3ZVXA

Structure of the lectin from platypodium elegans in complex with a trimannoside
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
242
structure length
242
Chain Sequence
STDSLSFSFINFDRDERNLIFQGDAHTSRNNILQLTRTDSNGAPVRSTVGRILHSAQVRLWEKSTNRVANLQTQFSFFLSSPLSNPADGIAFFIAPPDTTIPSGSAGGLLGLFNPRTALNESANQVLAVEFDTFFAQNSNTWDPNYQHIGIDVNSIRSSKVVRWERREGKTLNVLVTYNPSTRTIDVVATYPDGQRYQLSHVVDLTTILPEWVRVGFSAASGEQFQTHNLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN
publication title A Lectin from Platypodium Elegans with Unusual Specificity and Affinity for Asymmetric Complex N-Glycans.
pubmed doi rcsb
source organism Platypodium elegans
total genus 58
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zvxA00
5F9TA 1OQ1A 3BIWE 3V0BA 3RMYA 4M3CE 5JVVA 4Y26A 4XE9A 2GNBA 4LBMA 3A0NA 1IS4A 3M3EA 2YZ4A 3O0WA 4R9DA 1LOBA 4UW3A 1RIRA 2WKKA 1N1SA 2E51A 4YG0A 3WOGA 1LHOA 3AZWA 1ULEA 2A7AA 2P2KA 4GA9A 2ZGUA 2WNEA 4XOGA 1A78A 3I4IA 1EPWA 3WVJA 4LBJA 4K1ZA 5HCBA 4DFSA 2GMEA 3ZXFA 2GMMA 2GN3A 2GN7A 3NV2A 3WG3A 1LULA 1G9FA 2R49A 3OYWB 2WLQA 4YFZA 1V6LA 4ITCA 3ASIA 1LEDA 4JRAA 1HQWA 1FATA 1WUVA 1N3QA 3OY8B 4AGGA 2GNTA 1C1LA 1CQ9A 3AYEA 5GZCA 5DUXA 2NP0A 2ZHKA 1LESA 1VAMA 1GSLA 3WV6A 2ZGKA 2A6ZA 3IN9A 1AX2A 2D43A 2UWCA 3MW4A 5IT6A 3AJYA 1V6IA 3BODA 4I30A 1QNWA 1UAIA 2D3RA 1A3KA 1DBNA 1I1EA 2E7TA 3ZXKA 3ILNA 5SV8A 4AVSA 4ASMB 2ZGMA 1LU2A 1UKGA 4P14A 4PQ9A 5T55A 4YW5A 1N1TA 4XXPA 2OUJA 5EYYA 2YV8A 3ZSKA 1GICA 2A70A 1N1YA 3B9CA 2R0HA 3HN1A 5DUWA 3WG1A 4IQPA 3FBYA 3T2TA 4M3CB 3IM0A 1QU0A 4C1WA 1AXZA 1MZ5A 1SBDA 3VKNA 4JC1A 4LBQA 4ZXKA 1DQ6A 2WT2A 3OBRA 3GALA 4XHBA 1LODA 1AXKA 3AK0A 1QOOA 3PVOA 4XBNA 1MR5A 1AJOA 2ZGPA 4U2AA 2I2SA 4YZ2A 1G9DA 4XIKA 1GZWB 1H9PA 4WZFA 1JOJA 1LOFC 2ZABA 3WDUA 1FV3A 1Q56A 2AREA 2R16A 2VY0A 1W6NB 4ISQA 5DG1A 1FX5A 2JECA 1W6QA 4ISRA 3O0VA 1SBFA 2EXJA 2YY1A 3BOPA 1DQ5A 4BMBA 3POSA 1S0IA 2A3XA 2ZHNA 5DZEA 3VV1A 2C9AA 3AXDA 2NN8A 3N3HA 4CTEA 1V6MA 3AXEA 2DURA 4H55A 3V0BB 3AP4A 2ZA9A 3GNEA 1WBFA 3M3QA 3MEPA 5IK5A 2XB6C 1V6NA 4RL7A 1UMZA 4YLZA 1WW4A 1AZDA 4XZPA 3D5OA 1S0DA 3AZVA 4XIOA 3WNXA 2VU9A 3AP7A 1QOSA 4NOTA 5GZFA 4Y20A 1FYUA 1G9AA 4XHXA 4DS0A 2D6PA 1SLAA 3AP5A 1CPNA 5T50A 5IK8A 1YXWA 1N47A 1SCSA 2WT1A 3ILRA 4PF5A 3V64A 3WDTA 1PZ9A 4BOWA 4DRVA 3T1LA 3ZVXA 5KXBA 3TB0A 1G86A 1G7YA 3AZZA 2DU0A 4Y1ZA 5DUUA 1LHUA 1Q8PA 1QDCA 4BQ1A 1S0CA 1QGLA 2P3IA 2DUPA 5H9SA 2G4IA 1F9KA 1VALA 2ZGSA 3POYA 4CRQA 1S0JA 3ZSLA 1I3HA 4MYEA 2E6VA 1GNHA 3SH5A 2W52A 4Y22A 4Q1RA 2NZ9A 3B3QE 3ZPYA 1HKDA 4XJWA 1V6KA 4YGBA 1JBCA 2EXIA 2JDZA 3T1MA 2CWSA 5E8AA 3IKWA 5LK5A 3QCWA 3DUIA 2ARBA 4Z8BA 1NLSA 1N3PA 1A8DA 1QKQA 1VLNA 2SLIA 3SISA 1D2SA 4DQAA 1YYNA 3CNAA 5IUQA 1S0FA 1UN1A 2ES3A 4AVVA 2A5ZA 1DFQA 3HMYA 4YG3A 2OVUA 1UZZA 2AENA 4Q27A 4LBQB 1WBLA 1WLDA 2GALA 3B01A 4FP3A 4YGCA 5AVAA 5JOXA 2W39A 3OPZA 3Q9OA 5GLWA 1LJ7A 5L73A 3WUCA 1DLLA 1N3OA 4JCKA 5DUVA 3N7KA 2CL2A 5GLTA 5H9RA 1ZA4A 3WG4A 2JE9A 5JDBA 2P3KA 1W6QB 4YW3A 2D6NA 4Y1VA 4Y1YA 3MPPG 2VXRA 3WCRA 4FQZA 4BLJA 2R0FA 1IKPA 4WV8A 5T5PA 1DIWA 2DTYA 4KBBA 3L2YA 4YFWA 1UX6A 4XTMA 4DPNA 4FOVA 2FHRA 3NV3A 1VIWB 2DUQA 5BYNA 1UPSA 5GALA 5DG2A 3JUUA 1FAYA 4FVVA 4XXAA 1LHNA 2GNDA 1KJRA 2SBAA 1QOTA 5KXCA 1WLWA 1XQNA 4GWNA 1ZM1A 3VKFC 1ULGA 4K20A 4BPZA 1DZQA 1IOAA 2DUOA 4C1XA 2GNMA 3ZSMA 3N7LA 4GWMA 2ZMKA 4Y20B 1GANA 1W6MA 1CESA 1JHNA 3FLPA 4W65A 5JOWA 2ZAAA 2CWMA 2A6WA 1HQLA 1Q8VA 2JKBA 1BKZA 3INAA 1BYHA 1UZYA 5T5JA 3UJQA 4Q8KA 1YO8A 1BJQA 1ULFA 4XJAA 3V65A 1S0GA 2DTWA 1KDMA 2D3SA 3M1HA 4PBOA 4XBQA 1F5FA 2RHPA 3R4SA 2EXHA 4XJZA 1DHKB 4ZKTB 4FPHA 1QF3A 2LTNA 1HLCA 2ZGRA 2WSUA 3B00A 4FP2A 5GZGA 4Q2FA 1W0OA 1DGLA 5T5OA 3RG0A 4XJUA 3N35A 4XJ8A 2Z42A 2PHXA 1LEMA 2GDFA 1GBGA 4M01A 4Q8LA 4P9YA 5CBLA 3MW3A 2A3YA 1SFYA 2D3PA 5EXOA 3AYAA 2WT0A 3R05A 1DYPA 4YZ5A 1Q8OA 2PHFA 1MS5A 2JD4A 3SNMA 5DZGA 2W08A 1GKBA 2P37A 2XG3A 3WDXA 1CIWA 2ARXA 2AGSA 4WVWA 4LBQD 1ENQA 1C57A 1KITA 4GXLA 1QNYA 2AYHA 4YM1A 4YZ3A 1AVBA 4YG6A 5H9PA 1N1VA 3OGGA 4OZXA 3R4UA 1V00A 1AJKA 2CYFA 3PVNA 1CVNA 4BLIA 4XBLA 1YI7A 2WQZC 1LGNA 1OFSA 3M3CA 1Z0HA 1JUIA 3PJQA 2EALA 4FPJA 3OY8A 2A6XA 2NM1A 1LGBA 2DVFA 5HCFA 1JYCA 1DQ2A 1BXHA 1B09A 3UL2A 3NWKA 4FOYA 1AXYA 4UW5A 1MZ6A 2DYCA 1AX1A 3HR9A 1FNYA 3ENRA 1JN2P 5T54A 4PBPA 1SCRA 4FPFA 4AYUA 1Q8QA 2E53A 2Q5TA 2PHTA 4FPLA 4Q26A 4YW2A 5GLVA 5CB7A 1F31A 3ATGA 4XYXA 1ULCA 2VW0A 1AX0A 2H0BA 5DZFA 5H9QA 3VUOA 1KRIA 1IS5A 1WCSA 1GNZA 2B7YA 2DU1A 2OUHA 1C4RA 1MS3A 1WW6A 2PHRA 1G9CA 1PZ7A 2D6KA 4R9BA 1V6JA 2WSVA 1ENRA 2P3JA 3VKMA 1CJPA 2PHWA 5CA6A 3SLIA 5IK4A 2YXSA 4U36A 2ZGQA 3RMXA 3WDYA 4AWDA 3IPVA 1LOCA 2UWAA 1WLCA 3AP9A 1W6MB 3AJZA 2VUAA 3FLTA 4BM8A 2A6VA 2A71A 2ZZJA 4LBOA 4M00A 3SITA 1ONAA 1GZWA 3OBTA 1O4ZA 2ZGTA 1LHWA 3A4UA 3NV4A 3W58A 1ULDA 3PVEA 3V0AA 5KXDA 5GZEA 4UW4A 1W0PA 4YM3A 3I8TA 5GLUA 5JMCA 2DVDA 2EXKA 1MS1A 1X50A 4GALA 3KQRA 1SACA 1CN1A 4FPKA 4K21A 4YZ4A 5EWSA 1LGCA 4F83A 1R1ZA 1D0HA 1GZCA 3WDWA 3SH4A 1H9WA 4XILA 2V73A 4TYSA 3U4XA 3ZYRA 4XTPA 3USUA 4Y1XA 1APNA 3IMNA 5IK7A 4YW4A 3TAYA 1URXA 5JOYA 3RRDA 1U0AA 1W6OA 2ZMNA 3N7MA 2DWRA 