4YLZA

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lacto-n-neotetraose (lnnt)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ylzA00
2AGSA 5JMCA 2JKBA 1AJOA 5JOXA 4YZ3A 5GJ6A 5IK4A 1FYUA 1S0EA 4JRAA 3R4SA 5HCAA 1GANA 1LESA 1CIWA 3RSJA 2GNDA 2W68A 4RL7A 1HLCA 4YFWA 2SLIA 3IKWA 1ONAA 1GLHA 4XIKA 1KQRA 4YGBA 2VW2A 3GNEA 1O4ZA 4IQPA 1UZZA 4GWMA 1W6OB 4FP2A 4M3CF 1JUIA 3B00A 1BXHA 2JECA 5JLVA 3V0AB 1IS3A 1ENRA 1EPWA 3OJBA 2DVAA 5GZEA 3WUDA 1CESA 2OUJA 1WD3A 2V5YA 2V73A 5DUVA 3N7JA 2GNBA 4Q1PA 1V00A 1ZA4A 5F9TA 2NMNA 2P3IA 4XMIA 2G4IA 3U4XA 3WHTA 4YGDA 2GN3A 3A0KA 3PMEA 4KBBA 4XXAA 5F5QA 4YZ4A 1DYPA 2ZABA 4FPCA 1KDMA 4DRRA 2ZGUA 2DVDA 4R9AA 5DUXA 1LODA 1LOFC 3M3EA 3V64A 3OY8A 1AF9A 3L2YA 5EWSA 2ES3A 2PHFA 1BQPA 2YY1A 1F5FA 3AYAA 4WZFA 2OW4A 5T52A 1VALA 2DUQA 4ZXKA 1IS6A 3AZWA 3VKOA 4WV8A 1YIFA 2CWSA 4LBMA 4Y1UA 1CR7A 3ZSKA 3IMNA 1JYCA 1SLLA 1V6NA 2D43A 1SLCA 1UN1A 2P37A 4LBNA 3SLIA 1G9DA 1GV9A 1MS5A 1Q8VA 1UZYA 2A6WA 3N35A 1D2SA 4LBOA 1V6IA 4R9CA 3D5OA 3DUIA 3OBRA 3WDTA 3AZVA 5E89A 2ZBJA 1JHNA 4AGGA 3AFKA 3M2MA 1V6MA 2AUYA 2B7YA 4FPOB 3ZPYA 1R1ZA 1UX6A 2UWAA 3AZZA 3WG3A 3M3OA 2ZGKA 1W6PA 2GN7A 2H0BA 3JU9A 3FUQA 1C57A 4ISRA 2ZMLA 1DQ5A 1H9WA 1AVBA 3B3QE 4PCRA 3GALA 1G9BA 5E88A 4FVVA 1F9KA 3HMYA 2WSVA 3N3HA 4Q8KA 3T2TA 4K20A 1HDKA 2VUAA 3WCRA 2CWMA 4ASMB 3B9CA 5BYNA 1C1LA 4XMAA 2YV8A 2ZGQA 5HCFA 1SCSA 5DUWA 2C9AA 5GLWA 1GNHA 1MS8A 1CONA 2DVFA 1MZ6A 1KJLA 5GZCA 3LSDA 1S0GA 2R0FA 4FPFA 1LOGA 2A6VA 5GM0A 4U36A 1QKQA 1SACA 1QOSA 4UW6A 2A75A 1DGLA 3UL2A 4AWDA 4K1ZA 2D6NA 3AYDA 3ENRA 4H55A 2R1DA 4UW3A 1DBNA 1LOCA 3OY8B 3O12A 3UK9A 3SNMA 3VV1A 3V0BA 1AJKA 1LHNA 2AENA 2BQPA 4SLIA 1VAMA 4TZDA 2ENRA 1NXD1 3OPZA 3R4UA 5SV8A 1HKDA 1LJ7A 1G9FA 2P34A 4CZSA 4XHXA 4HL0A 2D7FA 5E8AA 2D6MA 3AZXA 5GZFA 1RITA 1S0BA 1N1SA 1F31A 1DQ6A 2CL2A 3N7KA 1IKQA 3MW2A 3OYWA 2VW1A 1LEMA 3O0WA 1CQ9A 4LBKA 3DGTA 1Y7BA 2ZHLA 3Q9OA 1AX2A 1W6PB 5JOZA 2W08A 2D44A 4JC1A 2E53A 3PJQA 2ZKNA 2ARBA 2ZGNA 1JOJA 1WLWA 2XG3A 4DRVA 1B09A 2AYHA 2DTYA 4Q1RA 2NYYA 4XBLA 4BMEA 1LEDA 4Y1XA 2PHUA 1H9PA 1U0AA 4YZ5A 1SBFA 1W6QB 1MZ5A 3WG4A 1X50A 4FP3A 4XOGA 1Q56A 2CNAA 2WT2A 1IKPA 3ZXFA 4BQ1A 2ZGRA 4W65A 4Y26A 2UURA 3WDVA 3SH4A 3WUCA 2ZMKA 4Z8BA 4Y20A 3C2UA 1ULEA 5CBLA 1CN1A 1LHOA 1SLAA 4UW4A 4Q8LA 3ILFA 2WJSA 1LOFA 1CJPA 1DIWA 2DU0A 3NWKA 4C1WA 1KJRA 3KQRA 4FOYA 5FRAA 2A6YA 1MR5A 1DQ2A 2SBAA 4YM2A 1WW4A 1O4YA 3V0BB 2LTNA 4L8QA 1CPMA 2JD4A 1DHKB 3AYCA 3WCSA 5LK5A 4BLIA 3WZ1A 2D3RA 1V6OA 1LGCA 1WLDA 1W0OA 3D6EA 3KM5A 2ZMNA 1GNZA 3O5SA 3WG2A 1N3OA 1A78A 3HN1A 1ENSA 1GBGA 2KM2A 1UAIA 4R9BA 5DZGA 2ZHKA 2DUPA 4AVTA 2DTWA 4XJ8A 2ZGPA 2DU1A 3I8TA 4XBQA 4XHBA 2UWCA 2A7AA 4XJWA 4F83A 3ASIA 4XE9A 1ULFA 3IPVA 2WNEA 1JYIA 1HQLA 4YFZA 1UPSA 2GNTA 2WT1A 1N3PA 4FPHA 3AP4A 1JN2P 2E51A 4YGCA 3ZXJA 4K21A 4XIOA 5IK7A 5DXDA 1N1TA 1J1TA 4FPKA 1Q8QA 3USUA 4AVSA 2DURA 2GMEA 2P3KA 2YROA 1SBEA 1KITA 3AJZA 1SLIA 1G8WA 1AX1A 1QNWA 2GNMA 4WVWA 1MS9A 2EAKA 2WT0A 3AYEA 1SCRA 1DFQA 4XDQA 3SISA 4BLJA 3HR9A 3M3CA 1AXKA 1LGBA 3LSEA 1LOBA 2PHTA 4Q26A 5T50A 5L73A 3RS6A 4YW3A 2NP0A 2RHPA 2E6VA 3FFZA 4FQZA 2EXKA 3ZYPA 3ZXLA 1FATA 4U2AA 4ZKTB 1OFSA 1YYNA 5JOWA 1LHVA 2D3SA 3ZXKA 4LBQA 1A3KA 1SBDA 1LU1A 2JDZA 2JJ6A 2I2SA 3MEPA 5DUUA 1MVQA 5DZFA 4YG0A 4XJZA 2DUOA 2ZHMA 1G9CA 3OGGA 4Q2FA 2ZGMA 4DPNA 1ENQA 1YXWA 5GLTA 3I4IA 2DV9A 4BOWA 2ZHNA 3SH3A 1IS5A 4FPEA 1AXZA 2TEPA 4JCKA 2VH9A 3RMXA 1QOTA 1Z78A 4FOQA 5DG1A 3RMYA 1V6LA 1FV3A 4NOTA 3ATGA 5H9SA 4YZ1A 5CB7A 5JDBA 3FBYA 1LHWA 4XJUA 3WV6A 2Z42A 1RINA 2WSUA 1FNZA 1LHUA 3IPVB 2WKKA 1IOAA 1BJQA 2GMMA 1QNYA 4LBJA 4HANA 4Y1YA 1APNA 1GZ9A 1JW6A 1WW5A 2WQZC 3APBA 3QCWA 4BMBA 1GZCA 1GYKA 3ILRA 4GALA 1MS0A 2R16A 3CNAA 1VIWB 2ZAAA 4FOWA 4M3CA 2ZGSA 4M3CE 5EYYA 1Z0HA 4GXLA 2AREA 1C1FA 4UW5A 4XYXA 3USUB 1VLNA 1QU0A 3BODA 5FREA 1FV2A 1ULDA 2W52A 3R05A 1WBFA 5CA6A 3SH5A 3V0AA 5H9RA 5H9PA 1LOAA 4NO4A 4YW5A 1DZQA 1Q8PA 3VKNA 1ULGA 1V6KA 1LECA 1WW7A 2DYCA 4Y22A 2PHRA 3LCPA 1HQWA 3N36A 4CTEA 1WLCA 3WDXA 2A3WA 3BIWE 1PZ8A 1V6JA 1SLTA 2GMPA 3AJYA 4WVVA 1QF3A 2ZA9A 2R1BA 3AP7A 2YZ4A 2GDFA 3RG0A 1QDCA 1LOEA 2NN8A 3JUUA 3FLTA 5GLZA 2VY0A 5GZDA 2A71A 1FNYA 3FUOA 4LBQB 4PF5A 5DZEA 1LTEA 1JXNA 2D6OX 5EXOA 2A70A 2R0HA 1IS4A 3WHUA 2NMOA 2UWBA 4XZPA 4ATFA 1N1YA 2A6XA 5KXEA 1WCSA 3MW3A 1MS1A 2PHWA 4OZXA 4BM8A 4CRQA 2EXIA 2WLQA 4GA9A 4ATEA 1UKGA 1RIRA 2CY6A 1Q8SA 4Y24A 4FOVA 1AX0A 2EXHA 1W0PA 3UJOA 5H9QA 5KXCA 2OUHA 1QDOA 4DS0A 1D0HA 3M1HA 5T55A 1C4RA 1MVEA 4C1XA 2NZ9A 1AXYA 3IN9A 1CVNA 5GLVA 3A4UA 5T5LA 4XJ9A 1N1VA 1DQ0A 2VXRA 1W6MA 1LCLA 4XILA 1GZWA 2P2KA 1JBCA 3AP9A 3N7MA 4M3CB 4YW2A 4AYUA 2R49A 2ZGTA 3IM0A 1MS3A 3POWA 5T5JA 3ZSJA 1S0CA 5JVVA 4YGEA 1PZ9A 3ZXEA 2FMDA 3MPPG 2D6LX 5IK5A 2PELA 3ZYRA 2A3YA 4AGRA 3A0NA 4GWNA 3OYWB 1H30A 2ZZJA 4Y22B 1KRIA 3W59A 1UMZA 3INAA 3T1LA 4P9YA 3AP6A 4ISQA 3NV3A 4XJAA 5GLUA 3V65A 2W39A 3W58A 2ZACA 4FPGA 4LBQD 1NLSA 3WLUA 4TYSA 4YLZA 1FX5A 1WBLA 3AK0A 2ERFA 3ZSMA 4FPYA 1SLBA 2LALA 2ZGOA 1QOOA 4YW1A 3WNXA 3VUOA 2EXJA 3SITA 1KDKA 1S0IA 