F4LA 3W21A 4AXOA 4Q4V3 1ST8A 3D0JA 5IVYA 1DGLA 1W9WA 3ZSEA 4DXSA 1IG0A 1SDDB 1OQ1A 1XNCA 4JRLA 2JE8A 3I59A 1PK6B 2WQ8A 3J7MA 3QBQA 4IEQA 4IL7A 4HVQA 2CTVA 2ZZJA 4AI9A 5C4WB 4CCNA 1GWLA 4N7UA 2VZSA 1BJQA 1O3SA 2Y6HA 5F5QA 3U37A 4AWDA 1VBC2 2XJQA 3BPSA 4Y1VA 2PXJA 3QD6A 2E26A 1UYPA 2BRTA 3NNGA 4IETA 5FY9A 2D6LX 1QJZA 5IAXA 2ES3A 4HKWA 1QQP2 1UZYA 3CZUA 5LA9A 2VCBA 2D6NA 4P9YA 2DCZA 2FDJA 4JVAA 3MFAA 4A42A 2VTXJ 1HXS2 4PLNA 1RUG3 1GFF2 2J1VA 4JGZB 1JHNA 3KGLA 1QXPA 3LD8A 2IXKA 4MGIE 3WOGA 1O4YA 4S2HA 3RDIA 3AP6A 1O6UA 3JBG2 1VBD1 2OUHA 1MPXA 3J8F1 1IPKA 1QJFA 5FK8A 1DU3D 1ND2B 4LBMA 1KDKA 1ZA4A 3K2OA 3LGRA 1ZX5A 2FBEA 2PAEA 4Z07A 4C1WA 4IV3C 4RL7A 2VNGA 4Q2FA 3SKVA 2C1FA 3PIGA 3I2DA 4GMP1 4Q4Y2 4OI2A 4XFIA 3OY8B 5HV0A 4WM8B 1AR61 2Y0IA 1PIV1 1TE1B 1PVC1 4GWMA 3EJKA 5DQ0A 2GZWA 3HQXA 2AC1A 4N8MA 5JR7B 1C5IA 3I54A 4BPZA 4XAAA 1XE0A 4F83A 3FLPA 5L7OA 1UF2C 2LRPA 1R082 2ZGNA 3PTYA 4HKOA 1BBT1 3EQEA 2B39A 2HWE3 3IB3A 1KJRA 5A3TA 1OC1A 2QQLA 1H2LA 1LU2A 3FE5A 1C57A 2WAAA 2BWAA 2ZX0A 1N1SA 3BU7A 1C8M1 1GZ9A 1V6NA 1RUE3 4BQ3A 3AMPA 2ZMLA 2VVDA 2C9KA 4PDWA 2XJPA 4QXCA 4XPVA 4QX2A 2VNOA 3TN91 3BI3A 2OPKA 3SLIA 3VDBA 4IXLA 4FPCA 5BNOC 4QGLA 2HWC2 1UIKA 5KXDA 2VMGA 2JG9A 2LTNA 5FZKA 4KQ7A 4RGAA 4AQ2A 4LPLA 5A7PA 3O1PA 3HAGA 2VULA 5T54A 3WDWA 3S0MA 1GNYA 1UYXA 2YFUA 2FDHA 1XRUA 2HBUA 2Q1MA 2QQKA 3K3NA 3VBOB 3J9SA 1XYNA 2JG8A 5LY1A 4FOWA 5IJRA 3D5OA 1PMJX 4LITA 3V64A 5FP7A 2RS32 3DUIA 4IW3A 2OQ7A 2W46A 4AI8A 1MS4A 2HKXA 4CUBA 3POBA 2VCAA 3ROUA 3ORJA 1RUC2 2MEV1 2VZTA 4NIDA 1NQDA 1ZZBA 3WEZA 5D8AA 5JLVA 2WNUB 4FSJA 1E5SA 1DZTA 2OKXA 1RINA 2DWRA 3P1IA 4EJRA 4DY5A 4EE2A 3FHQA 4L9BA 3SC7X 3GYDA 4OHYA 2RM22 2UU8A 1N1TA 4TLGA 4XFFA 1Q5OA 2B4KA 5A1AA 3OPTA 3AP4A 3PJQA 1Y9GA 4LNVA 4UT5A 4MUVA 4Y20A 5ERLA 1P8JA 2KXLA 3O1RA 1GOGA 4IUGA 2JDZA 4QPIB 4QWNA 2OZJA 4LIVA 4LKDA 4KGQA 2XOMA 5C9AA 2FQPA 2JDUA 1HN0A 4CDWC 1OFSA 3I2FA 4XFBA 2A6VA 1XOYA 4LULA 1SFYA 1NT0A 2D98A 4CXXA 4B1MA 1MS0A 1I1EA 1L3JA 1RVF1 2A3WA 2NZ9A 4XQDA 5HPOA 5A7WB 2VOWA 3HN3A 1H9WA 3KGZA 1W2UA 5JSRA 1EPWA 5CFDC 4K40A 1QOSA 1NCQA 1W6OB 1CVNA 2XB6C 3N9OA 3POEA 3WQ1A 2XH6A 4RR3A 5CISA 1NE4A 1RHI3 4COUA 3LA2A 3RPQA 4BJ0A 3TNPB 1FATA 4YFWA 5HV4A 5HBAA 1OA2A 2DVDA 3KD4A 1RIRA 2A1XA 1X7NA 1V6MA 2WA4A 3OGVA 1HRV2 4N90A 4Q0SA 2Q8DA 1DYKA 4CPBA 1TMF3 2P5BA 1W28A 5DUXA 4QDRA 2B45X 2W2IA 5DAVA 1UY0A 2K46A 2ZGUA 3DKQA 1E5HA 2P2KA 3POIA 4JAAA 3ZM8A 3BKZA 4OUSA 3IMMA 3GCXA 1V6IA 1FMD3 1O3QA 3AP7A 2D6OX 3O1VA 2F17A 5IVJA 1XYOA 2YV8A 3VL8A 5A3UA 4QPYA 3HNBM 3NL1A 1UOBA 5C3OA 5GZGA 5I0SA 1ZBA1 2ZEZA 4WM7B 2QUOA 3GBGA 1FYUA 3DPRB 3CJXA 4KH9A 4AE2A 4OYUA 1BQPA 2YDEA 3ZR5A 2AR6A 1LTEA 1YWKA 2LUWA 1NLRA 3HR9A 2E7AA 3A23A 4WVZA 4YVWA 2VMFA 2DVBA 5A6ZA 1D4M3 3ZN6B 1FV3A 3WNOA 5C5TA 4V2WA 1HRI3 3NKGA 2I07B 2W1WA 4AK3A 1S2EA 2FCTA 5FP4A 3THDA 5AFBA 4GB33 4E9KA 3ZMOA 2VZRA 4XEZA 2B9VA 5AC93 3ETPA 4AR2A 2ETEA 4XQWA 4ZS3A 1DZRA 4OI0A 3H1MA 1XQNA 2VZ1A 4J6GA 1JZ4A 3LEKA 3LSDA 3I3BA 4NUBA 3B69A 4YW2A 1RUH2 5C5UA 1Y4WA 3N7MA 3OB8A 4GIQA 4MGSA 1FT9A 4YW5A 4ASKA 1L7LA 1SQ4A 1H1IA 4MGYE 1H4HA 1WCKA 1SHWB 2A75A 2CDPA 3GM8A 3MUZ1 3MIBA 1CQ9A 3NNLA 4HKLA 4SBVA 2FDFA 2C6SA 2DU0A 4EWEA 1H8TB 2WBKA 4QHOA 4HZFA 2BDRA 3UJQA 5B2GB 3WCRA 2G1MA 4IEWA 2XVGA 1TNRA 4HT1T 4UW3A 4GA9A 1TMF1 3SEPA 2X5IC 2RMU2 5FZ0A 2WT0A 2XONA 3OOXA 1A34A 1LGNA 5C8CC 4K6BA 1W9SA 4NR1A 3ZYIB 4A6SA 4FVVA 1IS5A 3JD72 4PF1A 5EJ1B 3ZFEB 1RUI3 4BYYA 5IK7A 3ENRA 3I2JA 1FMD1 4XJAA 1DQ6A 2V73A 1JBCA 1J3RA 1DFQA 1WD4A 3I2IA 5CA6A 4NIGA 2HWF1 1VP6A 4CU6A 3WF1A 3UV9A 3DF0A 3BOPA 1HQLA 5BNPA 2RG4A 3VBSA 5H9SA 1O5UA 4YM3A 3PL0A 4X8PA 1DQ1A 2D43A 5FYCA 4HN1A 2A5ZA 4OHVA 2VBBA 2W08A 3ZFGC 3O1SA 3AZZA 4MGKE 3Q8EA 2GH8A 4P9LA 