5SV8A

Crystal structure of the catalytic nucleophile and surface cysteine mutant of vveg16 in complex with a xyloglucan oligosaccharide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
198
structure length
198
Chain Sequence
AQPLKFIAVDYSPESCTHSPESSTITLTFDHRGGSRWRSTTRFQYGTFSSLIQCPKGNTSGLNFNIYLSSLEGDKSQDEIDFEFLGKDKRIVQTNYYTAGTGNREAIHDLGFDCSDGFHEYVIKWGPDLIQWLIDGKVIRSVRADGEGFPQKPMFLYASVWDASYIDEGRWTGPYVGSDAPYICLYKNVNVPVGTAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable xyloglucan endotransglucosylase/hydrolase protein 1
publication title Crystallographic insight into the evolutionary origins of xyloglucan endotransglycosylases and endohydrolases.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Hydrolase
total genus 47
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2016-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5sv8A00
1D2SA 1B09A 3WNXA 4YFWA 1MS9A 4YLZA 5T5PA 1JYIA 2I2SA 2NYYA 2ZKNA 1Q8OA 1DQ1A 2YROA 1UZZA 3OBRA 2AYHA 1ULDA 4U2AA 1W0PA 1UL9A 2DVDA 4M00A 3RS6A 2D6MA 4FQ4A 4FVVA 4XJ9A 1CJPA 1LEMA 1MVEA 1LU1A 5JOWA 2D43A 1MS5A 4ITCA 3SLIA 1SCSA 3IMNA 1FV2A 2DUOA 4PBOA 1QGLA 5DXDA 3UK9A 3CNAA 4Y26A 1DHKB 3AZWA 4XXPA 5GLUA 1KDKA 1W6NB 4UW4A 5DUUA 4HANA 1LULA 4YG0A 3JUUA 2VW1A 3MW3A 1AXZA 4RL7A 2ZACA 3ZVXA 1VIWB 1G9AA 4YGBA 1W6OB 3V0BA 1HQLA 4D69A 1LOCA 3UL2A 3V0AA 2P3IA 1OFSA 4XHXA 1N3QA 3RG0A 4Q27A 2AGSA 4L8QA 1IOAA 4LBQB 3ZYRA 1LOBA 1YYNA 4PQ9A 1BQPA 4AVVA 1C1FA 5T50A 3WG2A 2D6LX 2GNDA 4Y20A 5F9TA 4YM2A 1DQ2A 1QMJA 2ZHMA 2JD4A 2D3PA 3T1MA 3PVOA 4AGVA 2NM1A 1TEIA 1SLBA 4XIOA 1ULCA 4DPNA 4TZDA 3ZSKA 5GJ6A 2EXIA 1Q8SA 2ZHKA 1A78A 1G9DA 2AH2A 4TYSA 5SV8A 2ZMNA 3INAA 5GLWA 4LBQD 2ARXA 1GZWB 1LOAA 3AP6A 3BODA 1LGNA 3TAYA 1W6PA 1JYCA 1BYHA 1LHVA 3N7MA 4XJWA 3R05A 5HCAA 2EAKA 1GZCA 2VY0A 1MZ5A 1YRZA 4PBPA 1DLLA 3FUQA 3N3HA 2NMNA 3MPPG 3WG4A 4UW3A 4YG6A 1SLCA 2WLQA 3ZXEA 4ATEA 3O0WA 1A8DA 4FP2A 5E8AA 3WG1A 1O4YA 1HLCA 4CZSA 1FYUA 3FLRA 3NV2A 2EXHA 3A4UA 1QDOA 5JOZA 2WSUA 1YXWA 2VU9A 2A6YA 4ASMB 1H9PA 4CRQA 1LOEA 3NV3A 2AUYA 3N35A 1H9WA 4NO4A 3SISA 1I3HA 1QU0A 3V0BB 1LU2A 3AP9A 3VKMA 3WDWA 1MS0A 2V73A 3SNMA 5KXDA 3WHTA 3H0OA 1JUIA 3ILNA 4WZFA 3V0AB 3WDVA 1LOFA 3B01A 1PZ9A 4BMEA 2CNAA 4RA0A 3OYWB 3C2UA 1DBNA 5KXEA 3ZXLA 3B00A 5GZEA 3D5OA 1SBFA 1Q8PA 4XBLA 2PHXA 4WVWA 3M3EA 2A6WA 3M1HA 2PHWA 4GALA 5GM0A 2JJ6A 2DTWA 1ULEA 4Y20B 3AZVA 3PVNA 2LTNA 2EIGA 1Y7BA 2EXKA 3IN9A 2ENRA 1GNZA 1LEDA 1WUVA 1LHNA 1CQ9A 2GALA 2ZGSA 2DUQA 3HMYA 4FP3A 4AGRA 1ULFA 2PHTA 1GLHA 4C1WA 1G7YA 1LENA 4FQZA 2A6XA 3KQRA 4R9CA 1AJKA 4Q26A 4XJUA 1V00A 2A5ZA 2A6ZA 1W6PB 3QLQA 4BPZA 3WCRA 4DFSA 4XHBA 2ZGMA 2CY6A 1UMZA 1SLLA 3AJYA 4YFZA 2R1BA 4GXLA 1LTEA 3V65A 3VUOA 1WLCA 3U4XA 5JDBA 4F83A 2AR6A 2KM2A 2V5YA 2DU1A 4P9XA 4R9BA 3WUDA 4I30A 4YW1A 1JW6A 2PHFA 4YG3A 3BTAA 3RMXA 3ENRA 4YM0A 2CL2A 1MACA 2DV9A 3ILRA 3AZXA 3JU9A 3O0VA 4KBBA 2UURA 1BXHA 3B9CA 5JVVA 3MW4A 3OY8A 3WUCA 5BYNA 5IK8A 1UX6A 2DURA 1YO8A 3VKOA 2ZGRA 1C57A 1LGCA 3AXEA 1YI7A 3M3QA 3ZXKA 5JLVA 5E89A 2SBAA 5CBLA 1MS8A 1RITA 3IM0A 3WDTA 5DUXA 1BKZA 1WCSA 2WJSA 3BIWE 3B69A 2YY1A 3WDXA 1N47A 3IPVA 2WNEA 1WD4A 3NWKA 3FLTA 4JC1A 5DG1A 2B7YA 3O12A 2ZGNA 4YW2A 4WVVA 2ZZJA 4K1ZA 1FAYA 4IQPA 3AYCA 4XJZA 4DRRA 3BOPA 1C1LA 1S0CA 3NV4A 2A6VA 1N1TA 2Q5TA 1JN2P 3RQ0A 4YW4A 1H30A 2OW4A 1SCRA 4UW6A 4YGEA 3POWA 1J1TA 4Y1VA 4XE9A 1KQRA 4YGCA 1DZQA 1S0BA 2JE9A 3SH3A 1CONA 2GMMA 2DVAA 1S1AA 4XIKA 5EYYA 1Z78A 1F9KA 1S0GA 1DQ0A 1DQ6A 5LK5A 1IKPA 2A75A 2VUAA 4K20A 3OGGA 1SACA 2ZABA 1VALA 3AX4A 1Z0HA 4FPFA 2OVUA 2D6KA 1AX0A 3FUOA 3WVJA 1DFQA 1NXD1 1VAMA 1QDCA 2YMZA 1QOOA 1JXNA 4YW3A 1MS1A 1WW7A 2R0FA 5HCBA 2GNMA 4NOTA 3WG3A 1GKBA 5FREA 1UZYA 1V6IA 2ZGKA 1FX5A 5DG2A 3ZSLA 4Q8KA 1S0EA 3O0XA 5GLTA 5GLZA 3D4KA 3O5SA 3OJBA 1NLSA 4DQAA 4YGDA 1R1ZA 2EXJA 4PCRA 2R49A 4XILA 1HDKA 1WW5A 5FRAA 1PZ7A 2R16A 3ASIA 1DGLA 2OUJA 3AP4A 3RMYA 5GZGA 1I1EA 4XOGA 4K1YA 2ZGOA 2UU8A 2ES3A 2ZGTA 3USUA 4LBMA 4AVTA 5GZCA 1X50A 2JDZA 1ENQA 3KM5A 5CNAA 3ZSJA 3ZYPA 1GSLA 2YZ4A 2WT2A 4YZ1A 2EALA 4M3CA 1GYKA 4AYUA 2WSVA 4LBOA 3WOGA 4FOYA 3WZ1A 5GZFA 1MZ6A 3VKLA 2A70A 3AZYA 2E53A 1N1YA 4Y1YA 1DYPA 1FV3A 4FPCA 4ISQA 2D6OX 5IT6A 5JMCA 3LCPA 1ONAA 2JECA 4PF5A 3L2YA 4AGGA 3IPVB 3N7LA 4YM1A 2PHRA 4WV8A 4AWDA 1QOSA 4BLIA 1SFYA 4OZXA 2W68A 3DGTA 2ZMKA 1DIWA 4YZ2A 1KRIA 4GKYA 2VW2A 5GALA 1GANA 2P2KA 4BOWA 1GBGA 2JKBA 1LHOA 1IS6A 1IS4A 1S0JA 2ZGQA 2XG3A 3HR9A 4XXAA 4JCKA 2DWRA 5F5QA 2H0BA 3PMEA 2NZ9A 5CB7A 2P3KA 5DZFA 4C1XA 4GA9A 1AF9A 1IS3A 1XQNA 4BMBA 2CTVA 2UWAA 4XYXA 2ZAAA 2PELA 4DRVA 1ENSA 5T52A 3VV1A 4ISRA 4LBKA 5EXOA 1LHUA 1IKQA 1FATA 4FPKA 1CVNA 1V6OA 1WLDA 1LOFC 3M3OA 2P34A 2GMEA 4FOWA 1G9CA 2D3RA 2ERFA 3FFZA 3QCWA 4XZPA 5T5JA 4LBJA 5H9RA 3WDUA 1W6OA 4XMAA 1LESA 2E7QA 4M3CE 1WBFA 4M3CF 4XTPA 3WLUA 2DU0A 1RIRA 1SLTA 2NN8A 1WLWA 1G8WA 2G4IA 1UAIA 2DYCA 3AFKA 2CWMA 1BZWA 4FPYA 4ZKTB 1S0DA 4LBQA 3LSEA 3A0NA 4YM3A 1CR7A 2W52A 4AVSA 2E7TA 4M3CB 4ATFA 2D6NA 5KXCA 5IK5A 4LBNA 3RSJA 1AXYA 1S0IA 2P3JA 1HKDA 2HYKA 2PHUA 4BM8A 3ZXFA 5IK4A 2WKKA 1CIWA 3PVEA 2ZGUA 2FHRA 3ATGA 1OKQA 3M2MA 2ZMLA 4SLIA 