2ZGTA

Crystal structure of agrocybe aegerita lectin aal mutant f93g
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
159
structure length
140
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDGAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
total genus 24
structure length 140
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgtA00
2JE7A 3AZWA 4D69A 1LOFA 4FP3A 1URXA 3PVEA 1DZQA 1QNWA 1FV3A 1GSLA 3IKWA 1W6OA 2EIGA 2DURA 2ZZJA 5T54A 1CESA 4FP2A 2H0BA 1LULA 2ZKNA 2ZMNA 3NV2A 3BTAA 1Q56A 1W6QA 2NN8A 2JJ6A 3O0WA 3LSEA 3ZSLA 2JKBA 1IS3A 2A5ZA 5L73A 1DQ0A 2W08A 4NOTA 1N1TA 1MVQA 3OYWA 1W6MB 1W6PB 3O0VA 4HL0A 3SISA 1JOJA 3O12A 1JYIA 1BQPA 4AGVA 3DGTA 3M1HA 4GWMA 5CAZA 2A6YA 3V0AB 3AZXA 1HQWA 1LU1A 3OY8B 2ERFA 1LGCA 1Q8QA 3QLQA 1JXNA 1OQ1A 2I2SA 2OUJA 2ZHKA 2KM2A 4Y1UA 4P9YA 1LECA 4XJZA 4C1WA 4XIOA 5T5LA 4Y1YA 1LESA 1MZ6A 3O0XA 3ENRA 2D6KA 2DVAA 3PVOA 4PBPA 1W6PA 1W6MA 1QMJA 1LOBA 2PHWA 3B00A 2A71A 3AZVA 4YLZA 1S0BA 1AX1A 2JE9A 1SLIA 4FOVA 2OVUA 4FPLA 3V0AA 1JYCA 1I1EA 1MR5A 4K1YA 2C9AA 1DQ4A 4MYEA 2GMEA 4TYSA 1WLDA 2PHTA 2Z42A 1S0DA 3V64A 4DPNA 3MW2A 4LBMA 3H0OA 1A8DA 3WG3A 5BYNA 5IT6A 1AF9A 2A6ZA 3WG2A 3TB0A 2P37A 1LHOA 3AZZA 2DVBA 2ZGUA 3TAYA 3VKMA 3ZXLA 1OFSA 1DYPA 1J1TA 3WHTA 2G4IA 4XJWA 4YM2A 1HKDA 3WUCA 3WDTA 4YGBA 5JDBA 2UWCA 3AYCA 1AZDA 2ENRA 1MZ5A 1WW5A 2YZ4A 1DQ6A 1FNYA 1APNA 1DBNA 3FLPA 1WLWA 1WUVA 1F9KA 2OW4A 4LBOA 4YG6A 1GZ9A 2ZHMA 1H9PA 3ZPYA 1DGLA 4YW3A 4Q1RA 4YZ2A 3N7LA 4Y1VA 1LHNA 5H9RA 2PHFA 4GA9A 3SH5A 1CPNA 3D4KA 4P9XA 5DXDA 5GZEA 4BMEA 1I3HA 3AK0A 3PJQA 4H55A 3M3CA 4UW6A 5DZGA 3ZXKA 4ATFA 4LBJA 3SNMA 4FPGA 1PZ8A 2P3JA 1G9BA 3WNXA 1LHVA 2DVGA 4Q1PA 5GZCA 4FPFA 4ZKTB 2A6XA 5DUWA 5GLUA 1WBLA 1OKQA 4LBQB 1QKQA 2PHRA 3N3HA 2GN7A 4BLJA 2DUPA 2GNDA 2YV8A 2ZGMA 3ZSMA 2A3WA 4XXAA 1DLLA 3IMNA 2VW2A 3HN1A 1DIWA 3V0BB 4Y22B 1G86A 2UURA 3DUIA 1GKBA 2R0FA 1DQ2A 1AJOA 1SLAA 2A6WA 2GALA 2P3KA 5GM0A 3WCSA 1RIRA 1V6OA 4AGGA 1LODA 3WDUA 4DS0A 5GZGA 2NYYA 3AJYA 2W68A 2CY6A 3BOPA 2VUAA 3I8TA 4LBQA 4BMBA 1RINA 3WUDA 3AYDA 1G9DA 2AYHA 5JOXA 3B3QE 5H9SA 4XIKA 3I4IA 1ULDA 1KITA 4YW2A 1WCSA 3WDWA 2A3XA 3V0BA 5DG1A 5JMCA 3SH3A 3FUOA 5E88A 1X50A 1SLTA 1FYUA 3OJBA 1PZ9A 4FPEA 2CTVA 3B69A 3AXEA 1V6NA 2FHRA 1MS1A 4Z8BA 2OUHA 1BXHA 3B01A 3RSJA 1IKPA 4HANA 2VW0A 3T2TA 2P2KA 2YROA 4K20A 2DYCA 5HCAA 3LSDA 1AJKA 2DVDA 2VH9A 4Q2FA 4R9BA 1LOGA 3T1LA 3IM0A 1GNZA 3FLTA 4KBBA 2B7YA 3OPZA 1DYKA 1DQ1A 1O4ZA 3FUQA 2ZGRA 3WLUA 2DU1A 4GXLA 1LU2A 4XOGA 1YI7A 1BKZA 3AP9A 3ZYPA 3WCRA 1ENQA 2ZGPA 2D44A 1GNHA 2JDZA 2JECA 3ILFA 5JVVA 5SV8A 4CZSA 4UW4A 1DHKB 2E7QA 1UZYA 1RITA 3N7JA 4XBLA 4XBNA 1WBFA 1LEDA 1QOTA 4DRRA 1GV9A 1N47A 4YGEA 4LBLA 1PZ7A 4FOQA 4IQPA 4YG3A 2EXHA 4U2AA 1MS5A 4LBNA 1S0EA 2WSUA 3ZXFA 1QDCA 3VUOA 5GZFA 1CPMA 2LALA 5DUUA 3POYA 1MS3A 3L2YA 5LK5A 1GZCA 5JOYA 3IN9A 1ENRA 4CTEA 5GJ6A 4FPJA 5EYXA 5HCFA 5JLVA 1GICA 3OY8A 1CQ9A 3AYEA 4M3CB 1Q8PA 3WZ1A 2ZMKA 1Z78A 3AP4A 1WD4A 1W0PA 3AP6A 1KJRA 1Q8SA 1Q8VA 3UL2A 1G9AA 4XHXA 1LOAA 4Q8LA 1HLCA 3PMEA 1HDKA 4YZ5A 4BM8A 1N1VA 4PQ9A 1NXD1 1VAVA 3N7KA 3NV3A 2GN3A 1JBCA 2E51A 3BODA 3PVNA 4PF5A 2CWMA 4M3CA 2CL2A 1TEIA 4JCKA 1S0IA 2A6VA 2D3PA 2GMMA 3MW4A 4PBOA 4Y26A 1IS4A 1V00A 2SBAA 1CN1A 3FLRA 3MW3A 2NM1A 2AR6A 4DQAA 1KQRA 2EXKA 3B9CA 4K21A 3T1MA 2JD4A 1CIWA 3AP7A 3D5OA 3N7MA 3WV6A 1SLCA 1UL9A 5GZDA 1ZM1A 1MS9A 3VKOA 1V6LA 3ILRA 2D6LX 1UX6A 2HYKA 1S0JA 2YXSA 4P9WA 4FPYA 3ZSKA 5CNAA 2DUOA 1SBDA 3ZXEA 2VW1A 3GNEA 4P14A 4AVTA 2ZGNA 1S0CA 1R1ZA 1QGLA 5GLTA 3APBA 3SITA 3NV1A 2ZHLA 4XTPA 2VU9A 4XILA 5T52A 1ULEA 1LOCA 1CONA 1AX0A 2AENA 5FREA 3USUB 2TEPA 1LGNA 3AX4A 3IPVB 2RHPA 3WG1A 3WDYA 1SCSA 4FPCA 3POSA 3OBTA 1V6JA 1WW6A 5H9PA 3Q9OA 4XJAA 2SLIA 3AZYA 4FQZA 3AJZA 1QF3A 4FPHA 1AX2A 1AXYA 4YW1A 5DZEA 2R16A 3WHUA 2YY1A 1G9FA 3R05A 4U36A 4Y20B 4LBKA 4Y24A 1LJ7A 4AVSA 2R0HA 1LHUA 1JN2P 3IPVA 2ZAAA 1JW6A 2DV9A 4WZFA 5KXBA 2CNAA 1VLNA 2FMDA 1C1LA 1SLLA 5DG2A 1KJLA 4BQ1A 1N3PA 4Y22A 1UKGA 4ASMB 2WJSA 1SFYA 4XHBA 3VV1A 1O4YA 2V73A 5T5OA 3WOGA 3N35A 4XDQA 1IKQA 5EWSA 4Y1XA 3N36A 1JUIA 4Y20A 4YM0A 1YYNA 4I30A 2E6VA 4ZXKA 2EAKA 2PELA 1QU0A 1S0GA 1UN1A 1DQ5A 3HR9A 5T5JA 2ZBJA 4FPKA 4AWDA 3MEPA 4WVWA 3AYAA 4YG0A 5T5PA 1V6KA 3WDXA 4Y1ZA 3GALA 1FATA 4JRAA 5F5QA 3KM5A 5DUXA 5AVAA 3RMXA 4SLIA 3RRDA 1V6IA 3UJQA 1CVNA 4UW3A 3ATGA 1W6NB 4XMIA 3W59A 2GNMA 5KXCA 1W6OB 3WG4A 4CRQA 4FVVA 4K1ZA 2GNBA 2R1DA 4BPZA 3LCPA 4OZXA 1YIFA 2ZA9A 3NWKA 1FV2A 4UW5A 5T55A 1VIWB 4FPOB 4PCRA 5JOWA 1QOOA 5IUQA 1B09A 2E7TA 3AXDA 4JC1A 3UK9A 3OYWB 4M3CF 4DRVA 1G7YA 5CB7A 1LOEA 3INAA 1S1AA 1C4RA 1H9WA 1W6NA 5EYYA 3KQRA 5GLWA 1GLHA 5FRAA 4W65A 4AGRA 1UZZA 4GKXA 1ULFA 3M3EA 3SLIA 1QOSA 2UWBA 4YM1A 1FAYA 1UMZA 2D6PA 1SACA 2ZGKA 1KDKA 1LOFC 1MS8A 1QDOA 2DWRA 1XQNA 4YGCA 2ES3A 5DUVA 2A75A 5GLVA 4BOWA 3AFKA 4XJ9A 1Q8OA 1N1SA 2EF6A 1N3OA 5CA6A 5HCBA 2PHXA 4YZ1A 1LGBA 2Q5TA 3RMYA 3WVJA 1WD3A 3W58A 3FFZA 2UWAA 4M01A 2AGSA 5KXDA 4M00A 1LCLA 2W52A 1BYHA 1KRIA 1D2SA 4YW5A 2A70A 2CWSA 4GALA 1GANA 2D6MA 3O5SA 1VAMA 1WW7A 1Y7BA 3ZSJA 4FOYA 