1ENXA

Structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE II
publication title Structural comparison of two major endo-1,4-xylanases from Trichoderma reesei.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 54
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1enxA00
3WT3A 1H8VA 3VL9A 1T6GC 5K9YA 4S2GA 5EJ3A 1OLQA 3VZJA 3MFAA 3WQ0A 1BVVA 1H1AA 3LGRA 2VG9A 3MFCA 3WP6A 1YNAA 3LB9A 2B45X 3AMMA 1OA2A 3WXPA 3AKRA 2C1FA 1XNBA 3VZLA 2QZ2A 4HKWA 2B42B 1TE1B 4IXLA 3O7OA 2Z79A 4XPVA 3WP5A 3WQ1A 1QH6A 3MF6A 2VULA 4S2DA 3HD8B 1NLRA 1BCXA 1OLRA 2BWCA 3B7MA 4NPRA 5HXVA 2VUJA 3AKSA 4HKLA 2DCZA 1C5HA 3WP4A 3AKPA 1ENXA 1M4WA 4XQDA 1H4HA 3VZKA 3VHNA 4HK9A 3VZMA 1HV1A 1IGOA 4S2FA 1OA4A 1REEA 3WY6A 1HIXA 1XNCA 1UU4A 3VGIA 3VL8A 4S2HA 2D97A 2BWAA 2DFCA 2BVVA 3AKTA 1UKRA 1XYNA 1XYPA 2BW8A 1XYOA 1F5JA 3RI9A 1HV0A 2QZ3A 2DCKA 3RI8A 3VLBB 1AXKA 3VZNA 2DCJA 2JENA 4HKOA 3WR0A 3AMNA 1C5IA 1W2UA 4XQWA 3VHPA 3B5LB 3VZOA 2F6BA 1BK1A 2D98A 3AMQA 3WX5A 2JEMA 3AKQA 3AMPA 2JICA 5K7PA 4XQ4A 1KS5A 3WQ7A 2NLRA 2VGDA 1H0BA 3M4FA 3MF9A 3WP3A 1UU6A 1QH7A 1REDA 4H7MA 1REFA 1UU5A 3AMHA 3EXUA 2DCYA 1XNDA 1OA3A 1PVXA 1H4GA 1XNKA 3VHOA 3ZSEA 4HK8A 1KS4A 2DFBA 1XXNA 2B46X 2NQYA
chains in the Genus database with same CATH superfamily
2H6CA 4WVWA 3S7EA 5LWBA 4JDNA 4GJZA 4CCDA 3ZPYA 3HWJA 4B8EA 2HWE2 1GU3A 4KBBA 4MG2A 1UX7A 3N7MA 1RHI3 2XXZA 5FR3A 1YXWA 2D6MA 3ZMNA 3KWVA 1CAVB 3ZDSA 3SISA 1BBT1 2V73A 4D0QA 5D8AC 4N9IA 2VNGA 3IAQA 2CAUA 2VG9A 4AR2A 2JDPA 3WG1A 4RS5A 5A3NA 4MLOA 1LGCA 2JG9A 5FZLA 2J1EA 2ZAAA 2C6SA 4LULA 2ZZJA 2E31A 1BJQA 1I1EA 4OZOA 4A45A 5C4WA 2C1FA 2GC0A 3UESA 5FYHA 1HN0A 2QZ2A 4ZPIA 3WG4A 1TE1B 2JDKA 4IXLA 4AEDC 5J36A 2GNBA 1Q8VA 1BEV3 4AYUA 1H2KA 3N7KA 3P3NA 4NIAA 4QX2A 2HBUA 4KL1A 3I2OA 2SBAA 1VAKA 1YUDA 4AAXA 2G9FA 5FZ6A 4YW4A 3T4VA 1NY71 2VW1A 5A70A 2G1MA 1O4ZA 4X8PA 4CCKA 1XOYA 3VHNA 3GJBA 4HBNA 5FY5A 1XBFA 2Q1ZB 2XUMA 4NAMA 2BERA 3LEMA 3HJRA 1IGOA 2LS6A 1ND3C 1S0CA 1ZBE1 2A3YA 3KF5A 1PMHX 2R063 2X09A 4LMFA 4Q4V2 1HRI1 2VW2A 2YPJA 1HDKA 4P9YA 5L9RA 3SXWA 3W9AA 3KVAA 2G9GA 2WFPA 5A33B 1V9U2 4LO7A 4LR4A 1W05A 1QGLA 4Q2FA 2Q1MA 3HOBA 5CKMA 3VBOA 1W6PA 3PMEA 3K4ZA 4E8DA 5C5TA 1UMIA 4S2HA 2R0FA 1ZZ8A 3H1YA 2D97A 4FOYA 1I9RA 2VZRA 5LATA 5FPLA 1X9PA 1LU2A 4AHYA 2CNAA 2RE9A 3WF0A 1QKQA 5HI0A 2OT7A 1QQP3 3B94A 4CDUC 2C5DA 5AVPA 4HXCA 2BBVA 1K5MB 3MIBA 4RQPB 4JGYB 3ST7A 2ZGRA 3OJBA 1RYYA 5FZGA 1CIWA 4Y5SA 4FVVA 1UOJA 3MV01 4Y20B 3U11A 3ZSMA 2Q8CA 3ZIWA 1VIWB 4YSFA 3H8UA 5E1RA 3UNPA 1IPSA 1IKQA 4QM8A 2ZX4A 1WLDA 5J7MA 5JSPA 1GANA 1EP0A 1W28A 5J96B 3MBWA 2ID4A 2MNGA 1E5IA 1YJKA 4LK7A 3DPRB 3URFA 4CDQC 4R4XA 2GNTA 5H9SA 4P5YA 4XVHA 4FPLA 2EXKA 1RUE2 4CZSA 4LBNA 4PF5A 4MADA 2P5BA 4XEZA 2Q1FA 3ZFEC 4GWNA 1Q3EA 2ARCA 4A7YA 2PAMA 1HN1A 3HIFA 1UOBA 4Q0UA 4ZONA 3B02A 5I8SA 2BEOA 2FDGA 5A32A 1QXPA 3NW4A 3WOGA 4FOQA 1T2XA 1GNZA 2EXIA 2FMYA 4NROA 3RSJA 4XJZA 2JG9C 3I59A 4AQSA 4W4ZA 3TNPB 2WWJA 2JE7A 1EAH3 3DUIA 2YXSA 4HK8A 4HVQA 4KBZA 1JI6A 4XJAA 3GJAA 5DUWA 4NPMA 2WA3A 5FMOS 4MYEA 1S0IA 3QLQA 4CEYC 4CDWC 1AXYA 1ZZ9A 3H3LA 4K6BA 3ALQA 4BE3A 1FI2A 5HV0A 1NA1A 3VZJA 3ZFGA 1Y9QA 4XDQA 5C3PA 1VJ2A 5GZCA 4XXAA 4E4ZA 2OPKA 2HWE1 2ZEWA 5A32B 4A3XA 3T1MA 1VAVA 4XFIA 1COV2 5EJ1B 4AGRA 1SEFA 1LOAA 4Z92B 2LW8A 1S1AA 5J98B 3LB9A 3I59B 3USUB 1RUC3 3S0MA 1RJ7A 1B09A 5FYZA 1ZZ7A 2XOMA 5HCFA 5FP8A 2ZGOA 3POIA 1ULOA 2RDRA 4QXKA 1L7LA 1PX4A 4CUGA 2EAAA 4PDWA 2W1QA 4QGLA 2R30A 3BPZA 4LBMA 4TYSA 3UGHA 1SG3A 2ZBJA 4GB32 1GBGA 1MEC3 3S6PA 3VDCA 2B5HA 2PHUA 4ORFA 1M4WA 1QXJA 4JC1A 4CPBD 2ZGKA 2CGPA 4R8HA 4XETA 5JR7B 1MQTC 2X5IB 1JHJA 4QXCA 5CZKA 4AG4A 2DUQA 3HN3A 4OULA 4NRQA 4WVVA 5J37A 1LESA 1CX1A 1LGNA 1WMFA 2X53S 4ES9A 3KV5A 1PMIA 4B4PA 2WS91 4MGYE 4QPIA 1I6XA 4W6XA 4XUTA 1RUI3 3MIFA 1UX6A 2WQZC 1PO13 5C8WA 4AGGA 1R093 2A5ZA 1UAIA 2P2KA 4Q4V1 3WCSA 4CU6A 4YM2A 4FP2A 4I0BA 5A7WB 2KXLA 2RDQA 5JI7A 1BYHA 1H8TB 4D94A 4JX0A 5F6KA 2DUPA 1MZEA 2J1RA 2QQPA 4P9IA 1TME2 5JOZA 5KXEA 4AHXA 3ILNA 1KFXL 2EIDA 3WLUA 1Z78A 2AEYA 3NVCA 3S57A 