3R0RA

The 2.3 a structure of porcine circovirus 2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
194
Chain Sequence
HPFTNGIFNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTAFENSIYDQEYNIRVTMYVQFREFNLKDPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Porcine circovirus 2 (PCV2) capsid protein
publication title The 2.3-angstrom structure of porcine circovirus 2.
pubmed doi rcsb
source organism Porcine circovirus 2
total genus 40
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2011-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.950 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3r0rA00
5J37A 3R0RA 5J09A 5J36A 3JCIA
chains in the Genus database with same CATH superfamily
4LHKA 4FBFA 4NHKA 5CVRA 3RG0A 5DAQA 4O65A 2UWBA 2B9UA 4PLNA 1GOGA 1S4CA 4WZCA 3E6DA 3EJKA 2YFZA 3O0XA 1NZIA 1RMU3 2ZMLA 4IGQA 5KHGA 1S0BA 4GALA 2W46A 3GBFA 3WY6A 5JOWA 1QXPA 2WZR2 1UX7A 2QQIA 5JR2A 3VBHB 2WR9A 1LNSA 4EV0A 4PHZA 3KV9A 3RMXA 2GC3A 1CX1A 1AL21 1YLLA 2RDQA 4MUVA 4CUAA 5LY1A 3BTXA 5C3RA 1RUD2 2GMEA 3O1UA 1V70A 1JZ6A 4WM8C 5KXCA 1JZ2A 1S2KA 2YY1A 1DCSA 1WCDJ 2JJ6A 3W58A 4CRQA 2YFUA 1W8UA 3WF4A 3NVCA 1QNYA 1RYYA 1VBE2 1V0AA 4Z2AA 2JDYA 5ERLA 4FXKB 3T09A 4MHRA 1XNBA 4FSJA 4FPEA 4AFCA 5T52A 1FV2A 5JOXA 4C91A 5BNQA 5FPXA 4IEQA 3X29B 4KG8A 1WLCA 3HR9A 2HBTA 2PLV3 2XJPA 3UETA 4PIZA 3BYWA 4HVOA 1W0PA 2VZUA 3VD9A 3FFZA 5KHKA 1MS0A 3LOIA 2R30A 4KH9A 1LOGA 3POEA 4XEZA 3VBRA 4Z8BA 1OUSA 1VBA3 1G6NA 4H55A 1ENQA 1QQP1 1SACA 3MLJA 4Q4Y3 2DVFA 5FP9A 2XKPA 1NOVA 1DIWA 3POGA 1Q3EA 5FJKA 1AX1A 1R093 4Q4V1 3MIEA 5LA9A 4C0BA 2WO7A 2BGPA 3SCGA 2XJVA 3TAYA 4A2UA 2ZGSA 4HOOA 2MEV3 1HXS3 2BU9A 3HNMA 1QNWA 2VOWA 1AYM1 5JMOA 4HANA 3U37A 1VR3A 3AL5A 1GZTA 1ZM1A 2WO3A 1NXD1 3T3YA 3S5AA 2WNEA 1C8M1 4A42A 1GOHA 1G9FA 3H0OA 3WF0A 3ZFGA 3ZO0B 4OFGA 3KSCA 1YIPA 4HKLA 4WVMB 4BLIA 5T5PA 1RL3A 5DZFA 2IFRA 2R1DA 3AYCA 3THDA 1VRH2 4HVRA 1H1IA 4B1MA 4S2FA 4OI1A 1UOBA 4MO3M 3T1LA 5JCTA 1L7RA 2VBDA 4JQTA 4LO5B 2VOTA 1QJY2 2D6LX 2OZ6A 2YBSA 3POIA 5I8SA 5JZGC 2B42B 2JG9C 2ZEXA 3KQRA 4C1WA 2BBVA 2XVKA 2ZS6B 1IOAA 1D0GA 1O4ZA 1IG0A 3NJVA 4O61A 3U75A 4Q0QA 3AXEA 1QJZA 4Q4X3 4COWA 3N7JA 1H4HA 1N1VA 1U0AA 3LKJA 1QGLA 4GMP1 3CBNA 4QPWA 3T2PA 4UI9L 4PQQA 5EJZB 1UZ0A 3AKRA 4ORFA 1W9SA 4WM7C 2KXLA 2VNGA 3FLPA 2C9KA 1H4GA 2G9FA 2VAUA 5FZGA 1X50A 4XDOA 4XFGA 1N1YA 1ZX5A 3Q8BA 4CDXA 4A6OA 2PHUA 5E89A 3RI8A 2XJUA 2A5ZA 2W94A 4QQHA 4ARXA 1RTVA 2ZKNA 2Y0IA 3BIWE 4NRPA 4UW3A 5CFDA 1NXMA 1D4M1 2A6XA 1AL23 2PQSA 3ACLA 2Q1MA 4OZXA 2A75A 2UWAA 1ZRRA 1UYZA 2WWUA 2DVAA 1AR93 3AFKA 3GJBA 2R073 5G05L 1NAEA 5JWPA 2EF6A 4CCDA 2WFPA 2UY8A 3HT2A 4ATFA 3AZXA 3Q9OA 4FAHA 1CPNA 3AM2A 3AYAA 3DXUA 1C5IA 1ZBA3 3DCQA 3EMRA 4BQ2A 1ULOA 3UGGA 4LPLA 4QPGC 1N3QA 3ZSMA 3NSTA 2YUEA 4Z2WA 4QX0A 3FE5A 3QBQA 1UYPA 1KDMA 4BWOA 5IFTA 3HBKA 1F35A 1K12A 1NY71 2VVEA 5ANNA 1ND3B 3WUCA 5C8CA 2RM23 1LHVA 3ACGA 4QDQA 4E2QA 5L36A 1PMJX 2GALA 1S0JA 2RS52 2WNVA 2ZGRA 4FP2A 2WAAA 3B69A 5GLZA 5LK5A 3K3OA 2W87A 4MHUA 5DAVA 3V0AA 1J3QA 4L97A 5D2AA 1XJAA 4KWKA 1T2XA 1BKZA 1JZ3A 1XB9A 2YBPA 3UGFA 2RDNA 5F5QA 1BBT1 2X5IC 1OFSA 1UIKA 2ORZA 1EPWA 1RXGA 2GU9A 2OUJA 2P6HA 2VULA 2ZEWA 3GHNA 4D7SA 1RUG1 2X29A 5K0UC 3V0BA 3H7JA 2EIGA 1FAYA 4ES8A 1TNRA 1VIWB 4BQ5A 2G9ZA 4XTPA 4OMCA 3N35A 1EAH1 3LZZA 1C8M3 1VP6A 2BERA 2LRPA 4NN0A 5ISLA 3AZZA 5FK7A 4DY5A 4AK3A 3ZN5A 3N4MA 2PA7A 3TNPB 2J1RA 2RMU3 3IB3A 1W2UA 2YMZA 5JXHA 3VBRB 3SEEA 2ATFA 3ZYBA 3W20A 3WNLA 4D69A 2ARCA 2DCKA 3O7OA 5HCHA 4TYSA 4WV8A 1COV1 4MXWA 1GOFA 2NP0A 2WNOA 3WG1A 2K2SA 4LJHA 2MEV2 5FY7A 1W03A 3H1WA 4QM9A 5DUVA 1AL0G 1AR63 4LKSA 2XHNA 2QTWB 3GCXA 1HN1A 2VZ3A 3C3VA 3PTRB 3VL8A 3H1YA 1W9YA 4D6SA 2C9AA 5FZHA 1PO11 4AFBA 4ES9A 3N9QA 3KV4A 4IDZA 2NQYA 3LA2A 3MUY1 5BY5A 5IK7A 1MEC1 2JG8A 3IDCB 3CKHA 2HEWF 4CPBA 1WD4A 3ZFGB 2GMPA 3Q8AA 4DZGA 4ZZ8A 1YFWA 3A23A 1DGWX 1H8TC 3SH5A 2RDRA 4IE6A 4CCCA 5IK5A 3MBWA 4P5YA 4GB31 4XQWA 4INDA 1TME1 3I2GA 4J1XA 1RUE3 2DFCA 3WW4A 2QVSB 3USSA 1GQHA 3DKWA 1TVGA 3I3EA 4AQSA 3BCWA 1URXA 4MYEA 2YXSA 4DUVA 1D4M3 3HJRA 2MPFA 4H7LA 4PIXA 5I0RA 4YFWA 4HL0A 4OHYA 4AVVA 4LK7A 5FJHA 3GGLA 3RSJA 4ISQA 2R041 4K6BA 3O1MA 4LO7A 4X6QB 4TN7A 4XZUG 2HJIA 4DY3A 3WT3A 1Q8QA 4DQAA 4A7YA 3SQOA 2W1QA 5I0SA 4P9WA 3FC0A 3SHRA 4ATEA 1V6JA 3KHBA 5E16A 1VMHA 5CFCC 1QU0A 1UPSA 4Y1YA 5T3NA 1O4TA 2F4LA 2D93A 4JKLA 4CDXB 1AL22 1LENA 1PMIA 4P08A 5EHDA 1XNTA 4EN8B 2HWC1 4FTEA 2ZAAA 4HVQA 2FDIA 1DGRN 2V5DA 2XJSA 4QXHA 3ZYHA 4HSJA 5CFDB 3MW2A 3PURA 4XDQA 4AEDB 1UOFA 2AC1A 4NWVA 3VN4A 1AYN3 5A7WA 1DLCA 4CPBD 1SLIA 2Y60A 3DYPA 4EWEA 3FHIB 4JDNA 1ASJ1 3V64A 4LT5A 3MF6A 1RUG3 4AYUA 2UY9A 3VKFC 3CJIC 1IGOA 3IBMA 5L9BA 2GP3A 3K2OA 4DXTA 5FXWA 1NA1C 4YZ2A 3WP5A 5C9AA 5C8CB 1V6MA 1A3KA 1EAH3 1VBB1 3TEZA 1LOAA 2WC2A 1VRBA 3WHUA 3NNLA 5FZIA 4YM3A 1QQP2 5EP9A 3PMSA 4LHNA 4FCAA 1XPWA 3TBDA 3V0AB 1CIYA 2JD4A 2VMEA 1IS4A 1Y9QA 4YARA 1AR81 1YJLA 4Q4V2 1ULDA 2ZX3A 5EJ3A 2HWD1 2WYFA 3LIGA 1COV3 1PHMA 1ACCA 4TSVA 2HWE1 5C70A 1DFQA 1XRUA 5APAA 4W8JA 1AYM2 3JUUA 3H3UA 3WXPA 4D7YA 3V0BB 3GZEA 3U4SA 2IXJA 4Q27A 4GKXA 