3JUUA 1MS4A 4BLIA 4GWNA 2DTYA 1BJQA 3QCWA 4F83A 5KXEA 1LHWA 1N3QA 2ZGTA 3BIWE 5EXOA 3A0KA 5F9TA 1D0HA 3ZXJA 5GLZA 1LTEA 4YW4A 4XJUA 1AXKA 1C1FA 5E8AA 3RQ0A 1SLBA 2R49A 3OGGA 1G9CA 1EPWA 1YXWA 3AP5A 2DUQA 5IK5A 2ZGLA 1H30A 2XB6C 2P34A 3JU9A 1SBEA 1A3KA 1IS6A 4C1XA 4FOWA 2AUYA 1N1YA 4RA0A 1FNZA 2DVFA 3ASIA 1SCRA 2WKKA 3M2MA 3SH4A 1UPSA 3CNAA 4LBQD 2WT0A 5CBLA 1YO8A 2EALA 2ZABA 2D3RA 4YGDA 2V5YA 2C5DA 2W39A 2PHUA 1C57A 2LTNA 1MACA 3ZVXA 1HQLA 5DZFA 4L8QA 5GALA 2E53A 5H9QA 4YFWA 4TZDA 1NLSA 1IS5A 2ARXA 2NMOA 2WLQA 1JHNA 3D6EA 4ISQA 1WW4A 1A78A 3RG0A 4Q8KA 2YMZA 1GYKA 4FQ4A 3VKLA 1LENA 1ENSA 4M3CE 4YZ3A 4YZ4A 2BQPA 2VXRA 1MVEA 1W0OA 2EXIA 1KDMA 2GNTA 2AREA 3OBRA 4R9AA 5T50A 1AXZA 3V65A 2VY0A 4AYUA 1CJPA 1CR7A 4XZPA 3USUA 4XYXA 1YRZA 3VKNA 5IK8A 1UAIA 2CYFA 2ZGOA 4RL7A 1F31A 2GMPA 2ZMLA 3M3OA 1LEMA 1ONAA 3MPPG 3NV4A 3R4UA 4R9DA 4WVVA 3UJOA 2D3SA 4NO4A 1F5FA 3POWA 1IOAA 3RS6A 2ZGSA 2P3IA 3ILNA 1VALA 5IK4A 2NMNA 1BZWA 4WV8A 3WDVA 1SBFA 2WT2A 2ZACA 2AH2A 4Q27A 1MS0A 4DFSA 2NZ9A 3A4UA 1ZA4A 1GBGA 3M3QA 1ULCA 4XBQA 4ATEA 2WT1A 4ITCA 2D6NA 3VKFC 4R9CA 3R4SA 3ZYRA 1FX5A 2NP0A 2A7AA 2WSVA 2EXJA 2DTWA 2WQZC 3C2UA 5JOZA 1AVBA 2D43A 1GZWB 1Z0HA 4Q26A 2ZGQA 3HMYA 1DFQA 2ARBA 2GDFA 4XTMA 3U4XA 2UU8A 1U0AA 1WLCA 2A3YA 4XE9A 5E89A 2ZHNA 1QNYA 3FBYA 4XXPA 3A0NA 4YFZA 1W6QB 2DU0A 2D6OX 2XG3A 4GKYA 4ISRA 2WNEA 4XMAA 4YM3A 1V6MA 1ULGA 2D7FA 4XJ8A 1G8WA 2R1BA 5IK7A 1S0FA 4AVVA 1GZWA
chains in the Genus database with same CATH superfamily
3RZGA 4L0PA 1RTVA 1PK6B 2JDUA 3AB0A 5FZ6A 2WYFA 3ZYJB 4NUBA 1DZQA 2PLV2 2KD7A 1GSLA 2TBVA 2YPJA 3IKWA 3VBOA 5T54A 3RZLA 4D94A 4CEWC 3FHAA 1CESA 1R1A1 2RM22 1NQDA 1Q56A 1RUD1 2HEWF 4CA9A 2NN8A 4CEYA 1PIV1 5KHHA 4QXBA 1IS3A 5FZEA 4PHZA 2B9UA 3IT8A 5LA2A 2OQ6A 1RUG1 1NYWA 1PO21 2F17A 1JOJA 4DXTA 2HH9A 2QQWA 4NHLA 2VZSA 1JYIA 4GH4C 1CZSA 1E5RA 5CKQA 4LEJA 4XDOA 1PMIA 1LU1A 3ZN6A 4EROA 3ZMOA 2FBEA 3WP4A 5C7GA 1PGW1 1AL21 1PM7A 1XBFA 4QKNA 3OUIA 2DFCA 2X09A 1LECA 4JGZC 4O61A 4ASKA 2C0ZA 2Y6KA 1UU6A 4Y1YA 5T5LA 3SEPA 4IXLA 2D6KA 2DCZA 2DVAA 4QPGC 2IUWA 3IZOA 5DN2A 4B4RA 1PO13 3B00A 4YLZA 3AZVA 3PIGA 3S6PA 4FOVA 2OVUA 1OOPB 3V0AA 1IPSA 2E31A 1JYCA 1MR5A 2ADDA 3T2PA 3GHNA 3BGAA 3J7NA 3T08A 1ZBE1 1S0DA 5FK7A 4RS5A 3S0MA 3LA2A 4IETA 3AKQA 5BYNA 2WN2A 5FPLA 2QE3A 2R30A 2A6ZA 2XJTA 2FDFA 1VBE3 5IAXA 4AAPA 2JEMA 5FQ0B 2VNGA 1VBD2 4HOOA 3X29B 4AI0A 4E2QA 4Q4X2 4E4SA 3CJXA 1CIYA 1HKDA 5IW0A 3VGIA 1JHJA 1UYPA 3WDTA 1LNSA 2WS92 4QX1A 4UFKA 1MZ5A 3ZSEA 3OSDA 2DBNA 5EJZB 2YZ4A 2UY8A 4RQPB 3HNYM 2OW4A 1F9KA 1SPPA 2W1WA 3SCHA 2ZHMA 4B7KA 1RC6A 2VECA 4A44A 2WR9A 2VC9A 4R52A 4Y1VA 4META 4DO0A 2K46A 1R1A2 3AFGA 4J1WA 4C0BA 1CPNA 4P9IA 1ZRRA 1RUD2 4EWEA 5I93A 5JCTA 1PIV2 2J22A 3AK0A 1GWMA 3ZXKA 2GC2A 3GJBA 2WO7A 4JX0A 1RUG2 1PO22 3WF2A 1CZVA 3WNXA 5GZCA 4DOUA 2YB7A 4NIGA 1COV2 2FDGA 4AFDA 3N4MA 4WVMB 5F3EA 4AVAA 1U5XA 4CDQB 1DCSA 2PHRA 2QZ2A 4W6XA 3TEXA 4UFLA 2GNDA 3DYMA 1PGL1 4YWAA 1DLLA 3IMNA 1CAWA 1PGW2 1AL22 1R091 2ZEYA 2UURA 4QQOA 1OLMA 1SLAA 5LA9A 2QQNA 1HXS3 2X5IA 5D1IA 5GM0A 1V6OA 3ACGA 2Q1FA 4TSVA 4DS0A 1ZZBA 1VRH1 3H8UA 3JZVA 3AJYA 2XR4A 3PHMA 2WWSA 3T4VA 3JBG3 2R041 2HWF3 1RINA 4NPLA 3WUDA 4ZU5A 3H1YA 4HPKB 2AYHA 4CEWB 5K7PA 2A73B 2E63A 1ULDA 4YW2A 5F7UA 1WCSA 3TN91 3V0BA 4AG4A 1ZBE2 2VZ1A 4HLTA 4LQRA 1W8UA 4TWTA 3IBMA 3OJBA 4FPEA 3JQXA 4RGGA 3B69A 4I3GA 3W9AA 4Z8BA 4OUSA 4DUVA 1IKPA 1XU1A 3MBWA 4XFFA 4K20A 1HQNA 4M4PA 4Q2FA 1JOBA 1LOGA 4FTSA 4JGZB 1ZZ9A 5LASA 2P3YA 2B7YA 3OPZA 2ZX2A 3OD4A 3P6BA 2WWJA 4QXHA 1UD1A 2E7AA 1DQ1A 1O4ZA 4ORFA 3WLUA 1NA1C 1JZ2A 1YI7A 3ZYPA 2DF7A 2IXCA 1ENQA 3H1WA 2DCJA 4IEUA 2RS13 3UGFA 3EXUA 1RGSA 4H14A 4QX8A 1PX4A 4MLOA 3PL0A 3HAGA 1QJY3 1UF2C 5FYVA 1R64A 1SQ4A 2BGOA 4LKEA 3T2OA 4AVCA 3VBSB 4EE2A 1H6YA 4XUTA 4LBLA 4FOQA 5FUNA 3JQWA 1W9WA 2W0XA 3C7GA 4IV3A 2QQIA 1MS5A 3FE5A 4KU7A 4LLFA 4ES9A 4JDOA 4X8NA 3ZYIB 2WSUA 2FMYA 2ZS6B 1PGL2 3I2GA 1CPMA 2LS6A 4JV4A 5DUUA 3LEGA 3POYA 1Y9GA 1R092 1MS3A 2VTXA 4UBHA 5CVRA 4HKWA 5A3WA 3IN9A 5GJ6A 2L9LA 5HCFA 5BNOA 1GICA 2VOXA 3ZFEA 5FXXA 2F4LA 1CQ9A 3AYEA 4M3CB 1Q8PA 4BXSV 1VRH2 1Z78A 3AP4A 3AKSA 4IGOA 1YHFA 2NLRA 3D8CA 2R042 3K4AA 3GZUC 4LE4A 1Q8SA 1WMDA 4IEYA 4CCJA 2ZX0A 4XPVA 4Q8LA 1OKOA 5A33A 1SFNA 1O91A 1A8MA 3TN92 4YZ5A 5ANQA 3AL6A 3MF9A 3OG2A 1HN0A 3VDDC 4MVTA 4LORA 1W3VA 3R4DB 3NV3A 3UKVA 1JBCA 2QVSB 3PTRB 5EFUA 3LOIA 5FO8B 2WABA 2A6VA 4CU8A 2VR4A 2SBAA 1V00A 3FLRA 1UXXX 1UY0A 4XQ4A 5FZBA 3MUZ1 2W47A 1Y43B 4DQAA 4LPLA 2EXKA 5BNNC 5JXGA 2XWJB 3B9CA 4JKMA 2ARAA 3WF3A 2JD4A 4HN0A 2IC1A 4JQRA 2VNOA 4PDWA 4RGKA 3TYJA 3D5OA 3N7MA 5EZWA 3WCSA 1NE4A 2BRTA 3WV6A 4AVVA 5GZDA 4OQ9A 4C91A 2VMEA 3PUQA 2B42B 4P9WA 1XNTA 3NQHA 1UO9A 3WP6A 1SBDA 3K77A 1GFF2 1R1ZA 4E4DX 4OUMA 5KHIA 3NV1A 3RWNA 1HJFA 2ET1A 3EBRA 4XILA 3ZN5A 3Q8BA 1ULEA 2XUEA 4S2FA 1CONA 1EYBA 2RHPA 2WFF3 3WG1A 1KFUL 5KWRA 2VZUA 2XOMA 5E6HA 4FAGA 4PQQA 5J48A 1ZBA1 4FPHA 2BEOA 1AX2A 3HQXA 4Q4Y1 4YW1A 1HB4A 2GSYA 5FLHA 3T2QA 4XF3A 2GH8A 1T6GC 3H3UA 4U36A 4AI9A 4LBKA 1LJ7A 1UWWA 3T0DA 4OHVA 4WZFA 