2ZKNA 1DYKA 2YROA 4P9WA 1DQ1A 4FOQA 3UK9A 2AH2A 4DRRA 2CTVA 1LOGA 2WJSA 1DQ0A 5CAZA 2JJ6A 4R9CA 1Z78A 2D6MA 2VW1A 4XMIA 5GZDA 4M3CF 4Y1UA 5FRAA 1O4YA 4FOWA 4SLIA 1PZ8A 4YZ1A 1J1TA 1WW7A 2VH9A 2ZGLA 3FUQA 2ZGOA 3MW2A 5HCAA 4XMAA 1ENSA 4BMEA 3NV1A 4LBKA 2E7QA 4FPEA 1JXNA 3ZYPA 1WD4A 4FPYA 5DXDA 2EF6A 2R1BA 2PELA 2DVAA 2R1DA 1LOEA 3OJBA 2UURA 3WG2A 3WUDA 1W6PA 2ZHMA 3H0OA 3KM5A 3LSDA 3WZ1A 1SBEA 2KM2A 2OW4A 3RS6A 3ZXLA 2ERFA 2W68A 3W59A 1Y7BA 2BQPA 3WHTA 4HANA 2D6LX 1IS6A 2NMNA 3AX4A 1DQ4A 5CNAA 1AF9A 4D69A 1CPMA 3AZXA 4CZSA 1V6OA 5T5LA 1QMJA 2CNAA 5GM0A 2TEPA 3D6EA 4YM0A 2VW2A 4ATEA 5JOZA 3C2UA 2C5DA 1S1AA 5EYXA 2UU8A 1RINA 1SLIA 4AVTA 1FNZA 3N7JA 3APBA 4Y22B 5E89A 1HDKA 4L8QA 4GKXA 4HL0A 5GJ6A 2PHUA 4TZDA 2AR6A 4FPGA 4PCRA 1BQPA 3IPVB 3FFZA 1SLLA 4Q1PA 4RA0A 1H30A 2ZMLA 1JYIA 2CY6A 1KQRA 1LOAA 2ZBJA 1KDKA 1MVQA 3ILFA 1KJLA 3M2MA 4GKYA 3AFKA 3QLQA 1SLBA 2EAKA 1MVEA 2NMOA 2P34A 1LECA 4LBNA 1GLHA 3RSJA 3VKLA 5T52A 1NXD1 1MS8A 3BTAA 4YGEA 3OYWA 3V0AB 1LENA 3O12A 2AUYA 1YRZA 4LBLA 3WCSA 2HYKA 3ZSJA 1MS9A 1GYKA 1C1FA 1RITA 3AP6A 4NO4A 1MS4A 2UWBA 2JE7A 2ZGNA 2GMPA 4Y24A 3AYCA 3LCPA 3PMEA 3WLUA 4ATFA 3N36A 1S0BA 1TEIA 1GV9A 1WW5A 2A6YA 3UJOA 5E88A 1SLCA 3FUOA 1FV2A 3USUB 1G9BA 1IKQA 3AYDA 4P9XA 4K1YA 1Q8SA 1OKQA 2V5YA 4FQ4A 1VAVA 5F5QA 2FMDA 2NYYA 3LSEA 1W6OB 2EIGA 1MACA 5GLZA 3VKOA 3DGTA 3JU9A 1UL9A 4AGVA 3POWA 4YM2A 2D6OX 1YIFA 3A0KA 3B69A 3D4KA 3M3OA 4WVVA 4YGDA 5KXEA 4XDQA 4FPOB 3WDVA 1LOFA 2DVGA 1LCLA 2LALA 4M3CA 1LU1A 1LTEA 4UW6A 1BZWA 1QDOA 2ENRA 1WD3A 2DV9A 3WHUA 2ZHLA 1JW6A 1MS0A 1S0EA 2A75A 4FPCA 1G8WA 1W6PB 5FREA 5JLVA 1W6NA 1CONA 3RQ0A 4XJ9A 3SH3A 4YW1A 3ZXEA 3O5SA 3AZYA 2D7FA 1GZ9A 4R9AA 3ZXJA 2A3WA 1LHVA 2DVBA 4AGRA 2D44A 1CR7A 1IS3A 1SLTA 3O0XA 2ZACA 2YMZA 3FLRA
chains in the Genus database with same CATH superfamily
2VZTA 1YC61 1OQ1A 3V0BA 5JVVA 2R073 4IERA 1HV0A 4Q0PA 4CDQB 4LBMA 3A0NA 4R9DA 1NUKA 2WAOA 2YBPA 4JGYA 1NA1A 1N1SA 1C8M2 5KHJA 3WOGA 4DNYA 4UOJA 4XUPA 3TEWA 3AZWA 4AHXA 2Y6HA 4GA9A 1D2QA 2XUEA 3I4IA 2I07B 4LNVA 3DYOA 2RS52 2O8OA 4R4XA 5C9AB 4XUTA 1LB2A 4PJYA 1QJZA 2JG9B 4DFSA 5FKBA 1XXNA 2GMEA 4UXAA 4AR2A 5F7UA 4NIIA 5JCTA 1YHFA 2GN3A 3W5MA 1RUF2 2VZ1A 1WKYA 4AL9A 4YFZA 2GC2A 2VMEA 3TWIA 2DCZA 3O1MA 2YG0A 5I91A 2V5DA 4NRQA 1PIV3 4BB3A 4JHTA 5D1IA 3RZKA 1CAUA 4PDWB 3MYXA 3BB6A 2NP0A 1VAMA 2QQIA 2HWF1 3FJSA 2VJXA 3NAPC 3WV6A 4BK5A 3K46A 2WA4A 1AX2A 5FJHA 5IT6A 4N7UA 3AJYA 1QJX1 1RXFA 2FZ1A 5F3IA 3MIGA 1UAIA 5FP9A 5CFCB 1DBNA 3CJIA 2JDNA 1BK1A 4D8MA 2PYTA 1XSRA 4HZFA 5SV8A 4AXOA 4QPGB 4P14A 4A44A 4PQ9A 1AR92 5T55A 4TWTA 2VZ3A 1ZBA2 1N1TA 1W06A 1WZXA 4CUBA 4N43B 3BTYA 5EYYA 1NZIA 1WWYA 3HN1A 4N53A 4CUCA 3HPNA 2VAUA 2R041 1ZBE2 4M3CB 4C1WA 1JZ3A 2C6SA 2HBTA 4OUSA 4IL7A 4ZXKA 3OBRA 3R0RA 4QB6A 3WF4A 5F3CA 1DGWA 1VBD2 1DZRA 1H2NA 2W1UA 2IXKA 1AXKA 1QXJA 3PDQA 3ETPA 4XQWA 2HWD1 3LA2A 5G04L 4IEYA 2I2SA 4YZ2A 1AHSA 1LOFC 2X05A 2AREA 2VY0A 2XJTA 4HONA 1FX5A 4KMQA 1W8TA 1AYM1 2ZS6B 3O0VA 4QX3A 5FV3A 2C24A 2RS32 4BIOA 2PMWB 2XOMA 1VBE2 3POSA 4JDOA 4P5HA 5JZGA 1TMF3 2R061 3VZMA 2C9AA 1ND3C 4AQ2A 3AXDA 3MF6A 5FMOL 3N3HA 4CTEA 2DURA 3BTXA 2HWB1 2WQ8A 1D4VB 3WP5A 2ZA9A 3AKTA 5EP9A 5IK5A 3TRSB 1YNAA 2B39A 1V6NA 4O9GA 1S4CA 1D4M3 1UMZA 1WW4A 4YLZA 5FLHA 3FMGA 3AZVA 3M70A 4CE8A 5KC6A 3AP7A 4XAEA 2BTVC 1OUXA 5C3SA 4IGPA 4COZA 1OPMA 1G9AA 2F6BA 3LEIA 4DS0A 2HJIA 4CEYA 2PQQA 4QX5A 4B1LA 5LY1A 1SLAA 3AP5A 4NE9A 1E5SA 3H3ZA 3QD6A 4LQRA 1GP5A 4IV3A 5IK8A 1N47A 1T6GC 1COV1 3ILRA 1W8UA 4IE0A 4Q4Y3 2JDAA 5CFDA 3OBAA 3V64A 3WDTA 4CCMA 4WM7C 3VHRA 1PX3A 5FZIA 3T1LA 1X9PA 3SXWA 3WY6A 4YVWC 4RGGA 1PO21 2HEVF 2YBSA 2KD7A 1LHUA 3LPGA 5ISLA 1RMU3 2Y0IA 2FQPA 5A1AA 5B4XA 4C0BA 3ITQA 3QBQA 2BW8A 3KZ4C 5FP4A 1U5YA 1RUG1 2PQSA 4D7YA 2X5IC 2XJVA 3WNPA 1F9KA 3PHMA 4NPRA 4ES8A 2UY8A 3ZSLA 4CXWA 3W21A 2E6VA 1GNHA 3LOIA 4OUEA 5EJZB 4LKSA 2B46X 2OXBA 2W46A 2ZAHA 3FL7A 2NZ9A 2PTMA 3KS7A 3B3QE 3JBG1 4OVEA 4XJWA 4D6SA 5FBJA 1JBCA 4AW7A 1UU4A 5E8AA 5LK5A 5A3TA 3U4SA 4OCTA 2ZEZA 5FZOA 4Z8BA 1NLSA 1N3PA 2JICA 1OC1A 1QKQA 1Y9MA 2GAUA 2Y34A 1OSGA 1HV1A 3MPBA 1D2SA 5A6YA 5B2GB 1RUE1 1YYNA 2XJSA 3VBFB 3VBRC 2A5ZA 3EHKA 4XDPA 4YG3A 3RFRA 1VMFA 5B4NA 3F2ZA 1TME2 2Y64A 2PAKA 1WBLA 1WLDA 1VBA3 3P3NA 4EE2A 3U0ZA 1ZRCA 4QHBA 2W39A 2BDRA 3J7MA 4AI1A 5A1FA 3IBMA 1LJ7A 2JB8A 2WYSA 1AR63 4JKKA 2UYBA 1L7LA 3NAPB 5I0DA 1ODMA 4XUNA 3ZYFA 3N7KA 3LKJA 5A7WA 2CAUA 1ZA4A 4RR3C 2JE9A 1S2BA 5FXZA 2D6NA 4ZU5A 4ARXA 1H4GA 1HRI3 4HLTA 3WCRA 1QXRA 4FQZA 5FFOC 4BLJA 4WV8A 4AEDA 4GQ7A 4Q4X1 5JSOA 2OKXA 4FFGA 1XNDA 1ASJ2 4CDUA 1QQP1 1ST8A 1IQAA 3IDAA 1TVGA 3KF5A 2XVGA 4HSLA 4XXAA 4G3YC 1GZTA 5FZ3A 4QHOA 4L9BA 2XPJA 3PU3A 5CKNA 1WLWA 4QX7A 1ZM1A 1MQTA 2RJ2A 1DZQA 2QUOA 1LR5A 5JXHA 3SMHA 1ENXA 1CESA 1RC6A 4AHZA 5JOWA 1OURA 4DOUA 2ZAAA 2XVLA 4FAHA 1XBFA 3MV01 1HQLA 2RM22 1BKZA 2BVVA 1BYHA 1UZYA 3INAA 1QJU2 3O14A 3P3PA 5FUNA 3WP6A 1G6NA 1FOD2 3N9QA 4PI2A 2DTWA 2WZR3 2IFWA 4PBOA 4XBQA 5CIRA 2EIEA 2EXHA 3JB8A 3R4SA 1UMHA 3J8F2 4A7YA 3BYWA 2LTNA 1HLCA 3O1PA 1L7RA 5DAXA 4Q2FA 5FZDA 2Q4SA 1RHI3 1NCRC 2P6CA 2R30A 3VBOB 4XCAA 