1C8M2 4QM8A 3UL2A 4AFDA 1BEV3 3JBG1 1A8DA 2VZTA 1QXJA 1PO13 3U78A 4NOTA 1DQ4A 1UZWA 5A1LA 3VDBA 1DZTA 4BMBA 2PAKA 1IHMA 2YGMA 3P3PA 1W06A 2B39A 1GNZA 3DPRA 4CXXA 2ETEA 4BYYA 4IGPA 1W99A 1TME3 1X9TA 4IQPA 5JVVA 5DZGA 2ZGLA 1PNGA 1IQAA 1CAUA 1WWYA 3GDBA 3LFIA 1Y9MA 4PF5A 4QB1A 2P4EA 5CBLA 5J96B 2VMHA 2VTXJ 1ZBE1 4HMZA 1G8WA 3WNPA 2WFF1 2V73A 2D3RA 1KQRA 3QH7A 3FHAA 3WOGA 4OQ8A 3ON7A 3VHOA 1ALYA 5GZFA 4ZU4A 3ILRA 3IZOA 2BEOA 2XLAA 4LKFA 4XUTA 1J58A 4IW3A 3QOPA 3U4XA 3M7AA 1YHFA 4ZU5A 1QJX3 5DUXA 3SCFA 2JG8B 4AXOA 1EYBA 4V2VA 1YXWA 1TEIA 3N3HA 2CYFA 5BNOC 2XL9A 1D4M2 4HN0A 4YW4A 4BXSV 2MNGA 1ULGA 2DBNA 3B93A 1WCKA 5H9QA 2VOXA 4XJWA 5IYYA 5KR7A 2CHHA 2P1BA 2OXBA 5T5OA 3VDDC 1MPXA 3LPFA 1RUF3 4M4PA 5FV3A 3I2HA 5FZEA 3GZUC 3IDAA 1HB1A 1AJOA 4GH4C 5FP8A 2B9VA 1OBNA 5IK8A 2WT1A 4QX8A 1RUJ1 5FY4A 4WM8A 1CIWA 1PX3A 1NY72 5CNAA 4E2GA 3POJA 3R0RA 3VD4A 3FJSA 3LAGA 1E57A 4MGYE 2A3XA 4JX0A 1VBD2 4UYBA 2I07B 1HQLA 1GR3A 4FPJA 4DB5A 2Z69A 5GALA 4CUBA 3QCWA 1BBT2 3KV6A 4ZZ5A 1AR83 5HV0A 1P8JA 5IVEA 1RUG2 2DURA 2UYBA 5A7WB 3RQ0A 1Y43B 5DMYA 2W39A 4XFBA 2C24A 5IT6A 1ENSA 2BNOA 3LQCA 2J1VA 3M3CA 4KWJA 3VD7A 3MFCA 4DRRA 1W2TA 2E51A 3ALQA 1DQ5A 3OGVA 3ZN6B 1W6QA 5KXDA 4JVAA 5FZLA 1EAH2 2D44A 4O9EA 4QB2A 1SQ4A 3JBG3 3MFAA 4CP9B 4LUMA 2X05A 3AZYA 4YVSC 1G86A 5C9AB 3AZWA 3ZSEA 2DCTA 3C7OA 4XUPA 3S5QA 3DL3A 4GQ7A 4LULA 1PM4A 4XJ9A 4E8CA 2BDRA 1F8VA 1IPKA 3OOXA 3ZXGA 1COV2 1W9WA 2VQUA 3OPWA 5FZ0A 1SEFA 4XQDA 4XJAA 1ZREA 1BQPA 5FO7B 2VOVA 1PZ9A 1AX0A 5C7GA 3KGLA 3GM8A 1ZBE3 3BU0A 4ONUA 5JZGA 1PO12 2BOJA 2CV6A 2JG9A 4GA9A 4JDMA 4W65A 2JKXA 2ZGQA 3GZAA 2XGXA 4G9SB 3DKQA 1MEC2 1HV0A 3FZ3A 4Q4W2 4P5HA 3TOJA 1KRIA 3AMNA 1GANA 3NKGA 1W05A 4NUBA 2QZ2A 4RHV1 5IWFA 4GB32 4M00A 1BVVA 2FDJA 3JU9A 1TME2 2VY0A 4CYDA 5K8SA 2UU8A 2E31A 4Q29A 1O6UA 4BH9A 4N90A 2JE8A 4Z82A 3S0MA 1K5MC 4WM7A 3ABZA 4A4AA 4BQ3A 1LOCA 3DPRB 3PUAA 4BQWA 2D3SA 4JHZA 3SLIA 2ZABA 2IXHA 2H0VA 1SFNA 5FYCA 5D8AC 4NHMA 1AUYA 1UNBA 2YDEA 3M70A 4AVTA 1O59A 3J7LA 4LO8A 3OEAA 2OQ6A 2BOIA 2R042 1F4HA 3T0AA 4JDOA 1PZ8A 5H9RA 4XQ4A 5GZDA 1DQ6A 5F8PA 5LBFA 3LGRA 4SBVA 1WW6A 3WX5A 1KD7A 4AI8A 3RZLA 5BPXA 3MIBA 3CNAA 1OQDA 2Q30A 3VBUC 4YG6A 2QNKA 1JW6A 4QXKA 5L73A 3HN3A 3IDBB 2JE9A 2ET1A 2HWC2 3ZSJA 4QPGA 5CAZA 2VW0A 5FY9A 5FMCA 3NNGA 1FPN2 1HB4A 3AXDA 3ZLIA 2VPVA 3OSDA 4QX5A 4YZ4A 3L2YA 5T5JA 1S2BA 1GSLA 2EAAA 1PO21 1NLSA 2QZ3A 2VBBA 1ASJ2 1BXHA 2A6ZA 4E4ZA 2XPJA 4FAGA 2JD9A 3T0DA 2O8OA 4TTGA 4GJZA 1JOPA 4K3UA 2X5IA 4WM8B 5A6ZA 2AUYA 2C0ZA 2QJVA 1C57A 2JXAA 1C1LA 2D40A 2J22A 3JXSA 3KVAA 5IJRA 4B4QA 1VBB2 1CX4A 1LODA 2FQPA 2W52A 3H1MA 1U5XA 4IE5A 5K0UA 4P9LA 2SLIA 4LKEA 4O7XA 3H9AA 3A0KA 5A33A 3O1OA 4CEYA 1MZFA 3A4UA 4QQOA 3VD5A 1RB8G 3NJXA 3WDVA 1AR82 5ACA1 5GJ6A 1XSRA 2HWD2 5JOYA 1IQDC 4KI5M 3PDQA 4XF9A 3RZJA 4JQRA 2HWE2 2JDPA 4B1LA 5IVFA 2I2SA 3BODA 5DAXA 1E5SA 1Y7BA 1POQA 2N7GA 1NCRC 1WLDA 3IIAA 4UXAA 5FYSA 1RUH3 5BNPC 4L9BA 5FXZA 4LE4A 5HV4A 2WA3A 4ZHNA 1EV13 3JBG2 3R4SA 2JB4A 4EN0A 3PVNA 1W6QB 5FY8A 4F3JA 3FN9A 4IE4A 2C26A 3U10A 4CU9A 2ZX4A 2XBO3 2Z4FA 2ZGNA 4RQPC 5C5TA 3GALA 4MX3A 4A41A 5M0TA 3MV11 4JGYC 2ZBJA 4L2NA 3G6JB 5F7UA 1RMU1 1QHDA 2R7EB 4S2GA 1I5ZA 4CXYA 4EN6B 1W2AX 2C1FA 4QQPA 4ASKA 5LA1A 5J7MA 3WINE 1ZBE2 5TSWA 4ASLA 1H8TA 1RHI3 5FZ9A 1GUIA 1U5YA 2WFF2 4CUCA 2CWSA 3CEWA 5BNNC 4BCUA 3ZMOA 1K3IA 5FZBA 2WBKA 1OF4A 5JZGB 4BM8A 1BLZA 1MS8A 2XWBB 2DU1A 5FZ1A 3WG3A 1SLLA 4DINB 4NAMA 1XSQA 1ULCA 3B3QE 3WG2A 3QD6A 3LA7A 4QHBA 4EQVA 4XIKA 2PHWA 3P3NA 3POWA 2AEZA 1JZ7A 1UF2C 5FUPA 5F3EA 4YGCA 2QQUA 2R49A 3I2OA 1UU4A 2ZX0A 5JPNB 4WM7B 3ILFA 1GYKA 2QBXA 2PLV1 3JD71 3PL0A 1RUC1 1PVC3 5CFCA 3T2QA 2DCYA 2RS12 4IEVA 5A70A 2Y38A 3VB9A 4FPKA 2Y6FA 1VBA1 3AJZA 4KG0A 2E7QA 3ETQA 4Q4Y1 3WNOA 1KXGA 1RUJ2 4NIHA 3M3QA 2DVBA 2Y64A 4MV2A 2B4KA 3RJ2X 2OPWA 1AR72 1SG3A 3BOWA 4HETA 2KR2A 5FO8B 2QUOA 5JLVA 3RZHA 5F3GA 4YVWC 2QQNA 1BK0A 1S0DA 2AACA 1XQNA 1HXS1 2B5HA 4V2WA 3VZKA 2DV9A 5IW0A 3W9AA 4MH0E 3CJIA 4Y20A 4PQ9A 3WNMA 2QQLA 4NAOA 4QPGB 4L92A 1NA1A 1NE6A 4DIQA 4D94A 2JICA 5ACA3 1Q8SA 2ORXA 4UF0A 2Y33A 1MS5A 3MW3A 4HFSA 4LIUA 1UY2A 4AVSA 3PU8A 3GXUA 1W8NA 1FOD2 1ZA4A 4DXRA 4XF0A 1PGL1 4DMIA 1EUTA 1JH5A 2JDMA 5J48A 2WL1A 1UZZA 2A70A 3BN6A 5JXJA 4XE9A 4YZ5A 5FYVA 1Z78A 5C3SA 4YZ3A 3WF2A 5A3OA 2X5IB 3WUDA 4TWTA 4Q4X1 1RVF1 2DU0A 2VOKA 5FMOS 3VZNA 1XC6A 1PGSA 5K0UB 3K4AA 4AQ2A 5C3OA 1H2KA 1OLQA 5T54A 1V9U3 1AXYA 5A33B 3JB4C 4I09A 4CEYB 3BIEA 5F39A 1GZWA 1ZZCA 4Y1ZA 5LEJA 4R52A 1GU3A 3IPVB 4PIYA 4R9BA 2TEPA 2VM9A 2ZMNA 1NUKA 4R8HA 2VD7A 2AH2A 4KGQA 4B4RA 4FOQA 4DFSA 3IT8A 4MVTA 1SHWB 4LBOA 5E1RA 3UNPA 4BLJA 2VCAA 4OI4A 4C1XA 3INAA 3E5XA 1R083 4QXBA 5JDBA 4XXPA 1POV1 1UZYA 1AR91 1ZZ9A 2R071 4RHV2 3ZYFA 4ZY9A 5DG1A 1MVEA 4K8FA 1YQ5A 4AEKA 2F6BA 1PGW2 4Q5OA 2ID4A 5J98B 1ZBA1 4QXCA 4JKKA 1ZZ6A 5SV8A 3WCRA 4WZFA 3WG4A 3CHXA 1REEA 3N36A 2BRTA 2YPDA 2ZKLA 1UOGA 4YW2A 1UCXA 4H14A 5FLIA 2C5DA 2GNMA 5LY2A 3K4ZA 1NCQC 2X8KA 2RM21 4Y5SA 3JQWA 3JD73 3H50A 1RUC3 4IUGA 2WS93 1H8TB 2B7YA 4XYXA 3ZX7A 1UQXA 4Q0PA 3APBA 1WMDA 5BNOA 2VZSA 4XOGA 4OHXA 1FNYA 4OQ9A 3RVHA 