3ZVXA

Structure of the lectin from platypodium elegans in complex with a trimannoside
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
242
structure length
242
Chain Sequence
STDSLSFSFINFDRDERNLIFQGDAHTSRNNILQLTRTDSNGAPVRSTVGRILHSAQVRLWEKSTNRVANLQTQFSFFLSSPLSNPADGIAFFIAPPDTTIPSGSAGGLLGLFNPRTALNESANQVLAVEFDTFFAQNSNTWDPNYQHIGIDVNSIRSSKVVRWERREGKTLNVLVTYNPSTRTIDVVATYPDGQRYQLSHVVDLTTILPEWVRVGFSAASGEQFQTHNLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title A Lectin from Platypodium Elegans with Unusual Specificity and Affinity for Asymmetric Complex N-Glycans.
pubmed doi rcsb
source organism Platypodium elegans
molecule tags Sugar binding protein
total genus 58
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zvxA00
4XILA 1KRIA 2ZMKA 4XBQA 2ZGRA 2A6XA 5HCAA 4AYUA 5KXCA 1W6OB 1WLCA 5GZFA 3USUA 4BPZA 1YI7A 4LBQA 4XMAA 4SLIA 2GNDA 2WJSA 3PVNA 4YW5A 2W39A 3ATGA 4U2AA 4GKXA 5DUWA 2OUJA 1N3QA 4XTPA 5HCFA 1MZ6A 5E88A 5FRAA 3NWKA 4XTMA 4BLIA 1MS5A 1QNYA 1LJ7A 2WKKA 1LEDA 4Y1XA 4I30A 5GZCA 3RQ0A 3ZXKA 4XE9A 1DQ4A 5IK7A 1GZCA 2WT0A 5H9SA 2D3SA 3AYAA 1W6NA 2UU8A 4XXPA 2GMMA 4FP3A 2E6VA 5T54A 1R1ZA 4YM1A 3V64A 3FLPA 1DZQA 2WT2A 4YG6A 1WW5A 4MYEA 3WCSA 1GLHA 5DUXA 2ZGSA 4BQ1A 2FHRA 1CONA 3LSDA 3B3QE 2GNBA 1OKQA 4FP2A 2YV8A 3GALA 5JVVA 5GLUA 4CTEA 1Q56A 2SLIA 3ZSLA 1LOAA 4M3CA 2DVFA 4YFZA 2PHRA 1ENSA 3WLUA 1N47A 4HL0A 1KITA 1IS4A 2YZ4A 1N3OA 3Q9OA 1JYCA 3M2MA 4Q8LA 3RMXA 1LOEA 4WVWA 1Y7BA 2PHTA 5IK4A 2D43A 1LOCA 3CNAA 4FVVA 4GXLA 3VKLA 3TB0A 2PHXA 3WVJA 1AVBA 4YM2A 4TYSA 3GNEA 2D3RA 1KDKA 2NMNA 2WT1A 3DGTA 5JOYA 2R1DA 4XJUA 1SBEA 4XOGA 1G7YA 2JDZA 1UL9A 2W68A 4BMEA 1FATA 4YG0A 5DXDA 1DQ5A 1W6MA 2A75A 4U36A 3A0KA 2EALA 4YW4A 3QCWA 4WVVA 3V0AB 1LU2A 2ARBA 3AX4A 2ZGTA 2VY0A 1QGLA 3O0WA 1JBCA 4AGRA 1DQ6A 1SLAA 1JN2P 3ZVXA 1MVQA 3OBRA 2ZMLA 1BZWA 1N3PA 4R9CA 3IPVA 4Q26A 1V6JA 3N7JA 4FOQA 3AXEA 3V0BB 1MS9A 5GLTA 4BMBA 1DGLA 1VAMA 2NN8A 2YROA 3AYDA 3POYA 1LULA 1S0IA 3HMYA 4ITCA 2ZAAA 1V00A 1X50A 1ZM1A 4LBOA 3USUB 5T50A 4LBQB 2D3PA 4YGBA 1AJKA 3IN9A 1ZA4A 4CZSA 3FUQA 1FNYA 3AJYA 3T1MA 2GMEA 4Y1YA 4ISRA 2EXIA 3C2UA 4P14A 1D2SA 2VUAA 3ZXJA 4GWMA 1S0BA 4W65A 1MS1A 2OVUA 1MR5A 2RHPA 1JUIA 1W0OA 3OPZA 3N7LA 4XYXA 2P3IA 3WNXA 1DIWA 1RIRA 3INAA 5L73A 1W6NB 2G4IA 3AZZA 3FUOA 4BLJA 3AP5A 4P9WA 1JW6A 4LBMA 3ZXLA 2WNEA 2HYKA 1LOFC 3UK9A 4XIOA 1LENA 3FLRA 1DFQA 5JOZA 3H0OA 5GALA 1FNZA 1GNHA 3R4UA 4GWNA 2D7FA 5T52A 3U4XA 5GZEA 1LGNA 4HANA 3WG2A 1AX1A 4M3CB 3AYCA 3OBTA 4M00A 4PBOA 2CY6A 4XJ8A 3VV1A 3ZXEA 4AVVA 4C1XA 5JMCA 3WDVA 2A3WA 2WQZC 3M3QA 5HCBA 2EF6A 1UPSA 1CESA 1MVEA 1SLIA 4PBPA 1TEIA 3V0AA 1UZZA 1EPWA 1RINA 2AGSA 4FPOB 1IKPA 1UAIA 1V6NA 3ENRA 1SFYA 1LHVA 3VKNA 2YY1A 1WW6A 3AZWA 1AXYA 2ZHKA 3A0NA 3SITA 3VUOA 3VKOA 1Z0HA 2VU9A 4Y26A 3OY8A 5GLZA 1BJQA 2D6KA 3MPPG 3W59A 3O0XA 5H9PA 4XXAA 2LALA 1DYPA 3ZYRA 1G8WA 2A7AA 5SV8A 4GALA 4LBQD 3WOGA 1NXD1 5DUVA 1W6MB 1S0CA 1W6QA 3ZSKA 3WHTA 2ZMNA 3V65A 1DLLA 1QU0A 2YMZA 1AXZA 1DQ2A 3AZYA 4M3CF 2GMPA 1GV9A 3ZSJA 4RA0A 5JLVA 1C4RA 1CR7A 1ULGA 1APNA 2LTNA 3N7KA 4FQZA 4XJWA 1B09A 4AVTA 4UW5A 1O4YA 3IPVB 1HDKA 2EAKA 3FLTA 4LBJA 4ASMB 3WHUA 4LBKA 2D6NA 1V6IA 1NLSA 3WDYA 3ZYPA 3B9CA 5CA6A 3WG3A 1F5FA 3SH5A 3SH4A 1MS3A 5F5QA 1FYUA 2P3KA 4YW3A 1FAYA 2VXRA 4GKYA 1UN1A 1S0FA 4YM3A 3N3HA 1JOJA 1LHOA 4R9BA 4FPEA 2I2SA 3AP6A 1CPNA 3HR9A 2JE9A 2ENRA 1AXKA 4FPYA 5FREA 4Y1ZA 2R1BA 4YZ4A 3PJQA 2NM1A 1JYIA 1WLDA 4WV8A 2PHFA 2OUHA 2TEPA 2ZGLA 4ZXKA 4FQ4A 2R0HA 3RG0A 3SH3A 1CJPA 2OW4A 5GJ6A 5AVAA 2AH2A 1C57A 4UW3A 1GICA 5DUUA 5DG2A 1ONAA 3BODA 1V6MA 2P34A 1AX0A 1IS3A 1JXNA 2VW1A 2CL2A 2BQPA 2ZHMA 3IKWA 1UKGA 3AZXA 3UJQA 2GN3A 3WDTA 1LCLA 3NV1A 2UURA 1QDOA 2ZHNA 2ZGMA 3AP9A 3APBA 1G9BA 3B00A 2DU0A 3D5OA 1LHNA 3FFZA 2DUOA 1LODA 3NV2A 4FOVA 1Q8PA 2KM2A 3WG1A 4YM0A 3OY8B 1S1AA 4DPNA 4XJZA 4DFSA 1GZWA 5BYNA 1A3KA 3NV4A 2D6MA 5E89A 4FPCA 1F9KA 5GZDA 1G86A 4UW4A 2NMOA 1FV2A 1V6LA 2E7TA 2P37A 3BOPA 3MW3A 2DURA 1SACA 1W6QB 2DVAA 4K20A 4BM8A 3AJZA 1S0JA 1DYKA 2D6OX 2PHUA 4Q8KA 4Q27A 5KXBA 2P3JA 4NOTA 2YXSA 1FV3A 1VLNA 4F83A 1IOAA 1YXWA 3ASIA 5KXEA 4BOWA 4Y1VA 2AR6A 1G9CA 2CWSA 3I4IA 3OYWA 2ZABA 3MW4A 3POWA 1H9WA 3JUUA 1WCSA 2P2KA 4ISQA 1DBNA 5IT6A 1LGBA 1LEMA 5DZGA 4Y20A 4Y1UA 5LK5A 3UJOA 2R0FA 4XIKA 2JECA 5GZGA 3D6EA 3AZVA 1MS0A 4XBLA 2JJ6A 1S0EA 1QKQA 1UZYA 1J1TA 2JE7A 3KQRA 2JD4A 4L8QA 3AP4A 3VKFC 4R9DA 1U0AA 5JOXA 1Q8VA 2AYHA 3M3CA 3RRDA 4FOYA 3OJBA 4YG3A 4H55A 1KJLA 5IUQA 1GANA 5CBLA 1OFSA 1F31A 5T5OA 1ENRA 4AGVA 2DVBA 2A6ZA 2ERFA 1WUVA 1PZ9A 5CB7A 2A6YA 3ILRA 4LBLA 2CWMA 3LSEA 1LOBA 2EXHA 2E7QA 3ZPYA 3AXDA 3QLQA 1DQ0A 1N1TA 1SCSA 4XZPA 3WG4A 3UL2A 1VAVA 2DTWA 2A70A 4DS0A 1AX2A 2ZGUA 3B69A 4XJAA 1WD4A 1QOOA 4R9AA 2CYFA 1IKQA 5EYYA 1AZDA 2ZGOA 3B01A 4FPGA 1SLBA 1VIWB 1FX5A 1A78A 4Q2FA 1CPMA 5DG1A 2ZZJA 1GKBA 4C1WA 3TAYA 1BXHA 3RS6A 3IMNA 1LECA 1PZ7A 1V6KA 1CQ9A 4RL7A 4TZDA 3N35A 2NYYA 5JOWA 5DZFA 2XG3A 1ULFA 1QF3A 1G9AA 1N1SA 1GZWB 3POSA 4K1YA 4Y22A 3WDUA 4GA9A 2A3YA 2VH9A 1LGCA 4YZ2A 1GZ9A 1IS6A 1KQRA 1SCRA 2JKBA 1C1FA 2ZGPA 2W08A 3M1HA 2AUYA 3JU9A 3N7MA 2PELA 