4YLZA

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lacto-n-neotetraose (lnnt)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ylzA00
3AZXA 1LGCA 3WDYA 2KM2A 2ZMKA 4Y22A 5GZFA 4AYUA 1BYHA 4FP2A 1VAMA 1IOAA 2SLIA 1BZWA 2XB6C 1QF3A 1AX0A 2PHFA 3USUB 1ENQA 3AFKA 1S0JA 3AYDA 1DLLA 5CBLA 1Q8VA 4R9DA 4FPKA 1G86A 1OFSA 1SACA 3O0WA 3AYEA 5GM0A 4Y1YA 1S0DA 2AR6A 2A71A 5JDBA 4Y26A 1AZDA 1DHKB 1KDKA 4XE9A 4XJ8A 1FAYA 1WCSA 1V6JA 1LGBA 1QDCA 2DVFA 1DFQA 1CVNA 3M2MA 2GN3A 2EALA 2GNTA 2W52A 2ARBA 4XDQA 1YIFA 3N7JA 4BMEA 5EYYA 4RL7A 4BPZA 3NV2A 3WCRA 1JYIA 3PVNA 3BTAA 4LBJA 4P9XA 4WZFA 4Y1VA 4XJWA 1NLSA 1DIWA 1HQLA 4LBLA 1EPWA 1U0AA 2FHRA 1CPMA 3C2UA 1UL9A 3WVJA 1OKQA 4Y1ZA 3WHUA 1BQPA 1VAVA 4BM8A 2EXIA 1DQ6A 3WOGA 2AH2A 3CNAA 1S0CA 1WD4A 5DZGA 3ZSLA 1W6NB 4M3CF 2GDFA 1YRZA 2D6LX 2ZGQA 1FV2A 3O5SA 3W59A 4DPNA 4Y22B 2OUHA 1UZYA 2CWSA 5DUUA 4CZSA 2W08A 2EF6A 1MS0A 3SH4A 1CIWA 5DZFA 2ZZJA 1LHVA 4NO4A 3IPVA 1WD3A 1IKPA 2WT0A 3INAA 5EWSA 4ZKTB 5BYNA 2A6VA 3PVOA 3OYWB 1QNWA 4UW3A 2ZGMA 1HKDA 4U36A 2GN7A 4GKYA 4YG6A 2CWMA 2DVDA 1LTEA 2VW1A 2RHPA 1FYUA 3IN9A 5JLVA 3HR9A 3M1HA 1KJRA 1LOGA 3NWKA 1GZWA 4DQAA 2ZA9A 3POYA 4AGVA 4LBNA 3SLIA 4R9AA 3ZSMA 4Q8KA 2ERFA 3JU9A 5CB7A 1MS5A 3OJBA 2WSUA 3FLRA 3ENRA 1URXA 3BOPA 2OVUA 1JOJA 4YZ2A 4R9CA 1S0IA 3O0VA 1LGNA 2P3IA 4M3CA 1LHNA 3UL2A 1I3HA 2D44A 4JRAA 2WLQA 4GWMA 4K1ZA 4DFSA 2CL2A 4YFZA 5LK5A 2CTVA 2P2KA 1ULGA 4JC1A 1BKZA 5GLTA 4XIKA 1AXKA 1PZ9A 2P34A 4XMAA 4YW1A 5SV8A 1RIRA 4ATEA 2ZGSA 3WUDA 4FPYA 5GZGA 3NV3A 1GZ9A 2DU1A 3WDVA 4I30A 4YZ4A 4YGDA 3RQ0A 3U4XA 1S1AA 5GZDA 5H9SA 2WKKA 2DTWA 3UJQA 1SBEA 4Q26A 4Y24A 2ZGUA 1MZ5A 1G9CA 1ULDA 5CA6A 1CR7A 4FQZA 1IS3A 4GXLA 2C9AA 1SLLA 3Q9OA 3QLQA 3MW4A 1G7YA 1SLAA 3OBRA 5GJ6A 4AVVA 3O12A 1I1EA 3ILRA 3IM0A 1CPNA 1MR5A 5T54A 3A0NA 3VKMA 2TEPA 3W58A 4C1WA 1IS5A 3AYAA 4YW4A 1JHNA 2ENRA 3N7MA 3WV6A 4YZ1A 1RITA 2DYCA 4Y20A 2P3KA 2UWBA 1CONA 5T5PA 1V00A 2E6VA 1WW7A 3APBA 5FRAA 5KXEA 2P3JA 2OUJA 3AYCA 3A0KA 3DUIA 4BQ1A 1SLTA 3R4UA 2EXKA 1FATA 1LOCA 4YM2A 1W6NA 4C1XA 1CJPA 1JW6A 4Y1XA 4YZ3A 4XMIA 5CAZA 2ZGTA 2GNDA 1N3OA 1UMZA 1QKQA 3ZXKA 1JN2P 3O0XA 1ULCA 1FX5A 1HDKA 3ZSKA 1O4ZA 3RSJA 1GLHA 2GMMA 3PMEA 5E8AA 1GBGA 3SH5A 1Q8OA 1X50A 4M3CB 4UW4A 2DVBA 1SFYA 2CYFA 2ZGPA 3ATGA 3OPZA 3UK9A 3OYWA 3LCPA 1SBDA 4XBLA 3VKFC 2NMNA 1QNYA 2ZBJA 1LJ7A 1MS1A 3NV4A 1AXZA 5DUVA 2W68A 2DURA 1IKQA 2ZACA 4FPCA 2Z42A 4P9YA 4XOGA 1C57A 2GMEA 3AJZA 1SLBA 1G9BA 2D7FA 1D2SA 3AXEA 1MACA 1Q8QA 1AVBA 3RMXA 2XG3A 4AWDA 4XJUA 3VKNA 2WT2A 3B01A 5GLVA 4M01A 5JOXA 1DZQA 3AXDA 4ISRA 2AENA 1GNHA 1ENRA 3ASIA 2EAKA 2B7YA 3A4UA 3BODA 1GKBA 1LHOA 4CRQA 2PHWA 1F9KA 2A3YA 3D6EA 5DXDA 1RINA 4Z8BA 1S0BA 3WG1A 3V64A 4FPLA 2D3PA 2D3SA 4PBPA 1Z78A 5F9TA 1C1FA 1SCRA 4Y20B 2YMZA 3ZXLA 1WBLA 3ZYPA 1V6MA 1VIWB 3B3QE 1WW6A 2DU0A 2DUPA 1LOFA 2ZGKA 4R9BA 5DUXA 4YW5A 4AGRA 3V0BB 3WDWA 2C5DA 1DYKA 1LENA 4DS0A 4M3CE 4FPFA 2OW4A 1KDMA 1IS6A 1DYPA 2E51A 1MS9A 3OBTA 1LEMA 3M3OA 1ENSA 1J1TA 1FV3A 1ZA4A 3D5OA 4FOYA 4LBOA 4PF5A 2ES3A 3AX4A 4XTPA 1MVEA 5KXCA 5T5LA 5CNAA 3WCSA 5GLUA 4ITCA 2G4IA 2ZHMA 5IK5A 2A3XA 3IMNA 4FP3A 3MW2A 2A75A 4KBBA 1LULA 4XJZA 1UN1A 3MEPA 4YW3A 2ZMLA 1QOOA 3OGGA 2VY0A 1UAIA 3AP5A 4F83A 2ZHKA 1R1ZA 4XTMA 3AP4A 3WDXA 1LU1A 5E88A 1B09A 1AXYA 2A70A 4TYSA 1CQ9A 3T1LA 5HCBA 1VLNA 2UURA 3D4KA 4NOTA 3AZVA 3WDTA 3H0OA 2ZGNA 5AVAA 1DQ4A 1V6KA 3B00A 1WBFA 4AGGA 1GSLA 2W39A 1FNZA 1N1TA 1W6PA 3PJQA 4LBKA 3AZYA 5L73A 5JVVA 1G9DA 3V0AA 1BJQA 3N35A 4W65A 3RS6A 2R1DA 2PHXA 5KXDA 2GALA 1ZM1A 3TAYA 2AGSA 3OY8A 1W0OA 5DZEA 3GNEA 1XQNA 2R16A 1WW4A 2WNEA 2WT1A 4YFWA 1C4RA 2E53A 1QOTA 3I8TA 1QDOA 2ARXA 5E89A 4GALA 3WG3A 2EXJA 4FVVA 5IK4A 2R0HA 1WUVA 4LBQD 2ZHLA 1HLCA 4P9WA 1TEIA 4XHXA 1CN1A 4XZPA 3R05A 1AX2A 5T5JA 3MPPG 3AK0A 4UW6A 1Y7BA 4XIOA 4DRVA 3FLTA 2R49A 1DBNA 4XHBA 5GZEA 4AVSA 5DG2A 4BOWA 1GNZA 4LBQA 2PHTA 4YM0A 4HANA 1S0EA 4WV8A 2P37A 1YXWA 3ZVXA 4OZXA 4LBMA 2WJSA 1BXHA 5GALA 5H9PA 4BLIA 2CY6A 1GANA 2ZAAA 1MS3A 2A7AA 2HYKA 3FUOA 3V0BA 2JECA 1HQWA 3AJYA 5T52A 1IS4A 4FOQA 1GYKA 1YI7A 1AJKA 3JUUA 1H9PA 2D6OX 2A6YA 2LTNA 2A5ZA 4CTEA 2NYYA 5IK8A 3ZXFA 1DQ5A 5T50A 4FPOB 3N7KA 3LSDA 5T55A 1W0PA 2ZKNA 5HCFA 5JMCA 2WQZC 4PBOA 1A3KA 1D0HA 2CNAA 2FMDA 1LODA 5EYXA 1NXD1 3KM5A 4PQ9A 3WUCA 3N3HA 5KXBA 2YZ4A 3M3QA 3MW3A 1N1YA 1F5FA 2JD4A 2VU9A 1A8DA 3HN1A 4IQPA 1JXNA 2NN8A 3SH3A 2PHRA 2WSVA 1W6PB 4YG3A 1V6OA 3V0AB 1LU2A 2R1BA 4Q2FA 1V6IA 1LESA 1UKGA 3OY8B 1W6MA 2VUAA 3WG4A 1LOFC 4UW5A 2VH9A 1MS4A 2D43A 3POSA 4ISQA 4XILA 2D6KA 1CESA 1F31A 2BQPA 2EIGA 2VW2A 3TB0A 2PELA 2E7TA 2GNMA 3RMYA 2D6NA 2UWCA 2AYHA 4FOWA 2AREA 3VV1A 5JOWA 1Q8PA 1WLDA 4K21A 1DQ2A 2V73A 1C1LA 3M3EA 4LBQB 3B9CA 1GICA 1MVQA 4YG0A 4Q27A 2VW0A 1ONAA 1KITA 3N7LA 4YM1A 5EXOA 4U2AA 4FPGA 4Y1UA 3RG0A 2DTYA 3SITA 1FNYA 3ZXEA 3SNMA 3WDUA 1YYNA 2DWRA 3AZWA 1QU0A 5GLWA 3B69A 3T2TA 4SLIA 1W6QA 1WLWA 1H30A 3GALA 4XXAA 1WLCA 1Q56A 3IKWA 2JDZA 3WNXA 3QCWA 1LOEA 2ZGOA 2DUQA 5F5QA 1QOSA 4M00A 2VXRA 1MZ6A 2DVAA 2Q5TA 3FUQA 3DGTA 2UWAA 3BIWE 3ILFA 