1XYNA 4W4ZA 1S0IA 4FQ4A 5SV5A 5LZ6A 3BALA 3DYOA 1DZQA 1O91A 5FLJA 1RGSA 4RN5A 5LWBA 1JI6A 3LA3A 2VH9A 3AMMA 3WNNA 3WNKA 2G4IA 1UYXA 4PI0A 4N8MA 3VDDA 3MPPG 1HJFA 2EAKA 4W50A 3GHMA 1O3RA 3I3MA 4GH4A 1GLHA 5DZEA 1DHKB 2VZRA 4YRDA 5A32A 4IEWA 2XJRA 4OHZA 2VG9A 1XBFA 4AI2A 1WD3A 1PO22 3Q8EA 5CFCB 4AOCA 4RGKA 2RMU1 5KBFA 1IPJA 3ZXKA 5B4NA 2RR11 4MGIE 3LDBA 1YI9A 2D6OX 1NLRA 2W3JA 2OS2A 5B4XA 4E9KA 1LHNA 2GC1A 1US3A 2WYSA 5A1FA 4XAAA 1FATA 1Q56A 2VR4A 1JYNA 1DG6A 4KMQA 3PUIA 1IG3A 4XF4A 4AI3A 4B7KA 3ZMNA 1AR61 1OFNA 2P6CA 1EY2A 1R64A 1STMA 5EJ1B 4XW3A 1RVF3 5J36A 2EXIA 2QQKA 2XLGA 5FXXA 3E97A 4K7JA 2GN7A 4YG0A 5ACA2 1F5FA 3CJIB 3H3LA 4Y20B 4N7IA 4PDWC 3WDUA 3NJZA 3ZPYA 1NA1B 5FCCA 3LDKA 4YVSA 2BTVC 2CU5A 2AYHA 4K9SA 4UF0B 1DQ1A 2Q1FA 4AAXA 1V6OA 2BQPA 3HN1A 5AFEA 3TEYA 4ZKTB 5CKQA 3B9IA 3MF9A 1RUE1 3OBRA 3KVBA 4LA3A 4L99A 4XC9A 2R32A 1O3SA 3GBWA 2SBAA 5FZ7A 2EIEA 3VBFB 3BI3A 2QQPA 2NLRA 1WCSA 3PLQA 4XXAA 2XJQA 1WW7A 5EQUA 3AC0A 1OI6A 3M1HA 2BWAA 5KHJA 5LCWL 4G3YC 1POV3 2GP5A 2Z79A 1KS5A 4YM0A 3FBMA 5K7PA 1UL9A 1RMU2 1GQGA 4HXCA 2WJSA 1DQ0A 4ZXEA 3OGRA 3WW3A 1X8EA 2JDUA 2VZVA 1D7PM 2YG0A 5DAPA 4BQXA 1CN1A 1R1A3 4AFMA 3K3NA 1GZWB 1MACA 2VMGA 3KGZA 2CTVA 4D6RA 1HW5A 3OBTA 4L8QA 1DLLA 4GD4A 3BKZA 3J9SA 3FUOA 4MGSA 2JIGA 3OF1A 4FPCA 2VC9A 4BISA 3LOBA 3I3QA 5IVYA 5BV6A 3GJAA 4J1WA 2VNOA 4NPLA 4UFIA 5D8AA 2GSYA 2RS33 1YC61 3K4DA 5IVCA 4AHZA 1QJEA 1AYN1 3KV5A 4I0WB 3J8F1 2P34A 1W8OA 2OX0A 2ZGTA 1YQ2A 2DTWA 3EHKA 4FQZA 3SISA 3VHNA 4BIFA 2D3PA 2WN2A 1LEDA 1UU6A 1W8FA 3ZYRA 1DDLA 3NL1A 4XDPA 1LU1A 3ZDSA 4X8NA 1DZRA 3MUZ1 1OUXA 1U12A 3N9MA 3NV4A 3POYA 4GWMA 2PLV2 2Z2SB 4IETA 1RUC2 2R061 5HCBA 3RPQA 3O14A 3VBUA 1RUI1 1N1SA 5FDBA 2A3YA 2AZ5A 5T55A 3IMMA 5FO9B 2JECA 2R6QA 3T30A 1VBA2 4Y1XA 4BK5A 4E4DX 2PQQA 1AHSA 4GULA 4Q4Y2 2D43A 4DXSA 5IAXA 4I0AA 4P9XA 1LHOA 1MS4A 3EYPA 3OJBA 2XVLA 2ZTNA 4OZOA 3SC7X 3VZLA 1R092 2RR13 3ETPA 3RJRA 1CAVA 4KQ7A 1X8MA 2BW8A 2Y8KA 3I2IA 1JZ8A 1HXS2 3IAPA 4ET7A 5LASA 1F15A 1FX5A 2V4VA 2ZGPA 5I0TA 4GH4B 3VZOA 3WR0A 3BOPA 2DCJA 3I54A 4M0NA 1BEV1 2HH9A 3MHZA 4FO9A 3I2FA 2X09A 1N3OA 3HT1A 4GWNA 1O3QA 1YQCA 5EPAA 3VBOC 5HPOA 3WDWA 1UMZA 4AW7A 2RDSA 4WVVA 5D1IA 5A3MA 2ZGUA 2ENRA 1CZSA 3EXUA 3M4FA 4JAAA 4EN9B 1W6PA 5FXVA 1AX2A 1PGL2 5EYYA 4XAEA 3W21A 5L7OC 2MHFA 2ZOEB 3G7DA 3GBGA 4Q0VA 1ZNPA 4P02B 3WSOA 2H6BA 5CG8A 4JTNA 1WCUA 3VHRA 4CEWC 2A71A 3LSDA 5FWJA 1VBC1 4Q4X2 1J1TA 1RVF2 3L2HA 3WDXA 1H2NA 2XVGA 1NCRA 2VBPA 2OW4A 1OD3A 2PHXA 3ELNA 4ITCA 5BNPA 2HEVF 4N43C 4AEMA 3KZ4C 4JV4A 4IV3C 1HDKA 2W5FA 4MSVA 3S30A 1WW4A 2PHTA 4ZONA 3UJOA 1RUNA 4CP1A 1IKPA 1QY4A 1FMD3 4U2AA 1H1MA 1QJX1 4DNYA 2A73B 4COYA 4OCTA 4RQPA 4EROA 1M4WA 1RUOA 1N47A 1W90A 4LXLA 2PYTA 2IWGB 4JGYA 4XUNA 5DPNA 4X6RB 5EWSA 4EJRA 1X33A 4QKFA 1OH4A 2JDZA 1W0NA 2ARAA 3ZYPA 1TMF3 5JIAA 4BHPA 1W04A 3DUIA 1RJ8A 1AR92 4Y5TA 2R072 1I6XA 3BPSA 5EFUA 3ZYGA 1AF9A 1YWKA 3NAPC 4XF3A 4YLZA 1RUF1 4DUXA 2VCBA 3J8F3 4JGZC 1ZBA2 2L9LA 3LWCA 4QT6A 5DXDA 1DYKA 2J7MA 4LORA 4DPNA 1SDWA 3OUHA 4Q8KA 5HI0A 5F37A 2ZJCA 2FDGA 2ZX1A 2W1UA 5AC93 4FTSA 2RM22 2E33A 5F5CA 5JPMB 3HNYM 2R063 2IC1A 3HQUA 4AGVA 4C90A 2Y6GA 4ARYA 1LKNA 1RUI3 5CKNA 3ZVXA 3O1VA 5F3CA 1GQPA 4TZDA 3UK9A 2JEMA 4UW5A 2WNVB 5FZMA 2HLEA 4GXLA 3W5MA 1JYCA 2WZEA 3E5QA 3IDEA 4IXLA 4KWLA 1QXRA 4C8DA 5D8AB 2XONA 2XWJB 4M0HA 3TRSB 4V1PA 3SEPA 1QH7A 1UD1A 2EXKA 3IAQA 4OLLA 1NG0A 2BFUS 2OPKA 4U36A 3ZXEA 1HX6A 5FZOA 3OEBA 3N9LA 4AR2A 5K4LA 2DYCA 1G7YA 2C4XA 1ZVFA 1LGCA 3MIDA 4FT8A 1UOJA 1Y3TA 4KL1A 4OUSA 3WEZA 1FV3A 5LB6A 4YVWA 4EZ4A 4XUOA 1APNA 2DTYA 2RMU2 2LM3A 2RR12 3ZOIA 5A3TA 4LNVA 4F7ZA 5CADA 2Q5TA 2A6WA 3NNJA 1H1AA 4LIVA 1AR62 1CAVB 1QIQA 1S0FA 5FBJA 2DWRA 4MXWB 2RV9A 3IN9A 4G4FA 5DQ0A 2VTXA 1VBC3 3PTYA 1WUVA 4P00B 5JUVA 4BQ4A 2J1UA 1OA2A 3NQHA 2YV8A 4QWNA 4I0BA 1GZCA 4BE3A 1OOPC 1DYPA 5FYTA 5LATA 5A6QA 3RYPA 4FPHA 1ND3C 3KS7A 4Y26A 4KNCA 3VUOA 1LTEA 1UO9A 3TYJA 1H6XA 3C8XA 3UT0A 2GMMA 3LEMA 2IVIB 1RUE2 4NRQA 3D8CA 3LFMA 4URTA 2IUWA 3I3BA 1W6PB 4AQ6A 4RFT0 4HSLA 2NMOA 1J83A 3OB8A 3C7HA 3UKVA 2WZ8A 3B9CA 4LLFA 1UU5A 2VXRA 4L11A 3NV3A 2HKXA 3MO4A 2EXJA 3FX3A 5F1RA 4CCOA 4JRAA 1NCRB 3D0JA 2BBAA 3E1F1 1PZ7A 4XFIA 4A6SA 1PM7A 1W0OA 2PXJA 1SDDB 5BNPB 3RRDA 1HRI1 2VXJA 4MXVA 4Y3OA 2EALA 3DECA 4BZ4A 1RC6A 2GNBA 2PELA 3MPBA 4QX2A 1JYIA 2WSUA 3D5OA 1S55A 2JDAA 1OD5A 2J1EA 3EO6A 3THPA 1ULFA 1I1EA 2I45A 3LCPA 4M3CE 3U14A 1EPZA 1OT5A 1PVXA 3AP7A 2ZXQA 3K51A 4PBOA 4RQPB 2C6SA 3ZDVA 5IATA 1N1TA 1V00A 1UWWA 3MIHA 3O0VA 4RS5C 4YFZA 1NCQA 2P3YA 2HEYF 3AP4A 3UESA 1AYN2 3R4UA 3HBZA 3J8F2 4O9GA 1JHNA 1SFPA 4PCRA 3A21A 4JRLA 2BWCA 4CDQC 3ZYJB 2Y6HA 3OYWA 2OZJA 5I8TA 4GWJA 4I3GA 1Z0HA 1YIFA 3HAGA 3ZR5A 1DU3D 1XNKA 2A6VA 4P9JA 4KBBA 3GF6A 3HD8B 4K1ZA 3ZXAC 4UWDA 5LA2A 4ZS2A 5A3WA 2WQ8A 4XTMA 4RGGA 3V65A 4BMEA 4KGGA 4URAA 4XABA 5BXXA 1LGNA 3POSA 4YWAA 2OVUA 2VZQA 4HPKA 1YCIA 1PIV1 4YYOA 3OUIA 1J3RA 3OD0A 5A7NA 5J37A 3OY8A 5LEKA 4MGTA 4MOAA 3VDCA 2GZWA 1G9AA 2LW8A 3NJYA 5DDJ3 3B02A 1IKQA 2UWCA 1H2LA 3KCCA 4B8EA 5BUVA 3WNXA 1BK1A 3GYDA 1SFYA 1QMJA 1NQDA 2ZHNA 4R4ZA 3WQ0A 