4L9BA 1ZRIA 3R6SA 2O8QA 3RZGA 5FYIA 4A3ZA 2UYBA 4CDXC 1W2UA 4XCBA 2OVUA 5FWJA 2V4VA 3BUCA 2WSUA 5J1XA 2JDYA 4XUQA 5CFCB 3H7YA 4LKEA 4HN1A 3T0BA 1AR82 5L19A 3MEPA 3G6JB 4HFSA 3FFZA 4B4RA 4JDOA 2PAKA 1TMF2 1PX3A 3ZXJA 4ARYA 1FX5A 2YGMA 4YZ1A 4QQOA 1AR92 1LECA 1RMU1 5C7GA 3V0AA 4BQ4A 4TZDA 1DZQA 5BPXA 4QB6A 2G4IA 1SBDA 2Z2SB 3NAPB 5IVVA 2YPDA 1AJOA 4K8RB 1SHWB 1JXNA 2FCVA 2RS52 1RUE1 3ON7A 3PTRB 5A7SA 3VHOA 3W59A 5JI9A 2A73B 4W6WA 5KR7A 1ONAA 1ULFA 2YFZA 1SDDB 2EA7A 2R042 1R1A2 2ZCWA 1W8ZA 3HQUA 2J1UA 2DU1A 3BALA 2EIGA 2GC3A 3TEWA 1T6GC 1DHKB 4NVPA 3R4SA 3VKLA 4NUBA 1Q8SA 2P17A 3H0OA 2PFWA 4EV0A 4PLOA 3V0AB 2QUOA 3CZJA 4CCNA 1SZBA 2JKXA 3GALA 1Y7BA 1KRIA 1K42A 4MHRA 3ZXDA 2PAEA 4QX7A 2J1VA 1DU3D 1XC6A 1BVP1 1K3IA 2JD9A 1LOBA 3ZFFC 5EWSA 3KT4A 5FXVA 2RJLA 1NYWA 2I2SA 1MACA 1Z7S2 3HEIA 4RA0A 5JXJA 3J4UH 4RSUA 5C9AB 4C1WA 1PGL2 1PVC2 2ERFA 1JZ3A 5EQUA 4CU7A 4N43C 3KQRA 2ZAHA 4I01A 4JQRA 3LFMA 2ZGUA 4ZKTB 3N3HA 3JQXA 1VRH3 2VULA 2V5YA 3CHXA 4Q0QA 5KXBA 1NLRA 3WQBA 1GZWA 2BWCA 2MEV3 3BU0A 1JYCA 4PHZA 4COZA 5C70A 4D7SA 1NUKA 4PJYA 4YW1A 4YVSB 1WW7A 1UNBA 5LBCA 1B35B 2WT1A 1UZ0A 2VOXA 1FXZA 5DZFA 1GZTA 2JDHA 3Q8FA 4GB31 2D7FA 4H3WA 1W6NB 2GC2A 4NWWA 2VCMA 3P1IA 4RHV3 2JWPA 3EHKA 3QACA 2IXCA 1RJ8A 4MGQA 4OMCA 1EY2A 4ZXEA 1TEIA 3KLSA 1ULDA 5JZGB 2BQPA 3C7FA 1FOD2 3RJRA 2A7AA 3RPQA 3VDDA 1W8UA 4XFFA 2VZUA 3K2OA 4UBGA 3CLPA 3U14A 5JOXA 3TWIA 1JYWA 1CJPA 2XJUA 2WZR1 1RXFA 3OD4A 4R9AA 1C1FA 3PL0A 5A6YA 1YHFA 1Q8QA 1AXKA 1RINA 1Y4WA 3FUOA 3M3QA 5DUXA 4DPNA 2OW4A 2DVAA 4RFRB 1ZRCA 1TME1 2EF6A 4BQWA 2BOIA 1GMMA 3KZ4C 3FFQA 5GJ6A 4FPCA 3RG0A 3DYMA 4RGGA 4MXWB 4P00B 3E6CC 1QDCA 4D3WA 3VBRA 3SEEA 2ZABA 1QDOA 2D6KA 3P6BA 5F5CA 4OFGA 3SCGA 2SLIA 3AYAA 3FE5A 4Z8BA 1O8SA 1Y9GA 3OGSA 1MR5A 1E5SA 3BIWE 4CEWB 2OPWA 1RHI2 4IE5A 4I0WB 1D4M3 1DGWX 4MH0E 1O6UA 4A42A 3O1VA 1FMD2 4YARA 1WUVA 4MXVA 3ZN5A 2JB8A 1TMF1 1NQJA 4CRQA 4MGZE 4LIUA 2YB7A 3AZVA 3J9SA 3V65A 1SFYA 4IGOA 2ORZA 1RXGA 3J7MA 5JIUA 4NRMA 5LRRA 2GZWA 1W99A 1YQ6A 2NN8A 2WAOA 3EYPA 4J1XA 4MX3A 5CFDA 3VBRB 4NAOA 1BK0A 4BU2A 3POEA 1OT5A 5LA9A 1ENRA 3VD7A 1JYVA 5I0DA 4JRAA 1OC1A 5A1AA 2WNUC 2XJQA 2R041 4HETA 4HZFA 3JB8A 1BXHA 1CESA 4OMDA 3BYWA 4G4FA 1AHSA 1K5JA 1UN1A 1LKNA 4Y26A 1W3VA 3OUJA 2X05A 4LLFA 5FPXA 2P6CA 4IGQA 4Q8LA 2E7TA 2C0ZA 3FWEA 5F2SA 4DXZA 1ZREA 1HLCA 3IMMA 4AEJA 1SLTA 2WO1A 4LOSA 5CKNA 4WVMB 2PN5A 3HT2A 3JU9A 2DWRA 2PXJA 3I4IA 4AF9A 5CFDB 2R062 5HCBA 4QHBA 4Q4Y3 4LNVA 4EYUA 1U12A 2CGNA 2HWD2 3I2FA 1PGL1 4AVVA 5FLHA 4BLIA 1QJU1 3O1RA 3SKJE 1W2AX 3LDKA 2AEZA 5F9TA 3ZM8A 1H4HA 3P5BA 2RM23 4I3PA 3HBKA 1MS8A 1PZ7A 2XQRA 2W68A 2A6XA 1OPOA 1QQP2 3NWKA 4S2FA 4W65A 1WLWA 4I30A 3ZXEA 3FHQA 3O1MA 3ZYRA 1LAJA 1NOVA 3UYJA 3WF1A 5DZGA 1V6MA 3H50A 2O14A 4GAZA 5C8CA 2JG8A 3K3OA 2L9LA 1QMJA 2BDRA 5IFTA 4N90A 2BWAA 1UIKA 3ZN6B 4NIGA 1CAXB 2BVVA 4O9GA 5LA1A 3AP4A 2LRPA 3K75B 5FLJA 3NRUA 5ABJB 5BNNA 3CL1A 2GMMA 3RI9A 5I0RA 5IVEA 3MLKA 3VLBB 3AVRA 3ME2A 4GXLA 5CG9A 1BZWA 3VBUA 3UT0A 4FFGA 4DRVA 5IWFA 1HQLA 2JB4A 1GP5A 5DABA 3B5LB 3GDBA 3WNMA 1JYTA 5FOJB 5E6HA 1AX1A 3NJZA 5LEKA 2D40A 1EAH2 4CCJA 2JG8B 3D82A 4CYDA 3WDTA 3AMPA 1F9KA 1X9TA 1V0AA 1ND2A 5JCTA 1JZ7A 1UW8A 4N53A 1X33A 3MF9A 1WLTA 3TBDA 1XE7A 2UU8A 1AL21 1F15A 2XLFA 2VUCA 3HT1A 4A4AA 2Q30A 2WAAA 1WCDJ 3WNOA 1JYNA 4RR3C 4EE2A 5FXWA 1G9FA 1TNRA 3ILRA 4PQQA 1WCKA 2O1QA 1VBB3 1RUH2 4AGVA 4LXLA 1W8HA 1H9PA 1V6JA 3GCWA 3P3PA 4JZRA 1W9FA 5T52A 1FMD1 1NCQA 2B9VA 3AYEA 3LA3A 2WIIB 4EN9B 3VL9A 1VBE1 4JHTA 5EYXA 4NHLA 2Z5WA 4MOAA 4Q1PA 3LPFA 2D6OX 4Q5OA 4L2NA 2QVSB 4CUCA 3UGGA 3N9PA 3U75A 4WM8A 1JN2P 1I3HA 1URXA 2XJTA 5HPOA 4IV3B 4QX3A 3TEXA 1OI6A 2VO5A 4MVTA 3VBHC 2CYFA 3NJXA 4FOWA 5DAVA 4YVWB 3K51A 1AUYA 1UPIA 3DCQA 4WM7A 1IHMA 1CQ9A 5T5JA 3TB0A 4DXTA 3AKRA 3SMHA 2BGPA 1ZNPA 3JB4C 4M4PA 1PIV3 1W8OA 2WFF1 1FATA 3GZTB 4XURA 3ZPOA 4JGZA 1OF4A 4JVAA 4LIVA 2EXJA 4Y3OA 2XJSA 2XBO3 4Q4X1 2W1WA 4L99A 2W2IA 4TLGA 1RUI2 2WYSA 3VBFA 4IETA 2PHLA 4CUBA 3WUCA 4Y24A 4BXSV 1R092 3ITQA 2VNVA 2R061 2HWC3 2E9QA 2WSVA 4NPRA 1MS4A 