4YZ1A 2ZHLA 1LHWA 2D6LX 4ATEA 2R16A 1MZ5A 3AYEA 1C1LA 4CRQA 2W52A 3ILFA 4AGGA 2R49A 1UMZA 1JHNA 1G9FA 2UWCA 5JDBA 4P9YA 3AK0A 2Q5TA 1W6PA 5EXOA 2GALA 3DUIA 2GNTA 1QDCA 3OYWB 2Z42A 2A5ZA 2E53A 3PVEA 1UX6A 3O0VA 1GNZA 4K1ZA 1LU1A 3ZXFA 5F9TA 1WW7A 4Y20B 4XHBA 1KDMA 5CAZA 1Q8OA 2DU1A 5E8AA 3T1LA 1D0HA 1ULCA 1DQ1A 3R4SA 3A4UA 2H0BA 1W0PA 3I8TA 4M01A 1Q8SA 5DZEA 2FMDA 2GN7A 2NP0A 1GSLA 2ZGKA 4FOWA 5KXDA 4ATFA 3L2YA 1SBFA 2DTYA 1CVNA 3SISA 4ZKTB 1LHUA 2ZACA 1YO8A 3OGGA 4JCKA 4XHXA 4AWDA 3WUDA 3PVOA 3WUCA 1N1YA 2DV9A 4YZ3A 3SNMA 1H30A 3O12A 1XQNA 2DUQA 3WDWA 2EXJA 3M3OA 3BTAA 1V6OA 3T2TA 2UWBA 2NZ9A 3N36A 1IS5A 1YYNA 2A71A 1SLTA 2AENA 4PCRA 4PF5A 3R05A 4YFWA 3AFKA 1YRZA 4DQAA 1HKDA 1LTEA 1AJOA 2GNMA 3AP7A 4FPFA 1RITA 1MS4A 1I1EA 2V5YA 1KJRA 1AF9A 1A8DA 2V73A 4IQPA 1W6OA 2ES3A 2D6PA 3M3EA 3PMEA 1HLCA 1YIFA 4P9XA 5EWSA 1HQLA 1SLCA 1URXA 2DUPA 2EIGA 2C5DA 3MW2A 1I3HA 5CNAA 5EYXA 1S0GA 2E51A 4YW1A 4DRVA 5H9QA 1N1VA 1VALA 1MS8A 2A3XA 3RSJA 1H9PA 1HQWA 4D69A 1GYKA 1SLLA 3VKMA 1BQPA 5IK5A 2A6WA 2UWAA 2ZKNA 4M3CE 1BKZA 4Y22B 3BIWE 3KM5A 2DYCA 2AREA 2WLQA 2D44A 4LBNA 4YGCA 4FPHA 3WCRA 1SBDA 1WW4A 1QNWA 2C9AA 5IK8A 4Z8BA 4XBNA 4WZFA 3WDXA 4K21A 1MACA 5T55A 3SLIA 1WD3A 1LOGA 2DVGA 4UW6A 3WV6A 1LESA 3FBYA 4FPJA 1CN1A 4DRRA 3O5SA 3ILNA 4YZ5A 2ZBJA 3LCPA 2B7YA 4PQ9A 1W6PB 2XB6C 4KBBA 3NV3A 5H9RA 1ULDA 4YLZA 2VW0A 2WSUA 2A6VA 2PHWA 2ZGNA 1Q8QA 3WZ1A 1BYHA 2SBAA 3RMYA 1WLWA 2VW2A 5T5PA 5GLVA 1OQ1A 2ZGQA 4Q1RA 4FPLA 1S0DA 2DWRA 4YGEA 4XDQA 2EXKA 4JC1A 1WBFA 1Z78A 1WBLA 4YGDA 2ZA9A 3ZSMA 2CTVA 4NO4A 5GLWA 1PZ8A 4YW2A 1DHKB 2WSVA 5GM0A 4Y24A 5T5LA 4Q1PA 1CIWA 4OZXA 4JRAA 2DVDA 1ULEA 3W58A 3IM0A 2CNAA 3D4KA 4FPKA 4AVSA 3MEPA 1QMJA 1O4ZA 2ARXA 5T5JA 1G9DA 1LOFA 4XMIA 2GDFA 3HN1A 1ENQA 4XJ9A 1QOTA 1QOSA 1GBGA 3V0BA
chains in the Genus database with same CATH superfamily
2PLV1 3L9JT 3ZKUA 2ZMKA 3EBRA 1GWKA 1REFA 4BJ0A 1QJU2 3SHRA 4D7SA 3VBOB 1VBE2 1W6OB 2VMHA 3USUA 1OC1A 1YI9A 4INDA 1YI7A 4HT1T 4WM8C 2QVSB 1RUC2 3IWZA 4XMAA 2GNDA 4CEWB 4YW5A 3U78A 1VBD3 5A6XA 1CAXA 5LWBA 3G7DA 3ATGA 4U2AA 3GZUC 3THCA 4E8CA 1VMJA 2YBSA 4OHYA 2CAVA 2BOJA 1N3QA 1QJY2 3WQBA 5J1XA 2VBBA 4XFHA 1R1A3 3SXWA 1D4M1 2K2SA 1XYOA 4Q0SA 5E6HA 4BLIA 2Y6JA 1LJ7A 2WKKA 2VMIA 3AKSA 1U5IA 1OXCA 4IESA 3RQ0A 5BNOA 4XE9A 1OA3A 4PLNA 1DQ4A 3U10A 1EAH3 2WT0A 5H9SA 4XXPA 2UU8A 3LD8A 1D2QA 4CUBA 2ZAHA 1NOVA 2WT2A 4Q29A 4L2NA 3WCSA 5IVCA 2E26A 1OUXA 3AKTA 4RR3A 2C9KA 2FDHA 4JDMA 5I0UA 3LSDA 5ISLA 4NPLA 3B3QE 1BLZA 4QXHA 3TN91 2YV8A 1HB1A 2BVVA 3TEXA 4XAEA 5FPLA 3HT1A 3K51A 1LOAA 2VOTA 4M3CA 5FZ7A 1J58A 1ULPA 5CU1A 5HXVA 1U5XA 1ENSA 4YFZA 5IATA 4HPKA 1T6GC 4OHVA 1VB4A 3IDEA 4RN5A 4FBFA 1N47A 4F7ZA 5F3GA 1IS4A 3KWVA 2YZ4A 3ES1A 3MYXA 3U75A 4CCMA 3MPBA 2HJIA 4Q8LA 4CPBA 1CZVA 1RJ8A 2VQUA 4WVWA 1NCRA 5HI0A 4B1MA 2D43A 4MHRA 1LOCA 3VBRC 2B42B 3H8UA 3MF9A 4GXLA 4P9GA 2OKXA 3MIGA 1AL22 2KA3A 4AL9A 1AVBA 4X8PA 3BKZA 1GWMA 5JZGC 5IHRA 2NMNA 4HK8A 4CCOA 1QH6A 5JXJA 3MIBA 2WT1A 1E5SA 4A7KA 1ND2B 1SBEA 3ORJA 2J1RA 5I8SA 1AYM1 2Q1MA 3E6BA 3PUSA 4UI9L 3WF1A 2N7GA 4YG0A 4GB33 5K0UA 2R061 2HWB2 4WVVA 2JXAA 2ARBA 4AGRA 3O0WA 2BBAA 1DQ6A 4IV3C 1GP5A 4P02B 3VN4A 1PX3A 1FOD2 2ZMLA 2XQXA 5FPVA 1ZZCA 2Z69A 2RJ2A 1V6JA 5A7NA 2VM9A 3NRUA 4BMBA 4ET7A 2NN8A 2YROA 5A33B 3M4FA 3FHAA 4Q4Y3 4QPIB 3NAPA 3R6SA 2LS6A 1V00A 1X50A 1ZM1A 1XNTA 3ACLA 3AKQA 1BBT3 4B29A 1ZA4A 4CZSA 3FUQA 1FNYA 3K75B 1RUD1 2GMEA 4IETA 4XAAA 1XYPA 4FO9A 1D2SA 5A3UA 4DY5A 3ZXJA 3WW3A 4W65A 1MS1A 2BWAA 2OVUA 1MR5A 2RHPA 3ELNA 4JV4A 4NN0A 4PDWB 4XCBA 2QE3A 4AEKA 4L99A 4BA6A 1LAJA 1ZRCA 3HN3A 3OPZA 4UF0B 4XYXA 2IC1A 5FY0A 1ZREA 2PLV3 1ENXA 3OF1A 2Z4FA 1RIRA 4JGYC 3ZN4A 3FUOA 5F37A 1JW6A 3ZFFB 1LRHA 1ZBA3 2YFZA 5IVEA 3UK9A 2K9ZA 1LOFC 1BMV2 5JXIA 1LENA 4UBHA 1AYN2 4QWNA 5DABA 5JOZA 2ARCA 3BTYA 1BCXA 3R4UA 2Q0AA 2Q30A 4RGAA 3FBMA 1TZOA 4BISA 2HWE3 1VBD2 1NY71 2W91A 4HANA 3WG2A 1D4M3 5JMOA 3VDBA 3AYCA 1WWYA 3OBTA 4M00A 3VV1A 4AVVA 5JMCA 4IV1C 1QJX1 4S2HA 1R1A2 4K8FA 5BUVA 4BWOA 1UPSA 5CFCB 1CESA 1CX4A 1SLIA 4PBPA 4NIIA 3V0AA 5FAXA 1RINA 1ZVFA 3WINE 2MNGA 1DZRA 5ERLA 1NCQC 3AMMA 3VKNA 2YY1A 4LKEA 3T4VA 1EV13 3A0NA 3VBSB 4XF9A 5LA0A 3VZMA 1HJFA 3UYJA 2Y6KA 4NAOA 3ZFGB 2GZWA 1ZZ9A 1JZ7A 1VP6A 5ANNA 3W59A 1PGL1 4JTOA 4PF1A 3ZYRA 2WNVC 1Y3TA 3I2DA 4GALA 1OD5A 2RS12 1V0AA 4LE3A 3T0BA 4CCLA 1NZCA 1WA4A 1RMU1 2PAKA 4C0BA 4CP9B 2EVXA 4RR3C 4J1XA 3WHTA 2RS33 2YMZA 1AXZA 2QDRA 1D0GA 4M3CF 5LATA 3WNPA 4KWUA 2EA7A 3NNGA 2VMGA 1HRV1 2LTNA 3FFQA 4LHKA 1XE0A 4CU6A 1B09A 1ND3B 1ZYBA 3I3EA 4GWIA 3MI8A 1HDKA 1CD3G 4UW5A 4AVTA 2AC1A 3VBHC 1VRH1 3FLTA 5FMBA 3LAGA 3H50A 4OUSA 4LBKA 4XFBA 2VMCA 4LTAA 5BXXA 1US2A 4LHSA 4CUGA 3DCQA 3T0AA 1ASJ2 1O59A 2J42A 1QQP2 1EUUA 1O3QA 3CLPA 4QAWA 2R063 2ZEXA 1OSGA 1UN1A 4YM3A 3WX5A 3GCXA 5FUPA 4L9BA 2I2SA 1XSRA 5LW9A 3MIFA 3A7QA 3JD71 2JE9A 3NKGA 1AXKA 4I0AA 1H1MA 2JD9A 5A6ZA 1NUKA 4XUPA 4CPBD 2QQUA 5FZ0A 1W8UA 4JX0A 4Q4V1 3MF6A 2ZGLA 4XW3A 4LHLA 2JEMA 5FMCA 1RB8G 4NUBA 2ETEA 1DF0A 3CJIB 4UFHA 5FJHA 1W90A 4GH4C 3VGIA 1V6MA 2P34A 4UAPA 2D93A 5FY5A 3VBFB 4AEDB 3RFRA 1W9SA 1H2NA 4COUA 