3H8UA 4CE8A 1RUH1 4CU8A 2ADEA 5AVAA 3WQ1A 5FUIA 1UMIA 2XOMA 4CDUC 1BEV2 1BZWA 1EV11 1LR5A 1YJKA 3CJXA 3D3AA 5FZOB 5FPUA 1XNCA 1WMEA 4LBMA 1VJ2A 1L3JA 3BB6A 3KCYA 2XBO1 3RDIA 2HWF3 4K8RB 3ZKUA 2GC0A 1UAIA 2OQ7A 4CZSA 1JYVA 4YVWB 1REFA 1Y9GA 4RYDA 2UYAA 3SKVA 4QD2A 4A45A 2VMCA 2B45X 3T1MA 2VMIA 4NMIA 4PDWA 1MZ5A 5LBBA 1J59A 1W6MA 3LSEA 4AEDC 3CDZB 1VBC2 4TLFA 1MZ6A 5HCAA 4YNIA 2VCMA 1RHI1 2J1TA 3SCHA 2ERFA 2XDVA 5FAXA 4FOYA 1CAUB 2D7FA 3JCIA 5JIUA 4MGZE 3JB8A 1PX4A 4UW6A 2V5YA 3UKTA 2BGCA 2FDKA 5G04L 2WSVA 3U07A 1Z7S1 5F9TA 3SITA 3S7EA 1OLRA 5FFOC 1SPPA 1LU2A 1OLME 1QJX2 2JDKA 5A7PA 1HRI3 5CIRA 1TNFA 1YRZA 3NWKA 2Y34A 4X8PA 2LS6A 1HN0A 1IS3A 1VBE1 3OD4A 5LA0A 5L9VA 2YROA 3VKLA 1ZYBA 3M3OA 2DF7A 2VMFA 2WA4A 1XE8A 3AVSA 3CU7A 2IXLA 3L9JT 4IE7A 4R9DA 4XILA 4AHXA 3THCA 1NYWA 3FUQA 1MVQA 4OYUA 3P5BA 1PVC1 2V09A 4XBNA 3VLBB 2JKBA 4M01A 3T0BA 2R0HA 1JYTA 2UURA 1RUF2 3NMBA 4D3WA 4LO6B 2RHPA 5FTTC 3QH6A 1D2SA 1QDOA 3DF0A 1V6IA 1OH3A 3DXTA 4UBHA 4DO0A 1VAVA 4AZZA 3T2TA 2YC2A 4OULA 2VZ1A 2WQZC 4I3PA 4R4XA 5FPBA 4OHVA 2FDHA 4OI2A 3LPGA 5A3NA 1YYNA 1WBFA 3CZJA 1XE0A 2XR4A 2WRAA 4D8MA 2PHLA 2ZAHA 4KU8A 4MZUA 5BYNA 1H8VA 1PIV3 5C3PA 3IIIA 1NCQB 3K75B 1LOFC 1UY4A 2EIBA 3LDRA 3LF7A 1AZDA 3ES1A 3I3DA 5F32A 4IEOA 4CUGA 3ORJA 4Q8LA 4QPIC 5FZ3A 5FPAA 4B7EA 4AHYA 2XB6C 3WDYA 1GP6A 1OLMA 4ZS3A 4NIIA 2WLPA 5DABA 4UT5A 4NIGA 3P6BA 4FPLA 4EWDA 2F17A 2FDFA 4GWIA 3AMPA 3ZFFC 1GBGA 1W28A 2OA2A 3AL6A 4DRVA 1WMFA 5EYXA 4JC1A 1V9U1 2PAMA 3N9PA 1D2QA 4HG6B 4WBBA 4BPZA 4CCLA 5KXBA 2W08A 1NX9A 3A7QA 3OTFA 4GMP0 4HPKB 2E6VA 3VBOA 1US2A 1UYYA 3OY8B 4XFAA 3PMEA 1AVBA 5CEHA 2BYVE 1OKQA 3D0SA 1QH6A 5FP3A 1IS5A 2E53A 1DP0A 4YM2A 5FQ0A 1WLWA 3AFGA 3PVBB 2CY6A 5L7OA 2D97A 4N53C 4YW3A 1N3PA 3TEWA 2WZR3 2YHJA 1QDCA 4WVWA 5JSPA 1NKGA 2E7TA 4TXWA 4CEWA 2FCVA 1R081 1Z7S3 2IXIA 2XJTA 3N9NA 2JG9B 4PF1A 1RUD3 1VMFA 2WN3A 2ZHLA 3UYJA 2CAUA 2TNFA 1HB3A 2W9XA 4N43A 3J7NA 2JDHA 4YPJA 4F8AA 3CQOA 5FIXA 4IV3A 2BNMA 5ANQA 5H9PA 1VBE3 4NIAA 3WW2A 3H8RA 4XIOA 1PMHX 4LHSA 5FY1A 2ARXA 4J6GA 5CISA 2RVAA 3UV9A 1CWPA 3MLLA 1UY1A 1BMV1 3MDPA 3LEKA 1H9WA 3AMHA 2WS91 2RS51 2FMYA 4FPYA 1O7FA 1W3VA 4XURA 3VZMA 2AREA 3NNFA 4E4HA 4YW5A 5A7OA 3D6EA 4FTBA 3O5SA 1HRI2 1REDA 2XHKA 1CJPA 1XXNA 4XVHA 2IVJA 2VQAA 5E88A 3VDAA 4XJ8A 2FMDA 4Z07A 5JOZA 1HJGA 4LMFA 1SPPB 3E5UA 4LA2A 5FYIA 1JUHA 3NAPA 3J7HA 3O0WA 4UFKA 5A3UA 1ZRDA 4JGZA 1UIJA 5T5LA 2E9QA 4RFRB 1QKQA 5KHIA 2K46A 2JWPA 2PFWA 2W1SA 4META 2W68A 4CU7A 1LESA 4HONA 3HPNA 4A44A 3ZN4A 1WW5A 5FMOL 1MQTC 1OMIA 1RINA 1PK6C 3FFQA 5F2SA 5HCFA 5FP4A 5FPLA 3OG2A 2GNDA 1W2NA 5JI7A 3H42B 3ZXFA 2E26A 3ECQA 4AE2A 4CU6A 2P5BA 1ZRFA 1ND2C 1ZA7A 4IEYA 1TG7A 1UN1A 2EICA 2ZHMA 3KM5A 4LBJA 1HB2A 3KWVA 4HLTA 3RZZA 5A6XA 1H2MA 1F31A 2D5HA 1RITA 1QJY3 1YNAA 4FPGA 1OVSA 4QKDA 5FYMA 1B35C 2ZCWA 2JB8A 5JXGA 4IEPA 1HIXA 2PAEA 2VO5A 2KA3A 3AK0A 4D7TA 3WDTA 3D82A 3LE0A 4RSUA 5IUQA 1YQ8A 1F9KA 2D6NA 2P17A 4CDWC 1PIV2 4YGBA 1UMHA 5F5IA 3MIGA 1ODNA 1HQWA 1MS3A 2BZDA 3PHMA 1M06G 1JTZX 5C71A 2W95A 5FMBA 2VJXA 4QQ2A 1W3XA 1RUH2 4D0QA 2FHRA 1A8MA 4H2AA 5FZFA 3IMNA 5FLHA 4QGLA 2GH8A 2WINB 1EV12 2G1MA 3H8XA 1QWRA 2CGOA 4XZPA 3ITQA 3MICA 2FZ2A 2P37A 1HLCA 3A22A 5J09A 1OSGA 2W91A 3ACHA 2QQVA 2W2IA 3N7KA 4RR3C 2XBO2 1OC1A 4N7UA 4XJUA 2CGPA 3I59A 2D6PA 1NQJA 5FUNA 4Y1UA 3RGBA 3AVRA 2VVFA 4OHWA 3VV1A 4LBLA 1KITA 2D98A 4BXFA 3ILNA 3MW4A 5FR3A 2QKDA 2FCUA 4E4SA 1O8SA 2IFWA 1OOPA 1W6OA 2W0XA 1R1A1 4HKWA 1ND3A 1ST8A 3LB9A 3VBOB 5ABJC 1RHI2 1QOOA 1W8TA 5GZEA 3NV1A 3ACFA 4IV1C 2VCCA 2ZGOA 3DEMA 3I2KA 2ZGKA 3AP9A 5FQ0B 5I8YA 1VAMA 3B01A 1BCXA 1Z7S2 2RS53 2ZACA 3EBRA 5L7OB 4BB3A 3I49A 4QAWA 4CCEA 1KJRA 5FOBB 1CVNA 4ISRA 2RS31 4F83A 1XYOA 3N9OA 4CEWB 5I0DA 2Z42A 2YB7A 2XXZA 5C33A 1LAJA 3BGAA 1F5JA 2E63A 4AVAA 3MGUA 5A80A 2GH2A 4N43B 4P9YA 3DYMA 3KF5A 4IV3B 3IWZA 1CZVA 3HNBM 4AHWA 4GZ9A 4FFIA 4LKDA 1PVC2 3WLUA 3U11A 4JTOA 5H9SA 4LO4B 4D6QA 1YFYA 5BNNA 1KEXA 3TB0A 5IAVA 2TBVA 2OKXA 3AP6A 4AGRA 1BHGA 4DS0A 1LECA 3KHCA 4RS5A 3KQ4B 1Q8PA 2EVXA 4TLGA 1SMVA 3LEIA 4AG4A 4Y24A 5FREA 2ZEZA 2WAOA 3HEIA 3PIJA 2K0GA 4NHYA 2PN5A 1I5PA 4CDQA 3CZUA 4H3WA 3NAPB 1UW8A 3ZXJA 4QU1A 3C7EA 4UFHA 4JGZB 2R16A 4LEJA 4K40A 4AI1A 1QOSA 1JS9A 1W8WA 3RFRA 3M3IA 5GLUA 4XFHA 3FLRA 4DOUA 4XBLA 1TQ5A 3BUCA 1VB2A 2NZ9A 2WT0A 5DN2A 4UAPA 5B2GB 4N9HA 4MLOA 5CA6A 4DEVA 1O3TA 1CESA 5L19A 1AXZA 3RWKX 5FKBA 4AL9A 3TWIA 1KFXL 5DAWA 4B29A 5C4WC 4EYUA 1GZ9A 3B7MA 4QGNA 1WBLA 4CCJA 4J25A 3W59A 3WP3A 1C5HA 1JU3A 3S6PA 2WABA 1VPHA 3AKPA 4Q1PA 3F95A 4BK4A 1E5IA 3H3ZA 2VUCA 2D6MA 4BIOA 2ET7A 5IK4A 2Q8DA 2VZOA 4CDUA 3FWEA 1V9U2 5FZ8A 2VL4A 3OCPA 3NRUA 1GP5A 3HWJA 3KMHA 4FFFA 3NO8A 1CQ9A 5D21A 3VKOA 1FMD1 4XACA 1D0HA 3WZ1A 3H8OA 2J1SA 2AEYA 5A7SA 2JIJA 4P9IA 4CTEA 1YFUA 5FPZA 1GICA 2HWB1 2HYKA 2ZHKA 1G9BA 2VGDA 4UOJA 5A3PA 5IFPA 3SH3A 3BU7A 1TMF1 3BVCA 1CAXA 2BPA2 4PLMA 4ZU7A 1K5MA 1R082 4AEDA 1E5HA 2VECA 4PJYA 4LBQA 2HBUA 2K9ZA 2A6YA 1PNFA 4QX3A 3ZFEC 2W92A 5FOJB 1X82A 1UPIA 2YZ4A 1QJU1 4IEXA 1ZRCA 3I59B 3Q8CA 2J1AA 3B94A 3DGTA 2WDBA 4KU7A 3U0ZA 3NKTA 4MGQA 5CYYA 1L7QA 1WA4A 