4P9WA 2D6KA 3PVNA 2NM1A 1UL9A 2CYFA 2D3PA 1QGLA 2C5DA 2P3JA 2VW0A 2A5ZA 4AVVA 1ULCA 2D6PA 4Y20B 4Y1VA 1S0DA 1DYKA 2E7QA 4MYEA 4PBOA 1QMJA 1BYHA 1S1AA 2CTVA 1LULA 3NV4A 3VKMA 1WW6A 3AP5A 3ZSLA 3H0OA 3NV1A 4Y1ZA 4YG6A 2DVBA 4M01A 4D69A 5JOYA 5CAZA 3AXEA 1DLLA 1BZWA 1W6NA 1MS4A 1G86A 3T1MA 3FLRA 1OQ1A 5IK8A 2UU8A 3OBTA 4GKYA 2A3XA 1W6MB 4YW4A 1G9AA 2EF6A 3FLPA 4LBLA 2E7TA 4BPZA 1GZWB 3PVEA 3M3QA 1AZDA 1YRZA 3B01A 5T5OA 5KXDA 5IUQA 3BTAA 5AVAA 1A8DA 1TEIA 2AR6A 3AXDA 2VU9A 3B69A 2DWRA 3VKFC 3RRDA 1GKBA 2GALA 2YMZA 4YM1A 3D4KA 1Q8OA 1DQ1A 1N47A 2ZGLA 3TB0A 4YM3A 3WOGA 1N3QA 5GALA 1W6QA 5CNAA 1I3HA 4Q27A 5GZGA 5EYXA 2AH2A 3WG1A 1PZ7A 1I1EA 4PQ9A 2OVUA 4XTPA 3ILNA 2EIGA 3O0XA 4GKXA 1W6OA 2PHXA 1XQNA 3QLQA 1YI7A 5IT6A 4PBPA 3TAYA 2JE9A 1WUVA 1S0JA 2ARXA 3MW4A 2A6ZA 4DFSA 4FQ4A 4R9DA 2Q5TA 4XXPA 1DQ4A 2YXSA 3AX4A 4ITCA 3ZVXA 3O0VA 2EALA 3RQ0A 3UJQA 4I30A 4FPLA 3POSA 3PVOA 4RA0A 3VKLA 1G7YA 4K1YA 1MACA 4P14A 4DQAA 1LU2A 1SFYA 1VAVA 1YO8A 1W6NB 4YM0A 4YG3A 4M00A 3POYA 5HCBA 3WVJA 2FHRA 3BOPA 1OKQA 4YZ2A 1S0FA 2XB6C 1GSLA 1WD4A 1FAYA 3WDWA 5T54A 4XTMA 2HYKA 5DG2A 4FPJA 2JE7A 1ZM1A 3WDUA 1BKZA 1CPNA 3AZYA 2DVGA 4P9XA 4AGVA 4XBNA 1GICA 3WDYA 5KXBA 3NV2A 1LENA 1URXA 5T5PA 3N7LA 1LGNA
chains in the Genus database with same CATH superfamily
5JXIA 1O3TA 1AJOA 5FO9B 4NRPA 2GU9A 1Q3EA 2DFCA 5KHHA 3I2OA 5F3IA 1PMJX 4HONA 1H8TA 3VBFA 1X9PA 4EYUA 1ZZCA 1LESA 4HPKA 1J58A 4UYBA 1OLRA 2SLIA 1AR93 1ONAA 1GLHA 5C9AA 1UY3A 3HPNA 3HWJA 1HB3A 1HW5A 2WQ8A 4IEYA 1W6OB 4GB31 4FP2A 1IQAA 4M3CF 4LKSA 1BXHA 3ALQA 3WD5A 3V0AB 4CEWB 4R52A 4FCAA 5DUVA 5AFEA 1DCSA 4BB3A 1ZA4A 2QCSB 2XJRA 3U07A 1UYPA 2P3IA 2LUWA 2WO3A 2JB4A 2GN3A 2A1XA 3PMEA 2Q8OA 3CJIA 5E1RA 3RDIA 1D4M3 4YNIA 2WZR3 4YZ4A 5F6KA 1KDMA 1RB8G 2RM21 1VBC1 3NNLA 4CCOA 4Y5SA 3HNMA 4WM7C 4QB6A 1RHI1 1OKOA 3HIFA 5EFUA 3RZZA 3OY8A 2RE9A 1ND3A 2ES3A 2PHFA 1BQPA 3GBFA 1HRI2 2YY1A 3CL1A 3WW2A 1VMJA 2XBO3 3IMMA 2OW4A 3OGVA 3AZWA 2CWSA 3JQXA 1OHFA 4CDXC 4D7TA 1OI6A 1SLLA 1PK6B 1SLCA 2P37A 4IEWA 4LBOA 5K4LA 4YYOA 2HWB2 3VD9A 4AG4A 4R9CA 4Q0VA 3D5OA 1CAWB 1X82A 4CEYC 3OBRA 5A7QA 3TEYA 3AZVA 1GU3A 1JHNA 4H7MA 3ZFFA 1QJFA 2B7YA 4LXLA 1JZ7A 4OULA 2BJSA 2DBIA 4CCNA 2GN7A 2H0BA 1XBFA 2XL9A 4L0PA 2O1QA 4ISRA 1C57A 1OA4A 4JX0A 2ZMLA 5LWBA 5C3SA 1QH6A 2HWC3 3BOWA 1DQ5A 1H9WA 4MH0E 3AMNA 3GALA 2WYSA 4RYDA 2JDKA 3MO4A 1F9KA 3HMYA 3NNMA 4O9EA 1IPSA 3N3HA 3S7IA 4LJHA 1VRH3 2RG4A 1HDKA 2VUAA 1ZRRA 2X8KA 2I07B 1CGPA 2JDYA 1C1LA 4XMAA 2ZGQA 4S2HA 1SCSA 5F32A 1SZBA 1FI2A 5DUWA 4B4QA 4LULA 5CIRA 2Y0IA 2IVIB 4H2AA 3J7HA 2R0FA 4FPFA 2WDBA 2WLPA 2F6BA 1SMVA 4IUGA 1M4WA 1RUD3 1SACA 3NAPB 2X53S 3GJAA 4UW6A 2A75A 4AWDA 2IVJA 4MHUA 5JXJA 4H55A 2NLRA 5FP8A 2OX0A 4JKKA 1ND2B 1R1A1 5FLIA 4DUVA 2E31A 5BPXA 1XE7A 2PLV1 1CAUA 1AJKA 3BYWA 4LIUA 1LHNA 2AENA 2BNOA 2BQPA 1NA1B 2W47A 1NKGA 3KVBA 3R4UA 4LE4A 5DMYA 5J7MA 2P34A 3UT0A 1C8M2 2XKOA 4ARYA 2D7FA 4JRLA 4G9SB 1RITA 1N1SA 2D93A 1DQ6A 3RZGA 2Q1ZB 3H3LA 2UYAA 5CZKA 4A45A 4AQ2A 4DMIA 1OA2A 2KR2A 5FQ0A 4CU8A 3ES1A 4LBKA 4Q4Y2 2ZKLA 5FZLA 4I3PA 1W6PB 2O0OA 1B35B 1QH7A 3P5BA 4JC1A 3PJQA 4JGZB 5FZOB 5A1FA 2ZGNA 3LEKA 5D8AB 1PIV1 4HBNA 1DYOA 1JOJA 3BCWA 1WLWA 5F3GA 4AQSA 5JSOA 4FXKB 4DRVA 5FDBA 4BMEA 1LEDA 1L7LA 5FJHA 1WLTA 2VUCA 2JIJA 4YZ5A 1SFPA 1MZ5A 1XC6A 3HQRA 2K2SA 1BMV1 1NCRB 1X50A 2WFF2 4XOGA 1RUJ3 3ZXFA 1IKPA 2GH8A 1US2A 4Y26A 2UURA 2EIEA 4OI1A 4HVRA 2BEOA 2R043 4Q4X1 5DDJ1 5CBLA 1RUNA 1O91A 4COWA 5F37A 1A6CA 4UW4A 4Q8LA 4CDQC 2VVDA 3DKQA 2WJSA 3NWKA 4C1WA 3K2OA 1O3RA 4NMIA 1GOGA 5FRAA 1DQ2A 3AKPA 2SBAA 2P6HA 4ARXA 4CU9A 1H0BA 2R072 2ARCA 1K12A 4BCUA 2Y6HA 4HVQA 2MEV3 3S0MA 1WWYA 2JD4A 1F2NA 3M70A 5FZEA 2D3RA 3FHQA 2R6QA 3D6EA 2GP5A 4Y33A 1GNZA 4B4RA 3OCPA 1N3OA 1A78A 1QJY3 2WZEA 4R9BA 2ZHKA 2ZGPA 3CMGA 5ACA2 3FHIB 2I74A 3ASIA 2YYOA 4XE9A 5BY5A 4OHZA 3WW1A 4HG6B 2WNEA 3WQ7A 3I3EA 1XXNA 2BERA 4YFZA 1MZFA 4A7ZA 2VJXA 3ZFEB 2VD7A 2FDHA 2WT1A 4KGGA 4HSJA 4K21A 5IK7A 5DXDA 2E9QA 3H8UA 2Y6JA 3USUA 1RUI2 4AVSA 2DURA 2YU2A 1KITA 1G8WA 3ELNA 4LHKA 1AX1A 1QNWA 1PVC3 1JS9A 4LHLA 1JUHA 1O5UA 2WT0A 5FLJA 4WVMB 4AK3A 3KV4A 1AXKA 2PAKA 3TNPB 4AAPA 2HWD1 4M0NA 1LGBA 3LSEA 4HKLA 3RS6A 3NRUA 4QPGA 4XQDA 1CD3G 2D97A 2JXAA 1QJZA 5AC93 1W06A 2NPIA 5FY5A 2WNVC 1W2NA 1X9TA 1OFSA 1YYNA 4XVHA 3VDDA 1R081 2JE8A 3H1WA 2JJ6A 1AYM2 2I2SA 1S4CA 3H7JA 2JDUA 1MVQA 3H9AA 5DZFA 2DUOA 2ZHMA 1VBB2 5C4WB 3LPFA 1G9CA 4AW7A 3N9QA 3OOXA 1UXXX 2RMU2 4JGYA 1UO9A 4AFCA 4AVCA 2TEPA 1G6NA 1TMF1 4PDWC 3RMXA 2VGDA 1K5MA 4N53A 1SQ4A 4FOQA 4B7EA 4LO6B 3ZR6A 2Z69A 2AACA 4NOTA 1MQTC 3ZYBA 5H9SA 1WCKA 1Y9GA 5CB7A 1LHWA 1WCDJ 1RINA 2WSUA 1FNZA 3IPVB 5A33A 5IVYA 3VDDC 2Y6LA 3A7QA 4ZS2A 1IOAA 4ZU4A 4AE2A 1UCXA 2GMMA 1JW6A 3LA7A 3Q8AA 4OUMA 2IWGB 2WA4A 1NYWA 2JG8B 2TNFA 5KC6A 5A32A 1OVPA 4FOWA 1V9U3 4AOCA 4XCBA 1Z0HA 1Y43B 4AI1A 5C8CC 1ULDA 3R05A 2YFZA 4IERA 4QQ2A 5FP4A 1RUE2 2GC0A 2WS93 3AKSA 5I0RA 3V0AA 3AKTA 3KMHA 3CZJA 1YQ2A 5H9PA 5L9RA 1LKNA 4LK6A 1SEFA 3KV6A 2VQAA 3VKNA 1W9WA 3N36A 5LA9A 2QQPA 5FYTA 2EIDA 2A3WA 