4Y1ZA 1URXA 4R9AA 1F31A 2DVFA 1MS3A 1FNZA 3GALA 5IUQA 1GZWA 4FOVA 1CN1A 2FMDA 4FPGA 3VKFC 2CWSA 3Q9OA 1C4RA 3FLPA 3MW2A 1SBDA 1UN1A 4FPOB 4YZ4A 3WDYA 3T1LA 3AYEA 2A3XA 5EYXA 2JE7A 1VLNA 1A3KA 1VAVA 4FPEA 3AP5A 3ILFA 4GWNA 1KITA 5GZDA 1KJLA 2Z42A 1O4ZA 1SBEA 4K21A 4W65A 5DUVA 5CA6A 4FPJA 1N3PA 1LOGA 2ZHNA 5CAZA 1AX2A 1W6MA 1N3OA 3AXDA 1G9BA 2A3YA 4DS0A 2ZBJA 3I4IA 3D6EA 1ZM1A 1U0AA 1JBCA 3W58A 3W59A 3AK0A 2E51A 1MVQA 1V6NA 3FBYA 4BLJA 1LODA 1UPSA 3AZZA 2W39A 1APNA 5DZGA 1KJRA 2DTYA 2EF6A 4Y22A 3RRDA 1AVBA 3N7JA 4Y24A 5E88A 1Q8VA 4FOQA 5H9SA 2GN3A 2CYFA 2E6VA 3WV6A 3OYWA 3B3QE 3OPZA 1S0FA 2TEPA 3V64A 4Q2FA 1WBLA 4JRAA 5T54A 2C9AA 2R0HA 3T2TA 1F5FA 1WD3A 3UJQA 2A7AA 4YZ3A 3OBTA 2GN7A 3R4SA 4XTMA 5T55A 2W08A 5H9PA 1ULGA 1WW4A 4YZ5A 1CPNA 3ZXJA 4R9DA 3A0KA 1FNYA 1OQ1A 1QNYA 1HQWA 1DQ5A 3OY8B 1QKQA 3SITA 1V6MA 2ZHLA 4XJ8A 1KDMA 1W6QA 1V6JA 1D0HA 5EWSA 4LBLA 1G86A 3POSA 3R4UA 4GKXA 3MEPA 1LHWA 4HL0A 2D44A 1GICA 1AX1A 1CESA 1QF3A 2D6PA 1IS5A 3AJZA 1RINA 2ARBA 1LJ7A 4XJAA 2YXSA 2DVBA 5T5LA 1WW6A 4Q1RA 4ZXKA 2YV8A 5H9QA 3WHUA 1G9FA 3N7KA 1DYKA 1SLIA 1ZA4A 3AYDA 3TB0A 1Q8QA 1QNWA 2A71A 5KXBA 1W6MB 3DUIA 2VW0A 2RHPA 1V6LA 5JOYA 1MS4A 2ZA9A 3IKWA 1YIFA 2D3SA 3GNEA 1N1VA 3ZPYA 4Y1UA 3SH4A 2DUPA 1MR5A 3I8TA 4Q1PA 1GZ9A 4YW5A 1BJQA 4Y22B 4Y1XA 5DUWA 3SH5A 1JOJA 1GNHA 5HCFA 2P37A 1W6NA 4GWMA 4Q8LA 4UW5A 5L73A 1QOTA 4FPLA 1PZ8A 4P9YA 2SLIA 4P9WA 4U36A 3HN1A 2ZGPA 5IK7A 4FPHA 2VH9A 4BQ1A 1Q56A 2NP0A 4XMIA 2WT0A 2OUHA 4XBQA 2ZGLA 2GNBA 1GV9A 2UWBA 1DQ4A 2VXRA 5GLVA 3USUB 5JOXA 4XBNA 3LSDA 1JHNA 4M01A 2DVGA 2GNTA 2LALA 4CTEA 3ZSMA 1V6KA 3PJQA 4XDQA 2R1DA 3M3CA 3AP7A 4P14A 3WCSA 2C5DA 2D7FA 3N36A 3VKNA 1EPWA 3AYAA 1LGBA 4H55A 5T5OA 2WQZC 4MYEA 1W6QB 2GMPA 3NV1A 2AREA 1AJOA 2A3WA 3UJOA 2NMOA 2BQPA 4Z8BA 2GDFA 1LECA 1ENRA 5AVAA 2WT1A 1SLAA 2UWCA 3POYA 1AZDA 1CPMA 1N1SA 2AENA 5DZEA 1W0OA 1LCLA 2XB6C 3APBA 1UKGA 1AXKA
chains in the Genus database with same CATH superfamily
1D2SA 1B09A 4XVHA 3WNXA 3ROUA 4PIXA 3NNMA 5T5PA 1GZTA 1RUI1 4CCKA 2NYYA 4CCMA 3EB7A 1T6GC 3EHKA 1UZZA 2AYHA 4KWKA 1O8SA 1ULDA 2G9GA 4CU9A 1W0PA 4QXKA 4UFLA 3RS6A 3ZFGB 4IDZA 3OCPA 2W47A 4FVVA 4P9GA 4COVA 4RS5B 5F6LB 4RGKA 1K5MC 3I7DA 2BNMA 4JQTA 3VBOA 4HOOA 4QM8A 5HXMA 3BGAA 2DUOA 4DO0A 4X6RB 1W8ZA 3CNAA 3PIGA 3AFGA 3AZWA 2JG9C 3PVBB 1W6NB 1ZYBA 1ZNPA 4HANA 5JXIA 3T4VA 2ZEXA 3MW3A 4PIYA 4UWDA 4RL7A 2ZACA 3VBHB 3ZVXA 5JXGA 1RUNA 3FX3A 3V0BA 1AL21 1HQLA 2Y34A 4HKWA 4D69A 2E7AA 2OQ6A 3H8UA 2HWC2 3O1TA 1E5RA 2GC1A 1OFSA 3OD4A 4BHPA 3RG0A 1PGW2 4E8CA 1AYM1 1KS4A 1AR73 5FYCA 3LEIA 3A22A 4L8QA 5BPXA 4CSWA 3RWNA 5LBFA 3ZYRA 1LOBA 5CZKA 1BQPA 1XE7A 5BNNA 1C1FA 5T50A 4IGQA 4QB1A 2YBSA 4GMP1 3K51A 2P1BA 1ZA7A 3ZYGA 4BA6A 3HT1A 3M8LA 5J98B 2O14A 1BVVA 1EV13 2D3PA 2WAOA 3PVOA 2NM1A 1R082 1SLBA 1TEIA 3ZSKA 5I93A 3CJIC 5GJ6A 3RZHA 4MO3M 2DF7A 2AH2A 2O8OA 2XL9A 3LFIA 2ZMNA 3INAA 5GLWA 4CCDA 1SQ4A 2CU5A 3AP6A 2ADDA 4PHZA 3BODA 4AQTA 2X5IA 4OLLA 1W6PA 5FUNA 1BYHA 4N53A 1WCUA 4O9GA 4WVZA 1JUHA 1B35B 1PK6C 4OUSA 3R05A 2C6SA 3I2IA 1GZCA 1ASJ2 2VY0A 5L9BA 2BU9A 2VPVA 1Y4WA 5FQ0A 3WG4A 2W1UA 4YG6A 1SLCA 1W2OA 5JZGA 3ZXEA 4HLTA 4DUVA 4QQPA 2QQJA 1A8DA 3LB9A 1HLCA 2G19A 1JZ4A 2OZJA 5A3LA 3KV5A 1R1A1 1YXWA 2A6YA 1LOEA 1UXXX 2QQVA 1H9WA 5E16A 4H3WA 5FYBA 3SISA 1I3HA 3FHAA 4QGMA 2WQ4A 1QU0A 3CBNA 3HIFA 3ITQA 3ZOIA 3AP9A 5JCTA 4EZHA 4LJHA 5FMOL 4QKBA 3WHTA 3V0AB 1LOFA 1WMFA 2OXBA 4F7ZA 4NE9A 4DXZA 4QX8A 1MEC2 2W3JA 1QH7A 4IEOA 3C2UA 2X05A 5KXEA 5FOBB 3OPTA 5FY7A 2VM9A 1OD5A 1W2UA 1ZBE3 3FWEA 4HBNA 2QZ3A 5FY1A 1SBFA 2PXJA 1YFWA 2H0VA 4H2AA 4WVWA 2DFCA 2JJ6A 1V9U2 1VBD3 3QOPA 3WP5A 1PK6B 4N8MA 2WFF2 3KCYA 4HG6B 5FJKA 4JDOA 3NAPC 5FZBA 3ACHA 3TEWA 2EXKA 4LKEA 1NX9A 3IN9A 5F32A 2HWF1 1GNZA 2L9LA 5FYTA 3TN92 5KBFA 1RJ8A 1WUVA 2GALA 3N9MA 4FP3A 3HMYA 2DUQA 2IVJA 4C1WA 1X9PA 4QWNA 4YVSA 5FFOC 3LDKA 4FQZA 2A6XA 3KQRA 5I0SA 3O14A 1ZZ8A 5JIUA 5FZ8A 3RGBA 5IFPA 1NLRA 1CAUB 1CAXB 1V00A 3MPBA 2B4KA 3RVHA 3WCRA 4FBFA 2VZQA 2VUDA 4QAWA 2OIIA 4XHBA 3X29B 2ZGMA 4AG4A 4CPBD 2CY6A 4JGYB 3KT7A 1UMZA 4QQLA 5HCHA 4QKDA 1LTEA 1WLCA 1E57A 4RGAA 3DCQA 3PTRB 3OB8A 2AR6A 2Z2SB 4I02A 5FK8A 5ABJA 3JQXA 2PAEA 1VBA1 4YG3A 1EAH2 2CL2A 2Y8KA 4RQPA 1RUF2 3B9CA 4IEUA 4MGKE 5A7QA 3KHCA 4LKFA 2HWC1 3EXUA 4YVWB 1LGCA 3GM8A 3AXEA 1YI7A 5JLVA 1S2EA 2SBAA 2XLAA 4QX2A 3IM0A 3WDTA 5DUXA 2MPFA 3LWCA 5FMCA 4XF0A 4AF9A 1FPN2 3B69A 3TWIA 2B45X 4D7YA 1GNYA 1ND2C 4AAXA 4TSVA 2QBXA 5A32B 3NWKA 4XUPA 2Y6LA 1W8HA 3O12A 3U75A 2ZGNA 2ZZJA 4JTOA 1FAYA 2PAKA 3AYCA 1O5LA 3BOPA 1BHGA 3ZXAC 4IGOA 2PQQA 5DMYA 2QKDA 1L3JA 1H30A 2NQYA 3A21A 3F95A 4WM8A 5L7OA 3POWA 1J1TA 1KQRA 2JE9A 4WVMA 3SH3A 3CDZB 3GZUC 2KXLA 3ZIWA 3RI8A 4HK9A 1F9KA 4MXVA 4Q4V2 1QJU2 4CP9B 1DGRN 1DQ0A 1UF2C 4K20A 3ES4A 3LIHA 3VBUC 4OUEA 3ZN5A 5EFUA 5FZMA 4URTA 2QZ2A 4IE5A 1XJAA 2QQUA 3FUOA 2HWE2 5FXXA 1ASJ1 4Q4W3 1QDCA 4BB3A 4YW3A 2WZR1 3NNJA 3KZ4C 2ZGKA 5AFEA 4AI8A 2VNOA 4Q8KA 1S0EA 5GLTA 3SHRA 2YB7A 2BFUS 2VOKA 1R1ZA 4PCRA 1UOFA 1HDKA 2QQOA 4AI2A 1I1EA 3V56A 1AR63 3AMNA 2OUJA 2AC1A 3AP4A 1ND2B 1W9WA 2ZGOA 2UU8A 2ES3A 4MGSA 4IV3C 3USUA 2FDGA 4I2OA 1X50A 