3VBHB 4CDUC 4UFKA 1ALYA 4RS5C 1GV9A 3RS6A 2F4PA 4XACA 1W6QB 1NA1A 5E8AA 2NP0A 2RE9A 1HLCA 2WWJA 1QOTA 1UMZA 4DQAA 2E53A 4E2QA 1K45A 3JQXA 4W4ZA 4B3NA 2RDRA 4FPFA 1OT5A 4QKFA 5FZDA 2O14A 5FZOB 2GAUA 4DMIA 2RS12 4FBFA 3CLPA 1N47A 3BTZA 1MR5A 4JQTA 2QKDA 4HSJA 3IBMA 1OPMA 2VE1A 1XSRA 1W8TA 5C4WC 1BXHA 3IZOA 4M3CA 5CKQA 4Y22B 3EXUA 1ZYBA 1Q8OA 5CB7A 3TEWA 3MGUA 2PELA 3ZIXA 3W58A 4BQYA 1PM4A 3IMNA 4AEDA 1F8VA 3A4UA 2QDNA 2WSUA 3RGBA 3AKQA 4Q0VA 4P08A 1ZRRA 4HSLA 4OI1A 1OLRA 1W0NA 3T2QA 2WZR3 5C3SA 1FPN2 5F9TA 2VUDA 2GU9A 3H1WA 4UBHA 2DYCA 4JGZC 2YBPA 4YPJA 3TEXA 4BA6A 5FPXA 1VB4A 3AMNA 5JIAA 3OGSA 5GLUA 2VZVA 2E6VA 2XBO1 4YVSA 4UWDA 3VD5A 2WO1A 3L2HA 5A6QA 2J1RA 1AF9A 4W6WA 3ZX7A 3I59B 2VZOA 2VW0A 1IPJA 2EF6A 5K8SA 3ES4A 4BXFA 2YC2A 4BOWA 3DV8A 1AYN3 2E7QA 1YLLA 2JXAA 4C1XA 2ID4A 2RS52 2AACA 5FY4A 1CAVA 4WM8C 5DN2A 3SISA 4QHZA 1AZDA 1LU1A 4HN0A 1C5HA 3WG4A 1WCUA 1NY71 5LBCA 5DMYA 3B5LB 3AMMA 5KXCA 4BIFA 4IE0A 3SH3A 3WDYA 3RZHA 1RUJ3 1MQTA 3I2GA 4O9EA 4UOJA 1J84A 1CAWA 2QJVA 4FQZA 4TSVA 2UURA 5GJ6A 2JX9A 4YZ3A 1YFXA 3J26N 2TNFA 1IZ3A 1Q3EA 4GQ7A 5FQ0A 1CAUA 4KWJA 5I93A 3WG1A 2WJSA 2YUEA 1GZTA 1O4TA 1WW6A 5KHGA 5FY0A 4L99A 4XCAA 4LHLA 4ASLA 3V0AA 1BCXA 1QQP3 5K0UA 3ZKUA 2VVEA 3UKVA 5T5LA 2PYTA 2A6ZA 4QD2A 4Q27A 3WDTA 5DPNA 1OXCA 1UW8A 2ERFA 4CDXA 1C4RA 3VHOA 1PGL1 3KV6A 3MDPA 5HXVA 2WZ8A 5FWEA 1VAVA 3N3HA 2JD4A 1O91A 1VMHA 2E63A 2LALA 4QKDA 4TYSA 1JYTA 4QM9A 4JTOA 5B4NA 1H6YA 1XE8A 3EO6A 4HVOA 1JMUB 5L7OB 4TZDA 2ZGKA 2BOJA 1UY1A 4R9DA 2EAKA 2D6MA 1J83A 3IPVA 3VZKA 4G3YC 2AH2A 4QX5A 1W04A 2QQWA 4XZUG 5E16A 3M3IA 4PDWB 3WDXA 4Z92B 1RL3A 2UY8A 4IGOA 5FMBA 1UD1A 1PO13 4DOUA 3PUIA 3ILNA 1CPNA 1F2NA 2J7MA 4N53C 3RYPA 1W2NA 2PMWB 2JG9B 1RUF2 5BV6A 4CPBD 1LCLA 1R083 4LKEA 3WF4A 2CWSA 3N9PA 4NAMA 1QHDA 1OBNA 3BOWA 4ORFA 4UFJA 3KVBA 1WKYA 3BTYA 1F15A 3UNPA 1ZZ9A 3O0WA 2HEYF 2JG8B 1B35A 5FY8A 1PO22 5KC5A 3ZO0B 2W47A 2TBVA 3GZUC 1ASJ3 4Q0QA 3R6SA 4FPJA 5I0TA 1ZRDA 3P3PA 2O1QA 3T30A 2DBIA 3UGFA 1UZZA 3WQBA 4PI2A 1OH3A 2E7TA 4AVSA 4IEYA 4YGCA 3WF2A 4LO7A 3WV6A 5H9PA 4QX0A 5D8AB 2DTWA 3OCPA 5A33A 2PAMA 4QKBA 5FXZA 5FZHA 2X10A 2H0BA 3LDBA 4B7EA 5GM0A 3C7HA 4OHZA 4IEOA 1FXZA 4LLFA 2RDQA 3VDDC 1VBC1 4RFT0 2RS33 3ZYGA 1S2BA 1REFA 2WWUA 4KGGA 4EN0A 2WO3A 1AR83 5A7QA 3E6CC 4ONUA 4L11A 5KWRA 4DUXA 2ZGOA 3GHNA 3AL6A 1S1AA 2ET1A 1QQP1 1RUC3 4INDA 1JZ5A 4Y20B 1TQ5A 1UZ0A 1YRZA 5M0TA 4FOVA 1G8WA 3M1HA 1HXS1 4BZ4A 4BLJA 1W0OA 1I5ZA 3O14A 3FHIB 3M3OA 3QOPA 5FJKA 2YPDA 4QXBA 5C9AB 1AYM2 2VBPA 1UY3A 2ZHMA 5LRSA 1UXZA 3AVSA 2B7YA 3RWNA 4UW5A 2G9FA 1US2A 3JBG1 3G7DA 4GZ9A 5KXBA 2RM23 1WD3A 1Q8QA 2V4VA 5E1RA 5JIUA 4AFCA 2JDPA 5KBFA 3J7LA 4WM7C 3DPRC 5A7OA 3GXUA 1U5ZA 1V70A 4M3CF 5F2WA 4AGRA 2QQNA 1NCQB 1VJ2A 3VDCA 1J1TA 1SCSA 2A73B 4Q4Y1 1DQ5A 1JOPA 4NMIA 4QX8A 2OS2A 3ETQA 4META 4RR3B 3RQ0A 1EP0A 4FOYA 4E4ZA 2ZGQA 1AR73 1LHNA 2WWSA 2Z69A 1IKQA 2A6XA 2WNEA 4IE5A 4J1WA 3M7AA 5LASA 3VHPA 1JYWA 4NHXA 2Q4SA 4A7YA 4AGVA 4HK9A 5BY5A 2W39A 2XUMA 1QH6A 1LESA 3PTRB 1R081 3ZFFA 2LS6A 4IGPA 4JKLA 3TBDA 3VN4A 2W95A 1W2TA 1ND3A 4NWWA 2FZ1A 4DIQA 5ACA2 3R4SA 1ENXA 1GP5A 3CF6E 2IFWA 2ZGRA 4L97A 4W6XA 4XAEA 4DZGA 1PZ7A 4EZ4A 2XKPA 2HWC1 5I91A 4EROA 4ISRA 2VMIA 2WNVA 3MW3A 4XXPA 2QFEA 3EHKA 3AB0A 1US3A 4K8RB 1PGSA 4RD7A 1S0BA 4XHXA 3M3CA 5F7UA 3T2TA 2XHNA 1QJX1 4FTEA 4WVWA 3BN6A 1Q56A 3N9MA 2NYYA 4YVWB 5GLTA 2RR12 4C91A 2XDVA 4D3WA 1EPZA 1Z78A 2I45A 2J1AA 1AX2A 1H8TC 2RS31 3KQ4B 5FCCA 4YW3A 2BP6A 5DUUA 1IG3A 4QPGC 5FZBA 3ECQA 2YC0A 3PU3A 3POFA 1GWKA 3BU0A 4LO4B 1RUC1 3P5BA 2ZABA 1V9U1 2CV6A 1MZ6A 3NJXA 1IGOA 1OQDA 4M4PA 4XETA 5T5JA 3WLUA 3D8CA 2QTWB 3LEGA 1GQGA 1O8PA 3IIAA 4RHV2 4BU2A 4JV4A 5K9YA 5CG8A 3K4AA 2V09A 4TLFA 4XJUA 3ZFEC 1ULEA 2VNRA 