3JB4C 1OQEA 4P08A 1GFF2 4IE0A 2ADEA 1AR63 1Z7S1 2XLAA 1SZBA 5EJ1B 3EHKA 2DFBA 2W1WA 1PGSA 3WDTA 1LCLA 3T08A 2ZHNA 2VQTA 2ZGMA 5FUIA 2RDSA 2RE9A 3M8LA 1LHNA 4FOVA 4CDUA 5J3UA 5I0DA 1S1AA 1ZBA2 3BPSA 2XJSA 4LIVA 2BJSA 2EIEA 2VR4A 4FPCA 4LKSA 1F9KA 3DV8A 4JGZA 5C3SA 5FZ9A 4UW4A 1QJX3 1VBB1 1FV2A 2NMOA 4JHTA 5D2AA 1W6QB 1UZVA 3LWCA 4BM8A 1DYKA 2XL9A 1J3PA 1OH3A 4AVCA 2JDAA 4NOTA 2YXSA 3WW4A 4NHLA 1HX6A 4F83A 5JSPA 3ASIA 4HMZA 1OLQA 2PN5A 5FP3A 2AR6A 3CJXA 5EJZB 3UETA 3ZMNA 5HV4A 3I4IA 3OYWA 4CEYA 1VR3A 1H9WA 3JUUA 4Q4W3 4RGGA 3CL1A 1EV12 2ZZQA 5DZGA 4K7JA 4TLGA 5LK5A 1SFNA 5C9AB 5JPMB 4B3NA 2JECA 3GGLA 3NJYA 3VBUA 4CCJA 5GZGA 3HNBM 4Q4X3 4RS5A 2XPJA 3AZVA 1MS0A 4XBLA 3AKRA 1W8HA 5D8AA 1QKQA 3KQRA 2JD4A 4MGTA 2VBPA 4IE4A 2DF7A 3BUCA 2HWD3 4YG3A 5IYYA 5IUQA 5DN2A 2RS32 1GANA 5CBLA 1OFSA 1F31A 3NJVA 5T5OA 3WNNA 1VBA2 2DVBA 4AGVA 4AFBA 5LA2A 2OQ6A 2VTXA 1JODA 5CB7A 1UMIA 1PM4A 2D97A 2YC4A 3GCWA 2E7QA 1AHSA 4WM8B 1SCSA 2YHJA 4XZPA 3UL2A 2DTWA 2XR4A 2QKDA 4DS0A 2JE8A 3KZ4C 4S2DA 5ACA1 5HXMA 2CYFA 2ZGOA 3B01A 4FPGA 3MHZA 1SLBA 1V9U3 3HVDA 1XNCA 2X53S 4MADA 5CG9A 5ABJC 3PDQA 4IEPA 3HD8B 2EICA 4HONA 1CAWA 5DG1A 2VZPA 3BCWA 1T2XA 3W20A 1BXHA 3IMNA 4CVUA 2WBKA 1TG7A 4MV2A 1XYNA 5LBEA 5DZFA 3ZR6A 4CDQA 1RVF2 1ULFA 4CU7A 5EFUA 1N1SA 3E6DA 1UYYA 2C26A 1AR93 5L7OA 2A3YA 4LUKA 1JYVA 4HVRA 1SCRA 2JKBA 3POJA 1C1FA 1OOPA 4KH9A 3U4SA 3I97A 2PELA 4YVSA 5FZIA 1IPKA 2ZHLA 4YZ1A 4EZHA 4NHMA 4CCDA 1MZ5A 3AYEA 3JBG1 5SV5A 1H6YA 1RUE1 3ILFA 4AGGA 1UPIA 4CUCA 3N9LA 1NE4A 1RHI3 2XHKA 2GC1A 2UWCA 2Q5TA 5IAVA 5JSRA 2GNTA 2XQRA 3N9PA 4LMFA 5A7WB 2Z42A 3ZIXA 2RMU1 2L9LA 3O0VA 5F9TA 4AK3A 2X09A 2VQAA 5A6QA 2WDBA 5B4NA 3T1LA 4TWTA 2B9UA 1ULCA 1PGW1 3ACFA 3R4SA 4CDUC 4D7TA 5CYYA 1RTVA 3O1OA 4QGLA 1GSLA 5IVBA 2HWF3 1W9YA 2DTYA 1K3IA 3GYDA 4QKFA 5JIUA 2WYFA 4Q0UA 1BVVA 1W28A 4JGZC 4QM9A 4A2UA 3WUDA 4K3UA 1FPN3 4ONUA 3PVOA 5AFBA 3WUCA 1OURA 1X9PA 2B9VA 3GZTB 3SCHA 1QJFA 3ZPOA 5J37A 1H30A 1RL3A 4Q4W2 2ZJCA 3M3OA 3HQXA 3K4AA 3OGJA 1O6UA 1F5JA 1JI6A 3PVBB 5FY9A 4ZS3A 2ZX1A 1IS5A 4YVWC 3BALA 4N53C 1M06G 4NHKA 2AENA 2VOVA 1W39A 3KV9A 4D6SA 4YFWA 1YRZA 1FMD1 2JB8A 5IWFA 2VJXA 2VC9A 1AJOA 1RITA 1F15A 2OA2A 4IEYA 4E4DX 2CV6A 5FZOA 2BGCA 2HWD2 3M3EA 3PMEA 2VOXA 3Q8CA 4IEWA 1JYWA 2DUPA 1PO12 3J8F3 1R083 1I3HA 3MW2A 1S0GA 1YFXA 4JGYB 3HNYM 1H6XA 5K9YA 1R091 1VALA 5FZAA 3RSJA 5KWRA 1HQWA 4N90A 3MO4A 3VKMA 1BQPA 2VAUA 4IEQA 2A6WA 3I59B 2UWAA 4A6SA 4B4PA 2BGPA 4XQ4A 5L9VA 2ZEWA 4Y22B 4EN7B 5HV0A 1POQA 2DYCA 2WFF3 3I3QA 4LE4A 4P9IA 5B2GB 2D44A 3EQEA 5LRRA 4JAAA 4Y5Z0 2WNOA 3WCRA 1QNWA 2EIBA 1K5MA 2XDVA 4IV1B 4MXWA 2KD7A 2Q8OA 4WZFA 1MACA 3W5NA 1WD3A 3T2PA 5BNPA 4K8RB 3WV6A 4QHZA 1CWPA 4A42A 2ZXQA 5A32B 4N7IA 1TME1 4QKDA 5T3NA 1NCQB 1VBE1 2W1QA 2FDFA 1HXS3 3LEIA 4OHXA 4A6OA 4KBBA 1NLQA 3VD4A 1PIV2 2BU9A 3PTYA 4CP0A 5FXXA 2QQWA 2O8OA 3I3DA 2K46A 1RUNA 5FYYA 2XJVA 3DYMA 3WD5A 1QJY1 1XOYA 2WNVB 2SBAA 1UOJA 2WZPP 1AR92 5AC91 5DDJ1 1OQ1A 2ZGQA 2YB7A 4QKBA 3ES4A 4BQWA 5HPOA 1YFYA 5GKAC 2CTVA 1ULOA 4NO4A 2CDOA 1UCXA 2ORZA 2KR2A 4XF4A 5EJ3A 5GLWA 4BYYA 5L7OC 2WSVA 3BN6A 5FOBB 5T5LA 2VPVA 3NL1A 2RJLA 4QB6A 2HEYF 4XZUG 2DVDA 2HKXA 3VBHB 3W58A 2FDGA 3IM0A 2CNAA 2VZ1A 1A34A 5A3NA 4Y4YA 4F3JA 4MGYE 2BNOA 1JZ6A 2YDEA 4KU7A 1O4ZA 4XMIA 3HIFA 3HN1A 1JHJA 1XE7A 5B4XA 3H7JA 2IWGB 1F8VA 4AI8A 3CMGA 4XJ9A 3P3PA 4MHUA 3AVSA 1QOSA 2R1DA 4XACA 3V0BA 2H0VA 2VCMA 4XBQA 4E2SA 2ZGRA 1RXGA 1VB2A 2A6XA 3H1MA 2HWF2 1AL21 3Q8EA 1XU1A 2GH2A 1WLCA 3KQ4B 4Z2WA 3OD0A 2P5BA 2XXZA 4LBQA 1B35A 4O61A 2C6SA 2YFUA 4NIDA 4YW7A 1UF2C 1CAUB 3LB9A 5LEKA 4GKXA 5DUWA 3AL6A 2OUJA 4XTPA 5E88A 4YSFA 2H6CA 3J7NA 1C5HA 3NWKA 3OG2A 4DEVA 4LOSA 5FZ6A 3RGBA 2HWB1 1UY2A 4BHPA 1WMXA 4MUVA 4ASLA 2YU2A 1RUF3 4UFLA 5FLJA 4GH4B 3Q8FA 1TMF3 3S7EA 3NSTA 1W2AX 2D3SA 1W6NA 5FKCA 4NIHA 4YM1A 2WL1A 1DZQA 3ZKYA 2B46X 2CGOA 5FTTC 4AAXA 5BNNC 3PIGA 3OEAA 5C4WA 2ZGSA 2JG9A 3RZHA 3VD9A 3BOWA 1RUJ3 3FC0A 5JVVA 3GALA 2B5HA 5A70A 1Q56A 2SLIA 2ZS6B 3LFIA 4HG6B 2DVFA 2JDMA 3N9OA 2BP6A 2PHRA 3WLUA 3W5MA 4HL0A 1RUH2 1RJ7A 3NJXA 1N3OA 2WQ4A 1JYCA 2D5HA 4A3ZA 1Y7BA 5DAVA 2C4XA 5FIXA 3CNAA 3OSDA 3VKLA 3TB0A 2BPA2 3OGVA 4TYSA 3OB8A 4TN7A 1NAEA 3CEWA 1KDKA 1MQTC 2GP3A 4WM7B 2WS92 4QQLA 2JDZA 3WNKA 1YC61 1AYN1 4MXVA 3OUHA 2W68A 4LKFA 4RQPC 1FATA 2QQVA 2VZQA 5DXDA 4MVTA 5BNPC 4HOOA 4U36A 2QQNA 3KS7A 2B39A 3QCWA 1HJGA 3I2JA 3K2OA 4YW4A 2G1MA 3V0AB 4KI5M 1NE6A 5DDJ3 1JBCA 1UOBA 1VRBA 5FUNA 1JN2P 1I5ZA 3C7FA 3OBRA 2XJRA 2B8MA 3IPVA 4Q26A 4R4ZA 1MS9A 4UFKA 2FZ1A 3E97A 1DGLA 1VAMA 4SBVA 5F3IA 2J1UA 3AYDA 4N43A 2RJKA 4OI2A 1RUI3 1LULA 1OQDA 3HMYA 4ITCA 1COV1 3DXTA 2GP5A 2O0OA 3AKPA 4LBOA 1O3SA 1XPWA 5FZFA 3DN7A 4A41A 1AJKA 5FYZA 1W3XA 1YEWA 1CGPA 2Q4SA 1HRI3 2CAUA 3T1MA 2OQ7A 4Y1YA 1OF4A 4E2QA 1L7LA 3F95A 2OZ6A 2R071 3C2UA 4P14A 2IZWA 4L0PA 5FMOL 1RUOA 4BU2A 4AQ6A 3PURA 2P3YA 3Q8AA 4RSUA 3W21A 3I2HA 4AHZA 3LDRA 1DIWA 5L73A 3USSA 2Y6FA 4AR2A 4E8DA 4BLJA 3AP5A 4P9WA 5ABJB 3AMHA 3B9IA 4HETA 4NWVA 1W05A 2O1QA 3GZEA 5FYIA 1DFQA 1VBC2 1MEC1 5GALA 4C8DA 1YWKA 2XOMA 5T52A 2RR12 4GWNA 1U5ZA 2D7FA 4HLTA 1QQP1 2JICA 