2WWUA 5FZ4A 3VBOA 1PZ8A 5TSWA 1F8VA 3B9IA 2G9FA 2JD9A 1JOBA 2RR13 4CCKA 2ZX1A 2NN8A 2HKXA 3LFMA 2X09A 1P8JA 4QM9A 5GLZA 1RUH1 4D7SA 2VY0A 2C26A 5JR2A 4LBQB 1SDDB 3LIHA 2VZQA 1JXNA 5EXOA 4YSFA 1UKRA 4GH4B 3WHUA 4CCJA 1ZZ6A 4EN6B 3O1OA 2HLEA 2YGMA 3DYOA 1ZREA 5A3LA 5FPXA 4LR4A 5FOJB 3JD73 2EXIA 4KNCA 5BNPC 5F3EA 4CEWC 4MG2A 5A1AA 2WN3A 4GA9A 1NT0A 1UKGA 1HQNA 5FFOC 4UBHA 1PO12 3H50A 4O9GA 2CY6A 3TWIA 5BV6A 3WF1A 1Y9MA 4E2GA 4WVZA 3LEIA 1UY4A 3OSDA 4NE9A 3GGLA 4AFDA 3LD8A 4DS0A 4PLMA 2HEYF 1COV1 3M1HA 4INDA 3WF0A 4AHZA 4NHMA 4C91A 3QACA 3UGFA 4YVWA 2P1BA 1CAWA 2XVKA 1CVNA 1H4HA 1Y4WA 3IN9A 5GLVA 5FP3A 3ZFGB 4EQVA 4XJ9A 4CCCA 1QIQA 2VXRA 4ZZ8A 1E5HA 5LBBA 4QKFA 3ACIA 3VBUC 4X6RB 3TEXA 1GZWA 4E4DX 5A1LA 1ZRDA 5LBEA 1NCQA 2VZTA 4S2GA 3ZKYA 1VRH1 1OF4A 4GJYA 3POWA 3ZSJA 4XF9A 1H8VA 1L7RA 1AL22 3TOJA 3ZXEA 3K46A 4B3NA 3MPPG 4HFSA 4MLOA 5D2AA 4MGSA 3ZYRA 3VB9A 4I3GA 4AGRA 1EV12 4Z2WA 4GWNA 1XPWA 2B46X 2WUHA 3HVDA 1H30A 1PK6C 2ZZJA 1PX4A 4Y22B 1OA3A 2W1UA 2VAUA 1BK0A 3T1LA 1KEXA 3NJVA 4Q0QA 4XJAA 3V65A 3W58A 3NW4A 3CEWA 4LBQD 4M0HA 5C33A 2FBEA 4JV4A 4Q4V2 3ZSMA 4UF0A 1H2NA 5FYUA 3J8F2 2KD7A 4YW1A 4GJZA 3J9SA 2ET1A 1ZNPA 1KDKA 2E26A 5BNNB 2BGOA 3BI3A 3PVNA 4YVSA 1OUXA 2CYFA 2D3PA 3AMHA 4NHLA 2C5DA 2VW0A 2RS52 2A5ZA 4OQ8A 1ULCA 2J1EA 4NIAA 4Y1VA 4NHKA 2E7QA 1XOYA 2XWJB 4MYEA 1NA1A 1GWLA 3VKMA 4HN0A 3ZSLA 5I0DA 2QTWB 1C5IA 3B7MA 3H0OA 4WM7B 4Y1ZA 2DVBA 4XZUG 3TYJA 4D69A 4OZOA 1AR81 4QPIB 2IFWA 1H6XA 1I5PA 3RZLA 1CX1A 2WRAA 1BZWA 5LK7B 1MS4A 1Z7S2 2ADEA 3T1MA 4MGQA 3GM8A 2UU8A 2F4PA 3OBTA 5FLHA 1RUC3 2W91A 4LTAA 3NAPC 2QQLA 2A3XA 2F17A 1OLME 3FLPA 4LBLA 4ZZ5A 2OQ6A 4P02B 3ES4A 4ZS3A 4AFBA 1ND2C 3E6DA 3MBWA 1ZBE1 2B9UA 1AZDA 4LUMA 4JGZA 2VZRA 1DLCA 3CQOA 4OI4A 4CEYB 1UU5A 1A8DA 3VKFC 4UI9L 1D2QA 1UZWA 1YHFA 2P6CA 2GALA 1WA6X 3D4KA 1Q8OA 2VOKA 1N47A 2BZDA 5FY0A 4E8DA 3VBSA 2VOWA 3T4VA 5FPBA 4YM3A 1O3QA 4MXVA 5J48A 3MLLA 5CISA 4W4ZA 5IVJA 4JDOA 4L11A 5EYXA 1O6UA 4PQ9A 2D40A 1VBD1 4L9BA 2JG9B 3ILNA 2BNMA 4GKXA 2TBVA 3O14A 4IV3B 3IIIA 1B35C 3TAYA 1W8WA 4GQ7A 1JYVA 2ARXA 3GHNA 3MW4A 1NXMA 5D8AC 5M0TA 3DCQA 2BPA2 1KFXL 2YC4A 4LKFA 3HBZA 3VD3A 5LASA 1WMXA 2BU9A 3H1MA 1DQ4A 3CO2A 3O0VA 5L36A 4IE0A 4FBFA 1NCRC 4LKEA 4I30A 1TVGA 3VKLA 3T09A 2XJUA 3URFA 2BDRA 1FPN2 1NX9A 1S2KA 5FP9A 1LU2A 3IAQA 1QJU2 4BHPA 1W6NB 5IATA 1YWKA 3WVJA 2FHRA 2EICA 1WD4A 4MUVA 3RGBA 1TME2 2HYKA 1VBE2 5DG2A 1W9FA 2JE7A 3WDUA 1BKZA 1D0GA 1V0AA 2DVGA 5L9VA 2IXIA 2W3JA 1XNCA 2BNNA 4E2QA 5T5JA 3WDYA 2ZPXA 5C3PA 5F39A 4TWTA 1VPHA 3K3OA 3G6JB 1F15A 2AEYA 2JKBA 4UAPA 1ASJ1 4YZ3A 1XNBA 4COUA 1JHJA 3S5QA 1FYUA 4CP2A 2IUWA 5HCAA 3WINE 1GANA 4R4ZA 2YPJA 4CSWA 1HRI3 4O65A 2W68A 1YQCA 4RL7A 4YFWA 5FIXA 2XJVA 4QU2A 1KQRA 1NZIA 2YHJA 4RR3A 4CDWB 5IWFA 3ZFEC 4GWMA 4CE8A 3HT1A 1JUIA 1QXPA 5FYIA 2VNOA 5LA1A 1AR62 4AZZA 2K0GA 4IGPA 5C6CA 5GZEA 2Y26A 5FMOS 3VBRA 3WUDA 1ZYBA 4P9LA 2JWPA 2RS12 4LNVA 4D8MA 1GWMA 1A8MA 1RUF1 4Q1PA 3UKNA 1J3RA 1V00A 4META 1POV3 3SKJE 4QPYA 4ORFA 3RZMA 2RDSA 2G4IA 3U4XA 3WHTA 4LQRA 3B02A 5EPAA 2TUNA 3A0KA 4KBBA 4R8HA 5F5QA 5LCWL 4OHYA 1DYPA 4CA9A 3NVCA 2PTMA 2ZABA 3PUAA 2BWAA 4D6RA 1UOJA 4DRRA 4DEQA 2DVDA 1UWWA 3E1F1 2EIBA 1LOFC 3VZKA 1JOPA 1AF9A 1PMHX 3L2YA 1O59A 1W04A 1CAVB 5A3MA 2ZTNA 3AYAA 2R062 2W46A 4WZFA 2VTFA 1YQ8A 5T52A 1I6XA 3WNNA 4M4RA 1GZTA 3CKHA 2JG8A 5FZFA 4IGQA 4BQ5A 5C4WC 2BFUL 4LBMA 4N43C 4GWJA 4URTA 1CR7A 2Y8KA 5L9BA 2Q8EA 3KV5A 3PUIA 3TN92 3CLPA 3R0RA 1UN1A 4HOOA 4EROA 1Q8VA 3T30A 5JZGB 1K5JA 1J1LA 2XLAA 2KXLA 3DUIA 3MICA 4LHSA 1H2LA 1AYN1 1W9TA 1NY71 1SHWB 1RMU2 4AGGA 3M2MA 4CDUB 2HWE1 1QJX2 3OEBA 2AUYA 3LOIA 5FZBA 4IE5A 3AZZA 3WG3A 1R091 1MEC1 4LA2A 3DKWA 3ME2A 4AVAA 1PO22 3FUQA 5ABJB 5AFBA 2J42A 2J1UA 3SHRA 3LZZA 1C8M3 4MGKE 4GWIA 3WSOA 5EQUA 3ZN6B 4F3JA 2WSVA 4Q8KA 3VDCA 1BCXA 2B9VA 3EB7A 4ASMB 1AUYA 3AM2A 2BVVA 2C4XA 2YV8A 5HCFA 3GXUA 2VTXA 4Q4Y3 3EBRA 1GNHA 3OUHA 5GLWA 5IFTA 2PFWA 3I2IA 4LUKA 4RQPB 3IB3A 4GMP3 4QPWA 3ZYIB 5JR7B 1KJLA 4PLNA 5GZCA 1LR5A 1S0GA 5FYBA 2A6VA 5A6ZA 2VOTA 5CVRA 3NO8A 1YQ5A 3U0ZA 1QOSA 3I59B 1DGLA 1W99A 3RWKX 4QGNA 3JBG2 2D6NA 3AYDA 3ENRA 4FXGB 2R1DA 1LOCA 1SPPB 1DGWX 1VBA2 4P9JA 4AVBA 3S7EA 1UIJA 3VV1A 2WFF3 3F95A 3VGIA 4TXWA 4RD7A 4GH4C 4SLIA 5SV8A 4DNYA 4OI0A 3FFQA 5I0SA 1JMUB 3AZXA 5GZFA 3N9OA 1XNDA 1ZRIA 3Q8EA 4QKBA 4LO5B 4XUTA 2RJKA 1I9RA 3QH7A 2XJTA 2IXJA 1NLQA 2R073 3AL5A 1LEMA 2JICA 1CQ9A 4GB32 3W20A 3DGTA 3ZX7A 3H8RA 5JOZA 1AX2A 5A3OA 2W08A 2D44A 5C8WA 2VZOA 1VR3A 3ZFGC 2ZKNA 5IFPA 4IE6A 3E97A 2AYHA 2DTYA 4XUNA 1FOD1 3BTYA 4Y1XA 5FXVA 5ACA3 1H9PA 1U0AA 1SBFA 3L9JT 1ZA7A 1W6QB 3WG4A 1H2KA 4EWEA 1IG3A 1TNRA 2VUDA 2WT2A 4XUQA 4BQ1A 1S2BA 3WDVA 3H3ZA 1DGRA 3SH4A 4W50A 3WUCA 2RM22 1VBC2 4RS5B 5DQ0A 1EPZA 2Q30A 4XETA 2BBAA 2XL7A 1RHI2 3G7DA 1SLAA 3ZYGA 5L7OB 4I0AA 4NPLA 3PUQA 3J26N 4WM7A 3EXUA 2FDJA 4ATEA 3BU7A 2BOIA 1CJPA 3MV11 2OT7A 4BYYA 5CFCB 3DF0A 1RUI3 1KJRA 3KQRA 1W3VA 4Q4W1 5BNPB 1MR5A 2DCTA 1YLLA 2PA7A 3Q8BA 4QHOA 4YM2A 5CFDB 3TEZA 4QDRA 5C3QA 2W95A 3VHRA 1KS5A 3V0BB 5JXGA 