1JW6A 3CIHA 1HXS1 5C70A 1MEC3 3ACFA 2CNAA 3POEA 4W6WA 4XUNA 4CDWC 1US3A 1SLLA 3O14A 4WBBA 4W8JA 2FZ2A 3JBG1 3I3MA 1N3PA 3KVAA 1UKGA 4Y22A 3OPWA 5T5OA 4XDQA 1UOFA 5FYMA 4GIQA 4Y1XA 1KEXA 3NO8A 2GC3A 4XUOA 1O4TA 4I30A 2PELA 4KWKA 4D7TA 2LM3A 3KV5A 5K0UA 3MZHA 3HT1A 2HWC3 2D98A 3MEPA 4I0WB 5T5PA 2VG9A 4Q0QA 3TWIA 4Y1ZA 3FL7A 3GALA 4QB1A 4A6SA 1XU2A 1EY2A 1RHI1 5F5QA 2JDYA 2NQYA 3UJQA 3VBUC 1CVNA 4QKFA 1W6NB 2EA7A 3U1XA 3W59A 1TMF3 5FPZA 4X8PA 3VBOB 4MGYE 3WG4A 5KXCA 2Q8OA 3I2FA 2XPJA 4K1ZA 2GNBA 2XVKA 1GWKA 2R1DA 1OA4A 2ZA9A 3NWKA 4RSUA 4UW5A 5FZOA 1CAXA 4FPOB 5JSOA 2WLPA 1YUDA 1UNBA 1B09A 3BPSA 2Z79A 2RS11 3AXDA 4JC1A 4XURA 3WX5A 2B5HA 4AFMA 1G7YA 2WNUA 1LOEA 1S1AA 1GOGA 1NCRA 1GLHA 1QJY1 1ST8A 3E5QA 4W65A 2HWB1 3ZN6B 4E2GA 2AEYA 1SEFA 1UY1A 1AR63 4YM1A 3AKPA 4M4RA 1KDKA 1QDOA 5GLVA 3IWZA 2A75A 3ZFGA 1ZBA2 4E27A 3LPGA 3ZXAC 1J3PA 5BNNB 2VQUA 4Q4Y2 3I49A 3TBDA 1LRHA 1NCQC 1PHMA 4MO3M 1QH7A 2D5HA 2ORXA 2OZJA 2K2SA 1LGBA 5KC5A 1HXS2 1REEA 3FFZA 5KXDA 4E4HA 5FY8A 2VZTA 4H7LA 3JBG2 5HV4A 2Y0OA 2CWSA 4A7YA 3WQBA 4DEQA 4OI4A 3CO2A 4P9GA 3KVBA 4KNCA 5J09A 3I3DA 4F83A 3QCWA 4MGSA 2CGNA 3ITQA 3FHIB 4NAOA 1O3TA 5F9TA 1D0HA 2I45A 5GLZA 1ND2C 2RJLA 1CZTA 3PMSA 1AXKA 4RFT0 4YVWA 2AZ5A 1QQP1 1SLBA 5FP7A 3AP5A 4HETA 2G9GA 2ZGLA 2W1SA 4DMIA 2P4EA 1NLRA 5FR3A 3P3NA 3JD71 3U14A 4EN6B 1ND3C 1RHI2 1A3KA 4RA0A 1FNZA 1SPPB 4PLOA 4K3UA 2RVAA 4CP9B 3SH4A 1UPSA 4CPBA 4MX3A 1HB1A 1MQTA 2EALA 2VZQA 2Z4FA 4M0NA 3SKVA 4COVA 4CXYA 5C3SA 1DLCA 5KC6A 4JTOA 4I01A 4CDWB 1VMJA 3KD4A 2WNOA 4WM8C 2CV6A 1H2MA 3K4ZA 4HVRA 5CIRA 2Q8DA 2RS12 2E53A 4X6QB 4YFWA 4AW7A 1F2NA 1GWLA 4COWA 5JWPA 2J1EA 2BBVA 2YHJA 3VBFC 4MGTA 3D6EA 4ISQA 3UV9A 5JZGA 5A7NA 3ZYHA 1A78A 1QJY2 1J58A 3A22A 2HWB2 3MPBA 5FCCA 5B4XA 3KV6A 1GYKA 4FQ4A 3JCIA 4JGYC 5ANNA 2MEV3 1CAWB 4XQDA 4YZ4A 1POV0 2BQPA 1W9FA 4CDXA 1MVEA 2Y60A 5FIXA 4ONUA 1W0NA 2GNTA 2AREA 2JDAA 4RHV1 4XABA 3MHZA 2VY0A 4RFRB 4RYDA 1K3IA 2X5IB 3N9OA 4OHWA 2R063 3VBUB 1UAIA 3DXTA 1YFUA 4B29A 1OA2A 1EV13 2ARCA 3H8RA 2RMU1 3BU7A 3M3OA 4WVVA 3R4UA 2JWPA 4N7UA 5AC93 2D3SA 3ABZA 1MEC1 4LA3A 3POWA 4MG2A 1IOAA 2Y33A 2WNVA 2P17A 1AR73 2VCCA 1HRV3 2IXHA 5EPAA 3WDVA 2WT2A 3FBMA 5IHRA 5FBJA 2B46X 3A21A 2R7EB 4TTGA 2D6NA 4R9CA 4XETA 1O5LA 4YRDA 3I59A 2NP0A 2AEZA 2EXJA 2PN5A 2WQZC 2HWC1 3JB4C 1OXCA 1QQP2 1Z0HA 3NVCA 4YW6A 3FN9A 3ZLIA 1F4AA 3WNKA 3HMYA 1ZNPA 2Q30A 3DV8A 3TEWA 3BTXA 5DQ0A 3U4XA 3LF7A 1F15A 2WS93 1OQEA 3DCQA 3JD72 4G9SB 3WD5A 2VMIA 1I6XA 3E97A 3FWEA 1NCQB 3HT2A 3A0NA 5FMOS 2BYVE 4QQ2A 4B1MA 4BH9A 4UF0A 4QD2A 3SXWA 1Q3EA 1W90A 4XMAA 2WNEA 4YM3A 4OMDA 4XC9A 5FAXA 2DCTA 3ALQA 1Q5OA 3URFA 1GZWA 5FLJA 4LK6A 1LOFA 1GQPA 2RDSA 2RJKA 1RUD3 2XL9A 3RYKA 2UYBA 5CU1A 3AMNA 1FV3A 1HJGA 3DPRA 1W6OA 1L7RA 2DURA 2ZZJA 5K0UC 1NZIA 4FP2A 2PMWB 1UYYA 2ZKNA 4DEVA 5ACA1 1H4HA 3NMBA 1GUIA 2ZTNA 1OH3A 2JKBA 5L73A 4NPMA 4UFIA 1ND2B 1AR61 4UAPA 1DF0A 1W6MB 2OPWA 3VZLA 1EUUA 3SISA 3O12A 4P02B 1BQPA 5TSWA 2K0GA 1D7PM 3E5UA 3M1HA 4GWMA 4RHV2 5EJ3A 4D7SA 5CAZA 1ND3B 3CZJA 5BNOB 2DCKA 1NUKA 1AL0G 1HW5A 3QLQA 4K40A 1OQ1A 2OUJA 4Y1UA 3PUAA 4MGZE 4C1WA 4NWWA 1BVVA 2RMU2 1XYPA 4ZZ8A 4XIOA 3HBKA 5C3PA 3O0XA 1MZ6A 1MPXA 3MLKA 4GAZA 4QPIA 2H6BA 3OEBA 3PVOA 1MEC2 1W6PA 3POBA 4PBPA 2RS51 5CISA 2Y8KA 5JXJA 2QQOA 2VUJA 1S0BA 2PXJA 1ODMA 4FPLA 1ZRCA 2VVDA 5A6QA 4IE7A 4QM9A 3ST7A 1CAVB 2OQ7A 4LK7A 2C9AA 3VBFB 1DQ4A 4IE4A 3BCWA 4D7YA 2RG4A 2XJPA 2B39A 4BQ5A 1OURA 2QUOA 1OH4A 5FO9B 4LBMA 4JGYB 3LA3A 3ZR5A 2R073 2X8KA 4CCOA 2HWC2 2OZ6A 4PDWB 3WG2A 4FBFA 1K45A 3ROUA 2Q8CA 2VMCA 1SZBA 1OI6A 3AZZA 2DVBA 2PQSA 3H8XA 3CJIA 1RXFA 3VKMA 3BUCA 3WW2A 1TNRA 1XE8A 1DYPA 1YQCA 4YM2A 5C5UA 2WN3A 3WUCA 4O65A 1NXMA 4Y33A 4Y3OA 2UWCA 2Y38A 3AYCA 2WAAA 5FY7A 4FAHA 1OOPC 1AYM3 5FY5A 3F2ZA 5FOJB 1DQ6A 4DRRA 1WLWA 2IWGB 3KT1A 1PX3A 4J6GA 4YG6A 5BXXA 1GZ9A 4I09A 3UKNA 3ZPYA 3C3VA 4N53A 3I3EA 5A70A 1DGLA 2BP6A 2BU9A 1LHNA 3OF1A 5FBZA 3SH5A 5ACA2 2GAUA 3D4KA 3VBHA 5FYZA 5IWFA 4BMEA 5C3QA 3PJQA 4ZS2A 1X82A 4NIHA 3L9JT 4UW6A 5DZGA 3LPFA 5CEHA 1W03A 1G9BA 1AR62 2MEV1 1LAJA 5A32A 2BGCA 1K5MC 2DVGA 3HOBA 5FWEA 4AOCA 4COYA 4D6QA 4ZKTB 5DUWA 1RMU3 5J1XA 4LBQB 3NAPA 4QDRA 3LIHA 2GN7A 2DUPA 4CP0A 5FZMA 2YV8A 2R061 4CUAA 4LULA 3ZSMA 2A3WA 5LCWL 3EJKA 1EV11 1YFWA 3IIIA 3LA7A 3HN1A 2W95A 3LKJA 3ON7A 1CGPA 1DIWA 4S2GA 1ZRDA 4Y22B 3DUIA 5AC91 1GKBA 2O1QA 5G04L 2R043 2A6WA 3TOJA 5LATA 2FD8A 2HBTA 5LA0A 4ARXA 1LODA 2RS52 2HWD3 5JZGC 3H8OA 1AR71 1Y4WA 3BOPA 1ULPA 1HRV1 3VZNA 4J25A 1BLZA 3I2OA 4GMP0 5K0UB 5IVBA 5LK7B 3B3QE 2JIGA 2VD7A 3HNBM 1T6BX 4UI9L 3WDWA 3GM8A 1VBA3 3CLPA 5FYTA 5M0TA 3FUOA 2VGDA 1GR3A 2EIDA 1PZ9A 1GOHA 4AEKA 4BDVB 1JMUB 1WA4A 3NNGA 4LKDA 4LITA 4PI2A 3MI8A 4R4ZA 2OUHA 3KS7A 3T2TA 2YROA 5HCAA 2DYCA 4BQ4A 4EN8B 1AJKA 2DVDA 3ZYFA 1CAXB 2BFUS 5A1AA 3O1UA 5JAXA 1RB8G 3NKGA 1GNZA 1W8FA 3FLTA 3K4DA 5CFCA 4LO4B 2VOKA 2C1FA 2JG8A 3IAPA 4OMCA 1KGYA 2YFZA 4EZ4A 2OT7A 2DU1A 2ZEZA 3KGLA 1SHWB 1UW8A 3SCGA 4AK3A 1WGPA 1QXJA 3AP9A 2FQPA 1O8PA 4S2DA 2V4AA 4KU8A 2ZGPA 3THTA 4LHSA 1VB2A 1JZ8A 3T09A 2JDZA 