3NNLA 3MUZ1 1XC6A 1AX1A 5J48A 4C1XA 3OTFA 3WDVA 4E9KA 4FTEA 1PHMA 1RUG3 1J84A 4ZY9A 4XQWA 1TEIA 1RUF2 1ZBE1 5LY1A 3AL5A 4XVHA 3ENRA 4CSWA 4XURA 1LHVA 3O1MA 2ZHKA 3ACGA 5FQ0A 3VKOA 1Z0HA 4DXSA 2VU9A 4Y26A 1H0BA 3OY8A 4MOAA 4M0NA 1RXFA 1SPPB 1O3RA 1JZ8A 4BIFA 4CDXA 1G8WA 4M4PA 2J7MA 3D82A 5EV7A 2OYZA 4LBQD 4CDWC 2RS53 3MLJA 5KC5A 4FTSA 5DUVA 2VNVA 1W6MB 1S0CA 3ZSKA 1ALYA 5FR3A 2JG9C 1QU0A 4LULA 4ARYA 4Q0PA 1POV3 4ZHNA 4RA0A 1IG0A 1QY4A 1AR81 4FQZA 3RI9A 4NHXA 2JX9A 4GMP3 3WR0A 4O9EA 1WLTA 4KGQA 2VCCA 2CGNA 4LBJA 4EYUA 5F39A 3N4MA 4BB3A 4CE8A 2YYOA 5F7UA 3DPRC 3WDYA 3ZYPA 3B9CA 3MUY1 5FCCA 2LROA 3SH4A 1AR71 1MS3A 3F2ZA 1W06A 2X5IA 4IE6A 4PI0A 5F5QA 4AG4A 1G6NA 1DGRA 3OPTA 1OI6A 1YHFA 3K3OA 2VOKA 1S0FA 4HN1A 5LBBA 3UV9A 4DXRA 1H4GA 1W8NA 4H2AA 1S2BA 2Q1FA 5F3CA 4FPEA 4YVWB 3AP6A 3MGUA 3SKVA 4N53B 4AE2A 1CPNA 4BQYA 1DGWA 3HBZA 2JDYA 2W1SA 4FPYA 5FREA 3POEA 2HWC3 4E2GA 4NR1A 4K6BA 4UOJA 3ZDSA 3IIAA 3PJQA 3WP5A 1WLDA 2OUHA 1STMA 4S2GA 1COV3 1PK6C 3C8XA 3GJAA 3RG0A 2WRAA 3MV11 1XRUA 1PVC2 4V2VA 1W2OA 5GJ6A 1DDLA 4PLMA 4UW3A 1GICA 5DUUA 3ECQA 1IQAA 3ZMOA 2VUJA 4LR4A 4MLOA 2YG0A 1WMDA 4Z1VA 5IFPA 2WNUC 2BQPA 5IFTA 3IKWA 1J3QA 1VBA1 3APBA 3DYPA 3VHOA 2QUOA 1G9BA 3B00A 1AUYA 4I3GA 4LO5B 3D5OA 1W2TA 1GQHA 1W3VA 3NV2A 1LODA 3JCIA 2KM2A 4DZGA 4XUNA 3NO8A 5BYNA 4XDOA 2VZSA 2H6BA 2D6MA 1H8TC 4HKLA 2MEV3 4LHNA 1GQGA 3ZFEB 3ZN6B 5GZDA 1G86A 1ZRFA 4ZZ5A 2VNRA 1V6LA 2P37A 3FX3A 3LA2A 1CZSA 3VZJA 2X8KA 4K20A 2GC3A 3C7OA 3EYPA 5HBAA 2PHUA 3UGGA 1M4WA 1W2NA 3NNMA 1RUG2 4FTBA 1NA1A 4MGQA 1YXWA 2WN2A 5J98B 3VB9A 5L9BA 1PO21 3UGFA 4BOWA 5JUVA 4AHXA 1JUHA 4A7ZA 2ZABA 4ISQA 3I7DA 4EN9B 5IT6A 1DBNA 1LGBA 4JQRA 3MFAA 4NJ4A 1XNAA 3UJOA 1MZFA 1O5LA 3GBFA 1RVF1 2FD8A 1DCSA 2E33A 5CZKA 3LFMA 4XF3A 3S57A 2JJ6A 3RYPA 5CFDA 3BPZA 2JE7A 4FFHA 3RZJA 1EPZA 3T2OA 5C8CA 3M3CA 2IXJA 3KHBA 5I8TA 1HV1A 1OA4A 1IPJA 2R7EB 5I8YA 2PA7A 4CDXC 1UU5A 3KSCA 4IEVA 3VL8A 3QD6A 4LA2A 4LORA 1NQDA 2A6YA 4B7EA 1NLRA 2CWMA 3GHMA 3LSEA 2G19A 1F35A 1OLMA 2EXHA 1W2UA 5A3OA 3GM8A 4H7MA 4QQOA 1CAVB 3EXUA 4PLOA 1EAH2 1DQ0A 3WG4A 2G9ZA 2AZ5A 3J7MA 2FDKA 1BEV1 1S2KA 2V5DA 5LZ6A 2WZR1 2WA3A 4QM8A 5BNOC 4RHV1 5EZWA 5LB6A 2Y0OA 3TN93 1Q5OA 4QPGA 1E5IA 1ZA7A 2Y8KA 3VDDA 2Y0IA 4N9IA 2X5IC 4GWJA 2BUKA 4C1WA 1JS9A 2HEVF 5CKMA 3TAYA 4OYUA 4BIOA 4XCAA 2QDNA 3UGHA 1W8TA 1W8ZA 2J1AA 1WKYA 2Q8EA 3JQWA 5BNNB 5JOWA 2HH9A 2NLRA 2BBVA 4LLFA 1KEXA 4AHYA 1SQ4A 1QF3A 2MHFA 3CZJA 4EWAA 1G9AA 1GZWB 3WDUA 4GA9A 2VH9A 3GHNA 5FO8B 2ET7A 3AVRA 3OGRA 2K0GA 3OGSA 4I02A 3M1HA 3JU9A 1NCRC 1AYM3 2HBTA 4ATEA 3HOBA 3VZLA 3C7HA 3ZN5A 3PMSA 1C1LA 4W6XA 5KHHA 4D3WA 5EIYB 3MBWA 4QQ2A 5ANQA 4GB32 2HYXA 3AK0A 3QH6A 1K5JA 1W6PA 3IZOA 3KGLA 5DAXA 4OI1A 2AEYA 2E53A 2F4LA 1UYPA 1UX6A 2WAOA 2XVGA 1GNZA 4AEJA 1LU1A 1WW7A 1TNFA 3POGA 5K0UC 1MQTB 4Y20B 4XHBA 4QHBA 3K4DA 3POIA 5K8SA 1Q8OA 2YBKA 2IXLA 4DUVA 5F32A 3W9AA 4M0HA 4AI9A 3PUAA 1D0HA 4KG8A 4RQPB 4I0BA 4PIZA 3I8TA 3AB0A 2Q8CA 1I6XA 4Q4Y2 2MEV2 3DXUA 4QX5A 1X7NA 2UY9A 4X8NA 3SMHA 2RDNA 3OEBA 4QXBA 1RUD3 2XJQA 2RM21 2QQIA 2ZGKA 4JQTA 1BBT2 4ATFA 3KV6A 2JG8A 1CVNA 2IFWA 3KCXA 1PO23 3ACIA 1LHUA 3NAPC 1YO8A 3NVCA 3OGGA 4LA3A 4PIYA 4QGMA 4XHXA 1XNDA 4IGQA 3QOPA 1ODNA 1N1YA 2DV9A 4YZ3A 4OULA 2XWBB 4KNCA 4K40A 1PIV1 3CQOA 3PUIA 3WDWA 5FZKA 4CA9A 2C0ZA 2PLV2 3A22A 3T2TA 3ZO0B 3ZLIA 4FSJA 2ZPXA 3N36A 1YYNA 3TRSB 2A71A 2ZX3A 5BPXA 4E4ZA 1KS5A 3PHMA 4DQAA 1HKDA 1Q3EA 1WGPA 3ROUA 4E27A 3PL0A 3TEWA 1A6CA 2GNMA 2O14A 3AP7A 4FPFA 5A1AA 1YQ6A 2V72A 5DAWA 4ZS2A 2J1SA 1A8DA 1LR5A 4MGKE 3VDAA 3VBOA 3ZDVA 3WW1A 4QX7A 1W6OA 2HWE2 1D4M2 1HLCA 4DUXA 5EYXA 5FY7A 3SEEA 2EIGA 1WCUA 2Y6HA 4YW1A 4CEWA 4OQ8A 3RJRA 1YQ2A 3NNFA 5H9QA 1N1VA 3O1SA 2QFEA 4ZU7A 4PIXA 4D69A 1GYKA 3L2HA 2Y38A 4GIQA 3LPGA 1BKZA 4QX2A 5F5AA 1IG3A 1X82A 3BGAA 3KM5A 4R8HA 4O7XA 3SEPA 4YNIA 4LXLA 1WW4A 3EMRA 4WVMB 5IK8A 4XBNA 2OZJA 3KT4A 1SFPA 5C33A 3WDXA 1GOGA 1RMU3 1LOGA 5JI7A 3ABZA 2JENA 4P5YA 3ACHA 1CN1A 3VD3A 2R32A 1PMIA 4YZ5A 2ZBJA 2B7YA 5L9RA 1HRV3 3NV3A 4QPGC 2WSUA 3VDDC 2B45X 2XBO1 2A6VA 4S2FA 1VRH3 4QHOA 5FY8A 1IPSA 2ZGNA 2Y64A 3KCYA 4ZONA 5FPAA 3FHIB 1Q8QA 2RDQA 4N8MA 3WZ1A 1BYHA 5FWEA 1WLWA 4CDWB 1ZZ8A 5T5PA 5GLVA 3ZXDA 2AEZA 2GAUA 2QZ2A 3HT2A 1S0DA 5FXZA 2EXKA 2Y6GA 1WBLA 4OHZA 5FYMA 4I09A 1CJDA 3WNMA 3SKJE 4PI2A 4COVA 3WP4A 2BFUS 1XU2A 2R062 2YGLA 1J1LA 4RYDA 1ND2A 3E5XA 4JRAA 3JD73 4URTA 1ULEA 4PHZA 1H2MA 4ES9A 1X36A 3DPRB 1F2NA 1REEA 3D4KA 4FPKA 1W03A 2Y60A 3CBNA 3CF6E 3OUJA 4JDOA 3MIHA 4Q4V3 3ZYJB 1G9DA 2RG4A 2GDFA 3ZYGA 4I3PA 2R30A 5FYHA 1DZTA 1QOTA 1OA2A 1GBGA 3WNLA 1EY2A 3J7HA 3A21A 1KRIA 3CZUA 2R041 5A33A 4GULA 4KWKA 1RUD2 4QPIA 3THDA 5HCAA 3IDBB 3H1YA 2VMFA 4DNYA 3K48A 1UD1A 5GZFA 3GBGA 1IHMA 4KBZA 4BPZA 3UKTA 4IL7A 1Z7S3 3N9MA 2WS91 2VTXJ 5KHIA 1UY3A 1W99A 1AR62 1PK6B 3LA7A 3MIEA 3TBDA 2ZOEB 3VBRB 2JG8C 3NQHA 4XTMA 1QNYA 4PDWA 1IQDC 3B94A 1GQPA 3PIJA 1LEDA 4Y1XA 5EPAA 4C0HA 3HJRA 1XBFA 4UF0A 5JZGB 3OUIA 3U11A 5IK7A 3PUQA 2DBNA 3AYAA 5F5CA 4AFMA 3I54A 1IZ3A 2GMMA 4FP3A 2E6VA 5T54A 3V64A 3FLPA 3ZFFA 1VBB3 2TUNA 1YLLA 1NY72 1WW5A 1GLHA 2WNUB 5DUXA 3GJBA 