1N3PA 4FPJA 4XJAA 4XYXA 5DG1A 1GV9A 2DUOA 3VUOA 1LEDA 2D3RA 2ZABA 1O4YA 5JOZA 2V5YA 1ULEA 4ATFA 4YGBA 2D6PA 4ZXKA 3SISA 3ZXJA 3M3CA 2ZGRA 3V65A 5JOYA 2UU8A 1W6MB 3WLUA 5GZCA 3ILNA 1V6NA 3AP6A 3N36A 2JJ6A 1AX1A 2DVGA 2GMPA 1V6LA 1QMJA 3AP9A 3L2YA 2NMOA 4XJ9A 1SBFA 3FLPA 1ULFA 1APNA 1W6OA 4XBQA 5H9RA 2A3WA 4AVTA 1G9AA 4WVWA 1AF9A 4ASMB 3I4IA 1QGLA 4YM3A 1A78A 4K1YA 4GA9A 2YROA 4GKXA 4XBNA 4FPHA 1LCLA 5GLZA 2JE9A 1SCSA 3R4SA 3AZZA 2GNBA 5T5OA 4FPEA 4D69A 1PZ7A 2A6XA 2ZMNA 4K20A 1JUIA 1UZZA 1SLIA 4HL0A 1KRIA 3LSEA 3USUA 2EXHA 4Q1RA 4L8QA 4RA0A 1UPSA 3ZSJA 1W6QB 3POWA 1KJLA 4JCKA 2I2SA 1LECA 1LOBA 1JYCA 3ZYRA 5DUWA 2ZHNA 4PCRA 1S0GA 1G9FA 1DQ1A 2JE7A 3UJOA 4WVVA 2YV8A 5H9QA 2LALA 1Q8SA 3WHTA 1PZ8A 3FFZA 1AJOA 2H0BA 3VKLA 2NZ9A 2D6MA 4DRRA 3RRDA 3AP7A 1S0FA 1H9WA 1KQRA 1UX6A 2ZGLA 2A6WA 1N1SA 4MYEA 3T1MA 4Q1PA 2PHUA 3HMYA 1LOAA 1LHWA 1N47A 2NM1A 5IUQA 1Z0HA 2NP0A 2E7QA 3WZ1A 1VALA 5IK7A 1OQ1A 1DQ0A 2JKBA 4P14A 1DGLA 4XXPA 3PVEA 3VKOA 4Q8LA 4BMBA 4YZ5A 4BLJA 1GZCA 2A6ZA 3IPVB 1WW5A 4FQ4A 5HCAA 2DV9A 3ZPYA 3NV1A 3KQRA 4TZDA 1W6OB 2YY1A 5IT6A 4YW2A 1N3QA 2SBAA 1LHUA 3WG2A 1YO8A 4FOVA 3FBYA 1GZWB 1SLCA 4YLZA 4YGCA 1JBCA 4GWNA 2R0FA 4YGEA 1G8WA 1MS8A 2YXSA 4H55A 5FREA 1N1VA 2AUYA
chains in the Genus database with same CATH superfamily
1OLMA 1LGCA 1YEWA 4IV3B 4ZY9A 3FN9A 1F4HA 4AYUA 1ULPA 4W8JA 2SLIA 4Q0PA 3NO8A 4BQ4A 2PHFA 1AX0A 3USUB 5LATA 4FAGA 4Z2AA 5FZKA 1DLLA 5CBLA 1E5SA 1X33A 3HEIA 4R9DA 5FLJA 3ZYHA 4FPKA 1AHSA 1XNKA 3M4FA 5FY7A 1W3XA 3I2FA 4Y1YA 1S0DA 3UESA 1XXNA 2A71A 2AR6A 2GC0A 4HN0A 1WCKA 5BNNA 2Y64A 4XUPA 4Y26A 4KH9A 2VBPA 4XE9A 4XJ8A 1H6YA 1QDCA 2RM22 2DVFA 3NJZA 4FXGB 4BQ2A 4DINB 4XDQA 2Y38A 1OVPA 3N7JA 4FFFA 3VD3A 3K48A 5F2SA 1TG7A 4P5YA 1VJ2A 2DCYA 3K2OA 3T0DA 1UF2C 5KHHA 2W94A 2Z79A 4RL7A 5BNOB 5K4LA 4KGGA 4MLOA 3LA2A 4CEYB 4WZFA 4P9XA 3K4AA 2PHDA 4RHV1 4SBVA 5JSPA 5F3CA 5FYCA 1U0AA 2FHRA 1OKQA 1XE7A 1H8TC 1WWYA 2XXZA 3WHUA 5IVYA 5FXZA 4UXAA 3WF4A 1DQ6A 4GJYA 4QAWA 4KG8A 1VBC1 5DZGA 3ZSLA 1W6NB 5HBAA 1FV2A 3W59A 1C5IA 2NQYA 2TNFA 1HQNA 5FCCA 1QEXA 4UFIA 5L19A 2HEVF 2V4AA 1MS0A 4EN9B 2PQQA 5DZFA 2ZZJA 1LHVA 3LEMA 4H7LA 4NO4A 1SQ4A 5J37A 1WD3A 2WT0A 2IXKA 5EWSA 5L7OC 1ZYBA 4JZRA 4DXTA 2JENA 1GOFA 3WD5A 2ZGMA 2ORXA 4CU8A 3N9PA 2DVDA 2VW1A 2RHPA 3L2HA 3GCWA 3HR9A 2XBO2 3JBG2 3M1HA 3NWKA 3O1UA 1FPN2 3VBOC 4DQAA 1UZWA 5BNNB 2OIIA 1A8MA 1W2UA 4HKOA 2WNOA 1UY1A 4MX3A 5A7OA 3KVAA 2VOTA 3LEIA 5CB7A 3BTYA 2JG8B 3OJBA 1UU6A 3IAQA 2WFF2 1RUG3 2BNMA 3AB0A 4C90A 1CWPA 2IFWA 4E8CA 2OVUA 1JOJA 1GMMA 1QWRA 1S0IA 3O0VA 4R9CA 3B7MA 3H1MA 1UU4A 5LWBA 5J09A 4H14A 2BFUS 4Z1VA 1PGL1 2WN3A 3VZNA 2ZX3A 4QKNA 4YFZA 5LK5A 2RR11 4UBGA 1ULGA 2E32A 4XQWA 4JC1A 3NW4A 1BKZA 5I91A 1XNDA 5GLTA 3D82A 4XMAA 5DAPA 5SV8A 4ATEA 4CEWC 1RIRA 4Q5OA 3NV3A 3U37A 3VBHB 2BBVA 4QXCA 1GFF2 4I30A 2CGOA 2DF7A 4PHZA 5K7PA 1S1AA 5H9SA 3SXWA 1J83A 5B4NA 4CYDA 2ZGUA 3LAGA 3H50A 2K0GA 1OURA 5CA6A 1CR7A 1H8VA 3LWCA 2C9AA 1SLLA 3Q9OA 4OLLA 3QLQA 3KMHA 4PLOA 3OBRA 2EAAA 1IGOA 3FFQA 3ILRA 4AHZA 4DMIA 2TEPA 2WABA 3IZOA 4YSFA 4QXBA 5JZGA 1PGW2 3ZFFB 2WO1A 1V00A 2E6VA 2XHNA 4PLMA 3APBA 4N7UA 4KBZA 5CZKA 3A23A 4YVWC 2GH2A 2GP3A 1VR3A 2JD9A 4HSJA 4B1MA 4BQ1A 3T09A 2PN5A 5HV4A 4C1XA 3SHRA 1JW6A 2D98A 2XKPA 2X10A 2IXCA 3O0XA 2ZTNA 2WAAA 5F8PA 2VNGA 1TMF2 2ZXQA 3DXUA 1GBGA 3SH5A 4AFCA 4CUGA 2DVBA 1SFYA 2WWSA 2ZGPA 1GOGA 3ATGA 3PUIA 3T2PA 3UK9A 4CP9A 2ZAHA 2NMNA 1MS1A 2ZKLA 5DUVA 1LR5A 5DMYA 2W68A 5FMOS 2HJIA 3O1OA 2ZACA 1NOVA 3K4ZA 5LBEA 2WFPA 1ZBE2 4CCOA 4DIQA 5FP8A 3PJYA 1QJX3 1W03A 4XOGA 3CJIC 2GMEA 1US3A 1SLBA 5C9AC 1CD3G 4W4ZA 3RMXA 4C91A 3GDBA 5FLHA 3U4SA 4XJUA 1NLQA 4OULA 3WEZA 4RQPB 5FZAA 4LEJA 1OF4A 3CKHA 2AENA 5HV0A 3NNJA 5F7UA 5FYVA 2HWC1 2CU5A 2VZUA 1RMU3 2EAKA 5IFPA 1VBE2 3A4UA 1LHOA 4Q4V1 4LKEA 4CRQA 2PHWA 4HVOA 1MZFA 5I8SA 4CU9A 3SCGA 3ZKYA 2KD7A 1PVC2 1SG3A 4M4RA 5FJHA 4Z8BA 2WL1A 4GMP3 1NA1B 1YCIA 2D3SA 2Y0OA 3ZMNA 4NMIA 1C1FA 4HVQA 3MIGA 3K77A 5C9AA 3I2GA 4A42A 3ZXLA 2GC3A 1LAJA 4NE9A 1WW6A 2ZGKA 1LOFA 3RZGA 5JMOA 5FO7B 4EROA 1RXFA 1AR83 3N9NA 5C6CA 1JZ5A 4LQRA 2VE1A 4M3CE 5IW0A 3DPRB 3ZFEC 1YQ6A 4CDXA 1ZZ9A 3OBTA 1EYBA 2XQXA 1LEMA 3M3OA 5GKAC 3DYPA 1RHI2 5F37A 5FWEA 1ZA4A 2XWBB 2OX0A 2VUDA 5J7MA 1QJY2 1WMXA 3AX4A 1NQDA 1MVEA 1W8WA 3O14A 5CNAA 4RGGA 4YWAA 5IHRA 1TE1B 2QE3A 5GLUA 4ITCA 2G4IA 4CP9B 1ZVFA 4D6QA 2D5HA 5F3GA 4CDUA 3I3BA 4GULA 4JGZA 2ETEA 4GQ7A 4XJZA 1UN1A 5FPVA 5FPLA 1QOOA 5CYYA 3VZOA 2VY0A 5HCHA 2G1MA 3AP5A 4F83A 5JPNB 4IGQA 4XTMA 1IG3A 1B09A 1GQPA 3TNQA 4WZCA 3WR0A 5FYMA 2A70A 2AC1A 3KD4A 1QJZA 4IEWA 2RE9A 5HCBA 2JDYA 4B4RA 1VLNA 3WNKA 5FLIA 1STMA 1XOYA 3OUIA 5SV5A 1R082 3FHQA 4FAHA 1K42A 4AAPA 3GM8A 3BKZA 1EPZA 1GQHA 2BDRA 3ON7A 1RMU1 3H8OA 1FNZA 1W6PA 1X9PA 2J22A 2XKOA 3AZYA 4LBKA 5L73A 3TYJA 4N43A 3V0AA 4W65A 2HWF3 5KXDA 1OH4A 3PUQA 4W6YA 2WDBA 1W8UA 2AGSA 4XEZA 5CEHA 3BGAA 4QU1A 4GMP1 5DZEA 1SHWB 4JVAA 2WUHA 2FCUA 5IATA 4IEPA 1L7QA 1C4RA 3WG3A 1RUF2 1H1AA 4JAAA 2QUOA 2VOWA 2VQUA 2XMLA 1KS5A 2D5FA 3ETPA 4JGYB 4WM7B 4P9WA 