2AGSA 4DXSA 2BYVE 4ZS3A 5FZAA 4NRPA 3DECA 5FXZA 4YGEA 1OKQA 3OYWA 2ZHNA 2HWD1 2O0OA 3J26N 2VZVA 3DKWA 3VKMA 3H1WA 5LK5A 5FZOB 3T2QA 2XONA 2JD4A 2BFUS 2WC2A 1U5YA 2W94A 3DYPA 3ZXFA 3I2DA 3SC7X 5L7OA 1OQEA 2HEYF 3NJVA 2VTXJ 1DIWA 1VMFA 1HIXA 1OOPC 1QQP1 2VBDA 3KD4A 4XF4A 2QKDA 3WZ1A 2FZ1A 4NIDA 2JDMA 1YIFA 1ZZBA 3PUAA 1RVF2 2VJXA 3OBRA 4IE4A 4IV1A 1RITA 3JQWA 2XB6C 3JXSA 3N9LA 3GYDA 3RFRA 3THDA 1XYNA 3AP6A 2Q5TA 3G7DA 5IVBA 5BUVA 5IK4A 4QX1A 2I45A 4XJ9A 4QMAA 5L9BA 1CZTA 2XPJA 2JDZA 4P9XA 2RR13 4QD2A 1NCRB 5FZKA 2QFEA 3WR0A 3O0WA 3OOXA 5FY1A 4AQTA 5BNOA 2A6ZA 2RS33 1FPN2 2Y6KA 3RWNA 5KC5A 5L7OB 1O91A 3O1PA 2GH8A 4OHYA 1PNGA 1S4CA 5FK8A 3AMQA 3KM5A 3VKFC 1YWKA 3MO4A 4FTSA 3CJIB 3SQOA 1QHDA 1UY1A 2ZX2A 2E51A 5F37A 4M4RA 5BNPA 1KS5A 4UFIA 2VGDA 2RJKA 3T4HB 3AZWA 4B29A 5HV4A 4IEZA 2W92A 1JZ6A 4O65A 3KCXA 2UY8A 3IKWA 4M3CF 1O3SA 1W39A 4MHUA 3BU7A 5DG1A 5F7UA 1VBA3 2WLPA 3LEKA 4R9DA 2ZKLA 5FZCA 1YRZA 3ETPA 4YW7A 3SKVA 1GZCA 3ZSEA 1W9SA 2IFWA 3V0BB 2WT2A 4UOJA 2Y6GA 1W8NA 4CUAA 2WNVA 1GQPA 2DFBA 5C6CA 2AYHA 1POQA 3UKNA 2VOKA 3IMNA 3GHNA 1RUH1 4C90A 4OI2A 1H2NA 1OFNA 1Q43A 1W9TA 4LBKA 4LHNA 5D8AB 1YYNA 3N9QA 4BQXA 3MFAA 3WCRA 2YY1A 3LZZA 1VRH2 5ACA3 3OUIA 2YC0A 1CAVA 1RUJ3 4FPGA 2MEV2 4PQ9A 4AWDA 2PHWA 1UF2C 2PLV3 3LGRA 3MFCA 2VQ0A 3RWKX 5FMOL 3WW3A 4BK5A 3CQOA 5SV5A 3WF2A 4JKLA 2D93A 5FYCA 3WXPA 5JAXA 4AEDB 4FAGA 5EFUA 5LBBA 1YIPA 1AYM3 3U10A 1NAEA 3O7OA 5FKCA 3ZYJB 2P4EA 2RHPA 4FFFA 4RHV2 3C7EA 3LOIA 4TTGA 2QBXA 5CVRA 2R32A 2XKPA 1GOFA 3BN6A 4PLNA 4QKBA 1RUD3 3AVSA 4IV1C 2TUNA 3RZHA 1RUF1 1JUIA 3TYJA 2VMGA 4DUXA 2VZQA 1LOEA 3AKPA 1IKPA 1ND3B 2Y6JA 4XQDA 2CWMA 3O14A 4LHKA 1WCSA 4FPKA 5H9RA 4AEMA 4COVA 1RUI1 2YU1A 5DQ0A 5EPAA 2B39A 3VZMA 1HV1A 1OXCA 4Z82A 1UY4A 4BQYA 1PM4A 3DGTA 4YM3A 4F83A 4XYXA 4IE7A 1UKGA 4RS5B 5CNAA 5E89A 5FZHA 5FZ8A 1N1TA 2VXRA 2ZGNA 1F31A 1QXRA 3GGLA 3MW3A 1NXMA 2E63A 3VD5A 5A33A 1VBD1 3OBTA 4L92A 1SLCA 3MHZA 3VL8A 5I8TA 2VU9A 5T50A 3SNMA 4XXPA 4TWTA 1OLME 1EPWA 4CDUB 4Z2AA 1KEXA 5JLVA 1UKRA 4BISA 2D3RA 4BOWA 5C3QA 4UW4A 5E88A 4FTBA 3SHRA 4NHMA 4XZUG 2DUOA 1RVF1 3I2KA 1AR72 1D4M2 1QJX1 4META 1RTVA 3KGZA 4W50A 3Q8AA 4XFCA 4PF1A 5GM0A 1K5MA 2WUHA 3M1HA 4JGYA 4RQPA 1O59A 2A1XA 3HR9A 4XHBA 4Y20A 4CDQB 4UFJA 3A0NA 1O7FA 1Q8OA 1APNA 3ZSKA 4Q0SA 3AK0A 4ISQA 2JICA 4K1ZA 1XPWA 5FY9A 3KV4A 3ZFEB 4V1PA 3KQ4B 3DPRA 1FPN1 4P9GA 3MW2A 4DIQA 4AVSA 4OYUA 5FZ9A 4XF0A 4DEVA 3FMGA 3LCPA 1PHMA 4L97A 4GH4C 2ZMLA 3LDRA 4D6QA 3EXUA 4NMIA 5H9PA 3WSOA 3WG3A 2PMWB 3W20A 2XJRA 1E57A 1UZVA 1NZIA 2WA4A 3OPWA 2J1TA 1UMHA 5K8SA 4DY3A 1L3JA 3NV4A 3ZXKA 1MZFA 1R083 4CEYB 4CDWB 2D3SA 4XBNA 4Z07A 4BIOA 4UFMA 1H8VA 4GMP3 2XL7A 4FP3A 4AFDA 2QQMA 4C1XA 1OFSA 4Q4Y2 4CU9A 4I09A 5BV6A 4RFT0 4XW3A 1HXS3 3HVDA 1GP4A 3ZXGA 3HPNA 1N3OA 3WQ0A 1SLIA 3A4UA 1MS9A 3VUOA 3MYXA 4K21A 1LR5A 3A23A 2HWB3 2E53A 4MZUA 3RNSA 1QWRA 2HWF2 5FPAA 1LB2A 1VBC2 5CKQA 1HJGA 4Q4W2 1QNWA 2YHJA 4A7ZA 4LORA 4IESA 4YM1A 1KJRA 3I97A 1HX6A 1PZ9A 1UY0A 2RM22 4RS5C 2BZDA 2W1SA 4IDZA 2LM3A 2MEV1 4JDMA 3USUA 1WMXA 1PNFA 3VZLA 5C4WC 1G9AA 1RB8G 4WVZA 1SDWA 1US3A 1YJLA 1AR63 4XFHA 4Y1XA 4ASMB 4DFSA 1GWKA 2A3WA 2VNRA 2WZ8A 4XPVA 2O8OA 2QDRA 5APAA 4S2DA 1WBFA 1WWYA 5FWEA 4CXXA 3MUY1 4Y1YA 3GCXA 1AYN3 1MQTB 4HKLA 2DCZA 5IUQA 3WP4A 1D2SA 1VMHA 2E33A 4BLJA 4RHV1 4XHXA 2BGOA 2ET1A 1TVGA 3IZOA 3WHTA 1LHUA 2AENA 2BUKA 1ZRDA 4QQHA 1C57A 2DV9A 2X5IA 3OUHA 4G3YC 4URAA 2X10A 5B2GB 1DZRA 3ZDVA 4QXBA 3TN92 3ZOIA 4AI9A 4EZHA 3WINE 1Z0HA 4YGDA 1HB4A 2HLEA 2XUEA 1ST8A 5I93A 4HG6B 3R4DB 4COWA 3BVCA 3QD6A 1AL0G 5F3CA 1OSGA 3VBOC 2GH2A 5J3UA 3VD9A 4LO5B 2QQNA 1NE6A 4BHPA 3NNMA 4XCAA 1XJAA 4IE0A 3VKNA 1OLMA 2ZJCA 5A7WA 1H8TA 3ASIA 1YQ2A 4P9WA 4XF1A 1F5JA 2WZEA 1WA6X 3PU3A 2R073 2W47A 4J6GA 4CDXB 1J1TA 4AI1A 2ATFA 4BQ1A 1PO23 1FV2A 2GAUA 2Y26A 1ASJ2 2TBVA 5A3WA 1EV13 1VBB2 3GBFA 2JJ6A 4M3CA 1TG7A 1YQ8A 2WL1A 4XILA 5FPZA 3D8CA 1CWPA 1D7PM 1S0GA 3LA2A 1AR71 3FLPA 4LLOA 5FP9A 3JD73 5CFCA 2IC1A 2FDFA 1HJFA 2WWSA 3AKQA 3OB8A 2WABA 5FUPA 3WDUA 2ZX1A 2VZTA 1H1IA 2NLRA 