4L8QA 3BKZA 4BLIA 5LK5A 4CDXA 3FX3A 5BNNC 2Q4SA 1W0OA 3KM5A 2UYBA 3ZLIA 3WG2A 3O5SA 2VM9A 4MGZE 4MXWB 3SCFA 2LROA 4CEYA 1ENSA 5LB6A 4A7KA 4XDPA 2XUEA 3I8TA 2DU1A 3FHAA 1W2OA 1OD3A 4QMAA 4UWDA 4Y4RA 3VBUB 4F83A 2QUOA 1AYM3 3DYMA 4QPIC 1JYIA 5FO8B 1NQDA 2CGNA 1CZSA 1KD7A 2G9ZA 3SEPA 5DAVA 4UFHA 2HYXA 2B5HA 4FPHA 3ZXAC 4URAA 4L2NA 1ALYA 2RMU3 4E4ZA 1W39A 3T0BA 3KCCA 1O7FA 2CDOA 1DP0A 1N1TA 1J1TA 1REDA 4FPKA 4E2SA 1Q8QA 2GMEA 2WWSA 4E27A 2P3KA 4KU7A 1SBEA 4YRDA 1AR71 2WINB 1ZZ9A 1ZZBA 4WVWA 3M8LA 1MS9A 2EAKA 4XDQA 1SCRA 1DFQA 2FCUA 4LLOA 5FZHA 3HR9A 3M3CA 4IESA 3SISA 5CYYA 3NJXA 3WP6A 3ACFA 1ODNA 4DY5A 4XF1A 2NP0A 1UY2A 3NL1A 2RV9A 4OHXA 2HWF1 1R1A2 5FXZA 3ZN5A 1HXS1 4Q5OA 3T0DA 2PLV2 2ZAHA 1W8NA 5EHDA 5JOWA 2RS31 1CWPA 2D3SA 5I93A 4EN9B 1SBDA 1LU1A 2JDZA 2LM3A 1DG6A 1RUE3 2JG9C 3MEPA 4Z07A 4QQLA 2VZSA 4IV3C 5FUIA 2XDVA 1H1MA 3S6PA 4Q2FA 2WR9A 3HEIA 4TLGA 1ENQA 5E6HA 1YXWA 2VOVA 4MGYE 5GLTA 2DV9A 3SH3A 5BNOB 1OH4A 1IS5A 4FPEA 3POEA 2EVXA 3PHMA 4CP9B 3PU3A 3PUHA 1QOTA 2WWJA 2GZWA 4V2VA 1XNAA 4R4XA 3RMYA 3I3QA 1PHMA 3JB8A 5EIYB 3RYPA 4K8FA 3ZDSA 4EWAA 4K9SA 5JDBA 4AHWA 4F7ZA 3MFAA 1LHUA 1PIV2 2ETEA 3OF1A 4QQHA 4FTBA 4LBJA 5FZGA 3VL9A 4DZGA 4Y1YA 3HD8B 1LAJA 1RUG1 4PIXA 3BU0A 3GBWA 3ZKUA 4BMBA 1E5SA 4JTNA 3ILRA 4JZRA 1RVF1 4M3CA 1MS0A 4XJUA 5EYYA 4XFBA 2ZGSA 1PO13 1BMV2 1RTVA 4GXLA 2VBDA 4IW3A 1UPIA 1VLNA 2YBKA 5LEJA 5FREA 3IIAA 1W28A 4XF0A 1UYXA 1XNKA 4Q4X2 5DDJ2 3SH5A 1GQPA 2VO5A 5K0UB 4NIHA 2YUEA 4AEMA 3WQ1A 1Q8PA 1V6KA 4GULA 1OLQA 2DYCA 2PN5A 1LB2A 2PHRA 3LCPA 4CTEA 2X05A 1WLCA 5LA2A 5A80A 3WDXA 4CDQA 3KHBA 4NR1A 5CG9A 4LO4B 4XAEA 4XF3A 1SLTA 3AJYA 3AP7A 4EWDA 4TTGA 4ONUA 4Q29A 2GDFA 5K7PA 4YARA 1QDCA 4KQ7A 3NKGA 3FLTA 1WGPA 1FNYA 5IVVA 4DB5A 4PF5A 3D8CA 1AL23 1LTEA 4RHV3 5FOBB 3R4DB 1C5HA 2R0HA 4CDWC 3K77A 3T08A 1EV13 2NMOA 4XZPA 2K9ZA 3B93A 4Q0UA 4UBGA 4ATFA 3GCWA 3HBKA 4NUBA 4CPBD 2J1TA 3LGRA 2E7AA 4CRQA 5LZ6A 5FO7B 2OXBA 4BQYA 2W5FA 3VBHC 3UKVA 1HRV3 4Y24A 2MPFA 5JSRA 2BW8A 4FOVA 3H1YA 2EXHA 1W0PA 3UJOA 4Q4V3 1LNSA 2OUHA 1QDOA 3LWCA 3J8F3 3OPWA 4MVTA 4LLFA 1QQP1 5T55A 1ZBA1 3BN6A 1C4RA 4EZHA 2NZ9A 4AXOA 1IZ3A 4FFHA 5FTTC 1EAH1 2RS53 2VL4A 5I0UA 4K6BA 1UY1A 4XILA 5SV5A 5JMOA 4YW2A 4S2DA 2VBPA 3OUJA 1EP0A 3THPA 5L19A 3MI8A 1MS3A 3RZHA 3C7GA 1YUDA 1BHGA 2BGCA 2PQQA 4AEKA 2HWD2 5LY1A 2BGPA 4IEPA 4YGEA 1BBT1 5FZ9A 2D6LX 5IAXA 4XEZA 2PELA 1Z7S3 2A3YA 3GZUC 2XGXA 3OYWB 3K4ZA 2O8QA 2J1VA 1OUSA 1UD1A 5F2SA 2WNVA 3W59A 4Z92B 1R082 3EMRA 4K3UA 4PIZA 1F35A 4P9YA 4B1MA 5JZGC 3NV3A 5HXVA 3WNLA 1E57A 3GBGA 5DPNA 4CDUC 4NROA 4TYSA 2Y0OA 3AFGA 4NHYA 1WBLA 3A23A 4FPYA 1SLBA 3VDBA 3WNXA 5B4NA 3MLJA 2CAUA 2E33A 2Z5WA 5ABJC 1TMF2 3BVCA 3SITA 4D6QA 3U78A 4HZFA 4N9IA 3VUOA 2D6KA 4FFFA 1UL9A 1OOPB 2CGOA 4PDWA 1NUKA 1QGLA 5D21A 3D82A 5FKCA 4AVVA 2D6PA 2Q1FA 4Y20B 5LY2A 1S0DA 1FMD3 2VVEA 4PBOA 1MQTA 3NV4A 2K46A 3AP5A 4XQWA 1L7QA 3VD4A 4YG6A 4EE2A 1QWRA 3MIHA 4WBBA 5A6XA 3KHCA 5JOYA 1ZRFA 2VQ0A 4OLLA 3E6BA 4RQPC 1JZ6A 4PT6A 5IK8A 2RDRA 5J09A 1ULOA 4N43B 4QM8A 1W6MB 4O7XA 4CYDA 3W21A 2E7TA 1XYNA 2QZ2A 2VCAA 1GMMA 5ACA1 1GOFA 5C8CA 1YRZA 4OVEA 4XUPA 5CEHA 3BTAA 2LS6A 1FPN3 3N9LA 2ZZQA 3F2ZA 1GKBA 3RRDA 3E5UA 2QQWA 1AR91 1QJU3 2B42B 3PUSA 4K40A 4KL1A 3T0AA 4IV1C 3I2HA 3HJRA 3O1UA 1MZEA 1TME3 1W6QA 5CNAA 1RUH2 4XW3A 5FUPA 1I3HA 1VBE3 1HB1A 3UETA 4QT6A 5HPOA 3W5MA 1YNAA 3WG1A 1PZ7A 5FPAA 3J7NA 5FYCA 2VPVA 3ST7A 1I1EA 1ULPA 4SBVA 5FKBA 2Z2SB 4N7IA 4XTPA 2XHNA 2ZEWA 4MZUA 2PAEA 4X8NA 4DINB 3O0XA 1ST8A 1W6OA 1XQNA 3QLQA 5A3NA 1YI7A 2FCTA 5ERLA 4ZXEA 4A7YA 4PBPA 1W03A 2Y38A 1WUVA 5KC5A 4CEWA 1VRBA 3D0JA 3M7AA 1YCIA 3MIBA 4P9IA 2WBKA 2YDEA 5BNPA 1RC6A 1UIKA 2A6ZA 4P5HA 1D4M1 3BPSA 2WZR1 1YEWA 4XXPA 3AX4A 4ITCA 1COV2 2HBUA 1XNTA 1DGWA 2Q8CA 3CF6E 3PNAA 3UJQA 5FY7A 4RA0A 3PVOA 2D5FA 3OGRA 4MXWA 1MACA 4ZU7A 2WO7A 4KBZA 4RS5C 4CUGA 3IDBB 3O1SA 2XBO1 3ZXDA 5L7OC 1W8HA 3POYA 2WNUB 1VRH2 3VBUA 2VZPA 3Q8CA 4H7LA 1FAYA 3WP5A 4DXTA 5CFCC 2RS13 2D5HA 1ZM1A 4XQ4A 1XE8A 2X10A 3AZYA 5CFDC 4AGVA 1BEV2 1PNGA 4DO0A 2N7GA 3UESA 5DN2A 1E5IA 2VULA 4IL7A 4AI2A 4AI0A 2PAMA 3ACLA 1LGNA 3DXUA 3DXTA 4KGQA 2AGSA 5JMCA 1PK6A 5JOXA 4L99A 5FYZA 3VDAA 3CDZB 1YC61 1PGW1 2W9XA 1S0EA 2BOJA 3R4SA 4JRAA 3KS7A 3KD4A 5C3RA 5IK4A 2HWC1 3BTXA 5FK8A 3RSJA 2A73B 3VHNA 2R063 1HLCA 3AKRA 5CKNA 3IKWA 5I8SA 1VB4A 3FC0A 4OUSA 3GNEA 3P3PA 4IQPA 3TN93 4AI9A 3K51A 1JI6A 1OSGA 3O1TA 1ENRA 1EPWA 2G1MA 2DVAA 3U37A 2VMCA 1CESA 1QY4A 1WD3A 3OPTA 4HVOA 3N7JA 1AR82 2GAUA 1RMU3 1RUD1 1QJX3 1H1AA 3WF3A 4A2UA 5FZ6A 3I54A 1M06G 4AI3A 1GUIA 4OYUA 4DEVA 4XXAA 2WZ8A 3HQUA 2YC2A 5LA0A 2B39A 5A3UA 3NAPA 4FPCA 4XAAA 4R9AA 1W0NA 1PGL1 1ZBE2 1LODA 3M3EA 3V64A 3VL8A 4AHYA 2YG0A 1ND2A 2HBTA 2ZOEB 2VNGA 1UF2C 1UOBA 1CJDA 2GH2A 2CV6A 3BPZA 2GC3A 4N90A 5JSPA 5LEKA 4NVPA 2XQRA 4QX7A 4ZXKA 4KI5M 4BQXA 4WV8A 4LO7A 1GQHA 1OQEA 5FY4A 4XFCA 4Y1UA 2CGPA 3LAGA 3ZSKA 5BNOC 4JQTA 3IMNA 1JYCA 3KT4A 2D43A 4LBNA 4E4HA 3LF7A 1GV9A 1UZYA 4PQQA 2A6WA 2PXJA 2VZVA 2JEMA 4JKLA 4IE7A 3JBG3 4BQ2A 2WAOA 1VBD2 4FAHA 1YJKA 