2RG4A 1JZ5A 1DQ2A 1DYOA 1XU1A 1FI2A 2GDFA 2KD7A 5AC91 1OOPB 3WVJA 4CP0A 1W6OB 2BGOA 1A78A 4QDSA 3MIFA 4XCBA 3W5NA 3JD72 4NRMA 1BMV2 5JAXA 1GWKA 3QLQA 2WS92 2X53S 1JUIA 5JI9A 1XE7A 1VBD1 4N9IA 1CPMA 5EZWA 4BQYA 5JMCA 4MGKE 2KM2A 4FPFA 4QX7A 5F3IA 4AI0A 2Y6LA 1EUUA 4UFLA 5BNOB 2BJSA 2A1XA 2WNUC 1DGWA 3M3EA 3VBSC 1QQP3 3ZXDA 5GLWA 1HV1A 2CAVA 1HRV1 4XFFA 1Q5OA 3ZYIB 4Q4V3 3LIHA 5I91A 3DV8A 1K45A 5FP7A 1V6LA 2GC2A 3RS6A 1C28A 2Y0OA 3VDDB 1UX6A 2LALA 2H6CA 3B00A 2WT2A 5JXIA 5F2WA 4CEYC 1AYM3 1VLNA 1Q8OA 2VW2A 2BP6A 2PHRA 3I7DA 3S57A 2P2KA 4YZ1A 4FOVA 4LBQD 3PU3A 1UXXX 3WP6A 3CF6E 5A32B 2XL7A 4AEJA 5BNNB 2DBIA 4KBZA 4LHLA 3CLPA 3SKJE 2NPIA 3VL9A 3VBHC 3C2UA 2VQ0A 5J1XA 3WP4A 1CZTA 5FY0A 2RJLA 1D4VB 3N7LA 5L9RA 3T08A 4CVUA 4RS5B 3POFA 1JMUB 1LOFA 3AYEA 2DUQA 4AQTA 2QDRA 3N7MA 3LEGA 5FYUA 1KJLA 3RZMA 1JZ4A 3VGIA 4CDQB 4IEZA 4QPIA 2TUNA 4DUWA 4Z92B 2BNNA 2PHFA 4GMP3 2ZEYA 1LCLA 3HQXA 2CDOA 1WCQA 3A0NA 3ZIWA 4Q4W1 5AVPA 3ZFFA 1JXNA 2XH6A 1V6NA 1H0BA 4FPOB 4B3NA 4Q0UA 5CG9A 4YVSB 3D4KA 4ZPIA 2HWB3 3MV01 2Q8CA 5IVVA 3ZIXA 2VUDA 1TE1B 1JBCA 3E6CC 5FYHA 3ACIA 1S0EA 2DCZA 1MS1A 1SBEA 4UFJA 1OA4A 1CAWA 3PJQA 2X10A 2VVDA 1H30A 2CWMA 1HQNA 3CIHA 3LD8A 2NMNA 3CMGA 4N53A 1VE0A 4XF1A 3U1XA 3BTYA 1QJU3 2JDNA 4RGAA 4CDUB 4H7MA 3OUJA 4COUA 3OGGA 2AGSA 2QFEA 1R1A2 3EQEA 5FZ4A 5JSOA 2BFUL 1OURA 1JYXA 2LROA 2V4AA 3O1RA 1OPMA 4GAZA 3HIFA 3IM0A 1GWLA 4XCAA 3R6SA 1VBD3 3KLSA 1UKGA 5FRAA 3WD5A 5JSRA 3GCWA 2RS32 1CAXB 3GNEA 3VZJA 1FPN1 3KT7A 5E8AA 1K5MB 1UY3A 2ARBA 1X9PA 2W47A 4Y22A 3ZPOA 1OHFA 4LBQB 3T4VA 1OPOA 1BBT3 3ATGA 1H6YA 3PJYA 3S7IA 4NPMA 3VD3A 1HRV3 4Z1VA 5EXOA 5DG2A 5FZKA 4MG2A 4XBQA 4XMIA 3ZN6A 5FK8A 2ADDA 2DUOA 2AR6A 4Y33A 5I93A 1JHJA 4CP9A 4XMAA 4I02A 1GNYA 4IGOA 3FMGA 5EV7A 1YQ6A 2JENA 4XUQA 2YBKA 1YUDA 1JU4A 3FL7A 5FYBA 3VBUB 4W6XA 2IXCA 4BOWA 5GZGA 4RD7A 2Y26A 2QCSB 1MQTA 3R05A 1CJDA 4PT6A 1O5UA 3VBFC 1PK6A 1QEXA 3M8LA 5DDJ1 1MR5A 1ND2A 4K21A 5CU1A 3TN91 5GZCA 3SXWA 5CB7A 5KHHA 1ZZ8A 3EB7A 2D6KA 2V72A 3OGSA 5DUWA 1KGYA 4K20A 1Y4WA 1B35A 1FT9A 3R4DB 2EXHA 2XG3A 4LE3A 4LK6A 5K9YA 2HWF1 1LEMA 4XHXA 1MEC3 2ZMKA 2YC4A 1ZZBA 4Q4W3 2VUAA 1EP0A 4CDWA 1S2EA 4QU2A 1RXFA 4P14A 5FYZA 1S0CA 3IKWA 4PI2A 5FBZA 4JZRA 1KFUL 4GB33 1U5ZA 3ENRA 4PLOA 5FZDA 2FD8A 2WIIB 3K77A 3WHTA 3VHPA 1W8ZA 1WGPA 2WKKA 3BTZA 1ULPA 1ULEA 2BVVA 1WZXA 4A3XA 2F4PA 4Q1RA 4R9CA 4XETA 5CKMA 5LBEA 2Q8EA 2VW1A 3P1IA 4QPIB 4CXWA 2R043 3RZKA 1JODA 4XHBA 3WW1A 2QQWA 5GLTA 1XOYA 1FMD2 4NHLA 4RR3A 4AVBA 1U5IA 3FBYA 1LOEA 1NT0A 1WA6X 3CO2A 1SBFA 3J7MA 2HWB2 2LUWA 3ZFFB 2JX9A 3O1TA 2YYOA 5E6HA 1NZCA 1TMF2 2DUPA 3MI8A 4QX1A 5HXVA 4I2OA 5T50A 3O1PA 4XPVA 3VBRC 1O8PA 4JGYB 2HWC3 5KC6A 3HQRA 5JR7B 5ABJA 4NR1A 4IV1A 1MS9A 1QJU2 5FWEA 1FPN3 1YO8A 3JQXA 1VAKA 4P9GA 1CAWB 4HT1T 2EIDA 2NN8A 2GNTA 2DVDA 2RS11 4NHXA 4XJZA 4AGGA 4N53B 4LBKA 1W6NA 2DFBA 3O12A 3I4IA 2O1QA 3AX4A 5AC92 1ASJ3 3PVEA 4NIDA 2XMLA 4CCMA 3TNQA 2ZZQA 4Q0SA 4QKNA 5C3QA 1YFXA 4IE0A 2R062 2QQJA 1UY0A 2BUKA 2YU1A 1AR71 3MYXA 2Y6JA 3PUHA 1RUI2 2WO1A 4COZA 4E8DA 5LK7B 5KWRA 3KT4A 3ZFGC 3DN7A 5A6YA 5IVBA 1R1ZA 3RYRA 4AAPA 1VBB3 3I97A 1WLTA 3OPTA 2ZZJA 4HN1A 3J26N 3BPZA 4IL7A 5LBCA 4RA0A 2P3KA 4R9AA 4A7KA 4LITA 3ZXLA 1GNHA 1LJ7A 1HRV2 2J42A 2ZPXA 2G9GA 4FFGA 3USUA 2VMDA 3NW4A 4I30A 4Y22B 3OGJA 2HWD3 2VNVA 1ODMA 3KCXA 4JKMA 2CDPA 2HWE3 1OVPA 1FOD1 3Q8FA 3TN93 4CCNA 4XFCA 1YEWA 1W8HA 1OQEA 2QQMA 1DGRA 4YGDA 1QOTA 2RE9A 5GLVA 4NO4A 4QKBA 2GAUA 3E6BA 1JN2P 1IPSA 1E5RA 2E7AA 2Y6KA 1UKRA 3PIGA 4FVVA 4W6WA 4EN7B 4BQ1A 3PUSA 1RIRA 3WCSA 4M3CA 4OMDA 4HK9A 2XUMA 4CDXC 1NE4A 4YGEA 4DXZA 1W39A 1MZEA 4OUMA 2XKOA 1MQTB 4NJ4A 1JOBA 3VKNA 1PK6B 4BDVB 5CFDC 5FZ6A 3TEXA 1LB2A 3KD4A 4IESA 1JYWA 2WO2A 4AWDA 4JCKA 1ND2B 1T6BX 4QHOA 5C4WA 4UW4A 2WZR1 1J84A 1S1AA 2WFF3 1H9PA 2NM1A 1ZRIA 4Y4YA 4DEQA 4EWAA 3ST7A 2XQXA 1CD3G 1FYUA 2Q8OA 5A7QA 1XU2A 1RUD1 4FI9A 1ENRA 1B35B 4M3CF 5C8WA 4OVEA 2VUJA 2H0BA 2OUHA 3MZHA 3K48A 3SMHA 1POV0 5C8CC 5FKCA 4KWUA 1PGW1 4CDWB 3OPZA 2XLFA 4IEUA 2WNVC 3MLKA 1J1LA 2IXKA 3HVDA 3ME2A 4FOWA 5F6KA 1DGLA 2R0FA 3AP5A 1XNAA 2R1BA 3RMYA 4Y4RA 1V6KA 4COVA 1WMXA 2VQTA 3ES4A 4RL7A 4BJ0A 2YPJA 5HBAA 1K5JA 3AYDA 3B5LB 4WVZA 1GWMA 1G9CA 3UGHA 2RS13 4FXGB 2WWJA 2Z5WA 2CSGA 1I3HA 1ONAA 1T6GC 2PHDA 2ES3A 1ENXA 2Q4SA 4LQRA 4Y5Z0 3ZFEA 2WLQA 1O5LA 2A7AA 1RUJ3 4RR3B 1OF3A 3I8TA 3ZR6A 2G19A 3WQBA 2D5FA 5F6LB 2YGLA 4AF9A 1IS6A 3HOBA 2LTNA 1AR73 2O8QA 3NNMA 4CSWA 2BV4A 4BA6A 5IHRA 3HMYA 1YI7A 4YSFA 2RJ2A 4BU2A 5ABJB 2P3JA 2PTMA 4CP2A 5AFBA 3AKTA 4CA9A 3FHQA 5LW9A 2ILMA 4HK8A 4IV1B 2ZA9A 1LHWA 2CGNA 4NPRA 2E32A 2XQRA 1AJKA 4E2SA 1TZOA 1VRH1 1W9FA 4YW6A 3ASIA 3OYWB 2WNUA 3VBSA 5C5UA 1W6NB 1BVP1 1FOD3 1OQ1A 2VE1A 4QQLA 1QJY1 4UFMA 5A3LA 5KC5A 4GJYA 5DUUA 2IZWA 5HXMA 3AB0A 5FYYA 4ZXKA 3C7FA 4LTAA 1G9DA 2JG8C 2W1WA 1XNDA 4LUKA 2WQ4A 3OBZA 5FZAA 3RI9A 1ZZ7A 2QQOA 1L7LA 4YW1A 5GM0A 5F5AA 1A34A 2WWSA 3IPVA 4AI9A 4QMAA 5DDJ2 1LOBA 1C3HA 3I2DA 3AJYA 1F4AA 4LLOA 1OA3A 1VALA 1NLQA 3AKSA 3T4HB 3TN92 4Q26A 4EZHA 3USUB 3VBHA 4LOTA 4LOSA 2YC0A 2HYXA 4S2HA 5C6CA 4YM1A 3T2OA 2ZX2A 5CZKA 4Y1VA 3V56A 