2LM3A 2Y0OA 4AFCA 2YZ4A 4ZU5A 3TEXA 1ZZ6A 2WSVA 5FMOS 4DY5A 1VBC3 1XNKA 3NJXA 1XNBA 3BB6A 3D82A 1A8MA 3VD3A 5GZFA 2A70A 3KVAA 3AZYA 1MEC1 3UKTA 1XBFA 3ZR5A 1N1YA 4DUWA 2W1WA 4QDQA 2VOTA 4S2DA 2QQNA 3AKRA 4FPCA 2D6OX 3TRSB 3LCPA 3WW3A 1D4M3 4AGGA 2D5HA 2F4PA 2Y60A 1PVC2 4GMP0 1SFNA 4OQ9A 5FO8B 5CFCA 3CQOA 5GKAC 1V9U1 4OULA 5HXVA 1W04A 1LAJA 2WFF1 2B46X 4UBHA 1RC6A 2ZMKA 1QXJA 1YI9A 2KR2A 2WUHA 1GOGA 4HVRA 4TXWA 2OS2A 4GKYA 3TN91 3B93A 2VW2A 3POEA 4D6SA 1GANA 2P2KA 4BOWA 1GBGA 3VDBA 4I0BA 2VECA 3K48A 2WO7A 1TMF2 4CCLA 2GP3A 3OBZA 3IT8A 3HR9A 1JYNA 5FUPA 2DWRA 3MFAA 3NJYA 4NIHA 5F5QA 3PMEA 2NZ9A 3RZLA 4C1XA 4GA9A 2UWAA 3S7IA 4O7XA 4ISRA 3ECQA 4IV3B 1VR3A 3C8XA 4BQ5A 1IKQA 1FATA 3KSCA 4BJ0A 5FPUA 4AI3A 3DKWA 2GH8A 2HBUA 4FOWA 4EJRA 1WLTA 2UY9A 4N9HA 2VNVA 5CYYA 4XMAA 5FPAA 2DCZA 2ZX3A 4EWDA 3QH7A 5A1FA 5LBBA 1EAH1 1RIRA 5FY8A 1ND3C 3LA3A 2PA7A 1G8WA 2G4IA 1RUF1 3AFKA 5A6ZA 4LIUA 4PI2A 2CWMA 2YUEA 4HPKA 3SEEA 5FZGA 5EQUA 5FJHA 4UFMA 2P3YA 4AVSA 5LA9A 4M3CB 4OHXA 1J3PA 1W2AX 2D6NA 2EICA 1POV3 2HH9A 3VZNA 4JV4A 1FPN1 4LBNA 4AEMA 2PHUA 3ZMNA 4I0AA 4BM8A 1PNGA 2W92A 2WNUC 5A7SA 1VRH2 3MHZA 3PVEA 2ZGUA 1ZVFA 1JODA 2R072 4MGZE 4OHYA 2Q1MA 2PHLA 2RM22 4R9AA 3NNFA 3VDDC 4DINB 3VBSA 1FNZA 3JBG3 2BJSA 4J25A 4XAAA 3R4DB 1GZWA 4LE3A 4Z2WA 2RMU3 2QUOA 4NROA 2CWSA 2P4EA 4Z1VA 1X82A 3MW2A 1SBDA 4Q4V1 5FCCA 2RS53 2VZSA 3POIA 4DXTA 1RUC3 4CU7A 2A3XA 4K3UA 4MGQA 4LE4A 4OI1A 2VMFA 1VLNA 1QJX3 2JG8A 5JWPA 1ND3B 1BBT3 4B29A 1OF4A 5A3WA 4QKNA 2DCYA 2VZ1A 4D3WA 4FPJA 2DBNA 2ZHNA 3WNOA 1AX2A 1W6MA 2VULA 2ARAA 5F8PA 3S6PA 2CAVA 1RMU3 1V6NA 2E51A 1QQP1 5A3NA 1ODNA 5CKQA 3NSTA 4OYUA 4RR3C 1I5PA 1Q8VA 2WNUB 2WA3A 4FOQA 4Q4X2 3WP3A 4X6QB 5K0UC 2GN3A 3ON7A 4QPGB 1EPZA 3T2OA 1YCIA 3IWZA 4GJYA 3D3AA 3ZSEA 4OI4A 3VN4A 5DAWA 2V4VA 4L97A 4CDUC 5BNPC 4Q2FA 5T54A 1F5FA 1NZIA 2HWD2 3T4HB 3GJAA 1XYPA 1R092 3R4SA 2ID4A 4CEYA 2W08A 2RDNA 5H9PA 3WY6A 5D8AB 5ERLA 1UNBA 1CPNA 4FT8A 1PVC1 4LK6A 5FPZA 4YZ5A 4LT5A 5FPXA 4NUBA 3E5QA 4Y3OA 1AR72 1E5HA 2BBAA 3L2HA 1JZ6A 1QKQA 1EY2A 1V6MA 4R52A 4YNIA 1KDMA 1ZZBA 4AEKA 1W0NA 1H8VA 4CDXC 1TMF1 3H50A 4GULA 1QXRA 1V0AA 3MEPA 4N43A 1POQA 1RGSA 4QXHA 3VL9A 5C8WA 4HL0A 1EV12 2RDRA 3VBFA 1IS5A 2ARBA 2RS32 4P08A 4XJAA 4C90A 4M4PA 5K0UB 1J59A 4Q4Y2 1HRV3 1K3IA 4ZXKA 2VD7A 4Z92B 3D8CA 3IDAA 2XPJA 2JB4A 3E97A 4KG8A 4CCCA 3DUIA 2VW0A 4CDUB 5BNPB 1OUSA 5FP4A 2HEVF 1RHI3 1V6LA 2WNVC 5JOYA 1MS4A 2VR4A 4LLFA 2D3SA 2IZWA 2VNRA 3GNEA 4CP2A 5FYHA 1YLLA 3SH4A 3W9AA 1MR5A 3I8TA 3UGHA 4Y22B 4META 5JI9A 1PO23 1JOJA 1RUJ2 1DU3D 1UO9A 4XFHA 4AFDA 2VZ3A 1UX7A 2XUMA 3A23A 5FY4A 5L73A 4EQVA 1QOTA 3GCWA 4NHKA 2SLIA 4LR4A 1HX6A 4XFAA 2MEV3 4JKKA 3ZKYA 2ZGPA 4AOCA 5IK7A 4FPHA 1NT0A 2K2SA 3NKGA 1NCQC 2RS11 5FYYA 1LB2A 4XMIA 2NP0A 2WT0A 4LO7A 2WN2A 4GAZA 4XBQA 4AFBA 2ZGLA 2GNBA 5I0UA 3MLJA 1D7PM 2H6CA 2UWBA 2QQMA 2R071 5CIRA 4XBNA 4NIDA 3ALQA 1FMD3 1O8PA 4IE6A 4HT1T 3ZR6A 1DYOA 1GWLA 2GNTA 3LKJA 1V6KA 3AC0A 2IXIA 4QDSA 2R1DA 4AL9A 2Y26A 3WCSA 1ZBE2 3AKQA 4D6QA 3H8OA 1EPWA 1OFNA 3BPZA 5T5OA 4FCAA 3O1RA 4MYEA 3JZVA 2WWJA 2CGOA 2EAAA 4QT6A 4E27A 1VBD2 2VOVA 3FBMA 1VBE3 3I3BA 5JOZA 1H2KA 3SEPA 2QTWB 2WT1A 3GGLA 4W6XA 4XQDA 3OGJA 1W0OA 1LKNA 4Y1UA 4DMIA 3C7EA 1TNRA 1SZBA 4YFWA 1MS9A 2VMDA 3IDCB 4YLZA 2B42B 4YW6A 5FY5A 3ZN6B 1F5JA 1VAKA 2VBDA 2X09A 1X33A 2B9VA 1O3QA 2XJQA 5FYUA 5JR7B 5C33A 3MF6A 1SEFA 2W0XA 5C5UA 3M4FA 4U2AA 4A41A 1UL9A 4M00A 3U1XA 3BUCA 2D6MA 3HWJA 4FTEA 2VUCA 2XJRA 1CJPA 5A7WB 5JOWA 1LU1A 4Q4X1 4RFT0 4JGZA 3WW4A 1MS5A 4AHYA 2JIGA 2X29A 4COWA 3IMNA 4AEDA 4LUKA 3UK9A 4MLOA 1JU4A 4XXPA 5GLUA 1KDKA 4KU8A 3U37A 2VZRA 4KMQA 3URFA 3PTYA 3I3QA 4XF1A 4UAPA 1LULA 2HWD1 1AYN3 5LWBA 1G9AA 3H3LA 5FYVA 1R091 1VIWB 4D6RA 1W6OB 3ZXDA 3HEIA 4FFFA 5F6KA 3NKTA 1XU2A 3I49A 2BGCA 3OGVA 3JQWA 2XJPA 4KGGA 1XC6A 1AHSA 2B5HA 2ORXA 3W21A 1ZRDA 1REDA 1N3QA 2QDRA 1AR71 1FT9A 2XHKA 4OCTA 3RNSA 3H9AA 2OZ6A 2WS93 4AE2A 4LBQB 4ARXA 1YYNA 4QPIA 1HV1A 4MGIE 4AVVA 1XNAA 3J8F3 3RZMA 5C71A 4CPBA 4AHZA 3P5BA 1ZZCA 2KD7A 4LOSA 4Y20A 4Z82A 4CXXA 5F9TA 1C5HA 1DQ2A 3F2ZA 5LATA 4XQWA 2WZPP 1EV11 5FDBA 2JD4A 2CGNA 5FP8A 2Y6JA 5KHGA 3JB8A 3BTZA 2CSGA 2RS31 1ULCA 4N7IA 3P3NA 3T08A 4DPNA 1RUH3 4KWUA 4UYBA 3QD6A 4Q4Y1 5C9AC 1RXFA 5J37A 1A78A 3FC0A 4HXCA 4TYSA 5SV8A 5IVJA 1QHDA 4RHV3 3DF0A 4R4XA 1VBB3 1LGNA 4M0HA 1JYCA 4H7MA 4MV2A 1JZ2A 2XHNA 1GOHA 5A7PA 4PLOA 4S2FA 2R6QA 3GJBA 3VHRA 1T2XA 1YQ8A 3UKNA 1OA3A 1YRZA 4PBPA 2PHDA 1DLLA 2Q8DA 3IAQA 4N90A 3MPPG 5LCWL 1RUJ1 2W87A 2BPA2 3VBOB 1VMHA 4ATEA 3RYRA 3O0WA 5EJ1B 4HSLA 5E8AA 1O4YA 3Q8EA 3VZMA 1AR62 1FYUA 3ETQA 3SQOA 3FLRA 2TUNA 2EXHA 4ZPIA 1UYYA 2WSUA 2VU9A 3DYMA 4ASMB 1AR82 1H9PA 4CRQA 4COUA 1Z7S3 2ZKLA 2PLV2 1NA1A 5FK7A 1JZ3A 2WWSA 1XU1A 1H8TC 2ET7A 2WAAA 2X10A 3ELNA 3FMGA 2PTMA 3MBWA 3SXWA 3V0BB 2BV4A 3SNMA 2GC2A 3H0OA 4MUVA 4GWIA 4NPRA 4BMEA 1UQXA 2WO3A 4OFGA 2HLEA 4Q5OA 3BU7A 3OYWB 3MLLA 5JZGC 2ZZQA 4QPYA 5C9AB 1ZBE1 3ZXLA 3B00A 5FP9A 1UU5A 4IEXA 1D4M2 3VZJA 5IW0A 5ISLA 1Q8PA 4RS5C 5BNNB 4HVQA 3M3EA 1VBD1 2GC3A 5FMDA 2H6BA 4BDVB 2XH6A 3LPGA 1HXS3 5APAA 2LTNA 2EIGA 3MFCA 1OI6A 2DBIA 1TZOA 1LEDA 