1H8TB 5E89A 3VBFB 1VBA3 2ZBJA 4GIQA 4HPKB 3OBAA 3RJRA 1V6MA 3WQ0A 4FPOB 3ZPYA 1UX6A 2UWAA 4OMCA 3LPGA 4RHV1 1J3QA 1EY2A 3M3OA 5JIAA 1W6PA 1B35A 5FZOA 5C9AB 1K45A 3J7MA 3GZAA 4OQ9A 5D8AA 1RUJ1 1XSQA 3B3QE 3RPQA 5E88A 2PHLA 4LEJA 4XFGA 4J1XA 2ZEZA 5I8TA 1EUTA 2R041 1YJLA 3LQCA 1RXGA 3GHMA 5FJKA 2VG9A 4K20A 4HMZA 2R32A 3WCRA 3OB8A 3ZIWA 3RJ2X 3S5AA 1XJAA 1HRV1 4TN7A 1NCRA 4Y3OA 4BXSV 3I2KA 3MLKA 4GB33 4W6WA 2C9AA 1UU4A 4WZCA 4LHNA 5K0UC 1U5ZA 3LSDA 1JYNA 5FZ7A 3CJIB 4HKWA 2OZJA 5DAXA 2MEV1 5GM0A 1GP5A 1DGRN 1QKQA 3UL2A 4Y4YA 2VMDA 3SEEA 4K1ZA 4AR2A 4UW3A 1DBNA 1NAEA 1UQXA 3OY8B 1PNFA 1QJY1 1ND3B 4QQOA 3O12A 4V1PA 3VZNA 2ET7A 3X29B 1PMIA 1YFUA 2W1SA 3IDCB 3THTA 1ASJ2 2RM23 1VBC3 3I2FA 2ENRA 1NXD1 3OPZA 4PIYA 4BQ3A 5C7GA 1HKDA 1OH3A 1RHI3 1SDWA 2Y60A 4CCEA 1CIYA 2H6CA 4Z1VA 4XHXA 2B4KA 5KBFA 1NOVA 1WMFA 3ZYFA 2Y64A 2ZCWA 3N9PA 3POBA 4D6SA 5E8AA 5EJ1B 5BUVA 1F31A 2IXKA 3ECQA 1W2TA 2CL2A 3N7KA 1IKQA 3HQXA 2ORXA 3NNGA 3OYWA 5AVPA 2VQTA 2VCMA 3ZFFB 2WAAA 1JZ3A 3T2QA 2C6SA 2LW8A 3ZFEA 4OI2A 4RSUA 1Y7BA 1W8ZA 2WZPP 3CHXA 2E53A 1PVC1 3HNBM 5B4XA 2AC1A 2JDNA 1RUF2 3GF6A 4I02A 5HV0A 4XFFA 2ORZA 4QGMA 2NYYA 4QKDA 3SKVA 5ISLA 2PHUA 2V09A 1FMD1 1A34A 5AC91 1OFNA 1KFUL 3KF3A 1Y9QA 1ZVFA 4WVMA 2CNAA 1AHSA 4S2FA 5FYHA 2ZGRA 4W65A 2QBXA 1YFXA 4QX1A 4V2WA 4UFLA 4K7JA 4Y20A 3KLSA 3C2UA 4X8PA 1CN1A 3M4FA 3GZEA 2W87A 1GFF2 2MNGA 4WM8C 5FZCA 2RDNA 2J7MA 3ILFA 3A22A 5F7UA 1LOFA 2DU0A 2LRPA 5A3TA 4FOYA 4JVAA 2W92A 2HWB3 5A7SA 3AMMA 5KWRA 5FP7A 1WW4A 1O4YA 4E4SA 1J83A 2BV4A 1S2EA 5C4WA 1OVSA 3VBHB 2VNRA 5KXBA 1CPMA 2YFUA 3AMQA 3AYCA 4IEQA 4N43A 4PLOA 3WZ1A 4AHXA 1DF0A 3ACHA 3POFA 4KWJA 5IVEA 1OOPC 2ZMNA 3DECA 4KWKA 3FZ3A 3LOBA 1AYN2 4BIOA 1R1A3 1NY72 2MHFA 3HN1A 1MPXA 1GBGA 2HWE2 2XVLA 5F2WA 2KM2A 4HK8A 5DZGA 1RJ8A 2J1SA 4RFRB 4AVTA 1R092 2DTWA 4XJ8A 1MEC2 1XU1A 5F1RA 2A7AA 2NQYA 1OXCA 2GC1A 2QQMA 4A42A 1V9U1 3IPVA 4XC9A 4EN0A 5FQ0B 4Q0SA 3AMPA 1C28A 1JODA 4C0HA 3E6CC 1STMA 3KCYA 4JTOA 2H0VA 3AP4A 1JN2P 2E51A 2WS91 3ZPOA 1PGSA 4UFJA 1JYWA 1OF3A 3BUCA 2F4LA 1JU4A 3I49A 3GCXA 2QQVA 4JHTA 1RYYA 2BVBA 2YROA 3K75B 3AJZA 4AQ6A 3PTYA 3MF6A 2Q0AA 2GNMA 3H8OA 2RR11 4K8RB 2P4EA 3DPRC 5JUVA 4FFIA 1PIV3 2CHHA 1PVXA 5J36A 4HKOA 3KCXA 3NMBA 4Z2AA 1LOBA 4Q26A 4A44A 2VR4A 4A3XA 4EZ4A 2DBNA 4W6XA 2RHPA 5IJRA 3HOBA 3SCGA 5JWPA 5LRSA 1C3HA 2RVAA 4FQZA 3ZXLA 3ZO0B 3CBNA 3ZYPA 4U2AA 3JD71 4LBQA 5FBJA 1OURA 4EV0A 2QDRA 3ETPA 4QKNA 4Q4X3 5DDJ3 5T3NA 5DUUA 3BIEA 4GH4A 3OUIA 4YG0A 4XJZA 3E5QA 2X5IC 2ZGMA 2VBBA 4BOWA 1OLMA 2ZHNA 1HJGA 3WNPA 1AXZA 3B94A 3JZVA 3WW4A 2CAVA 4IETA 4MSVA 1GQGA 1E5RA 4JCKA 2R7EB 2FDGA 1Z78A 5DG1A 3UNPA 4CXWA 1J84A 1TE1B 3ATGA 3I3BA 5F6LB 4YZ1A 5CU1A 2OQ7A 2QJVA 3FBYA 2Z42A 3M3IA 4QD2A 2Q1MA 3POIA 3E5XA 3C7EA 1F4AA 1VAKA 1QXJA 2XQXA 3SMHA 4HLTA 3ITQA 3VN4A 2WYFA 2FQPA 3ZFGA 4BWOA 5IVFA 4QHBA 5LW9A 1FOD2 1APNA 2WNUC 5FYSA 1WW5A 2WQZC 3UV9A 3APBA 3LE0A 5CG8A 4QAWA 3MPBA 4M3CE 3CNAA 1VIWB 5C71A 3P6BA 4IV1B 4QX2A 4UW5A 3USUB 2WC2A 4GD4A 2D98A 5A6YA 4PI0A 1EUUA 1WBFA 3RWNA 1HV0A 3R6SA 5H9RA 2O8OA 2JB8A 1LOAA 3HNYM 2XOMA 2Y34A 4LO8A 4QXKA 4YW5A 2QQIA 3K4DA 4Y22A 2ZEXA 4OFGA 3MGUA 4QPGB 4Q4W2 3BIWE 3P3NA 5FK7A 3ZR5A 4CU6A 2GMPA 1W8UA 1OD5A 2ZA9A 5I91A 2YBPA 4ZY9A 3JUUA 2HWD3 2A71A 3J4UH 3FUOA 1POV0 4IEOA 4MGIE 5DAQA 1U5YA 5FY1A 4BH9A 2D6OX 2A70A 4KWLA 3N9MA 5BNNA 4BQ4A 1UYZA 5CADA 2UWBA 5EV7A 4MO3M 3U75A 1UZVA 1V70A 1N1YA 2ARAA 3RYRA 3UGGA 1OMIA 2PHWA 1H2MA 1UOGA 4M4PA 4JGYB 5FYYA 1K5MB 3JBG1 1RIRA 4N53B 2P17A 3AKQA 4AEDC 1RUC1 2OZ6A 2BUKA 1J59A 3IAPA 2R30A 1BVVA 5KXCA 4QPIA 2ID4A 5FYVA 1D0HA 4E9KA 5A33B 1SG3A 1TMF3 3RNSA 1MVEA 2V4AA 3I2JA 3MZHA 3A4UA 4CUCA 4RFT0 4XFAA 1WMDA 2XHKA 1N1VA 1DQ0A 1VB2A 3IT8A 3WF2A 1AR72 5FZAA 2I45A 2P2KA 3N7MA 3AP9A 5A32B 1XE0A 3I3MA 2FD8A 2ZGTA 4D7YA 3T3YA 4NPMA 1U5XA 3S57A 2YB7A 2PYTA 1PZ9A 3O7OA 4AEJA 2FDIA 2HWF2 3KGZA 4I0BA 1HXS2 3A0NA 3OGSA 1VBB3 3VLBB 4CP0A 3AVRA 2RS32 1WCUA 3I2GA 1KRIA 1IG0A 1UMZA 3VBOB 3AP6A 4ISQA 4MHRA 5GLUA 1H8TC 2P5BA 3VBFC 2ZACA 3WP4A 2JIGA 1NLSA 3WP3A 4JAAA 4YLZA 2IXCA 2JG9A 3FJSA 3AK0A 2ERFA 1O3SA 1RUOA 1W9SA 4IV3A 2LALA 2ZGOA 1QOOA 5C9AC 1O8PA 4AAXA 4L97A 5FMOL 2EXJA 1S0IA 1KGYA 1OBNA 1UU6A 4GMP0 2NM1A 2L9LA 4Y5TA 5ANQA 4MX3A 5JCTA 1RUH3 4YWAA 4IEZA 3LIGA 5FCCA 1D7PM 3LEGA 4JQRA 1BYHA 2CTVA 3THDA 1LULA 5HI0A 1WW6A 4IDZA 2JKXA 4M01A 4BDVB 1RUG2 1HJFA 5IHRA 1RVF2 1W6NA 5IVBA 1G86A 2FDKA 3CIHA 3CJIC 1OQ1A 4YVWB 2OIIA 3KVAA 5IYYA 2C9KA 4W8JA 3Q8FA 5DAWA 4DXSA 1S55A 5F5CA 3RZJA 4KU8A 4GKYA 4MGTA 5FV3A 1G9AA 1T6BX 2EF6A 3AB0A 3QH6A 4BPZA 1GZWB 4COVA 1COV3 2WA3A 1NCQB 1ND3C 2EAAA 3T2OA 1OPOA 1BVP1 3M3QA 5IAVA 3B01A 3NJZA 5IUQA 3PL0A 4CCMA 1JZ4A 1HRI1 1GP6A 2DWRA 2BYVE 2VU9A 3B69A 3I7DA 5I0TA 4ASKA 4YM1A 2QDNA 5HCHA 3SCHA 2VZ1A 1DQ1A 3O1RA 3TB0A 1N3QA 1WKYA 5GALA 1W90A 2VMHA 3FE5A 5GZGA 4BK5A 3WQBA 1AL0G 2XXZA 2ADDA 1BEV3 2HWB1 4I0WB 2QNKA 3ZFFC 3RVHA 3N9NA 3D3AA 2ZX3A 1D4VB 4CDWA 5FAXA 3NJYA 4UF0B 1POV1 5IT6A 5LBFA 2JE9A 5J1XA 1S0JA 1CAXB 2XJQA 5J37A 4YVSB 4B7KA 3PIGA 4DFSA 2OPWA 