4XHXA 2ARAA 5DPNA 4CDXB 2QCSB 1RYYA 2Z4FA 3VN4A 1JZ3A 1PO13 4DNYA 2P17A 2VJXA 2R49A 1DBNA 4LOTA 4IE5A 1LB2A 1XYOA 2WS92 1DF0A 5DG2A 4BOWA 4LBQA 3K3OA 4FTEA 2UYAA 2BOJA 4HANA 4K7JA 4WV8A 1HN0A 2ET7A 1W90A 3C7FA 4BU2A 4LBMA 2VZRA 1H1MA 3WF3A 4JGZB 3I2HA 2YBSA 4GWJA 2X53S 3CQOA 5A7NA 4QPGC 2XH6A 3SMHA 4AI9A 4BWOA 3WW3A 1AL22 5A6XA 5CFDB 3H8XA 3I2OA 4L97A 1IS4A 1JU3A 5FYUA 1W8FA 5FZBA 2DDUA 3CF6E 4WM8C 2D6OX 4YVSB 4UFHA 4YNIA 2LTNA 3T0BA 1PNGA 4CTEA 1TZOA 2NYYA 4XFIA 4S2HA 5T50A 4FPOB 4CE8A 1B35A 3LSDA 4M4PA 3S7EA 4XCBA 5EFUA 2PLV3 4PBOA 5A32B 1A3KA 3RZHA 4XDOA 1LODA 2Y8KA 2XLAA 3F95A 3HAGA 3HNBM 3WUCA 3LD8A 4D0QA 5C4WC 3RI8A 3AKSA 3I3QA 3M3QA 2FDKA 1N1YA 1F5FA 1CAVA 1FI2A 4LT5A 2VG9A 1HXS3 2JIGA 3P5BA 3TN93 4Q29A 1W6PB 1W99A 2XJUA 3V0AB 3BPZA 1HJGA 4L9BA 3CZUA 4N43B 4Q2FA 1V6IA 4E27A 1NG0A 1YFWA 2MEV3 1BLZA 4AE2A 2WNUC 5FY5A 4WM8A 3MV01 1W6MA 2VUAA 2YU2A 3M3IA 3WG4A 2J1SA 1PHMA 5FYIA 4V2VA 1UNBA 2ATFA 4KNCA 4CUAA 1RTVA 4GIQA 2QQPA 4NIAA 2LW8A 1W9TA 4FTBA 2D6KA 1F31A 1MQTC 4E2SA 4AFMA 1EY2A 2EIGA 1OKOA 2GNMA 3EB7A 2D6NA 2WNVB 1YQ5A 2AYHA 2AREA 5CFCA 1Q8PA 4YW7A 5A6ZA 2CGNA 4K21A 1O3SA 1BK0A 1EAH3 2QQJA 1DQ2A 3M3EA 1PO11 5L9VA 2Y26A 4LBQB 3AMMA 5HI0A 4X6QB 1F8VA 3FWEA 4CDQA 4Q27A 3HQXA 2JG9C 3SEEA 4E2GA 4M0NA 2VW0A 3B9IA 1KITA 3AKRA 1NZIA 3ZXEA 3ZOIA 1ZBA3 2OT7A 2YYOA 1NLRA 4I0WB 2PAMA 1QU0A 5DDJ2 5ISLA 3T2TA 2YC2A 1JMUB 1IZ3A 4GJZA 1WLWA 4JHZA 4QM9A 3ZR5A 1WLCA 3AVRA 1Q56A 1SFPA 4CCNA 1LOEA 1B35B 3KQ4B 1O3RA 4M00A 1OPMA 5L9BA 4LO5B 3ACHA 2Q5TA 3FUQA 1YI9A 4HMZA 2HEYF 2PLV1 5BNPA 1ZRDA 2ADEA 4FCAA 2JG9A 1OA2A 3EXUA 5DN2A 2V5YA 1ULEA 1RUG2 1HXS1 4ZXKA 1XNBA 3TN91 5CKNA 1BCXA 3V65A 4HXCA 1UY0A 2ARCA 2PA7A 1W6MB 2DFBA 5E6HA 3U78A 2D97A 3WLUA 4F3JA 4NIHA 4EE2A 2YBPA 1DGRA 3N36A 3DYOA 4MGIE 2BWCA 1KS4A 3L2YA 2NMOA 2IUWA 1DZRA 1ZNPA 2YPJA 3WT3A 2X5IC 1W6OA 4CPBA 5LA1A 4AVTA 5FY1A 4ASMB 5CFCB 2JICA 4Q4X3 3T2OA 3VBRA 4IE7A 3UKTA 1VBB3 5EJ3A 4XQ4A 2VAUA 2NPIA 4GA9A 2V09A 4LE4A 4AFAA 2ZS6B 1W39A 4HLTA 1SCSA 1K5MC 3VDDA 2AACA 3A21A 1RUJ2 2GNBA 4CUBA 4D69A 1PZ7A 4CSWA 2V72A 1ODNA 2HWD3 1KRIA 3LSEA 3V56A 4Q1RA 1PIV1 2P5BA 3POEA 1ZBA1 4IEYA 3THCA 4RA0A 5CVRA 4JRLA 1KJLA 3ROUA 2I2SA 1LECA 2WINB 4JQTA 1COV3 1RUI3 4LHNA 2JDAA 5DUWA 3EHKA 4MADA 4UAPA 4MXWB 4BISA 3FX3A 5J1XA 3P6BA 1G9FA 1UOJA 4GH4A 3ACLA 4TLGA 3AL6A 2QZ3A 1VRH3 1DQ1A 5BNPB 1MEC3 1QJFA 1OLME 1QJU1 1Q8SA 1GP5A 1Z7S3 4QMAA 2H0BA 2BP6A 3VKLA 1K5JA 3VD9A 1NCQA 2P1BA 4E4HA 1RGSA 5JR7B 1N1SA 1PM4A 1QXPA 1MZEA 4B7EA 4Q0SA 3HMYA 4AOCA 4FBFA 2HLEA 2CGPA 4IV1C 1N47A 5IUQA 1YWKA 1VALA 1OF3A 3VKOA 3MICA 4DO0A 1J3PA 4YZ5A 3NL1A 1H0BA 2A6ZA 4AQ2A 2BERA 3RWNA 1QJX2 3IPVB 4MOAA 5HCAA 2ZEYA 1W6OB 4S2FA 4XFFA 3LDKA 2YY1A 5D2AA 1PO22 4TXWA 4DEVA 4YW2A 2XPJA 1F15A 3B93A 3VBRB 5C70A 4QQOA 3WG2A 2VZSA 4OYUA 2IXJA 3FBYA 4IE0A 4YLZA 2W92A 4Q4X1 2EIBA 4GWNA 4AQ6A 3UGGA 2O8OA 3IMMA 1G8WA 4CVUA 2CNAA 2AUYA 3AZXA 5A3MA 3WDYA 4IV1A 4Y22A 2ZMKA 3VDDB 5GZFA 1BYHA 1AR63 2ZZQA 4MGSA 4OUMA 1IOAA 4EZHA 3ACGA 1DP0A 2XB6C 4EN8B 1QF3A 5F39A 3U75A 2C24A 3G6JB 2HWD1 1Q8VA 1QQP1 3FC0A 2VOVA 2BNNA 1SACA 1COV1 2EVXA 4PDWA 1W8ZA 1AR82 3HQUA 3RJRA 1FAYA 2GC2A 5CU1A 4AHYA 3CIHA 1DFQA 3LA7A 5I0TA 2EALA 1VRH1 1JOBA 1W9WA 4DZGA 3WP4A 1MEC1 1YIFA 1NCQB 1Z7S1 4BMEA 1D2QA 5G04L 1RL3A 2WC2A 1FOD2 2PAEA 1AYN3 5F3EA 3RJ2X 3TEYA 2D93A 2IXLA 4AEMA 4UFLA 4LBJA 4HG6B 4MVTA 2E33A 1RUE3 1O8PA 4HVRA 3QH6A 3T0AA 4AVBA 3C2UA 4CDWA 4QKFA 3UGFA 1S4CA 4CA9A 1HRV3 4BM8A 3N9LA 2VTXJ 2EXIA 3VBFB 2J1VA 3X29B 1AR92 2WO7A 3FZ3A 2W91A 1WD4A 5FYYA 2A1XA 4HKLA 2ORZA 2ZGQA 5FMDA 4IV3C 1X8EA 4IUGA 3ES4A 5FTTC 2FD8A 4KU8A 4Y22B 1F35A 5D1IA 2CWSA 2RJLA 2Q1ZB 2W08A 3NKTA 3WNMA 1CIWA 4E4ZA 4L0PA 4LO8A 1UCXA 4C0HA 1I5PA 1WCDJ 4NIIA 1UW8A 3RI9A 1GQGA 4PQQA 2A6VA 1JH5A 3OYWB 5LA0A 1NKGA 1QNWA 1W3VA 1W8TA 2BV4A 2GN7A 4GKYA 4JV4A 4UW3A 4YG6A 4B4PA 4ZZ5A 3I3MA 5JLVA 2QQUA 1KJRA 2R072 4COVA 1CAUB 1REEA 2XR4A 1ND3A 4FXKB 1HIXA 2ZA9A 3BB6A 3POYA 4FFHA 2P4EA 4AGVA 1GZTA 3SLIA 4R9AA 4IV3A 1BVVA 1MS5A 2YB7A 3LA3A 2ZX0A 2WSUA 1BBT1 1RUH2 1L7RA 2VCAA 5FZOB 3BOPA 3LKJA 3GZTB 3HBKA 4EWAA 1LGNA 3UL2A 5B4XA 3DV8A 3I3EA 4JRAA 2B46X 4MH0E 4CEYC 1AYN1 4QM8A 2CL2A 3EO6A 4QQPA 3DN7A 3HOBA 4E8DA 1RUOA 1PZ9A 4J25A 4RR3B 4Y5SA 4HBNA 2E63A 4Q4Y2 5GZGA 1YLLA 1RUE1 4YGDA 4NPMA 4EZ4A 5LEKA 4CDQB 1XSRA 5GZDA 3RDIA 2BFUL 2WKKA 5K8SA 1SBEA 2WZR2 4Q26A 3HT2A 3Q8BA 4Y24A 1D4M2 5HXVA 1G9CA 4W50A 4LUMA 4FQZA 2VVDA 2L9LA 4QX0A 3E6DA 4HFSA 2XUMA 5BNOA 2HWE2 1G7YA 3FJSA 4RHV3 5ANNA 4RFT0 3CZJA 1UYYA 5GJ6A 1I1EA 5A3UA 4CEYA 1TNFA 4GB33 3H3LA 1BMV1 1UO9A 4KWKA 1MR5A 3VKMA 2FCTA 3W58A 1A6CA 3Q8CA 4N7IA 5F5AA 3VZJA 4C1WA 2B5HA 2VTXA 3WV6A 3N7MA 2MEV2 2CAUA 3J4UH 2LS6A 2DYCA 2RS33 2Z5WA 2B42B 4RN5A 2P3KA 4Y20A 3WW2A 1IHMA 1R092 4TN7A 1VBC3 1NY71 2HBTA 1T2XA 2FQPA 4S2GA 5KXEA 3NJVA 1JOPA 3OGJA 2OUJA 3AYCA 2K46A 3A0KA 2B39A 5BNNC 3R4UA 3LZZA 5FPAA 4Z92B 1FATA 1ND3B 4XFAA 1W6NA 3NNFA 5I8TA 5C5TA 3RZLA 2JG8C 4XMIA 3POJA 3SKJE 2GNDA 1N3OA 2J1AA 3C7EA 3PTYA 3AMNA 2WA3A 1M06G 5AC93 