2Y33A 2ZGSA 4B7KA 1Y3TA 4AGRA 1VPHA 1ULFA 3FL7A 4Y33A 1EP0A 3RZZA 2O0OA 4XC9A 4IETA 2YC0A 2O1QA 3HVDA 4I01A 3ACIA 5KHJA 4NN0A 4A6SA 2X5IB 1W6PB 4COYA 4N53B 1ULOA 1C8M3 4A44A 2WO2A 4JKMA 1W2TA 1SLLA 1XSQA 5C4WA 2R1BA 2WFPA 4IXLA 2HWB3 3V65A 4CDQC 1GR3A 4FAGA 5A1LA 3THPA 5FQ0B 1KFXL 5JZGB 2V5YA 1PIV2 3WUDA 1XXNA 4YW1A 3H3ZA 1DZTA 2PHFA 5A6XA 1MQTA 2XL7A 1NCRA 1SFPA 1MACA 3ILRA 4CEWC 2Y6KA 4KBBA 2Y64A 2UURA 1BXHA 3T09A 3OY8A 1OXCA 4LHKA 1DLCA 4WM7A 2C9KA 1HB1A 3LFMA 2QQKA 2YG0A 2IXLA 3BN6A 4XCBA 5FTTC 2VTFA 3U10A 1YEWA 2XJVA 5HV0A 2VAUA 1DDLA 4YYOA 4AFAA 2GU9A 4AXOA 5F5AA 1JZ8A 3DV8A 3H1YA 1WCSA 3ABZA 2WR9A 4TN7A 3WDXA 1B35C 1N47A 5F7UA 3WW1A 5F3EA 5LW9A 4LHLA 4J6GA 2LRPA 3C7OA 4IEPA 5IAVA 4IQPA 4DRRA 1S0CA 1KFUL 2IWGB 3NV4A 2A6VA 3JBG2 4NWVA 3W5NA 1JN2P 3RQ0A 4YW4A 1SCRA 2VL4A 3SC7X 4YGEA 2RMU2 5A6QA 2C1FA 1SDWA 4NHXA 1DZQA 3S30A 1S0BA 1RVF3 1LNSA 2A73B 1CONA 2GMMA 4CDQB 2P6CA 4WZCA 4XIKA 1S0GA 4MH0E 4S2GA 1DQ6A 1BEV1 4W6WA 2HEWF 2VUAA 2R063 4EWEA 1QJX2 3OGGA 4JKLA 3WX5A 3AX4A 4FPFA 3DL3A 4XF3A 1DFQA 1ZBA3 3BVCA 1VAMA 1JS9A 4L92A 4CEWB 1QOOA 1JXNA 1MS1A 5IJRA 3IAPA 2GNMA 1CAWA 1OLQA 1X8EA 1V6IA 3JD72 1LR5A 1YUDA 2VOXA 2IC1A 3O5SA 5GLZA 4BQWA 2F17A 1RUD2 1WCQA 4P9JA 5J1XA 2EXJA 5JSOA 4XILA 2R49A 1PZ7A 2R16A 3ASIA 1REFA 5GZGA 2PMWB 2FCTA 1XSRA 1QJZA 4KBZA 2QNKA 3PUQA 4XF4A 1AR81 4XOGA 4LBMA 1YWKA 2PLV1 3KM5A 1ENQA 5CNAA 3ZYPA 4AQ2A 4Y4YA 2UYAA 1JHJA 3NQHA 4RQPB 2EALA 3I3EA 4AYUA 1O91A 5ANQA 4QQOA 3WZ1A 5BUVA 2BFUL 3UYJA 4GQ7A 4OHVA 3VHPA 5C8CA 3N9NA 5ACA3 4MX3A 5JMCA 4FAHA 5FZCA 3ZFEC 5CFDC 2PYTA 3N7LA 4JGYC 4WV8A 4YM1A 1QOSA 4XABA 4OZXA 2JB8A 5DAXA 2XWJB 2ZAHA 5A3PA 1RUOA 2CDPA 4HETA 3GDBA 4BCUA 3I2GA 3KVBA 5J7MA 3U4SA 1IS4A 1Y43B 2BGOA 2AEZA 4WM8B 5F2WA 5L7OB 3W5MA 5FR3A 5FZ0A 3ZFGA 5BXXA 4P00B 5HI0A 2Q1FA 5CB7A 3ZKUA 3IMMA 4YVWC 2PELA 1ENSA 3ZYFA 1S2KA 3HN3A 2FDKA 2YBKA 4MADA 2QQLA 1WGPA 4K40A 4LLOA 4CCEA 2P34A 2OT7A 4QGNA 2GMEA 3DXTA 3HQXA 2BBVA 2VTXA 3FFZA 4HVOA 4NPMA 4XZPA 1RHI2 4LBJA 1PIV1 2W2IA 1UZ0A 2E7QA 3I2KA 5FZDA 3NNLA 3WLUA 4BQXA 2DU0A 1ODMA 3KF5A 5LK7B 1SLTA 2WBKA 3VBRA 3U07A 4XZUG 1WLWA 2DYCA 3ZFEB 1PO22 3ZYIB 2VVFA 5CFDB 4FPYA 3N4MA 4DEVA 3RPQA 3LSEA 3A0NA 2ADEA 4EZ4A 1HB4A 4FI9A 5FO9B 5JMOA 3KLSA 4ORFA 5KXCA 2AZ5A 2VG9A 3PMSA 5IK5A 4QX7A 1SDDB 1MPXA 4L9BA 4E2SA 5FKCA 3RSJA 3MIEA 4XACA 2P3JA 4AI0A 2HYKA 5IK4A 1WMXA 3T3YA 4OMCA 4QKFA 4IE4A 2BNNA 3MZHA 4GB32 5B2GB 5IVCA 5F3GA 1HN0A 2FHRA 2VE1A 3ATGA 1K5MA 5JPMB 5FBJA 1F31A 4IE0A 1PGW1 4AZZA 1MS3A 1YQ5A 4BQYA 3CMGA 3GALA 3GZEA 4QD2A 1UZWA 4MVTA 2RMU1 3J26N 2FMDA 2JG9A 3LPFA 4RD7A 4UBGA 3Q9OA 3RFRA 3POBA 1OQDA 1RUI3 4FPOB 2WO1A 3AYEA 4L99A 5EYXA 1QJX1 1YNAA 4JHZA 4Q0VA 5FZ7A 1ZZ7A 5FY0A 4GWNA 3IDBB 1R081 5D1IA 1I6XA 5DUVA 2G1MA 1W8TA 1N3PA 2VZTA 3WF3A 1LOGA 3B7MA 3HQRA 1N3OA 3JD71 4ZS3A 4OUMA 5I8YA 2ZBJA 1BMV2 3D6EA 1JBCA 3W58A 3AMHA 1RUD1 1PX3A 3FBYA 3NRUA 4PI0A 1GWMA 1OOPC 2W39A 1APNA 4QX1A 4EE2A 2DTYA 3RRDA 2VQ0A 1FOD2 2J7MA 2CV6A 1PHMA 5E88A 1W9SA 5F5CA 4BIOA 1AL23 4NWWA 5AC93 5J96B 3CJIA 3WF2A 2YBPA 3HNYM 1HIXA 4QMAA 1WCKA 4PF1A 1KEXA 1AR92 3VZLA 3OPZA 4NHLA 1IG0A 2VXJA 2JDUA 2F4LA 2JENA 2JKXA 2O8QA 4UOJA 3V64A 5BNOC 2HYXA 1WD3A 5A7OA 4CDWC 3OPWA 3UJQA 4LA2A 5I91A 3OBTA 2GN7A 5T55A 1PK6A 3ACGA 1H6XA 3HNBM 4HSJA 4DY3A 4AVAA 4E4DX 1EUUA 1PMIA 2VZOA 1YFYA 3SCFA 3E6BA 3A0KA 5DDJ2 1OQ1A 2OPKA 3DEMA 5FWEA 1QNYA 2WS92 3B94A 4UFJA 4CP1A 1HQWA 4UFKA 4FTBA 3CEWA 4HN0A 1K42A 1YQCA 2W91A 5E6HA 3I3MA 1W6QA 3J8F2 3VBSB 1HB2A 3VLBB 4LBLA 3O1VA 1CAUA 4XUNA 3K4ZA 3R4UA 3N9QA 4A6OA 1JZ7A 2WA4A 1KS5A 1UY1A 4LKSA 2D44A 4OQ8A 1ULPA 1GICA 1OOPB 2BERA 4LEJA 1IPJA 4XCAA 2RV9A 1LJ7A 1RUH2 4B4PA 1G6NA 1W8WA 2JG8B 5T5LA 1YJLA 3ZIXA 4AEJA 4B1LA 4CE8A 5FZ4A 4A42A 1OA4A 2VMCA 3BTXA 4G9SB 1G9FA 3N7KA 4UF0A 3TEZA 1QNWA 4NIGA 3J7NA 3WP6A 5DQ0A 3WNMA 1W6MB 1RHI1 4CCJA 3R0RA 5BNOB 4Q0QA 5L9VA 2RHPA 1US2A 2RR13 1PVXA 1GUIA 4N7UA 2ZA9A 1PO13 4CDWB 3ZYHA 3LDRA 2JICA 2BUKA 1R1A3 2Y0IA 3NVCA 3ZPYA 2X8KA 2ZXQA 3PURA 5CG8A 1OSGA 4Q1PA 1UOJA 4DIQA 1BJQA 1PO21 2I45A 2Z79A 3LEGA 3NAPA 4QB6A 4Q0PA 5FPVA 1HB3A 5TSWA 3SH5A 3OUIA 5HCFA 2FCUA 3UETA 1GQGA 2VCBA 1RXGA 2WZ8A 5F3CA 5EIYB 5DAPA 2WDBA 4KQ7A 1QJY3 4LKDA 3ZFFA 4H14A 1Z7S2 4IGPA 3MIDA 1X8MA 1Q56A 1S55A 4XUTA 4B4QA 4BQ1A 4IERA 2QVSB 4GB31 3GHMA 1DQ4A 1HW5A 5GLVA 4GIQA 1JYWA 4GWJA 4C91A 1BLZA 5EP9A 2Q4SA 2DDUA 1JTZX 3PJQA 4KG0A 2VUJA 2HWF3 2PAMA 4I0WB 4JRLA 4P14A 5FXVA 1W2NA 3CJXA 3AYAA 2VQUA 5A3MA 3NV1A 4MHRA 1SPPA 5SV5A 1C5IA 5E1RA 1M06G 2BQPA 4QPGC 4Z8BA 5A6YA 1LECA 4N43B 1HXS2 1WKYA 4ZZ8A 5AVAA 1ST8A 1SLAA 3AMMA 5B4NA 2XBO2 1N1SA 2AENA 1RUG2 4K7JA 4DB5A 1UKGA 2XG3A 2ZS6B 3T0BA 3BYWA 3MUY1 5FZ3A 2ZJCA 5C3PA 1T6BX 3PL0A 5FZIA 3THDA 4ASKA 4EN6B 4NAMA 3GBFA 3OEBA 1JYIA 1QJU1 1ND2A 1RTVA 4ES8A 5CEHA 5F1RA 5D8AC 2R042 3MI8A 1DQ1A 3OBRA 4S2HA 1UPIA 1VBA3 1UOBA 3K3NA 4FQ4A 1FOD1 1BVP1 2HWE1 4E4ZA 4MXWA 1LEMA 1MVEA 1A34A 1QEXA 5FLHA 2LS6A 3RZGA 3DN7A 2D43A 3K4DA 2HWB2 2CAUA 2WIIB 1SCSA 4XEZA 3CZJA 2HWC3 1FV2A 1AR91 2ZOEB 4JDNA 4PBOA 2KA3A 5DXDA 2JDKA 4Y26A 1DHKB 2ET1A 5FXWA 4HZFA 1L7RA 2JXAA 4MZUA 2HKXA 