2VMEA 4UFKA 4R9DA 4IXLA 5CKMA 2Q5TA 3VBHA 5FZKA 3AL6A 5FXXA 4CXYA 3BTZA 1JYTA 4NAMA 1QQP2 1ZBA2 4L92A 3ZVXA 1U5IA 3H7YA 4AFAA 2Z79A 4LOSA 2IXLA 3K48A 4FPLA 3POSA 2ZX2A 3DV8A 4MADA 1GP4A 1EAH2 4IE4A 2Z4FA 3OEAA 1KS4A 1J3PA 4AQTA 1IPKA 4YG3A 4YM0A 2ZXQA 4M00A 5HCBA 3OTFA 1OKQA 4YZ2A 1S0FA 4NRMA 1ZZ7A 1GSLA 3LA3A 2FCVA 5T54A 4XTMA 2Y6FA 3WEZA 1CAVA 4FPJA 1AR83 1CPNA 4NHXA 4P9XA 3A21A 3ROUA 1BBT2 5JXHA 2E63A 4XPVA 3EO6A 4IEXA 3PMSA 4P5YA 4RGAA 2XONA 2OKXA 3NV2A 3I97A 1URXA 1VP6A 3ZN4A 3N7LA 2VMIA 2DF7A 4HSLA 3POJA 1HV1A 3FN9A 5J96B 4I01A 3T4HB 2DCYA 5FZ1A 5GJ6A 2WIIB 4BA6A 5JZGA 4KG0A 2VUJA 3VBSB 2V5DA 5IVCA 1ZBE3 3OGJA 3V56A 1CIWA 1X36A 2Y6GA 3MUZ1 1C8M1 2UY9A 4FI9A 2CDPA 2GNDA 4CDUA 3MIEA 1X7NA 3SC7X 1SFNA 4PI2A 4B29A 5K9YA 4UFMA 4XUOA 2ZX0A 3QOPA 4IEUA 4XIKA 2W1WA 5ABJA 4YGBA 2VW2A 1O4ZA 2XWBB 3IDAA 1UZZA 1UYYA 3IZOA 4LORA 4NJ4A 3AVSA 3B00A 4Q4Y1 2JECA 3ZN6A 2B45X 1IS3A 3VHPA 5FY8A 5JLVA 3OJBA 4GMP1 4A41A 2RDQA 4LE3A 2OUJA 1VBD3 2V5YA 2BP6A 2V73A 1R64A 4WM8B 5FPZA 2GNBA 4XF4A 5FZIA 1IQDC 4YW6A 5F9TA 2NMNA 4XMIA 4YW7A 2QFEA 1WCQA 5EZWA 1GWKA 4RQPA 4YGDA 3DEMA 2VMFA 3DN7A 2WFF1 4QXCA 1FT9A 3KV9A 4J1WA 3H8XA 2XLFA 1T2XA 4OHWA 3I59A 2ZGUA 3IWZA 1BLZA 1WA4A 5E16A 5DUXA 5C3OA 5C70A 4XABA 1SPPA 5HBAA 3BB6A 2VXJA 5EWSA 4C8DA 2ILMA 1F5FA 3LFIA 1AR92 1X33A 5FMDA 3VD5A 3KQ4B 1VALA 2DFBA 4A6SA 2DUQA 4CCDA 4HK9A 4CU7A 5A7WB 1IS6A 3VKOA 2XVGA 1YIFA 4CVUA 3FBMA 2GP3A 3BGAA 2R071 4OCTA 1VMFA 4IV1A 4CXXA 4EN7B 2YU1A 4LPLA 2WO1A 1V6NA 1TG7A 2JDAA 3SLIA 1G9DA 1OT5A 1MS5A 4DOUA 4G3YC 2H6BA 1D2SA 3N35A 1V6IA 4QU1A 1JZ8A 2C1FA 4ASLA 1POQA 3WDTA 2QQJA 3AFKA 1NE6A 1US3A 4J25A 3VD7A 1R1ZA 5LBCA 2WN2A 3PURA 1ASJ3 2ZGKA 4XACA 3GYDA 3JU9A 1GR3A 3P1IA 4RR3B 1D4M2 3DPRB 2WZR2 3LEMA 3LDKA 1AVBA 4QXHA 2HJIA 4PCRA 3ZM8A 1G9BA 4LA3A 4E8CA 4FVVA 2ZEYA 3VBRB 3I3DA 4QX0A 3T2TA 4QX3A 2DCKA 3KB5A 1NQJA 2CWMA 3KT1A 3K3NA 2VCCA 3B9CA 5BYNA 2J22A 1RUI1 2XBO2 4DIQA 1DDLA 1JTZX 4RS5A 3ZYHA 1MS8A 1CONA 2BRTA 2DVFA 1MZ6A 2PMWB 4QDSA 1H4GA 4KG8A 5L7OA 2G19A 1LOGA 2CSGA 5FWEA 1RUF3 4QPGC 4B8EA 4FSJA 2X5IB 4U36A 5CFCA 4FTEA 3PDQA 1L3JA 3KWVA 3KZ4C 3WY6A 1NE4A 5CFDA 5J98B 3THCA 3WXPA 4DXRA 3LA2A 3UK9A 1JZ5A 3OD0A 3KSCA 3SNMA 3V0BA 4LK7A 2GSYA 1VAMA 2VMGA 4XCAA 5FZ3A 4TZDA 1PGW2 5FZMA 1AYM1 4NN0A 4I09A 3U1XA 2HWC2 1LJ7A 1G9FA 1QXRA 4CZSA 1VBB1 2BWCA 4PJYA 1OQDA 2WNOA 3FMGA 2QE3A 4JGYC 4HL0A 4CUAA 5FPVA 2D6MA 5G05L 1AR63 1K5MC 2W2IA 1S0BA 4N53C 2RMU1 3VHOA 5FPLA 5K8SA 5KHGA 2XPJA 5FXWA 2JDPA 3MW2A 1PM4A 3ZSEA 2VW1A 2Y33A 3O0WA 5EJ3A 2OS2A 5EP9A 2HH9A 1PX3A 1UZ0A 2ZHLA 3Q9OA 1REEA 1PM7A 5A6QA 1C8NA 2ARBA 1AYN3 2XG3A 1RUD2 2HWE3 5EJZB 1K42A 1B09A 4Q1RA 1KXGA 4QHZA 4XBLA 1Y3TA 1R093 1WMEA 1MEC3 1YFYA 4MV2A 2HEVF 2C0ZA 3U4SA 4FO9A 2XR4A 4GZ9A 3RI8A 4FP3A 4QX5A 1Q56A 1IGOA 1QEXA 4ES8A 4KH9A 2ZMKA 4QB1A 1JYXA 1O8SA 1HIXA 4Z8BA 2ZS6B 1RUE1 1PGL2 1ULEA 3VZJA 1LHOA 1UXZA 2KA3A 3MIGA 4FT8A 1Q5OA 4Q0PA 5A7PA 1DIWA 2ZX4A 3VBOC 5A3WA 4COYA 4MOAA 2A6YA 3EJKA 3JCIA 4A6OA 4ET7A 3IDEA 2FZ2A 5J3UA 4GAZA 3EQEA 4AEDB 3K4AA 2QVSB 2LTNA 4KWUA 3ZXGA 1DHKB 3WCSA 1JZ2A 5FZ8A 5BNOA 1V6OA 4JKMA 1LGCA 1WLDA 3ACGA 3TEWA 4JHZA 2AZ5A 4CPBA 3D0SA 4CP9A 1PO23 3HN3A 3RZKA 3WNKA 2BFUS 4LIVA 1UAIA 5F5AA 2O14A 1NLRA 2DUPA 5A70A 4RHV2 2DCJA 5A3PA 4BIFA 4XBQA 4XHBA 1UY0A 2UWCA 4XJWA 4FTSA 1W8OA 1BEV1 1ULFA 5DAPA 4EJRA 3N4MA 2XMLA 1PO11 2IFRA 1F5JA 5A7OA 4RGGA 1HQLA 1RUJ2 2UY8A 4BZ4A 3RFRA 4A3ZA 1UPSA 3USSA 2XLGA 2GNTA 1HN0A 1N3PA 2R042 3FWEA 4YGCA 4YVWC 1UX7A 1RGSA 4HXCA 3ZXJA 4XIOA 2ATFA 5B2GB 1IPJA 1HRV2 4TLFA 5JPMB 5KHIA 1JU3A 3MF9A 5JPNB 1DU3D 1W2UA 5FR3A 1NCQC 4X6QB 3LDBA 4XURA 1SLIA 3DL3A 4IEVA 2QQKA 3DYPA 5C5TA 3CZUA 5I8YA 4N9HA 5K0UA 5FMCA 1CAXA 3AYEA 4BLJA 2MEV2 3RYKA 3MHZA 4HN1A 4HETA 4D3WA 2PHTA 1FOD3 1AL21 5T50A 5L73A 4YW3A 1XYPA 3PVBB 1UW8A 1QJY2 2E6VA 1EV11 3FFZA 4IGOA 2JDMA 2EXKA 4BQWA 1UMIA 3WNMA 1FATA 4ZKTB 1W8TA 4N7UA 3TBDA 1ACCA 4HT1T 3WR0A 1LHVA 3ZXKA 1WZXA 1UOFA 1VE0A 5FUNA 1A3KA 3NNJA 2J1RA 3NKTA 2XKPA 5D1IA 2X29A 2B8MA 4ZONA 2FDFA 4LKDA 3GZTB 4OUEA 3OGGA 4DPNA 1YQ6A 4Q4V1 4A4AA 1LRHA 3I4IA 4CDXB 4W6YA 1HX6A 3J8F1 4Q4W3 4YVSC 2VH9A 4COZA 1DZTA 1CZVA 2JDHA 3ZYJB 4H3WA 1OC1A 3PTRB 1Q43A 1V6LA 1FV3A 3NQHA 3ORJA 2RS51 2OYZA 1NA1C 4JDMA 1O4TA 4XFHA 4DUWA 4C90A 3WV6A 1PVC2 2VECA 1RXFA 4NRQA 2WQ4A 2WKKA 1BJQA 3KF5A 4Y5Z0 1QNYA 4ZU5A 4HANA 1O5LA 4Z82A 1TNFA 4UXAA 3RI9A 3WX5A 1GZ9A 4EN8B 2RJ2A 1FMD2 1ZX5A 1GZCA 1GYKA 3QCWA 5FZDA 5AC92 4GALA 1U12A 1Z7S1 2R16A 2VZ3A 2ZAAA 3MIDA 4D94A 2VTXJ 3LB9A 4PF1A 2AREA 1C1FA 4XYXA 4H14A 3W9AA 1QU0A 3BODA 2BTVC 1FV2A 5KHKA 2W52A 5CA6A 3C7OA 3OD4A 1CX4A 1GNYA 2QQUA 2CU5A 4JGZC 3TNQA 3WNOA 3MUY1 2WO2A 2PQSA 2V72A 2JX9A 3QD6A 1DZQA 4NO4A 1ULGA 1WW7A 1LECA 3CU7A 4WM8A 3J7LA 1HQWA 2EA7A 1UMHA 5KR7A 3U11A 1W05A 3VBSC 1AR73 1V6JA 4WVVA 2VVFA 3O1PA 1QF3A 2R1BA 2YZ4A 3RG0A 1VJ2A 3B5LB 1LOEA 3UKTA 5GZDA 3C7FA 3ON7A 1NZCA 1W8FA 2YGLA 5DZEA 5F3CA 1QJEA 3ABZA 4QB2A 5HV4A 2V4VA 2HWF3 1IS4A 2XJPA 5FY9A 1HXS3 2IC1A 4UOJA 3PJYA 1ODMA 1OOPA 1CZTA 2XH6A 