1GLHA 1EAH2 2E9QA 2GMMA 1BEV2 5AFEA 4I01A 3BU0A 4YPJA 4QHZA 4AI3A 2BOIA 1OQEA 4XZUG 1LJ7A 5EPAA 4WVMB 1AXZA 3ZN4A 4E9KA 2DURA 3POGA 3I59B 4I0AA 3E1F1 4IEQA 3D0SA 3U0ZA 2Z42A 3NJYA 3LQCA 4A41A 4P9YA 1YNAA 3VBHC 2VXJA 5JSOA 1VB2A 1U5YA 4XETA 4LUKA 3AXEA 1MACA 1Q8QA 3AMHA 4A7YA 4A7ZA 1ASJ3 2XG3A 2OPWA 1VBD3 4AWDA 2JG8A 4KU7A 3B01A 3BOWA 4OUSA 4LLFA 4LA2A 5IVVA 3JZVA 3T30A 5JOXA 1DZQA 3AKTA 5FMOL 4E4DX 2VL4A 2VQ0A 4AG4A 1OC1A 1AUYA 4NPRA 1ENRA 3ASIA 4G9SB 2RR13 4UT5A 2JDPA 1XSQA 4QXKA 3ALQA 4ARXA 5A3LA 3POIA 4CCDA 1DDLA 4GB31 3V64A 1NE4A 5IVBA 3KSCA 2Q30A 3VBHA 1HB3A 5FP7A 3WP3A 4CP2A 1VB4A 2BEOA 4XF1A 2VZPA 4Y20B 1TNRA 2YMZA 3PHMA 3WF0A 2Y33A 2RS31 2DUPA 4NIDA 1W9YA 1YQCA 2BUKA 1Y3TA 3OEBA 2C5DA 3V0BB 4IEXA 4MG2A 4QD2A 3BI3A 1PX4A 2VO5A 1HN1A 1L3JA 1MS9A 2E51A 3ZO0B 3KF3A 1DG6A 1ENSA 1UD1A 3D5OA 4FOYA 3VHPA 1VBB2 2ADDA 3UT0A 5FPXA 5ANQA 3HIFA 5KXCA 5AC91 5FV3A 2VMHA 1X36A 4LO4B 3LIGA 2CDOA 3ZFFA 2ZHMA 5IK5A 3D0JA 3IMNA 1UXXX 1PK6A 2RV9A 4MHUA 1LULA 4A4AA 1UAIA 5LBBA 2KR2A 4Q0UA 2BRTA 3VBSA 3KCYA 5IAXA 5E88A 2YPDA 5I93A 4RQPC 4CPBD 5CISA 4TYSA 4UF0B 2XLFA 3T1LA 3EJKA 1ASJ1 1VBD1 4QPYA 4YW6A 3ZIWA 5C8CB 4I02A 4J1WA 1DLCA 4PT6A 4ZS2A 1LKNA 4NOTA 3HNYM 2RDQA 1AL21 3DKQA 3WDTA 2GSYA 3H0OA 1JZ8A 5AVAA 3PDQA 3I3DA 4L11A 1GSLA 2W39A 1N1TA 2C1FA 4P5HA 4P08A 3PIJA 3WNNA 1NA1C 4QT6A 1SMVA 4YYOA 1BJQA 3PU3A 3WQ1A 3LFMA 3WW4A 5JZGC 2PHXA 4IEVA 2YG0A 1ZM1A 2R32A 4K6BA 4LA3A 3TAYA 2Y6FA 4P9LA 4AFDA 1OPOA 1VMHA 2UY8A 1V9U1 1W28A 2R16A 3OPWA 1EP0A 1POV1 3C3VA 4RQPA 2E53A 3I8TA 2VUJA 3LB9A 2ARXA 2HWC3 3CDZB 5IK4A 2VVFA 4FVVA 5IYYA 1OD5A 4Q4V3 5JXIA 4LHKA 1AYM2 3DPRC 4ZXEA 2ZHLA 4N90A 1TEIA 4BIOA 2JDKA 5T5JA 5K0UA 1VBA3 1RUC1 4UW6A 3FLTA 4PIXA 5JXHA 4V1PA 5GZEA 5FJKA 5IJRA 5A7PA 2WA4A 4UI9L 1G9DA 1NA1A 3D8CA 4MGKE 4YM0A 4QKDA 1S0EA 5I8YA 2P37A 3WQBA 1PX3A 2AEZA 2WZEA 4ZONA 2WJSA 1BXHA 1PK6B 1Q5OA 5A33B 2JIJA 3HN3A 1GANA 2VZQA 3NNMA 1MS3A 3AM2A 2HYKA 3FUOA 4QHOA 1UZVA 2JECA 3AJYA 4IE4A 5I0DA 1AR62 4IEOA 1QHDA 3MGUA 1H9PA 1WCQA 3VBSB 3DPRA 3WW1A 2A6YA 1ZRRA 3QACA 4B7KA 2A5ZA 4XAEA 4JTNA 5KBFA 4JDNA 5IK8A 3ZXFA 3HPNA 4J1XA 2ZKNA 5ACA3 2WQZC 2PQSA 4HT1T 3ZDVA 1C28A 4AI0A 2FMDA 2JWPA 4F8AA 3MIEA 1NXD1 1VE0A 3VDCA 3J8F3 3N3HA 5KXBA 2W46A 2YZ4A 1OMIA 1U12A 1UKRA 3AMPA 3IDCB 3ORJA 4D8MA 5FZIA 3SH3A 2PHRA 2CAVA 1ZZ6A 2D40A 4OI4A 2Y6JA 4YG3A 5FFOC 1RVF2 4CP1A 3T08A 2OXBA 1LESA 3R4DB 2PXJA 3NNGA 2Q8CA 3PUSA 5FDBA 2Q1MA 4LJHA 1WCUA 1LOFC 1SFNA 4KI5M 2TBVA 2VZTA 4AQSA 3MHZA 1O4TA 2D43A 3POSA 4O61A 4JGYC 1OVSA 1BHGA 2BVBA 1CESA 3CLPA 4WM7C 2OKXA 4CXWA 4Z2WA 3UKVA 2BQPA 4CDXC 2VW2A 5FY8A 2PELA 2VZ3A 4QB6A 3RMYA 4FI9A 5FY9A 1C8M2 5K0UB 3VV1A 4UBHA 1WLDA 1OBNA 3H1YA 3LOIA 2WQ8A 4RD7A 1VBA1 2V73A 1C1LA 3VBOB 4JKLA 4EQVA 1V70A 1GICA 2ZJCA 4CDUC 5FXWA 2QDNA 4JGZC 3MIFA 1DGWX 5LA9A 1R1A2 5EXOA 4AHWA 3O7OA 5CFDC 1TME1 2RS13 4Y1UA 2RS52 4HONA 3SITA 1Y4WA 4A3ZA 3SNMA 4CCKA 1YYNA 1EV11 5EIYB 5GLWA 3B69A 3MV11 5B2GB 4JGYA 3JB8A 4WM7A 5KC6A 4ONUA 1O8SA 4XXAA 1H30A 5LEJA 1RB8G 1W8NA 2LUWA 2RMU1 3QCWA 2ZGOA 4QX5A 2BJSA 4NAMA 1MZ6A 4MGYE 3J26N 1WMFA 5ACA1 3DGTA 2UWAA 3ILFA 1N3PA 3KCCA 4FPJA 4JKKA 4XYXA 5DG1A 1GV9A 2XJPA 2DUOA 1KEXA 3J8F1 2ZABA 1OFNA 3RGBA 4N43C 5CFDA 4BZ4A 4Q0QA 5FOBB 1RUD3 1Y9GA 2W1QA 1BK1A 3MLJA 3ZIXA 4YVSA 4C0BA 3LEGA 4LO7A 5IWFA 5GZCA 3I49A 1FT9A 3ILNA 5KHIA 5FZLA 3WNPA 3AP6A 4Y5Z0 2JJ6A 5EHDA 5A32A 3N9QA 2DVGA 2J1RA 2XL7A 2Z2SB 4DXRA 4OUEA 2GMPA 4UFKA 1QMJA 3AP9A 4P9IA 3T4HB 3RFRA 2X29A 1APNA 2OZ6A 2PHLA 4WVWA 5FOJB 2QFEA 3KB5A 5EJ1B 5F5CA 3ZXGA 3VD4A 1QIQA 4K1YA 3W5NA 3I2JA 3LIHA 1KFXL 5DABA 2B9UA 4BXFA 4GKXA 4HSLA 3UKNA 3MYXA 5GLZA 4JQRA 1F5JA 2DCTA 2VR4A 5A6YA 1AR73 3I2DA 2RJKA 3AZZA 4RHV2 4AVCA 4PF1A 5L9RA 2ZMNA 3U11A 3U07A 4XDPA 1ACCA 1CZVA 1SLIA 1UZZA 2AZ5A 2RS11 4HL0A 1DGRN 1POQA 1UPSA 1XC6A 3ZYIB 2Y6GA 3POWA 1BVP1 2ILMA 2PAKA 2WNVA 3GBWA 3NKGA 5FUNA 1B35C 2MNGA 1VBC2 2ZOEB 4GWIA 4L2NA 5FZ0A 3BUCA 3ZR6A 3OPTA 4PCRA 5KHKA 1S0GA 2VQTA 3HD8B 3OGSA 4A3XA 4WVVA 2IXHA 2YUEA 5H9QA 1YFXA 1PZ8A 3FFZA 4Q4W1 1AJOA 1FXZA 3GBFA 5A6QA 2Y6LA 4NRPA 2D6MA 3RRDA 4QPIB 5FUPA 5A3OA 3T1MA 2ZGLA 4MYEA 1XYNA 1DYOA 2QQWA 1FMD1 3KLSA 1RUD1 3OUHA 4W6WA 2NM1A 2WO2A 4DB5A 2NP0A 2R061 1DQ0A 4P14A 1O5UA 4NN0A 3FMGA 3PVEA 3JD71 4Q8LA 4XXPA 3BTZA 4BLJA 3I7DA 5CKQA 5D21A 4OMDA 5FBZA 3HJRA 4FQ4A 3ZPYA 3NV1A 3ZPOA 5CFCC 5FMCA 3JB4C 1S2BA 2SBAA 1LHUA 1GZWB 1JBCA 1JTZX 2C4XA 2R0FA 4YGEA 5JXJA 4CDQC 1PGL2 2YXSA 3KGLA 4OHYA 3MI8A 5FREA 5J98B 4AW7A 4BQ5A 2VZVA 2RR12 5EQUA 5FQ0A 1YIPA 1WA6X 3ZFEB 2KM2A 1JYVA 3IDEA 5DAVA 1JYXA 2NLRA 4FP2A 3C7OA 3KHCA 3ZM8A 1AR71 2R043 3BPSA 3K75B 1ENQA 3GYDA 3THPA 1YJKA 1ZA7A 4M0HA 1S2EA 1G86A 1F4AA 4K8RB 4MSVA 4JDMA 3O0WA 4RYDA 3AYEA 4N53B 2WN2A 1GP6A 3FHIB 4G4FA 1OSGA 5GM0A 4A7KA 4BB3A 1W0NA 2CV6A 5A7WB 4LKDA 1DHKB 1KDKA 2VOKA 5BNPC 5FO8B 1WCSA 1OOPB 3M2MA 4GAZA 3HNMA 1CVNA 2W5FA 2GN3A 3OSDA 2XJRA 5JPMB 1PIV3 3ZKUA 5FZ8A 3S30A 1XE8A 3LDRA 4BQXA 3URFA 5EYYA 2ZEZA 4A6OA 4Y3OA 4BPZA 3Q8AA 3WCRA 1JYIA 2ZX4A 4Y1VA 3IDBB 2HWB1 