2YU1A 1DP0A 1XNBA 2OA2A 4PF1A 1V9U1 3MFCA 5JVVA 3UGHA 3ZFGB 1TE1B 2P6HA 4LIUA 2XXZA 5LEKA 4L11A 2G9ZA 1DHKB 2E7QA 1X9TA 1FXZA 1RITA 1W04A 4XBLA 5LB6A 2BNMA 1QOTA 1GQHA 3WXPA 4A7KA 2Y34A 4QQPA 5HXMA 2MEV2 3W5MA 1N47A 5JI9A 2OIIA 2ORZA 3RFRA 2E33A 2HLEA 4IQPA 1UYXA 3RYRA 4Y4RA 4WVZA 1Y9MA 3H3LA 4IEQA 3D3AA 4LKSA 3ZXFA 2R062 2X05A 3VUOA 4HMZA 1EV12 2LALA 4K8RB 3L2YA 3WT3A 5LK5A 5AC92 1F5JA 3BTYA 4FPJA 1JOPA 5C8CC 4QWNA 3KV9A 3OY8A 3WZ1A 3U07A 1H8TA 2K9ZA 3KWVA 1AR72 4GZ9A 1HRV2 4BJ0A 2J1AA 1WD4A 3MIGA 1W0PA 4BYYA 2BPA2 4P08A 4QX0A 4C90A 4Y5Z0 1BVP1 4XHXA 1HLCA 3PMEA 2BV4A 3J9SA 1W8NA 5FP3A 3TNPB 5A7SA 3VBSC 1YI9A 1NG0A 2PFWA 4L2NA 4S2HA 4BCUA 1NXD1 4RD7A 1VAVA 3KQ4B 3N7KA 2R071 1YIPA 2VOTA 2GN3A 4A7ZA 1K5MB 3PVNA 1FT9A 2CL2A 5FZFA 1S0IA 4JKLA 4PBOA 2IFRA 1WCKA 5CZKA 1CN1A 1QEXA 1L7QA 3LB9A 3KCXA 2NM1A 2VOWA 3T1MA 3VBRC 2FCVA 1WKYA 2JKXA 1E57A 1OFNA 3I7DA 1SLCA 1UL9A 1MS9A 3HNMA 1V6LA 4QX5A 1AYM1 4HBNA 1ULOA 2D6LX 4XAAA 1S0JA 2YXSA 2FDJA 4FFIA 5JZGB 1NAEA 4RR3A 2DUOA 3C7OA 4BB3A 1VE0A 3Q8AA 3ZXEA 3GNEA 1OSGA 4BQYA 4AFAA 3APBA 1UIKA 2WWUA 2ZHLA 4MOAA 5T52A 3O1VA 1V9U2 1VP6A 2IFWA 3LEKA 3AX4A 1ZBA3 1YLLA 2ZZQA 2WZPP 4LIVA 1KS5A 1YQ6A 4IGPA 2Q8EA 2A1XA 1IHMA 4Q4Y3 3MIBA 2XL7A 2QCSB 3POSA 4NR1A 4CSWA 5FMOL 1KFXL 1QXPA 1RMU1 4XJAA 3MUY1 4IV1A 1W06A 4GJYA 4AL9A 3WQ0A 5BPXA 4PT6A 2EVXA 5C9AA 2R16A 3IDAA 3WNOA 2ADEA 1G9FA 2WNVB 4A6OA 4V1PA 2IXJA 5J7MA 2ZEWA 3GCWA 4XQWA 5FV3A 5FPBA 2XKOA 1POV1 2R0HA 2VE1A 1JN2P 3VLBB 3IPVA 5JPMB 1A34A 5KXBA 5J36A 2HWD1 5IVCA 1VLNA 5FYYA 1C1LA 3P3PA 2ET7A 5A3MA 4BQ1A 3THDA 1B35A 2Y0IA 5BNPC 2ID4A 3DL3A 1CX4A 3USSA 1WCUA 3N35A 3WOGA 4QT6A 4IEOA 1H0BA 2VUCA 3N36A 1JUIA 4Y20A 1VBA1 4CCCA 2ETEA 3LIGA 3BI3A 1V0AA 2YC0A 2EAKA 4K9SA 5LBBA 1H1MA 4NIDA 4XUPA 5JSPA 1OVPA 2R072 3HR9A 1RHI3 3E6DA 4PLMA 5FZIA 4WVWA 3AYAA 2VMFA 4OQ8A 4KGQA 1STMA 4FXKB 1RUJ1 4BXFA 1PNGA 1UZ0A 3O1TA 4LO8A 3IDBB 2Q1MA 5FFOC 2ZKLA 5DAQA 1XJAA 1J3QA 1NX9A 2W5FA 2Y26A 3I3BA 2HWE3 1W6OB 5HV0A 3ORJA 3FHQA 5C8CB 3KMHA 3TEYA 1AYM2 5A1FA 1CWPA 5J98B 1P8JA 2QFEA 2Z69A 1YIFA 2WZR3 2WZEA 4BPZA 2WBKA 4EWAA 1EAH3 1VIWB 4PCRA 5JMOA 5JOWA 5JXHA 4NWVA 4TLGA 4DINB 3POIA 2RE9A 2E7TA 1UY2A 2MHFA 5F39A 2PYTA 2HWB3 1D4VB 3IMMA 4M3CF 3OOXA 2X53S 1VBB3 3ZYGA 3INAA 1C4RA 1H9WA 3OPTA 2WUHA 5A7OA 1OUXA 5CG8A 2W87A 5CG9A 4JKKA 2XGXA 4P9LA 5I0RA 2H0VA 3GZAA 3WQ1A 5FPAA 1FAYA 3H7YA 2W2IA 2W46A 1E5IA 2D6PA 4LR4A 3ACHA 3RZHA 1MS8A 4XEZA 1RMU2 4YGCA 2CDOA 3QACA 2ZX3A 4AEDA 3VBOC 2JG8C 4HXCA 4XJ9A 2QQJA 1Q8OA 4H2AA 2ZOEB 3VBRB 5A7QA 3IB3A 5C4WA 4CEYC 2HEYF 1W3XA 3AMQA 4KGGA 1C5IA 3JB8A 3VDAA 5L7OA 4OI2A 2BERA 5JXIA 3RMYA 3AVSA 2IXKA 3VZOA 1XYNA 4QKBA 1QXRA 3W58A 5FMDA 4CDUA 4M01A 2CGOA 2HWD2 4AI2A 4UYBA 4CCLA 1BYHA 3ACLA 1YQ2A 1KRIA 1QJX3 2A70A 3KHCA 2WA4A 3O5SA 3M3IA 5FY9A 1AR91 1UKRA 2JX9A 1QQP3 4GWNA 2DTYA 1BJQA 1VBA2 2HBUA 3KHBA 3WNNA 3E6CC 1AYN3 4CCKA 3PURA 3CKHA 4CUCA 3JD73 3K3OA 1C1FA 4P5YA 4D3WA 4NMIA 1S55A 2IVJA 3OGGA 4BQ3A 1G9CA 2DUQA 5A7WA 3ZKYA 2YBPA 3WF0A 2H6CA 4D6RA 2W91A 1ZX5A 2JB8A 2Q4SA 3M4FA 1W8TA 1RUJ2 2CU5A 5FZGA 1WLTA 4IE6A 3F95A 1MZFA 1JZ4A 1OQDA 3M2MA 2Y6FA 5FYIA 4LBQD 4N53B 3GBFA 4W4ZA 1WWYA 5ABJA 1YO8A 4BIFA 2ZABA 5IFPA 2D3RA 4RS5C 1C28A 2V5YA 3SCFA 1HB3A 4Z82A 3PVBB 4L97A 2GZWA 2VBDA 3VBHB 1GP4A 1BK1A 1UYZA 4GB33 1IGOA 3AL5A 4WM7A 5BNPB 4AXOA 3ZVXA 1HQLA 3BALA 5FZ3A 5GALA 2XLFA 5A32B 5A3UA 1TVGA 3MYXA 1NLSA 4XFCA 2ARXA 2WLQA 1KD7A 2BUKA 5FLIA 2YMZA 4HK9A 4O9GA 3AMHA 4RHV3 5FWJA 4OVEA 3HQUA 3OD0A 1LENA 4LMFA 4IL7A 2EICA 4M3CE 4QMAA 3WEZA 2JG9A 2TUNA 2BVVA 2BFUL 1W0OA 2WRAA 3C7HA 3D0SA 4MUVA 4N43A 2RMU3 1WCQA 5FKBA 3USUA 1CR7A 4CUGA 3VKNA 4D8MA 5A6ZA 3WNMA 1F31A 5C71A 4R9DA 4B1LA 1OPMA 2BDRA 4LHNA 3Q8FA 1JTZX 1J59A 2VZOA 3RZJA 3WQ7A 3J4UH 2FDIA 3I54A 4QXCA 3RS6A 2ZGSA 2BJSA 2ZAHA 2PA7A 4K8FA 1X7NA 2NMNA 1UMIA 5I0DA 1SBFA 4Z2WA 1GOFA 3KV4A 1WCDJ 3U75A 2VM9A 1T2XA 4DFSA 4CUBA 2XLGA 4DNYA 1GBGA 1ENXA 1ULCA 3RGBA 1AR92 2MNGA 3VKFC 4ATEA 4HG6B 3GZEA 3IIAA 2Y6LA 3K2OA 2WSVA 1JZ3A 1JU4A 3KT4A 1AVBA 4CXWA 2D43A 2X5IC 4LOTA 4GMP1 1SDDB 4AQ6A 4URAA 2ZGQA 1X33A 3CEWA 1RUH3 1DFQA 4HZFA 4HVQA 3HPNA 2JG8B 4XE9A 4IESA 3POGA 2ZHNA 1FPN3 2G1MA 2Z2SB 4XXPA 5JSRA 2XKPA 4CEYB 1RUE3 5I8SA 2DU0A 1GZTA 2HWE1 1C3HA 2QBXA 2VXJA 4ISRA 1V6MA 1ULGA 2D7FA 1SMVA 4XJ8A 4AI3A 4AQTA 5I8YA 5JR2A 5ISLA 1G8WA 4IW3A 5IK7A 1S0FA 3K3NA 3T0BA 3J7HA 3ZIXA 2WZR1 4D69A 4OLLA 3WINE 1EAH1 5ACA3 3J7MA 5LBEA 2VZ3A 1URXA 3T30A 3PVEA 1WZXA 3GF6A 3IDEA 2X10A 3N9NA 2C26A 1D0GA 1VBB1 2H0BA 1LULA 2ZMNA 5D8AA 1R083 1YNAA 1W6QA 3BTAA 4AF9A 2JDNA 3DKQA 3O0WA 3LSEA 3OGVA 3EYPA 3ZSLA 4MGKE 1VB4A 3ZFFA 2C4XA 2W92A 1UZVA 2W08A 2D5FA 1J1LA 4NJ4A 4O9EA 1MVQA 1RUC1 2ZX1A 3OYWA 3O0VA 3MO4A 4JDNA 4LT5A 5FZ8A 1PK6A 3QH6A 4WZCA 1DDLA 1GNYA 4QB6A 4AR2A 3U0ZA 5BUVA 5EV7A 3T4HB 3V0AB 3P1IA 1HQWA 2BW8A 2O0OA 1XB9A 2ERFA 3OY8B 4NIAA 1LGCA 2V72A 4LNVA 1RUOA 1H8TB 1JXNA 2ZHKA 2RS53 4URTA 2Y6JA 2BVBA 5FTTC 3LZZA 2R6QA 3V56A 4RS5B 1LESA 1OLQA 3LDRA 1QMJA 5F3GA 4XF9A 2PHWA 5I0SA 3EHKA 1AX1A 2JE9A 4E4ZA 1SLIA 