4BQ1A 1QJX2 3LEKA 4DY3A 2GNBA 1H2LA 3HNMA 4IV3B 5GLUA 4CTEA 1QXJA 1YIPA 5BNQA 4HFSA 2Q8DA 1O5UA 4DB5A 4CP1A 3MLLA 3M7AA 5FZMA 4MO3M 1KITA 3EJKA 4UFIA 1H8TB 5CFCA 3Q9OA 1C8M1 4G3YC 2WZ8A 3K3NA 5IK4A 1C3HA 2PHTA 1C28A 3N9NA 1QH7A 1ZZ7A 4N7UA 4GJZA 4Q4X2 1UOGA 3VBSA 4CEYC 5FOJB 5FWJA 3O1VA 3ZFGA 5FLHA 4FI9A 4Z92B 2D3RA 3O1PA 1DG6A 1OLRA 4Y3OA 5CG8A 2WWSA 4AAPA 2FQPA 2YGMA 4XJUA 3V56A 3VBUC 1G7YA 4RS5C 4ZXEA 1VBC1 2XBO3 3JB8A 3Q8BA 5D8AC 2XLGA 1DQ5A 3ETPA 4CP9A 2QBXA 2PMWB 4BXFA 2EALA 2ZEZA 2VECA 3ZIWA 2QQJA 1VRH2 4KWLA 4BQ2A 3AX4A 4QT6A 2VY0A 1QGLA 4RGKA 2VE1A 1SLAA 1GMMA 2DFCA 1MVQA 4R9CA 3E5QA 1ND3A 4FOQA 2FDJA 3H9AA 3AXEA 5ACA3 5GLTA 3WSOA 4URAA 2GC2A 1S55A 4B4RA 3HPNA 1ZZBA 1XSQA 3TNPB 1S0IA 4OI4A 3KF5A 3OD4A 5CKQA 4COZA 1F4AA 3USUB 5A80A 5T50A 2D3PA 4XUOA 1V9U2 2IXKA 1CAXB 1QJU1 3AJYA 4BQXA 2D40A 4ISRA 2EXIA 1GNYA 2VUAA 1Q43A 2JWPA 1RUC1 3GDBA 2XGXA 5LA1A 4Q4V2 2P1BA 4R4XA 3BI3A 2XKPA 1XE8A 1CZTA 3N7LA 2JDPA 1BK0A 2JIGA 5BNOB 3LOBA 2P3IA 2C24A 3WNXA 3I3BA 3IAQA 2G4IA 1ODMA 3AZZA 2Y33A 1QXPA 4LBMA 3ZXLA 2LM3A 4AFCA 2WO3A 2I74A 4XQDA 3ZYHA 4CDQC 4B4QA 4RR3B 3JBG3 3FLRA 4D0QA 3TNQA 3WQ0A 1RUE3 3J7LA 3LIHA 5TSWA 4NIGA 3CJIA 1GNHA 3AFGA 4Q0QA 4Y33A 2ZKLA 1Z7S2 3U4XA 5GZEA 1LGNA 3AMQA 1OPOA 5C3OA 1ZRRA 4HSJA 4M3CB 4QPIC 1OOPC 1RHI2 5L19A 3VBFA 4AEDA 3ZXEA 5KHGA 4HPKB 4YVSC 2EIDA 4EN6B 2RMU3 1VPHA 3I3MA 2WQZC 3M3QA 2EF6A 4LO4B 1JTZX 1HB2A 1UZZA 1EPWA 1YQ5A 4QDQA 1UY0A 1V70A 1O3TA 1NCRB 3VUOA 3AZWA 1WW6A 1AXYA 2VCBA 4HVOA 3PLQA 4H14A 2YU1A 4QB2A 1U5YA 4GJYA 1UU6A 2D6KA 5DQ0A 1DU3D 4P9JA 3O0XA 5H9PA 2LALA 1DYPA 3FJSA 4XF1A 5SV8A 2TNFA 3WOGA 1T6BX 2GSYA 1JZ4A 1NXD1 3P1IA 5K0UB 2UY8A 5IW0A 1W6QA 4P9LA 1S2EA 4IERA 1SEFA 1FPN2 4FFIA 4QDRA 5FV3A 4NPRA 3V65A 1YNAA 5JSOA 1C8M3 3VLBB 4ZZ8A 5C71A 5C5TA 5JLVA 2DCZA 3N7KA 1APNA 5FYBA 4XJWA 4LK6A 4EN0A 1O4YA 2W3JA 2EAKA 1W0NA 1FMD3 4ASMB 3WHUA 3ZXAC 3P6BA 2R6QA 2D6NA 4FFGA 1JH5A 5FK7A 5C9AA 5I93A 3NAPB 4Y5TA 1FOD1 3WG3A 2RVAA 1F5FA 3SH5A 4FAHA 3BYWA 1FT9A 2WAAA 3CKHA 3GXUA 2F17A 4NAMA 1QHDA 2JDUA 4YW3A 3J26N 3HEIA 2VO5A 1FAYA 1H2KA 2VXRA 5JXGA 4GKYA 3CDZB 3ZFGC 2W92A 3N3HA 1JOJA 1R093 1LHOA 3J8F2 3HBKA 4R9BA 1R082 3DF0A 2PAEA 1JOBA 2WA4A 3RWKX 3LEGA 3WT3A 3MV01 1HN0A 2XONA 3KGZA 3LE0A 2WWJA 1VMHA 5A3WA 4NPMA 3AC0A 3BTXA 2XJUA 2NM1A 2VNGA 5C6CA 1JYIA 2FBEA 5ACA2 4WV8A 4BH9A 2WFF2 2TEPA 3AMNA 4ZXKA 5A7SA 4FQ4A 2R0HA 4AF9A 4AVBA 3SH3A 4W6WA 4WM8A 4CXWA 1UIKA 2DCTA 5FMDA 4DO0A 3LZZA 1CJPA 3FE5A 4OMDA 4TSVA 5EP9A 3O7OA 3POFA 5AVAA 1TME3 2AH2A 1C57A 4N9HA 3BIEA 5FXVA 1VBE3 1BMV1 2JDKA 5A1LA 1ZRIA 1JXNA 1POV0 1QJZA 1RUC3 2WO7A 2VTFA 1HV0A 1K5MC 3LF7A 2J22A 3T2QA 1HXS2 3RVHA 4ES8A 4OMCA 4GMP0 1FI2A 5I0TA 5D21A 4IUGA 1PMJX 3U07A 4CCEA 1QJY3 5JR7B 1VBD1 2BYVE 1UKGA 1W9FA 1X8MA 3MFCA 4QD2A 4YWAA 3UJQA 4AQ2A 1W9WA 1O4TA 3NV1A 2PYTA 1QDOA 5AC93 1YJLA 4EV0A 1R1A1 2QQKA 2DU0A 3CHXA 3T3YA 3FN9A 2BEOA 3D3AA 2BW8A 4JVAA 3KD4A 4W50A 3SCGA 3WG1A 4DPNA 4YM0A 5KXBA 1NXMA 5C70A 5FFOC 2OIIA 2PXJA 3SQOA 3CO2A 3ZSEA 4BK4A 3G6JB 4IEUA 5A3MA 2X10A 4QKNA 3MW3A 3RZMA 2DVAA 3MICA 2ET1A 3AJZA 4DXTA 2XHNA 3EO6A 2D6OX 1Y9GA 2RMU2 4Q8KA 4FT8A 3CJIC 5LBCA 1FV3A 2RS11 5I0RA 1IOAA 3KMHA 4Y1VA 2E32A 5A7WA 2CWSA 3POWA 4J6GA 3MW4A 1WCSA 2P2KA 1UZ0A 5JAXA 5DPNA 5F3EA 2R0FA 4HK9A 4MSVA 4XIKA 1GR3A 4KU8A 3D8CA 4QDSA 4RFRB 3U37A 1AL23 2PQQA 2QCSB 1NQJA 2IVJA 2ATFA 1S0EA 1UZYA 1OPMA 5APAA 4Y5SA 2BRTA 2QQPA 1CX1A 2QTWB 1KFXL 1UMHA 3AP4A 4L8QA 4O65A 1U0AA 1YUDA 1Q8VA 4R9DA 3VL9A 1LKNA 5JOXA 1YFUA 1ASJ1 4MH0E 2JKXA 4FOYA 3RRDA 1JZ5A 4W4ZA 2HWB3 2A6ZA 2ERFA 2O8QA 4AI1A 1WUVA 3MZHA 1PZ9A 1B35C 2YC2A 1GOFA 4LBLA 4QQHA 4Y4RA 2XJPA 1LOBA 2FCTA 2IFRA 2W94A 4FAGA 5IVYA 2PTMA 1FMD2 3ZPYA 3QLQA 2HLEA 5G05L 1OF3A 4QX1A 1TMF2 4IE7A 1PVXA 1N1TA 4IE5A 1VAVA 4M4RA 2W0XA 5F2SA 2VVFA 4LT5A 1AX2A 2Y6LA 2ZGUA 2OPWA 4XJAA 1WD4A 2QNKA 4R9AA 3VHPA 2ILMA 4IEXA 4AZZA 4B1LA 5EYYA 1AZDA 4LPLA 2VL4A 4LJHA 4BK5A 4DEQA 1NYWA 1RUJ2 1VIWB 2A1XA 2WIIB 1R092 4XEZA 3NKTA 4Q2FA 2X05A 1SDDB 1BBT1 1GKBA 2ZZJA 2CDPA 5C4WC 4XUTA 3GZAA 4JGYA 1LECA 1OFNA 1V6KA 4KL1A 1REDA 2NYYA 5FZEA 3LEMA 4CDUB 4LK7A 3I59A 2ZCWA 4QPWA 3POSA 4K1YA 2CU5A 3O14A 4RFT0 4XETA 4Y22A 4AW7A 1LGCA 1OMIA 4HKOA 3TWIA 4EQVA 3DECA 5LRSA 1X33A 1BHGA 4JGZB 5FZ1A 1OLME 1TME2 2AUYA 2WN3A 1AYN3 3N7MA 1ZBA1 4IV1A 5FBJA 3THTA 4F8AA 1LHWA 2D6LX 3DL3A 3RNSA 4EZ4A 4B7KA 2R16A 4HKWA 2I45A 3K4ZA 5A32A 4JKKA 1G9FA 1HB4A 4P9YA 1NCQA 1W8FA 5LBFA 2HWE1 2GALA 3QBQA 4MZUA 1QDCA 2F4PA 2WQ8A 3OYWB 2A5ZA 4QXKA 5DDJ2 4CEYB 5AC92 3FWEA 1Y43B 4AI2A 2J1VA 3ZXFA 2QZ3A 5CAZA 4P5HA 2WNVA 3VBUB 4RS5B 1DQ1A 3BTZA 1W0PA 3O1TA 5D8AB 1EV11 4ZU5A 5LCWL 1RUI2 1Q8SA 5DZEA 1ZX5A 4NIAA 1RYYA 1U12A 2ZX0A 3ZXGA 4GAZA 5KXDA 2RS13 2R073 4NRPA 1HRI2 2XVLA 4N43C 4ZKTB 2BDRA 4XFIA 4AWDA 1HQNA 1UIJA 5LASA 5A7QA 5KBFA 3VBHA 1GZTA 1YFWA 5F6KA 2W46A 4LO8A 5LEJA 4G9SB 5LA9A 2DUQA 1QIQA 2RS31 5F1RA 3S7IA 1C5IA 2EXJA 2P6HA 5FPBA 3LQCA 1JYXA 1SLTA 2W47A 4D6QA 4XDPA 3WP6A 2FCUA 5IVFA 1MEC3 2VNOA 1US3A 1LTEA 2IXCA 2V4VA 4QB1A 5FKBA 1ASJ3 1QQP3 1MS4A 5LY2A 2VOWA 3D0JA 3KCCA 4LLOA 1I1EA 2NPIA 4FXGB 