5FZCA 2GN3A 1SZBA 4W6YA 4OUEA 3UJQA 1CONA 3AZVA 1B09A 1LGBA 2HWF2 2OIIA 4QPYA 4UBGA 3ZSKA 4SLIA 1JOJA 1GFF2 1Q43A 5FY5A 3VKMA 1SCRA 1SBDA 2Q1ZB 3PVOA 4I01A 4M4RA 4M3CB 3THTA 4RHV3 4A7ZA 2RJKA 2B8MA 3PUQA 3UKNA 4CCKA 4NWWA 5A1AA 1K42A 1OXCA 2O0OA 1W9TA 1OKOA 1CR7A 1WKYA 3CL1A 2QE3A 4FP3A 2WUHA 4HZFA 1SLCA 3WQ7A 2B46X 1HKDA 3GZTB 4PDWB 1KS4A 3ROUA 3RZGA 1SLBA 3KF3A 1W6MB 4NROA 2XUEA 1C4RA 4YW7A 1VMJA 3POBA 1BJQA 3KB5A 5FPVA 4QGMA 3C7GA 4IERA 1UXZA 4AFAA 4LBNA 2NYYA 4HBNA 5C4WB 1GMMA 1QJFA 4OI0A 1W2OA 1C1FA 1LULA 5LRRA 5KXEA 3WF1A 4QB6A 4NE9A 4NVPA 3SNMA 4K1YA 5C9AC 3M2MA 3H7YA 4C0HA 1C8NA 4GKYA 2BVBA 2CNAA 2PMWB 1VB4A 1CGPA 2VU9A 1X36A 4JHTA 5EIYB 4PBPA 1J3PA 1DBNA 4HKOA 4ASMB 1UZVA 1O4YA 4S2DA 3WF3A 4QHZA 1Q8VA 4EE2A 2DDUA 3KT1A 2DVGA 1GV9A 3MEPA 4WVMA 3NV2A 1F2NA 4Q2FA 3SH4A 3ZKYA 4AVCA 1S0GA 3ZSLA 5LRSA 2VZPA 3ZM8A 4A3ZA 1PO23 2A3WA 3FLTA 1SCSA 2FZ1A 2QDNA 1FXZA 1KDKA 2ZGMA 1GKBA 2WZPP 3RWNA 1VRH3 1R091 2Q0AA 3K46A 3URFA 3ZFEB 1BYHA 1AXKA 2CL2A 5J3UA 2OYZA 3I2JA 3RYKA 1RJ7A 1SLAA 2MEV1 2O14A 1A6CA 2VTFA 2FBEA 4FFHA 2EA7A 4QDRA 1QF3A 3BTAA 3WV6A 3QACA 4MADA 1XYPA 2JE7A 1X7NA 1GP4A 4GIQA 2OT7A 2I74A 3F2ZA 4L0PA 5IVJA 3PNAA 3DPRC 3O1SA 3AMQA 4LR4A 4YG3A 2AENA 1SLTA 4E27A 2FCTA 1LRHA 5GKAC 5I0UA 2YU2A 5FMDA 4B4PA 3RNSA 3VBFA 2VNRA 1I9RA 3AKQA 1DF0A 1LHUA 3OBAA 3J4UH 3VBSB 2WNUB 1FNZA 3JZVA 2P3IA 1IZ3A
chains in the Genus database with same CATH topology
4LHKA 4FBFA 4NHKA 5CVRA 3RG0A 2UWBA 2B9UA 4PLNA 4WZCA 3E6DA 3EJKA 3O0XA 1RMU3 2ZMLA 5KHGA 1S0BA 4GALA 3GBFA 3WY6A 5JOWA 1QXPA 2WZR2 3VBHB 4EV0A 3RMXA 2GC3A 1AL21 1YLLA 4MUVA 1RUD2 2GMEA 1V70A 4WM8C 5KXCA 1S2KA 2YY1A 1WCDJ 2JJ6A 3W58A 4CRQA 3NVCA 1QNYA 1VBE2 4FXKB 4FSJA 1XNBA 4FPEA 4AFCA 5T52A 1FV2A 5JOXA 4C91A 5BNQA 5FPXA 4IEQA 3X29B 4KG8A 1WLCA 3HR9A 2XJPA 2PLV3 4PIZA 4HVOA 1W0PA 3FFZA 5KHKA 1MS0A 3LOIA 2R30A 4KH9A 1LOGA 4XEZA 3VBRA 4Z8BA 1VBA3 1G6NA 4H55A 1ENQA 1QQP1 1SACA 3MLJA 4Q4Y3 2DVFA 2XKPA 1NOVA 1DIWA 1Q3EA 1AX1A 1R093 4Q4V1 3MIEA 4C0BA 3SCGA 4A2UA 2XJVA 3TAYA 2ZGSA 2MEV3 1HXS3 1QNWA 2VOWA 1AYM1 4HANA 1VR3A 1ZM1A 1NXD1 2WNEA 1C8M1 3H0OA 1G9FA 3ZFGA 3ZO0B 4OFGA 3KSCA 1YIPA 4HKLA 4WVMB 4BLIA 5T5PA 1RL3A 5DZFA 2IFRA 2R1DA 3AYCA 1VRH2 4HVRA 1H1IA 4S2FA 4OI1A 3T1LA 5JCTA 4LO5B 1QJY2 2D6LX 2OZ6A 5I8SA 5JZGC 2B42B 2JG9C 3KQRA 4C1WA 2BBVA 2XVKA 2ZS6B 1IOAA 1D0GA 1O4ZA 4Q0QA 3AXEA 1QJZA 4Q4X3 4COWA 3N7JA 1H4HA 1N1VA 1U0AA 3LKJA 1QGLA 4GMP1 3AKRA 4ORFA 4WM7C 2KXLA 2VNGA 3FLPA 1H4GA 2G9FA 1X50A 4XFGA 1N1YA 1ZX5A 4CDXA 2PHUA 5E89A 3RI8A 2XJUA 2A5ZA 4QQHA 1RTVA 2ZKNA 2Y0IA 3BIWE 4UW3A 5CFDA 1NXMA 1D4M1 2A6XA 1AL23 3ACLA 4OZXA 2Q1MA 2A75A 2UWAA 1ZRRA 2DVAA 1AR93 3AFKA 2R073 5JWPA 2EF6A 2WFPA 2UY8A 3HT2A 4ATFA 3AZXA 3Q9OA 4FAHA 1CPNA 3AM2A 3AYAA 1C5IA 1ZBA3 4QPGC 1N3QA 3ZSMA 3NSTA 2YUEA 4Z2WA 3FE5A 3QBQA 4BWOA 1KDMA 1NY71 2VVEA 5C8CA 1ND3B 3WUCA 2RM23 1LHVA 4E2QA 5L36A 2GALA 2RS52 1S0JA 2WNVA 2ZGRA 4FP2A 3B69A 5GLZA 5LK5A 3V0AA 1J3QA 4L97A 4KWKA 1BKZA 5F5QA 1BBT1 2X5IC 1OFSA 1UIKA 2VULA 1EPWA 2GU9A 2OUJA 3GHNA 4D7SA 1RUG1 2X29A 5K0UC 3V0BA 3H7JA 2EIGA 1FAYA 4ES8A 1TNRA 1VIWB 4XTPA 3N35A 1EAH1 3LZZA 1C8M3 1VP6A 4NN0A 3AZZA 4DY5A 4AK3A 3ZN5A 3N4MA 2PA7A 3TNPB 2RMU3 1W2UA 2YMZA 3VBRB 2ATFA 4D69A 2DCKA 3O7OA 4TYSA 4WV8A 1COV1 4MXWA 2NP0A 3WG1A 2K2SA 2MEV2 4QM9A 3H1WA 5DUVA 1AL0G 1AR63 3C3VA 3VL8A 3H1YA 2C9AA 1PO11 4AFBA 4ES9A 2NQYA 3LA2A 5BY5A 5IK7A 1MEC1 2JG8A 3IDCB 2HEWF 1WD4A 3ZFGB 2GMPA 4DZGA 1YFWA 3SH5A 1DGWX 1H8TC 5IK5A 4XQWA 4GB31 4INDA 1TME1 4J1XA 3WW4A 1RUE3 2DFCA 2QVSB 3USSA 1GQHA 3DKWA 4AQSA 3BCWA 1URXA 4MYEA 2YXSA 1D4M3 4H7LA 2MPFA 5I0RA 4PIXA 4YFWA 4HL0A 4OHYA 4AVVA 3RSJA 4ISQA 2R041 4K6BA 4LO7A 4X6QB 2HJIA 4DY3A 3WT3A 1Q8QA 4DQAA 4A7YA 5I0SA 4P9WA 3FC0A 3SHRA 4ATEA 1V6JA 5E16A 5CFCC 1QU0A 1UPSA 4Y1YA 5T3NA 1O4TA 4CDXB 2D93A 1AL22 1LENA 1PMIA 4EN8B 2HWC1 4FTEA 2ZAAA 4HVQA 1DGRN 2XJSA 4HSJA 5CFDB 3MW2A 4XDQA 4AEDB 4NWVA 3VN4A 1AYN3 1SLIA 4EWEA 3FHIB 4JDNA 1ASJ1 3V64A 4LT5A 3MF6A 1RUG3 4AYUA 2UY9A 3VKFC 3CJIC 1IGOA 3IBMA 1NA1C 4YZ2A 3WP5A 5C9AA 5C8CB 1V6MA 1A3KA 1EAH3 1VBB1 1LOAA 2WC2A 3WHUA 4YM3A 1QQP2 3PMSA 4LHNA 4FCAA 3TBDA 3V0AB 2JD4A 1IS4A 1Y9QA 4YARA 1AR81 1YJLA 4Q4V2 1ULDA 2ZX3A 5EJ3A 2HWD1 1COV3 1PHMA 4TSVA 2HWE1 1DFQA 1XRUA 1AYM2 3JUUA 3H3UA 3WXPA 4D7YA 3V0BB 2IXJA 4Q27A 4GKXA 1C8M2 4QM8A 3UL2A 4AFDA 1BEV3 3JBG1 1A8DA 1QXJA 1PO13 4NOTA 1DQ4A 1DZTA 4BMBA 2PAKA 1IHMA 2YGMA 3P3PA 2B39A 1GNZA 3DPRA 2ETEA 1TME3 4IQPA 5JVVA 5DZGA 2ZGLA 1PNGA 1IQAA 1CAUA 4PF5A 5CBLA 5J96B 2VMHA 1ZBE1 4HMZA 1G8WA 2WFF1 2V73A 2D3RA 1KQRA 3QH7A 3WOGA 3VHOA 1ALYA 5GZFA 4ZU4A 3ILRA 2BEOA 2XLAA 1J58A 3U4XA 3QOPA 3M7AA 1YHFA 4ZU5A 1QJX3 5DUXA 3SCFA 2JG8B 4AXOA 1EYBA 1YXWA 1TEIA 3N3HA 2CYFA 5BNOC 2XL9A 1D4M2 4HN0A 4YW4A 2MNGA 1ULGA 3B93A 1WCKA 5H9QA 2VOXA 4XJWA 5T5OA 3VDDC 1RUF3 3GZUC 4GH4C 1AJOA 5IK8A 2WT1A 1RUJ1 4WM8A 1CIWA 1NY72 5CNAA 4E2GA 3R0RA 3FJSA 3LAGA 1E57A 4MGYE 2A3XA 1VBD2 2I07B 1HQLA 1GR3A 4FPJA 4DB5A 2Z69A 5GALA 3QCWA 1BBT2 1AR83 1RUG2 2DURA 2UYBA 3RQ0A 1Y43B 2W39A 4XFBA 5IT6A 1ENSA 2BNOA 3M3CA 4KWJA 3MFCA 