2WFF2 5FKCA 1ODNA 5JDBA 1U5YA 1Z7S3 2PLV2 3EB7A 5FJHA 2J1SA 5C3RA 4RYDA 3KS7A 1SZBA 1VRH2 4AVTA 1MS1A 3PLQA 1LOAA 3FUOA 2BQPA 4OZXA 1WMEA 4LUMA 1H8VA 5F5IA 5FKBA 1POQA 2D44A 1SMVA 5A7SA 4GALA 4EZHA 4F7ZA 1XSQA 3H9AA 2FDIA 4OMCA 2R071 3RVHA 4BH9A 1GSLA 3Q8FA 5FZAA 1POV3 3VBHC 5CNAA 4H14A 4XUOA 2ZMKA 2EICA 1WUVA 3GNEA 3HNMA 3B7MA 3NWKA 4K8FA 3RFRA 4D7SA 5BYNA 5AVAA 4CU8A 1YYNA 3VZLA 5FO8B 1GMMA 1RUD2 5BXXA 4NPRA 4EN7B 2Q30A 2XQXA 1D4VB 3INAA 2BBAA 1OUSA 2E9QA 3ACLA 3N9QA 2BZDA 1HKDA 2DDUA 4GKXA 2JKXA 1VPHA 1VAMA 2QZ2A 4QPWA 5EHDA 4OUEA 3AC0A 2H6CA 1RGSA 3AMHA 1TZOA 3E6BA 3IAPA 3M2MA 2EXIA 4I0AA 4Y26A 3H3ZA 4UXAA 1I9RA 4K1YA 2XG3A 4YW1A 1LECA 4Q4W2 1VMJA 3BB6A 1HRV1 1PGW2 2J22A 4D6SA 5BNPB 2PHFA 3MPPG 3VBSB 3PDQA 1Q43A 1SEFA 1LOFA 1VBD3 4LE3A 4B7KA 2R7EB 3LF7A 4L2NA 4UF0B 4YNIA 1HDKA 3H8XA 4QQLA 3RJ2X 2YGMA 1ZRCA 3JXSA 4AEKA 2IXHA 3NRUA 4P14A 3O1OA 1WW5A 3B02A 1UY4A 3H7JA 1JZ6A 1ZVFA 4PF5A 5EV7A 3VBFA 1CZTA 4ZXEA 4WBBA 1S0GA 5F37A 4GMP3 1K5JA 1TNFA 4GJZA 1VBA2 1V00A 1AR63 1QJEA 1PIV3 2W92A 1PVC3 1NA1B 4LA3A 4NJ4A 3ZXLA 3LDRA 3NJVA 2ZBJA 1YFUA 3AKSA 5JZGA 1ZBE1 2VOVA 3HN1A 3UESA 2E31A 2B8MA 1E5IA 1UX6A 2AZ5A 1CR7A 5F39A 3DKWA 5ISLA 1LGBA 1BBT3 3WZ1A 3ZYFA 2BNNA 3USUA 5SV5A 2DUPA 1YQCA 3WUCA 1V6LA 2R16A 1KD7A 5LBEA 4C0BA 1C8M3 3WNXA 5SV8A 4E4DX 1K5MA 2CHHA 2UWAA 2VJXA 5FPLA 3HWJA 4QMAA 4M3CB 2ZTNA 3TN93 3LOBA 3KZ4C 5FZ6A 2UYBA 1LOGA 1F9KA 4TWTA 1AXKA 2NMNA 4AEDB 4EYUA 4UW6A 1UCXA 4BB3A 2R042 5IAVA 1X8MA 4BCUA 3LOIA 2WZPP 2EVXA 1AJOA 1YI7A 3DECA 4R52A 1NG0A 1POV1 3C2UA 3VKNA 4BWOA 1O7FA 2JDAA 3AK0A 5EYYA 5FZLA 2E32A 4CCLA 5EPAA 5L73A 3AX4A 3K4ZA 2BWCA 2VGDA 2GC3A 1GR3A 1RUH1 3HVDA 4LBNA 4OQ9A 1BK0A 3OF1A 2OA2A 1YQ6A 4JKKA 4YVSB 5E89A 5LK7B 4AZZA 2MEV3 1QF3A 4LUKA 2AGSA 4Y33A 4NVPA 3C7FA 4YFZA 1F4AA 2J1EA 3FFQA 1SDWA 3PMEA 1SCRA 2D5HA 2VQUA 2ORXA 3T4HB 1V6OA 3L9JT 3A21A 5F3EA 5IFTA 4AQ6A 2PFWA 2WRAA 1G9BA 1YXWA 4P9GA 3T08A 4MGZE 5J1XA 3E5UA 1CAVB 2RMU1 1QNWA 1W8WA 4E8DA 2ZXQA 1RITA 2G19A 3PJYA 1YFYA 3OYWA 3JD71 2XVKA 3WD5A 4FO9A 2Z79A 5FLIA 3JQWA 1PMIA 2V4AA 3ZXKA 5KHIA 5L7OC 3QH7A 5KXEA 1MQTB 2BUKA 3U14A 3VDAA 2LW8A 1AX1A 2YPJA 1CAWB 2R49A 5A1LA 5E88A 4QKNA 2HYXA 4NIAA 4OMDA 4K3UA 4PDWC 5FQ0B 2VMDA 1CAUB 5FZ7A 5GKAC 4Q1RA 5A70A 5T50A 1RVF3 1R091 3LEMA 1O3RA 1PVXA 2JB8A 1RTVA 3WW2A 1Y3TA 3MV11 4YW7A 3AVRA 5K0UB 1H2KA 2JG9C 5GLWA 2HYKA 1XNDA 2BGPA 3I7DA 3LAGA 4ES9A 3ES1A 4P9WA 2E33A 4CDXB 4IEXA 4XILA 3MLLA 4AG4A 4AVCA 2JG8C 4CDQA 1CESA 5FZMA 4HONA 4NWVA 4QAWA 3VZMA 3QH6A 2RJLA 5JR2A 3K75B 1EAH2 4W6YA 1W3XA 3LSEA 1W99A 2RS11 2ZA9A 4CP2A 4AFAA 1H6XA 3KV9A 4FQ4A 2YFZA 4UI9L 1NUKA 1QJX2 4XFCA 5APAA 5FOJB 3BTXA 2WS92 5ABJA 3IPVB 2P1BA 4AQTA 4DO0A 4N7IA 2Q1ZB 3MLKA 1HX6A 1ZBA3 3KCYA 3FJSA 1J3PA 1OKOA 1V9U2 1PX4A 5JPMB 3GJAA 1DYOA 5JOZA 2QQMA 2F6BA 3OEAA 4LBLA 2P17A 3WCSA 3WDUA 1DHKB 3GZEA 2Y26A 1FPN1 1UWWA 5FBZA 2EIDA 2PTMA 5DAQA 1SLIA 2JDNA 1B35B 4KL1A 3KCCA 3PIJA 4OCTA 4BK5A 2ZMNA 1VBE2 2OIIA 3H7YA 4I0BA 1MEC1 5FZIA 3CEWA 1XPWA 1RUF3 1AL22 5LRRA 4CA9A 1Q8PA 4LE4A 2R072 2WYSA 4AAPA 1NCRA 2IXJA 4UFMA 5A33B 2Y60A 1NCQC 5DUVA 4RR3C 2RS51 3KT4A 1COV2 2OVUA 2NN8A 4I2OA 4LQRA 3T4VA 5AFEA 3HT1A 3FFZA 3W5MA 3DYOA 1ZA7A 3ACGA 3MI8A 5DUWA 3S6PA 3I49A 5LBBA 2QNKA 2RJ2A 5CFCC 1AHSA 1QJU1 4R8HA 2BW8A 3SCGA 3AZWA 4A4AA 1PNGA 2VUJA 4ZONA 5FO7B 3SMHA 4QU2A 5ANQA 5AVPA 3ZYPA 2Y8KA 1OSGA 2AEYA 3RZJA 5JOYA 1I6XA 4A44A 3WINE 2HJIA 2G4IA 1G9FA 1HV0A 1F35A 1I5PA 1YNAA 2BFUL 3AZXA 1NLSA 3LB9A 3NO8A 2NM1A 1F4HA 1RMU2 2TEPA 1JW6A 1ULCA 1FX5A 1LHOA 1HB3A 3NV4A 2Y38A 2VD7A 4OZOA 3OUJA 5FPZA 1CX4A 2X05A 5BNNA 2DUQA 3NNMA 2ILMA 1MZEA 2X29A 3ZXJA 2ZKLA 3TEYA 4P02B 1XXNA 3THTA 1ODMA 5A6YA 4M0HA 2EIGA 5HCHA 4LKFA 1OF4A 4KWUA 