3N35A 4XJ8A 2Z42A 4E4HA 4Q8LA 1LEMA 4M01A 5ACA3 5JSRA 5JSPA 1PGW1 1OA2A 1PM7A 4K8RB 2A3YA 4XFIA 5C8CA 1SFYA 2BNMA 3C7GA 4KU7A 1UY0A 3AKSA 3VL8A 3IT8A 5JXGA 4EYUA 5DZGA 3U07A 5A80A 4ZU7A 3GJBA 5ACA1 1L3JA 1FMD3 2B8MA 3HAGA 3N9PA 4LBQD 1ENQA 4GXLA 4P02B 1QNYA 2R071 2ZX0A 5LA2A 1PO13 3WD5A 4KWJA 3BVCA 3TOJA 1V00A 1HRV3 2CYFA 5A3OA 4FTSA 1NLQA 1V0AA 2PHDA 3GBWA 3QH7A 4YVWB 3BTZA 4IV1A 4J1WA 1IG0A 1OFSA 1VR3A 3KV4A 3VZNA 4AFBA 2CSGA 3PJQA 3ZX7A 4KQ7A 3EB7A 1XU2A 3ZLIA 2JB4A 4A7ZA 2A6XA 2NM1A 2KR2A 2VNRA 4MOAA 3IDEA 2DVFA 1OUSA 4F3JA 1WCQA 1BXHA 1DQ2A 4GD4A 4QKBA 5LY2A 4BQXA 3WNMA 1PM4A 4UW5A 1MZ6A 5FP7A 2DYCA 1HN1A 5FYHA 4I01A 2VZQA 1M4WA 2Q1FA 1WLTA 2YGLA 4AOCA 4BU2A 1PNFA 4AYUA 1DGWX 1IPJA 1VBC3 1POV1 1PIV1 1OD3A 3ATGA 3GGLA 2W1WA 4XYXA 5H9QA 4IETA 3TEXA 1KRIA 2DU1A 2B7YA 1UQXA 2OZJA 3KF3A 2PHRA 2DFBA 1OLQA 4RHV1 2HWF2 1DG6A 1Q43A 2D6KA 1V6JA 2RJKA 1OVPA 2VBDA 3UGGA 2XWBB 4DXSA 1V9U1 3HNYM 2YC4A 4RN5A 1QJX2 3AKQA 2K9ZA 5AC93 2PHWA 5CA6A 3MBWA 3SLIA 1RGSA 3VBRB 3ON7A 1C28A 3GF6A 3RMXA 3U10A 4DXTA 1W3XA 5K8SA 3IPVA 1ULOA 2BNOA 1FPN3 2J1RA 4AHYA 2ADDA 4MZUA 3EMRA 4WVZA 3MHZA 2VCMA 3SITA 4UFLA 1ONAA 2E26A 1GZWA 1B35A 2WZ8A 1LHWA 2ZGTA 4KWLA 2R042 3ES1A 4NVPA 4RQPC 5I93A 2WNUC 5FK8A 4YARA 5FY7A 4UW4A 1CAXA 3NJVA 3I8TA 5C71A 2FD8A 5JMCA 1QJY3 1MS1A 1X50A 2JDUA 4GALA 5FP3A 3KQRA 5FY9A 1CN1A 4CCOA 1NCQC 1UOGA 4K21A 3OEBA 1LGCA 4F7ZA 2HWD2 5LK7B 2WYFA 1H2KA 3SH4A 4B4RA 4TYSA 4EN9B 3Q8FA 5L7OB 4S2DA 4Y1XA 2E7AA 3T2PA 4WM8B 3AL5A 1ZRRA 3ZXAC 1F5JA 4H2AA 2XL9A 1SDWA 1ZZ6A 3WNLA 4CXYA 2VOWA 3V56A 4QXHA 5EV7A 1DYKA 2R062 1OOPA 4QPIB 4OHVA 5BNQA 3Q8CA 5I0RA 1LOGA 1YQ5A 2HWB2 1H8TA 2LROA 5BUVA 3ZR6A 2DCKA 3H8OA 3QOPA 4I0WB 4XMIA 4JKLA 4M3CF 1D4M1 1BVP1 4FOWA 4LUKA 1K3IA 1QXPA 3FUQA 2ZGOA 4Q29A 4RGKA 4XMAA 4BMEA 2DCJA 3G6JB 3BN6A 3UYJA 2E7QA 3SEEA 2RDQA 1W39A 3NL1A 5IJRA 2VQAA 4MV2A 5DXDA 2EF6A 2R1BA 1LAJA 1COV2 2DVAA 4IE6A 1WMFA 5BNOA 3GM8A 2KM2A 4NJ4A 4EWAA 2BQPA 1ULPA 4J6GA 4ZONA 5FDBA 2G19A 2QQKA 3MIEA 2ZEXA 1PO22 4D69A 1BMV1 3GBGA 3ZR5A 2BP6A 4LE3A 4UBHA 4I2OA 5GM0A 2TEPA 1VRBA 1CZSA 1K5MB 1RUG2 4JVAA 5FBZA 4EWDA 5F1RA 5JOZA 5HCHA 1BCXA 1O7FA 5EYXA 4FXKB 1RINA 1FNZA 2LUWA 2X53S 5KHHA 2J1VA 3N7JA 5EQUA 3APBA 4E2QA 5FPBA 3GCXA 2WS93 2XQRA 1HDKA 1I6XA 2QBXA 1UYPA 3H7YA 4Y22B 4HL0A 3JBG2 5EHDA 2P1BA 5C7GA 2RR13 4FPGA 2VMDA 3ECQA 5FJKA 2Y60A 4FTBA 1W28A 2ZMLA 2XBO3 5FZAA 1LOAA 2XKOA 2ZBJA 4DY5A 1MVQA 3GYDA 5ABJA 4LBNA 2OQ6A 2EAKA 4HXCA 2P34A 5FYCA 1GLHA 1RUE2 3OOXA 5T52A 3RSJA 5BNPA 3C8XA 4CP1A 2E63A 4YGEA 2QZ2A 3OYWA 3NVCA 5LA1A 3V0AB 3ALQA 4N9HA 4RSUA 2AUYA 1NZCA 3CDZB 4M4RA 5IYYA 2WFPA 4LLOA 3I3EA 1BK0A 2BWCA 2NQYA 4NIAA 1GWMA 3AP6A 1X8MA 5A7QA 2UWBA 2JE7A 2ZGNA 2GMPA 2O8QA 3AYCA 1UIJA 3E97A 3LCPA 4L92A 3N36A 4Y24A 1GOFA 1AR61 4W8JA 1S0BA 2A6YA 4W4ZA 4LA3A 4UBGA 5FQ0A 4XCBA 1D7PM 4HK9A 3USUB 2WABA 4K1YA 1DP0A 5D8AA 3ZN6A 3J7NA 1OKQA 1VAVA 1HRI1 2FMDA 3M8LA 3BPZA 3LSEA 1W6OB 3DF0A 1AL23 5SV5A 4CDXA 4COYA 1CWPA 4GMP0 5BPXA 2Y6KA 4Q4X2 3O1SA 2QE3A 5A7NA 4AGVA 3POWA 4QU1A 1QQP2 1JOPA 2BFUS 3KB5A 2YUEA 3TNQA 4WVVA 3LIHA 3D3AA 4CDWB 3WDVA 5IVJA 1HXS3 2YFZA 2D5FA 2EVXA 2ZPXA 4HN0A 4Q4V3 2RDNA 3WXPA 2LALA 2J22A 3LF7A 2WNUB 4QX0A 3FN9A 3ZFGA 4JGYC 1QDOA 4LPLA 2ENRA 1W8WA 1W8NA 4AQTA 1NCQB 3ZPOA 3WHUA 1XJAA 2FDKA 3ZSEA 2Q1ZB 1P8JA 1W03A 2OA2A 5FY4A 3I2JA 5FYUA 2VCCA 3VD5A 2BV4A 1OH3A 4QDRA 2WZR1 5JWPA 1W8HA 2MEV3 4C0HA 4BQYA 3AKRA 1FT9A 3SH3A 3VDDB 4YW1A 2VNVA 3VDCA 3KV9A 3O5SA 2D7FA 1X8EA 1UCXA 2HWC3 4R9AA 4NIGA 4A6SA 1EAH3 4DZGA 3AMHA 3CJXA 1YFWA 4QHZA 2WFF3 5GALA 1MPXA 1PGW2 4QWNA 2HYXA 1CAWA 4Y26A 3AMQA 3S57A 1SDDB 4LE4A 3PUHA 1PK6B 2P6HA 1IS4A 3M3EA 3JD73 3GDBA 3PTRB 4JGZB 4UW3A 2VQ0A 2E51A 3KT7A 4YG0A 5BNNC 2CHHA 4JAAA 1YLLA 3K4ZA 5ACA2 2VOVA 2ZGUA 4FFHA 1JYTA 4URAA 1A78A 4PHZA 5FCCA 2R072 1PO11 5HCBA 1JOBA 4A6OA 1JYVA 4CDQC 1HRV1 2GN7A 3WG3A 4TLFA 4YWAA 1G9FA 2R49A 1XPWA 2WLQA 2XR4A 2W2IA 5FY0A 3ZYIB 1V6LA 4ITCA 5JXJA 4NWVA 1K42A 1HQWA 3D0JA 2AACA 5C9AC 3E5XA 2RDSA 2JG9C 2GC1A 1KFUL 4ZHNA 4DUVA 2WINB 4XEZA 3MW4A 4QQOA 1V6IA 4I30A 1QNWA 2D3RA 3ZFFB 3MO4A 1AR81 1PIV2 1XYOA 4EN0A 5IVEA 1I1EA 4LHSA 1WA4A 3ILNA 4R8HA 4YPJA 4AVSA 2ZGMA 4RHV2 2RG4A 4MXWB 4QX8A 3VD9A 5A33A 2P5BA 4C91A 5C3OA 4IEQA 4YW5A 4AVBA 1OLME 1EV13 2JXAA 1V9U2 3PUAA 4BISA 4OHWA 2YV8A 3ZSKA 3NJYA 2B42B 2A70A 4I0AA 2JD9A 1JYXA 2R0HA 3C7EA 3DEMA 4IE5A 5DUWA 5JPNB 2ZX2A 3MIDA 1XYPA 3O7OA 3RYRA 1QU0A 4CEWA 3EO6A 2QVSB 1SBDA 1PGSA 2DF7A 5DAWA 4LBQA 1X7NA 2WT2A 1JMUB 4PQQA 4L0PA 3TBDA 3GALA 4XHBA 1C8NA 1UMIA 1GMMA 4XBNA 3P5BA 4U2AA 1ZZ8A 3AB0A 4COUA 4OI2A 4GH4A 1CX4A 1H9PA 4WZFA 1JOJA 2ORXA 4E4ZA 3ORJA 1FV3A 5CFDC 2R16A 2RV9A 2BWAA 5LATA 1W6QA 4DXZA 2JX9A 1UYYA 2EXJA 1DQ5A 1HX6A 3ACLA 3RVHA 4NRPA 4SBVA 3VV1A 5CG8A 4BQ5A 4UI9L 3RI9A 1CIYA 2OS2A 1YQCA 4H55A 3LPFA 3AP4A 3V0BB 4AVCA 3GNEA 3M3QA 2VG9A 1BLZA 1RUI3 4X6QB 3BGAA 3OD4A 3OUJA 2FZ2A 4RL7A 2I45A 1J1LA 3CIHA 3C7FA 4BE3A 5AFEA 1M06G 3D5OA 3RI8A 4XIOA 3WNXA 4HMZA 4JGYB 1AR71 5GZFA 2ET1A 4Y20A 3SKJE 5KHIA 3U1XA 4XHXA 5IVYA 3RJ2X 5T50A 2FCTA 5FR3A 1SCSA 4F8AA 1D4M2 4PF5A 