2QDNA 1OF3A 1TNFA 4QU1A 4QKFA 1V9U1 4U2AA 3F95A 2ARAA 1DG6A 2RVAA 4LE3A 2UURA 4QQ2A 3T2PA 4IGPA 4I0AA 3ROUA 3NSTA 4KU8A 1G86A 2VCBA 1WCQA 3EQEA 2E7AA 2V4AA 4Q27A 4E4DX 3NAPA 1C8M3 4JV4A 1KXGA 2HH9A 4FQZA 3NNGA 1BBT3 1J1LA 4M3CB 1W6MB 4C91A 3PMSA 4FQ4A 4AFAA 3D5OA 1WW4A 1GQGA 3THCA 2VNOA 5FZ3A 1XXNA 2B46X 4NHKA 4ET7A 3LSDA 5KWRA 5JUVA 2D43A 1N1YA 5FZMA 2HEWF 4HOOA 1QF3A 2YU2A 4OUMA 4AOCA 3MPPG 2E7QA 3NMBA 1Y3TA 3OGVA 3Q9OA 3Q8EA 4S2GA 4Y1VA 5LASA 5A7QA 3I49A 2J22A 1JTZX 4XBLA 4CCMA 2ZMKA 1W90A 3RJ2X 3RZKA 2TEPA 2XBO2 3QBQA 4CE8A 1WA4A 5JDBA 1NA1C 3ZFGC 2XQXA 3ZFFB 2R1DA 4K3UA 1Q56A 1SPPB 1ZM1A 2OIIA 4Q0VA 5FO9B 5L36A 2ZGQA 1OQDA 1S0FA 2VD7A 2HWC2 2VTFA 4HVRA 2WJSA 3WP6A 2RMU3 2H0VA 4TLFA 3RS6A 3AYDA 5AFBA 4CPBA 3PUQA 2GU9A 5LZ6A 1A8MA 3WD5A 2KR2A 4D69A 3PVOA 1DDLA 4N43B 5IATA 5EXOA 4N7UA 2FDKA 4BCUA 2OUJA 4CCLA 2HWF1 1VBC1 2B42B 2ZZQA 4Q4W1 5C9AA 4LKFA 3FZ3A 2AZ5A 2JKBA 1DLCA 1PK6B 4DO0A 1ZBE3 4QKNA 4CCOA 1H2MA 2P3YA 1ZBA3 3V56A 4KG0A 2NZ9A 3BTAA 1HRI3 3HD8B 1W0PA 1AJKA 2XG3A 3B7MA 3AL5A 2WNEA 3J7LA 4PDWC 3VD3A 3ZKUA 4UI9L 1NXD1 4XF9A 1W9WA 5FP4A 2ZHKA 1XSRA 1MPXA 3VBSA 2ENRA 4N7IA 1ZVFA 5L9VA 1VAMA 3BOPA 2JDUA 4X6RB 4YVSA 1BMV2 3LQCA 1RUG3 1B35A 1QJEA 4GWIA 1CZSA 2B4KA 4B3NA 1F8VA 2YYOA 2BU9A 3CIHA 4A41A 3POBA 4ES8A 1XNTA 1W6NA 2ZGMA 5T54A 4LUKA 2QCSB 1COV1 3THTA 1U5IA 1SCRA 1W06A 2RS32 2YFUA 4QPIC 2D5HA 4CVUA 3TN91 4MGIE 3C8XA 4YW5A 2FDHA 2DDUA 2DFCA 2RDSA 1WMDA 5FUNA 4COUA 5JZGA 4AI0A 3VBSB 2D6NA 4HPKA 3WVJA 3OY8B 2PHTA 3UKTA 5CAZA 2VL4A 4AHZA 1NT0A 1HRV3 2GDFA 3ILFA 4LKDA 3GZEA 1UD1A 5GLTA 1S0JA 1AX2A 1A6CA 1LU1A 5DMYA 2JDAA 1DQ5A 5ERLA 1IOAA 1G8WA 5FFOC 4LK6A 1W0OA 2DTWA 3AJYA 3I54A 4MXWA 3I8TA 4JKKA 1ASJ1 2Y6FA 5FQ0A 2J7MA 1EUUA 2D5FA 4NIHA 5F5QA 1JBCA 4HPKB 1GSLA 1C8NA 1DGWA 4CEWA 5IAXA 3GHMA 1UU5A 4LEJA 4NHXA 1N1SA 1N1VA 2DCYA 4XE9A 1POV3 4E2GA 5ACA2 1HKDA 4V2VA 5IJRA 3TEYA 1OA3A 2VCAA 1H4GA 1RUJ2 3KT1A 4DS0A 3N36A 4URTA 4GD4A 4F8AA 2IXHA 3N9MA 3PUSA 2K9ZA 1DQ4A 4CTEA 4X8NA 4Q1RA 2WNUB 3KS7A 4EQVA 3HAGA 5GZGA 5C9AC 3BI3A 5M0TA 2HEVF 4IEPA 3WNXA 3ACIA 5KHGA 5FQ0B 4KWJA 4YFZA 2BRTA 3BODA 4R9BA 3RDIA 1W6QA 3LF7A 2ZGLA 5CADA 2CGOA 3ORJA 1WCUA 3IBMA 1J58A 3OBAA 2HKXA 5C5UA 1AVBA 1AR81 1UZZA 2LROA 2W52A 1RUD2 4UW6A 4RGKA 3H8RA 3C2UA 1UYZA 2H0BA 2XBO1 1ULPA 5C3SA 3HQXA 4Y33A 1OA2A 1AR91 4XAAA 2PELA 1ZZ6A 2BP6A 4PIYA 4WVMA 1W9YA 2YUEA 4PIXA 1LRHA 5DN2A 4BWOA 3B93A 2OUHA 3WW2A 2RS51 5LW9A 4KU7A 3MICA 3N9OA 1E5HA 2W0XA 1D0HA 2IXKA 2QQVA 4CSWA 4QPYA 5CYYA 1H9WA 1W6QB 1BHGA 3KGLA 1BEV2 2YZ4A 1R1A1 1SLBA 1UXXX 2BNOA 2WS93 4QU2A 1JU4A 1N3PA 4NN0A 1D0GA 3VN4A 1GNHA 1OUXA 3CU7A 4LTAA 1XQNA 2Q8DA 5DUUA 2UYAA 3EMRA 1YI7A 4NOTA 5DUVA 1ZYBA 5FYVA 4E4HA 4I02A 3I2GA 3IB3A 4E9KA 4FO9A 3WDWA 2A6VA 2IXIA 4QB2A 2WZPP 4YG3A 1O4TA 4AXOA 3AJZA 1GKBA 1IS4A 4O61A 2Y6HA 1I5ZA 1OA4A 5SV8A 2VR4A 2CV6A 4O9EA 5G05L 2Q8OA 4XDPA 3MIEA 3LKJA 1D4VB 1Z7S1 4IERA 5FMBA 3CO2A 2OQ6A 3ZMOA 4QKDA 4E2SA 2X29A 1CR7A 1US2A 1PVC1 3LIGA 4GKYA 3AKTA 4IEXA 3VDDC 4YYOA 3ZN6A 4BMBA 5K0UB 2BFUL 2FDIA 1CAXA 4MSVA 3FLRA 3EB7A 3KV9A 5HCAA 3O1TA 4P9JA 4COYA 2F4PA 3E5UA 5ABJA 2FCTA 3RMXA 4FPFA 2ZGPA 1RMU3 5K4LA 1MS3A 1UIJA 1SLLA 5JVVA 3IIAA 5T5LA 5FZ7A 1LOCA 4YG0A 2QQUA 2EICA 4GALA 1CAUA 1KJLA 1AX0A 3CKHA 3RMYA 3VBRC 1QOTA 2P1BA 4DZGA 4BIFA 3IDCB 4AFMA 2WNOA 1X7NA 2XH6A 4XF3A 3RYKA 1QH7A 1REDA 1OURA 4RYDA 1HXS2 4FXGB 2XKOA 4I3GA 2VM9A 2VZSA 4EN6B 1NLQA 3RYRA 3ATGA 4JAAA 3O1SA 4XTMA 2R1BA 3U07A 5GZEA 2HWB2 3OEAA 2PHXA 5F3GA 4KMQA 1FOD1 4GKXA 4OLLA 4YG6A 3ECQA 3U37A 4FPJA 2VECA 1G9CA 5F32A 2QQKA 1A34A 2J1AA 3WEZA 3GBGA 4LBQD 3MUZ1 1V70A 1BK1A 5CG8A 1CAUB 1L7RA 3AP9A 5JPNB 2JE9A 5CFDC 3B00A 5IFPA 5J48A 2VZ3A 5IW0A 1L7QA 1KDMA 1IZ3A 2P34A 3OPTA 1AR62 2JDNA 1GV9A 1T6BX 1SFPA 1NQDA 3T0AA 3VBHB 4ZU7A 1IG3A 1MVEA 4WZFA 1DGRA 4UFHA 2DVBA 2VVDA 4GWJA 3FUQA 1IS5A 4NWVA 4OHVA 3TNQA 3POYA 4IV3A 3T2TA 2CY6A 4FBFA 2B45X 4CP1A 3GNEA 4YVWA 1PMJX 1LEMA 2VZOA 1RHI1 3ZXLA 2KD7A 1RUD1 4IW3A 1JH5A 3W58A 2LALA 4AEKA 2F17A 3WW4A 1LHWA 1RUC2 2XL9A 2IZWA 