3VZKA 3LOIA 1POV0 2XLGA 5DUUA 4YG0A 3JUUA 2VW1A 3VBUA 1AXZA 4CXYA 3ACFA 1LOCA 2R7EB 3UL2A 4FXGB 1C28A 3OD0A 4LXLA 4BWOA 5DDJ1 4XHXA 3VD9A 2D98A 4NIIA 5A33B 4K9SA 1OKOA 4Q27A 5IFTA 5JUVA 4XW3A 2QCSB 1UWWA 4IUGA 4PQ9A 3R6SA 3LEMA 3PJYA 5F39A 3GF6A 4KWLA 3WG2A 4QU1A 2D6LX 5HV4A 4GH4C 2JIJA 1ZRRA 2OA2A 1UY3A 2GNDA 1O3SA 1U5XA 2GAUA 3C7FA 3OGSA 2BYVE 1QMJA 2K0GA 4FO9A 3T1MA 5KR7A 2WL1A 3WP4A 4ZONA 3LIGA 4XUQA 3N9LA 5AVPA 2RJ2A 1RUH1 3K3OA 3VD7A 5I8SA 1ASJ3 5LRSA 2EXIA 4BXSV 4M0NA 1RVF2 2WZR3 2Q30A 3LE0A 2J22A 3UESA 2UY8A 4ARYA 5FZOB 4P9IA 4HK8A 2I07B 3HNMA 1UKRA 2VJXA 2RVAA 2GH2A 2R062 2XVLA 3EBRA 5FZAA 3DPRC 4LO8A 2MHFA 3TAYA 3O1OA 3KGLA 4XJWA 2WABA 3DXUA 5HCAA 3H7YA 3M7AA 4V2VA 3AKSA 3O1MA 1XNTA 1MZ5A 2YPJA 2XMLA 1J58A 3N3HA 3ZN4A 1Y9MA 3HPNA 2WLQA 4JGZB 3ZO0B 4ZU7A 2LW8A 1RYYA 2R30A 2F6BA 4FP2A 5FLJA 3WG1A 4CZSA 1O3RA 3A7QA 1MEC3 2W46A 4QHZA 1QDOA 3E6DA 4GH4B 1Z7S1 4BK4A 3NV3A 3PUHA 3LZZA 5EPAA 2AUYA 4NO4A 2JD9A 4L11A 3ZM8A 2E32A 1LU2A 3VKMA 2V73A 2FMYA 1XE8A 2WFF3 5KXDA 4WZFA 1JUIA 5DABA 3U11A 1PZ9A 5LBCA 2CNAA 2EIEA 4RA0A 4CA9A 3KF3A 1S2BA 5EJZB 1ZRFA 2JDNA 4OHWA 5GZEA 1H8TB 3D5OA 5LRRA 4QPIB 3ZMOA 1JU3A 4G4FA 2VMEA 4OHZA 1JOBA 3DPRB 1U5YA 1XB9A 2BP6A 3BU0A 1ND3A 5BV6A 1VRH1 2PHWA 2GSYA 1TNFA 5GM0A 4Y20B 1X7NA 2RM21 3HBKA 2XBO1 1RUG1 1Y7BA 2ARCA 2JX9A 3T30A 2ENRA 3C7HA 2C26A 3AKTA 1LHNA 1HQNA 4EN0A 2Z4FA 4ZY9A 1GLHA 1G7YA 3KV4A 4R9CA 2R041 5C3QA 1AJKA 2WNUA 4XJUA 4AVCA 1W9YA 5LASA 4X8NA 2A5ZA 1VB4A 5FPLA 4YARA 4Q0SA 4AI9A 1EAH3 3QLQA 4BPZA 4LK7A 3MV11 4DFSA 3I2OA 3KCCA 3VDDA 1RUF3 3AJYA 2Y38A 2HWB1 3AKPA 1UY2A 2GP5A 4GXLA 5F5IA 3VUOA 5I8TA 3U4XA 4OMDA 1C3HA 1OUXA 2K9ZA 2JEMA 1WA4A 3KV6A 5JAXA 4R9BA 4P9XA 3KGZA 4I30A 1JW6A 4XDOA 1FPN3 4PDWC 4EWAA 2J1VA 3RMXA 3ENRA 4YM0A 4QDRA 4B8EA 3JU9A 3O0VA 1I5ZA 4LIVA 5IK8A 3RJ2X 2DURA 4TTGA 4QX0A 4QXCA 1NUKA 1JOPA 1C57A 2ZGRA 3M3QA 3I59A 4A3XA 1X9TA 3GZAA 2QQPA 3B9IA 3AB0A 4FFIA 4XFGA 4E4HA 1BKZA 3BIWE 2WJSA 1CZVA 1H4GA 5DAVA 4W50A 4XPVA 3SCHA 4JHTA 3IPVA 2WNEA 1WD4A 4Q4V3 3S5QA 4JC1A 2WYSA 2B7YA 3H1WA 5DG1A 2HJIA 4RR3A 1ZX5A 2CHHA 2I74A 2YC4A 2E33A 4K1ZA 3MGUA 5K0UA 4XJZA 1W3VA 5LZ6A 1ZRCA 2HEYF 2EIBA 3VBOC 2BZDA 3WSOA 1PM7A 3IZOA 2Z5WA 4V1PA 1IGOA 1SHWB 3FJSA 4YGCA 4XE9A 1TG7A 2CDOA 5HBAA 1OC1A 3HQUA 4CDUA 5BNPA 1I9RA 3LA2A 1QWRA 2JDPA 3H7JA 4CCNA 5LK5A 2R061 1IKPA 1XE0A 1QQP3 1SACA 2YU2A 2ZABA 5LY1A 2XKPA 3T0AA 4PDWB 3RYPA 2OVUA 1AX0A 5FZLA 3WVJA 2WRAA 1JYTA 3OGRA 1OLRA 2YMZA 3OUJA 5FZ1A 3TYJA 4A3ZA 5HCBA 1K12A 4I09A 3WG3A 1AL0G 1NE6A 3P1IA 2EVXA 1GKBA 3LAGA 5FREA 2MNGA 2QDNA 1FX5A 2E26A 3LD8A 5DG2A 3WD5A 3ZSLA 2XOMA 3S0MA 4CDXA 2ZPXA 4DQAA 5C4WB 4YGDA 5BNNC 4CUAA 4IEZA 2J1EA 5FRAA 3RMYA 2NLRA 1DGLA 1UCXA 4BU2A 4K1YA 4Q4W2 2ZGTA 5GZCA 3VL8A 4AVTA 4D7SA 3L9JT 2VC9A 5AC92 4EYUA 5ANNA 2JDZA 3ZSJA 1NCRB 1GSLA 5BY5A 5B4XA 1L7QA 2XONA 2WT2A 1IQDC 2BVBA 4IW3A 2C24A 4LBOA 3WOGA 1K45A 3BPSA 1VB2A 1JYVA 4QGLA 1HN1A 5FZEA 2E53A 2IXJA 5C3OA 4HN1A 2WNVA 1DYPA 2J1TA 4Y1YA 1TMF3 2X5IC 4TLFA 4LQRA 4N53C 3MDPA 5FO7B 4K8RB 4PF5A 3L2YA 1XOYA 2P17A 4AWDA 3I2FA 2C4XA 1CZTA 3QH6A 3FE5A 1SFYA 1VBC2 3DGTA 5M0TA 3BTYA 4B4RA 1UOGA 1DIWA 1H1MA 2FD8A 1KRIA 4LNVA 5GALA 2IFWA 4COZA 1LHOA 1CAVA 4AHWA 4F8AA 2ZGQA 1S0JA 3UNPA 4A4AA 4JCKA 3WF1A 5KC5A 1NCQA 3O7OA 2VZUA 2ZCWA 3VZOA 5A3UA 4HONA 1AF9A 4XYXA 2ZAAA 3DYPA 3ZX7A 5IWFA 3H42B 5EXOA 3POGA 4EN7B 1W03A 1CWPA 1KD7A 1V6OA 1LOFC 1WZXA 3M3OA 4UT5A 4CU8A 4XQ4A 1CAWB 1PM4A 2D3RA 2XXZA 3QCWA 5T5JA 2RR12 5H9RA 3WDUA 1PO12 1W6OA 1MZFA 1LESA 5C3RA 1R1A2 4M3CE 1WBFA 4XTPA 1XRUA 1S4CA 2BOJA 2IUWA 1LRHA 2NN8A 2RS13 1NE4A 1OH3A 2JDYA 3EQEA 3TNPB 1O3TA 3MLKA 1DP0A 4ZKTB 1S0DA 4LBQA 3PUIA 4AQSA 1UYXA 2B8MA 5KHKA 3KD4A 4C0BA 2J1SA 4QPWA 4GZ9A 2E7TA 5CKNA 2FZ1A 4O61A 3RYKA 1QJY2 4SBVA 1UU4A 4IEQA 4YVSC 1S0IA 4KNCA 3ZXFA 1NZCA 2PN5A 4IV1A 1W99A 1UU6A 4BQ3A 2LROA 4EN9B 3WQ1A 4LO5B 1CIWA 4BK5A 3BOWA 4D7TA 4LOTA 1OKQA 3M2MA 2ZMLA 3POJA 3TEYA 4Y1ZA 1URXA 4XAEA 5IYYA 1VJ2A 4LO4B 1R64A 2QJVA 1HRI3 1YJKA 2WNOA 5IUQA 3LGRA 1KXGA 4Y5Z0 3MF9A 4JDMA 4FOVA 3MV01 4NHMA 1OA2A 2B39A 2WINB 1SMVA 2WLPA 5ABJC 2VCMA 2EA7A 1UXZA 2W1QA 1P8JA 2JE7A 3RZKA 1QY4A 3CL1A 4RQPC 2YU1A 3WT3A 3AP5A 1U5ZA 4CUCA 1KITA 1DG6A 3MUZ1 3G7DA 2XR4A 1KJLA 2Z42A 1SBEA 3IDEA 3KWVA 3NJZA 1W9FA 5C70A 4Q4X3 4DUXA 3LEKA 3PUSA 4XFCA 5A1AA 3AVRA 2A3YA 4DS0A 3I4IA 2RS52 1U0AA 2Y6GA 1F35A 1RUC2 1W90A 3AK0A 3HOBA 4Y4RA 3SKJE 1MVQA 1AUYA 1OLMA 1RJ7A 1UPSA 2BVVA 3AZZA 1VBA2 3O1UA 5DZGA 2CGPA 4YVSB 1KJRA 3E1F1 5LY2A 2HWD3 4Q4W1 5CU1A 1BBT2 1ENXA 1R093 4I3PA 4Y24A 4XUOA 3OTFA 5AC91 1UYZA 2J1RA 2BNOA 4R8HA 1W8UA 3VBRB 3MIHA 1VRBA 3U0ZA 3OYWA 2VZVA 3B3QE 2QQIA 5C9AA 1YFXA 1RUE3 2BWCA 3CU7A 4DNYA 4WM8C 5L7OC 1GOFA 1RMU2 1RL3A 2TEPA 4IL7A 2J1UA 1AR61 2C9AA 2R0HA 3KMHA 3T2TA 1GP4A 3NO8A 2A7AA 5LBEA 1NG0A 5C6CA 1NYWA 4XTMA 3HT2A 5ABJB 2VVDA 1F8VA 1OH4A 3ZXJA 3TNQA 2VOWA 5K9YA 4RFRB 3VHOA 2GZWA 4HKOA 4UI9L 1VBC1 1DQ5A 1E5SA 1OQEA 2RS33 3T2QA 1K5MB 4ZS2A 5KHHA 2D93A 2VCAA 1V6JA 4Q4Y3 1D0HA 4CVUA 3CF6E 2VTXJ 2IXCA 2VQAA 2W9XA 3POSA 2IXHA 2JDAA 4FSJA 1D4M1 4IESA 2XQRA 4AFMA 2JG9B 2P5BA 3VD4A 2ZTNA 