1NYWA 5L36A 5HXVA 5IVCA 2W3JA 3Q8BA 1HB1A 3RZJA 1DF0A 2DCYA 2OT7A 1Q8PA 1SQ4A 4QGMA 1QDCA 3CL1A 1S0CA 1QGLA 2ARCA 2P3IA 1PVC1 1JYNA 1YFYA 4MSVA 5F6LB 1NE6A 2G4IA 1VALA 2PLV3 3SEPA 2X29A 4EZHA 5IVFA 1I3HA 3KSCA 3CZJA 1BMV2 2W52A 4UFJA 3T3YA 4PIYA 4S2FA 1NQDA 4B4PA 3KCXA 3VZOA 4LHNA 2JDZA 3ZYPA 4DINB 2RE9A 2CWSA 2G9FA 4RGAA 3LGRA 3OSDA 4UFKA 5EJ3A 4OYUA 1XNTA 1RXGA 2ARBA 3OG2A 4LT5A 4HBNA 3WF1A 1A8DA 5FLIA 5IHRA 2VTXJ 2WO2A 4FI9A 4DQAA 2W1QA 2WS91 3CNAA 3K3OA 2P3YA 1S0FA 4LKEA 4XABA 4I3GA 4OHYA 1EUUA 4QDQA 4YW7A 5FP8A 4BQWA 3UKVA 1REFA 2OVUA 4GB33 3Q8AA 5FZCA 4NWWA 4DEQA 1XNAA 3B01A 3L2HA 1MEC1 2VTFA 2FCUA 5GLWA 2OPKA 5L73A 2CGPA 2K0GA 4XFCA 1BBT1 4JCKA 3VBFC 5H9RA 5CISA 4HKWA 1UW8A 1H4HA 2QQPA 3WG4A 4AI0A 4PT6A 4S2GA 2P3KA 5KWRA 4PI0A 5F37A 2ID4A 4Y1YA 4QGLA 4QAWA 2JG8A 3LEGA 4JV4A 3CLPA 1IKPA 4MLOA 3VHPA 2ZXQA 1AR62 2MNGA 2CDOA 5D2AA 1UX6A 1NQJA 2VNOA 5BYNA 2DUQA 1UPSA 5FYVA 1POQA 2FMYA 3ZMNA 4BJ0A 5FYZA 5K0UA 4FVVA 1JZ6A 3URFA 1I5PA 1KJRA 1O8PA 1BVVA 5FZGA 1HRI2 5CVRA 4COWA 5C8CC 5KXCA 1AL21 4K20A 4RS5A 4BPZA 1WA6X 1VBB1 2KXLA 4CP9A 2Y38A 4XF3A 4IEPA 3GHMA 4HOOA 2FBEA 2CWMA 5LZ6A 2A6WA 3NRUA 1JU3A 3HD8B 2JKBA 1VPHA 2QZ3A 1UY3A 4IV3B 4RYDA 2YU2A 4Q4V1 1H1AA 4Q8KA 3IDCB 3AVRA 3SQOA 5CFDB 5FYBA 1BJQA 2D3SA 2VM9A 2XHNA 4GMP3 1OXCA 4CSWA 5JPMB 2K2SA 1DHKB 2BVBA 4Q0VA 2R6QA 3GZAA 1AYN3 2XH6A 4AQ6A 1DGLA 3TN93 1UKRA 1W8OA 3KV6A 3E1F1 5T5OA 3RG0A 2RJLA 3LDBA 4K40A 1RUH1 1UIKA 2GDFA 2R32A 2WZR2 5A7SA 2MEV1 2RS13 1A6CA 1I9RA 3AYAA 3N9NA 3FHIB 5A3PA 4FT8A 3SCHA 1OT5A 4XVHA 4YZ5A 1YWKA 4C8DA 2JD4A 3NKTA 1EAH1 2W08A 4GWJA 1XNBA 3VBOC 5FZHA 4IESA 2WFF1 3QH6A 4WVWA 1DCSA 4MGIE 4LO6B 1C57A 3AMNA 2A1XA 2AYHA 4X8NA 4YM1A 3MIFA 4YZ3A 1CZTA 5FZOB 3VHNA 4YG6A 2ZTNA 3NNFA 1N1VA 1SFPA 4OZXA 2XJPA 2RMU3 4L11A 4OQ8A 3JD71 5FPVA 4XFHA 1CVNA 2D93A 3IDBB 2VR4A 3WT3A 1YI7A 2WQZC 3SHRA 1WMXA 1A34A 2ZX1A 3M3CA 3L9JT 3VBUA 1JUIA 2VVFA 4IEUA 1PO12 4FPJA 5CYYA 5F2WA 2WL1A 3FWEA 5HCFA 1JYCA 4G9SB 1HRV2 3H42B 4FOYA 4OFGA 4P9LA 1UF2C 1GUIA 2ILMA 3HR9A 5A3MA 4CUAA 5A3UA 5T54A 4PBPA 5EIYB 5KBFA 3TNPB 1SCRA 4FPFA 4A3XA 5CFCA 2Q5TA 5F3GA 5FWEA 4CCNA 5J3UA 4PLOA 5CB7A 3UETA 3VBHC 2VW0A 2H0BA 4ZZ5A 4AEDB 1KS4A 2ETEA 1IS5A 3NKGA 1C4RA 3DXUA 1WW6A 4QPGA 3WR0A 1NLRA 4QD2A 4CDUB 3KVBA 2GSYA 1CD3G 2VECA 5A6XA 5C70A 4N43A 2TUNA 5L9BA 1CJPA 1ZVFA 5JI9A 5C3QA 5FK7A 1J59A 1AR82 2YXSA 2Z4FA 1MQTB 4H7MA 2E31A 4B3NA 1XE8A 5M0TA 2FDIA 1RUD3 3EXUA 4LIVA 1LOCA 4XF9A 4B4QA 1LNSA 2J1TA 1OOPC 4MH0E 2QQNA 3CQOA 1EV11 4HN1A 4OULA 2ZZJA 2JIJA 4Q4W3 3I3DA 4LBOA 4M00A 1Z7S3 1O4ZA 3W58A 3A4UA 3HQXA 1ZZCA 2JE8A 5KXDA 2D40A 3ZMOA 3SCFA 4YM3A 3I3BA 3KGLA 4AI9A 2EXKA 1TG7A 5CU1A 3THTA 4XUQA 4FPKA 4TN7A 1RVF3 4GAZA 3N9OA 5IVVA 3ZFEA 1D0HA 1JHJA 2C0ZA 1GZCA 3WDWA 3GCWA 1C8M3 4NHXA 4W6XA 5L9RA 4CP2A 5A3LA 3GZUC 4LITA 5C3RA 3DL3A 4FSJA 3ZYRA 4XTPA 1W90A 1ODNA 1RUOA 1APNA 5C8CB 5IK7A 2VZRA 4YW4A 3TAYA 3UT0A 2WIIB 5JOYA 1J3RA 2QJVA 2ZMNA 2H6CA 1GR3A 4OLLA 3DN7A 3WNKA 2XHKA 5EPAA 2ZKNA 2YROA 2N7GA 4KL1A 1DQ1A 4FOQA 4HPKB 3RPQA 3K4AA 3FBMA 5L7OC 1DQ0A 3WF3A 4WVMB 2Q8CA 3JQWA 4R9CA 5CAZA 1NE4A 1RUI1 1W8FA 4WM8C 3WEZA 3ST7A 2VCBA 4Y1UA 4EQVA 5FO7B 4YZ1A 1KFXL 3MW2A 5HCAA 1AR72 1YFXA 3VZLA 1CAVA 1F8VA 5GKAC 4XC9A 3WP3A 4QPIC 4FFIA 4FPEA 2WR9A 2YC2A 3DXTA 1JXNA 2BOIA 3H3LA 4IEVA 4K3UA 4KGGA 5FXWA 3U11A 4LA2A 2Y8KA 2YPJA 4L97A 3A23A 4A3ZA 1DGRN 1OF3A 3OJBA 3VD7A 1W6PA 1ZZ9A 3KM5A 3WUDA 1RJ7A 3LSDA 5ABJC 2OW4A 5A70A 3ETQA 3W59A 1Y7BA 1IS6A 1RUJ1 3AX4A 3AMPA 4KG8A 5CNAA 1W9YA 2VC9A 1JODA 1SFNA 4CU8A 3BOWA 5DN2A 4GJZA 5J37A 2Q0AA 5T5LA 1UOJA 1ZBE3 1PVC2 2GU9A 3D6EA 4Y5Z0 4ATEA 3BUCA 3C2UA 5FYTA 2VZSA 3KWVA 2PLV1 3BIEA 2UU8A 4AVTA 3VD4A 1VBD3 4E2GA 3DKWA 4PIXA 3WW1A 5FMCA 1JH5A 1QJEA 1UYXA 1MZFA 2IVJA 2VPVA 2Y26A 4HG6B 4XPVA 4A45A 4GKXA 3PTYA 1SEFA 5GJ6A 2PHUA 2XL7A 3AMMA 4MO3M 4EWEA 1BQPA 3IPVB 4RD7A 1SLLA 1LRHA 4Q1PA 3KCYA 2VMIA 1W9FA 4RA0A 1K5MC 5LA0A 4ZXEA 2CY6A 1KQRA 1FXZA 2O14A 3E5QA 1MVEA 1F15A 2WS92 3IWZA 4AF9A 3NAPA 1U5IA 1R1A3 3T0BA 3O12A 4I09A 1YRZA 2QQUA 4LBLA 3WCSA 4AZZA 3ZFGC 2WWJA 1GWLA 3N9LA 1MEC2 2XBO2 3ZSJA 1C1FA 3VBHB 4NO4A 3CMGA 3DPRA 3PMEA 1H2MA 3B7MA 1BBT2 2HBUA 2PA7A 3OCPA 3I49A 2V09A 3UJOA 1XC6A 4JTOA 2J1AA 4ZS2A 1Q8SA 2VMGA 4MHRA 5FZLA 1L7QA 4LULA 5A7PA 2DBNA 5EJ1B 2WNVC 3ABZA 3DGTA 3KHBA 2PN5A 4ASLA 1OOPB 3R6SA 2LW8A 3D8CA 4YM2A 3B69A 3A0KA 4H3WA 3HT1A 5KXEA 3H1YA 4CU6A 2EA7A 4HVOA 1LOFA 1ND2C 4B1MA 1AL22 2XGXA 3I7DA 2Y6GA 5C6CA 3O1TA 1VBB2 1LTEA 4UW6A 2JDHA 1ZREA 1QY4A 1GOHA 4TTGA 2IFRA 1OHFA 2RVAA 2IXJA 2LM3A 2ZHLA 1ND3A 3LD8A 1XNKA 4Q4V2 2A75A 4CDWC 4FPCA 3M7AA 4JRLA 5BNOB 3KLSA 3LDRA 1W6NA 3BI3A 4GMP1 1QH7A 4XJ9A 3RQ0A 1DDLA 4TSVA 1TE1B 2X09A 4QX1A 1PMJX 3J4UH 2ZCWA 1AYN1 3AZYA 1GZ9A 2QQVA 3ZOIA 3TN91 5A7OA 4AGRA 4QXBA 4L99A 4CCKA 1Y9QA 3O0XA 3MIBA 1RUH2 2XQXA 4LJHA 4IEZA 1TME3 2YMZA 5CG9A 2YC0A 2MEV2 3BIWE 4K7JA 2RS11 3P6BA 4M3CE 3H1WA 4WM7A 2GNBA 4MGZE 4ZU4A 3H9AA 3LEMA 4TLGA 3VDDC 1JI6A 2J1SA 1J83A 3NO8A 3OD0A 5FXVA 1EAH2 1E57A 1TMF1 4LO4B 1LHOA 2Z2SB 2WFF2 3UNPA 3T0AA 4NHYA 4LBJA 3OGSA 1SHWB 3MF9A 5ABJB 