3OBAA 1RXFA 5DZGA 4CDWA 4YVWC 1AYM3 2HWF3 1YIFA 1YJLA 1UIJA 1YQ5A 3KV5A 4CZSA 2L9LA 1ONAA 1NXMA 1S0JA 2BTVC 5GLVA 1QWRA 3VBUA 3MF9A 3WX5A 1ZBE2 2HWD2 4QU1A 3ZFFB 3X29B 3A22A 3LDKA 1DIWA 1OA3A 2DU1A 3RZGA 1PZ9A 1FNYA 1ND3B 4UFHA 4XVHA 3WUDA 4QM8A 1DGRA 2WQZC 1JXNA 4O7XA 1WCQA 4OFGA 1JYIA 4KWKA 4QT6A 4N43A 4AGGA 4MHUA 3VL9A 2GALA 3MF6A 2WLQA 2JENA 5JI7A 3DXTA 5JCTA 1RUF1 3I2HA 4LKSA 3OGJA 5EZWA 1UYZA 4E27A 1SFPA 2HLEA 1ENSA 3OPZA 4Y5SA 3A7QA 4UFIA 3MV01 1X9TA 2IXLA 3C8XA 1VE0A 4Q29A 1PO21 4FPHA 3LFIA 3GZAA 5F6KA 3VBRA 1O59A 4CYDA 5IVVA 3H8RA 2OZ6A 3OPWA 2Q8EA 1UL9A 3ZXFA 4YLZA 3OBRA 3N7KA 2W87A 2MNGA 4QHBA 4FTSA 2YC4A 4LTAA 3WNMA 1G9AA 1PZ8A 3BGAA 5K7PA 2WKKA 4MHRA 2V72A 2JICA 3Q8CA 2JJ6A 2EXHA 4PLOA 1SG3A 4PHZA 2R1DA 2QQVA 1C1FA 3NQHA 4Z8BA 1JYNA 1CAXA 3K77A 1EYBA 2VR4A 5BUVA 3RI8A 4KG8A 5FYIA 1OD5A 4N9HA 2WL1A 2A3YA 2G9GA 5FYYA 5FK7A 4Z2WA 4DXRA 5BNPC 4RGGA 2XBO3 3APBA 3PHMA 4IEPA 5A3WA 4ZS2A 4Y5TA 2DVAA 2HWB2 4Y24A 3VBSC 4CCJA 3GGLA 4M0NA 1AVBA 2VAUA 4JC1A 2BPA2 3ZYHA 1AYM1 2WLPA 1Y7BA 5KHHA 2D93A 5IVEA 2BGCA 1VRH3 4V2VA 4LO5B 1ACCA 1R092 3KHCA 1S4CA 5LEKA 2J42A 2IXIA 5F2SA 1QY4A 3MEPA 1CPMA 1HJGA 4UFLA 1X33A 2AEZA 1OMIA 1O8SA 2J1TA 3BALA 3KT1A 4RQPA 3KM5A 4FPGA 1AR92 1VAKA 3RWKX 4XUPA 2WABA 2JDMA 4YM2A 2VCMA 2ZX4A 2TUNA 1D0GA 4Y4YA 1MS3A 2KA3A 4HMZA 3O5SA 4HPKA 1DGWX 4HBNA 3Q8AA 1CIYA 4CEWA 4FP2A 5J96B 2ZAHA 3FMGA 5FYHA 4XZPA 4CUCA 4Z2AA 5BNQA 3CJIA 1VLNA 4JHTA 1PK6C 5F3GA 5ACA1 2VBDA 4H55A 3VGIA 5DDJ2 3VBFB 5EP9A 2IXCA 2NQYA 3B93A 4W50A 3ZYBA 1DBNA 1UMHA 3HBZA 1W8ZA 3A0KA 1W05A 2Y6KA 4XF3A 5JZGB 2C0ZA 3WT3A 4Q4V2 4HETA 4P5HA 2SLIA 2OQ6A 3ZFGA 3I2OA 5LK5A 4YVSC 3UETA 5FBJA 4CDUA 3USUB 3IDCB 2N7GA 4RS5A 2RR11 4HXCA 4LK6A 2YYOA 5DAPA 5FXWA 3AKPA 3ZSLA 4J25A 1K5MB 1DG6A 2VW1A 4Y1XA 1KS5A 3KWVA 3J4UH 4GKYA 5I8TA 1W90A 4A6OA 1UMIA 4H3WA 3WW3A 2WSVA 3ILFA 1MEC2 3AFKA 3BIEA 1JS9A 4JHZA 1VB2A 3PMSA 4XF9A 4XIKA 1ND2C 3AFGA 5FZFA 5C33A 1ZNPA 3U0ZA 2EAAA 4RHV1 1LAJA 4MH0E 1XC6A 3AZVA 3DEMA 1LOCA 4DEVA 2YROA 2WFF1 3AP5A 4MADA 4AL9A 1RUG2 2Y6FA 4I09A 2JE7A 2DVFA 3WQ7A 5J36A 1MQTC 2PLV1 3BVCA 3DYMA 4IEVA 4Y1YA 1VRH1 1EUUA 1HB4A 4PIXA 5LA1A 2R1BA 3MHZA 3WR0A 3OG2A 1QH7A 2EXJA 4GAZA 4MGTA 1QJU2 1UZVA 2ZJCA 4CCMA 2R043 1W9TA 3CO2A 5FYMA 2OUJA 5K0UC 2I74A 4U36A 2Z5WA 5FYUA 3U10A 3I3QA 3UL2A 2FZ2A 1OH4A 3J7NA 4OULA 4AQSA 4CDXC 2WR9A 1VBC3 3LZZA 5FMCA 4KU7A 3R4DB 2BVBA 1RUD1 1ENQA 5FUNA 3VKLA 2VZUA 5CEHA 1S0EA 2K0GA 3OYWB 1LOEA 2D5FA 3EBRA 5LW9A 1APNA 1REDA 2QQIA 2VQAA 1XU2A 1HXS3 3KF3A 1GOFA 4QB2A 2CWMA 1WMXA 1NKGA 1WCSA 3S5AA 2YXSA 3VBOC 3UGGA 1A78A 1BEV2 4Q4W1 3GBWA 1OI6A 2GC1A 3AYCA 1OQEA 1PGW1 1U5IA 2JB4A 4AHZA 4LBJA 2GDFA 5A3LA 2ADEA 2QQUA 3JBG3 1SBFA 2BYVE 1ZM1A 2ZAAA 5CKMA 1UPIA 1IKPA 2UY9A 4Q26A 3SEEA 2VNVA 4COVA 4AFDA 4YW4A 2Q1FA 1LGCA 5HXMA 1HJFA 1E5RA 4XUTA 1U0AA 3PVOA 4CTEA 5J09A 3H42B 3HMYA 1KFUL 4Q4Y3 4ZZ5A 2WNUC 5GZEA 2GC2A 2VO5A 1VBA1 4WVMA 4B29A 4CP9A 3O0XA 3B01A 4D8MA 3AL5A 2XWBB 4LBQA 4AEJA 4CDQB 5L36A 1ZZCA 2VG9A 4S2FA 2GMEA 2ZEWA 4GULA 3W9AA 4A3XA 1KFXL 2DTYA 1JODA 3UJOA 4ZU7A 3OD0A 4GJYA 3TB0A 2IVIB 4DS0A 1XYPA 3K3OA 2VCCA 1D0HA 3KSCA 3FUQA 4CXYA 1DQ2A 4COZA 2WYFA 1X50A 5A3MA 4QPIC 3B3QE 4GXLA 3ZN4A 1YO8A 5EQUA 5ABJB 1W8HA 4GH4A 1NLQA 2YMZA 3I8TA 2VTXA 4Q8LA 2XGXA 2XWJB 2HWC3 4K1ZA 2DFBA 2GNBA 4B4QA 1AL0G 1CN1A 1QJY1 1GBGA 1SLTA 3E5XA 2R041 3TRSB 4DXZA 3BCWA 5IVFA 4BQXA 3T3YA 4E4SA 4TTGA 3AJYA 4M00A 2WN3A 1QJX3 2ZS6B 2YGLA 1N3PA 3HBKA 2W1QA 3UYJA 5CG9A 4XBLA 2GNMA 4ASMB 4QX3A 3ST7A 4Q0UA 4NRQA 4NHKA 5E6HA 1J59A 2Q5TA 4N53A 1RXGA 3KVAA 1W6MA 4PQQA 3AJZA 2IUWA 3UKTA 3OTFA 1WWYA 2LM3A 4IV1A 2A71A 1V9U3 1PNFA 1MVEA 2JIJA 4I3PA 5GALA 2BNMA 2Z42A 3IIIA 2D6PA 3VKOA 2GNTA 2VQTA 1NCRB 