3MIGA 2JIJA 4KNCA 4UF0B 1G9BA 4M0NA 3WP5A 1KDKA 4XFAA 3BB6A 2VZPA 2ADEA 2XDVA 1LULA 4A44A 3NL1A 3AKSA 2W95A 5F6LB 1C5HA 1ALYA 4JRLA 3QOPA 1FAYA 4UT5A 4ZHNA 1JYIA 5LBFA 4B1LA 2OYZA 1MEC2 4DQAA 5FPUA 1BEV1 1R1ZA 1W03A 4C8DA 5AC93 2R072 2R49A 1GYKA 1K45A 2YDEA 1GICA 2XMLA 4YRDA 3K77A 5DZEA 4BA6A 1ZRRA 1OOPB 1PO22 5FIXA 5FZOA 4XAEA 4A6OA 2WZR3 1OD5A 5IK8A 1EV12 3UK9A 1J3RA 1PZ8A 4LBQA 1LOFA 1NG0A 1UOGA 2AUYA 2RV9A 3M3IA 5G04L 1LEDA 3WNLA 3VGIA 4KQ7A 1TME3 2JG8C 3WUDA 2OX0A 4LHSA 1PO12 4XUOA 2JECA 3WDYA 4OI1A 3ZN4A 1XYPA 5EJZB 2K0GA 4ZZ5A 3T08A 2GC1A 3OGJA 5HBAA 4IE6A 2DCKA 3EJKA 3IPVB 5BNNC 3CJXA 4ATFA 1N47A 4I2OA 4MGSA 1LCLA 2ZS6B 4HKOA 4H55A 3POSA 3VBUC 1SBEA 1C8M2 3VHPA 1NCRA 1W6OB 1X50A 2QNKA 4QGNA 2RDNA 3GZUC 1BBT2 3MI8A 1TMF3 2GN3A 2W08A 1JODA 3ACGA 4LBQB 4LA2A 1WGPA 3DXTA 4YWAA 5LB6A 4QPGA 5FBZA 3GBWA 3CJIA 1JZ2A 2YC2A 4H7LA 2VMFA 1CAWA 3M4FA 1TZOA 4YZ4A 1OVSA 2D6PA 1ZA4A 1ND2C 4BQ5A 4YW2A 4N53C 1FV3A 4FAHA 4A7KA 2VXJA 5EIYB 3E1F1 3AFGA 3O12A 5FKBA 4CP9B 5IVJA 3MDPA 4OI0A 4IQPA 2BOJA 3I3DA 5D1IA 4GMP1 1CIYA 1XNKA 3T30A 4IV3C 5EHDA 3LSEA 3A0KA 4LKSA 4EN8B 2RMU2 4H2AA 5KXCA 1C28A 4NHYA 5FYMA 3V0BA 1KS4A 4AFCA 3KMHA 4UYBA 3THPA 2NQYA 3VV1A 4DINB 1H6XA 4QPGB 1NCQC 4D6SA 1KD7A 4KI5M 4Z1VA 2EALA 3AP5A 2WKKA 4QT6A 2NP0A 1CAWB 2C9KA 4GIQA 3LAGA 5FUIA 2DTYA 2PHDA 4P14A 5FZ1A 5D8AA 3I2JA 2C26A 1F4AA 4HANA 2UWBA 1OHFA 1IPKA 1ZBA2 1V6LA 2RS13 4GZ9A 4PLMA 3TEZA 5EV7A 1HRI2 1EAH1 1NX9A 1O5LA 2Y0IA 4HONA 4WM8C 5CEHA 2BBAA 4QDQA 1AR61 4PI2A 1NE4A 3MV11 5FAXA 1NZCA 5LEJA 3PUIA 4BH9A 4FSJA 5ANQA 3AM2A 1YCIA 5FZBA 1ZX5A 2XVKA 5FYYA 4FCAA 1QJU3 2WQ8A 3IDAA 4WM7C 3ZXAC 1CJDA 5JOWA 1HQNA 1RUG2 1XNBA 2ADDA 2WO7A 1AZDA 3B69A 1VRBA 2ZEZA 3CNAA 3KT7A 4AEDA 2ZPXA 1KGYA 1ULEA 2QE3A 4YFWA 3W5MA 3I2HA 2WO2A 1UQXA 4JGZC 1LOFC 1LENA 4UXAA 5I0SA 4TN7A 1UXZA 4G9SB 4LO6B 3MLLA 3PIGA 3H8XA 1SBFA 2JXAA 4MO3M 2R6QA 3FL7A 1GFF2 4FPOB 2BGCA 2Y38A 3AC0A 3VBFC 1RUC1 4N9HA 1RIRA 5LRSA 4YLZA 3WDXA 1UYXA 2QJVA 4QX5A 5I8YA 5ANNA 4HK9A 1SLAA 4YW6A 1ND3A 3T09A 1CPNA 1BKZA 3F2ZA 1G9DA 2VPVA 5K0UA 2Y6LA 4RL7A 2CTVA 1LHOA 5FO7B 1HRV2 1JUHA 3N4MA 2CAVA 5FY8A 5TSWA 3PVBB 1RGSA 5DXDA 2GMEA 1GR3A 3O0XA 1MEC1 3SLIA 1UPSA 3WY6A 5L7OC 2R071 1UU4A 2P3KA 3GM8A 4HMZA 5FREA 1JMUB 5FXXA 3ABZA 2VOTA 4Y4RA 1DQ2A 3OEBA 4Y1UA 3WW1A 4LE4A 1PO21 2CWSA 3DL3A 1A3KA 2ZMNA 1MZ5A 2IUWA 5A3LA 1DYKA 3NO8A 4TXWA 5DAQA 4CDUA 2OZ6A 3AZYA 2G19A 2J1SA 4Y5TA 5F3EA 2GN7A 1DFQA 1UY2A 3M3CA 2A6WA 1G7YA 1OD3A 3PVEA 2WRAA 3VZNA 1PO11 1R091 3KHBA 3PVNA 3ZO0B 1AL23 2VVEA 3PJYA 4QHOA 1F35A 2C24A 5BNOC 4F7ZA 3T1LA 5I0TA 2ZKNA 3WX5A 1QJZA 4CDQA 2A3XA 1W2OA 4FTEA 2JEMA 3ETQA 2A71A 3R4UA 1ZZCA 3E6BA 3FC0A 2EIBA 3D3AA 4KGGA 1C8M1 4XC9A 5FZDA 3ZIXA 4L0PA 5BNPC 1JOJA 1FMD3 1FYUA 4GH4B 4INDA 3ZFEA 3ZYGA 1GOHA 4AVTA 4QPWA 4IEUA 5JXHA 3BIEA 4PBOA 4XZPA 1E5RA 2XWJB 4CXWA 1VBE3 1REFA 3H9AA 4QGMA 3UETA 4KWUA 1LJ7A 1UMZA 1XNDA 1JU3A 4K1YA 3MGUA 4QAWA 3WDVA 4Y4YA 2OKXA 1PGW2 4A6SA 1UZWA 2DVDA 3UKVA 5JIAA 2C4XA 4M3CE 5FPVA 1DBNA 2W9XA 2WNVC 5A7PA 1N3QA 5FP3A 3W5NA 1KFUL 4LT5A 1S2KA 2E32A 2NYYA 1S0DA 4KH9A 4OHZA 4BMEA 2VOWA 4CDWA 4CEYA 2B8MA 4E8CA 2RMU1 2FMDA 4P9LA 3WG2A 3BCWA 4X6QB 5L73A 2PQSA 1OLQA 4E27A 1I5PA 3RZLA 3C7GA 1XRUA 2OA2A 3KCCA 1QY4A 2VE1A 2WFF3 2PTMA 2YGLA 4AAPA 3PUHA 4Y1ZA 1LTEA 4C0HA 2K46A 3M2MA 1A8DA 3PDQA 3RQ0A 3Q8CA 3M70A 4FT8A 2EIEA 1U0AA 4FPEA 4Q4X3 2WS92 4HT1T 1UO9A 2JG9B 2ZX3A 4PT6A 1VR3A 3BPSA 3PTYA 4DOUA 2FD8A 4DEQA 3CZUA 1YFYA 3MLJA 5K0UC 3INAA 5C4WB 1ZBA1 4NJ4A 3J8F3 2VUDA 3IM0A 4ONUA 1WMEA 3Q8BA 1VE0A 4AQ2A 1O3TA 4IEWA 1AXZA 1KQRA 2HWD3 4QWNA 2VOVA 3S30A 3VB9A 1QOOA 4BDVB 3APBA 5DPNA 3CEWA 4QXHA 1GWLA 4A2UA 5C3OA 2WN2A 3OD0A 4JTNA 4XJUA 3SEPA 3IAPA 2GALA 1RUG1 5FLIA 1ULGA 2V72A 2ZGSA 3IWZA 5I0UA 3WNNA 1W8WA 4Q26A 4AI8A 3LE0A 2LUWA 5FPBA 5KHJA 2ARBA 5KHHA 4E4SA 4LJHA 1G6NA 1MQTA 2BJSA 1CPMA 3DV8A 3ELNA 5GZFA 2YMZA 4ARXA 1JZ4A 3ZSLA 1V6KA 2BVBA 4ISRA 4D8MA 2HYXA 2CSGA 1WW6A 2A6YA 3MW4A 2OQ7A 2ZGTA 1VRH1 4P5HA 1WBLA 1XE0A 3AX4A 1LGBA 3E5XA 5FV3A 1RMU2 3D6EA 