3VHNA 5J96B 2GU9A 2QBXA 3NAPB 3OBAA 1SEFA 3AVSA 4MXWA 4XPVA 1QJU3 3S5AA 4LBLA 3B5LB 1EPWA 4NJ4A 3WVJA 4Y1ZA 1BQPA 1OH3A 1VAVA 4D94A 3S57A 3VBRC 1ENXA 2BVVA 2AH2A 3PL0A 2B45X 3ACIA 1S0CA 3CNAA 4N9HA 5E1RA 4RGKA 3KV4A 2GDFA 2D6LX 4CCJA 2RM23 3O5SA 4FFIA 5F32A 3ZXJA 3VDDC 5FQ0B 3BYWA 2VCMA 4K3UA 4A6SA 2RDRA 2EA7A 3H3ZA 2FMYA 3KF5A 3O1MA 4S2DA 2DBIA 3I2KA 3CBNA 4IL7A 3HWJA 3IPVA 4AEDB 2BTVC 1IKPA 2WQ4A 5AFBA 5BYNA 2R041 5FY0A 2W1SA 2B9VA 2Q0AA 1JYNA 1VRBA 3DCQA 1HKDA 3Q8EA 1GWMA 3H8RA 3IN9A 2OQ6A 4LPLA 4CCCA 1LOGA 2RJ2A 2YHJA 1W2TA 3PMSA 3QBQA 3KWVA 4GH4C 3GF6A 1O7FA 1CZSA 4BE3A 3GXUA 4Q4V2 2E26A 5JCTA 4LBNA 5D8AA 3ZSMA 3W5MA 4MGTA 1DGWA 3E5QA 1XNTA 1UY4A 3FLRA 2G9GA 3VL8A 1NCQC 4LNVA 2QDRA 1XE0A 4LMFA 4G3YC 4J6GA 1CAWA 4OHXA 4BQYA 1HRI1 2J1TA 1QQP3 2QVSB 4MHRA 1XRUA 4BK4A 4M3CA 4E4SA 3MUZ1 1I3HA 4I0BA 4DUWA 4P9JA 5E16A 2BBAA 4DFSA 1C8NA 5FZFA 2P6CA 3AFGA 3PNAA 2CTVA 2YDEA 4HK8A 3ZDSA 4NPLA 1W05A 1AXKA 3OGVA 2ZGSA 3WUDA 1ZRIA 4XF3A 2XOMA 5L36A 3VBUB 3VZMA 5FPBA 1R64A 4YZ4A 3RQ0A 3U4XA 3H3UA 5LBFA 2OZJA 5HXMA 1E57A 2DTWA 2Q4SA 2XBO3 3JBG3 3UJQA 4DOUA 3J7NA 4NR1A 1FPN3 1MZ5A 2VOXA 3WNOA 4LXLA 1ULDA 4ARYA 4KG0A 3VDAA 3E6CC 5FR3A 4OMCA 4GXLA 3C7HA 3MLLA 3NRUA 1JYTA 3THTA 1VMJA 2F4PA 2E31A 3DEMA 4AVVA 2WFF3 2RM21 3O12A 4O7XA 3LGRA 1CPNA 5T54A 3A0NA 4AFBA 2Y34A 1IS5A 3AYAA 3OBZA 4N9IA 4YW4A 5FPZA 2ENRA 5TSWA 5A7SA 4YZ1A 5FK7A 1LNSA 3I97A 5FYSA 5FRAA 3VBFA 2P3JA 1U5XA 4RS5A 1Y9MA 4OHVA 4QGLA 4XVHA 4PDWC 5DAQA 5FYZA 4D3WA 1SLTA 3ABZA 4NROA 4EWEA 1LOCA 4UOJA 4A44A 4YM2A 1CJPA 4YZ3A 4LHSA 1RMU2 2G9FA 5CAZA 5D8AB 2ZGTA 3NVCA 1IPSA 4NHLA 2HEWF 3ZXKA 4O9GA 1ULCA 1FX5A 3OTFA 1HDKA 3OG2A 1JS9A 1O4ZA 3DF0A 3ZSKA 3VL9A 2Y6KA 4KWJA 1JZ6A 1CAWB 2YFZA 3PMEA 5E8AA 5C33A 4M3CB 4UW4A 4QPWA 4AEKA 3H42B 4CXXA 5LY1A 3OYWA 3VKFC 1SBDA 3IWZA 4MV2A 2ZBJA 1PM7A 3ETQA 5FBJA 2GP5A 4FPCA 1KFUL 3M7AA 3EMRA 3WXPA 1CAUA 1PMJX 4QB2A 5IAVA 2XVGA 4CDWC 2HKXA 3JQXA 1C57A 1GWKA 1LRHA 3AJZA 3WY6A 1G9BA 2D7FA 2B8MA 5EP9A 3USSA 1AVBA 3ZN6B 1ZZ8A 1BBT3 4OQ9A 2OYZA 3VKNA 2WT2A 1WGPA 2V4VA 4YRDA 4EJRA 1HB2A 3OD4A 5GLVA 2XJVA 2JDHA 1OLRA 5F6KA 5FZOA 5LK7B 3AXDA 4ISRA 2RG4A 3JBG1 2XBO1 4Z82A 3CJXA 1FPN1 1NCRA 2QNKA 2J1EA 4AHXA 1GKBA 4JX0A 4Y5TA 4XCAA 5BUVA 1F9KA 2A3YA 4X8NA 2FDFA 5DXDA 1TMF3 3RZKA 4XUOA 4RR3A 2X8KA 2IXIA 2WFF1 1S0BA 2PFWA 3WG1A 4FPLA 3ZFGB 5M0TA 2D3PA 3D3AA 1Z78A 3FL7A 1SCRA 2FBEA 1WBLA 3ZYPA 1V6MA 1VIWB 4R9BA 1ZBE3 4RS5B 4YW5A 4IDZA 4BH9A 3RYRA 3SCFA 1ND3C 1XNAA 4NWWA 4XURA 1DYKA 2BPA2 4NHYA 2VGDA 4XACA 1JHJA 5IVJA 2P6HA 1KDMA 1UU5A 2CDPA 1ODMA 3DKWA 2QQVA 3RZZA 4QX8A 1W04A 1FV3A 3WF2A 4PF5A 4LBOA 2ES3A 1CZTA 4XTPA 3GCXA 4O65A 2HWF2 4LK7A 2XWJB 3WCSA 3MFAA 4AR2A 4XFCA 3UNPA 2A3XA 2W1UA 5G05L 3TBDA 4C8DA 2A75A 2XGXA 1X7NA 3MEPA 4DUXA 3MPBA 1PVC3 2A73B 2XQRA 5FY4A 3RNSA 5DAWA 4Y4RA 3E5UA 2DFCA 5FXXA 3P3NA 4FT8A 1OUXA 5BXXA 2G9ZA 2ZHKA 1R1ZA 4QQLA 1NYWA 5LW9A 5F3IA 3MLKA 1D7PM 4KQ7A 3QD6A 4XQDA 4NHMA 1AXYA 4FFGA 2XJTA 3P1IA 1PGW1 1PO12 4TWTA 5FZ4A 1E5IA 4MO3M 1PGSA 4URTA 1H2LA 4K40A 3D4KA 5BNOC 1NCRB 1CAXB 4CU6A 2WWUA 2UY9A 2DCZA 1V6KA 2BGPA 4WVMA 1RHI3 3I59A 2WIIB 3RPQA 5A70A 1QJY3 5JVVA 2F6BA 3IB3A 3HVDA 3N35A 2R1DA 5JWPA 3KVBA 3T2QA 4LK6A 1TMF1 1W0OA 1Y43B 3VD7A 2WLPA 4PI2A 4V2WA 1OA3A 2VZ1A 1NT0A 4PI0A 1WW4A 2WNEA 2VD7A 3R6SA 4YFWA 5FZHA 4BIFA 1QOTA 2Y60A 1QDOA 5FYHA 5E89A 4GALA 1ND2A 3UGHA 5KHGA 2K2SA 3GGLA 1UXZA 2PLV2 1ZBE1 1WUVA 4LBQD 2FDHA 1HLCA 1XYPA 3R05A 1AX2A 1ST8A 3MPPG 5C5UA 4XIOA 1HXS2 3TN92 2V5DA 1OA4A 3ZYJB 4O9EA 1GNZA 5CKMA 1YC61 3T3YA 2XL9A 1H2KA 1ZX5A 1YXWA 5FMBA 3GHNA 2JX9A 2H6BA 5GALA 4BLIA 1VBE1 5DAXA 1QXJA 2HYXA 2A7AA 1YUDA 1MPXA 5A3WA 3V0BA 3H7YA 5T52A 4NVPA 4NRMA 1PVC1 1AJKA 3JUUA 4K9SA 4LORA 4RGAA 1I9RA 3ZYFA 1DQ5A 1H4HA 5BNQA 3N7KA 1UOFA 5T55A 5JMCA 2WYSA 1UMHA 1D0HA 3KGZA 3L9JT 2EIDA 3NJXA 4URAA 5J36A 3KM5A 4IETA 4PQ9A 1UYPA 2XVKA 3VD5A 4MXVA 3K3NA 4IQPA 2JD4A 2VU9A 1A8DA 3HN1A 3A22A 1JXNA 1UYXA 2X09A 3BVCA 1PIV2 2WS93 1ZBA2 1LU2A 5JI7A 3VLBB 1I5ZA 1RHI1 3ZMOA 3EBRA 5C3SA 2P3YA 1L7LA 1QJY1 3CU7A 2C6SA 2OQ7A 4H2AA 5T3NA 4P02B 4UYBA 4GD4A 4UF0A 4ZU4A 5I0SA 2VH9A 3IT8A 1V0AA 1AL23 3GZAA 5C8CA 4Z07A 3MO4A 1ND2B 1NQJA 3W21A 4ISQA 1QJU2 5A1FA 5ABJB 1JUHA 1YQ8A 5A80A 2UWCA 4JKMA 5JOWA 2VMDA 2ZPXA 1O5LA 1EUUA 4AZZA 4QB1A 4CUCA 5FZ9A 2QQNA 1V9U3 3ZFFC 1MVQA 1OT5A 1POV3 2VNVA 4YG0A 3TOJA 4ZZ8A 5IFTA 4BCUA 1PK6C 4LE3A 1R081 5FKBA 4B3NA 3N7LA 4BXSV 5IVEA 4U2AA 4ZU5A 1K3IA 2LRPA 3RG0A 2DTYA 3U10A 3WDUA 4HETA 4PIZA 2O1QA 3ACFA 3A7QA 3IDAA 3VBSC 4XUTA 1RUC3 3JQWA 4SLIA 5C3QA 2W2IA 4NHXA 1W6QA 1EUTA 1YQ2A 4D7TA 2E7AA 4NHKA 3IKWA 1ZREA 2WRAA 2JDZA 4Q4X2 2DUQA 1UMIA 4TSVA 3EYPA 1REDA 4LKFA 4XF0A 5F5QA 2VXRA 2BWAA 2IVJA 1RUF1 3AKQA 2YGLA 3ST7A 3BIWE 4BK5A 4XJAA 3TEXA 1S2KA 3GZUC 2D3RA 5A33A 3ZXAC 2G19A 3MIHA 2TUNA 2XONA 4IEUA 4QDRA 4ATFA 1RUNA 4QGNA 2VNRA 4YGBA 4ZS3A 5KR7A 1RJ7A 1QQP2 1UOGA 2HWD2 3DECA 3M3CA 2JE8A 2WS91 2ZGRA 1E5HA 1QH7A 1J1LA 4HN1A 2JXAA 3IAPA 4AXOA 4KWUA 2DBNA 1COV2 2MHFA 1RUI2 1V6NA 4MUVA 2J7MA 4H7MA 1AX1A 