5FP7A 1AX1A 3RI9A 1HJFA 1QF3A 3OSDA 5D21A 1H8TA 2NPIA 1RINA 4NMIA 2WZR2 2DVBA 1WW6A 4Q1RA 5J36A 1Y9GA 5H9QA 2WN3A 3WHUA 3ST7A 5CKMA 1DYKA 1RUJ3 1SLIA 1ZA4A 3AYDA 4XURA 4A45A 5J48A 4O9EA 3BIEA 3WR0A 2RR11 4WVMB 1IG3A 1OBNA 1PO11 4F3JA 3WINE 4MOAA 4RS5A 3IKWA 1F4AA 1TME3 1W05A 1IPKA 1YHFA 3D0SA 2ZX2A 3NNGA 4LTAA 5CFCC 1UIKA 4YW5A 1HRV2 3MICA 2YC2A 3PDQA 3PIJA 4P02B 2PQSA 4X8PA 5DUWA 1ALYA 1VP6A 2P37A 1W6NA 4GWMA 1PX4A 4QXBA 4UW5A 1PGL2 3CJIB 4BXFA 4ZZ5A 2QQWA 4K8FA 3C7GA 2WYFA 3KV9A 3KT4A 3VBHA 4P9YA 1QJY1 3T2PA 1UIJA 4PQQA 1F4HA 3HN1A 5CG9A 1QXPA 4EN8B 1RB8G 2VH9A 4AR2A 2FDFA 2OUHA 5JXJA 4CYDA 3WW2A 4V2WA 5F2SA 1GV9A 3USUB 2FZ2A 2GC0A 3LSDA 2RDQA 1JHNA 2LALA 2Q8OA 4CDQA 3ZSMA 2G9ZA 5FZ6A 1POV1 3K2OA 4B7EA 1COV3 3S5AA 2P6HA 3M3CA 4WBBA 2MEV2 3AP7A 2VZPA 4C8DA 5C7GA 5JXHA 1MZEA 3N36A 5K7PA 3BALA 1LGBA 4H55A 4C0HA 4ES9A 1W6QB 3DKQA 2AREA 3ZFFC 4CEWA 3LQCA 2XKOA 4JZRA 3RZJA 2GDFA 1FMD2 3BKZA 3WNLA 1H4HA 4BH9A 2RE9A 4QHBA 4E4SA 5LB6A 2UWCA 3POYA 1AZDA 1CPMA 3JBG1 5CFCB 5DZEA 1LCLA 4IEYA 2XB6C 3APBA 4FFGA 3MYXA 4JQRA 1ZZ9A 5FAXA 3S57A 2I2SA 2RS51 1RUC1 1B35A 1XNCA 2ZKNA 1Q8OA 4KWJA 3NW4A 4JAAA 4UF0B 1VBE2 2YROA 2QFEA 3PU3A 1D4VB 1CX4A 1OF3A 2YHJA 2DVDA 3Q8CA 4NAOA 3LOBA 1Q43A 1IHMA 1H6YA 1W8FA 1BBT1 4GD4A 2D97A 4XJ9A 3LF7A 3LDBA 4IEWA 5CADA 5I0DA 5LEKA 1PMJX 4PT6A 4BE3A 5DPNA 4ITCA 4HMZA 3SLIA 3VBSC 1U12A 2E63A 1W9TA 2JDHA 4QHOA 1DCSA 1QGLA 3NAPB 3QACA 5FYZA 3ZDSA 1JYXA 1JH5A 1RMU1 5EZWA 1XPWA 4XDPA 2D5FA 3MO4A 3NJVA 3E5UA 3POFA 2RJKA 4UW4A 5CVRA 3VGIA 4YZ2A 2XJSA 3KB5A 2Q1ZB 4YGBA 2W1SA 1GU3A 2JG8C 3ZFFB 3V0AA 2P3IA 3M3IA 3DYOA 5IVFA 2AGSA 1AYM3 1IOAA 2AEYA 2DCKA 2QE3A 4HPKB 2VMHA 5FYMA 3W20A 2ILMA 1REEA 3Q8AA 1AYN2 4JTNA 3VDCA 3H1MA 3CO2A 1IZ3A 2YFUA 1Y9QA 1BEV3 1Q5OA 4GMP3 4YM2A 4MGTA 4KH9A 4LULA 4NVPA 2ZHMA 3OBAA 4NPLA 5FUIA 3I97A 4AGVA 1SPPB 4XIOA 4XFBA 4TZDA 2VNGA 1QH6A 3PHMA 2X53S 2W95A 1Q8SA 2ZHKA 1G9DA 2ZX4A 3UKVA 5FPBA 1CAXA 5FY9A 4LBQD 2ARXA 1GZWB 1LOAA 1QQP2 3KT1A 4D0QA 2VBBA 2VBPA 1LHVA 3N7MA 4CEYC 3CKHA 3I2HA 4LO6B 3ZFEA 1F2NA 5CFDA 1XYNA 4JGYA 2EAKA 4E9KA 3IBMA 1AR83 1VMFA 3FUQA 1HRV1 2PLV3 2NMNA 3PU8A 5FZ9A 1OLME 2BRTA 2Y6HA 4UW3A 4MXWB 4W4ZA 2OYZA 1DZRA 1JI6A 5K4LA 2FDJA 1NKGA 4RHV2 1PGL1 1VBB2 4A7KA 2YGMA 5JPNB 1OVPA 3UGFA 2ATFA 3NV2A 2ORZA 3A4UA 3GCXA 1J3RA 4N43C 1IQAA 1E5IA 4RYDA 3U78A 2YPDA 3PNAA 4XFIA 5I0RA 4NRPA 1CX1A 3JXSA 4AK3A 4YVWA 4AVBA 1CZSA 3N35A 3ZPOA 4DXRA 3VBFC 3VBUB 2ZEYA 3QBQA 4BQ4A 4PIZA 4D94A 1H0BA 3WDWA 1MS0A 3ILNA 3UGGA 3WDVA 3B01A 4B3NA 5A32A 2FDIA 2MEV1 3JCIA 1DBNA 5IVVA 3OF1A 2OPWA 3IIIA 3CHXA 3I2DA 3P6BA 5FZHA 4R4ZA 1H1IA 4XBLA 2PHXA 5FOJB 3E6CC 1ACCA 2A6WA 3M1HA 5BNQA 4GALA 2A1XA 3Q8BA 4CEYB 2HBTA 2DTWA 4HKLA 1ULEA 1FMD1 5A3TA 2C0ZA 5HPOA 5EHDA 4MG2A 3AZVA 2ZX0A 2DCJA 3CZUA 3PVNA 4ASLA 5AFBA 5LA0A 4DEQA 1H1AA 4W8JA 1PNFA 4CP9A 4MSVA 4LUMA 1CQ9A 3K75B 1SG3A 3ZYJB 2PHTA 2VQTA 2BOIA 3DECA 2RJLA 2Q8EA 1LENA 4L2NA 3IIAA 3RWKX 3WNPA 4M4RA 4Q26A 1VBE1 5JSRA 1YIPA 1PIV3 3U14A 2BGPA 2A6ZA 4OVEA 4XF9A 3AL5A 2J42A 3ME2A 5C5TA 1OPOA 5G04L 5IVEA 3VHNA 3VBFB 4AAPA 1NXMA 4YFZA 3BI3A 3WXPA 4CXWA 1UMIA 5FZKA 3EJKA 3ZDVA 4UFHA 4E8DA 3GXUA 5JDBA 1BMV1 4F83A 1J84A 3WF4A 1CJDA 2KM2A 3SCGA 2DU1A 4BISA 3O1PA 1HV0A 5EV7A 3ACLA 3BTAA 1VMJA 2RS12 2DV9A 1C8M2 4GJZA 4A2UA 3AZXA 1CIYA 4L0PA 3E5XA 2Q0AA 5JVVA 1ZREA 3GZTB 3MW4A 2Z69A 4OZOA 1UYPA 3WUCA 1UX6A 5BYNA 1YO8A 3VKOA 3USSA 2IFRA 5C3SA 3ZXKA 1GQPA 2IVIB 2XJUA 5CBLA 2AACA 1MS8A 1RITA 2W5FA 2D40A 3J7MA 3KHBA 2ZX1A 2YY1A 1AYN1 1OOPA 1BCXA 1O7FA 3I3DA 1L7LA 3FLTA 1UMHA 4OI0A 1UY0A 1WA6X 3D0JA 4P5YA 4ZXEA 4YW2A 1W8OA 3EYPA 4WVVA 1YQ2A 5IVYA 4BYYA 3HAGA 3CLPA 1C1LA 1HRI2 2WS91 4JGZC 3WEZA 5IVBA 1N1TA 2Q5TA 4YWAA 5LA2A 1R083 2PFWA 2OW4A 2B9UA 3BCWA 5FXZA 4K6BA 4UW6A 5JR2A 2FDHA 4Y1VA 2G9FA 4AEDC 5BNOA 1NAEA 3J8F1 5K8SA 3FZ3A 5EYYA 2DVAA 1S1AA 3JD73 3OUHA 1Z78A 1YC61 5FYIA 4D8MA 5JSPA 4CDWA 4MHUA 3VD5A 1GFF2 2UYBA 2A75A 1RUD3 2K46A 1VALA 4IV3A 1C8NA 1Z0HA 1EYBA 2D6KA 3WQ7A 3WQ0A 1NXD1 1D0GA 4I3GA 4LORA 2R0FA 1WW7A 4NOTA 4CUBA 2JWPA 2N7GA 1US3A 1UZYA 4UFIA 3VB9A 5A70A 4LITA 3VDDB 3O0XA 3MIFA 1FXZA 3D4KA 4QPIC 3OJBA 4RHV1 1NLSA 1VBB1 4YSFA 1J1LA 4H7LA 3ZYBA 1WW5A 4INDA 3RJRA 3M70A 5FYSA 1ZBA2 1UZVA 3JB4C 1FI2A 2YYOA 3FFQA 4FXKB 1OHFA 4AHXA 1TVGA 3FN9A 1RUE2 4M3CA 4YZ1A 1GYKA 3B02A 4NJ4A 4FOYA 3WNKA 3VKLA 1MZ6A 3I59B 1ZRIA 3K4AA 3GYDA 3Q8FA 4AEDB 4UXAA 1FV3A 4ISQA 5IT6A 3ES1A 4TWTA 1ONAA 2V4AA 2JECA 5FWJA 5D2AA 2XVKA 3IPVB 4BLIA 2PHRA 2XWBB 1V9U3 2W68A 2YFZA 4RR3B 4NRMA 4QQ2A 3H3UA 2WZEA 4IEVA 3ORJA 2FQPA 4RSUA 3TN93 2JKBA 3HJRA 5ACA2 1CGPA 1IS6A 3FHQA 2YDEA 2BWAA 3SKVA 4P5HA 4XXAA 4BZ4A 1Q3EA 1HJGA 5J3UA 2XLFA 2H0BA 4AI1A 1OD3A 3G6JB 4FTSA 2P3KA 5DZFA 4CUGA 3UV9A 1IS3A 1XQNA 4BMBA 2CTVA 1J3QA 1HXS1 1OURA 1NA1C 4DRVA 3VV1A 5T52A 4LBKA 1LHUA 3UT0A 2V72A 4EROA 4FPKA 1CVNA 5IATA 1CD3G 1WLDA 2TNFA 1W8NA 4ONUA 1G9CA 4QM9A 2ERFA 4ET7A 4Q0UA 1XYOA 4LA3A 3CIHA 5KWRA 1BK1A 3NMBA 1W06A 4QU2A 4YPJA 3ZXGA 1QJFA 3KQ4B 4NRQA 1TME2 4M3CF 4CDXB 4QPGA 3K46A 1C8M1 4EV0A 1UAIA 3J7LA 5A33A 3S7EA 4GB33 1BZWA 2VVEA 4DXSA 4YM3A 2BEOA 1CR7A 2W52A 