1QJX1 1RVF3 3ZR6A 4IV3C 4ZS3A 3GBWA 3WNPA 4K1YA 1W05A 1HV0A 3AMMA 1Q43A 4QAWA 2GMEA 4OHZA 1WLDA 2Z42A 3DN7A 4XW3A 3OUJA 4DPNA 1AYN1 2EIBA 3H0OA 1A8DA 4QQLA 3WG3A 4DIQA 1HX6A 4QDSA 5L36A 5ERLA 5BNOC 3RPQA 3VDCA 4JZRA 5FPVA 3ZFEC 5IAVA 1UXZA 1LHOA 2WFPA 3PU8A 4IEXA 2VO5A 1VJ2A 3TAYA 3ZXLA 2PHDA 1OFSA 3KT7A 1J1TA 3K51A 3WHTA 4XJWA 2V4VA 4I3PA 1H2NA 2HWE2 2JIJA 1PNFA 5JDBA 1GP5A 1CJDA 3DECA 3NJXA 2XVGA 2XJRA 4D0QA 3PLQA 5CFDA 1FNYA 1DBNA 3FLPA 2GP3A 2WZR2 4GQ7A 5FZ4A 3MF6A 4GB31 1EAH2 1NZCA 1W8OA 5FQ0A 2HKXA 3N7LA 5FMCA 1VBB2 4GA9A 4Q0VA 5JIAA 4IUGA 2VZVA 4P9XA 5DXDA 1NLQA 1JZ6A 1O6UA 4PDWC 1I3HA 2BWAA 1NY71 1OVSA 3DF0A 3WNLA 4LBJA 3GXUA 1OD5A 2WO2A 4EWDA 3UESA 3CMGA 3ES4A 1RUC2 4PJYA 4ZXEA 1LHVA 4OHYA 4FPFA 4B8EA 2A6XA 3KF3A 3OB8A 2PAKA 2LROA 2VQAA 5GLUA 1YQ5A 2JXAA 5F5IA 1QKQA 4Q4V1 3WF4A 3N3HA 4CVUA 5LA1A 2QZ3A 2YYOA 2D97A 2VPVA 4XXAA 3Q8EA 4L9BA 5F1RA 3V0BB 5DPNA 2PAMA 4Y5SA 4Q5OA 1AJOA 2GALA 2VOVA 4QU1A 2O8OA 3WDUA 4AQSA 5GZGA 2QDRA 2W68A 2CY6A 4WVMA 2VUAA 1QJX2 4BMBA 4CDQA 1YWKA 3AYDA 1G9DA 3MICA 5H9SA 3EQEA 5FZ0A 5AFBA 4FFHA 3SHRA 3N9QA 2CSGA 3HVDA 1O7FA 4AFCA 5JMCA 3SH3A 1F35A 5E88A 1X50A 1JODA 4Z1VA 1AYN2 2HYXA 3J8F1 1FYUA 1OA3A 1UOJA 2VVFA 3EO6A 5T3NA 2B8MA 2FHRA 3NNMA 1DZRA 1I9RA 1MS1A 3BOWA 1S2BA 4EJRA 1RUH1 1REDA 1UU5A 5LBFA 1IPKA 4HANA 1OT5A 3BPZA 1ZRIA 2J1RA 2VW0A 4HPKA 1FPN1 2BGPA 2P2KA 3ZKUA 3LSDA 2VH9A 3WW4A 4R9BA 4UT5A 1RUE1 5F6KA 1QJU3 4SBVA 1ODNA 2JDKA 1XNCA 4KBBA 4CE8A 2C24A 5BNQA 1ZYBA 4M0HA 4NRMA 3LGRA 4LHLA 2TNFA 4GH4A 1LU2A 4GB32 4XOGA 1V9U3 5F2SA 3PTYA 4IV3B 3WCRA 2P5BA 2NPIA 1YQ8A 2VQTA 1GNHA 4FO9A 4KMQA 4A42A 4CCDA 1R081 4NHXA 1O3SA 1YFXA 2VQ0A 2JECA 1YFYA 3PNAA 5I0UA 5SV8A 4CZSA 4UW4A 1NY72 3VZKA 4XBNA 4GJZA 5K4LA 4QPGA 4PIYA 1LEDA 3I2JA 3T3YA 1QY4A 5C4WB 3ZFEB 3NJYA 4YGEA 5B4NA 1IQDC 2EXHA 2RR11 4CU9A 5L7OB 2WAOA 4U2AA 1BK0A 4HK8A 3POJA 4YW7A 4Q4V2 4GWIA 2XHNA 4LBNA 1S0EA 2Z5WA 4Y4YA 5LRRA 4CDUB 3TNQA 2XJVA 2BWCA 4AZZA 5A33B 2WNUC 1OLRA 1NCRC 4EZHA 3ETQA 4CTEA 1H8VA 5JLVA 3EB7A 4PIXA 3E5XA 3MLLA 4H3WA 4QPWA 2G9FA 3ETPA 5DAWA 1RVF1 1VRBA 2N7GA 3ZFGC 4FCAA 1Q8VA 1PM4A 5DMYA 2QQPA 4OI0A 5A7WB 3FZ3A 3BVCA 1N1VA 3RDIA 5B2GB 4G3YC 4PQ9A 4EV0A 5LWBA 4XACA 3IAQA 3J8F2 1IPJA 2E51A 3BODA 3OCPA 3K75B 4M3CA 4QPYA 4JCKA 4ES8A 2GMMA 1RUH2 4Y26A 5FZKA 4NN0A 3AM2A 5KBFA 5FZHA 1FPN2 2AR6A 4RN5A 3RYPA 1VBC3 1RUE2 5FZ1A 1CIWA 3LDKA 4WM7B 1PVXA 2WQ4A 3VD7A 4XFHA 1UX6A 2HYKA 1GU3A 1FOD3 4YVWC 4FPYA 3HIFA 4DXZA 3VHPA 3ZSKA 4LA2A 3WP5A 2WDBA 4AVTA 3O1PA 4P14A 3NW4A 2ZGNA 1ALYA 3KB5A 4NHKA 5FZDA 3SITA 2JG9B 1R082 4XTPA 1VR3A 2VU9A 3HQRA 5FREA 1AX0A 4E9KA 1DGWX 1MQTC 1W2UA 2Y6GA 3N9MA 5APAA 3USUB 3VDBA 3NSTA 1NQJA 2BBAA 4AE2A 2XDVA 1SCSA 5FZCA 1V6JA 5HPOA 1WW6A 1DZTA 2RR12 2SLIA 1OD3A 3AJZA 1YCIA 3B5LB 1QF3A 2YBSA 3B94A 4FQZA 2XQXA 5D21A 4COZA 4FXGB 1VAKA 2QKDA 2YG0A 1POV3 1FI2A 1AXYA 1LB2A 1TZOA 4K7JA 1GMMA 2YDEA 2YY1A 3ZX7A 5A3PA 2D40A 2JDHA 4EQVA 4Y24A 3LQCA 3KGZA 1DGRA 1UY3A 1AHSA 1LHUA 2J1TA 5F6LB 4AVSA 2ZAAA 2DV9A 1AUYA 2XQRA 5A7PA 3E6BA 5DG2A 1X8EA 1KJLA 4CDXC 2FDHA 3H1MA 2QQUA 1RVF2 3NL1A 2XJUA 2YPDA 4XFAA 4XAEA 2WJSA 4XHBA 3TRSB 1O4YA 4NHMA 3I2KA 5FYBA 5I91A 5FYHA 4BQ2A 3VD9A 2VBBA 5FXVA 2X29A 4ZY9A 1W9YA 4TN7A 3ZO0B 3CZUA 4RGAA 1UN1A 1DQ5A 3VD4A 4UFJA 1RUJ3 1FMD1 5T5JA 4GWJA 2WL1A 4YG0A 2BNNA 5FZOB 1NA1A 3H50A 3WDXA 4AAXA 2WNVC 2RS33 1F4HA 4QKDA 4Z07A 4ZZ5A 2ATFA 5FKCA 5AVAA 4LXLA 3RMXA 5FZ7A 4SLIA 4F7ZA 4HFSA 1QJU1 2WNUB 4UW3A 5CKNA 1NCRB 1XNKA 4XMIA 4BWOA 3ELNA 1ZZ7A 5FO7B 3HWJA 4CRQA 2VMHA 3VB9A 4B4PA 1DYOA 4FVVA 4Z2AA 3LCPA 4QXKA 4MV2A 1ZVFA 1FV2A 2QTWB 3OGRA 2AC1A 4HN1A 4D6SA 1QOOA 4V2WA 5IUQA 1XE0A 5KHKA 3LD8A 3R6SA 3OYWB 1TME3 4P9JA 2J1VA 4NRPA 1UZWA 1W2TA 4COUA 5CB7A 5EHDA 1BCXA 4HT1T 2DDUA 5EYYA 1W6NA 3WR0A 4HSJA 5FRAA 4IEPA 1C5HA 3DYOA 4LO5B 3WSOA 3CHXA 4AGRA 4EN0A 1UZZA 4GKXA 4XF1A 3M3EA 3SLIA 2ILMA 1QOSA 1JZ7A 2UWBA 2I74A 1UMZA 1S4CA 4OHXA 1SACA 4A41A 1LOFC 2DWRA 5DUVA 1XQNA 2ES3A 4BOWA 4DXSA 2VMDA 1UU4A 1Y9QA 3S5QA 3DPRC 3KZ4C 1COV1 1N3OA 4MGQA 4DY5A 1NOVA 4IEVA 2LUWA 4QDQA 3VDDA 4BK4A 2Q5TA 3WVJA 3PUIA 1US2A 4KL1A 4YVWB 2HJIA 3DYPA 5EP9A 4IE5A 4KQ7A 3ZXGA 1LCLA 2WINB 1AR93 5FYCA 3LAGA 3LE0A 2RDQA 3LEMA 3MLJA 4GALA 4MH0E 3OTFA 3NNJA 4MSVA 5BY5A 5BNNA 2AACA 1WW7A 1Y7BA 3M7AA 4QU2A 5C6CA 1JYVA 1MS4A 1M4WA 1K42A 4L92A 2QJVA 1LHWA 1MQTB 2ZGTA 3BIWE 5EXOA 1ZREA 3A0KA 4LUKA 3ZXJA 1RUNA 3LFMA 4YW4A 4QPIC 3NNFA 4CXXA 1G6NA 1FMD2 1W8ZA 3RQ0A 4V2VA 2R49A 1EPWA 1YXWA 3QBQA 3KLSA 4IERA 1H30A 2XB6C 1DGWA 4AHZA 1O3RA 1A6CA 4LE3A 3TEZA 1VPHA 3MFAA 1SBEA 1IS6A 3SKJE 4YNIA 5CFDB 2AUYA 1N1YA 1VBC1 3VHNA 2DVFA 2VNVA 3ASIA 4CCNA 1QJU2 1SCRA 1XRUA 2WKKA 3UGGA 3DEMA 3I97A 3C7EA 5HBAA 4KG8A 2FDKA 2VBPA 2YGMA 5LY2A 1DGRN 2VJXA 4YGDA 5A3NA 1FOD1 2C5DA 5A1LA 1BBT3 4CDXB 1ASJ3 1RUI3 2PHUA 2W39A 4JAAA 1C57A 2LTNA 3U10A 4DY3A 3CJIC 5FY0A 5CYYA 2VZPA 1Z7S3 5FYUA 4AI8A 1D4M1 5HXVA 5IVEA 4CP9A 4LO6B 1OBNA 1O5UA 3KCCA 5FUPA 4Q8KA 1KS4A 3R0RA 4FFFA 3SC7X 2IXIA 3ME2A 3W20A 3D0JA 5F32A 4DUWA 4XFIA 3SQOA 2V5DA 3VL8A 