5DDJ3 3RZJA 5LY2A 1CGPA 2BNOA 3FLPA 1VRH2 1ULFA 5K0UC 2W0XA 4XBQA 4ASLA 1H8TA 4AVAA 1MEC2 2A3WA 2QTWB 5C3OA 4CXYA 1AF9A 1Z7S2 1VAKA 2VMCA 3I4IA 3MUY1 2FDJA 1NUKA 4OVEA 4QX7A 1UY3A 2OPKA 2I07B 4XBNA 1DCSA 1OI6A 4UWDA 3KZ4C 4COWA 2WR9A 2CHHA 1YJLA 2JE9A 4XAAA 3UYJA 1XBFA 3OF1A 1GUIA 2W9XA 5T5OA 2A6XA 5F6LB 1A34A 4XFBA 4K20A 5FZCA 1HB4A 3RWKX 4D7SA 4XC9A 4LULA 3BU7A 2VM9A 1W6QB 3ECQA 3ZSJA 4JCKA 4B8EA 5IVCA 5L7OA 3E5XA 1LOBA 2XLGA 3W9AA 3ZYRA 2FCVA 4LR4A 3I2IA 3VBOA 4DY5A 3OGRA 1TME3 2K9ZA 2WWJA 5APAA 4ZPIA 4TTGA 1F2NA 5LCWL 1EV13 4GMP0 4FTSA 1ZRFA 2NZ9A 4INDA 4HK9A 4DRRA 3AP7A 2JDMA 4B29A 1H9WA 4QX3A 3VGIA 1KQRA 4ASKA 3WX5A 4NIGA 4CCEA 2YGMA 5AVPA 1S55A 4OHWA 2RMU3 3TWIA 1LHWA 1HW5A 2E7QA 3OUJA 1RUJ3 1J59A 5FZ6A 2H6CA 1W9FA 4BMBA 4XFHA 1HB1A 3O1VA 5FZ7A 4CEWA 1SDDB 4D6SA 2XJSA 4KL1A 1JI6A 4META 1WLTA 2Y6HA 2DV9A 5DDJ1 2FZ1A 1O6UA 1H8TB 1BBT2 1JZ4A 5LASA 5FXVA 5IT6A 5JUVA 2R7EB 1N3QA 5J3UA 5JI9A 1JYWA 1SLCA 1UX7A 1CX1A 1OUSA 4AL9A 3ZX7A 2VPVA 1AYN2 3JCIA 2WLQA 3GBGA 3Q8FA 4LKSA 1K45A 2VBDA 4COUA 1VAMA 1BZWA 1RUE2 1RUG1 2XHKA 3AFKA 5EZWA 1S0JA 3AYDA 1SPPA 3HT1A 3NMBA 1NE6A 4Y33A 3POBA 5L7OB 2WO3A 2FDIA 1QY4A 1HRV2 1OFSA 1WKYA 3T4VA 3TEWA 3MIDA 3OCPA 3PIGA 4D6RA 3KT1A 4QXHA 4YVWA 4IE6A 5JDBA 4EN7B 1AZDA 3AMQA 1T6BX 2KXLA 1V6JA 1H2MA 1LGBA 2Q8DA 5BV6A 1PO23 1BMV2 4DY3A 3JXSA 3LOBA 4QPIC 2GNTA 2W52A 2ARBA 2ZCWA 4QDSA 1ZZBA 1HJFA 3ZLIA 2VMGA 1VPHA 4YVSC 4PIYA 3EQEA 1NY72 1KXGA 3PURA 3VZKA 1XPWA 2J1UA 2QQOA 3NV2A 4OI0A 4LTAA 4QWNA 3PVNA 3BTAA 3ZYBA 3MF6A 4I3PA 3SEPA 4XJWA 2EICA 1RUJ1 1NLSA 1DIWA 3S6PA 4XUNA 4CEWB 5A3TA 5JZGB 1HQLA 5BY5A 4Q4W3 1CPMA 3BCWA 1UL9A 2QKDA 3CJIA 4QX2A 3CEWA 4BA6A 2YC0A 1I6XA 3WOGA 1WMEA 3DYMA 5ERLA 4Q0VA 4QPIA 4DXZA 2WBKA 1FMD3 3ZYGA 1IPJA 2I45A 4XF4A 4M3CF 2XJQA 1YRZA 2R063 4XF9A 3R0RA 4XW3A 3KT4A 5EV7A 1JODA 2Z69A 3DL3A 3ITQA 3JD73 4DPNA 2GC1A 2JDUA 3CO2A 5CADA 2OUHA 1UZYA 4IESA 5DUUA 5F2WA 5FP4A 4CCMA 2EF6A 1M4WA 4CZSA 1W2AX 1O3QA 3SH4A 4DXSA 2BGOA 3B02A 1FOD3 1CIYA 2XDVA 4QDQA 3INAA 1J3QA 4W6XA 4ZKTB 5CG9A 3PVOA 1SPPB 2WNVC 4U36A 2CWMA 2VULA 1LTEA 1FYUA 4N53C 5KWRA 1XB9A 4OI1A 4E2QA 1GZWA 3SQOA 4YVWB 2VBBA 4FO9A 2LROA 1OOPC 2AEYA 2QQLA 5FKCA 1QJX1 2VVEA 4Q8KA 4RFRB 2ERFA 1H1IA 3JU9A 3ZFEA 4XUQA 1AR93 4GB32 2VMFA 1PO21 1URXA 3ENRA 5FIXA 1XJAA 2DCJA 3O1SA 1IQDC 4LITA 4UFMA 4COZA 2YFUA 4HZFA 2P3IA 1LHNA 2D44A 3VZLA 3WQ7A 4LIVA 2RS32 4GWMA 4LO6B 4K1ZA 3U14A 5A7QA 4AI8A 5LRRA 1JZ7A 2P2KA 3NAPC 4N53A 3N4MA 4XIKA 2P34A 5I0RA 4YW1A 1KD7A 5FP9A 4I2OA 1OHFA 4IEZA 2Y0IA 4FPYA 5A7WA 4IXLA 4R8HA 4K8FA 5F1RA 1GZ9A 3CJIB 3FHAA 4NWVA 2DU1A 3WDVA 5C9AB 1OOPA 2N7GA 4OQ8A 1X9TA 4ET7A 1UYZA 2R073 2ZX1A 2Q8EA 1GU3A 2QJVA 5AC92 3IIIA 5FZEA 1IS3A 2IC1A 3VB9A 3ZXDA 4P9GA 3MW4A 1AR81 2HWB3 1SLAA 5KHJA 3C7GA 1RUH3 3IM0A 4JHTA 2VQAA 1WMDA 3KS7A 3NAPA 4AEDC 4IERA 1E5RA 2X05A 1JHNA 2W47A 2W87A 3VHRA 1RITA 2BW8A 1ZZCA 1FOD1 2RDSA 1ASJ2 1CONA 2UWBA 1VBD2 3LF7A 1UWWA 5T5PA 4AEJA 4CDUB 1Q3EA 1WW7A 4HOOA 1W2OA 1AL0G 3DUIA 4IGOA 2EXKA 4Q4Y3 1U5ZA 5FP3A 1ULOA 1W06A 4Y1XA 4A2UA 4DEQA 3SC7X 4CCLA 1UMZA 1QKQA 5FZ1A 1UIJA 1JN2P 2WZR3 4L99A 2OA2A 1GR3A 2F4LA 1O3TA 1D4M3 2GH8A 5FK8A 1GWLA 4JTOA 2MPFA 4N8MA 2Q8OA 3RSJA 3BIEA 2DCKA 5C3PA 1AR91 1Q8OA 1X50A 4AEDA 2CYFA 1V9U2 2HWE3 3OPZA 2PMWB 3LCPA 4XBLA 3NV4A 1GNYA 1QNYA 4QX1A 4YZ2A 4LHLA 1IKQA 1W9SA 4OCTA 1DU3D 1YHFA 3PTRB 3RVHA 2IWGB 4QQ2A 4QPGA 4TLFA 1H6XA 4LLOA 3VBUC 1D2SA 1RUC2 1R093 2HWF1 3RYKA 1PMHX 5A3NA 1ZZ7A 1HRI3 1OXCA 3TRSB 1GP4A 3B94A 4M01A 2FZ2A 2VMEA 5DQ0A 2GAUA 1H4GA 1GNHA 2R071 4L92A 3SCHA 3H1WA 3J9SA 4FSJA 2B7YA 3BODA 5C4WA 3KV9A 2O8QA 5FO9B 5IVFA 2VC9A 3H8UA 3D6EA 3K4DA 3FE5A 1RINA 1BEV3 1P8JA 2VZOA 1RUH1 3CL1A 3THDA 4PBPA 5F9TA 5JXGA 3VBUA 4BQ3A 1U5IA 4UFJA 2WNUA 4B1LA 5LRSA 5FZDA 2O0OA 3B3QE 3OEAA 2DU0A 2WYFA 5DUXA 4AGRA 4BHPA 5FYTA 3WDWA 4AQTA 1LENA 5A1LA 1HV1A 4DS0A 2C0ZA 4FPFA 2OW4A 5FWJA 5D8AC 1MQTA 2C9KA 1IS6A 5C8WA 1DYPA 1HX6A 4Q4Y1 4OFGA 5JIUA 3MIBA 2BU9A 3NSTA 2ET1A 4QKBA 5A3PA 3DXTA 1J1TA 1TVGA 2F17A 2W95A 2FDGA 4QGMA 2ID4A 2WZR1 2XVLA 5KC5A 3RYPA 2EIEA 1D4M1 5T5LA 3WINE 3WF1A 1QJEA 2JB8A 1CAVB 4FP3A 3MW2A 2HWE1 4KBBA 3KV6A 2JDNA 4YW3A 2ZMLA 3J7HA 1X8MA 3OGGA 2HWC2 4QPGB 4COYA 3O1PA 1TQ5A 3VDBA 2LM3A 4AI1A 3AP4A 3WDXA 1LU1A 3LPGA 4WM8B 1Q43A 4NUBA 2MEV1 3PVBB 1NXMA 1VBA2 1CQ9A 2GZWA 2RVAA 1R091 2QZ2A 2VECA 4HPKA 2UURA 3WQ0A 5FAXA 3AZVA 1SZBA 2ZGNA 3PU8A 1TME2 5C4WB 3H7JA 1DQ4A 2CSGA 3B00A 2WZ8A 1WBFA 2WZPP 5BPXA 4AGGA 3S0MA 1EV12 1YFUA 3O1RA 3PJQA 4I3GA 1IPKA 3ZFGC 2C26A 1YFYA 3RS6A 2UYBA 4WVZA 1C3HA 2GALA 1EAH1 3LDBA 2O14A 1BEV1 1REFA 3OY8A 5CIRA 5F5IA 5FZGA 5I0UA 2RMU2 3ZN6A 3GNEA 1XQNA 2JKXA 2WNUB 2HH9A 2ZEWA 3VBFC 1US2A 1C5HA 4RS5C 2IVIB 2WT1A 5JAXA 5HPOA 3NNLA 5ACA2 2EXJA 1ALYA 5LBCA 2R0HA 3ELNA 2VNOA 4GZ9A 1MQTB 3J8F2 1CN1A 4YARA 5FPUA 4XZPA 5FUIA 2X5IA 1O59A 3AK0A 1UQXA 1Y7BA 4DRVA 3UETA 4XHBA 2Q1FA 5C71A 3WNLA 4AVSA 3ZFGA 2PHTA 4OI2A 3UV9A 1JU4A 3ZVXA 2HBUA 4OZXA 4ES8A 3G7DA 4KWLA 2JG9B 5H9PA 4R52A 1K5MA 4Y4YA 2CY6A 4XABA 1W8HA 