2MHFA 3BIWE 2VMEA 1B09A 1RHI2 3NKTA 4BQ1A 4DB5A 3MW4A 1NYWA 4OHWA 3ZIWA 2WIIB 2VW2A 2XLGA 5FFOC 3WP3A 3GBFA 2ZX2A 3ZKYA 4NHMA 4PLMA 3RYRA 3LKJA 5JXJA 2HH9A 2G9ZA 3N7LA 5FYVA 4BM8A 2JDYA 1AL23 3WNLA 2P3IA 5J3UA 5FO9B 1DGWA 2GP5A 2R073 4XDQA 1VIWB 5A1FA 3HIFA 3I3DA 1ND3C 3OUHA 3VDDA 1TME2 3IKWA 4BDVB 3SH5A 5F6LB 4BQ2A 1RUOA 1VR3A 1LJ7A 1H9PA 2JDHA 1WLTA 4H2AA 1G9CA 1EY2A 2KR2A 4Y4RA 3MICA 1HB1A 3ME2A 4KWLA 2GMMA 5FP3A 2WFPA 3HD8B 4PJYA 4UYBA 1QDCA 1IS4A 2JEMA 2YG0A 3MFCA 3OSDA 3VKMA 2PAKA 2V5YA 4NRPA 4DNYA 4XUNA 4NAOA 4HVRA 4DRRA 1LHWA 4RGKA 1A8MA 2XHKA 4LR4A 4XFHA 2ZEYA 3ZSKA 2ZACA 4CDWB 3POWA 2BFUS 3CBNA 2VC9A 1D4M2 2R32A 5B4XA 2GC0A 2VTFA 1HRV3 1R1A1 2CYFA 3VBUB 1EAH1 1GYKA 3Q9OA 5LWBA 3N4MA 4XXAA 1HRI2 4QDQA 1WA6X 4P5YA 1Q8SA 1CZVA 1UOFA 3PUSA 5A80A 5FWJA 1WZXA 5DG2A 1JH5A 2Q0AA 3U78A 2WS91 1HN1A 4JZRA 4O9GA 3UK9A 1ZRIA 4JX0A 1UKRA 1WA4A 5LA0A 1D7PM 3WF0A 1GZCA 1JU4A 5DAXA 4GMP0 2Y6JA 4X6RB 4XF4A 1NXD1 4XF1A 4N43B 4YG0A 4UW4A 3U07A 3F95A 3ACFA 1ZBE3 3SH4A 5JAXA 2HWD3 2DCKA 2O8QA 2ZGTA 3DCQA 1MZFA 3UT0A 4B4RA 1FV2A 3FC0A 3SXWA 2W1UA 2FD8A 5FP9A 5CZKA 4KBZA 1OOPA 2WQ4A 2X8KA 2XVLA 1C3HA 3HT2A 4XMIA 1JZ3A 1LEMA 1RB8G 4CCOA 1AXZA 5T5OA 3VBRB 1DP0A 4LOSA 2CAUA 1IOAA 1VBE1 4NPMA 5CBLA 3ZMNA 2K9ZA 3LEIA 2H0VA 3SCHA 5JUVA 4MXWA 1NZCA 1OA4A 3K46A 5C70A 1URXA 1AL21 2ZGMA 4MSVA 4NE9A 1BLZA 3DXUA 3M8LA 4COYA 1HQNA 4HANA 1RUI2 3N9NA 2R30A 2VVFA 2B42B 1UX7A 1CAXB 3WF3A 5FOBB 1COV1 3OD4A 4QPGA 2R0FA 3VD7A 3RSJA 2ZOEB 1VRBA 2A70A 1RUH3 2PQQA 2VQ0A 4PI0A 5LY2A 3THPA 4YGBA 4P9IA 5LA2A 3RRDA 1GANA 4CU7A 1IQDC 2IZWA 1QDOA 1G7YA 3T1MA 1YC61 2DBNA 1LOFC 4I3GA 4Q4X2 2P4EA 4XYXA 2JDKA 2ENRA 4TN7A 3NAPA 2WO7A 2CY6A 5C3QA 3JZVA 3NV2A 3MUY1 3VBFC 3AZYA 2UYAA 3KQRA 4E4HA 5TSWA 1YJKA 2WUHA 1RMU1 2RMU3 4R4ZA 2P3YA 5DAWA 2IVJA 3WNPA 3N36A 1ULFA 2C5DA 1BMV1 1CGPA 5G05L 5JZGC 1RYYA 1EV12 2WN2A 2XLAA 1XBFA 1W8NA 3I2KA 3JD73 4IDZA 1M06G 3IN9A 2BEOA 3LIGA 3MIHA 1L7RA 2XXZA 4RSUA 1QU0A 3FL7A 3NJYA 5FMOL 4CRQA 4RQPB 2DVGA 4JGYA 4CEYA 2FDGA 3ZXGA 2O0OA 3VZJA 4A2UA 1K5MC 4LHSA 4IQPA 4V1PA 4YG6A 2HWD1 4JDOA 1W8OA 5LBFA 1BZWA 4HPKB 1DCSA 1R093 4QGNA 4QX7A 1X8EA 2P37A 3OUIA 4AI0A 2CU5A 4CEWB 4CCDA 3CL1A 4IERA 1GKBA 1N3QA 2W68A 5FZOA 3KHBA 3CJIB 3LPFA 3K51A 3LQCA 2HEVF 1MS5A 2WZR2 1OVPA 3QACA 1AR93 2YZ4A 1JN2P 1RJ7A 1JYCA 1YIPA 1YUDA 4URTA 3ZPOA 4CXWA 3ITQA 3NJZA 2DCJA 1GNZA 5FV3A 1JOBA 3DN7A 1QJY2 1V6JA 3NVCA 3R0RA 5ANNA 2RS13 3ZFGB 4ET7A 3IT8A 3GHMA 3FBYA 4RS5B 3C7GA 1ZREA 4QGMA 2ZGPA 4ZZ8A 5IYYA 5A32A 1AYN2 5KR7A 4DY3A 1SLBA 1ULPA 3BPZA 3WNKA 4AFMA 4BHPA 2ZZQA 3WDVA 4FFHA 2BBVA 2VOXA 3BTAA 1C28A 4LBQD 3ZPYA 3POSA 3ZR6A 5JXIA 3PUHA 3ELNA 4X8NA 3MBWA 1LNSA 4XCBA 2JD9A 5FZCA 3AKRA 1FPN3 1RUJ2 2B9UA 3OBTA 5FRAA 4ITCA 3FX3A 4KBBA 1XJAA 2BERA 3LA7A 2CAVA 4PBPA 3ZXEA 5T3NA 2D3PA 3WY6A 1CWPA 2YHJA 1BK1A 1WBFA 2Y34A 1UY2A 3Q8BA 1MEC3 2HWB1 3LA3A 3ATGA 1NX9A 5J7MA 4OI4A 3SKJE 4QB6A 2J1UA 2WZEA 4XHBA 2BV4A 4Q0PA 2Q8OA 1A3KA 1QMJA 1ENRA 1XU1A 1Z0HA 3T2OA 3ILRA 4HOOA 4Q5OA 3RYKA 1SPPA 2BU9A 3MW2A 2RS53 1CJDA 4JQRA 1FOD2 1L7QA 3ALQA 2LROA 2P3JA 5FZ4A 4C8DA 4XJZA 4CDQC 3R4UA 2R062 3N35A 4XC9A 3U75A 4BMEA 2C9AA 1QJU3 1JTZX 3U1XA 4FAGA 1IS3A 3V0AB 1UU5A 1AUYA 3WP6A 3RZLA 2YBKA 3VHNA 2QQOA 3PVNA 4QXHA 3ZSMA 3AYAA 3AMQA 4KG0A 4W8JA 2DCYA 1AR91 4TXWA 5F3IA 1IHMA 2GSYA 2EALA 5L9BA 4F3JA 3TAYA 1OPOA 4A7ZA 5ABJC 2AREA 1EUTA 3WNNA 1R1A2 4FCAA 1PO12 2VPVA 3ASIA 5EYXA 2DF7A 1KITA 4XJ9A 1KJLA 5T52A 4D7TA 4QQPA 3ZYJB 4FPKA 4LOTA 2QVSB 4IV3A 4MO3M 5GLZA 5DDJ1 3CIHA 5D8AC 4AI1A 3GDBA 4PBOA 2JIGA 4WVMB 4CP9B 1BEV3 4XBQA 3RMYA 3ZVXA 3KCXA 4IE6A 5FPAA 3O0VA 4LBQB 1DQ4A 1ASJ2 5D21A 4Z1VA 5IFPA 3VD3A 1LEDA 4Q4V1 1VMFA 2D6KA 3AYEA 1MZ5A 4DFSA 1LKNA 4BLIA 5A3NA 