3VKLA 1ENSA 4YZ3A 4OULA 5J37A 2CHHA 4CDWA 2VCMA 2XONA 5AVPA 2JDPA 1S2KA 4R9AA 5T50A 5LEJA 4PLNA 3B02A 4N53C 1O8SA 1CJPA 3RZZA 1GQGA 4QQHA 1YRZA 2Q0AA 4KG0A 4XYXA 2WZ8A 3A23A 3M70A 3Q8CA 2YUEA 1K12A 1JS9A 3QH7A 4MXWA 3VBHC 4RL7A 2GMPA 2RV9A 5EQUA 1LEMA 1ONAA 2W1UA 3I59B 1HRI3 3MDPA 3MIEA 4LUMA 5JPNB 1I5ZA 2P3IA 1ZZ6A 3ZMNA 3NNLA 1VALA 4HVOA 1RUF3 3NAPC 1OMIA 5IATA 1BZWA 1PMHX 4WV8A 2ZACA 5CKMA 1CAUA 4KH9A 3MIFA 3VBUA 5AFEA 2NZ9A 3MGUA 4INDA 3M3QA 3AVRA 4UF0B 3CDZB 4GMP3 5JUVA 4IE0A 1NT0A 1FX5A 4CP2A 3ZPOA 3ZXDA 1IZ3A 3RI8A 2O14A 2DTWA 5JOZA 2ZX4A 2CAUA 4BQXA 4KBZA 1GZWB 5DABA 3UNPA 1I5PA 2VULA 4Q26A 3OUHA 2RS31 5FYSA 2UU8A 1U0AA 3DPRB 3NJZA 4LKFA 4A3ZA 4YARA 3K46A 3K48A 3FBYA 3OGJA 5FP8A 1H2LA 2VCAA 1K5JA 1VBC2 4GH4B 4HKOA 1JUHA 5C8WA 2D6OX 1H1AA 2LW8A 4GKYA 2ZJCA 2Q1ZB 4XCBA 1QWRA 1LKNA 4OYUA 1REFA 5DDJ3 3U4SA 1FOD2 2JE7A 3AZWA 5KHJA 3BU0A 4FP3A 3VHRA 2ZPXA 4QPGB 1QNWA 2EIGA 2ZCWA 1TME1 4ASLA 4XDPA 1NCQA 1WMEA 3NV2A 4NROA 4Q4W3 2B9VA 1D4M2 1MZEA 1RUC3 2JJ6A 3MIHA 1W28A 3GCXA 2A5ZA 2W3JA 5F8PA 5CFCC 1DQ0A 2B45X 4NOTA 1N1TA 3PJYA 4QPIB 5LRSA 3MV01 4HL0A 1TG7A 1W6PB 3CQOA 4HKLA 3HJRA 3I3QA 1QH6A 4JQTA 4AGVA 3DGTA 3H7JA 3THCA 1C8M3 3ZOIA 3BB6A 3DKWA 5KHGA 2A6YA 2IVIB 4OI1A 3AZXA 5FY1A 4YSFA 1BEV3 2QDNA 2XUMA 2XWBB 1PMJX 1Q8QA 2I2SA 1W99A 2KM2A 4P9YA 5SV5A 2C9KA 4XJZA 3RWKX 4KWLA 4YVSA 2JICA 1GP6A 1ND2A 3ENRA 1POQA 2GP5A 3C7FA 3GBGA 3MIDA 3VD3A 3ZYBA 1W6MA 5JIUA 1LOBA 1QJFA 2P1BA 2A71A 3RNSA 3AC0A 2VAUA 1JI6A 2W94A 5FMBA 3UT0A 4Q0SA 4LLOA 2PTMA 3CJIB 1ND3A 1PO11 1I1EA 1E5SA 1VMHA 4NRQA 3VN4A 1U5YA 1DG6A 4GD4A 4MYEA 4TYSA 2PHTA 5EIYB 1IG0A 3L2HA 3V64A 3VL9A 3MW2A 4XF0A 2OKXA 3WP3A 5FPXA 5IVFA 3WW1A 4OCTA 2O8QA 3VZJA 3FJSA 5IT6A 2FCUA 1AF9A 3TB0A 2P37A 4L99A 5FXZA 2VTXJ 1WMFA 1H8TC 4WM8A 3W21A 3I2HA 1AR83 2RS32 2ZGUA 5KR7A 3POFA 4R8HA 4MXVA 1CAVA 4P5HA 4BE3A 1JYTA 2G4IA 3UETA 3VBFA 1VBE1 4CCMA 1PVC3 1ZA7A 4CYDA 4FI9A 3BYWA 4YGBA 2JDMA 1AZDA 5IJRA 2ENRA 3B7MA 2YFUA 1WW5A 4JGYA 5L9RA 4B3NA 1W9SA 4PIZA 1UIJA 3HBZA 1APNA 1BBT1 5FPUA 1WUVA 2QQLA 1ASJ1 1RUI1 4LBOA 5A80A 1F8VA 4ZU7A 4KI5M 1H9PA 3PU3A 4IGQA 3NAPB 4DB5A 3KSCA 3NRUA 4YW3A 4Q1RA 4YZ2A 4YYOA 5L19A 1TME2 1Z7S1 5H9RA 3UKTA 1XYOA 2PHFA 3NJVA 1HN1A 3G7DA 5GZEA 4A2UA 5IVVA 1ZZ8A 1EUTA 4H55A 3M3CA 4ATFA 5LZ6A 4ZPIA 3OGSA 2W9XA 2VNRA 3SNMA 1J84A 1X9PA 1PZ8A 2P3JA 4FPGA 4Q4V3 3ES1A 4IEWA 4Q1PA 3NKTA 4RR3C 1O59A 4QHOA 1WBLA 4Q0PA 2E26A 2PAEA 1OKQA 3FMGA 4W50A 5F5AA 4BLJA 1NE6A 3G6JB 2JENA 4F8AA 2XHKA 2ZGMA 1TNFA 5C3OA 2VW2A 4JHZA 4DZGA 1G86A 2BZDA 1XSQA 2R0FA 1HRI1 1DQ2A 2P3KA 4QGNA 1JYWA 3D82A 1RIRA 4AGGA 4ZU4A 3T0AA 3DXUA 2NYYA 1H6XA 4X6RB 2VCBA 4LBQA 3I8TA 1RUF1 4IV1C 1L3JA 4HONA 1D2QA 3BN6A 1PO12 3O7OA 3EMRA 5JOXA 3J8F3 3LWCA 4QM8A 4XIKA 1NA1B 3I4IA 1KITA 5C9AC 5E16A 3PUHA 1BMV1 3SEEA 3BIEA 2A3XA 3B93A 2OPKA 2HWF1 5DG1A 5FUIA 4AI1A 2PQQA 3VD5A 5CFCB 4CP1A 1XNDA 1SLTA 1W9TA 4BIOA 2CTVA 1JYXA 3U11A 1W2NA 3AXEA 1V6NA 3ZDSA 5A3LA 1UOBA 2J42A 4BZ4A 1BXHA 2EAAA 1H2KA 3B01A 1B35C 3RSJA 3LOBA 1E5HA 4PI0A 2IXLA 5L9BA 3N9PA 5FZAA 3T1LA 1VBE2 3IM0A 2OYZA 4UFHA 1DYKA 5DDJ1 2J1UA 3FUQA 3LEIA 2ZGRA 4I0AA 5G05L 1BBT2 1C8NA 3JXSA 1ASJ2 1RUI2 4GXLA 4QX7A 5F5CA 1BKZA 1JU3A 3VHOA 5CADA 2D44A 1Z7S2 4Q4W1 1BHGA 3B9IA 3ILFA 2XJQA 4XFBA 5C33A 5GKAC 5IFTA 1L7LA 1PGSA 1SFPA 2RR13 3PIJA 1UZYA 3N7JA 4LHKA 1U5IA 3H9AA 1WBFA 4N9IA 4JHTA 2RDRA 1GV9A 2DBIA 2GC1A 1PZ7A 2Y6HA 3FX3A 2XBO3 3LDBA 4YG3A 1C8M1 2WO1A 4NIIA 3VDDB 4CPBD 2XJSA 4N8MA 4UXAA 1X36A 4CU6A 3QD6A 1BEV1 1QDCA 1U5ZA 5GZFA 1U12A 1XNAA 1Y3TA 1GZCA 5JOYA 1ENRA 2I07B 3AMPA 4B4QA 1HRI2 2Y64A 5EYXA 5A3OA 1CD3G 3RJRA 5FDBA 2QNKA 2ZMKA 4QHBA 1XOYA 1RUF2 1YC61 3AP6A 4AEDC 5L9VA 1KJRA 4JRLA 3UL2A 1G9AA 2OX0A 1LOAA 3H42B 5C4WC 1W2AX 2F4PA 4JTNA 1BMV2 1HDKA 3RI9A 3W5NA 4BM8A 2HWF2 2YC2A 2KR2A 5L7OC 1OOPA 3FFQA 3KCYA 5HCHA 4A4AA 3BTZA 4AHYA 4PF5A 4CDUC 4RR3B 2CWMA 1RJ7A 1TEIA 2D3PA 1AR81 3MW4A 3N9LA 4IDZA 4YVSC 1J83A 4FSJA 1IS4A 3O1MA 2CAVA 3J7LA 3MW3A 1KQRA 4N9HA 3CL1A 4K21A 1PVC1 4LOSA 4N7IA 5DAPA 5FJHA 1XPWA 2E32A 4BHPA 3S5AA 5F2WA 2XMLA 3AP7A 3ACIA 4MGIE 4ZHNA 2W1QA 1ZM1A 3VKOA 1IQAA 2VVEA 3ILRA 4GULA 5DDJ2 3S57A 4LO7A 1K5MA 4FT8A 2BOIA 5FZLA 1M06G 1ZZCA 1TQ5A 3RZKA 5CNAA 2JE8A 2J7MA 4IV1B 2WO3A 4FTEA 2PLV3 3UYJA 2VW1A 1WA6X 1S0CA 1QGLA 3GYDA 5GLTA 3M8LA 4QGMA 2RM23 5C9AB 4Q4W2 4QX2A 4RQPA 2P6CA 4BA6A 1LOCA 4EYUA 1OHFA 2AENA 3I2IA 5J96B 2TEPA 1LGNA 5ABJC 5FJKA 5FK8A 3IPVB 2BNOA 3WDYA 4FPCA 1OPOA 2KA3A 3OBTA 4MXWB 5H9PA 3Q9OA 2VUDA 1C8M2 3AZYA 1B35B 3GZTB 2WFF1 4MHRA 1VMFA 4WM7C 1XXNA 1YJLA 4AEJA 3ZM8A 4E2SA 1BEV2 4Q0UA 5DZEA 2GC0A 3WHUA 3O1SA 3R05A 1OC1A 5FY4A 4NPRA 4Y20B 1H1IA 3HD8B 4EN9B 2LRPA 5JI7A 2XH6A 1CAUB 3WW3A 2CDPA 3CU7A 4J1XA 3U78A 3PUSA 3ECQA 4Q29A 1JH5A 3ZDVA 3O1OA 2FMDA 2DFBA 2JG9C 2GH2A 5LBCA 4YPJA 4CCEA 4ASMB 2YU2A 4JVAA 4N43C 1EP0A 1SFYA 3VV1A 4AFBA 2V73A 4XFGA 1OUSA 1ZRFA 1IKQA 5EWSA 4BQWA 4KWUA 1FMD3 4XVHA 2WA3A 4YM0A 5K8SA 1YYNA 1NKGA 2F6BA 4ET7A 4CU7A 2E6VA 3PDQA 4ZXKA 2QQMA 1QU0A 1S0GA 4CEWA 2ZBJA 4FPKA 4AWDA 4QGLA 2CGPA 