2X5IA 2ZKLA 2CU5A 1OD5A 2RMU1 2GMMA 2ZEWA 1PK6C 3JD72 3K48A 5BNPB 1OLMA 3RZLA 4JGZC 3OYWB 3H8RA 4OHZA 1UY2A 2C9KA 5C4WC 3ASIA 4NAMA 4EZ4A 5F8PA 3HVDA 1UXXX 1FATA 1WUVA 1N3QA 1XSQA 3OY8B 3UV9A 4Q4Y1 2GNTA 5A32B 5GZCA 3MFAA 1LESA 3IB3A 2ZGKA 2A6ZA 4O9EA 3WF0A 4D94A 2B9VA 1GWKA 2UWCA 4LUMA 5E1RA 5LCWL 3ZN6B 5D8AB 5FZBA 2ZX3A 1UU6A 1O3QA 2RM23 2HKXA 1RMU1 1ZYBA 5FY8A 3O1UA 5CKMA 2GZWA 1OKOA 1FOD3 1DYOA 4FFFA 4INDA 5ERLA 3VBSA 4E8CA 4H14A 4ASMB 4QXCA 1ZX5A 1R093 1STMA 5IWFA 1DZTA 1A8MA 3HNBM 1EYBA 2OUJA 1KEXA 3VDBA 1K5JA 3WNOA 3B9CA 5FZKA 3ZDSA 3ZKYA 3RDIA 4BQ3A 3ZFFC 1YQ8A 4RR3A 3ZDVA 1RUD1 1AXZA 4Y5TA 1GQHA 3ZFGB 1MZ5A 3VKNA 2BOJA 4JC1A 1DQ6A 2FDJA 2WQ4A 1JYWA 1EV12 3W20A 1NG0A 3FC0A 5A3NA 1REEA 2R7EB 1REDA 1G9DA 1Z7S1 1IPSA 4IGQA 4AE2A 1IPKA 3VL9A 1IHMA 3WDUA 4ISQA 4KGQA 3PIJA 4XACA 1VRH3 3IAQA 5DG1A 4Z07A 4OQ9A 4N7IA 4QDSA 2YY1A 3BOPA 1VBA1 4HVRA 3NNGA 4HT1T 4I0BA 2WNVB 4UAPA 1RVF1 2IXLA 4EN7B 4EV0A 1LKNA 1S0IA 2A3XA 3HN3A 1XOYA 3LA7A 1QJFA 5DZEA 4KU8A 2JIGA 1BHGA 3H1MA 4Z92B 3VN4A 1V6MA 1H6YA 3AXEA 4FO9A 2YDEA 4X6RB 2Q8EA 3WP4A 4NN0A 5FZMA 3MEPA 1ND2B 1WBFA 4MGQA 3PVBB 2XB6C 3H3UA 5A3WA 5EFUA 1AZDA 4XZPA 3AC0A 5FUIA 1VMJA 1S0DA 1QOSA 1KS5A 1UO9A 3O1RA 5FZ4A 4AEMA 1Q5OA 1FYUA 5IATA 2G9GA 3KT4A 4O61A 3BKZA 4LK7A 2D6PA 4HKLA 2A73B 1NCRA 1RUI2 2WT1A 2HWE3 3CHXA 4LIUA 1PZ9A 4DRVA 1R64A 1Y9GA 3TB0A 1NA1C 2WZEA 1G86A 1X36A 1G7YA 1QJX3 2DU0A 3AZZA 3OEAA 4ZY9A 4AEKA 4BXSV 2JENA 2XUMA 4QKDA 2QCSB 3NJZA 1HJGA 4HKOA 5DAVA 5LRRA 2GC0A 2J42A 3MLJA 4ZS3A 5FPZA 3POYA 5K9YA 1JZ4A 3DYPA 2WAAA 3ZYHA 1RUJ2 1S0JA 4PF1A 4CRQA 4MYEA 1PVXA 1UOBA 3K51A 5J98B 3SH5A 1ZZBA 4Y22A 5DMYA 3ZXDA 4Q0UA 5LASA 1F4HA 3KV5A 3BPSA 4BCUA 1HKDA 3NNLA 1V6KA 4P00B 4YGBA 2XJQA 1RHI1 2EXIA 4QQ2A 3T1MA 4QMAA 5DDJ3 2PLV2 5A33B 4JHZA 3DUIA 4ET7A 1NX9A 3E6BA 4P9JA 5TSWA 4LHLA 5AFBA 3ACHA 2SLIA 2BBVA 2HWD3 3KGZA 4N90A 3SISA 5K0UC 4XF0A 4QPWA 4HK8A 3VB9A 1UN1A 2V4VA 2ZZQA 1RTVA 5C5UA 3CJIC 3PUIA 3HMYA 4RS5C 2YPDA 4E8DA 5C4WB 1H0BA 1AYM3 4DEVA 3E5UA 2AENA 1FMD1 2VO5A 4LBQB 5J36A 1UPIA 2GALA 4FP3A 4YGCA 5AVAA 4YW6A 3TEZA 3OPZA 2Y6JA 2QDRA 1WMEA 5LBCA 1RYYA 1R1A1 1DLLA 1N3OA 5DUVA 1OBNA 4N53C 1OLRA 2CL2A 5GLTA 2HWB3 2WBKA 5JDBA 1W6QB 1KXGA 1OQEA 4Y1VA 3UESA 2E32A 3S5AA 2WNOA 2VXRA 1IZ3A 4OI0A 1E5IA 1K12A 4ZZ8A 1PX4A 4IXLA 4KBBA 1H1MA 4YFWA 4XTMA 3ZYBA 4DPNA 4FOVA 3KD4A 2EIBA 1VIWB 2F4LA 1W0NA 3B93A 3ZKUA 4AQSA 5DG2A 1FAYA 4GULA 3RYKA 3RZGA 1COV3 2CGNA 4X8PA 3VKFC 4GWNA 1VBC1 4RQPA 2WNUA 1IOAA 2DUOA 5JAXA 5KR7A 3ZSMA 2X10A 1SZBA 3D82A 3B5LB 5FO9B 4Y20B 5JR2A 1GANA 1BEV3 1C5HA 1W6MA 3OB8A 1PO23 4W65A 3RWKX 5C33A 5JZGC 1XU1A 2ADEA 2BPA2 5J96B 4LR4A 5AC91 1PGL1 3N4MA 1Q8VA 1ZRDA 1S2EA 3UJQA 4XQ4A 4UF0A 4FTEA 4J1XA 1YO8A 3V65A 1K45A 2W0XA 4JQTA 3M1HA 4XJZA 1F5FA 2RHPA 2XJUA 3I2DA 1FPN1 1QWRA 4YRDA 2ZGRA 5GZGA 4CEYC 4XW3A 1JZ7A 4BH9A 3DV8A 4DIQA 4IV3C 4B7KA 4XJUA 3U75A 1F35A 3OGRA 2PHXA 5FZ6A 1GBGA 1SG3A 2DCTA 2CDPA 5IFTA 2D3PA 4Y4YA 5EXOA 1CZVA 4QKFA 1QJY1 1VMHA 5FMOS 3T30A 1UWWA 1DYPA 1AYN2 1RUE3 1Q8OA 2PHFA 4QM8A 4WZCA 2VOXA 3VZJA 3SNMA 3TN92 4UFHA 4BZ4A 1YQ6A 1GKBA 2P37A 2WZPP 2XG3A 4Z82A 1CIWA 3WDXA 2ARXA 2AZ5A 4XFFA 4CA9A 2RS12 1KITA 5HV0A 1AVBA 3IAPA 1YIPA 1R083 3H8UA 3OGGA 4HFSA 1CGPA 2PHLA 1AJKA 5FMDA 4I3PA 1TMF2 1NA1B 3FX3A 5LBBA 2BGOA 5J48A 2BNNA 3ES4A 4XBLA 5IW0A 3FHAA 1LGNA 2VUCA 2GP5A 2W87A 2EALA 4DY3A 1HIXA 1GP4A 2H6BA 1OF4A 2RMU2 4O65A 3UL2A 5IAXA 3NWKA 3T2QA 5HXMA 1AX1A 4AI2A 1KGYA 3I59A 5FZFA 1FNYA 3ENRA 1JN2P 1NKGA 3ZM8A 3TYJA 4LORA 1Q8QA 4Q26A 4QB2A 3P1IA 4YW2A 5GLVA 5FWJA 5C3PA 2FDHA 1ULCA 3VUOA 4Q4Y2 4META 4MHUA 2LRPA 4BLIA 1D0GA 1GNZA 2F17A 3ZFEC 1CAUB 4CCEA 4P9IA 4R9BA 2DDUA 4JX0A 3HOBA 1ENRA 4UFMA 2IXHA 4CXXA 2HEWF 5K0UB 1W05A 3LDKA 4NHLA 1RUC3 1RMU2 1TNRA 2BBAA 4W6WA 3CJIB 3VGIA 4RS5B 2BFUL 2BEOA 3WDYA 4Q5OA 4AWDA 1Y4WA 3PMSA 4AEDC 4CP9B 5CEHA 3AP9A 1S55A 1R091 2VD7A 3AJZA 4JTNA 2VUAA 3PURA 4Q0QA 2OYZA 4BYYA 5JXIA 5F5IA 2A6VA 2A71A 4CDUC 2V72A 2P17A 1Y3TA 2QDNA 4N53B 4QPYA 4PLNA 1H8VA 3DYMA 3NV4A 4ZPIA 3POJA 1RUD2 2IXIA 2RR11 4AAXA 1MQTC 2HH9A 4L2NA 4YSFA 5LEJA 2LS6A 4QT6A 1X82A 4V2VA 2Y33A 3S5QA 1YUDA 1MZEA 2XBO1 1SACA 1WMDA 3CEWA 3FZ3A 3LE0A 4YZ4A 4F83A 3MLKA 2WDBA 4MADA 1Z7S2 1H9WA 1SPPA 2B45X 1DLCA 1GNYA 2V73A 4XILA 4BA6A 4BWOA 4OHXA 3U4XA 1DU3D 1TQ5A 3JQXA 5FMBA 1VRH1 3I3QA 1OI6A 1VBA2 5E16A 5C5TA 3RRDA 1U0AA 1NT0A 3JB4C 1RVF2 3JXSA 3ME2A 3VD3A 2DWRA 4LLFA 2VZVA 5FIXA 3WQBA 1US3A 3RZMA 1YJKA 4P9WA 5JZGB 4M4PA 3ZO0B 3UK9A 4DRRA 2CTVA 4ONUA 2JJ6A 1HJFA 3N9MA 1Z78A 2D6MA 3NQHA 1VJ2A 5GZDA 5FRAA 4YVSA 5D21A 1PZ8A 2YYOA 4LKDA 5IFPA 1J1TA 2VH9A 2Q30A 5DAPA 4YYOA 3UKTA 4CCJA 4B29A 3NV1A 3X29B 1GQGA 4LK6A 3S0MA 1QHDA 2JDYA 3ZIXA 3S30A 5I8SA 3VBUB 4CEYB 1F4AA 1WD4A 1POV3 4FPYA 5FYYA 5IAVA 4AVAA 2PELA 4COVA 2R1DA 2ZJCA 1HXS1 1LOEA 2UURA 3LFIA 3THCA 3WG2A 4A41A 2HWE1 2ZHMA 3ELNA 3H0OA 4RHV3 3QACA 2WO1A 3RS6A 1O3RA 3WHTA 3MI8A 2VOTA 3M3IA 4I02A 1V9U3 3LWCA 4XFGA 3HWJA 4HETA 1AF9A 3I2IA 5FLJA 2HEYF 4IV1C 3AZXA 5FYMA 4M0NA 2G1MA 4CZSA 5BNNA 2BZDA 3KQ4B 5FOJB 3ACGA 2KA3A 1W2TA 2CNAA 3GJAA 4CVUA 4A2UA 