2BDRA 2XUEA 4Y5SA 4ATFA 2R32A 2TBVA 5FBZA 1YFUA 5D8AA 1AXYA 5LA1A 1HKDA 1WWYA 3FHIB 1F15A 4CCOA 4RGGA 4Z2AA 3IB3A 2WKKA 2IXKA 2JDMA 2OQ7A 2WNVB 1GWKA 3AL6A 5DAQA 4SLIA 1W28A 4KI5M 1HRI1 1NA1B 4LMFA 4QB2A 2DVFA 4NR1A 5FZOA 1COV2 5LEJA 1NY72 5C4WC 4KGQA 2Y6FA 3J4UH 4E2GA 1CN1A 4FPGA 2BW8A 5A3OA 4XFFA 3EMRA 3VKFC 1C4RA 3FLPA 1UN1A 2FCVA 3AMQA 4QX3A 4YZ4A 1JMUB 3WDYA 3T1LA 2ETEA 1QJU3 5IAXA 1CAVB 1MQTC 1IPSA 2LUWA 1NCRC 1PGSA 4PLMA 1A3KA 4IV1C 1VAVA 3HBZA 1O6UA 4Q29A 4FPEA 5A80A 3J7HA 3ILFA 1DGWA 1NCQB 5F3IA 5GZDA 5CISA 3GHNA 1FOD3 1NQDA 2WWUA 4W65A 1O4ZA 2HWE3 4K21A 4WM7C 3MIGA 2J1AA 5I0TA 5CA6A 4N9IA 1RVF1 5CAZA 1QJEA 3AXDA 4AQ6A 1BK0A 4TLGA 5FZFA 1G9BA 4W6YA 1AR93 1OT5A 1RUI2 1ZM1A 2EIDA 2VMIA 2Q8CA 3W59A 5L19A 4GH4A 4BLJA 5FLIA 4DOUA 5JI7A 5KC6A 1LODA 2XVGA 3K77A 5KHIA 5IHRA 5EJ3A 1K5JA 2EF6A 4Y22A 1H2MA 1ZBA1 1AVBA 1H2NA 3N7JA 1DGWX 3J9SA 4LHSA 1O59A 2VO5A 3WF0A 1O5UA 5H9SA 4HFSA 2CYFA 3O1SA 2E6VA 3WV6A 4CU6A 1RUE1 5DDJ3 2RDSA 4PLNA 4ZU4A 3P3PA 1S0FA 5FP3A 5L9RA 2WC2A 2OKXA 5JIAA 2V09A 1WBLA 4JRAA 3DPRA 1OMIA 3OG2A 3TBDA 4YZ3A 2FBEA 1W39A 1AL22 1OPMA 1WW4A 1ULGA 1UW8A 4LPLA 1MQTB 1NOVA 4JVAA 4R9DA 4XETA 1PVC3 1FNYA 3H8XA 4IV1B 3C3VA 4J1XA 1AYM2 3SMHA 3OY8B 3H8RA 4JX0A 4AW7A 3KS7A 3SITA 4WM7B 2ZHLA 4PJYA 4XJ8A 3PLQA 4P9LA 3OOXA 2YGLA 1D2QA 4O65A 5EWSA 5ACA1 4B1MA 1G86A 1GP6A 3B5LB 4MGYE 1BEV2 4GKXA 4KL1A 3VDAA 1U5IA 1LHWA 2RG4A 4E2QA 2ZEZA 4ZHNA 2WQ8A 4IE7A 1CESA 3NL1A 3EO6A 2D6PA 2V5DA 1OVSA 3AJZA 2VGDA 1J83A 2YXSA 1EUTA 4DZGA 4YRDA 5G05L 3ZN6A 4URAA 5DN2A 2YV8A 4A7YA 1H2LA 1WMEA 2DFBA 3ETPA 1V70A 1TQ5A 3AMPA 3AM2A 1Q8QA 3TB0A 2A71A 5FKBA 3RDIA 3WNNA 4CP0A 5KXBA 3OEAA 5C8CC 3N9OA 1JZ5A 4BIFA 1GMMA 5A7WA 1TME1 1YIFA 4QQHA 1N1VA 1WCDJ 2VCCA 3MIBA 1DF0A 3PUAA 4G3YC 5F37A 2DUPA 5L36A 5A7NA 1DGRA 1GZ9A 2ZEWA 4A7ZA 4KU7A 4Y1XA 5FIXA 2E9QA 1TE1B 3AVSA 2BTVC 1GNHA 4OI2A 2XDVA 3THCA 3T0DA 4Q8LA 1X36A 1XNDA 2XQXA 1GP5A 5J09A 3N9PA 3LA7A 4FPLA 1PZ8A 2VMGA 3WQBA 4BQ2A 1NLQA 1W3XA 4U36A 4P9WA 3I54A 2OX0A 1QIQA 1O4TA 3ZFGC 3KCXA 4Y5TA 4LHNA 2XJTA 1GQHA 1VRH3 2VXRA 5JOXA 4Z07A 1PMHX 3GBGA 2XGXA 2R073 4FFHA 4M01A 2DVGA 2RM23 2DCTA 1M4WA 1COV1 2XBO3 1NY71 4XDQA 1RUG3 3ZLIA 4CTEA 1NQJA 3HD8B 2C5DA 2D7FA 4RN5A 3VKNA 2JE8A 1UY4A 1UD1A 3VBHC 2E31A 4J1WA 3I2JA 5FV3A 2WQZC 1YQ6A 4PDWA 2GMPA 1A6CA 1AJOA 1KGYA 2A3WA 2NMOA 4NHYA 4QX5A 3UJOA 2R043 5C8CB 3VBRC 3THTA 2W94A 1ENRA 4YW7A 1WMDA 5FMBA 3TOJA 3GBWA 5T3NA 1STMA 1VE0A 4NIAA 5E89A 2HWF2 1AXKA
chains in the Genus database with same CATH topology
1D2SA 1B09A 3WNXA 3ROUA 4PIXA 5T5PA 1RUI1 2NYYA 1T6GC 3EHKA 1UZZA 2AYHA 4KWKA 1ULDA 2G9GA 1W0PA 4QXKA 3RS6A 4COVA 3ZFGB 3OCPA 4FVVA 4P9GA 4RS5B 5F6LB 1K5MC 3I7DA 2BNMA 3VBOA 4QM8A 2DUOA 4X6RB 3CNAA 3AFGA 3AZWA 2JG9C 3PVBB 1W6NB 1ZYBA 1ZNPA 4HANA 3MW3A 4PIYA 3ZVXA 1RUNA 4RL7A 2ZACA 3VBHB 3FX3A 3V0BA 1AL21 1HQLA 4HKWA 4D69A 2E7AA 3H8UA 2HWC2 2GC1A 1OFSA 3OD4A 4BHPA 3RG0A 1PGW2 1AYM1 1KS4A 1AR73 5BPXA 4L8QA 3RWNA 3ZYRA 1LOBA 1BQPA 1XE7A 5BNNA 1C1FA 5T50A 4GMP1 3K51A 3ZYGA 4BA6A 3HT1A 3M8LA 5J98B 1BVVA 1EV13 2D3PA 3PVOA 2NM1A 1R082 1SLBA 1TEIA 3ZSKA 5I93A 3CJIC 5GJ6A 2DF7A 2AH2A 2O8OA 2XL9A 2ZMNA 3INAA 5GLWA 1SQ4A 3AP6A 3BODA 4AQTA 2X5IA 4OLLA 1W6PA 1BYHA 4N53A 4O9GA 4WVZA 1JUHA 1B35B 1PK6C 4OUSA 3R05A 1GZCA 1ASJ2 2VY0A 2VPVA 5FQ0A 3WG4A 4YG6A 5JZGA 1SLCA 3ZXEA 4HLTA 4QQPA 1A8DA 3LB9A 1HLCA 2OZJA 5A3LA 1R1A1 1YXWA 2A6YA 1LOEA 5E16A 1H9WA 4H3WA 3SISA 1I3HA 4QGMA 2WQ4A 1QU0A 3HIFA 5JCTA 3AP9A 5FMOL 3WHTA 3V0AB 1LOFA 1WMFA 4F7ZA 4DXZA 1MEC2 4IEOA 1QH7A 3C2UA 5KXEA 5FOBB 1OD5A 1W2UA 1ZBE3 3FWEA 4HBNA 2QZ3A 1SBFA 1YFWA 2H0VA 4WVWA 2DFCA 2JJ6A 1V9U2 1VBD3 3QOPA 3WP5A 1PK6B 2WFF2 3KCYA 4JDOA 3NAPC 2EXKA 3TN92 3IN9A 2HWF1 1GNZA 5KBFA 1RJ8A 1WUVA 2GALA 4FP3A 3HMYA 2DUQA 4C1WA 4YVSA 5FFOC 4FQZA 2A6XA 3KQRA 5I0SA 3O14A 1ZZ8A 5JIUA 1NLRA 1CAUB 1CAXB 1V00A 3MPBA 3WCRA 4FBFA 2OIIA 4XHBA 3X29B 2ZGMA 4AG4A 2CY6A 4JGYB 3KT7A 1UMZA 4QQLA 1LTEA 1WLCA 1E57A 4RGAA 2AR6A 2Z2SB 4I02A 5ABJA 3JQXA 2PAEA 1VBA1 4YG3A 1EAH2 2CL2A 4RQPA 1RUF2 3B9CA 4IEUA 4MGKE 2HWC1 3EXUA 4YVWB 1LGCA 3AXEA 1YI7A 5JLVA 2SBAA 2XLAA 3IM0A 3WDTA 5DUXA 2MPFA 3LWCA 4AF9A 4XF0A 1FPN2 3B69A 3TWIA 2B45X 4D7YA 1ND2C 4TSVA 5A32B 3NWKA 3O12A 2ZGNA 2ZZJA 4JTOA 1FAYA 2PAKA 3AYCA 1O5LA 3BOPA 3ZXAC 2PQQA 2QKDA 1L3JA 1H30A 2NQYA 4WM8A 5L7OA 3POWA 1J1TA 1KQRA 2JE9A 4WVMA 3SH3A 3GZUC 2KXLA 3ZIWA 3RI8A 4HK9A 1F9KA 4MXVA 4Q4V2 1QJU2 1DGRN 1DQ0A 1UF2C 4K20A 3ES4A 3VBUC 3ZN5A 5EFUA 4URTA 2QZ2A 3FUOA 2HWE2 1ASJ1 4Q4W3 1QDCA 4YW3A 2WZR1 3KZ4C 2ZGKA 5AFEA 4AI8A 2VNOA 4Q8KA 1S0EA 5GLTA 3SHRA 2BFUS 2VOKA 1R1ZA 4PCRA 1HDKA 4AI2A 1I1EA 3V56A 1AR63 3AMNA 2OUJA 3AP4A 1ND2B 2ZGOA 2UU8A 2ES3A 3USUA 4IV3C 4I2OA 1X50A 2LM3A 2Y0OA 4AFCA 2YZ4A 4ZU5A 1ZZ6A 2WSVA 5FMOS 4DY5A 1VBC3 1XNKA 1XNBA 3BB6A 3D82A 1A8MA 5GZFA 2A70A 3AZYA 1MEC1 3UKTA 1N1YA 4S2DA 3AKRA 4FPCA 2D6OX 3TRSB 3LCPA 3WW3A 1D4M3 4AGGA 2D5HA 2F4PA 5FO8B 1PVC2 4GMP0 1SFNA 5CFCA 5GKAC 1V9U1 4OULA 5HXVA 2WFF1 2B46X 4UBHA 1RC6A 2ZMKA 1QXJA 1YI9A 4HVRA 4GKYA 3TN91 3B93A 2VW2A 1GANA 2P2KA 4BOWA 1GBGA 4I0BA 2VECA 3K48A 1TMF2 3IT8A 3HR9A 