1PMIA 2ZAAA 1UPIA 3KCXA 2VMIA 3GJAA 1HQWA 4FOQA 1GYKA 1YI7A 3ES1A 1RXGA 5FZMA 1XNCA 1W2NA 1XU2A 2BYVE 4EYUA 4JDOA 5LA2A 3OB8A 4R4ZA 1W0PA 5HCFA 4OZOA 4HPKB 1NCRC 1AYM3 4RSUA 4ZU7A 5EYXA 3N9OA 1RJ8A 5FYBA 4BDVB 1NZCA 4NAOA 4BYYA 3MW3A 1OD3A 4MGQA 4CU7A 1QH6A 2NN8A 3POFA 4KMQA 2WSVA 3AL5A 2RS12 4RR3C 1V6OA 4IGPA 2R1BA 3KHBA 3HQRA 1UZ0A 1UKGA 1VBB1 3OY8B 3K51A 4OHZA 3E97A 5EJZB 5C7GA 1PVXA 4UW5A 1MS4A 4XILA 4D7YA 1CAXA 3K46A 4Q4W2 3TB0A 2E7TA 2JB4A 2X5IB 4FOWA 4QQHA 1VP6A 1RUI1 1T6GC 1FMD2 3CMGA 1RUD2 2XUEA 4GH4B 3VHOA 3B9CA 1NX9A 4I09A 4KGQA 2R062 3KV5A 4QU2A 3RZMA 4QHBA 2IFRA 1ONAA 3JD72 4X6RB 2WAOA 4YM1A 3E6BA 4FPGA 1K5MB 1PNFA 3U1XA 1FNYA 1RVF3 2YU1A 4AI2A 2DWRA 3AZWA 3W20A 3GZEA 3MDPA 3QH7A 3O1TA 4BQWA 1UOBA 4AAXA 3NQHA 4ES9A 1NAEA 3GALA 2PTMA 4DUVA 3WNXA 5JSRA 1XU1A 1QOSA 5LZ6A 3LPFA 5FZ3A 3AKPA 2DVAA 4F7ZA 1RC6A 1VBE3 4HKWA 1AYM1 1C8M3 2R30A 2VCCA 3VUOA 1LEDA 1AR72 1KGYA 1O4YA 5JOZA 1DZTA 1VMFA 1IG0A 2QQIA 1D0GA 4WBBA 2D6PA 3SISA 4NRQA 2BZDA 3HBZA 1OLQA 2QQMA 4BJ0A 2UU8A 2YC4A 5JOYA 1R1A3 3KT7A 4IV1B 4LOSA 3J7LA 2B4KA 2RS53 4P00B 3WP5A 3MZHA 5CG8A 1J3RA 1ND2C 5JR2A 1CX4A 3FBMA 1Y9QA 4MZUA 3IIAA 3ME2A 4PLNA 5ABJC 1AR61 1V6LA 4XJ9A 1SBFA 5H9RA 3PUHA 3BN6A 2IZWA 4MGZE 4LIUA 1G9AA 3J7MA 3I54A 1QGLA 4YM3A 3H9AA 5J48A 3WP6A 1A78A 1UY2A 2KA3A 3LEKA 4PDWB 1CJDA 2YROA 3OOXA 1K12A 4FPHA 4ORFA 5LB6A 1LCLA 3TNPB 4EN0A 5C3RA 3MBWA 1O91A 2HWB2 4PJYA 3MFCA 3R4SA 4FPEA 4B4QA 1HV0A 1JUIA 3USUA 2EXHA 3P3PA 2H0VA 1SDWA 3QOPA 2W3JA 1RVF1 4L8QA 4R4XA 3WSOA 5ABJA 3LFIA 1J84A 3C8XA 3TEZA 3LE0A 1JYCA 3BTXA 2J42A 4CP0A 2ZX2A 3IBMA 2ZHNA 3OD0A 3PLQA 3F2ZA 4H3WA 3GJBA 1G6NA 1R083 3BALA 4CDWB 2YBKA 2BGCA 2JE7A 2VCBA 3UJOA 2YV8A 2RDNA 2LALA 3WHTA 3MF9A 3M8LA 1WZXA 5A1AA 4EWDA 1J58A 5K9YA 1C8M1 1UIKA 1HRV1 2JEMA 2W1WA 1POV0 1S0FA 4EV0A 1UX6A 2PYTA 2A6WA 2R042 3AC0A 1X82A 2PHUA 4Q1PA 4A45A 1ZRCA 1H2NA 1LOAA 3M70A 3PUAA 3GHMA 1Z0HA 1GOHA 3WZ1A 5IK7A 1OQ1A 2I74A 2JKBA 4AF9A 3CHXA 5C8CC 1DGLA 3SKVA 1RUF3 2VUCA 1R1A1 3ZN5A 3S7IA 1GZCA 2RS51 1W8OA 3S5QA 1QXRA 3ZSEA 2QQKA 1WW5A 4TZDA 4IW3A 3KQRA 2R6QA 4X8PA 4AK3A 1HRI2 4EN6B 3N9MA 1WA4A 1YO8A 2OS2A 2ZEXA 4FOVA 1JZ2A 1OQDA 1IQAA 2VTFA 4YGCA 5JIAA 4XFGA 1MS8A 4H55A 4ZHNA 1D4VB 1N1VA
chains in the Genus database with same CATH topology
1LGCA 4IV3B 4AYUA 2SLIA 4Q0PA 3NO8A 2PHFA 1AX0A 3USUB 4FAGA 1DLLA 5CBLA 1X33A 4R9DA 5FLJA 4FPKA 1AHSA 1XNKA 3M4FA 4Y1YA 1S0DA 1XXNA 2A71A 2AR6A 2GC0A 4HN0A 1WCKA 5BNNA 4Y26A 4KH9A 4XE9A 4XJ8A 1QDCA 2RM22 2DVFA 3NJZA 4FXGB 4DINB 4XDQA 2Y38A 3N7JA 3K48A 1VJ2A 2DCYA 1UF2C 5KHHA 5BNOB 2Z79A 4RL7A 4KGGA 4MLOA 3LA2A 4CEYB 4WZFA 4P9XA 2PHDA 4RHV1 4SBVA 5JSPA 1U0AA 2FHRA 1OKQA 1XE7A 1H8TC 3WHUA 4UXAA 1DQ6A 4KG8A 1VBC1 5DZGA 3ZSLA 1W6NB 5HBAA 1FV2A 3W59A 1C5IA 2NQYA 2TNFA 1HQNA 5FCCA 5L19A 2HEVF 4EN9B 1MS0A 2PQQA 5DZFA 2ZZJA 1LHVA 4NO4A 4H7LA 5J37A 1SQ4A 1WD3A 2WT0A 2IXKA 5EWSA 5L7OC 1ZYBA 2JENA 3WD5A 2ZGMA 2DVDA 2VW1A 2RHPA 3L2HA 3HR9A 2XBO2 3JBG2 3M1HA 3NWKA 1FPN2 3VBOC 4DQAA 5BNNB 2OIIA 1A8MA 1W2UA 4HKOA 4MX3A 5CB7A 2JG8B 3OJBA 1UU6A 2WFF2 1RUG3 2BNMA 3AB0A 4C90A 2IFWA 2OVUA 1JOJA 1QWRA 4R9CA 1S0IA 3O0VA 3B7MA 3H1MA 1UU4A 5J09A 4H14A 2BFUS 4Z1VA 1PGL1 3VZNA 2ZX3A 4YFZA 5LK5A 2RR11 4UBGA 1ULGA 4XQWA 4JC1A 3NW4A 1BKZA 5I91A 1XNDA 5GLTA 3D82A 4XMAA 5SV8A 4ATEA 4CEWC 1RIRA 3NV3A 3VBHB 2BBVA 1GFF2 4I30A 2CGOA 2DF7A 5K7PA 1S1AA 5H9SA 3SXWA 4CYDA 2ZGUA 3LAGA 3H50A 2K0GA 5CA6A 1CR7A 1H8VA 3LWCA 2C9AA 1SLLA 3Q9OA 4OLLA 3QLQA 3KMHA 4PLOA 3OBRA 2EAAA 1IGOA 3FFQA 3ILRA 4AHZA 4DMIA 2TEPA 4YSFA 5JZGA 1PGW2 3ZFFB 1V00A 2E6VA 4PLMA 3APBA 4N7UA 4YVWC 2GH2A 4HSJA 1VR3A 4BQ1A 2PN5A 4C1XA 3SHRA 1JW6A 2D98A 2XKPA 2IXCA 3O0XA 2ZTNA 2VNGA 1TMF2 3SH5A 1GBGA 4AFCA 2DVBA 1SFYA 2WWSA 2ZGPA 3ATGA 3UK9A 2ZAHA 2NMNA 1MS1A 2ZKLA 5DUVA 1LR5A 2W68A 5FMOS 2HJIA 2ZACA 1NOVA 2WFPA 1ZBE2 3PJYA 1QJX3 4XOGA 3CJIC 2GMEA 1SLBA 5C9AC 1CD3G 3RMXA 4C91A 5FLHA 4XJUA 4OULA 4RQPB 4LEJA 2AENA 2HWC1 1RMU3 2EAKA 1VBE2 3A4UA 1LHOA 4Q4V1 4CRQA 2PHWA 4HVOA 1MZFA 5I8SA 3SCGA 1PVC2 4Z8BA 2WL1A 4GMP3 1NA1B 1YCIA 2D3SA 2Y0OA 3ZMNA 1C1FA 4HVQA 3MIGA 5C9AA 3ZXLA 2GC3A 1WW6A 2ZGKA 1LOFA 5FO7B 4EROA 1AR83 5C6CA 4M3CE 3DPRB 3ZFEC 4CDXA 1ZZ9A 3OBTA 1EYBA 1LEMA 3M3OA 5GKAC 1RHI2 1ZA4A 2XWBB 5J7MA 1QJY2 3AX4A 1NQDA 1MVEA 3O14A 5CNAA 4RGGA 1TE1B 2QE3A 5GLUA 4ITCA 2G4IA 1ZVFA 2D5HA 4CDUA 4GULA 4JGZA 2ETEA 4GQ7A 4XJZA 1UN1A 1QOOA 3VZOA 2VY0A 3AP5A 4F83A 5JPNB 4XTMA 1B09A 3TNQA 4WZCA 3WR0A 2A70A 3KD4A 1QJZA 4IEWA 2RE9A 5HCBA 4B4RA 1VLNA 5FLIA 5SV5A 1R082 4FAHA 1EPZA 1GQHA 1RMU1 1FNZA 1W6PA 2XKOA 4LBKA 5L73A 3AZYA 1G9DA 3TYJA 3V0AA 4N43A 4W65A 2HWF3 5KXDA 4W6YA 2AGSA 4XEZA 4GMP1 5DZEA 4JVAA 4IEPA 1C4RA 3WG3A 1RUF2 1H1AA 4JAAA 2QUOA 2VOWA 1KS5A 2D5FA 4JGYB 4WM7B 4P9WA 4XHXA 4CDXB 2QCSB 3VN4A 1PO13 4DNYA 2P17A 1LB2A 2R49A 1DBNA 1XYOA 2WS92 1DF0A 5DG2A 4BOWA 4LBQA 4FTEA 2UYAA 4K7JA 4HANA 4WV8A 2ET7A 4LBMA 1H1MA 4JGZB 2X53S 3SMHA 4QPGC 2XH6A 5CFDB 4BWOA 3WW3A 1AL22 4L97A 1IS4A 3CF6E 4WM8C 2D6OX 4YVSB 4YNIA 2LTNA 1PNGA 4CTEA 4XFIA 