2WA3A 3DPRC 4YM0A 4IGOA 1NAEA 1S1AA 3OGVA 1SLIA 5FY5A 2QQWA 1AL0G 4XZUG 5ANNA 4CDQA 3GZEA 4KH9A 3LZZA 4L8QA 4EJRA 4OI4A 2HWC1 2YFUA 1TZOA 4TZDA 4LTAA 2AR6A 2NPIA 3B9IA 1RHI2 3FFZA 5DDJ1 1UYZA 4FBFA 5F5AA 1H30A 2VL4A 5BY5A 3ILFA 4BK4A 1RB8G 5C9AA 1KJLA 1NY71 1O6UA 2W5FA 3CO2A 4IEWA 3AFKA 2JG9A 3RGBA 2WRAA 2J1UA 1LECA 3VKLA 1JS9A 1NXD1 1MS8A 1RJ8A 5A1LA 3DCQA 2CAVA 3PJYA 5FYIA 1LENA 3RYPA 3WNNA 3S7IA 1FMD2 2HYKA 5BXXA 1MS9A 2X8KA 2QQMA 4P5YA 2P4EA 1MS4A 4NIDA 3WQ0A 2W47A 3USSA 4KWUA 3ZFEB 4CU9A 1O59A 4PDWA 1WW5A 1GV9A 1R1A2 4PLMA 5LBFA 1SLCA 2W91A 4ARYA 1B35C 1FV2A 2C1FA 2IXCA 5A7WB 1G9BA 5JI7A 4UFIA 4MX3A 2V5YA 3H7JA 4FQ4A 2YB7A 5F5QA 2NYYA 2BUKA 2EIGA 1ZZ7A 3I97A 4DUXA 4E4SA 4MGTA 3K4DA 5BV6A 4CYDA 4A42A 4D6RA 3AM2A 4UT5A 4XQDA 3MDPA 4IDZA 1YIFA 2Z79A 3D4KA 4YGDA 2XDVA 4XDQA 1QIQA 3EYPA 2DVGA 1IGOA 1LCLA 1VBC2 4BHPA 2GC3A 2PAEA 3MLLA 4M3CA 1LU1A 3MUY1 1ALYA 4RFRB 1CAVB 5FXXA 2MPFA 1BZWA 3SC7X 1H2LA 1UXZA 1BEV1 4URTA 4OMCA 2YGMA 3R4DB 5AC92 1PGL2 2JDPA 3HJRA 1JW6A 1H8TC 4MGKE 2OZ6A 2TBVA 4FCAA 1G8WA 1W6PB 4E27A 5JLVA 4MVTA 4GZ9A 5FO8B 4NMIA 1CONA 1HB2A 5I8TA 1QH6A 2EIDA 2YHJA 1FPN2 4B8EA 2XXZA 2ET7A 3ZXEA 5KHKA 4IUGA 3D0SA 4NR1A 2VULA 3ZXJA 1YEWA 2A3WA 1FI2A 2DVBA 2D44A 4Z2AA 1IS3A 2BGPA 4AGGA 4OI1A 1YJLA 1PMIA 2ZACA 5BNOC 2FDFA 5F9TA 1W2UA 2Z69A 3RMYA 2WWUA 3I2FA 1W8ZA 2RS53 1QJY2 4XE9A 4BDVB 1SMVA 2JKXA 5C8WA 2QTWB 2YZ4A 3O0WA 1LOBA 2RDRA 2WWSA 1RIRA 2WKKA 2B5HA 4JZRA 1RUF3 4QXKA 2O0OA 4KI5M 1ULEA 2A7AA 2P2KA 3VBSC 3VHOA 2WNEA 4XOGA 5JIAA 3I3MA 3LIGA 1E5RA 1IG3A 1EPWA 2UY9A 3WVJA 4AFMA 1O91A 4K1ZA 5KC5A 2W94A 1R081 2XMLA 3ZXFA 3T2OA 3K2OA 3NV2A 2VMFA 4AK3A 1LULA 4D3WA 3EQEA 1U5XA 4CPBD 3BU0A 4IV1B 4JRAA 1LEDA 1WGPA 2EAAA 4Y3OA 5J09A 4GIQA 5FAXA 3DPRB 5CADA 3TEYA 1C1LA 1CQ9A 2ZX4A 2ORZA 3AYEA 5DUXA 2ZHKA 1C5IA 2VGDA 1GSLA 2VUDA 5BNPC 1JUHA 1AR93 3IN9A 1ZBA3 2D43A 3Q8EA 3ZIWA 2BU9A 4DUWA 4NIHA 3BODA 3H50A 4R4ZA 4YNIA 1O4TA 4KBZA 4QQHA 1A3KA 4XFBA 1RL3A 4DXRA 1UOFA 5LRSA 4NUBA 2E7TA 3ZXKA 4ORFA 4B7EA 1LU2A 3IZOA 1UKGA 3I54A 3U37A 4XXPA 4D6QA 4KWKA 1GICA 1N1YA 1RUC1 3WLUA 5D8AC 3WG1A 3MIHA 3VBFA 2CV6A 3HEIA 4IQPA 3FBYA 3T2TA 4CDXC 3IM0A 5HI0A 1R092 4XFAA 3RZZA 4CU7A 2RS33 5L9VA 4K9SA 1LODA 4K8FA 2Y0OA 4RFT0 3MICA 1VBE3 3AK0A 1QOOA 3PVOA 1UY4A 1MR5A 1ND3B 1AJOA 2ZGPA 5ANQA 4CUGA 3AFGA 4XIKA 1GZWB 1B35B 3S7EA 2ZABA 3IMMA 2RR12 3HBZA 1Q56A 3H8XA 1UNBA 4UWDA 1W6NB 4GB31 1HW5A 1V70A 2JECA 4ISRA 4V2WA 4BIFA 1SBFA 5FZ8A 1CAXB 3ZYGA 3LAGA 5F39A 5FUPA 2IUWA 3FE5A 4XAAA 4BMBA 3K77A 3E6DA 1JTZX 2ZHNA 4HPKA 3W5NA 2NN8A 2W92A 4S2HA 3OTFA 4HVQA 4WVMA 5DAQA 1VRH2 4BQ2A 1W3VA 1OH4A 3GXUA 4WM7B 1I5ZA 4MGYE 1YFUA 4QB1A 2V4AA 4XETA 5KHGA 4Z2WA 2VU9A 4NOTA 3G7DA 3PLQA 3BALA 4FXGB 1CPNA 1XB9A 1H8TB 2WC2A 3HNMA 2AC1A 1YXWA 2VZPA 3ZN5A 4Q0SA 4JKMA 2X5IB 3DECA 1J84A 2OIIA 4QU2A 3POGA 4BOWA 3ZVXA 5KXBA 3CKHA 4XUOA 1JZ2A 3I2KA 4Y1ZA 2B9UA 1W2AX 5DUUA 3HT2A 4E4DX 1AR83 1X33A 3I2GA 3AKPA 2ARAA 2ATFA 3AL6A 4BQ1A 1HB3A 1HXS2 3VBOA 2DUPA 5H9SA 2HWE2 5LWBA 4IW3A 2ZGSA 3CZUA 3VLBB 2G9ZA 3O1VA 5J1XA 3FHQA 2VMHA 5F5CA 1ZA7A 4Q1RA 3ZPYA 3B94A 3VBSB 1EY2A 2O1QA 5FPAA 2VQUA 5K4LA 4JQRA 4BQ4A 2AEYA 3IKWA 2TNFA 3QCWA 4ES9A 5A6QA 5AVPA 4A4AA 1VLNA 3KMHA 1VE0A 5HPOA 5IUQA 1UZWA 2ES3A 4AVVA 2HWC2 4CCLA 4QKNA 4RR3B 1DFQA 1QEXA 3KVAA 4YVWA 3PL0A 5DDJ2 1O3SA 1UZZA 3LEKA 4KNCA 4Q27A 3VBHA 4Y4RA 5JMOA 5JOXA 2CGOA 1NY72 3Q9OA 3VDAA 1OQDA 1O3TA 3WUCA 5CZKA 3W9AA 3WW4A 1ASJ3 2YU1A 3T0DA 2HLEA 4M0HA 4NPLA 1AYM2 4YW3A 4CEWC 3WW3A 4LXLA 4OUMA 3MPPG 1C3HA 2R0FA 2XLGA 5T5PA 5FPXA 1DIWA 1AR73 2VXJA 4CP0A 2DTYA 2QKDA 2XKPA 5FZ9A 3L2YA 3T4VA 5JIUA 5L19A 5FQ0B 3MFCA 2FHRA 4GH4C 2D98A 3JCIA 1OFNA 3NV3A 3UGFA 2VVDA 3J26N 3JUUA 3BU7A 3F95A 1LHNA 2WO7A 2GNDA 1WCKA 1J3QA 2NLRA 1QOTA 2SBAA 3VBRA 1XQNA 3OBZA 1ULGA 1QJU3 3AVSA 3HQRA 4CDXB 1JU4A 3U78A 4C1XA 2GNMA 3OGJA 3N7LA 2PAMA 4GWMA 2ZMKA 3FLPA 1JHNA 4EN6B 1NOVA 3J8F3 2VVEA 2VE1A 3J7HA 3RJRA 4XDOA 1NCRB 3WQ1A 1IQDC 4DMIA 1PVC3 2OPWA 4GJYA 5T5JA 1O5UA 1ULFA 3GBFA 4XJAA 1S0GA 1KDMA 3NNMA 1BEV2 1E5HA 1XRUA 4AAPA 4FPHA 4ZKTB 2ZOEB 4G4FA 1QF3A 4FP2A 1CJDA 2WLPA 2WSUA 3B00A 1W0OA 4Q4W1 3OUIA 4JDMA 1XNCA 2J1EA 3CF6E 1NXMA 5L7OA 3JZVA 3S6PA 1J3PA 3BCWA 3MZHA 2W95A 1X9TA 4P9YA 5CBLA 3MW3A 4WM8A 5I0TA 3J9SA 2PXJA 3EJKA 4NRMA 2WT0A 2IWGB 3R05A 1MS5A 2XONA 1C8M1 2ZEYA 1WCUA 2D5HA 3IIIA 4QPIA 3PIGA 5LBEA 5FZ0A 2AGSA 1MEC3 1POV0 1W9SA 4V1PA 2Y6LA 3K3NA 2RS51 1CAWB 1F2NA 1U5ZA 1EPZA 5H9PA 1CX1A 2W1SA 3R4UA 1BBT3 3LB9A 4GWIA 5FKCA 3T09A 3RNSA 2D97A 2EICA 1RUF1 3WSOA 3PVNA 4QX2A 4LOSA 2VTXA 2WN2A 1JZ8A 1Z0HA 1WCDJ 3M4FA 1HB4A 4W50A 1T6BX 3OY8A 5FYSA 1LGBA 3OF1A 1R082 2IVIB 4WBBA 5FZ1A 5A32A 1B09A 1VP6A 3OUHA 4LMFA 1AXYA 3I2HA 2HWF3 4AFAA 1AUYA 4AFDA 2AEZA 1ZRFA 3UGHA 5F6KA 2E53A 2VQTA 4FPLA 1T2XA 2PHTA 1YCIA 4XF4A 3ZN4A 3KHCA 1F31A 4LKFA 4AI8A 5LEKA 1AX0A 2Y6FA 5DZFA 1HN0A 2BJSA 1OA3A 4LHKA 4PCRA 1WCSA 1K5MA 1VBB3 3MV11 2BYVE 2OUHA 1MS3A 2VOKA 4Y33A 5I0SA 1G9CA 1PZ7A 4MXVA 2WSVA 4QQLA 1AR91 2QNKA 1ZBA1 2QQOA 2P3JA 3VKMA 1UZVA 2WUHA 4AFCA 5IK4A 2GH2A 5APAA 1O5LA 4U36A 4RQPB 3SCGA 2ZGQA 2JG8C 