4NIGA 2A6XA 5KXEA 1WCSA 3MW3A 1MS1A 1HB4A 2RS33 4OZXA 5F5IA 4B1LA 1TZOA 1UNBA 4BM8A 2HEWF 3C3VA 1RL3A 2WLQA 5ANNA 1EYBA 1V9U2 4P00B 4BISA 2BBVA 5A7WA 1W3XA 1YIPA 2Y6KA 1OPMA 1Q8SA 3FL7A 1I5ZA 5APAA 1AX0A 5FBZA 3S30A 3VZMA 5H9QA 2E32A 1HB2A 3H3UA 3MV01 5LRRA 3U10A 3MYXA 3PLQA 2WS92 5JIUA 4B4PA 1HN1A 3H42B 4QXBA 4LT5A 4C1XA 1AXYA 3L2HA 1CAUB 4RGKA 5T5LA 1FPN1 1W6MA 1LCLA 3U14A 4AI8A 1QJU1 1XSRA 4N8MA 2XUMA 1JBCA 4M3CB 4AYUA 3I2DA 2R49A 2RR12 4ES9A 4RN5A 5JAXA 4QQPA 4BU2A 3IM0A 4UT5A 5A7NA 1QHDA 4NIIA 1TME1 2PLV3 4F8AA 4O61A 1ENXA 3IBMA 4QWNA 1VBE1 4TSVA 1S0CA 3DPRA 3LKJA 1RUG3 5JVVA 4UFIA 1ZRCA 1W2AX 4QX8A 1BK1A 2YC0A 3ZIXA 3O1MA 2FMDA 5IK5A 2QQOA 3JB4C 1RVF3 5G04L 1VMHA 4PHZA 5KHJA 3PIJA 3LDRA 2GC2A 1RJ7A 3JD72 1XU2A 2PHDA 4CDQB 3INAA 2W0XA 4YPJA 3MDPA 4I2OA 2W39A 4CUBA 4FPGA 3ZDVA 3PU8A 2VOXA 5CKQA 4DXZA 4QDQA 3WLUA 2JENA 1FX5A 2OPKA 4CP1A 3C8XA 3CJXA 5FPUA 5F8PA 2VCBA 2IZWA 2X5IA 5FZ0A 4LITA 1DZRA 4RR3C 2J1AA 3VZLA 4NWVA 4KMQA 4P9WA 1XYOA 2P3JA 3NNFA 3W5NA 3AC0A 3KT7A 1H6YA 1FXZA 3NSTA 1JH5A 3UGHA 3VBRC 1DYKA 4QGLA 5JI7A 3WF4A 1AR61 1QMJA 1S1AA 3NV1A 5BNQA 2VC9A 2VQUA 2RS11 4FFGA 2W94A 4D0QA 3HAGA 5CAZA 3AXEA 5FMBA 1DLLA 3KGLA 5FYMA 3HT2A 5LATA 4J6GA 3FLRA 2WNUA 3GJBA 1T6GC 1X8EA 1XRUA 3C7HA 4LOTA 3WW3A 3WT3A 3JXSA 5JI9A 2W1QA 4YW4A 2WABA 3OBZA 2XJSA 3PVEA 1QQP3 4AFMA 1ZBA3 1ZZ8A 4ZPIA 3MIFA 5C5UA 5T5OA 3BALA 3VZOA 5KXDA 2Q8DA 2QZ3A 3AXDA 1TEIA 1IHMA 2AR6A 1EAH3 5AVAA 3ZMOA 2JG8C 1TQ5A 2AEZA 2R061 2YPDA 2QQNA 2YMZA 2ZGLA 4NAOA 2C24A 3WOGA 3T2PA 3UYJA 3TN91 4LMFA 2WNVB 4Q27A 2QKDA 3POGA 3JQWA 2AH2A 1BBT3 3MFCA 4OHVA 1REFA 2OA2A 4NWWA 2OVUA 4BK4A 4BXFA 3QBQA 3ZMNA 3SQOA 1XB9A 3ETQA 2EIGA 2VNVA 3GDBA 4FAGA 5BXXA 1RMU1 2WL1A 2G9GA 4BJ0A 2PHXA 1QJX1 5HXMA 1GOHA 2VZUA 2FMYA 1RUC2 4DY3A 1PO21 1X8MA 1YFWA 4PDWB 2WFPA 4AEDA 1K3IA 4FQ4A 1F4HA 2YBSA 5DABA 2YXSA 4XDOA 4XFIA 3EYPA 4AL9A 2RJLA 2ZJCA 3TRSB 5GKAC 1MQTB 4P08A 2EALA 3RQ0A 4NIDA 4CCLA 4BE3A 2IXHA 1G7YA 4K1YA 3O1VA 3VDDB 4NPRA 4P14A 4DQAA 5IW0A 1VAVA 1SFYA 4JDNA 1YO8A 1W9YA 2DCZA 3BOPA 2DDUA 2XB6C 3SXWA 4OMDA 3WDWA 5FWJA 1R083 2P3YA 2VE1A 1NG0A 4P9GA 5C8CB 4AF9A 4XBNA 1GICA 4C0BA 1LENA 2FZ1A 3EHKA 4G4FA 5T5PA 4ZHNA 1VBA1 4DUXA 3ZOIA 3OG2A 1YI9A 1H1IA
chains in the Genus database with same CATH topology
1O3TA 1AJOA 5FO9B 2GU9A 1Q3EA 2DFCA 5KHHA 1H8TA 3VBFA 1ZZCA 1LESA 4HPKA 1J58A 1OLRA 2SLIA 1AR93 1ONAA 1GLHA 5C9AA 3HWJA 1HW5A 4IEYA 1W6OB 4GB31 4FP2A 1IQAA 4M3CF 1BXHA 3ALQA 3WD5A 3V0AB 4CEWB 4R52A 4FCAA 5DUVA 5AFEA 1ZA4A 2QCSB 2XJRA 3U07A 2P3IA 2LUWA 2GN3A 3PMEA 2Q8OA 3CJIA 5E1RA 3RDIA 1D4M3 4YNIA 2WZR3 4YZ4A 5F6KA 1KDMA 1RB8G 2RM21 1VBC1 4WM7C 1RHI1 3HIFA 5EFUA 3RZZA 3OY8A 2RE9A 1ND3A 2ES3A 2PHFA 1BQPA 3GBFA 1HRI2 2YY1A 3CL1A 3WW2A 2XBO3 2OW4A 3AZWA 2CWSA 3JQXA 1OHFA 4CDXC 4D7TA 1OI6A 1SLLA 1PK6B 1SLCA 2P37A 4IEWA 4LBOA 4YYOA 2HWB2 4AG4A 4R9CA 4Q0VA 3D5OA 1CAWB 1X82A 4CEYC 3OBRA 3AZVA 1JHNA 4H7MA 3ZFFA 2B7YA 4OULA 2GN7A 2H0BA 2XL9A 2O1QA 4ISRA 1C57A 1OA4A 2ZMLA 1QH6A 2HWC3 3BOWA 1DQ5A 1H9WA 4MH0E 3AMNA 3GALA 1F9KA 3HMYA 4O9EA 3N3HA 3S7IA 1VRH3 1HDKA 2VUAA 1ZRRA 2X8KA 2I07B 1CGPA 1C1LA 4XMAA 2ZGQA 4S2HA 1SCSA 5DUWA 1FI2A 4B4QA 4LULA 5CIRA 2Y0IA 2R0FA 4FPFA 2WLPA 2F6BA 1SMVA 1M4WA 1RUD3 1SACA 3NAPB 2X53S 4UW6A 2A75A 4AWDA 4H55A 2NLRA 1ND2B 1R1A1 5FLIA 5BPXA 1XE7A 2PLV1 1CAUA 1AJKA 1LHNA 2AENA 2BNOA 2BQPA 1NA1B 3R4UA 4LE4A 5J7MA 2P34A 1C8M2 2XKOA 2D7FA 4JRLA 4G9SB 1RITA 1N1SA 2D93A 1DQ6A 2Q1ZB 2UYAA 4AQ2A 4DMIA 1OA2A 5FQ0A 3ES1A 4LBKA 4Q4Y2 2ZKLA 4I3PA 1W6PB 2O0OA 1B35B 1QH7A 4JC1A 3PJQA 4JGZB 2ZGNA 5D8AB 1PIV1 4HBNA 1JOJA 3BCWA 1WLWA 4AQSA 5JSOA 4FXKB 4DRVA 5FDBA 4BMEA 1LEDA 1WLTA 4YZ5A 1MZ5A 2K2SA 1BMV1 1NCRB 1X50A 2WFF2 4XOGA 1RUJ3 3ZXFA 1IKPA 2GH8A 4Y26A 2UURA 4OI1A 4HVRA 2BEOA 2R043 4Q4X1 5DDJ1 5CBLA 1RUNA 1O91A 4COWA 1A6CA 4UW4A 4Q8LA 4CDQC 2VVDA 2WJSA 3NWKA 4C1WA 1O3RA 5FRAA 1DQ2A 3AKPA 2SBAA 1H0BA 2R072 4BCUA 4HVQA 2MEV3 3S0MA 2JD4A 1F2NA 3M70A 2D3RA 2R6QA 3D6EA 1GNZA 4B4RA 3OCPA 1N3OA 1A78A 1QJY3 4R9BA 2ZHKA 2ZGPA 5ACA2 3FHIB 2I74A 3ASIA 2YYOA 4XE9A 5BY5A 4OHZA 3WW1A 2WNEA 3WQ7A 1XXNA 4YFZA 1MZFA 4A7ZA 3ZFEB 2WT1A 4KGGA 4HSJA 4K21A 5IK7A 5DXDA 2E9QA 3H8UA 4AVSA 3USUA 1RUI2 2DURA 1KITA 1G8WA 3ELNA 4LHKA 1AX1A 1QNWA 1PVC3 5FLJA 4LHLA 1JUHA 1O5UA 2WT0A 4WVMB 4AK3A 1AXKA 2PAKA 3TNPB 2HWD1 4M0NA 1LGBA 3LSEA 4HKLA 3RS6A 4QPGA 4XQDA 1CD3G 2D97A 2JXAA 1QJZA 5AC93 2NPIA 2WNVC 1OFSA 1YYNA 3VDDA 1R081 3H1WA 2JJ6A 1AYM2 2I2SA 3H7JA 1MVQA 3H9AA 5DZFA 2DUOA 2ZHMA 1VBB2 5C4WB 1G9CA 4AW7A 4AFCA 2RMU2 4JGYA 4AVCA 2TEPA 1G6NA 1TMF1 4PDWC 3RMXA 2VGDA 1K5MA 4N53A 1SQ4A 4FOQA 4B7EA 4LO6B 2Z69A 4NOTA 1MQTC 5H9SA 1WCKA 5CB7A 1LHWA 1WCDJ 1RINA 2WSUA 1FNZA 3IPVB 5A33A 3VDDC 4AE2A 1IOAA 4ZU4A 1UCXA 2GMMA 1JW6A 3LA7A 4OUMA 2IWGB 2WA4A 1NYWA 2JG8B 2TNFA 5KC6A 5A32A 4FOWA 1V9U3 1Z0HA 1Y43B 4AI1A 5C8CC 1ULDA 3R05A 4IERA 4QQ2A 1RUE2 2GC0A 2WS93 3AKSA 5I0RA 3V0AA 3AKTA 3KMHA 5H9PA 1LKNA 3VKNA 1SEFA 2VQAA 3N36A 2QQPA 2A3WA 3VBOA 1PZ8A 5TSWA 1F8VA 3B9IA 2G9FA 2RR13 2ZX1A 2NN8A 