5CA6A 2GNMA 3VBOB 1W6PB 5FY4A 4MGTA 4AE2A 4XBQA 2XGXA 2Z69A 2NM1A 3B01A 1ULCA 1KITA 3FLTA 1VPHA 2R7EB 2ZXQA 3VKOA 1J59A 1HRV1 4EZ4A 5JWPA 1JZ5A 5LY2A 2VQUA 3JBG3 1DCSA 2CDOA 3U78A 5JMCA 2WR9A 1HV0A 2VW0A 3NV3A 4XABA 4B7KA 4KWKA 5LBEA 3ENRA 4CDXA 3O0VA 2MPFA 3LIHA 2VUAA 3IT8A 3V64A 3RYPA 1Y9MA 3HNMA 4WV8A 1C5IA 1UWWA 3C3VA 2P3JA 3M8LA 3MIHA 4XQWA 5EYYA 3N7LA 3KVBA 2GNDA 5T3NA 2FQPA 1K5MC 1R64A 1X8EA 2UWAA 1Y43B 2ZA9A 4JGYC 4RQPC 1QJY3 2D98A 1V00A 3AP7A 1DQ1A 5IAVA 5IVFA 4EWAA 1POV1 3JCIA 4XQ4A 1GP6A 4LQRA 3U4SA 5DDJ3 3PIJA 5A3PA 1O5UA 1YC61 1FNYA 3DPRC 3KHCA 2XVLA 3POGA 2GP5A 1QNYA 4H7MA 5IVCA 5A3OA 1RUH3 1UOFA 1P8JA 3L2YA 2CU5A 3OF1A 4AVCA 3FHIB 5GALA 2YG0A 2VQTA 5FMDA 5GLWA 4EN0A 2ZHMA 2OXBA 3OBZA 4DXRA 3ACFA 4V2WA 1UY3A 2B9UA 1W6MA 3B9CA 5FZEA 3WQ1A 4BQ3A 4DUWA 3M3OA 3UV9A 1C1LA 3DEMA 3SCFA 1D4M1 4CXYA 1PGW1 4OQ8A 1EPZA 2YBKA 2ZEYA 1O3RA 1NA1B 4K20A 3ZFGB 3PJQA 1O3QA 5EP9A 1GUIA 3LD8A 3B9IA 2Y0OA 1K12A 1X8MA 3ACHA 4GMP0 4LBJA 3UGFA 3ZFFA 2YROA 1SPPA 4KWLA 3OSDA 3AZZA 3FN9A 4NIIA 4AQ6A 5GLZA 5JR2A 3BTZA 5I91A 1RUF3 4AK3A 3AXEA 2DCTA 4QQPA 4QX8A 5AC92 3K4AA 4N43A 4CP2A 3H8OA 2PYTA 4HKWA 4IEQA 4Z2WA 5A3MA 4GULA 4YZ5A 2P6HA 4PDWB 1S2BA 2Z79A 4CCCA 2WZR2 1S55A 1PIV2 1J3PA 1PK6A 1LHNA 4K9SA 1BCXA 1OKOA 1OLRA 3HQRA 4LPLA 2VUJA 3WNKA 4AW7A 1VBD3 4GQ7A 3FBYA 3H3UA 1TQ5A 2VVFA 3BTXA 1MS1A 4FPHA 4Q4Y1 5BNQA 5K7PA 1GLHA 2WYFA 3OG2A 4XJ8A 1VB2A 4HLTA 4XUPA 3SITA 4BXFA 2W5FA 2X5IC 4QPIB 2KA3A 4C0BA 1CGPA 4XUNA 3D0JA 2YC4A 3HN1A 1RVF3 4XFGA 1YQCA 1QJX3 2QQOA 4Y22A 5IYYA 3C7OA 2F4LA 4M01A 3K46A 4JCKA 1QEXA 2RM21 1V6IA 3ZKYA 4ASKA 2PHRA 2BTVC 3K4DA 3JUUA 2IWGB 5A6QA 4HL0A 4M0HA 5FK7A 5ISLA 4XDOA 4FPYA 5E8AA 1FNZA 1H8TC 4B7EA 4ZZ8A 3D4KA 1UYYA 1IQAA 2HJIA 1WKYA 4BB3A 3OY8A 2BV4A 1SMVA 2JIGA 1FPN3 1GWMA 2CHHA 4XFBA 5JPMB 3MIDA 4IUGA 4YNIA 3NV1A 5HCHA 1V6NA 1OBNA 3NNJA 4BJ0A 2HBTA 2RR12 1XU2A 1YI9A 4NR1A 1ENSA 1YQ5A 4R52A 4XIKA 4Y22B 1M06G 2VMCA 3H42B 3IIIA 4E2QA 3N7JA 4QB1A 5CFCC 5FBJA 3USSA 4AI2A 3LEIA 3GXUA 2IXLA 1DGRN 2KM2A 1U5XA 4LOTA 5IT6A 1PGSA 1OPMA 2GP3A 2Y8KA 2NMNA 2RS12 2XJVA 4B1MA 1CVNA 5DG2A 3NAPC 4CU8A 1VP6A 1VBA2 4P02B 4ATEA 2ET7A 4LITA 2Q0AA 5FZ4A 5IHRA 1PM7A 1QJU2 2BNNA 3D0SA 4QDRA 4ZY9A 2NPIA 5JSOA 5JMOA 3H1MA 2WNUA 3H7JA 5FZ0A 3SH5A 5IVYA 3TOJA 3I3BA 1PK6C 1VBB1 4FFIA 3M7AA 5FYTA 4K7JA 3EO6A 4UW5A 4QX0A 2GSYA 3OGGA 2J42A 4IEOA 1O4YA 1H1AA 4XTPA 1LHVA 1MZ6A 1X82A 4LHLA 5JSRA 3J7NA 1YNAA 1CX4A 4CCEA 3AL6A 3A22A 4XIOA 5F5IA 3IDEA 3ZYIB 3AMMA 1ODMA 2PLV2 1XNAA 3FJSA 2HWE3 3ZVXA 3LDBA 4L11A 1MVQA 5F8PA 5FYBA 2WQ4A 4OCTA 5FP7A 1QU0A 3OPZA 5LA2A 4OI4A 1GZWB 3E97A 4IEVA 4TSVA 1AYM2 5AC91 3KB5A 4UBHA 1LODA 3SH3A 1AF9A 3X29B 1SACA 1WZXA 2ILMA 4YGBA 5KHKA 3FHAA 5FY0A 1CZVA 3RZJA 4XOGA 5F1RA 1W3XA 1PIV1 3SCHA 3VBSC 1YO8A 3KSCA 2WDBA 4YVSC 4CA9A 4EROA 5FZFA 1A78A 1IS6A 3HNBM 5A7OA 1DF0A 3DN7A 4GWMA 1B35C 3ZYFA 2WLQA 2VCCA 1S2EA 4AVAA 1OUSA 3AB0A 2HWC1 3PLQA 1AL22 4D7YA 5KXDA 4OHXA 3TAYA 5D21A 3LA7A 5FYUA 5FRAA 2IFRA 3NKGA 4KG8A 5C33A 4KGQA 2ZACA 3VDDB 1RUOA 4H14A 3VDAA 2IXJA 2QQLA 3DYOA 2ES3A 3U1XA 4BM8A 4RGAA 1OVPA 1IQDC 1O8PA 2XLAA 3FX3A 4Q8KA 4DB5A 1AR73 5A6ZA 3RZZA 3K48A 4ZU4A 2BW8A 5JZGC 3H3ZA 1DQ6A 2QZ3A 3BOWA 5AFEA 3DXUA 4Q4V3 5KBFA 3DF0A 2VQAA 1VBE2 4IEYA 3BKZA 2DCJA 2Q8EA 1IS3A 2JX9A 4N8MA 3I7DA 1V9U3 3AFKA 5CU1A 4FI9A 1W0NA 5DAWA 1WD4A 4MV2A 3WV6A 2PHFA 1ACCA 4K8FA 4LO8A 4U36A 4J1WA 5F39A 3K3NA 2XHNA 2DBIA 1YLLA 3RVHA 1BMV1 4DRRA 3AXDA 4K40A 3LPGA 4AHWA 1GQHA 2AREA 4YZ3A 2RR11 2Y33A 4GA9A 3WP3A 1UU6A 2VC9A 3PHMA 5B4XA 3NQHA 4RR3A 2I07B 4WZCA 5KC6A 2RS31 1ZA7A 1DYOA 2WFF2 4UWDA 2FBEA 3IN9A 4CEWC 2Z42A 1GNYA 1HB1A 3QCWA 4BK4A 4Q4X2 2YBSA 4JHZA 3T0DA 3M3EA 4OQ9A 5CISA 3ZLIA 2YV8A 5JXGA 1S0BA 2RS11 2XLGA 3J8F2 2IVJA 1POV0 2Y34A 2OZJA 3WT3A 1RL3A 1RUE3 1HB2A 1SFNA 2BNMA 2NMOA 2VBBA 2WINB 4LA3A 1VBA1 1R082 5D2AA 3GF6A 3HNYM 3JZVA 3LFIA 3I3EA 2HWF3 2K2SA 4OUEA 1VBC3 3PU8A 3HMYA 3E6DA 2WBKA 2FHRA 2VBPA 4Q4W3 4RR3B 4Y5Z0 2X8KA 4D7TA 4OUSA 1SCSA 1YFXA 5FCCA 3VBHA 1QOSA 2ZEXA 4IL7A 4PBPA 