2R043 3C7HA 1ZBE1 3I2OA 3U14A 2JDKA 2UWAA 1WLCA 2VBBA 2XVKA 1W6MB 1W9TA 2VBPA 4H7LA 3POBA 3A21A 2B4KA 3FLTA 4MGSA 4N9IA 3THPA 4BM8A 1VBD1 1XE7A 5EZWA 4W6YA 1ACCA 1RUC2 2XLFA 3ACIA 3THDA 3VZKA 1OPOA 2UYAA 3OBTA 4UF0B 2WN3A 3RZHA 1ULDA 4YVSC 1RUH3 3MUZ1 3PVEA 4CCCA 3GZTB 3V0AA 2QQJA 2BERA 5FTTC 5FZEA 1OMIA 3C7OA 3OPTA 5GZEA 4CEWB 4C90A 1W0PA 2VNGA 1VB4A 2VZOA 5GLUA 2DVDA 2RS31 2WNVA 2BRTA 5EWSA 1VBE1 2Z5WA 1R1ZA 4LEJA 3NMBA 4E2SA 2C26A 5F32A 5JR7B 2R063 1GU3A 4GH4B 2OX0A 5LA9A 5FPUA 3USUA 2F4PA 4GB32 4CPBA 4BXFA 2W9XA 3IMNA 1ND2A 3A7QA 4O7XA 2FDGA 3EBRA 1URXA 3T08A 4OZOA 2E9QA 4XF1A 1W6OA 5LB6A 3N7MA 5J7MA 1PHMA 1OVSA 4P08A 5A6ZA 3LFMA 4N8MA 1GQPA 3NSTA 2AH2A 5F3EA 2WJSA 2I74A 5FPLA 4EROA 3T4HB 4CDWA 4KG0A 2WO3A 1UY1A 2VW1A 5T3NA 1OA4A 2JEMA 3HQUA 3POIA 2L9LA 1O4YA 4SLIA 5I0UA 1RUNA 1WW7A 2ZGLA 4AEJA 4AG4A 5G05L 1UZ0A 4Y5SA 1US2A 1ENSA 5CKQA 2IC1A 4AHWA 4NROA 4LBKA 4UYBA 4DO0A 1NCQA 4NHKA 5I8YA 3NW4A 4ASKA 1ZRIA 2JDMA 2VMCA 5K7PA 1Q3EA 3E6CC 3ZXLA 3CBNA 1RUG3 1SBEA 1W9WA 3WZ1A 2JWPA 2ERFA 2W68A 5HV4A 4HANA 2D6LX 2NMNA 3I59B 1DQ4A 2Q1MA 3OPWA 3VDDA 4EN8B 3LA3A 1CPMA 1UD1A 1ZNPA 1W2OA 3MGUA 3VBUC 1V6OA 4D7SA 4Z1VA 3WW2A 1QMJA 3JBG3 3NJXA 1HQNA 3DKQA 2VW2A 2PFWA 3C3VA 2YBKA 2C5DA 4PDWC 2DFCA 3PUSA 1PK6A 4D0QA 4K6BA 5E89A 4JGZA 1GOGA 5CFCC 1YQ2A 1W99A 1EP0A 4QQPA 5C4WA 2FCVA 2XLAA 3WX5A 1XE0A 1GP6A 1W2NA 1TME1 1KD7A 1W04A 4IE7A 4JDNA 4QPGC 1JYIA 1KDKA 3ROUA 4E9KA 3WQ7A 4LOTA 2K46A 3M2MA 1H1IA 3QLQA 1SLBA 4GKYA 2NMOA 4P9GA 4N43C 2Q8DA 5IVBA 3LQCA 4QGNA 1VB2A 5LW9A 5HBAA 3BTAA 4MUVA 2QFEA 5FOBB 3O1OA 1Y43B 5DPNA 3A22A 3FFQA 5DQ0A 4D7TA 1EUTA 4IEOA 5JUVA 4QM9A 4IE4A 2BGCA 1GYKA 1RITA 3IIAA 2Q8OA 3ZYJB 2J7MA 4ATFA 2C4XA 1TEIA 4Q4X3 1SPPB 1UU5A 5E88A 4LO8A 2E33A 3CU7A 3LOBA 3FUOA 1ASJ1 1QQP3 1XYNA 5E6HA 1IKQA 3AYDA 2GP3A 4P9XA 3PU8A 4AI3A 4J25A 3WF2A 2MHFA 2XWJB 3ZFFA 3PNAA 4MG2A 2JG8B 1MACA 3HIFA 3ACFA 3K75B 5GLZA 3VKOA 2VUJA 3JU9A 4NAOA 4MXWA 1GFF2 1UL9A 4IEXA 5DABA 5FZ7A 1PMHX 2D6OX 2H0VA 3M3OA 4TXWA 2OQ7A 4PIZA 4FPOB 2VZUA 3J7LA 2RM21 1O8SA 4YVSB 2QQLA 1QJU1 4R52A 3UKNA 3RWNA 1FOD1 3KCCA 3KT1A 4LO5B 1RUJ3 2DBIA 1U12A 4FAGA 4NPMA 3ZXGA 4DB5A 5FY1A 1DGRA 1WD3A 2DV9A 3J8F1 4OMDA 5F2SA 3SKVA 1MS0A 3GHNA 1S0EA 2XJRA 1TNFA 3WINE 1JZ5A 1H6XA 1J58A 5FREA 4A7KA 1S2KA 2IZWA 4XURA 2GH8A 3POEA 1UX7A 4LO7A 1PNGA 2VCAA 3HBKA 1YI9A 4Q4W2 5BNNB 3B02A 1LHVA 4HSJA 3POFA 3PUQA 1CR7A 4CCDA 4NHMA 1SLTA 3NNJA 1VAKA 3FLRA
chains in the Genus database with same CATH topology
1OQ1A 3V0BA 5JVVA 2R073 4IERA 1HV0A 4Q0PA 4CDQB 4LBMA 3A0NA 4R9DA 4JGYA 1NA1A 1N1SA 1C8M2 5KHJA 3WOGA 4DNYA 3AZWA 4AHXA 4GA9A 1D2QA 3I4IA 2I07B 4LNVA 2RS52 2O8OA 4R4XA 5C9AB 1LB2A 4PJYA 1QJZA 2JG9B 4DFSA 1XXNA 2GMEA 4UXAA 5JCTA 1YHFA 2GN3A 1RUF2 4YFZA 2GC2A 3TWIA 2DCZA 5I91A 1PIV3 5D1IA 1CAUA 4PDWB 3MYXA 3BB6A 2NP0A 1VAMA 3FJSA 2HWF1 3WV6A 3NAPC 2WA4A 1AX2A 5IT6A 4N7UA 3AJYA 1QJX1 2FZ1A 3MIGA 1UAIA 5CFCB 1DBNA 3CJIA 1BK1A 2PYTA 4HZFA 5SV8A 4AXOA 4QPGB 4P14A 4PQ9A 1AR92 5T55A 4TWTA 1ZBA2 1N1TA 4N43B 5EYYA 3HN1A 4N53A 2R041 1ZBE2 4M3CB 4C1WA 4OUSA 4IL7A 4ZXKA 3OBRA 3R0RA 1DGWA 1VBD2 1DZRA 1H2NA 4XQWA 2IXKA 1AXKA 1QXJA 2HWD1 3LA2A 4IEYA 2I2SA 4YZ2A 1AHSA 1LOFC 2AREA 2VY0A 2XJTA 1FX5A 3O0VA 1AYM1 2ZS6B 2RS32 4BIOA 1VBE2 3POSA 4JDOA 4P5HA 5JZGA 1TMF3 2R061 3VZMA 2C9AA 1ND3C 4AQ2A 3AXDA 3MF6A 5FMOL 3N3HA 4CTEA 2DURA 2HWB1 1D4VB 3WP5A 2ZA9A 3AKTA 5IK5A 3TRSB 1YNAA 2B39A 1V6NA 4O9GA 5FLHA 1D4M3 1UMZA 1WW4A 4YLZA 3FMGA 3AZVA 3M70A 5KC6A 3AP7A 2BTVC 4COZA 1OPMA 1G9AA 2F6BA 4DS0A 2HJIA 4CEYA 2PQQA 4QX5A 1SLAA 3AP5A 3H3ZA 3QD6A 4IV3A 5IK8A 1N47A 1T6GC 1COV1 3ILRA 4Q4Y3 5CFDA 3V64A 3WDTA 4WM7C 3VHRA 3T1LA 3SXWA 3WY6A 4YVWC 4RGGA 1PO21 2HEVF 1LHUA 1RMU3 2Y0IA 2FQPA 4C0BA 3QBQA 2BW8A 3KZ4C 4D7YA 1U5YA 1RUG1 2X5IC 2XJVA 1F9KA 3PHMA 4NPRA 4ES8A 2UY8A 3ZSLA 2E6VA 1GNHA 3LOIA 2B46X 2ZAHA 2NZ9A 2PTMA 3KS7A 3B3QE 3JBG1 4OVEA 4XJWA 4AW7A 1JBCA 1UU4A 5E8AA 5LK5A 4Z8BA 1NLSA 1N3PA 2JICA 1QKQA 2GAUA 3MPBA 1OSGA 1HV1A 1D2SA 5B2GB 1RUE1 1YYNA 2XJSA 3VBFB 3VBRC 2A5ZA 3EHKA 4YG3A 3P3NA 1TME2 3U0ZA 2PAKA 1WBLA 1WLDA 1VBA3 1ZRCA 4QHBA 2W39A 4AI1A 3IBMA 1LJ7A 1AR63 2UYBA 3NAPB 3N7KA 3LKJA 2CAUA 1ZA4A 4RR3C 2JE9A 1S2BA 2D6NA 4ZU5A 1H4GA 1HRI3 4HLTA 3WCRA 1QXRA 4FQZA 5FFOC 4BLJA 4WV8A 4AEDA 4GQ7A 4Q4X1 5JSOA 1XNDA 1ASJ2 4CDUA 1QQP1 1IQAA 2XVGA 4HSLA 4XXAA 4G3YC 4L9BA 2XPJA 1WLWA 1ZM1A 1MQTA 1DZQA 2QUOA 1LR5A 3SMHA 1ENXA 1CESA 1RC6A 4AHZA 5JOWA 4DOUA 2ZAAA 2XVLA 4FAHA 1HQLA 2RM22 1BKZA 2BVVA 1BYHA 1UZYA 3INAA 1QJU2 3O14A 3P3PA 3WP6A 1G6NA 1FOD2 2DTWA 2WZR3 2IFWA 4PBOA 4XBQA 5CIRA 3R4SA 2EXHA 3JB8A 3J8F2 4A7YA 2LTNA 1HLCA 4Q2FA 2Q4SA 1RHI3 1NCRC 2R30A 3VBOB 3N35A 4XJ8A 2Z42A 4Q8LA 1LEMA 4M01A 5ACA3 5JSRA 5JSPA 1PGW1 1OA2A 1PM7A 4XFIA 2A3YA 5C8CA 1SFYA 2BNMA 4KU7A 3AKSA 3VL8A 3IT8A 5DZGA 3U07A 4ZU7A 5ACA1 1L3JA 1FMD3 2B8MA 3HAGA 4LBQD 1ENQA 4GXLA 1QNYA 2R071 2ZX0A 1PO13 3WD5A 4KWJA 3TOJA 1V00A 1HRV3 2CYFA 4FTSA 3GBWA 2PHDA 3QH7A 4YVWB 4IV1A 4J1WA 3VZNA 1OFSA 1VR3A 4AFBA 3PJQA 3ZX7A 4KQ7A 1XU2A 4A7ZA 2A6XA 2NM1A 2VNRA 3IDEA 2DVFA 4F3JA 1BXHA 1DQ2A 