2NYYA 4S2HA 5T50A 4FPOB 1B35A 3LSDA 3S7EA 5EFUA 2PLV3 4PBOA 5A32B 1A3KA 1LODA 3HAGA 2XLAA 3WUCA 5C4WC 3RI8A 3AKSA 4LT5A 3M3QA 1N1YA 1F5FA 1CAVA 1FI2A 2VG9A 1HXS3 3TN93 4Q29A 1W6PB 2XJUA 3V0AB 3BPZA 4L9BA 4N43B 4E27A 4Q2FA 1V6IA 1NG0A 1YFWA 2MEV3 4AE2A 2WNUC 4WM8A 1W6MA 2VUAA 3M3IA 3WG4A 1PHMA 2ATFA 4KNCA 1RTVA 4GIQA 2QQPA 4FTBA 2D6KA 1F31A 1MQTC 4E2SA 4AFMA 1EY2A 2EIGA 2GNMA 2D6NA 2WNVB 2AYHA 2AREA 5CFCA 1Q8PA 2CGNA 4K21A 1O3SA 1EAH3 1DQ2A 3M3EA 1PO11 2Y26A 4LBQB 3AMMA 5HI0A 4X6QB 3FWEA 4CDQA 4Q27A 3HQXA 2JG9C 4E2GA 4M0NA 2VW0A 3B9IA 1KITA 3AKRA 3ZXEA 1ZBA3 2YYOA 1NLRA 4I0WB 2PAMA 1QU0A 5DDJ2 3T2TA 1IZ3A 1WLWA 4QM9A 1WLCA 1Q56A 1LOEA 1B35B 1O3RA 4M00A 1OPMA 4LO5B 2Q5TA 3FUQA 1YI9A 4HMZA 2HEYF 2PLV1 5BNPA 1ZRDA 4FCAA 2JG9A 1OA2A 3EXUA 2V5YA 1ULEA 1RUG2 1HXS1 4ZXKA 1XNBA 3TN91 1BCXA 3V65A 2PA7A 1W6MB 2DFBA 3WLUA 4F3JA 2D97A 1DGRA 3N36A 4MGIE 2BWCA 1KS4A 3L2YA 2NMOA 1DZRA 1ZNPA 2YPJA 3WT3A 2X5IC 1W6OA 4AVTA 4ASMB 5CFCB 2JICA 4Q4X3 3VBRA 3UKTA 1VBB3 5EJ3A 4XQ4A 2NPIA 4GA9A 2V09A 4LE4A 4AFAA 2ZS6B 1W39A 4HLTA 1SCSA 1K5MC 3VDDA 1RUJ2 2GNBA 4D69A 1PZ7A 2HWD3 1KRIA 3LSEA 3V56A 4Q1RA 1PIV1 4IEYA 1ZBA1 4RA0A 5CVRA 4JRLA 1KJLA 3ROUA 2I2SA 1LECA 2WINB 1COV3 1RUI3 4LHNA 5DUWA 3EHKA 4MXWB 3FX3A 1G9FA 4GH4A 3ACLA 2QZ3A 1VRH3 1DQ1A 5BNPB 1MEC3 1QJU1 4QMAA 1Q8SA 1Z7S3 2H0BA 3VKLA 1NCQA 1RGSA 5JR7B 1N1SA 1QXPA 1MZEA 4B7EA 4Q0SA 3HMYA 4FBFA 2CGPA 4IV1C 1N47A 5IUQA 1YWKA 1VALA 3VKOA 3MICA 1J3PA 4YZ5A 3NL1A 1H0BA 2A6ZA 4AQ2A 3RWNA 1QJX2 3IPVB 5HCAA 1W6OB 4S2FA 4XFFA 2YY1A 1PO22 2XPJA 4YW2A 3B93A 3VBRB 4QQOA 3WG2A 2IXJA 3FBYA 4YLZA 4Q4X1 4GWNA 4AQ6A 2O8OA 1G8WA 2CNAA 2AUYA 3AZXA 5A3MA 3WDYA 4IV1A 4Y22A 2ZMKA 3VDDB 5GZFA 1BYHA 1AR63 2ZZQA 4OUMA 1IOAA 2XB6C 4EN8B 1QF3A 3G6JB 2HWD1 1Q8VA 1QQP1 3FC0A 2VOVA 2BNNA 1SACA 1COV1 2EVXA 4PDWA 1AR82 3RJRA 1FAYA 2GC2A 5CU1A 4AHYA 1DFQA 3LA7A 5I0TA 2EALA 1VRH1 4DZGA 3WP4A 1MEC1 1YIFA 1NCQB 1Z7S1 4BMEA 1D2QA 1RL3A 2WC2A 1FOD2 2PAEA 1AYN3 3RJ2X 2D93A 2IXLA 4AEMA 4LBJA 4MVTA 1RUE3 4HVRA 3QH6A 4AVBA 3C2UA 4CDWA 1HRV3 4BM8A 2EXIA 3VBFB 3X29B 1AR92 3FZ3A 1WD4A 4HKLA 2ZGQA 4IV3C 1X8EA 5FTTC 3ES4A 4KU8A 4Y22B 5D1IA 2CWSA 2RJLA 2Q1ZB 2W08A 3NKTA 1CIWA 4E4ZA 4LO8A 4C0HA 1UCXA 1WCDJ 1UW8A 3RI9A 1GQGA 2A6VA 1JH5A 3OYWB 1QNWA 4UW3A 4B4PA 4YG6A 2GN7A 4GKYA 4JV4A 5JLVA 1KJRA 2R072 4COVA 1CAUB 1REEA 1ND3A 4FXKB 1HIXA 2ZA9A 3BB6A 3POYA 4AGVA 3SLIA 4R9AA 4IV3A 1BVVA 1MS5A 3LA3A 2ZX0A 2WSUA 1BBT1 1RUH2 3BOPA 3LKJA 3GZTB 4EWAA 1LGNA 3UL2A 3DV8A 4JRAA 2B46X 4MH0E 4CEYC 1AYN1 4QM8A 2CL2A 3EO6A 4QQPA 3DN7A 1RUOA 1PZ9A 4RR3B 4HBNA 2E63A 4Q4Y2 5GZGA 1YLLA 1RUE1 4YGDA 5LEKA 5GZDA 3RDIA 2BFUL 2WKKA 5K8SA 1SBEA 2WZR2 4Q26A 3HT2A 4Y24A 1D4M2 5HXVA 1G9CA 4LUMA 4FQZA 2VVDA 3E6DA 4HFSA 2XUMA 5BNOA 2HWE2 1G7YA 3FJSA 4RHV3 4RFT0 5GJ6A 1I1EA 4CEYA 1TNFA 4GB33 1BMV1 4KWKA 1MR5A 3VKMA 4C1WA 3W58A 1A6CA 4N7IA 3VZJA 2B5HA 3WV6A 3N7MA 2MEV2 2CAUA 3J4UH 2RS33 2DYCA 2Z5WA 4Y20A 2B42B 3WW2A 2P3KA 4EN6B 1F8VA 1IHMA 1R092 1VBC3 1NY71 2FQPA 4S2GA 5KXEA 3OGJA 2OUJA 3AYCA 3A0KA 5BNNC 2B39A 3R4UA 3LZZA 4Z92B 1FATA 1ND3B 4XFAA 1W6NA 5I8TA 2JG8C 4XMIA 2GNDA 1N3OA 3PTYA 3AMNA 2WA3A 1M06G 5AC93 1GLHA 1EAH2 2E9QA 2GMMA 1BEV2 5AFEA 4I01A 4AI3A 1OQEA 1LJ7A 3ZN4A 4WVMB 1AXZA 4E9KA 3U0ZA 2DURA 3I59B 4I0AA 4IEQA 3D0SA 2Z42A 4P9YA 1YNAA 3VBHC 5JSOA 1VB2A 1U5YA 4XETA 4LUKA 3AXEA 1MACA 1Q8QA 3AMHA 4A7YA 4A7ZA 1ASJ3 2XG3A 4AWDA 1VBD3 2JG8A 4KU7A 3B01A 3BOWA 4OUSA 4LLFA 4LA2A 5JOXA 3JZVA 1DZQA 3AKTA 5FMOL 4E4DX 2VQ0A 4AG4A 1AUYA 4NPRA 1ENRA 3ASIA 4G9SB 2RR13 4QXKA 3ALQA 5A3LA 1DDLA 4GB31 3V64A 1NE4A 3KSCA 2Q30A 3VBHA 4CP2A 3WP3A 1VB4A 2BEOA 4XF1A 4Y20B 1TNRA 2YMZA 3PHMA 2RS31 2DUPA 2BUKA 3V0BB 1Y3TA 2C5DA 4IEXA 4QD2A 1L3JA 1MS9A 2E51A 3ZO0B 1DG6A 1ENSA 1UD1A 3D5OA 4FOYA 3VHPA 1VBB2 5FPXA 3HIFA 5KXCA 5AC91 2VMHA 1X36A 4LO4B 3ZFFA 2ZHMA 5IK5A 3D0JA 3IMNA 1PK6A 1LULA 1UAIA 4Q0UA 3VBSA 3KCYA 5E88A 5I93A 4RQPC 4TYSA 2XLFA 3T1LA 3EJKA 1ASJ1 1VBD1 4QPYA 5C8CB 3ZIWA 4I02A 4J1WA 1LKNA 4NOTA 1AL21 3WDTA 2GSYA 3H0OA 5AVAA 4L11A 1GSLA 2W39A 1N1TA 2C1FA 4P5HA 4EN0A 1NA1C 4QT6A 1SMVA 4YYOA 1BJQA 3WQ1A 3WW4A 5JZGC 2PHXA 4IEVA 1ZM1A 2R32A 4K6BA 4LA3A 3TAYA 4P9LA 4AFDA 1OPOA 2UY8A 1V9U1 2R16A 1EP0A 1POV1 3C3VA 4RQPA 2E53A 3I8TA 2VUJA 3LB9A 2ARXA 2HWC3 5IK4A 2VVFA 4FVVA 1OD5A 4Q4V3 4LHKA 1AYM2 3DPRC 2ZHLA 4N90A 1TEIA 4BIOA 5T5JA 5K0UA 1VBA3 1RUC1 4UW6A 3FLTA 4PIXA 4V1PA 5GZEA 2WA4A 1NA1A 3D8CA 4MGKE 4YM0A 1S0EA 5I8YA 2P37A 2WJSA 1BXHA 1PK6B 1Q5OA 5A33B 1GANA 1MS3A 3AM2A 2HYKA 3FUOA 1AR62 2JECA 3AJYA 4IEOA 1QHDA 3MGUA 1H9PA 3VBSB 4B7KA 3DPRA 3WW1A 2A6YA 1ZRRA 3QACA 2A5ZA 4JTNA 5KBFA 4JDNA 5IK8A 3ZXFA 4J1XA 2ZKNA 5ACA3 2WQZC 4HT1T 1C28A 4AI0A 2FMDA 4F8AA 3MIEA 1NXD1 3J8F3 3N3HA 5KXBA 2YZ4A 1OMIA 1U12A 1UKRA 3AMPA 3IDCB 3SH3A 2PHRA 2CAVA 1ZZ6A 2D40A 4OI4A 4YG3A 5FFOC 1RVF2 4CP1A 1LESA 3R4DB 5FDBA 2Q1MA 1LOFC 1SFNA 2TBVA 4AQSA 4Q0QA 1O4TA 2D43A 3POSA 4JGYC 4WM7C 2BVBA 1CESA 3CLPA 4Z2WA 3UKVA 2BQPA 4CDXC 2VW2A 2PELA 3RMYA 1C8M2 5K0UB 3VV1A 4UBHA 1WLDA 3H1YA 3LOIA