4DRRA 5KXDA 2E51A 3ALQA 1DQ5A 3ZN6B 1W6QA 4JVAA 1EAH2 2D44A 4O9EA 1SQ4A 3JBG3 3MFAA 4LUMA 5C9AB 3AZYA 4YVSC 1G86A 3AZWA 3ZSEA 2DCTA 3DL3A 4GQ7A 4LULA 4XJ9A 1F8VA 1IPKA 3ZXGA 1COV2 1SEFA 4XQDA 4XJAA 1ZREA 1BQPA 5FO7B 2VOVA 1PZ9A 1AX0A 3KGLA 1ZBE3 4ONUA 5JZGA 1PO12 2CV6A 2JG9A 4GA9A 4JDMA 4W65A 2ZGQA 3GZAA 2XGXA 4G9SB 1MEC2 1HV0A 3FZ3A 4Q4W2 4P5HA 3TOJA 1KRIA 3AMNA 1GANA 3NKGA 2QZ2A 4RHV1 4GB32 4M00A 1BVVA 3JU9A 1TME2 2VY0A 4CYDA 5K8SA 2UU8A 4Q29A 4BH9A 3S0MA 4N90A 4Z82A 1K5MC 4WM7A 1LOCA 3DPRB 2D3SA 3SLIA 2ZABA 2IXHA 2H0VA 1SFNA 5D8AC 4NHMA 1AUYA 2YDEA 3M70A 4AVTA 4LO8A 2R042 4JDOA 1PZ8A 5H9RA 4XQ4A 5GZDA 1DQ6A 3LGRA 4SBVA 1WW6A 3WX5A 1KD7A 4AI8A 5BPXA 3MIBA 3CNAA 1OQDA 2Q30A 3VBUC 4YG6A 2QNKA 1JW6A 4QXKA 5L73A 3IDBB 2JE9A 2ET1A 2HWC2 3ZSJA 4QPGA 5CAZA 2VW0A 1FPN2 3AXDA 2VPVA 4QX5A 4YZ4A 3L2YA 5T5JA 1S2BA 1GSLA 2EAAA 1PO21 1NLSA 2QZ3A 1ASJ2 1BXHA 2A6ZA 4E4ZA 2XPJA 4FAGA 2O8OA 4K3UA 2X5IA 4WM8B 2AUYA 2C0ZA 2QJVA 1C57A 2JXAA 1C1LA 2D40A 4B4QA 1VBB2 1CX4A 1LODA 2FQPA 2W52A 3H1MA 1U5XA 5K0UA 4P9LA 2SLIA 3H9AA 3A0KA 5A33A 4CEYA 1MZFA 3A4UA 4QQOA 1RB8G 3WDVA 1AR82 5ACA1 5GJ6A 2HWD2 5JOYA 4XF9A 4JQRA 2HWE2 2I2SA 3BODA 1Y7BA 2N7GA 1NCRC 1WLDA 3IIAA 4UXAA 1RUH3 5BNPC 4L9BA 4LE4A 2WA3A 1EV13 3JBG2 3R4SA 4EN0A 3PVNA 1W6QB 4F3JA 3U10A 2ZX4A 2XBO3 2ZGNA 4RQPC 3GALA 4MX3A 4JGYC 4L2NA 2ZBJA 3G6JB 1RMU1 1QHDA 4S2GA 1I5ZA 4EN6B 2C1FA 4QQPA 5J7MA 3WINE 1ZBE2 5TSWA 4ASLA 1H8TA 1RHI3 1U5YA 2WFF2 2CWSA 3CEWA 5BNNC 4BCUA 3ZMOA 5JZGB 4BM8A 1MS8A 2XWBB 2DU1A 3WG3A 1SLLA 4DINB 3B3QE 1ULCA 3WG2A 3QD6A 3LA7A 4QHBA 4XIKA 2PHWA 3P3NA 3POWA 1UF2C 4YGCA 2R49A 1UU4A 2ZX0A 5JPNB 4WM7B 3ILFA 1GYKA 2PLV1 3JD71 1RUC1 1PVC3 5CFCA 2DCYA 2RS12 4IEVA 2Y38A 4FPKA 1VBA1 3AJZA 4KG0A 2E7QA 3ETQA 4Q4Y1 1KXGA 1RUJ2 3M3QA 2DVBA 4MV2A 3RJ2X 1AR72 3BOWA 4HETA 5FO8B 2QUOA 5JLVA 4YVWC 3VZKA 1S0DA 1XQNA 1HXS1 2B5HA 2DV9A 3W9AA 4MH0E 3CJIA 4Y20A 4PQ9A 4QPGB 4L92A 1NA1A 1NE6A 4D94A 2JICA 5ACA3 1Q8SA 1MS5A 3MW3A 4HFSA 4AVSA 1FOD2 1ZA4A 4XF0A 1PGL1 4DMIA 1JH5A 5J48A 2WL1A 1UZZA 2A70A 4XE9A 4YZ5A 1Z78A 4YZ3A 2X5IB 3WUDA 4TWTA 4Q4X1 1RVF1 2DU0A 2VOKA 5FMOS 3VZNA 1PGSA 5K0UB 4AQ2A 1H2KA 1OLQA 5T54A 1V9U3 1AXYA 5A33B 3JB4C 4I09A 4CEYB 1GZWA 1ZZCA 4Y1ZA 5LEJA 4R52A 3IPVB 4PIYA 4R9BA 2TEPA 2ZMNA 4R8HA 2AH2A 4KGQA 4B4RA 4FOQA 4DFSA 3IT8A 4MVTA 4LBOA 5E1RA 4BLJA 4OI4A 4C1XA 3INAA 3E5XA 1R083 5JDBA 4XXPA 1POV1 1UZYA 1AR91 1ZZ9A 2R071 4RHV2 5DG1A 1MVEA 4K8FA 4AEKA 2F6BA 1PGW2 5J98B 1ZBA1 1ZZ6A 5SV8A 3WCRA 4WZFA 3WG4A 3N36A 1REEA 2ZKLA 4YW2A 1UCXA 4H14A 5FLIA 2C5DA 2GNMA 1NCQC 2X8KA 2RM21 3JQWA 3JD73 3H50A 1RUC3 2WS93 1H8TB 2B7YA 4XYXA 3ZX7A 4Q0PA 5BNOA 3APBA 1WMDA 4XOGA 4OHXA 1FNYA 1XYNA 1S0IA 4FQ4A 5SV5A 3BALA 1DZQA 1O91A 5FLJA 1RGSA 3LA3A 2VH9A 3AMMA 2G4IA 3VDDA 1O3RA 3MPPG 2EAKA 3GHMA 4GH4A 1GLHA 5DZEA 1DHKB 4YRDA 5A32A 4IEWA 2XJRA 4OHZA 2VG9A 4AI2A 1WD3A 1PO22 5CFCB 2RMU1 5KBFA 1IPJA 3ZXKA 2RR11 4MGIE 1YI9A 2D6OX 1NLRA 4E9KA 1LHNA 2GC1A 1FATA 1Q56A 1DG6A 4XF4A 4AI3A 4B7KA 3ZMNA 1AR61 1OFNA 1EY2A 4XW3A 1RVF3 5J36A 2EXIA 2XLGA 3E97A 4K7JA 2GN7A 4YG0A 5ACA2 1F5FA 3CJIB 4Y20B 4N7IA 4PDWC 3WDUA 3NJZA 3ZPYA 1NA1B 5FCCA 4YVSA 2BTVC 2AYHA 4K9SA 1DQ1A 1V6OA 2BQPA 3HN1A 5AFEA 4ZKTB 3B9IA 3MF9A 1RUE1 3OBRA 4LA3A 4L99A 2R32A 1O3SA 3GBWA 2SBAA 3VBFB 2QQPA 2NLRA 1WCSA 3PLQA 4XXAA 2XJQA 1WW7A 1OI6A 3M1HA 2BWAA 5KHJA 4G3YC 1POV3 2Z79A 1KS5A 4YM0A 3FBMA 5K7PA 1UL9A 1RMU2 1GQGA 2WJSA 1DQ0A 3WW3A 1X8EA 1CN1A 1R1A3 4AFMA 1GZWB 1MACA 2VMGA 3KGZA 2CTVA 1HW5A 3OBTA 4L8QA 1DLLA 3J9SA 3FUOA 3OF1A 4FPCA 3LOBA 5BV6A 4J1WA 2VNOA 5D8AA 2GSYA 2RS33 4AHZA 1AYN1 4I0WB 3J8F1 2P34A 2ZGTA 2DTWA 3EHKA 4FQZA 3SISA 3VHNA 4BIFA 2D3PA 3ZYRA 1LEDA 1UU6A 1DDLA 3NL1A 1LU1A 3ZDSA 4X8NA 1DZRA 1U12A 3POYA 3NV4A 4GWMA 2PLV2 2Z2SB 4IETA 1RUC2 2R061 5HCBA 3RPQA 3O14A 3VBUA 1RUI1 1N1SA 5FDBA 2A3YA 2AZ5A 5T55A 5FO9B 2JECA 2R6QA 1VBA2 4Y1XA 4E4DX 2PQQA 1AHSA 4GULA 4Q4Y2 2D43A 4I0AA 4P9XA 1LHOA 1MS4A 3OJBA 2XVLA 2ZTNA 3VZLA 1R092 2RR13 3RJRA 1CAVA 4KQ7A 1X8MA 2BW8A 1HXS2 1FX5A 2ZGPA 5I0TA 4GH4B 3VZOA 3WR0A 3BOPA 2DCJA 3I54A 4M0NA 1BEV1 4FO9A 1N3OA 3HT1A 4GWNA 1O3QA 3VBOC 3WDWA 1UMZA 4AW7A 4WVVA 5D1IA 5A3MA 2ZGUA 2ENRA 3EXUA 4JAAA 3M4FA 4EN9B 1W6PA 1AX2A 1PGL2 5EYYA 5L7OC 2MHFA 2ZOEB 3G7DA 3GBGA 4Q0VA 1ZNPA 2H6BA 5CG8A 4JTNA 3VHRA 4CEWC 2A71A 3LSDA 1VBC1 4Q4X2 1J1TA 1RVF2 3L2HA 3WDXA 1H2NA 2XVGA 1NCRA 2OW4A 2PHXA 3ELNA 5BNPA 4ITCA 2HEVF 4N43C 4AEMA 3KZ4C 4JV4A 4IV3C 1HDKA 4MSVA 3UJOA 3S30A 1WW4A 2PHTA 1RUNA 4CP1A 1IKPA 1QY4A 1FMD3 4U2AA 1H1MA 1QJX1 4DNYA 2A73B 4COYA 4RQPA 4EROA 1M4WA 1RUOA 1N47A 2PYTA 2IWGB 4JGYA 5EWSA 4EJRA 4X6RB 1X33A 2JDZA 3ZYPA 1TMF3 5JIAA 4BHPA 3DUIA 1RJ8A 1AR92 2R072 1I6XA 5EFUA 3ZYGA 1AF9A 1YWKA 3NAPC 4XF3A 4YLZA 1RUF1 4JGZC 3J8F3 1ZBA2 5DXDA 3LWCA 4QT6A 1DYKA 4DPNA 1SDWA 4Q8KA 5HI0A 2ZJCA 2ZX1A 5AC93 4FTSA 2RM22 5JPMB 2R063 2IC1A 4AGVA 4C90A 1LKNA 1RUI3 3ZVXA 4TZDA 3UK9A 2JEMA 4UW5A 2WNVB 4GXLA 1JYCA 3E5QA 3IDEA 4IXLA 4KWLA 1QXRA 5D8AB 2XWJB 4M0HA 3TRSB 4V1PA 1QH7A 1UD1A 2EXKA 4OLLA 1NG0A 2BFUS 2OPKA 4U36A 3ZXEA 1HX6A 2DYCA 1G7YA 4OUSA 1ZVFA 