5JOYA 1YFWA 3HBZA 1HQWA 1WD3A 2DF7A 2FCUA 4LUMA 4EN7B 3KF3A 1OQ1A 1DLLA 2EXHA 4GJYA 3S5QA 3AYCA 1DQ0A 5BXXA 1ODNA 1SQ4A 3ZYBA 1J84A 4AFBA 1UZYA 5ACA1 2A75A 3E5QA 1F4HA 3S7IA 1RUJ1 4BPZA 3O1UA 4QDSA 3U0ZA 2PLV1 3MF6A 4YZ2A 3EBRA 1QIQA 4UF0A 2QTWB 2VTXA 1W8FA 3J7HA 5HXVA 1NLSA 1U5ZA 2DVFA 4UFKA 1DZTA 1COV3 4EJRA 3R05A 2W39A 5FJHA 1JHNA 3LWCA 1ENXA 2AR6A 3NV2A 4MGKE 4AVBA 1JW6A 1MS0A 3JBG2 1AYM1 3TN93 3DKQA 1AYN2 3IDBB 1BQPA 2QQJA 2VMHA 5LA0A 2P37A 4FFHA 3ES1A 3CF6E 5DAPA 2RJ2A 3CDZB 2V09A 3TRSB 3WHUA 4YPJA 5A1FA 1VB4A 2XR4A 5C8CB 1W2TA 5KHIA 3W21A 3VDBA 1OOPA 4Q0PA 2V5DA 4PIZA 5FY7A 1EYBA 1BLZA 3AZXA 1XNCA 3OCPA 5A7NA 1XB9A 3UJQA 3POWA 4SBVA 5CB7A 4D6RA 1CN1A 2RG4A 1QJY2 2ETEA 4GB33 5FDBA 4XMAA 3MZHA 5H9QA 1OH4A 4HSLA 5C71A 1RUNA 5BNNB 2VH9A 2VZ1A 1Q8PA 5A3UA 5DDJ2 4PI0A 5A6XA 5LY1A 3U4XA 2IVIB 1F2NA 4XACA 1XE8A 3T2OA 1ASJ3 4FXKB 4OZXA 5T55A 1EUTA 2WN3A 3RI8A 2VY0A 3VBUB 4BQ2A 3CBNA 5ABJC 3IPVA 3POJA 3VD4A 2JENA 3A7QA 2ZHLA 3AMNA 1VLNA 3BTYA 5T5OA 4EWDA 5BYNA 2ARXA 3VZOA 4LO4B 4OVEA 4SLIA 3ZR6A 1GOGA 1W6OA 2F6BA 3ZX7A 3UJOA 3RZMA 4RN5A 4F3JA 2FZ2A 5J09A 3ZR5A 1UCXA 1ND2B 2ORXA 4UW3A 2B7YA 4N53B 3WQ7A 5B4NA 3NNFA 5F3IA 1H0BA 3JD72 2WWUA 5FYSA 3MPBA 4M00A 4LBLA 3WF3A 2AACA 2W91A 4ITCA 4PCRA 3LOBA 4JQTA 3T3YA 1CONA 4NPLA 2DBNA 4QQLA 4XJWA 5FJKA 4CP9A 4HSJA 5C8CC 4YW3A 1STMA 1PVXA 2EAKA 1H30A 1J3QA 4QHZA 5F2WA 4XMIA 1VMJA 3VHRA 1NCQB 1AR83 5BY5A 2PA7A 2R16A 3B3QE 5EZWA 4AI3A 5GLUA 4R9CA 5LCWL 1RUF2 2N7GA 1IPJA 3C7HA 5LK7B 1ENQA 3WNPA 4B4QA 3LEGA 4R4ZA 5K9YA 1AR93 5JXIA 4HVOA 4WBBA 5EJ3A 5FTTC 5GLVA 2XHKA 1W8TA 2WT0A 1UYPA 2EVXA 3ACLA 4WM8B 1FT9A 3J8F1 3OTFA 2C9AA 1BVVA 1JS9A 2RS53 1DYPA 2VMEA 1R081 4L8QA 5HXMA 4HN0A 2BPA2 3BGAA 3R0RA 4WM7B 3CMGA 1VBD2 2R043 1R1A3 4NO4A 1H1MA 2VMIA 3SH4A 1IG0A 3ES4A 1HXS1 4YVWC 4AZZA 1OH3A 4JGZB 4LBOA 1C4RA 2VMDA 2D3PA 5CIRA 2D44A 1DGLA 2YBPA 5CBLA 1NY72 5IK7A 2HWB1 3VBFB 2GMPA 4EWEA 1QH6A 2DYCA 4UAPA 2CDPA 2D6LX 1JZ8A 1OMIA 1QJX2 2QQIA 1V6OA 4O7XA 4OHWA 1MS5A 1ZRFA 3NJYA 3POFA 3RRDA 1ZBE2 2XJPA 4ZXKA 2DURA 4DY5A 1F5FA 1NKGA 3NNLA 2W87A 3OYWB 3VZKA 1LNSA 2Q4SA 2W1UA 2OS2A 2Y60A 3FBMA 5E16A 5FZIA 1WLCA 1Z7S3 5DAXA 5A1LA 2LTNA 2DVGA 3I3QA 1PVC3 1RC6A 2ZTNA 3PURA 5C3RA 1D2QA 2WO3A 4ZU5A 3ZSJA 5AVAA 3QH7A 3L9JT 3RGBA 3KV6A 2AC1A 2VAUA 2Y64A 3JBG1 3PNAA 4DMIA 1Q5OA 4NE9A 1REEA 4BYYA 1AYN1 5T5PA 4DUVA 1DP0A 2DU0A 2R0HA 2MHFA 4BZ4A 3GZAA 4IV1B 5F5AA 2UWCA 1S0EA 3L2HA 5GZDA 2QQWA 5FMCA 1X36A 3I2IA 3NKTA 1UL9A 1XYOA 4W6YA 4W8JA 2XVGA 1VALA 1HW5A 2HYKA 1QJY1 4ZS2A 1GZ9A 1W04A 3WF4A 4CP0A 4AL9A 2UY9A 5FOBB 5BNOB 3S5AA 1JOPA 2AH2A 2H6BA 5DDJ1 5FO8B 4QM9A 4DNYA 4YM0A 1C3HA 2W46A 2E26A 1NCRC 2TNFA 2FDJA 5BNPB 1H6YA 1QJFA 3O5SA 3N35A 2XWBB 4FOVA 5GKAC 1FOD3 3O1OA 1CD3G 2ZOEB 4UFLA 4RD7A 3A21A 4QPGC 3KCYA 2G9ZA 4Q29A 1J83A 4MUVA 4YGCA 5A80A 3CJIC 2A70A 2I74A 1XU1A 2JE8A 3ZYPA 4GH4A 2P3IA 1JYXA 1EV11 1LOGA 5A3TA 1H2LA 1WW5A 1YFUA 3AMHA 3UL2A 5IK5A 2ZX0A 1JOBA 3QH6A 1YEWA 2E6VA 3JD71 3OGRA 4JTOA 2WNVB 3N9NA 1XSQA 1W2NA 4ASLA 4JKMA 3ZYHA 1HB3A 4P08A 4J25A 2PQQA 2Z4FA 2CL2A 3I3MA 2W3JA
chains in the Genus database with same CATH topology
2H6CA 4WVWA 3S7EA 4JDNA 3ZPYA 3HWJA 4B8EA 2HWE2 4KBBA 3N7MA 1RHI3 1YXWA 2D6MA 3ZMNA 3ZDSA 1CAVB 3SISA 1BBT1 2V73A 5D8AC 4N9IA 2VNGA 2CAUA 2VG9A 3WG1A 4RS5A 4MLOA 1LGCA 2JG9A 2ZAAA 4LULA 2ZZJA 1BJQA 1I1EA 5C4WA 2C1FA 2GC0A 3WG4A 2QZ2A 1TE1B 4IXLA 4AEDC 5J36A 2GNBA 1Q8VA 1BEV3 4AYUA 1H2KA 3N7KA 3P3NA 4KL1A 2SBAA 1VAKA 1YUDA 2G9FA 4YW4A 1NY71 2VW1A 1O4ZA 4X8PA 3VHNA 4HBNA 2Q1ZB 2XUMA 1IGOA 1ND3C 1S0CA 1ZBE1 2A3YA 2R063 4Q4V2 1HRI1 2VW2A 2YPJA 1HDKA 4P9YA 3SXWA 3W9AA 5A33B 2G9GA 2WFPA 1V9U2 4LO7A 4LR4A 1QGLA 4Q2FA 2Q1MA 3VBOA 1W6PA 3PMEA 4S2HA 2R0FA 1ZZ8A 3H1YA 2D97A 4FOYA 1I9RA 1LU2A 4AHYA 2CNAA 2RE9A 1QKQA 5HI0A 1QQP3 3B94A 4CDUC 2C5DA 5AVPA 2BBVA 1K5MB 3MIBA 4RQPB 4JGYB 3ST7A 2ZGRA 3OJBA 3ZSMA 1CIWA 4FVVA 4Y20B 3U11A 3ZIWA 1VIWB 4YSFA 3H8UA 5E1RA 1IKQA 4QM8A 2ZX4A 1WLDA 5J7MA 5JSPA 1GANA 1EP0A 5J96B 2MNGA 1YJKA 3URFA 3DPRB 4CDQC 4R4XA 2GNTA 