2QQKA 4QHZA 1SG3A 1V6KA 1W39A 1AR82 1VBD3 1FATA 4JRAA 5HI0A 4Q4X3 5FOBB 3KM5A 5DUXA 5E1RA 4I0BA 3RRDA 1V6IA 1PVC2 3ATGA 4MZUA 3VZMA 1OLME 4K6BA 4TXWA 2GNMA 1QJEA 3CBNA 2YGLA 2FCTA 2GU9A 5IYYA 3IDCB 1XE7A 1YJKA 5A6XA 4A45A 4OZXA 1TMF1 5T55A 3E1F1 3KF5A 4E8DA 4JGZA 3MV11 4AEDB 3UK9A 3CF6E 5JR7B 5F3IA 1R1A3 1QHDA 2OS2A 4DRVA 3OBZA 3P5BA 4QB2A 1XSRA 5GLWA 3KQRA 1PIV3 1KXGA 1DU3D 4W6YA 3HEIA 4LTAA 5C8CA 1ULFA 1RJ8A 5C5TA 1LR5A 1RUG3 4NE9A 1PO23 4XZUG 5IVJA 1W8WA 1COV3 3GJAA 2VMGA 2XBO1 2ZGKA 4H7MA 5D2AA 4YVSB 2WFF2 2RDNA 3AFKA 3FC0A 1QJZA 2VZRA 4UBGA 3AKRA 1N1SA 5DAXA 2EF6A 2WIIB 4XF4A 3VBSA 5HCBA 5D8AC 5CA6A 4FFGA 1AL23 1IG3A 2PHXA 1W8HA 3ZN4A 4YZ1A 2YC4A 3ZFFC 1YEWA 1WD3A 1OF4A 4KWJA 2KXLA 2UWAA 2AGSA 4Y5TA 4LJHA 4M00A 2W52A 1RXGA 1PK6C 1W2OA 1OF3A 2QQVA 1D2SA 4YW5A 5J3UA 1CX1A 5A3TA 1GANA 2D6MA 2C6SA 1VAMA 2IZWA 4NHYA 3VBRA 4FOYA 3OBAA 3ZSJA 5K9YA 3JUUA 1WMXA 3O1RA 4WM8B 4BLIA 4BISA 4TLFA 2V09A 4R4XA 3S30A 1ZBE3 4QX3A 1N3QA 5ABJB 4HSLA 5KXEA 2JD9A 4OUEA 2UYAA 1UX7A 1LTEA 4XJUA 1V70A 2R32A 5E8AA 4XCAA 4UFMA 2E9QA 5IK5A 4NAMA 2B4KA 1J3RA 2P34A 4ARYA 3JU9A 1UPIA 4C1XA 4FOWA 2WQ8A 2XVLA 2D93A 4IEZA 4AEMA 3RZMA 3CNAA 3THPA 1UMHA 2OXBA 2WT0A 4OZOA 2WC2A 3A7QA 5CBLA 1SDWA 2VL4A 3GHMA 1X8MA 3AKTA 2JB4A 2WYSA 4FTBA 4C8DA 5EJ1B 4EN7B 4I2OA 4G4FA 3HN3A 1TMF2 4MADA 1D4M3 5C3RA 1QIQA 2EIEA 5IVYA 1MACA 2PLV1 4N43B 5DZFA 3C8XA 4I02A 2XLAA 4L8QA 4OFGA 5H9QA 4AHXA 4AVBA 4TZDA 1S2EA 2BOJA 1H4GA 2RM21 2PHLA 5A6YA 1HIXA 1IS5A 1UY4A 2NMOA 1JHNA 4JDMA 1WW4A 3RG0A 3GDBA 1HV1A 4Z92B 5I8TA 4AQ2A 2MPFA 5FZ9A 4B7EA 4C0HA 4MHUA 5BV6A 1UQXA 2DCYA 5CFDC 2VXRA 2XBO2 1O3QA 2EXIA 1KDMA 5FXWA 3OBRA 5FP4A 1UOGA 1AXZA 5BNPA 3V65A 2ZXQA 3J26N 4XUQA 5FP9A 4AYUA 1RYYA 4XZPA 5IK8A 3RJ2X 3RVHA 5F37A 1JYNA 2CYFA 3S7EA 2ZGOA 4BU2A 3ZIWA 1R093 2ZMLA 3MPPG 3NV4A 1EPZA 2HEVF 2BTVC 2UY9A 3UJOA 4AHWA 4NO4A 2J1SA 1F5FA 4N90A 4RQPC 3ILNA 1VRH3 5IK4A 3WY6A 1RL3A 3S7IA 2AH2A 1XC6A 2ZEXA 1MS0A 4Q27A 5I0TA 3A4UA 1ZA4A 4XBQA 5DAVA 2WT1A 4ITCA 4O7XA 3TN93 3SMHA 2G19A 3R4SA 3ZYRA 2FZ1A 4E8CA 3WF1A 3OEAA 4BK5A 2A7AA 3C2UA 3QOPA 1JZ5A 4P00B 4UWDA 3GGLA 4DUXA 4A3XA 5F3CA 1ACCA 2ARBA 2GDFA 1VBD1 4XTMA 4UOJA 1WLCA 2A3YA 4Q4X1 5E89A 4CDQC 1UCXA 3H3ZA 1QNYA 5LY1A 4YFZA 5LW9A 2YBKA 5D8AB 1W6QB 2RJ2A 3U37A 2XG3A 3BKZA 2WS91 3ZFFB 2VTFA 1HB2A 4NVPA 4DXRA 3LFIA 2R1BA 4F3JA 4ZONA 3I2DA
chains in the Genus database with same CATH topology
1RTVA 1PK6B 3AB0A 3ZYJB 1DZQA 2PLV2 2TBVA 1GSLA 2YPJA 3IKWA 3VBOA 5T54A 4D94A 4CEWC 1CESA 1R1A1 2RM22 1NQDA 1Q56A 1RUD1 2HEWF 4CEYA 2NN8A 1PIV1 5KHHA 1IS3A 2B9UA 3IT8A 1RUG1 1NYWA 1PO21 1JOJA 4NHLA 1JYIA 4GH4C 4LEJA 1PMIA 1LU1A 3ZN6A 4EROA 3ZMOA 2FBEA 3WP4A 1PGW1 1AL21 1PM7A 2DFCA 1LECA 4JGZC 2C0ZA 5T5LA 1UU6A 4Y1YA 4IXLA 2D6KA 2DCZA 2DVAA 4QPGC 4B4RA 1PO13 3B00A 4YLZA 3AZVA 3S6PA 4FOVA 2OVUA 1OOPB 3V0AA 1JYCA 1MR5A 3GHNA 1ZBE1 1S0DA 4RS5A 3S0MA 3LA2A 4IETA 3AKQA 5BYNA 2QE3A 2R30A 2A6ZA 2XJTA 1VBE3 2JEMA 5FQ0B 2VNGA 1VBD2 4AI0A 3X29B 4E2QA 4Q4X2 4E4SA 3CJXA 1HKDA 3VGIA 3WDTA 2WS92 1MZ5A 3ZSEA 2YZ4A 2UY8A 4RQPB 2OW4A 1F9KA 3SCHA 2ZHMA 4B7KA 1RC6A 2VECA 4R52A 4Y1VA 4META 1R1A2 3AFGA 4J1WA 4C0BA 1CPNA 4P9IA 1ZRRA 1RUD2 4EWEA 5I93A 5JCTA 1PIV2 3AK0A 3ZXKA 2GC2A 1RUG2 1PO22 3WNXA 5GZCA 4DOUA 1COV2 4AFDA 3N4MA 4WVMB 4AVAA 1U5XA 4CDQB 2PHRA 2QZ2A 4W6XA 2GNDA 1PGL1 1DLLA 3IMNA 1CAWA 1PGW2 1AL22 1R091 2UURA 4QQOA 1SLAA 3WCSA 2X5IA 1HXS3 5GM0A 5D1IA 1V6OA 4TSVA 4DS0A 1ZZBA 1VRH1 3H8UA 3JZVA 3AJYA 3PHMA 2WWSA 3JBG3 2R041 2HWF3 1RINA 3WUDA 5K7PA 4ZU5A 3H1YA 4HPKB 2AYHA 4CEWB 2A73B 2E63A 1ULDA 4YW2A 1WCSA 3TN91 3V0BA 4AG4A 1ZBE2 4TWTA 4HLTA 3IBMA 3OJBA 4FPEA 3JQXA 4RGGA 3B69A 4I3GA 3W9AA 4Z8BA 4OUSA 1IKPA 1XU1A 4XFFA 4K20A 1HQNA 4Q2FA 1LOGA 4FTSA 4JGZB 1ZZ9A 2B7YA 3OPZA 2ZX2A 3OD4A 1UD1A 2E7AA 1DQ1A 1O4ZA 4ORFA 3WLUA 1NA1C 1YI7A 3ZYPA 2DF7A 2IXCA 1ENQA 3H1WA 2DCJA 4IEUA 2RS13 3EXUA 1RGSA 4H14A 4MLOA 3HAGA 1QJY3 1UF2C 1SQ4A 4AVCA 3VBSB 4LBLA 4FOQA 3JQWA 2W0XA 4IV3A 4KU7A 4LLFA 1MS5A 3FE5A 4ES9A 4JDOA 4X8NA 3ZYIB 2WSUA 2FMYA 2ZS6B 1PGL2 1CPMA 4JV4A 5DUUA 3POYA 1R092 1MS3A 5CVRA 4UBHA 4HKWA 3IN9A 5GJ6A 5HCFA 5BNOA 1GICA 2VOXA 3ZFEA 1CQ9A 3AYEA 4M3CB 1Q8PA 1VRH2 1Z78A 3AP4A 3AKSA 1YHFA 2NLRA 3D8CA 2R042 3GZUC 4LE4A 1Q8SA 1WMDA 4IEYA 2ZX0A 4XPVA 4Q8LA 5A33A 1SFNA 1O91A 1A8MA 3TN92 4YZ5A 3MF9A 3VDDC 4MVTA 3R4DB 3NV3A 3UKVA 1JBCA 2QVSB 5EFUA 3LOIA 5FO8B 2A6VA 2SBAA 1V00A 3FLRA 4XQ4A 1Y43B 4DQAA 5BNNC 2EXKA 2XWJB 3B9CA 2JD4A 4HN0A 2IC1A 4JQRA 2VNOA 4PDWA 3TYJA 4COUA 3D5OA 3N7MA 5EZWA 3WV6A 1NE4A 5GZDA 4C91A 2B42B 4P9WA 3WP6A 1SBDA 1GFF2 1R1ZA 4E4DX 4OUMA 5KHIA 3NV1A 3RWNA 2ET1A 3EBRA 4XILA 3ZN5A 1ULEA 4S2FA 1CONA 1EYBA 2RHPA 2WFF3 3WG1A 1KFUL 5KWRA 4FAGA 5J48A 1ZBA1 4FPHA 2BEOA 1AX2A 3HQXA 4Q4Y1 4YW1A 2GSYA 5FLHA 4XF3A 2GH8A 1T6GC 3H3UA 4U36A 4LBKA 1LJ7A 4OHVA 4WZFA 1JW6A 1HXS1 1MEC3 2CNAA 4W6WA 4CDWC 1SLLA 3O14A 4WBBA 2FZ2A 3JBG1 1N3PA 4Y22A 1UKGA 5T5OA 4XDQA 4GIQA 4Y1XA 3NO8A 2GC3A 1O4TA 4I30A 2PELA 4KWKA 4D7TA 2LM3A 5K0UA 3MZHA 3HT1A 2HWC3 2D98A 3MEPA 4I0WB 5T5PA 