1LGCA 3MIDA 4FT8A 1Y3TA 4KL1A 1FV3A 4YVWA 1APNA 2DTYA 2RMU2 2LM3A 2RR12 4LNVA 4F7ZA 5CADA 2Q5TA 2A6WA 1H1AA 1AR62 1CAVB 1S0FA 2DWRA 4MXWB 4G4FA 3IN9A 1VBC3 3PTYA 1WUVA 1OA2A 2YV8A 4I0BA 1GZCA 4BE3A 1OOPC 1DYPA 3RYPA 4FPHA 1ND3C 3KS7A 4Y26A 4KNCA 3VUOA 1LTEA 3TYJA 2GMMA 1RUE2 3D8CA 4URTA 1W6PB 4AQ6A 4RFT0 4HSLA 2NMOA 3UKVA 3B9CA 4LLFA 1UU5A 2VXRA 4L11A 3NV3A 2HKXA 2EXJA 3FX3A 5F1RA 4JRAA 1NCRB 3D0JA 1PZ7A 4XFIA 5BNPB 1PM7A 1W0OA 3RRDA 1HRI1 4MXVA 2EALA 4BZ4A 1RC6A 2GNBA 2PELA 3MPBA 1JYIA 2WSUA 3D5OA 1S55A 1OD5A 3EO6A 3THPA 1ULFA 1I1EA 2I45A 3LCPA 4M3CE 4BYYA 1EPZA 1PVXA 3AP7A 3K51A 4PBOA 4RQPB 1N1TA 1V00A 3MIHA 3O0VA 4RS5C 4YFZA 1NCQA 2HEYF 3AP4A 1AYN2 3R4UA 3HBZA 3J8F2 4O9GA 1JHNA 4PCRA 4JRLA 2BWCA 4CDQC 3ZYJB 3OYWA 2OZJA 5I8TA 4I3GA 1Z0HA 1YIFA 3HAGA 1DU3D 1XNKA 2A6VA 4P9JA 4KBBA 3GF6A 3HD8B 4K1ZA 3ZXAC 4XTMA 4RGGA 3V65A 4BMEA 4KGGA 5BXXA 1LGNA 3POSA 2OVUA 4HPKA 1YCIA 1PIV1 4YYOA 1J3RA 3OD0A 5J37A 3OY8A 5LEKA 2GZWA 1G9AA 5DDJ3 3B02A 1IKQA 2UWCA 1H2LA 3KCCA 4B8EA 5BUVA 3WNXA 1BK1A 3GYDA 1SFYA 1QMJA 1NQDA 2ZHNA 4R4ZA 3WQ0A 3H8UA 1RUH1 5AVAA 3WQ1A 4CDUC 1BEV2 1BZWA 1EV11 1LR5A 1YJKA 3CJXA 1XNCA 1WMEA 4LBMA 1VJ2A 1L3JA 3BB6A 3KCYA 2XBO1 3RDIA 2HWF3 2GC0A 1UAIA 4CZSA 4YVWB 1REFA 2UYAA 4QD2A 2B45X 3T1MA 2VMIA 4PDWA 1MZ5A 1J59A 1W6MA 3LSEA 4AEDC 1VBC2 4TLFA 1MZ6A 5HCAA 4YNIA 1RHI1 3SCHA 2ERFA 5FAXA 4FOYA 1CAUB 2D7FA 3JCIA 5JIUA 4MGZE 3JB8A 4UW6A 2V5YA 3UKTA 2BGCA 3U07A 2WSVA 1Z7S1 5F9TA 3SITA 3S7EA 1OLRA 5FFOC 1LU2A 1QJX2 1HRI3 5CIRA 1TNFA 1YRZA 3NWKA 4X8PA 1IS3A 1VBE1 3OD4A 2YROA 3VKLA 1ZYBA 3M3OA 2DF7A 2WA4A 3L9JT 1XE8A 3CU7A 4R9DA 2IXLA 4XILA 2Q8OA 4AHXA 1NYWA 3FUQA 1MVQA 3VLBB 1PVC1 2V09A 4XBNA 2JKBA 4M01A 2R0HA 2UURA 1RUF2 4D3WA 4LO6B 2RHPA 5FTTC 3QH6A 1D2SA 1QDOA 3DF0A 1V6IA 4UBHA 1VAVA 3T2TA 4OULA 4I3PA 2WQZC 4R4XA 4OHVA 4OI2A 1YYNA 1WBFA 2PHLA 2ZAHA 4KU8A 4MZUA 5BYNA 1H8VA 1PIV3 1NCQB 1LOFC 1AZDA 3ES1A 4IEOA 4Q8LA 4QPIC 4B7EA 4AHYA 2XB6C 3WDYA 2WLPA 4FPLA 4EWDA 3AMPA 3ZFFC 1GBGA 2OA2A 4DRVA 1WMFA 5EYXA 4JC1A 1V9U1 2PAMA 4WBBA 1D2QA 4BPZA 5KXBA 2W08A 3OTFA 4GMP0 4HPKB 2E6VA 3VBOA 3OY8B 4XFAA 3PMEA 1AVBA 2BYVE 1OKQA 3D0SA 1QH6A 1IS5A 2E53A 4YM2A 5FQ0A 1WLWA 3AFGA 3PVBB 2CY6A 5L7OA 2D97A 4N53C 4YW3A 1N3PA 2WZR3 2YHJA 1QDCA 4WVWA 5JSPA 2E7TA 4CEWA 1R081 1Z7S3 2IXIA 2XJTA 2JG9B 1RUD3 2ZHLA 2CAUA 2TNFA 4N43A 4F8AA 4IV3A 2BNMA 5H9PA 1VBE3 3WW2A 4XIOA 2ARXA 4J6GA 3UV9A 3MLLA 1BMV1 3MDPA 1H9WA 3AMHA 2WS91 2RS51 2FMYA 4FPYA 1O7FA 3VZMA 2AREA 4YW5A 3D6EA 4FTBA 3O5SA 1HRI2 1REDA 2XHKA 1CJPA 1XXNA 5E88A 2VQAA 4XJ8A 2FMDA 4Z07A 5JOZA 3E5UA 4LA2A 1JUHA 3NAPA 3O0WA 1ZRDA 4JGZA 1UIJA 5T5LA 2E9QA 1QKQA 5KHIA 2PFWA 4META 2W68A 1LESA 3ZN4A 1WW5A 5FMOL 1MQTC 1OMIA 1RINA 1PK6C 3FFQA 5HCFA 5JI7A 2GNDA 3ZXFA 4AE2A 3ECQA 1ZRFA 1ND2C 4IEYA 1UN1A 2ZHMA 3KM5A 4LBJA 4HLTA 3RZZA 1H2MA 1F31A 2D5HA 1RITA 1QJY3 1YNAA 4FPGA 1B35C 2ZCWA 4IEPA 1HIXA 2PAEA 2KA3A 3AK0A 4D7TA 3WDTA 3D82A 5IUQA 4RSUA 4CDWC 2D6NA 1F9KA 2P17A 1PIV2 4YGBA 3MIGA 1HQWA 1MS3A 3PHMA 1M06G 1JTZX 4QQ2A 1RUH2 2FHRA 1A8MA 3IMNA 5FLHA 4QGLA 2GH8A 2WINB 1EV12 1QWRA 2CGOA 4XZPA 2FZ2A 3MICA 2P37A 1HLCA 5J09A 1OSGA 3N7KA 4RR3C 4ASMB 2XBO2 4N7UA 4XJUA 2CGPA 3I59A 2D6PA 1NQJA 4Y1UA 2VVFA 4OHWA 3VV1A 4LBLA 1KITA 2D98A 3ILNA 3MW4A 2QKDA 4E4SA 2IFWA 1OOPA 1W6OA 2W0XA 1R1A1 4HKWA 1ND3A 3LB9A 3VBOB 5ABJC 1RHI2 1QOOA 5GZEA 3NV1A 4IV1C 2ZGOA 2ZGKA 3AP9A 5FQ0B 5I8YA 1VAMA 3B01A 1BCXA 1Z7S2 2RS53 2ZACA 3EBRA 5L7OB 1KJRA 5FOBB 1CVNA 4ISRA 2RS31 4F83A 1XYOA 4CEWB 2Z42A 5C33A 1F5JA 2E63A 4AVAA 3MGUA 2GH2A 4N43B 4P9YA 4IV3B 3IWZA 4AHWA 1PVC2 3WLUA 3U11A 4JTOA 5H9SA 4LO4B 5BNNA 1YFYA 3TB0A 2TBVA 3AP6A 4AGRA 4DS0A 1LECA 4RS5A 1Q8PA 2EVXA 4AG4A 1SMVA 4Y24A 5FREA 2K0GA 2PN5A 4CDQA 4H3WA 3NAPB 1UW8A 3ZXJA 4JGZB 2R16A 4LEJA 4K40A 4AI1A 1QOSA 3M3IA 5GLUA 4XFHA 3FLRA 4DOUA 4XBLA 1TQ5A 1VB2A 2NZ9A 2WT0A 5B2GB 4N9HA 4MLOA 5CA6A 1O3TA 1CESA 5L19A 1AXZA 3TWIA 1KFXL 5C4WC 4B29A 1GZ9A 3B7MA 4QGNA 1WBLA 3W59A 3WP3A 1C5HA 3S6PA 3AKPA 4Q1PA 3H3ZA 5IK4A 2D6MA 4BIOA 2ET7A 4CDUA 3FWEA 1V9U2 3OCPA 3HWJA 3KMHA 3NO8A 1CQ9A 3VKOA 1FMD1 3WZ1A 1D0HA 4CTEA 4P9IA 1YFUA 5FPZA 1GICA 2HWB1 2HYKA 2ZHKA 1G9BA 2VGDA 3SH3A 3BU7A 1TMF1 1CAXA 2BPA2 4PLMA 4ZU7A 1K5MA 1R082 4AEDA 2VECA 4PJYA 4LBQA 2K9ZA 2A6YA 1PNFA 3ZFEC 5FOJB 1X82A 1UPIA 2YZ4A 1QJU1 4IEXA 1ZRCA 3I59B 3B94A 3DGTA 4KU7A 3U0ZA 3NKTA 1WA4A 1DQ2A 1XU1A 1FI2A 2GDFA 5AC91 1OOPB 3WVJA 4CP0A 1W6OB 1A78A 3MIFA 3JD72 1BMV2 5JAXA 3QLQA 2WS92 2X53S 1JUIA 5JI9A 1XE7A 1VBD1 4N9IA 1CPMA 5EZWA 5JMCA 4MGKE 2KM2A 4FPFA 4AI0A 5BNOB 3VBSC 2WNUC 1DGWA 3M3EA 3ZXDA 1QQP3 5GLWA 1HV1A 2CAVA 1HRV1 4XFFA 1Q5OA 3ZYIB 4Q4V3 5I91A 3DV8A 1V6LA 2GC2A 3RS6A 1C28A 2Y0OA 3VDDB 1UX6A 2LALA 2H6CA 3B00A 2WT2A 4CEYC 1AYM3 1VLNA 1Q8OA 2VW2A 2PHRA 3I7DA 2P2KA 4YZ1A 4FOVA 4LBQD 3WP6A 3CF6E 5A32B 2XL7A 4AEJA 5BNNB 4LHLA 3CLPA 3VL9A 2NPIA 3VBHC 3C2UA 2VQ0A 3WP4A 2RJLA 1D4VB 3N7LA 4RS5B 1LOFA 3AYEA 2DUQA 4AQTA 2QDRA 3N7MA 1KJLA 3VGIA 4CDQB 4IEZA 4QPIA 2TUNA 4Z92B 2BNNA 2PHFA 4GMP3 1LCLA 3HQXA 3A0NA 3ZIWA 4Q4W1 5AVPA 3ZFFA 1JXNA 2XH6A 1V6NA 1H0BA 4FPOB