5KHKA 2GU9A 1CAWB 2ES3A 5EWSA 1YIFA 1D7PM 4P9XA 4V1PA 4OUEA 5FY1A 1KS4A 2C5DA 5CNAA 4CU8A 3WXPA 2E51A 1JOPA 1CAUA 4DRVA 3C7GA 1ZBE3 5JWPA 2A3XA 2P6CA 5KC6A 3K46A 1H9PA 2FDIA 4CCCA 3ALQA 1SLLA 4CDQB 5IK5A 1VAKA 3CU7A 1GOHA 4AEMA 5L7OB 3BIWE 3EB7A 2AREA 4L97A 2WLQA 4IDZA 5C5UA 2VZRA 4GH4A 4YGCA 4FPHA 1OOPB 4UT5A 1I9RA 2VQ0A 4Q0VA 4YVSB 2V4AA 4Z8BA 2BTVC 5T55A 1FXZA 5DAPA 5FPUA 2QQLA 1OBNA 2DVGA 3LDKA 3RDIA 4FPJA 2LW8A 2RS52 2OT7A 1OT5A 3UKNA 3ILNA 4PQ9A 3B5LB 5K4LA 2XB6C 1AR83 3PNAA 5E16A 1AR61 2AACA 2PHWA 5DAQA 5FDBA 1XJAA 3JXSA 4LITA 4DINB 5CEHA 5FY4A 5A6YA 4YYOA 5CIRA 5IVVA 4HVQA 4BQ4A 2VW2A 4OHWA 4Q1RA 1AR73 4FPLA 4HN0A 4XFCA 4ZU4A 4YGEA 4XDQA 4JC1A 1WBFA 4YGDA 4YW6A 3ZSMA 4ZPIA 3WF2A 1YCIA 5F5IA 2VZTA 1PZ8A 4HBNA 4YW2A 5GM0A 4WM7A 4Y24A 4Q1PA 1CIWA 4WZCA 4J1WA 4LKDA 4W8JA 1WCDJ 3LA3A 2W9XA 4EROA 1HN1A 1JU4A 3WEZA 3WF3A 4AVSA 3MEPA 2HWC2 2ORXA 1VMFA 4QX3A 2ARXA 5T5JA 4AQTA 1GWLA 1ENQA 5I0SA 3JQXA 1COV2 4Q4W1 4EWEA 4DIQA 4XILA 3QH7A 5FJKA 5J96B 3URFA 3PU8A 3H1WA 4BXSV 1L3JA 2VBDA 4Q4X1 5FZOB 4AYUA 4BQ5A 2R072 4FXKB 4EJRA 5JI9A 4IGOA 2UYAA 4UYBA 5KXCA 2DDUA 5C3PA 4SLIA 2JB4A 2WJSA 3PVNA 1DGRN 2W39A 3M3IA 1H4HA 2B4KA 3N9QA 2UYBA 3R0RA 4IW3A 5FK8A 4C91A 3VHNA 1VBA3 2HWD1 5HCFA 1UY4A 1MZ6A 3SC7X 4C90A 5FRAA 3O1UA 1PO11 1MS5A 3IAPA 1WA6X 5LK7B 1Y9MA 2VULA 3DKQA 4NVPA 4NHYA 5GZCA 1NKGA 4I30A 1DP0A 5KR7A 1X9TA 1VE0A 3ZXKA 2FMYA 4JZRA 1YJKA 2P17A 2JDNA 1GZCA 1MEC2 1K5MB 1L7QA 1WMEA 2IXIA 4META 1R1ZA 4MXWB 4A45A 1R64A 5ABJA 4QXCA 3IB3A 1UKRA 5J09A 4YG6A 4MYEA 5FZLA 4OVEA 5BNPB 2VUCA 3UKVA 3T4HB 2FHRA 1CONA 4OQ9A 1OKQA 4FP2A 4X6RB 1XNKA 3U14A 2WO2A 3LIGA 5IVJA 4KWJA 2D98A 2WO1A 3ZSLA 1V9U1 4QX0A 1ZBE2 3PU3A 4LIUA 2WINB 4MGSA 2ZEYA 5FZ8A 1W8WA 4AHWA 1K42A 3SCFA 1MZEA 2YUEA 2NQYA 2XJTA 1RVF3 3M2MA 3RMXA 1LOEA 1QWRA 1NA1C 3POBA 2LUWA 3J9SA 3ME2A 4FVVA 4E4HA 3I2FA 4BZ4A 4AXOA 2PHXA 3WVJA 2PQSA 4YM2A 1AR91 2PFWA 3GNEA 4LUMA 1SPPA 1QEXA 2ZTNA 3DGTA 5JOYA 4XOGA 4TXWA 3RZZA 3TEZA 3H3UA 4OZOA 4NRMA 1UL9A 4Z07A 4BMEA 5CFDC 1AR82 4B8EA 1W6MA 2JDHA 5JR2A 2A75A 2J1EA 5FXWA 3A0KA 3JZVA 3NNJA 1PMHX 1RHI1 1SMVA 3HQUA 4JKLA 1LU2A 5FPZA 5FZ3A 5C8CC 2ZGTA 4NWWA 2YBPA 3ON7A 2RDRA 3B93A 3ZVXA 2EAAA 1BZWA 1BEV3 1N3PA 2G9FA 2WZR3 1AR72 3D0SA 3N7JA 3V0BB 3MIDA 4RHV3 2FZ2A 5F8PA 3POYA 1H1IA 4CUAA 2ZAAA 4P00B 2A73B 5E1RA 3TN92 2XUMA 3I49A 4LBQB 4YGBA 3HQRA 5FLIA 1B35B 3IN9A 5FBZA 2DCYA 3ZYFA 3TYJA 4DXZA 3O1RA 2KXLA 4R52A 3VZNA 5AFEA 5BY5A 4MX3A 2HWF1 1ZZ6A 1UZWA 4MGZE 4ORFA 3VHRA 4YVWA 2Z2SB 4GWMA 1S0BA 4WM7C 1EP0A 4N53A 2LRPA 1FPN1 4FCAA 1BK1A 1UX7A 3RYKA 2PAMA 5A3TA 1JUIA 1W0OA 2W2IA 1YQ8A 4AOCA 2XMLA 2BNNA 3RYRA 4AFDA 4XF0A 3AM2A 5A1FA 4K9SA 2WUHA 3INAA 4A4AA 1W6NB 5FP8A 2VG9A 3BB6A 2WNEA 2HYKA 3FMGA 3S5AA 3I2GA 4XIOA 3IDCB 3IDAA 5C4WB 4QU2A 2JG9B 4OFGA 3H0OA 4CXYA 1AYM2 4KMQA 1FNZA 1C8NA 4GD4A 3OBZA 2Z5WA 4AVAA 3H3ZA 4PBOA 1PO13 2CY6A 1UY1A 4XJ8A 3T30A 1HW5A 2A3WA 1H1AA 3J8F1 5HCBA 3OBAA 3E6CC 1R081 2WZEA 1MVEA 4JDNA 2AGSA 4OI0A 4FPOB 1IKPA 1UAIA 1V6NA 3UESA 3T0DA 1SFYA 5JPNB 1ZRDA 3B7MA 4NE9A 1JYTA 3K77A 3KHCA 1RUH1 3SITA 2CGPA 3VZOA 3FL7A 3LGRA 1WCQA 3NJZA 1BJQA 5GLZA 3BVCA 2RM23 2WFF1 3DEMA 3MPPG 4FFFA 5C7GA 1EYBA 3OOXA 2VXJA 4XXAA 1J3RA 1XB9A 1S4CA 3ZFEA 3ZN6A 4NMIA 2A7AA 4G4FA 4J25A 1WCKA 1BVP1 1PO22 3LDBA 2ZMNA 1DLLA 1SDWA 2XL7A 3AZYA 1DQ2A 1PIV3 3ZSJA 2GMPA 1GV9A 4AI3A 1JYNA 1PX4A 1HXS1 1QXRA 4UFJA 3S30A 1K12A 1C4RA 1CR7A 1ULGA 2IUWA 2VUDA 2VZ3A 4YPJA 3PJYA 2WYSA 3IPVB 5CISA 3S5QA 1UYXA 3H3LA 4CYDA 2WWUA 4N43B 1V6IA 1NLSA 3KB5A 3UT0A 5CA6A 1E5RA 3ITQA 1FYUA 2P3KA 2DCKA 1ACCA 4UBGA 1J83A 3U0ZA 2DBIA 1H8VA 1KFUL 1OVPA 4WVZA 4TLFA 1Y9QA 2YPJA 3WNOA 1GP6A 3HR9A 3I2IA 2ENRA 3VBOC 4NROA 1J59A 4JTNA 4IEOA 3VD5A 3RJ2X 2G9GA 1BEV2 2R1BA 3NMBA 4Y1ZA 4YZ4A 3WQ1A 4CEWC 2WZR2 1SHWB 4E4SA 4EWDA 1W04A 2PHFA 1LB2A 4RHV2 1TVGA 4NRQA 3GBWA 3J4UH 1PGL2 1CAVA 5CVRA 2Z79A 4GZ9A 3ZR5A 4ASKA 5FO9B 4ARXA 1GUIA 1HB3A 3TOJA 2OW4A 2CSGA 4MGIE 1JZ2A 3P3NA 1RMU2 2VZOA 3MLKA 3T09A 4DOUA 5DG2A 1ONAA 1UXZA 2W87A 3BODA 4UWDA 1AX0A 1IS3A 3CIHA 4CCNA 5K7PA 1I5PA 4QMAA 4XC9A 1AL0G 5A7PA 1LNSA 2VW1A 2C1FA 1HRV2 2CL2A 1K45A 1VJ2A 2BOIA 2RR11 5HCHA 2PHLA 4XFGA 1W8OA 1X8EA 2BGOA 2ZHMA 4A3XA 3AZXA 3WF4A 4KQ7A 5G04L 4COYA 2GN3A 2XKOA 4HSLA 2UURA 3AP9A 1O7FA 2MPFA 5BNNA 5FPXA 1IGOA 3RI8A 5FQ0B 3TEYA 3FFZA 2DUOA 1ZNPA 3NW4A 5FP4A 1Q8PA 3RZKA 3OY8B 4KG0A 4XJZA 4DFSA 1GZWA 1RUF1 1A3KA 3NV4A 3A23A 3R4DB 5E89A 1OD3A 3RZLA 1TMF1 4Q5OA 2HBUA 4CDXB 4YARA 2XUEA 2Y34A 1DLCA 1NT0A 5FZCA 2E7TA 3BOPA 2DURA 1SACA 2GH8A 4BE3A 3JD72 2IXHA 1S0JA 3LKJA 4Q27A 5F2WA 2P3JA 1RUJ1 1VLNA 5FYTA 4CP2A 5KXEA 3GF6A 1RUH3 1ND2C 2P4EA 3WY6A 1G9CA 1CIYA 1TQ5A 3THPA 1EUTA 1LEMA 5FZ4A 1SG3A 4A44A 1MQTA 4Y20A 4Y1UA 3WF0A 2R043 3KVAA 3KT1A 1WZXA 2XVKA 4UXAA 3KF3A 2W1UA 2RM22 3D6EA 2QQMA 2X5IB 4RQPA 4O9GA 1GU3A 3UNPA 5FMOS 5I91A 1J1TA 3AMPA 5FYVA 3WW2A 1O91A 5CADA 2WS93 3VKFC 4CU9A 3WP3A 2AYHA 5KHJA 4L92A 3OJBA 4H55A 1KJLA 4AQSA 1JU3A 3VZKA 5FZGA 3ZFEC 2W5FA 1KGYA 1ENRA 1DYOA 3PTRB 5BV6A 3S6PA 1TNRA 4XFAA 3ILRA 5M0TA 2BFUL 4EN8B 3E5UA 3AXDA 5L36A 4BQ3A 1XXNA 