2VG9A 4Q0QA 3TWIA 4Y1ZA 3GALA 1XU2A 1EY2A 1RHI1 5F5QA 2NQYA 3UJQA 3VBUC 1CVNA 1W6NB 2EA7A 3W59A 1TMF3 5FPZA 4X8PA 3VBOB 4MGYE 3WG4A 5KXCA 2Q8OA 2XPJA 4K1ZA 2GNBA 2XVKA 2R1DA 1OA4A 2ZA9A 3NWKA 4RSUA 4UW5A 1CAXA 4FPOB 5JSOA 2WLPA 1YUDA 1B09A 2Z79A 2RS11 3AXDA 4JC1A 3WX5A 2B5HA 4AFMA 1G7YA 2WNUA 1LOEA 1S1AA 1NCRA 1GLHA 1QJY1 3E5QA 4W65A 2HWB1 3ZN6B 4E2GA 1SEFA 1AR63 4YM1A 3AKPA 1KDKA 1QDOA 5GLVA 3IWZA 2A75A 3ZFGA 1ZBA2 4E27A 3ZXAC 1J3PA 5BNNB 4Q4Y2 3TBDA 1LRHA 1NCQC 1PHMA 1QH7A 2D5HA 2OZJA 2K2SA 1LGBA 5KC5A 1HXS2 1REEA 3FFZA 5KXDA 4H7LA 3JBG2 2Y0OA 2CWSA 4A7YA 4OI4A 3CO2A 4P9GA 4KNCA 5J09A 4F83A 3QCWA 2CGNA 3FHIB 1O3TA 5F9TA 1D0HA 2I45A 5GLZA 1ND2C 2RJLA 3PMSA 1AXKA 4RFT0 4YVWA 2AZ5A 1QQP1 1SLBA 3AP5A 4HETA 2G9GA 2ZGLA 4DMIA 1NLRA 3P3NA 3JD71 4EN6B 1ND3C 1RHI2 1A3KA 4RA0A 1FNZA 4PLOA 4K3UA 3SH4A 1UPSA 4MX3A 1MQTA 2EALA 4M0NA 4COVA 5KC6A 4JTOA 4I01A 4CDWB 3KD4A 4WM8C 2CV6A 1H2MA 4HVRA 5CIRA 2RS12 2E53A 4X6QB 4YFWA 4AW7A 1F2NA 4COWA 5JWPA 2BBVA 2YHJA 3VBFC 3D6EA 4ISQA 3UV9A 5JZGA 1A78A 1QJY2 1J58A 2HWB2 3MPBA 5FCCA 1GYKA 4FQ4A 3JCIA 4JGYC 2MEV3 1CAWB 4XQDA 4YZ4A 1POV0 2BQPA 4CDXA 1MVEA 4ONUA 2GNTA 4RHV1 2AREA 2VY0A 2X5IB 4OHWA 2R063 3VBUB 1UAIA 4B29A 1YFUA 1OA2A 1EV13 2RMU1 3BU7A 3M3OA 4WVVA 3R4UA 4N7UA 5AC93 2D3SA 1MEC1 4LA3A 3POWA 1IOAA 2WNVA 2P17A 1AR73 1HRV3 2IXHA 3WDVA 2WT2A 3FBMA 2B46X 2D6NA 4R9CA 4XETA 1O5LA 4YRDA 3I59A 2NP0A 2EXJA 2PN5A 2WQZC 2HWC1 3JB4C 1QQP2 1Z0HA 3NVCA 3HMYA 1ZNPA 2Q30A 3DV8A 3U4XA 2WS93 3JD72 1OQEA 4G9SB 3WD5A 2VMIA 1I6XA 3E97A 3FWEA 1NCQB 3HT2A 3A0NA 5FMOS 2BYVE 4QQ2A 4BH9A 4QD2A 3SXWA 1Q3EA 4XMAA 2WNEA 4YM3A 5FAXA 2DCTA 3ALQA 1Q5OA 3URFA 1GZWA 5FLJA 1LOFA 2RJKA 2XL9A 1RUD3 3RYKA 2UYBA 5CU1A 3AMNA 1FV3A 3DPRA 1W6OA 2DURA 2ZZJA 5K0UC 4FP2A 2ZKNA 5ACA1 1H4HA 2ZTNA 2JKBA 5L73A 1ND2B 1AR61 1DF0A 1W6MB 3VZLA 3SISA 3O12A 5TSWA 1BQPA 2K0GA 3E5UA 3M1HA 4GWMA 4RHV2 5EJ3A 4D7SA 5CAZA 1ND3B 5BNOB 2DCKA 1AL0G 1HW5A 3QLQA 4K40A 1OQ1A 2OUJA 4Y1UA 4MGZE 4C1WA 4NWWA 1BVVA 2RMU2 1XYPA 4XIOA 3O0XA 1MZ6A 3MLKA 4QPIA 2H6BA 3PVOA 1MEC2 1W6PA 4PBPA 2RS51 2VUJA 1S0BA 4FPLA 1ZRCA 2VVDA 4QM9A 3ST7A 1CAVB 2C9AA 3VBFB 1DQ4A 3BCWA 4D7YA 2XJPA 2B39A 2QUOA 5FO9B 4LBMA 4JGYB 3LA3A 2R073 2X8KA 2HWC2 2OZ6A 4PDWB 3WG2A 4FBFA 3ROUA 1OI6A 3AZZA 2DVBA 3CJIA 3VKMA 3WW2A 1TNRA 1XE8A 1DYPA 4YM2A 3WUCA 1NXMA 2UWCA 2Y38A 3AYCA 4FAHA 1OOPC 1AYM3 5FOJB 1DQ6A 4DRRA 1WLWA 2IWGB 3KT1A 4J6GA 4YG6A 5BXXA 3UKNA 1GZ9A 4I09A 3ZPYA 3C3VA 4N53A 1DGLA 1LHNA 3OF1A 5FBZA 3SH5A 5ACA2 2GAUA 3D4KA 3VBHA 4BMEA 3PJQA 1X82A 3L9JT 4UW6A 5DZGA 1G9BA 1AR62 2MEV1 5A32A 2BGCA 1K5MC 2DVGA 4COYA 4ZKTB 5DUWA 1RMU3 4LBQB 3NAPA 2GN7A 2DUPA 4CP0A 2YV8A 2R061 4LULA 3ZSMA 2A3WA 3EJKA 1EV11 1YFWA 3LA7A 3LKJA 3HN1A 1CGPA 1DIWA 4S2GA 1ZRDA 4Y22B 3DUIA 5AC91 1GKBA 2O1QA 2R043 2A6WA 3TOJA 1LODA 2RS52 2HWD3 5JZGC 1AR71 3BOPA 1HRV1 3VZNA 4GMP0 5K0UB 5LK7B 3B3QE 3WDWA 1VBA3 3CLPA 3FUOA 2VGDA 1GR3A 1PZ9A 4AEKA 1WA4A 3MI8A 4R4ZA 2OUHA 3KS7A 3T2TA 2YROA 5HCAA 2DYCA 4EN8B 1AJKA 2DVDA 1CAXB 2BFUS 1RB8G 5JAXA 3NKGA 1GNZA 3FLTA 5CFCA 4LO4B 2VOKA 2C1FA 2JG8A 2DU1A 3KGLA 1UW8A 3SCGA 4AK3A 1WGPA 1QXJA 3AP9A 2FQPA 4S2DA 4KU8A 2ZGPA 3THTA 1VB2A 2JDZA 1XNBA 2OA2A 1V9U1 3MFCA 5JVVA 3ZFGB 1TE1B 5LEKA 4L11A 1DHKB 2E7QA 1FXZA 1RITA 4XBLA 3WXPA 2BNMA 1QOTA 1GQHA 4A7KA 4QQPA 2MEV2 1N47A 5JI9A 2OIIA 4IQPA 3RYRA 4WVZA 4IEQA 3ZXFA 2R062 3VUOA 4HMZA 1EV12 2LALA 3L2YA 3WT3A 5LK5A 5AC92 1F5JA 4FPJA 5C8CC 3OY8A 3WZ1A 3U07A 1H8TA 2K9ZA 1AR72 1HRV2 1WD4A 3MIGA 1W0PA 4BYYA 2BPA2 4C90A 4Y5Z0 1BVP1 4XHXA 1HLCA 3PMEA 3J9SA 3TNPB 3VBSC 1YI9A 1NG0A 2PFWA 4L2NA 4S2HA 4BCUA 1NXD1 4RD7A 1VAVA 3N7KA 2R071 1YIPA 2GN3A 4A7ZA 1K5MB 3PVNA 1FT9A 2CL2A 1S0IA 4PBOA 2IFRA 1WCKA 1CN1A 3LB9A 3KCXA 2NM1A 2VOWA 3T1MA 3VBRC 1E57A 1OFNA 3I7DA 1SLCA 1UL9A 1MS9A 1V6LA 4QX5A 1AYM1 4HBNA 2D6LX 1S0JA 2YXSA 5JZGB 4RR3A 2DUOA 3ZXEA 3GNEA 1OSGA 4AFAA 3APBA 1UIKA 2ZHLA 5T52A 1V9U2 1VP6A 2IFWA 3AX4A 1ZBA3 1YLLA 2ZZQA 2WZPP 1KS5A 1IHMA 4Q4Y3 3MIBA 2XL7A 2QCSB 3POSA 4NR1A 5FMOL 1KFXL 1QXPA 1RMU1 4XJAA 4IV1A 3WQ0A 5BPXA 2EVXA 5C9AA 2R16A 1G9FA 2WNVB 4V1PA 2IXJA 5J7MA 4XQWA 2XKOA 1POV1 2R0HA 3VLBB 1JN2P 3IPVA 5JPMB 5KXBA 5J36A 2HWD1 1VLNA 1C1LA 3P3PA 2ET7A 5A3MA 4BQ1A 1B35A 2Y0IA 5BNPC 3DL3A 1CX4A 3USSA 3WOGA 3N35A 4QT6A 4IEOA 1H0BA 3N36A 1JUIA 4Y20A 1VBA1 2ETEA 2YC0A 2EAKA 4K9SA 1H1MA 5JSPA 2R072 3HR9A 1RHI3 3E6DA 4PLMA 4WVWA 3AYAA 4KGQA 4FXKB 1RUJ1 1PNGA 4LO8A 3IDBB 2Q1MA 5FFOC 2ZKLA 1J3QA 2Y26A 2HWE3 1W6OB 5C8CB 3KMHA 1AYM2 5J98B 2QFEA 2Z69A 4BPZA 1YIFA 2WZR3 4EWAA 5JOWA 1EAH3 1VIWB 4PCRA 4NWVA 4DINB 2RE9A 2E7TA 2MHFA 2PYTA 2HWB3 1D4VB 4M3CF 2X53S 1VBB3 3ZYGA 3INAA 1C4RA 1H9WA 5CG8A 5CG9A 2XGXA 4P9LA 5I0RA 2H0VA 3GZAA 3WQ1A 1FAYA 3H7YA 2D6PA 4LR4A 1MS8A 4XEZA 1RMU2 4YGCA 3QACA 2ZX3A 4AEDA 3VBOC 2JG8C 4XJ9A 1Q8OA 2ZOEB 3VBRB 5C4WA 4CEYC 2HEYF 3AMQA 4KGGA 1C5IA 3JB8A 5L7OA 4OI2A 3RMYA 2IXKA 3VZOA 1XYNA 3W58A 1QXRA 4CDUA 4M01A 2CGOA 2HWD2 4AI2A 1BYHA 3ACLA 1KRIA 1QJX3 2A70A 2WA4A 3O5SA 3M3IA 1AR91 1UKRA 2JX9A 1QQP3 4GWNA 2DTYA 1BJQA