2DWRA 3MFAA 5F5QA 3PMEA 2NZ9A 4C1XA 4GA9A 2UWAA 3S7IA 4ISRA 3ECQA 4IV3B 1VR3A 1IKQA 1FATA 3KSCA 4AI3A 3DKWA 2GH8A 4FOWA 4EJRA 1WLTA 2UY9A 4N9HA 4XMAA 2DCZA 2ZX3A 4EWDA 3QH7A 1EAH1 1RIRA 1ND3C 3LA3A 2PA7A 1G8WA 2G4IA 1RUF1 3AFKA 2CWMA 2YUEA 4HPKA 4AVSA 4M3CB 4OHXA 1J3PA 2D6NA 1POV3 3VZNA 4JV4A 1FPN1 4LBNA 4AEMA 2PHUA 3ZMNA 4I0AA 4BM8A 1PNGA 2WNUC 1VRH2 3PVEA 2ZGUA 1ZVFA 2R072 4MGZE 4OHYA 2Q1MA 2PHLA 2RM22 4R9AA 3VDDC 4DINB 3VBSA 1FNZA 3JBG3 3R4DB 1GZWA 4LE3A 4Z2WA 2RMU3 2QUOA 2CWSA 4Z1VA 1X82A 3MW2A 1SBDA 4Q4V1 5FCCA 2RS53 1RUC3 2A3XA 4K3UA 4LE4A 4OI1A 1VLNA 1QJX3 2JG8A 5JWPA 1ND3B 1BBT3 4B29A 2DCYA 4D3WA 4FPJA 2ZHNA 1AX2A 1W6MA 2VULA 3S6PA 2CAVA 1RMU3 1V6NA 2E51A 1QQP1 3NSTA 4RR3C 1Q8VA 2WNUB 2WA3A 4FOQA 4Q4X2 3WP3A 4X6QB 5K0UC 2GN3A 4QPGB 1EPZA 1YCIA 3IWZA 3ZSEA 4OI4A 3VN4A 4L97A 4CDUC 5BNPC 4Q2FA 5T54A 1F5FA 2HWD2 1XYPA 1R092 3R4SA 4CEYA 2W08A 5H9PA 3WY6A 5D8AB 4YZ5A 1CPNA 4FT8A 1PVC1 5FPZA 4LT5A 5FPXA 3E5QA 1AR72 3L2HA 1QKQA 1EY2A 1V6MA 4R52A 4YNIA 1KDMA 1ZZBA 4AEKA 1H8VA 4CDXC 1TMF1 3H50A 4GULA 1QXRA 3MEPA 3VL9A 4N43A 1RGSA 5C8WA 4HL0A 1EV12 3VBFA 1IS5A 2ARBA 2RS32 4XJAA 4C90A 5K0UB 1J59A 4Q4Y2 1HRV3 4ZXKA 4Z92B 3D8CA 2XPJA 3E97A 4KG8A 3DUIA 2VW0A 4CDUB 5BNPB 2HEVF 1RHI3 1V6LA 2WNVC 5JOYA 1MS4A 4LLFA 2D3SA 2VNRA 2IZWA 3GNEA 4CP2A 1YLLA 3SH4A 3W9AA 1MR5A 3I8TA 4Y22B 4META 5JI9A 1PO23 1JOJA 1RUJ2 1DU3D 4XFHA 4AFDA 2XUMA 5L73A 1QOTA 4NHKA 2SLIA 4LR4A 1HX6A 4XFAA 2MEV3 2ZGPA 5IK7A 4FPHA 2K2SA 3NKGA 1NCQC 2RS11 1LB2A 4XMIA 2NP0A 2WT0A 4LO7A 4XBQA 4AFBA 2ZGLA 2GNBA 5I0UA 3MLJA 5CIRA 2H6CA 2UWBA 2R071 4XBNA 3ALQA 1FMD3 4HT1T 2GNTA 3LKJA 1V6KA 2IXIA 2R1DA 2Y26A 3WCSA 1ZBE2 3AKQA 1EPWA 1OFNA 3BPZA 5T5OA 4FCAA 4MYEA 3JZVA 2CGOA 2EAAA 4QT6A 4E27A 1VBD2 2VOVA 3FBMA 1VBE3 1H2KA 2WT1A 4W6XA 4XQDA 3OGJA 1W0OA 1LKNA 4Y1UA 4DMIA 4YFWA 1TNRA 1MS9A 3IDCB 4YLZA 2B42B 3ZN6B 1F5JA 1VAKA 1X33A 1O3QA 2XJQA 5JR7B 3MF6A 1SEFA 2W0XA 3M4FA 4U2AA 1UL9A 4M00A 2D6MA 3HWJA 4FTEA 2XJRA 1CJPA 5JOWA 1LU1A 4Q4X1 4RFT0 4JGZA 3WW4A 1MS5A 4AHYA 2X29A 4COWA 3IMNA 4AEDA 4LUKA 3UK9A 4MLOA 4XXPA 5GLUA 1KDKA 4KU8A 3URFA 3PTYA 4XF1A 1LULA 2HWD1 1AYN3 1G9AA 1R091 1VIWB 1W6OB 3ZXDA 5F6KA 3NKTA 1XU2A 2BGCA 3JQWA 2XJPA 4KGGA 2B5HA 1AHSA 1ZRDA 1REDA 1N3QA 2QDRA 1AR71 1FT9A 2XHKA 3RNSA 3H9AA 2OZ6A 2WS93 4AE2A 4LBQB 1YYNA 4QPIA 1HV1A 4MGIE 4AVVA 3J8F3 4AHZA 1ZZCA 4Y20A 4Z82A 5F9TA 1C5HA 1DQ2A 4XQWA 2WZPP 1EV11 5FDBA 2JD4A 2CGNA 5KHGA 3JB8A 2RS31 4N7IA 1ULCA 4DPNA 3P3NA 1RUH3 3QD6A 4Q4Y1 5C9AC 5J37A 1A78A 3FC0A 4TYSA 5SV8A 1QHDA 4RHV3 3DF0A 4R4XA 1VBB3 1LGNA 4M0HA 1JYCA 4H7MA 4MV2A 4PLOA 4S2FA 2R6QA 3VHRA 3UKNA 1OA3A 1YRZA 4PBPA 2PHDA 1DLLA 4N90A 3MPPG 1RUJ1 2BPA2 3VBOB 4ATEA 3RYRA 3O0WA 4HSLA 5E8AA 1O4YA 3VZMA 1AR62 1FYUA 3ETQA 3FLRA 2TUNA 2EXHA 2WSUA 2VU9A 4ASMB 1AR82 1H9PA 4CRQA 4COUA 1Z7S3 2ZKLA 2PLV2 1NA1A 2WWSA 1XU1A 1H8TC 2ET7A 3FMGA 3SXWA 3ELNA 2PTMA 3V0BB 3SNMA 2GC2A 3H0OA 4MUVA 4NPRA 4BMEA 4OFGA 5JZGC 3BU7A 3OYWB 3MLLA 2ZZQA 4QPYA 5C9AB 1ZBE1 3ZXLA 3B00A 1UU5A 4IEXA 1D4M2 3VZJA 1Q8PA 4RS5C 5BNNB 4HVQA 3M3EA 1VBD1 2GC3A 2H6BA 2XH6A 1HXS3 2LTNA 2EIGA 3MFCA 1OI6A 1LEDA 2ZGSA 4B7KA 1Y3TA 4AGRA 1ULFA 1EP0A 3RZZA 2O0OA 4IETA 2YC0A 2O1QA 4I01A 5KHJA 4NN0A 2X5IB 1W6PB 4COYA 4N53B 1C8M3 1SLLA 5C4WA 2R1BA 2WFPA 4IXLA 2HWB3 3V65A 4CDQC 1GR3A 4FAGA 3THPA 5FQ0B 1KFXL 5JZGB 2V5YA 1PIV2 3WUDA 1XXNA 4YW1A 3H3ZA 1DZTA 2PHFA 1MQTA 2XL7A 1NCRA 4CEWC 1MACA 3ILRA 4KBBA 2UURA 1BXHA 3OY8A 4LHKA 4WM7A 5FTTC 3U10A 2IXLA 2XJVA 1DDLA 4YYOA 4AFAA 2GU9A 4AXOA 3DV8A 3H1YA 1WCSA 3WDXA 1B35C 1N47A 4LHLA 4J6GA 4IEPA 4IQPA 4DRRA 1S0CA 1KFUL 2IWGB 3NV4A 2A6VA 3JBG2 4NWVA 1JN2P 3RQ0A 4YW4A 1SCRA 4YGEA 2RMU2 2C1FA 1SDWA 1DZQA 3S30A 1S0BA 1RVF3 2A73B 1CONA 2GMMA 4CDQB 4WZCA 4XIKA 1S0GA 4MH0E 4S2GA 1DQ6A 1BEV1 4W6WA 2HEWF 2VUAA 2R063 4EWEA 1QJX2 3OGGA 3WX5A 3AX4A 4FPFA 3DL3A 4XF3A 1DFQA 1ZBA3 4CEWB 1VAMA 4L92A 1QOOA 1JXNA 1MS1A 2GNMA 1CAWA 1OLQA 1X8EA 1V6IA 3JD72 1LR5A 1YUDA 2VOXA 2IC1A 3O5SA 5GLZA 1RUD2 4P9JA 2EXJA 5JSOA 4XILA 2R49A 1PZ7A 2R16A 3ASIA 1REFA 5GZGA 1QJZA 4XF4A 2QNKA 4XOGA 1AR81 4LBMA 1YWKA 2PLV1 3KM5A 1ENQA 5CNAA 3ZYPA 4AQ2A 4Y4YA 2UYAA 4RQPB 2EALA 4AYUA 1O91A 4QQOA 3WZ1A 5BUVA 2BFUL 4GQ7A 4OHVA 3VHPA 5C8CA 5ACA3 4MX3A 5JMCA 4FAHA 3ZFEC 5CFDC 2PYTA 3N7LA 4JGYC 4WV8A 4YM1A 1QOSA 4OZXA 2XWJB 2ZAHA 1RUOA 4HETA 4BCUA 1IS4A 1Y43B 4WM8B 5L7OB 3ZFGA 5BXXA 5HI0A 5CB7A 4YVWC 2PELA 1ENSA 1S2KA 1WGPA 4K40A 4LLOA 2P34A 4QGNA 2GMEA 3HQXA 2BBVA 3FFZA 4HVOA 4XZPA 1RHI2 4LBJA 1PIV1 2E7QA 3WLUA 2DU0A 5LK7B 1SLTA 3VBRA 3U07A 1WLWA 2DYCA 3ZFEB 1PO22 3ZYIB 2VVFA 5CFDB 4FPYA 3RPQA 3LSEA 3A0NA 5FO9B 3KLSA 4ORFA 5KXCA 2AZ5A 2VG9A 3PMSA 5IK5A 4L9BA 4E2SA 3RSJA 3MIEA 2P3JA 4AI0A 2HYKA 5IK4A 2BNNA 3MZHA 4GB32 5B2GB 2FHRA 3ATGA 1K5MA 5JPMB 1F31A 1PGW1 1MS3A 3GALA 4QD2A 4MVTA 2RMU1 3J26N 2FMDA 2JG9A 4UBGA 4RD7A 3Q9OA 1OQDA 1RUI3 4FPOB 3AYEA 4L99A 5EYXA 1QJX1 1YNAA 4Q0VA 1ZZ7A 4GWNA 3IDBB 1R081 5D1IA 1I6XA 5DUVA 1N3PA 1LOGA 3B7MA 1N3OA 3JD71 5I8YA 4OUMA 1BMV2 2ZBJA 3D6EA 1JBCA 3W58A 3AMHA 1RUD1 3FBYA 1OOPC 2W39A 1APNA 2DTYA 3RRDA 2VQ0A 1FOD2 2CV6A 1PHMA 5E88A 4BIOA