5JI9A 4ZKTB 2ZHKA 3GCWA 4YWAA 2RVAA 5FLHA 3T0DA 5FUPA 4PCRA 3U11A 4X6QB 4NRMA 4AW7A 1I3HA 1QGLA 1ULDA 5FPVA 3M3QA 1NCRC 3AM2A 3IDEA 5G04L 5BNOA 4GH4B 5C9AC 2CDOA 2XJVA 4B8EA 1AR82 1S2KA 2ZKNA 3T0AA 1DGRN 5CYYA 4Q1PA 5FDBA 4IE4A 3TOJA 1FNZA 4Q8KA 5H9RA 2DFCA 4LHKA 1G86A 2HBTA 4YGDA 4LBOA 4ISQA 1TG7A 1RUG1 1JU3A 1WW7A 3P6BA 1UOGA 4R9CA 1PO23 3W59A 2CL2A 2A6YA 3G6JB 3OEBA 3HOBA 4FFIA 4LEJA 3VD9A 1JHJA 2GN3A 2ZGLA 4N53B 1W6MB 4HK8A 3HQRA 4CCEA 1YCIA 4IV1B 4QX1A 1S0CA 4KNCA 1OF3A 4AEMA 4OQ8A 2C24A 4XABA 2K2SA 2VZQA 1W9YA 4AI2A 4CSWA 3M70A 4ARYA 3ABZA 4OUMA 4G9SB 1BMV2 4KMQA 3MO4A 2P6HA 3P3NA 1PMHX 4FPEA 1X9PA 4K9SA 1MS8A 5EJ3A 4Y1UA 1GZWA 1AR72 1QIQA 1RC6A 3ACIA 4G4FA 5F32A 2ATFA 2XQRA 4MX3A 1UNBA 2OX0A 3AYDA 5FYSA 3AKTA 5F5CA 3VBUC 2XPJA 3CDZB 3I4IA 4D94A 1SLLA 3NNJA 4MOAA 4MXVA 1H1AA 2HWE1 4HLTA 4Y3OA 4M4RA 2XKOA 2ZCWA 5AC91 4CE8A 4MZUA 1W8FA 2WT1A 4RN5A 1RUE1 3M4FA 3WW4A 4EN9B 1BEV1 4LT5A 1CZSA 4EWAA 2B5HA 3VDDB 3N9LA 3ZOIA 1KQRA 3TWIA 4AHYA 4COWA 4LA2A 2D40A 1GICA 4MGQA 1LB2A 5D2AA 4N43C 5CFCA 3WHUA 3L2YA 5CIRA 5CFDA 3EMRA 4NOTA 1SLAA 2DURA 4DUVA 2VM9A 4W65A 4YGEA 2VECA 2W94A 3HNYM 2WA3A 1UQXA 2C4XA 1IPSA 1BYHA 1VBB2 2W52A 3D0SA 2FMYA 4OVEA 3U4XA 3V0BA 2ARBA 1TME3 2XL9A 4BQ4A 4FPLA 4B1LA 3VBRC 2CGPA 5FAXA 2WNVB 4JDMA 3CU7A 5T5PA 2GH2A 4MV2A 4QQ2A 3URFA 4FXKB 5JSOA 3I97A 1JYXA 1LODA 2EIEA 2VZPA 3ACHA 4ZPIA 1BKZA 4P9XA 5ACA3 1XNBA 2ARAA 4I0WB 4JTNA 3IWZA 3WW1A 2KM2A 2PHWA 1DYPA 2VZ3A 1CD3G 3MIFA 1MACA 1Z7S2 2UWCA 4XOGA 1V0AA 5DXDA 1Y9MA 2XL7A 2VL4A 4NROA 5GZFA 2WNOA 1YEWA 3KF5A 4IESA 4DINB 1F31A 1UOJA 2PQSA 1JOJA 4FAHA 5EIYB 3NMBA 4NHLA 5IWFA 2CGNA 1UO9A 4ZXKA 2VUAA 1W6PA 4YYOA 5I0DA 5KHKA 1OOPB 4XFAA 2RR13 1LOBA 1STMA 3LWCA 4NHYA 5FIXA 1UN1A 1V6KA 3B9CA 4YARA 3UKNA 2RJKA 2FHRA 1DF0A 2VUCA 4MYEA 3D3AA 4MXWB 4KI5M 4CCCA 3DL3A 3S30A 1XNTA 4IEUA 3PUAA 1NQJA 5FZ8A 1YFWA 3RNSA 3WG3A 3GF6A 1O3TA 3KMHA 4RHV3 2X53S 2JECA 4EN8B 5JXGA 1UYYA 1WMDA 3J7HA 4LIUA 2WFF3 5J37A 1RHI1 3FN9A 5FMDA 3V56A 1R1ZA 3FWEA 5J48A 3AXDA 2PLV3 4AVVA 4QPGB 2ZGSA 1T2XA 4RQPC 3PURA 4XW3A 1NA1C 2NPIA 2RDNA 2YU2A 1O5LA 1WLDA 3IAQA 5BPXA 1VBD2 5FZGA 1W39A 3J8F2 1CIWA 4CU9A 4YSFA 5EJZB 1TEIA 3SHRA 3V65A 3H3LA 1UAIA 4CEWC 4E2SA 4K20A 1IS6A 3C3VA 3C7EA 3CJIC 3NAPB 4S2GA 4M3CE 1TME1 5L9RA 3QLQA 3VB9A 2BJSA 3ZDSA 3VD4A 4ZU5A 1SBEA 2X5IA 2D7FA 2PHLA 3BYWA 3PVEA 4YG3A 3D4KA 1PIV2 2VH9A 1PVC2 3H0OA 3NV1A 5FY1A 4AOCA 4LBKA 4MG2A 5C8CA 1RUD3 4AAXA 3H50A 1OFNA 5FY5A 1RUNA 2B46X 4UF0A 4AEDC 4JCKA 5IK5A 3HQUA 3KV4A 2FCVA 4Q4X3 2SBAA 4XJ8A 3FHAA 1BBT2 1OURA 1S0IA 4JKMA 4ZU4A 5FREA 3NV3A 3WVJA 1C8M2 3NSTA 1D4M1 4JGYB 3CKHA 1H0BA 4PIZA 4U2AA 3T09A 4Q4W3 4CEYB 2IWGB 4Y1ZA 1RJ8A 4LHNA 4MVTA 3TN92 4BXSV 1HRI1 2VY0A 4NIHA 3MLJA 4QQOA 1A6CA 4GB31 4XUQA 4HL0A 1BHGA 5BNNB 3KB5A 1T6GC 1EV13 3IDBB 1AXYA 3VKFC 2QQJA 1AJKA 2GN7A 5FZ1A 1D2SA 2FMDA 1W6NA 5FMOS 3HEIA 5FPBA 3UGHA 1SBDA 2BOIA 3DGTA 1VALA 2W3JA 3IM0A 3N7JA 4IGQA 4QXKA 5F1RA 1VBA3 2DV9A 2XJRA 1FI2A 1XB9A 2PHUA 1DLCA 4E2GA 1YHFA 5KC6A 1JUHA 3DYPA 4CCKA 4CUAA 4BK4A 5FR3A 3CHXA 1W8UA 1T6BX 4WZFA 4XURA 2MEV2 4FTBA 1PK6A 4ZHNA 2EXKA 5DG1A 2O8OA 2DCTA 2C26A 2ZX1A 4FI9A 4JRAA 2QE3A 3S5QA 5C4WA 3MIDA 1KS4A 4BIOA 1SACA 5A32B 4BE3A 4YRDA 3MYXA 5HI0A 1SFNA 1OVSA 1QJY3 2WC2A 4GWIA 3S7IA 4FFFA 5FXXA 5F8PA 5IK4A 5LZ6A 3ON7A 3THCA 1LULA 1RUI1 2IFRA 3WXPA 4OLLA 5C71A 4QB1A 1JYVA 1G9DA 1PHMA 2H6BA 5JOXA 2GNDA 2W9XA 4JGZA 2VMCA 1NOVA 5HCFA
chains in the Genus database with same CATH topology