2WC2A 3P5BA 4PDWC 1UNBA 4PJYA 4QQPA 2A70A 2BV4A 1VBB2 1UYZA 1HIXA 3B02A 3B69A 4OUMA 4H3WA 1QOOA 2ZX2A 4QGNA 1IKQA 4D94A 3ETQA 1RUI1 1PM7A 2QQOA 4CXXA 1PVC1 1UQXA 1FX5A 1UWWA 2XH6A 2VZUA 1A78A 1UXXX 3ZFFC 1CPMA 2VMEA 4EE2A 2ID4A 2E7AA 2OXBA 4XFFA 3RS6A 1HRI1 3E1F1 4I01A 5FP9A 4QU1A 1PZ7A 4RL7A 1CQ9A 3IIIA 4QX8A 1JZ3A 4TZDA 3N35A 2FCVA 5JXHA 2XG3A 5FZBA 2GC0A 2BNMA 3VD7A 2JIJA 2BZDA 5D1IA 4LNVA 4TTGA 2X29A 1L7RA 1NG0A 1W9TA 3BU7A 1GZ9A 1IS6A 1KQRA 4YZ2A 5CFCC 5J36A 2WLPA 1Y4WA 2ZGPA 2W08A 4WVMA 1VBC3 2XWJB 3WQ7A 2VD7A 2OS2A 2RR13 3VBSC 4IGPA 4CRQA 3H42B 2W52A 3ZYIB 4LO7A 2XBO2 1PNFA 2R49A 4D8MA 1UMZA 1JHNA 5JDBA 1NA1B 4YRDA 4MG2A 2ADDA 5EXOA 3DUIA 4GQ7A 1RC6A 5AVPA 3PVEA 4V2WA 3H8XA 1KXGA 2VVEA 4K1ZA 3ZX7A 1RUG1 3OCPA 4JRLA 1E5HA 2RV9A 1KDMA 3KT7A 5EQUA 4Z82A 5F6LB 3ZOIA 2DU1A 5E8AA 2VCAA 5FYCA 3ST7A 5IAXA 4CDWA 1KD7A 2ZX4A 2H0BA 3A4UA 3RWNA 2Q1ZB 4M01A 5CFDB 2YC0A 2VZVA 4HZFA 4LO6B 3KLSA 1ND3C 2OX0A 2FMDA 2GN7A 1QJU3 3HAGA 2NP0A 5C8CB 1OKOA 4FOWA 3C7EA 3L2YA 1SBFA 1NZIA 2YPDA 4PQQA 3SISA 1UOFA 4BDVB 3IT8A 1A8MA 2ZACA 4JCKA 1PNGA 4L11A 2RS51 1F4HA 3SNMA 1DGWX 4OCTA 3O12A 1XQNA 3KV4A 3DPRA 3H7YA 1UW8A 4W6YA 5FO7B 5C8WA 1POV1 3C3VA 1V6OA 3BTAA 2UWBA 2NZ9A 4LEJA 2R042 5A3LA 4BCUA 1UU4A 2CHHA 4X6QB 4GMP1 4LQRA 1WMFA 1OUSA 2I07B 3U1XA 3OPWA 2ARAA 4PCRA 3LOIA 4PF5A 3R05A 3AFKA 3FHQA 1YQCA 2BVBA 3MDPA 1OHFA 3JBG2 3VDCA 2Y26A 1EAH1 4QPGB 1P8JA 1RUE2 4UFMA 2V5YA 3VDDB 1KJRA 1AF9A 2DCJA 5C3QA 2V73A 5J7MA 1RGSA 4IQPA 2D6PA 4CCKA 3X29B 4AI0A 3QACA 1HQLA 1SLCA 1URXA 1O8PA 2VMDA 3M70A 3H8OA 1E57A 4LOTA 1MS8A 1TE1B 1PK6A 4IXLA 2XLFA 3VBRA 4OLLA 2BWCA 4RD7A 2ZKNA 4M3CE 3VBFC 4AEDC 1OH4A 1PGW2 1UO9A 4Z2AA 4A7YA 2IVIB 2HWC1 4I0WB 4IEZA 5JZGA 5FP7A 4D6RA 2WABA 4LBNA 4D7YA 2HEWF 1SBDA 3H8RA 4QPYA 2C9AA 1PVC3 1OVSA 1XNBA 4JHZA 4K21A 5JIAA 3SLIA 4UW6A 2WNUA 1LESA 3FBYA 3PUHA 3DYOA 4PT6A 5DMYA 5FYUA 2J1TA 3BU0A 4DRRA 3O5SA 3RZGA 3LCPA 3KV5A 4IV3A 1W6PB 2BERA 1QJEA 5H9RA 1ULDA 1C8M2 2VW0A 4YLZA 4XPVA 3FZ3A 5EHDA 4XABA 4GB31 3ZYBA 3LPFA 1H8TA 1NX9A 5FZDA 2E9QA 5JCTA 5FZHA 3RMYA 1FOD3 1ST8A 2F6BA 2W95A 4KGGA 1JMUB 4XUQA 1D4VB 4H7LA 3IBMA 5C3RA 2DWRA 2VVDA 2WFPA 1Z78A 2ZA9A 3IMMA 2QJVA 2E31A 5CKNA 4AFAA 2V09A 2VGDA 3I2KA 3S0MA 1DHKB 1GP4A 2JG8B 4Q4Y1 5C9AC 4I2OA 2MEV1 3HWJA 2PHDA 4OZXA 3DKWA 4COWA 4DUWA 1O8SA 4JKMA 1MPXA 4HXCA 4DMIA 2E63A 2D5FA 2TBVA 3ZM8A 1QMJA 3RPQA 2OPKA 5A3PA 1LOFA 4WBBA 5A7OA 2WR9A 5IJRA 5FYSA 3KVBA 3I2OA
chains in the Genus database with same CATH topology
2PLV1 3L9JT 2ZMKA 3EBRA 1REFA 1QJU2 3SHRA 4D7SA 3VBOB 1VBE2 1W6OB 2VMHA 3USUA 1YI9A 4INDA 1YI7A 4HT1T 4WM8C 2QVSB 1RUC2 3IWZA 4XMAA 2GNDA 4CEWB 4YW5A 1VBD3 1CAXA 3G7DA 3ATGA 4U2AA 3GZUC 4OHYA 2CAVA 1N3QA 1QJY2 4XFHA 1R1A3 3SXWA 1D4M1 2K2SA 1XYOA 4Q0SA 4BLIA 1LJ7A 2WKKA 2VMIA 3AKSA 1U5IA 4IESA 5BNOA 3RQ0A 4XE9A 1OA3A 4PLNA 1DQ4A 3U10A 1EAH3 2WT0A 5H9SA 4XXPA 2UU8A 1D2QA 2ZAHA 1NOVA 2WT2A 4Q29A 4L2NA 3WCSA 3AKTA 4RR3A 4JDMA 5I0UA 3LSDA 3B3QE 3TN91 2YV8A 2BVVA 3HT1A 3K51A 1LOAA 4M3CA 1J58A 5HXVA 5CU1A 4YFZA 1U5XA 1ENSA 4HPKA 1T6GC 4OHVA 1VB4A 3IDEA 4FBFA 4F7ZA 1N47A 1IS4A 2YZ4A 3ES1A 3MYXA 3MPBA 2HJIA 4Q8LA 1RJ8A 4WVWA 1NCRA 5HI0A 2D43A 3VBRC 1LOCA 2B42B 3H8UA 3MF9A 4GXLA 4P9GA 3MIGA 1AL22 2KA3A 1AVBA 4X8PA 5JZGC 2NMNA 4HK8A 1QH6A 3MIBA 2WT1A 4A7KA 1ND2B 1SBEA 5I8SA 1AYM1 2Q1MA 3E6BA 2N7GA 4YG0A 4GB33 5K0UA 2R061 2HWB2 4WVVA 2JXAA 2ARBA 4AGRA 3O0WA 4IV3C 1DQ6A 3VN4A 1FOD2 2ZMLA 1ZZCA 2Z69A 1V6JA 4BMBA 5A33B 2NN8A 2YROA 3M4FA 4Q4Y3 4QPIB 3NAPA 3R6SA 1V00A 1X50A 1ZM1A 3ACLA 3AKQA 1BBT3 4B29A 1ZA4A 4CZSA 3FUQA 1FNYA 1RUD1 2GMEA 4IETA 1XYPA 4FO9A 1D2SA 4DY5A 3ZXJA 3WW3A 4W65A 1MS1A 2BWAA 2OVUA 1MR5A 2RHPA 3ELNA 4JV4A 4NN0A 4PDWB 4AEKA 2QE3A 4BA6A 4L99A 1ZRCA 3OPZA 4XYXA 1ZREA 2IC1A 2PLV3 1ENXA 3OF1A 1RIRA 4JGYC 3ZN4A 3FUOA 1JW6A 3ZFFB 1LRHA 1ZBA3 1BMV2 3UK9A 2K9ZA 1LOFC 1LENA 4UBHA 1AYN2 5JOZA 1BCXA 3R4UA 2Q0AA 2Q30A 4RGAA 3FBMA 2HWE3 1VBD2 1NY71 4HANA 3WG2A 1D4M3 3AYCA 3OBTA 4M00A 3VV1A 4AVVA 5JMCA 4IV1C 1QJX1 4S2HA 1R1A2 4K8FA 5BUVA 4BWOA 1UPSA 5CFCB 1CESA 1CX4A 1SLIA 4PBPA 3V0AA 5FAXA 1RINA 1ZVFA 3WINE 2MNGA 1DZRA 1NCQC 3AMMA 3VKNA 2YY1A 1EV13 3A0NA 3VBSB 4XF9A 3VZMA 3ZFGB 2GZWA 1ZZ9A 1VP6A 3W59A 1PGL1 4JTOA 3ZYRA 2WNVC 1Y3TA 3I2DA 4GALA 1OD5A 2RS12 4LE3A 1NZCA 1WA4A 1RMU1 2PAKA 4C0BA 2EVXA 4RR3C 4J1XA 3WHTA 2RS33 2YMZA 1AXZA 2QDRA 1D0GA 4M3CF 2EA7A 2VMGA 1HRV1 2LTNA 3FFQA 4LHKA 1B09A 1ND3B 1ZYBA 4UW5A 4AVTA 3MI8A 1HDKA 1CD3G 3VBHC 1VRH1 3FLTA 3LAGA 3H50A 4OUSA 4LBKA 4XFBA 4LTAA 5BXXA 1ASJ2 1QQP2 1O3QA 3CLPA 2R063 1OSGA 1UN1A 4YM3A 3WX5A 4L9BA 2I2SA 3MIFA 3NKGA 3JD71 2JE9A 4I0AA 1AXKA 1H1MA 4Q4V1 3MF6A 2ZGLA 4XW3A 4LHLA 2JEMA 1RB8G 2ETEA 1DF0A 3CJIB 4GH4C 3VGIA 1V6MA 2P34A 2D93A 3VBFB 4AEDB 1H2NA 4COUA 3JB4C 1OQEA 1GFF2 1AR63 1Z7S1 2XLAA 3EHKA 2DFBA 1PGSA 3WDTA 1LCLA 2ZHNA 2ZGMA 2RE9A 3M8LA 1LHNA 4FOVA 4CDUA 5J3UA 1S1AA 1ZBA2 2XJSA 4FPCA 1F9KA 3DV8A 4JGZA 4UW4A 1QJX3 1VBB1 1FV2A 2NMOA 1W6QB 3LWCA 4BM8A 1DYKA 2XL9A 1J3PA 4AVCA 4NOTA 2YXSA 3WW4A 4NHLA 1HX6A 4F83A 5JSPA 3ASIA 4HMZA 1OLQA 2PN5A 2AR6A 3CJXA 3ZMNA 3I4IA 