4UW5A 1MZ6A 2DYCA 4I01A 1M4WA 1WLTA 2YGLA 1PNFA 4AYUA 1DGWX 1IPJA 1VBC3 1POV1 1PIV1 3ATGA 4XYXA 1KRIA 5H9QA 4IETA 2DU1A 2B7YA 2OZJA 2PHRA 1OLQA 2DFBA 4RHV1 1DG6A 1Q43A 2HWF2 2D6KA 1V6JA 2RJKA 2XWBB 5AC93 1V9U1 1QJX2 3AKQA 2K9ZA 2PHWA 5CA6A 3SLIA 1RGSA 3VBRB 1C28A 3GF6A 3RMXA 3U10A 5K8SA 3IPVA 2BNOA 1FPN3 4AHYA 4MZUA 4WVZA 3SITA 1ONAA 1GZWA 1B35A 2ZGTA 1LHWA 4KWLA 2R042 3ES1A 4NVPA 4RQPC 5I93A 2WNUC 4YARA 4UW4A 1CAXA 3I8TA 5JMCA 1QJY3 1MS1A 1X50A 4GALA 2FZ2A 3KQRA 1CN1A 4F7ZA 1NCQC 4K21A 1LGCA 2HWD2 5LK7B 1H2KA 3SH4A 4B4RA 4TYSA 4EN9B 5L7OB 4S2DA 4Y1XA 2E7AA 4WM8B 1ZRRA 3ZXAC 1F5JA 2XL9A 1SDWA 1ZZ6A 2VOWA 3V56A 5EV7A 1DYKA 2R062 1OOPA 4QPIB 4OHVA 5BNQA 5I0RA 1LOGA 2HWB2 1H8TA 5BUVA 2DCKA 3QOPA 4I0WB 4XMIA 4M3CF 1D4M1 1BVP1 4FOWA 4LUKA 1QXPA 3FUQA 2ZGOA 4Q29A 4XMAA 4BMEA 2DCJA 3G6JB 2E7QA 1W39A 3NL1A 2VQAA 4MV2A 5DXDA 2EF6A 2R1BA 1COV2 2DVAA 1WMFA 5BNOA 2KM2A 4EWAA 2BQPA 4J6GA 5FDBA 3MIEA 1PO22 4D69A 1BMV1 3GBGA 4LE3A 4UBHA 4I2OA 5GM0A 2TEPA 1K5MB 5JOZA 1RUG2 4JVAA 5FBZA 4EWDA 5F1RA 1BCXA 1O7FA 5EYXA 4FXKB 1RINA 1FNZA 2LUWA 2X53S 5KHHA 3N7JA 3APBA 4E2QA 2WS93 3H7YA 1HDKA 1I6XA 4Y22B 4HL0A 3JBG2 2RR13 4FPGA 3ECQA 4FTBA 2ZMLA 2XBO3 1LOAA 2XKOA 2ZBJA 4DY5A 1MVQA 3GYDA 5ABJA 4LBNA 2EAKA 2P34A 1GLHA 1RUE2 3RSJA 5T52A 5BNPA 4CP1A 2E63A 4YGEA 2QZ2A 3OYWA 3NVCA 3V0AB 3ALQA 4N9HA 4RSUA 2AUYA 1NZCA 2WFPA 4LLOA 2BWCA 2NQYA 3AP6A 1X8MA 2UWBA 2JE7A 2ZGNA 2GMPA 2O8QA 3AYCA 1UIJA 3E97A 3LCPA 4L92A 3N36A 4Y24A 1AR61 1S0BA 2A6YA 4LA3A 4UBGA 5FQ0A 4HK9A 3USUB 4K1YA 3ZN6A 5D8AA 1OKQA 1VAVA 1HRI1 2FMDA 3M8LA 3BPZA 3LSEA 1W6OB 3DF0A 1AL23 5SV5A 4CDXA 4COYA 4GMP0 5BPXA 4Q4X2 2QE3A 4AGVA 3POWA 1QQP2 2BFUS 3KB5A 3TNQA 2YUEA 4WVVA 4CDWB 3WDVA 1HXS3 4Q4V3 2D5FA 2EVXA 2ZPXA 4HN0A 2LALA 2WNUB 3ZFGA 4JGYC 1QDOA 2ENRA 4AQTA 1NCQB 3WHUA 3ZSEA 2Q1ZB 2OA2A 2WZR1 5JWPA 2MEV3 4C0HA 3AKRA 1FT9A 3SH3A 3VDDB 4YW1A 3O5SA 2D7FA 1X8EA 1UCXA 2HWC3 4R9AA 1EAH3 4DZGA 3AMHA 3CJXA 1YFWA 2WFF3 5GALA 1PGW2 1CAWA 4Y26A 3AMQA 4LE4A 1PK6B 1IS4A 3M3EA 3JD73 4JGZB 4UW3A 2VQ0A 2E51A 3KT7A 4YG0A 5BNNC 4JAAA 1YLLA 5ACA2 2VOVA 2ZGUA 1A78A 5FCCA 2R072 1PO11 5HCBA 4CDQC 1HRV1 2GN7A 3WG3A 4TLFA 1G9FA 2R49A 2WLQA 3ZYIB 1V6LA 4ITCA 4NWVA 1HQWA 3D0JA 5C9AC 3E5XA 2JG9C 2GC1A 1KFUL 2WINB 4XEZA 3MW4A 4QQOA 1V6IA 4I30A 1QNWA 2D3RA 3ZFFB 1AR81 1PIV2 1XYOA 4EN0A 1I1EA 1WA4A 3ILNA 4R8HA 4AVSA 2ZGMA 4RHV2 4MXWB 5A33A 4C91A 4IEQA 4YW5A 4AVBA 1EV13 2JXAA 1V9U2 4OHWA 2YV8A 3ZSKA 2B42B 2A70A 4I0AA 2R0HA 5DUWA 5JPNB 2ZX2A 3MIDA 1XYPA 3O7OA 3RYRA 1QU0A 4CEWA 3EO6A 2QVSB 1SBDA 1PGSA 2DF7A 4LBQA 1X7NA 2WT2A 3TBDA 3GALA 4XHBA 1C8NA 4XBNA 4U2AA 1ZZ8A 3AB0A 4COUA 4OI2A 4GH4A 1CX4A 1H9PA 4WZFA 1JOJA 4E4ZA 5CFDC 1FV3A 2R16A 2BWAA 1W6QA 4DXZA 2JX9A 2EXJA 1DQ5A 1HX6A 3ACLA 3VV1A 4SBVA 5CG8A 3RI9A 4H55A 3V0BB 3AP4A 4AVCA 3GNEA 3M3QA 2VG9A 1RUI3 4X6QB 3OD4A 4RL7A 2I45A 1J1LA 4BE3A 5AFEA 1M06G 3D5OA 3RI8A 4XIOA 3WNXA 4HMZA 4JGYB 1AR71 5GZFA 2ET1A 4Y20A 5KHIA 4XHXA 3RJ2X 5T50A 1SCSA 4F8AA 1D4M2 4PF5A 1NYWA 5L36A 5HXVA 1DF0A 2DCYA 1Q8PA 1SQ4A 4QGMA 1QDCA 3CL1A 1S0CA 1QGLA 2P3IA 1PVC1 1YFYA 4MSVA 5F6LB 1NE6A 2G4IA 1VALA 2PLV3 2X29A 1I3HA 3KSCA 1BMV2 2W52A 4PIYA 4S2FA 1NQDA 4B4PA 3KCXA 3VZOA 4LHNA 2JDZA 4DINB 2RE9A 2CWSA 2G9FA 4RGAA 3LGRA 5EJ3A 2ARBA 4LT5A 4HBNA 1A8DA 5FLIA 4DQAA 4EN6B 2WS91 3CNAA 4OHYA 1S0FA 4I3GA 3UKVA 1REFA 2OVUA 4GB33 4NWWA 3B01A 3L2HA 1MEC1 5GLWA 2OPKA 5L73A 2CGPA 2K0GA 4XFCA 1BBT1 4JCKA 3VBFC 5H9RA 4HKWA 1UW8A 1H4HA 2QQPA 3WG4A 4AI0A 4S2GA 2P3KA 5KWRA 4Y1YA 4QGLA 2JG8A 4JV4A 3CLPA 1IKPA 4MLOA 3VHPA 1AR62 2MNGA 1UX6A 1NQJA 2VNOA 5BYNA 2DUQA 1UPSA 2FMYA 3ZMNA 5K0UA 4FVVA 3URFA 5C8CC 1KJRA 1BVVA 1HRI2 5CVRA 4COWA 5KXCA 1AL21 4K20A 4RS5A 4BPZA 1VBB1 2KXLA 2Y38A 4XF3A 4IEPA 3GHMA 2FBEA 2CWMA 2A6WA 3HD8B 2JKBA 2QZ3A 4IV3B 4Q4V1 1H1AA 4Q8KA 3IDCB 5CFDB 1BJQA 2D3SA 4GMP3 5JPMB 2K2SA 1DHKB 2BVBA 4Q0VA 2R6QA 3GZAA 1AYN3 2XH6A 4AQ6A 1DGLA 3TN93 1UKRA 5T5OA 3RG0A 2RJLA 4K40A 1RUH1 1UIKA 2GDFA 2R32A 2WZR2 2MEV1 2RS13 1A6CA 1I9RA 3AYAA 3FHIB 4FT8A 3SCHA 4YZ5A 1YWKA 2JD4A 3NKTA 1EAH1 2W08A 1XNBA 3VBOC 4IESA 2WFF1 3QH6A 4WVWA 4MGIE 4LO6B 1C57A 3AMNA 4X8NA 2AYHA 4YM1A 3MIFA 4YZ3A 3VHNA 4YG6A 2ZTNA 1N1VA 4OZXA 2XJPA 2RMU3 4L11A 3JD71 4XFHA 1CVNA 2D93A 3IDBB 3WT3A 1YI7A 2WQZC 3SHRA 2ZX1A 3M3CA 3L9JT 3VBUA 1JUIA 2VVFA 4IEUA 1PO12 4FPJA 2WL1A 3FWEA 5HCFA 1JYCA 4G9SB 1HRV2 4FOYA 4P9LA 4OFGA 1UF2C 2ILMA 3HR9A 5A3MA 5T54A 4PBPA 5KBFA 3TNPB 1SCRA 4FPFA 4A3XA 5CFCA 2Q5TA 5J3UA 4PLOA 5CB7A 3VBHC 2VW0A 2H0BA 4AEDB 1KS4A 2ETEA 1IS5A 3NKGA 1C4RA 4QPGA 1WW6A 3WR0A 1NLRA 4QD2A 4CDUB 2GSYA 1CD3G 2VECA 4N43A 2TUNA 1CJPA 1ZVFA 5JI9A 1J59A 1AR82 2YXSA 1MQTB 4H7MA 4B3NA 1XE8A 1RUD3 3EXUA 1LOCA 4XF9A 4B4QA 1OOPC 4MH0E 4HN1A 1EV11 4OULA 2ZZJA 4Q4W3 4LBOA 4M00A 1Z7S3 1O4ZA 3W58A 3A4UA 3HQXA 1ZZCA 5KXDA 2D40A 3ZMOA 3SCFA 4YM3A 3KGLA 2EXKA 3THTA 5CU1A 4FPKA 1RVF3 3ZFEA 1D0HA 2C0ZA 1GZCA 3WDWA 4CP2A 1C8M3 4W6XA 5A3LA 3GZUC 3DL3A 4FSJA 3ZYRA 4XTPA 1RUOA 1APNA 5C8CB 5IK7A 4YW4A 3TAYA 2WIIB 5JOYA 1J3RA 2QJVA 2ZMNA 2H6CA 1GR3A 4OLLA 3DN7A 2XHKA 2ZKNA 2YROA 2N7GA 4KL1A 1DQ1A