1G6NA 4GWNA 2WT2A 2DUOA 5JWPA 2QCSB 5JVVA 4L8QA 4WV8A 4EV0A 3H3UA 5T55A 4K7JA 1H30A 2PN5A 1ND2A 1RVF2 2E51A 4FOQA 4Q4X1 1QXRA 5EFUA 5CADA 2HWE2 3AP9A 4PIYA 5AC92 4A7KA 1BVVA 3M3EA 1RUE2 3JUUA 3OY8A 2HEWF 4WM8A 4CP1A 3O12A 4FPYA 1GQHA 2A3XA 4ATFA 1U12A 1WLCA 3WQ0A 1EV11 1UKGA 4ES8A 3RZZA 1SLCA 4YZ4A 1C8NA 3GZTB 3USSA 4XIOA 1FAYA 4YM0A 4IEZA 5FTTC 1QKQA 2PHXA 3D82A 5C6CA 1B35C 3D6EA 1FOD3 2A6WA 4GH4C 4LO6B 1ZZ7A 1NE6A 3E5QA 1ZBA2 2ZHLA 2XJTA 3OGGA 5GZDA 2R063 3H8UA 4C0HA 4NO4A 3RG0A 4IV3B 2BVVA 2CGOA 3VBOA 1PM7A 2WZR1 5DZFA 5EWSA 2ZX3A 1F5JA 1A8DA 4FP3A 2UWBA 3KLSA 1R1A3 1EAH3 4Y5Z0 2XLFA 1N1YA 1N3OA 3ZYRA 2ZPXA 3JU9A 5J98B 4IV1C 2WNUA 2WS93 2JKBA 4H7LA 1AYN1 1JUIA 5I0RA 4L92A 5BNOB 1DLLA 1C1LA 2EA7A 3E6DA 1E57A 4KU8A 2AYHA 4WVVA 4AVBA 2RHPA 2VOKA 1BVP1 4R9AA 2QDRA 4XMAA 1ZZ8A 3BODA 4XF0A 2CNAA 4FT8A 4QQHA 1J1LA 4ATEA 3TYJA 3MIGA 4FPOB 4QPIA 1RUJ1 3B94A 2QQPA 3NW4A 1QOOA 2BNOA 4NN0A 4AHWA 1IQAA 1DZQA 2R6QA 2P34A 1YI9A 1VBE3 3ZXDA 1H4GA 5I8SA 5C8WA 1J3QA 1S0FA 2ET7A 4F8AA 4OHXA 1LHVA 4DRVA 1TMF2 4MLOA 2ARXA 4XFGA 4YZ1A 4J1XA 2PHTA 5KHJA 3ZFFC 4AHXA 1DQ0A 3WG2A 1LHUA 3MPBA 1GNHA 2D97A 2AENA 4D7YA 3RI9A 1W6OA 1LENA 5H9QA 1XE7A 1CONA 1FMD2 5I8YA 4XE9A 1COV3 1POV0 1XNKA 4K21A 2HWF2 1FOD1 4FXGB 1GZWB 3QCWA 2W0XA 4JDNA 3B00A 1D2QA 4P9JA 2R061 5CVRA 4BMBA 1Y9QA 2PHDA 4R4XA 1QXJA 3WHTA 2WNVC 3FLTA 4XTMA 3WP4A 4AFBA 3JCIA 4AYUA 3OJBA 1J58A 1QNYA 3VV1A 5L19A 2D3RA 1WLWA 2QZ3A 2PHRA 2GMPA 3S7EA 1PO11 1RMU3 4WM7A 4YZ5A 3DPRA 5GZCA 1H1MA 5CFCB 2IC1A 4GB32 4S2DA 5CFDB 4EN6B 3PVBB 4LO8A 1LRHA 3SNMA 1F5FA 1DDLA 2MPFA 1HW5A 1O4ZA 4XJWA 3JB8A 4UBGA 3V0BB 1OOPC 2Y0OA 2OW4A 3K48A 3ZN6A 4CP0A 4XTPA 1ASJ1 2YY1A 3B9IA 3RJRA 1OHFA 1U5XA 4I30A 4N9IA 3VZOA 3A0NA 3SCFA 1S0DA 3FLRA 1VBB3 1S55A 1N1VA 4YM1A 4M01A 2JE9A 3LCPA 1AR81 3FZ3A 3T1LA 4AVAA 5IK4A 3CNAA 1WMFA 2P3KA 4DPNA 1WCDJ 5IT6A 2XJSA 2XBO2 5FLJA 1Y43B 3FBMA 2A7AA 1W6PB 4XQ4A 1X36A 3VHRA 3GALA 1H8TA 1M4WA 5EXOA 4RA0A 3NAPC 2VU9A 3MZHA 3JB4C 4SLIA 4AF9A 2RM21 1KDMA 3VLBB 3E97A 3VUOA 4Z82A 2Z2SB 1NY72 3ZFEA 5D1IA 4C90A 1X82A 3VZNA 2VXRA 1WBLA 4D69A 1AR71 2VMHA 1ULGA 4JGYC 4CEYC 1HQWA 1HV1A 2HWB3 3H1YA 5LEJA 3PNAA 5I0UA 3ZSJA 5BNNC 1AX0A 4WZCA 3TNQA 2PA7A 3VBHA 3WP5A 5CAZA 2AUYA 1PGL2 1UU4A 1W6QA 4I02A 4R9BA 2X5IB 5IUQA 1W0PA 5CU1A 1ZRFA 3MIEA 2WINB 5C8CB 2ZHNA 3J8F3 4AI3A 1MVQA 2I2SA 1OLQA 4B4PA 4EWDA 4PQ9A 4I01A 1VBB1 3AXEA 5HCAA 1KXGA 3O7OA 1OKQA 1ZZ6A 1GLHA 2D3SA 3RMXA 4XBNA 5JPNB 3SITA 4Y22A 1CJPA 5JOWA 3ZN5A 1H2MA 1UPSA 1UU6A 1MS9A 2NMOA 2OYZA 1WGPA 3POYA 1H2NA 2NLRA 1WW4A 4LLOA 5JMCA 5DZEA 4YZ2A 2R0HA 1Q8VA 2XJUA 4CDUB 1W6NB 5DDJ3 3ZXAC 3KT7A 1LR5A 4H7MA 5HCBA 1KRIA 1Z7S1 3R05A 1HIXA 4HFSA 1REEA 4AXOA 4Q4V3 3D0JA 1DGLA 3ZSEA 1OQ1A 1XNCA 4JRLA 3I59A 4IL7A 1PK6B 4IEQA 4HVQA 3QBQA 2CTVA 2ZZJA 5C4WB 4N7UA 1BJQA 1O3SA 5F5QA 4AWDA 1VBC2 2XJQA 4Y1VA 3QD6A 4IETA 2D6LX 1QJZA 2ES3A 4HKWA 1QQP2 1UZYA 2D6NA 4P9YA 2DCZA 4JVAA 3MFAA 1HXS2 4PLNA 1RUG3 1GFF2 4JGZB 1JHNA 3KGLA 1QXPA 2IXKA 4MGIE 3WOGA 1O4YA 4S2HA 3RDIA 3AP6A 3JBG2 1VBD1 2OUHA 3J8F1 1IPKA 1DU3D 1ND2B 4LBMA 1KDKA 1ZA4A 3LGRA 4C1WA 1ZX5A 2FBEA 2PAEA 4Z07A 4IV3C 4RL7A 2VNGA 4Q2FA 2C1FA 4Q4Y2 3I2DA 4GMP1 4XFIA 4OI2A 3OY8B 4WM8B 1AR61 2Y0IA 1PIV1 1TE1B 1PVC1 4GWMA 3EJKA 2GZWA 3HQXA 5JR7B 1C5IA 3I54A 4BPZA 4F83A 3FLPA 5L7OA 1UF2C 2ZGNA 1R082 3PTYA 4QQOA 4HKOA 1BBT1 3EQEA 2B39A 2HWE3 1KJRA 5AC93 3FE5A 1H2LA 1LU2A 1C57A 2BWAA 2ZX0A 1N1SA 3BU7A 1C8M1 1GZ9A 1V6NA 1RUE3 3AMPA 2ZMLA 2VVDA 4PDWA 2XJPA 4XPVA 2VNOA 3TN91 2OPKA 3SLIA 4IXLA 4FPCA 5BNOC 4QGLA 2HWC2 1UIKA 5KXDA 2VMGA 2JG9A 2LTNA 4AQ2A 4KQ7A 4RGAA 3HAGA 2VULA 5T54A 3WDWA 3S0MA 1XRUA 2Q1MA 3VBOB 3J9SA 1XYNA 2JG8A 4FOWA 3D5OA 3V64A 2RS32 3DUIA 4AI8A 1MS4A 2HKXA 3ROUA 1RUC2 2MEV1 1NQDA 1ZZBA 5D8AA 5JLVA 2WNUB 4FSJA 1DZTA 1RINA 2DWRA 4EJRA 4DY5A 4L9BA 3GYDA 4OHYA 2RM22 2UU8A 1N1TA 4XFFA 1Q5OA 3AP4A 3PJQA 4LNVA 4Y20A 4MUVA 2KXLA 2JDZA 4QPIB 2OZJA 4KGQA 5C9AA 2FQPA 4CDWC 1OFSA 