3OYWA 4CEYA 1VR3A 1H9WA 3JUUA 4Q4W3 4RGGA 3CL1A 1EV12 2ZZQA 5DZGA 4K7JA 5LK5A 1SFNA 5C9AB 5JPMB 4B3NA 2JECA 5GZGA 3VBUA 2XPJA 4Q4X3 4RS5A 3AZVA 1MS0A 4XBLA 3AKRA 5D8AA 1QKQA 3KQRA 2JD4A 2DF7A 2HWD3 4YG3A 5IUQA 2RS32 1GANA 5CBLA 1OFSA 1F31A 5T5OA 1VBA2 2DVBA 4AGVA 4AFBA 5CB7A 2D97A 2E7QA 1AHSA 4WM8B 1SCSA 2YHJA 4XZPA 3UL2A 2DTWA 2QKDA 4DS0A 5ACA1 3KZ4C 4S2DA 2CYFA 2ZGOA 3B01A 4FPGA 5CG9A 1SLBA 1V9U3 1XNCA 2X53S 5ABJC 4IEPA 3HD8B 1CAWA 5DG1A 3BCWA 1BXHA 3IMNA 4MV2A 1XYNA 5DZFA 4CDQA 1RVF2 1ULFA 5EFUA 1N1SA 3E6DA 5L7OA 1AR93 2A3YA 4LUKA 4HVRA 1SCRA 2JKBA 1C1FA 1OOPA 4KH9A 2PELA 4YVSA 4YZ1A 1IPKA 2ZHLA 4NHMA 1MZ5A 3AYEA 3JBG1 5SV5A 1RUE1 3ILFA 4AGGA 1UPIA 1NE4A 1RHI3 2XHKA 2GC1A 2UWCA 2Q5TA 5JSRA 2GNTA 2Z42A 3ZIXA 2RMU1 3O0VA 5F9TA 4AK3A 2VQAA 3T1LA 4TWTA 2B9UA 1ULCA 1PGW1 3R4SA 4CDUC 4D7TA 1RTVA 4QGLA 1GSLA 2HWF3 2DTYA 3GYDA 5JIUA 4Q0UA 1BVVA 4JGZC 4QM9A 4A2UA 3WUDA 4K3UA 1FPN3 4ONUA 3PVOA 5AFBA 3WUCA 3GZTB 3SCHA 5J37A 1H30A 1RL3A 4Q4W2 2ZJCA 3M3OA 3HQXA 3OGJA 3PVBB 1F5JA 2ZX1A 1IS5A 4YVWC 3BALA 4N53C 1M06G 4NHKA 2AENA 2VOVA 1W39A 4YFWA 1YRZA 1FMD1 1AJOA 1RITA 2OA2A 4IEYA 4E4DX 2CV6A 2BGCA 2HWD2 3M3EA 3PMEA 2VOXA 4IEWA 2DUPA 1PO12 3J8F3 1R083 1I3HA 3MW2A 1S0GA 1YFXA 4JGYB 5K9YA 1R091 1VALA 3RSJA 5KWRA 1HQWA 4N90A 3VKMA 1BQPA 4IEQA 2A6WA 3I59B 2UWAA 4B4PA 4XQ4A 4Y22B 4EN7B 2DYCA 5B2GB 2WFF3 4LE4A 4P9IA 2D44A 3EQEA 5LRRA 4JAAA 4Y5Z0 3WCRA 1QNWA 1K5MA 4IV1B 4MXWA 2Q8OA 4WZFA 1MACA 1WD3A 5BNPA 3WV6A 5A32B 4N7IA 1TME1 5T3NA 1NCQB 1VBE1 1HXS3 4OHXA 4KBBA 1PIV2 3PTYA 4CP0A 2O8OA 1RUNA 2XJVA 3WD5A 1QJY1 2WNVB 2SBAA 2WZPP 1AR92 5AC91 5DDJ1 1OQ1A 2ZGQA 3ES4A 1YFYA 5GKAC 2CTVA 4NO4A 5EJ3A 5GLWA 1UCXA 4XF4A 5L7OC 4BYYA 2WSVA 5FOBB 5T5LA 2VPVA 3NL1A 2RJLA 2HEYF 2DVDA 2HKXA 3VBHB 3W58A 3IM0A 2CNAA 4Y4YA 4F3JA 4MGYE 2BNOA 2YDEA 4KU7A 1O4ZA 4XMIA 3HIFA 3HN1A 1XE7A 1F8VA 3H7JA 2IWGB 4AI8A 4XJ9A 3P3PA 2R1DA 1QOSA 3V0BA 2H0VA 4XBQA 4E2SA 2ZGRA 2A6XA 1VB2A 3H1MA 2HWF2 1AL21 1XU1A 2GH2A 1WLCA 4Z2WA 3OD0A 4LBQA 1B35A 1UF2C 1CAUB 3LB9A 5LEKA 4GKXA 5DUWA 2OUJA 4XTPA 5E88A 4YSFA 2H6CA 1C5HA 3NWKA 2HWB1 4BHPA 4MUVA 4ASLA 1RUF3 5FLJA 4GH4B 3S7EA 1TMF3 3NSTA 2D3SA 1W6NA 4YM1A 2WL1A 1DZQA 5BNNC 2B46X 2CGOA 5FTTC 5C4WA 2ZGSA 2JG9A 3BOWA 1RUJ3 3FC0A 5JVVA 3GALA 2B5HA 1Q56A 2SLIA 2ZS6B 2DVFA 2PHRA 3WLUA 4HL0A 1RUH2 1RJ7A 1N3OA 2WQ4A 1JYCA 2D5HA 1Y7BA 3CNAA 3VKLA 3TB0A 2BPA2 4TYSA 3CEWA 1KDKA 1MQTC 4WM7B 2WS92 4QQLA 2JDZA 1AYN1 4MXVA 2W68A 4RQPC 1FATA 5DXDA 4MVTA 5BNPC 4U36A 3KS7A 4YW4A 2B39A 3QCWA 3V0AB 1NE6A 5DDJ3 1JBCA 1JN2P 1I5ZA 3OBRA 2XJRA 2B8MA 3IPVA 4Q26A 4R4ZA 1MS9A 2FZ1A 3E97A 1DGLA 1VAMA 4SBVA 4N43A 3AYDA 2RJKA 4OI2A 1RUI3 1LULA 1OQDA 3HMYA 4ITCA 1COV1 2O0OA 3AKPA 4LBOA 1O3SA 3DN7A 1AJKA 1CGPA 2Q4SA 1HRI3 2CAUA 3T1MA 4Y1YA 4E2QA 2OZ6A 2R071 3C2UA 4P14A 2IZWA 5FMOL 1RUOA 4AQ6A 4RSUA 4AHZA 1DIWA 5L73A 3USSA 5ABJB 4BLJA 3AP5A 4P9WA 3AMHA 3B9IA 4HETA 4NWVA 2O1QA 1DFQA 1VBC2 1MEC1 5GALA 1YWKA 5T52A 2RR12 4GWNA 1U5ZA 2D7FA 4HLTA 1QQP1 2JICA 1AX1A 5J48A 4C1XA 3OTFA 3WDVA 4E9KA 4FTEA 1PHMA 1RUG3 4XQWA 1TEIA 1RUF2 1ZBE1 3ENRA 1LHVA 2ZHKA 5FQ0A 3VKOA 1Z0HA 2VU9A 4Y26A 1H0BA 3OY8A 4M0NA 1O3RA 4BIFA 4CDXA 1G8WA 3D82A 5EV7A 2OYZA 4LBQD 4CDWC 2RS53 3MLJA 5KC5A 4FTSA 5DUVA 1W6MB 1S0CA 3ZSKA 1ALYA 2JG9C 1QU0A 4LULA 4Q0PA 1POV3 4RA0A 1QY4A 1AR81 4FQZA 3RI9A 2JX9A 4GMP3 3WR0A 4O9EA 1WLTA 4KGQA 2CGNA 4LBJA 3N4MA 2YYOA 3DPRC 3WDYA 3ZYPA 3B9CA 5FCCA 3SH4A 1AR71 1MS3A 5F5QA 2X5IA 4AG4A 1G6NA 1DGRA 1OI6A 1YHFA 2VOKA 1S0FA 4HN1A 3UV9A 1H4GA 1S2BA 4FPEA 4YVWB 3AP6A 3MGUA 4N53B 4AE2A 1CPNA 1DGWA 3HBZA 4FPYA 5FREA 2HWC3 4E2GA 4NR1A 4K6BA 3ZDSA 3IIAA 3PJQA 3WP5A 1WLDA 2OUHA 4S2GA 1COV3 1PK6C 3RG0A 1XRUA 1PVC2 5GJ6A 1DDLA 4PLMA 4UW3A 1GICA 5DUUA 3ECQA 1IQAA 3ZMOA 2VUJA 4LR4A 4MLOA 1WMDA 4Z1VA 2WNUC 2BQPA 3IKWA 1J3QA 1VBA1 3APBA 3VHOA 2QUOA 1G9BA 3B00A 1AUYA 4I3GA 4LO5B 3D5OA 1GQHA 3NV2A 1LODA 3JCIA 2KM2A 4DZGA 3NO8A 5BYNA 2H6BA 2D6MA 1H8TC 4HKLA 2MEV3 4LHNA 1GQGA 3ZFEB 3ZN6B 5GZDA 1G86A 1ZRFA 2VNRA 1V6LA 2P37A 3FX3A 3LA2A 3VZJA 2X8KA 4K20A 2GC3A 5HBAA 2PHUA 1M4WA 4FTBA 1RUG2 1NA1A 5J98B 1YXWA 1PO21 4BOWA 4AHXA 1JUHA 4A7ZA 2ZABA 4ISQA 3I7DA 4EN9B 5IT6A 1DBNA 1LGBA 4JQRA 3MFAA 3UJOA 1MZFA 1O5LA 3GBFA 1RVF1 4XF3A 2JJ6A 3RYPA 5CFDA 3BPZA 2JE7A 1EPZA 5C8CA 3M3CA 2IXJA 5I8TA 1HV1A 1OA4A 1IPJA 5I8YA 2PA7A 4CDXC 1UU5A 3KSCA 4IEVA 3VL8A 3QD6A 4LA2A 4B7EA 1NQDA 2A6YA 1NLRA 2CWMA 3GHMA 3LSEA 2EXHA 1W2UA 4H7MA 4QQOA 1CAVB 3EXUA 4PLOA 1EAH2 1DQ0A 3WG4A 2AZ5A 1BEV1 1S2KA 2WZR1 2WA3A 4QM8A 5BNOC 4RHV1 5EZWA 2Y0OA 3TN93 1Q5OA 4QPGA 3VDDA 2Y0IA 4N9IA 2X5IC 2BUKA 4C1WA 2HEVF 3TAYA 4BIOA 2QDNA 3JQWA 5BNNB 5JOWA 2BBVA 2NLRA 4LLFA 4AHYA 1SQ4A 1QF3A 2MHFA 4EWAA 1G9AA 1GZWB 3WDUA 4GA9A 2VH9A 3GHNA 5FO8B 2ET7A 2K0GA 4I02A 3M1HA 3JU9A 1NCRC 1AYM3 4ATEA 3VZLA 3ZN5A 3PMSA 1C1LA 4W6XA 5KHHA 4D3WA 4QQ2A 4GB32 3AK0A 3QH6A 3KGLA 1W6PA 4OI1A 2E53A 2XVGA 1UX6A 1GNZA 4AEJA 1LU1A 1WW7A 1TNFA 5K0UC 1MQTB 4Y20B 4XHBA 4QHBA 5K8SA 1Q8OA 2IXLA 3W9AA 4M0HA 1D0HA 4KG8A 4RQPB 4I0BA 4PIZA 3I8TA 3AB0A 1I6XA 4Q4Y2 2MEV2 4QX5A 1X7NA 2UY9A 4X8NA 3SMHA 1RUD3