2HKXA 4QM9A 5GLZA 4D7SA 1RUH1 2VY0A 4LBQB 1JXNA 5EXOA 4YSFA 1UKRA 4GH4B 3WHUA 1ZZ6A 4EN6B 2YGMA 1ZREA 5A3LA 5FPXA 4LR4A 5FOJB 3JD73 2EXIA 4KNCA 5BNPC 4CEWC 4GA9A 4ATEA 1UKGA 1HQNA 5FFOC 4UBHA 1PO12 3H50A 4O9GA 2CY6A 3TWIA 5BV6A 4E2GA 4WVZA 4AFDA 4DS0A 4PLMA 2HEYF 1COV1 3M1HA 4INDA 4AHZA 4NHMA 4C91A 3QACA 4YVWA 1CAWA 2XVKA 1CVNA 1H4HA 3IN9A 5GLVA 3ZFGB 4XJ9A 2VXRA 3VBUC 4X6RB 4E4DX 1GZWA 1ZRDA 1NCQA 4S2GA 1VRH1 3POWA 3ZSJA 4XF9A 1H8VA 1AL22 3TOJA 3ZXEA 4B3NA 3MPPG 4HFSA 4MLOA 3ZYRA 4I3GA 4AGRA 1EV12 4Z2WA 4GWNA 2B46X 1H30A 1PK6C 2ZZJA 4Y22B 1OA3A 3T1LA 4Q0QA 4XJAA 3V65A 3W58A 3NW4A 3CEWA 4LBQD 4M0HA 5C33A 2FBEA 4JV4A 4Q4V2 3ZSMA 1H2NA 3J8F2 4YW1A 3J9SA 2ET1A 1ZNPA 1KDKA 5BNNB 3PVNA 4YVSA 2CYFA 2D3PA 3AMHA 4NHLA 2C5DA 2VW0A 2RS52 2A5ZA 1ULCA 4Y1VA 4NHKA 2E7QA 2XWJB 4MYEA 1NA1A 3VKMA 3ZSLA 4HN0A 1C5IA 3B7MA 3H0OA 4WM7B 4Y1ZA 2DVBA 3TYJA 4D69A 1AR81 4QPIB 2IFWA 1BZWA 5LK7B 1MS4A 1Z7S2 3T1MA 2UU8A 2F4PA 3OBTA 5FLHA 1RUC3 4LTAA 3NAPC 2A3XA 3FLPA 4LBLA 3ES4A 4AFBA 1ND2C 3E6DA 1ZBE1 2B9UA 1AZDA 4LUMA 4JGZA 4CEYB 4OI4A 1UU5A 1A8DA 3VKFC 1D2QA 1YHFA 2GALA 3D4KA 1Q8OA 2VOKA 1N47A 3VBSA 2VOWA 4YM3A 1O3QA 4MXVA 5J48A 3MLLA 4JDOA 4L11A 5EYXA 4PQ9A 2D40A 1VBD1 4L9BA 2JG9B 3ILNA 2BNMA 4GKXA 2TBVA 3O14A 4IV3B 1B35C 3TAYA 4GQ7A 2ARXA 3GHNA 3MW4A 1NXMA 5D8AC 2BPA2 1KFXL 3HBZA 3H1MA 1DQ4A 3CO2A 3O0VA 5L36A 4FBFA 1NCRC 4I30A 3VKLA 2XJUA 3URFA 1FPN2 1S2KA 1LU2A 1QJU2 4BHPA 1W6NB 1YWKA 3WVJA 2FHRA 4MUVA 1WD4A 1TME2 2HYKA 1VBE2 5DG2A 2JE7A 3WDUA 1BKZA 1D0GA 2DVGA 2IXIA 1XNCA 2BNNA 4E2QA 3WDYA 2ZPXA 4TWTA 3G6JB 2JKBA 1ASJ1 4YZ3A 1XNBA 4COUA 1FYUA 4CP2A 5HCAA 3WINE 1GANA 4R4ZA 2YPJA 1HRI3 2W68A 4RL7A 4YFWA 2XJVA 4QU2A 1KQRA 4RR3A 2YHJA 4CDWB 3ZFEC 4GWMA 3HT1A 1JUIA 1QXPA 2VNOA 1AR62 2K0GA 5C6CA 5GZEA 2Y26A 5FMOS 3VBRA 3WUDA 1ZYBA 4P9LA 2RS12 4LNVA 1A8MA 1RUF1 4Q1PA 3UKNA 1J3RA 1V00A 4META 1POV3 4QPYA 4ORFA 2G4IA 3U4XA 3WHTA 3B02A 2TUNA 3A0KA 4KBBA 4R8HA 5F5QA 4OHYA 1DYPA 3NVCA 2PTMA 2ZABA 2BWAA 4DRRA 2DVDA 1LOFC 3VZKA 1AF9A 3L2YA 1CAVB 5A3MA 2ZTNA 3AYAA 2R062 4WZFA 5T52A 1I6XA 2JG8A 5C4WC 2BFUL 4LBMA 4N43C 4URTA 1CR7A 3TN92 3CLPA 3R0RA 1UN1A 4EROA 1Q8VA 5JZGB 1J1LA 2XLAA 2KXLA 3DUIA 3MICA 1H2LA 1AYN1 1NY71 4AGGA 1RMU2 3M2MA 4CDUB 2HWE1 1QJX2 2AUYA 3LOIA 3AZZA 3WG3A 1R091 1MEC1 4LA2A 3DKWA 3ME2A 4AVAA 1PO22 3FUQA 5ABJB 5AFBA 3SHRA 3LZZA 1C8M3 4MGKE 3ZN6B 4F3JA 2WSVA 4Q8KA 1BCXA 4ASMB 1AUYA 3AM2A 2BVVA 2YV8A 5HCFA 4Q4Y3 3EBRA 1GNHA 5GLWA 2PFWA 4LUKA 4RQPB 3ZYIB 4GMP3 5JR7B 1KJLA 4PLNA 5GZCA 1LR5A 1S0GA 2A6VA 5CVRA 3NO8A 3U0ZA 1QOSA 3I59B 1DGLA 4QGNA 3JBG2 2D6NA 3AYDA 3ENRA 4FXGB 2R1DA 1LOCA 1DGWX 1VBA2 4P9JA 4AVBA 3S7EA 1UIJA 3VV1A 2WFF3 3VGIA 4RD7A 4GH4C 4SLIA 5SV8A 4DNYA 4OI0A 3FFQA 5I0SA 3AZXA 5GZFA 1XNDA 4LO5B 2RJKA 1I9RA 3QH7A 2XJTA 2IXJA 2R073 4GB32 1LEMA 2JICA 1CQ9A 3DGTA 3ZX7A 5JOZA 1AX2A 2W08A 2D44A 5C8WA 1VR3A 3ZFGC 2ZKNA 3E97A 2AYHA 2DTYA 1FOD1 4Y1XA 5ACA3 1H9PA 1U0AA 1SBFA 3L9JT 1W6QB 3WG4A 1H2KA 4EWEA 1TNRA 2WT2A 4BQ1A 1S2BA 3WDVA 3H3ZA 1DGRA 3SH4A 3WUCA 2RM22 1VBC2 4RS5B 1EPZA 2Q30A 4XETA 2XL7A 1RHI2 3G7DA 1SLAA 3ZYGA 5L7OB 4I0AA 3J26N 4WM7A 3EXUA 3BU7A 4BYYA 1CJPA 5CFCB 3DF0A 1RUI3 1KJRA 3KQRA 4Q4W1 5BNPB 1MR5A 2DCTA 1YLLA 2PA7A 4YM2A 5CFDB 3VHRA 1KS5A 3V0BB 4L8QA 4BLIA 5LK5A 4CDXA 3FX3A 5BNNC 2Q4SA 1W0OA 3KM5A 2UYBA 3WG2A 3O5SA 4MGZE 4MXWB 3SCFA 4CEYA 1ENSA 4A7KA 3I8TA 2DU1A 4F83A 4QMAA 3VBUB 2QUOA 1AYM3 4QPIC 1JYIA 5FO8B 1NQDA 2CGNA 1KD7A 2B5HA 4FPHA 3ZXAC 4L2NA 1ALYA 2RMU3 4E4ZA 1W39A 3KCCA 1O7FA 1N1TA 1REDA 1J1TA 4FPKA 4E2SA 1Q8QA 2GMEA 2WWSA 4E27A 2P3KA 4KU7A 1SBEA 4YRDA 1AR71 2WINB 1ZZ9A 1ZZBA 4WVWA 3M8LA 1MS9A 2EAKA 4XDQA 1SCRA 1DFQA 3SISA 4LLOA 3HR9A 3M3CA 4IESA 3WP6A 4DY5A 2NP0A 3NL1A 4OHXA 2HWF1 1R1A2 3ZN5A 1HXS1 2PLV2 2ZAHA 5JOWA 2RS31 2D3SA 5I93A 4EN9B 1SBDA 1LU1A 2JDZA 2LM3A 1DG6A 1RUE3 2JG9C 3MEPA 4Z07A 4QQLA 4IV3C 1H1MA 3S6PA 4Q2FA 1ENQA 1YXWA 2VOVA 4MGYE 5GLTA 2DV9A 3SH3A 5BNOB 1IS5A 4FPEA 2EVXA 3PHMA 1QOTA 2GZWA 4R4XA 3RMYA 3JB8A 1PHMA 3RYPA 4K8FA 3ZDSA 4EWAA 4K9SA 5JDBA 4AHWA 4F7ZA 3MFAA 1LHUA 1PIV2 2ETEA 3OF1A 4QQHA 4FTBA 4LBJA 3VL9A 4DZGA 4Y1YA 3HD8B 1RUG1 4PIXA 3GBWA 4BMBA 4JTNA 3ILRA 1RVF1 4M3CA 1MS0A 4XJUA 5EYYA 4XFBA 2ZGSA 1PO13 1BMV2 1RTVA 4GXLA 1UPIA 1VLNA 5LEJA 5FREA 3IIAA 4XF0A 4Q4X2 1XNKA 5DDJ2 3SH5A 5K0UB 2YUEA 4AEMA 3WQ1A 1Q8PA 1V6KA 4GULA 1OLQA 2DYCA 2PN5A 1LB2A 2PHRA 3LCPA 4CTEA 4CDQA 1WLCA 3WDXA 5CG9A 4NR1A 4LO4B 4XF3A 1SLTA 3AJYA 3AP7A 4EWDA 4ONUA 4Q29A 2GDFA 5K7PA 4YARA 1QDCA 4KQ7A 3NKGA 3FLTA 1WGPA 1FNYA 4DB5A 4PF5A 3D8CA 1AL23 1LTEA 4RHV3 5FOBB 3R4DB 1C5HA 2R0HA 4CDWC 1EV13 2NMOA 4XZPA 2K9ZA 3B93A 4Q0UA 4UBGA 4ATFA 3LGRA 2E7AA 4CRQA 5FO7B 3VBHC 3UKVA 1HRV3 4Y24A 2MPFA 5JSRA 2BW8A 4FOVA 3H1YA 2EXHA 1W0PA 3UJOA 4Q4V3 2OUHA 1QDOA 3LWCA 3J8F3 4MVTA 4LLFA 1QQP1 5T55A 1ZBA1 1C4RA 2NZ9A 4AXOA 1IZ3A 5FTTC 1EAH1 2RS53 5I0UA 4K6BA 4XILA 5SV5A 4YW2A 4S2DA 3THPA 1EP0A 5L19A 3MI8A 1MS3A 1YUDA 2BGCA 2PQQA 4AEKA 2HWD2 4IEPA 4YGEA 1BBT1 2D6LX 4XEZA 2PELA 1Z7S3 2A3YA 3GZUC 2XGXA 3OYWB