4XFBA 2A6VA 4LULA 1SFYA 2D98A 1MS0A 1I1EA 1L3JA 1RVF1 2A3WA 2NZ9A 4XQDA 2VOWA 1H9WA 3KGZA 1W2UA 5JSRA 1EPWA 5CFDC 4K40A 1QOSA 1NCQA 1W6OB 1CVNA 2XB6C 3WQ1A 2XH6A 4RR3A 1NE4A 1RHI3 4COUA 3LA2A 3RPQA 3TNPB 1FATA 4YFWA 5HBAA 1OA2A 2DVDA 3KD4A 1RIRA 1X7NA 1V6MA 2WA4A 1HRV2 4N90A 4Q0SA 1DYKA 1TMF3 5DUXA 2B45X 2ZGUA 2P2KA 4JAAA 4OUSA 1V6IA 1FMD3 1O3QA 3AP7A 2D6OX 1XYOA 2YV8A 3VL8A 4QPYA 3NL1A 5GZGA 5I0SA 1ZBA1 4WM7B 2QUOA 3GBGA 1FYUA 3DPRB 3CJXA 4KH9A 4AE2A 1BQPA 2YDEA 2AR6A 1LTEA 1YWKA 2LUWA 1NLRA 3HR9A 2E7AA 4WVZA 4YVWA 2DVBA 1D4M3 3ZN6B 1FV3A 1HRI3 3NKGA 2I07B 4AK3A 5AFBA 4GB33 4E9KA 3ZMOA 4XEZA 2ETEA 4XQWA 1DZRA 4OI0A 3H1MA 1XQNA 4J6GA 3LSDA 3B69A 4YW2A 1RUH2 3N7MA 4GIQA 4YW5A 1FT9A 1SQ4A 1H1IA 4MGYE 1H4HA 1WCKA 2A75A 3MIBA 1CQ9A 4HKLA 4SBVA 2DU0A 4EWEA 1H8TB 4HZFA 3UJQA 5B2GB 3WCRA 4IEWA 2XVGA 1TNRA 4HT1T 4UW3A 4GA9A 1TMF1 2X5IC 2RMU2 2WT0A 1LGNA 5C8CC 4K6BA 4NR1A 3ZYIB 4FVVA 1IS5A 3JD72 3ZFEB 1RUI3 4BYYA 5IK7A 3ENRA 1FMD1 4XJAA 1DQ6A 2V73A 1JBCA 1J3RA 1DFQA 1WD4A 5CA6A 2HWF1 1VP6A 3UV9A 3DF0A 3BOPA 1HQLA 5BNPA 3VBSA 5H9SA 1O5UA 4YM3A 4X8PA 1DQ1A 2D43A 4HN1A 2A5ZA 4OHVA 2W08A 3ZFGC 3AZZA 4MGKE 2GH8A 4P9LA 3VBHB 4CDUC 1ALYA 4RS5C 1GV9A 3RS6A 2F4PA 1W6QB 1NA1A 5E8AA 2NP0A 2RE9A 1HLCA 1QOTA 1UMZA 4DQAA 2E53A 4E2QA 3JQXA 4B3NA 4FPFA 4DMIA 2GAUA 2RS12 4FBFA 3CLPA 1N47A 1MR5A 2QKDA 4HSJA 3IBMA 1OPMA 5C4WC 1BXHA 4M3CA 4Y22B 3EXUA 1ZYBA 1Q8OA 5CB7A 3MGUA 2PELA 3ZIXA 3W58A 3IMNA 4AEDA 1F8VA 3A4UA 2QDNA 2WSUA 3AKQA 4Q0VA 1ZRRA 4HSLA 4OI1A 1OLRA 2WZR3 1FPN2 5F9TA 4UBHA 2GU9A 3H1WA 2DYCA 4JGZC 5FPXA 4BA6A 1VB4A 3AMNA 5JIAA 5GLUA 2E6VA 2XBO1 4YVSA 3L2HA 1AF9A 4W6WA 3ZX7A 3I59B 2VW0A 1IPJA 2EF6A 5K8SA 3ES4A 4BOWA 3DV8A 1AYN3 2E7QA 1YLLA 2JXAA 4C1XA 2RS52 1CAVA 4WM8C 3SISA 1AZDA 1LU1A 4HN0A 1C5HA 3WG4A 1NY71 3B5LB 3AMMA 5KXCA 4BIFA 3SH3A 3WDYA 1RUJ3 1MQTA 4O9EA 1CAWA 2QJVA 4FQZA 4TSVA 2UURA 5GJ6A 2JX9A 4YZ3A 1YFXA 3J26N 2TNFA 1IZ3A 1Q3EA 4GQ7A 5FQ0A 1CAUA 4KWJA 5I93A 3WG1A 2WJSA 2YUEA 1O4TA 1WW6A 5KHGA 4L99A 4LHLA 3V0AA 1BCXA 1QQP3 5K0UA 2VVEA 3UKVA 5T5LA 2PYTA 2A6ZA 4QD2A 4Q27A 3WDTA 1UW8A 2ERFA 4CDXA 1C4RA 3VHOA 1PGL1 3MDPA 5HXVA 1VAVA 3N3HA 2JD4A 1O91A 2E63A 2LALA 4TYSA 4QM9A 4JTOA 1XE8A 3EO6A 4HVOA 5L7OB 4TZDA 2ZGKA 4R9DA 2EAKA 2D6MA 3IPVA 3VZKA 4G3YC 2AH2A 4QX5A 5E16A 3M3IA 4PDWB 3WDXA 4Z92B 1RL3A 2UY8A 1UD1A 1PO13 4DOUA 3ILNA 1CPNA 1F2NA 4N53C 3RYPA 2JG9B 1RUF2 5BV6A 1LCLA 1R083 2CWSA 1QHDA 3BOWA 4ORFA 1ZZ9A 3O0WA 2HEYF 2JG8B 1B35A 1PO22 5KC5A 3ZO0B 3GZUC 2TBVA 1ASJ3 4Q0QA 3R6SA 4FPJA 5I0TA 1ZRDA 3P3PA 2O1QA 1UZZA 2E7TA 4AVSA 4IEYA 4YGCA 4LO7A 3WV6A 5H9PA 5D8AB 2DTWA 3OCPA 5A33A 2PAMA 4CRQA 4B7EA 2H0BA 5GM0A 4OHZA 4IEOA 1FXZA 4LLFA 3VDDC 1VBC1 4RFT0 2RS33 3ZYGA 1S2BA 1REFA 4KGGA 4EN0A 1AR83 4ONUA 4L11A 5KWRA 2ZGOA 3GHNA 1S1AA 2ET1A 1QQP1 1RUC3 4INDA 4Y20B 1TQ5A 1YRZA 4FOVA 1G8WA 3M1HA 1HXS1 4BZ4A 4BLJA 1W0OA 1I5ZA 3O14A 3FHIB 3M3OA 3QOPA 5C9AB 1AYM2 2ZHMA 5LRSA 2B7YA 3RWNA 4UW5A 2G9FA 5KXBA 3JBG1 3G7DA 2RM23 1WD3A 1Q8QA 5E1RA 5JIUA 4AFCA 5KBFA 4WM7C 3DPRC 1U5ZA 1V70A 4M3CF 4AGRA 1NCQB 1VJ2A 1J1TA 1SCSA 2A73B 4Q4Y1 1DQ5A 4RR3B 3ETQA 4META 3RQ0A 1EP0A 4FOYA 4E4ZA 2ZGQA 1AR73 1LHNA 2WWSA 2Z69A 1IKQA 2A6XA 2WNEA 4J1WA 3M7AA 3VHPA 2Q4SA 4A7YA 4AGVA 4HK9A 5BY5A 2W39A 2XUMA 1QH6A 1LESA 3ZFFA 1R081 3TBDA 3VN4A 1ND3A 4NWWA 2FZ1A 5ACA2 3R4SA 1ENXA 3CF6E 2IFWA 2ZGRA 4L97A 4W6XA 4DZGA 1PZ7A 2XKPA 2HWC1 5I91A 4EROA 4ISRA 2VMIA 2WNVA 3MW3A 4XXPA 2QFEA 3EHKA 3AB0A 4RD7A 1PGSA 1S0BA 4XHXA 3M3CA 3T2TA 1QJX1 4FTEA 4WVWA 1Q56A 2NYYA 4YVWB 5GLTA 2RR12 4C91A 4D3WA 1EPZA 1Z78A 2I45A 2RS31 1AX2A 1H8TC 5FCCA 4YW3A 5DUUA 4QPGC 3ECQA 2YC0A 4LO4B 1RUC1 2ZABA 1V9U1 2CV6A 1MZ6A 4XETA 1IGOA 1OQDA 5T5JA 3WLUA 3D8CA 1GQGA