5H9SA 4FPLA 2EXKA 1RUE2 4CZSA 4LBNA 4PF5A 4XEZA 3ZFEC 4GWNA 1Q3EA 4A7YA 2PAMA 3HIFA 5I8SA 4Q0UA 3B02A 2BEOA 5A32A 1QXPA 3NW4A 3WOGA 4FOQA 1GNZA 2EXIA 2FMYA 3RSJA 4XJZA 2JG9C 3I59A 4AQSA 3TNPB 2JE7A 1EAH3 3DUIA 2YXSA 4HK8A 4HVQA 4XJAA 5DUWA 2WA3A 5FMOS 4MYEA 1S0IA 3QLQA 4CEYC 4CDWC 1AXYA 1ZZ9A 4BE3A 4K6BA 3ALQA 1FI2A 1NA1A 3VZJA 3ZFGA 1Y9QA 4XDQA 1VJ2A 5GZCA 4XXAA 4E4ZA 2OPKA 2HWE1 5A32B 4A3XA 3T1MA 1VAVA 4XFIA 1COV2 4AGRA 1SEFA 1LOAA 4Z92B 1S1AA 5J98B 3LB9A 3I59B 3USUB 1RUC3 3S0MA 1RJ7A 1B09A 1ZZ7A 5HCFA 2ZGOA 4QXKA 2EAAA 4PDWA 4QGLA 2R30A 3BPZA 4LBMA 4TYSA 2ZBJA 4GB32 1GBGA 1MEC3 3S6PA 2B5HA 2PHUA 4ORFA 1M4WA 1QXJA 4JC1A 2ZGKA 2CGPA 4R8HA 4XETA 5JR7B 1MQTC 2X5IB 4AG4A 2DUQA 4OULA 4WVVA 5J37A 1LESA 1LGNA 1WMFA 2X53S 4ES9A 1PMIA 4B4PA 2WS91 4MGYE 4QPIA 1I6XA 4W6XA 1RUI3 3MIFA 1UX6A 2WQZC 1PO13 5C8WA 4AGGA 1R093 2A5ZA 1UAIA 2P2KA 4Q4V1 3WCSA 4YM2A 4FP2A 4I0BA 2KXLA 5JI7A 1BYHA 1H8TB 4D94A 5F6KA 2DUPA 1MZEA 2QQPA 4P9IA 1TME2 5JOZA 5KXEA 4AHXA 3ILNA 1KFXL 3WLUA 1Z78A 3NVCA 4L9BA 3R6SA 2O8QA 4CDXC 2UYBA 1W2UA 2OVUA 2WSUA 5CFCB 3H7YA 4HN1A 1AR82 5L19A 3MEPA 3G6JB 4HFSA 3FFZA 4B4RA 4JDOA 2PAKA 1TMF2 3ZXJA 1FX5A 2YGMA 4YZ1A 4QQOA 1AR92 1LECA 1RMU1 3V0AA 4TZDA 1DZQA 5BPXA 2G4IA 1SBDA 2Z2SB 3NAPB 1AJOA 1JXNA 2RS52 1RUE1 3W59A 3VHOA 5JI9A 2A73B 4W6WA 1ONAA 1ULFA 2EA7A 2R042 1R1A2 2ZCWA 2DU1A 3BALA 2EIGA 2GC3A 1T6GC 1DHKB 4NVPA 3R4SA 3VKLA 1Q8SA 2P17A 3H0OA 2PFWA 4EV0A 4PLOA 3V0AB 2QUOA 3GALA 1Y7BA 1KRIA 3ZXDA 2PAEA 1DU3D 1BVP1 1LOBA 3ZFFC 5EWSA 3KT4A 2RJLA 1NYWA 2I2SA 1MACA 1Z7S2 4RA0A 3J4UH 4RSUA 5C9AB 4C1WA 1PGL2 1PVC2 2ERFA 4N43C 3KQRA 2ZAHA 4I01A 4JQRA 2ZGUA 4ZKTB 3N3HA 3JQXA 1VRH3 2VULA 2V5YA 4Q0QA 5KXBA 1NLRA 1GZWA 2BWCA 2MEV3 1JYCA 4COZA 4D7SA 4PJYA 4YW1A 4YVSB 1WW7A 1B35B 2WT1A 2VOXA 1FXZA 5DZFA 4GB31 2D7FA 4H3WA 1W6NB 2GC2A 4NWWA 4RHV3 3QACA 3EHKA 2IXCA 1RJ8A 1EY2A 1TEIA 3KLSA 1ULDA 5JZGB 2BQPA 3RJRA 1FOD2 3RPQA 2A7AA 3VDDA 5JOXA 4XFFA 4UBGA 3CLPA 3TWIA 1CJPA 2XJUA 2WZR1 3OD4A 4R9AA 1C1FA 1YHFA 1Q8QA 1AXKA 1RINA 3FUOA 3M3QA 5DUXA 4DPNA 2OW4A 2DVAA 1ZRCA 1TME1 2EF6A 3KZ4C 3FFQA 5GJ6A 4FPCA 3RG0A 4RGGA 4MXWB 3E6CC 1QDCA 4D3WA 3VBRA 2ZABA 1QDOA 2D6KA 3SCGA 4OFGA 2SLIA 3AYAA 3FE5A 4Z8BA 1MR5A 3BIWE 4CEWB 1RHI2 4I0WB 1D4M3 1DGWX 4MH0E 1FMD2 4YARA 1WUVA 4MXVA 3ZN5A 1TMF1 1NQJA 4CRQA 4MGZE 3AZVA 3J9SA 3V65A 1SFYA 5JIUA 5LRRA 2GZWA 2NN8A 4MX3A 4J1XA 5CFDA 3VBRB 1ENRA 4JRAA 2WNUC 2XJQA 2R041 4HETA 4HZFA 3JB8A 1BXHA 1CESA 4G4FA 1AHSA 1UN1A 1LKNA 4Y26A 5FPXA 4LLFA 4Q8LA 2E7TA 2C0ZA 3FWEA 4DXZA 1ZREA 1HLCA 4AEJA 1SLTA 4WVMB 2PN5A 3HT2A 3JU9A 2DWRA 3I4IA 4AF9A 5CFDB 2R062 5HCBA 4QHBA 4Q4Y3 4LNVA 1U12A 2CGNA 2HWD2 1PGL1 4AVVA 5FLHA 4BLIA 1QJU1 5F9TA 1H4HA 2RM23 4I3PA 1MS8A 1PZ7A 2W68A 2A6XA 1OPOA 1QQP2 3NWKA 4S2FA 4W65A 1WLWA 4I30A 3ZXEA 3ZYRA 1NOVA 5DZGA 1V6MA 3H50A 5C8CA 2JG8A 1QMJA 4N90A 2BWAA 1UIKA 3ZN6B 1CAXB 2BVVA 4O9GA 3AP4A 5FLJA 5ABJB 5BNNA 3CL1A 2GMMA 3RI9A 5I0RA 3MLKA 3VLBB 3ME2A 4GXLA 5CG9A 1BZWA 3VBUA 4DRVA 1HQLA 3B5LB 5FOJB 1AX1A 3NJZA 5LEKA 2D40A 1EAH2 4CYDA 2JG8B 3D82A 3WDTA 3AMPA 1F9KA 1ND2A 5JCTA 1UW8A 4N53A 1X33A 3MF9A 1WLTA 3TBDA 1XE7A 2UU8A 1AL21 2XLFA 3HT1A 2Q30A 1WCDJ 4RR3C 1G9FA 1TNRA 3ILRA 1WCKA 2O1QA 1VBB3 1RUH2 4AGVA 1H9PA 1V6JA 3P3PA 5T52A 1FMD1 1NCQA 3AYEA 3LA3A 2WIIB 4EN9B 3VL9A 1VBE1 5EYXA 4NHLA 2Z5WA 4Q1PA 2D6OX 4L2NA 2QVSB 4WM8A 1JN2P 1I3HA 1URXA 2XJTA 4IV3B 1OI6A 4MVTA 3VBHC 2CYFA 4FOWA 4YVWB 3K51A 1AUYA 1UPIA 4WM7A 1IHMA 1CQ9A 5T5JA 3TB0A 3AKRA 3SMHA 1ZNPA 3JB4C 1PIV3 2WFF1 1FATA 3GZTB 4JGZA 4JVAA 2EXJA 2XJSA 2XBO3 4Q4X1 4L99A 1RUI2 3VBFA 4IETA 2PHLA 3WUCA 4Y24A 1R092 4NPRA 2R061 2HWC3 2E9QA 2WSVA 1MS4A 2AGSA 2BYVE 4YGEA 1OKQA 3OYWA 2ZHNA 2HWD1 2O0OA 3J26N 3DKWA 3VKMA 3H1WA 5LK5A 2JD4A 2BFUS 2WC2A 1U5YA 3ZXFA 3I2DA 5L7OA 1OQEA 2HEYF 1DIWA 1HIXA 1OOPC 1QQP1 3KD4A 4XF4A 2QKDA 3WZ1A 2FZ1A 1YIFA 1ZZBA 1RVF2 3OBRA 4IV1A 1RITA 3JQWA 2XB6C 3GYDA 1XYNA 3AP6A 2Q5TA 3G7DA 5BUVA 5IK4A 2I45A 4XJ9A 4QMAA 2XPJA 2JDZA 4P9XA 2RR13 4QD2A 1NCRB 2QFEA 3WR0A 3O0WA 4AQTA 5BNOA 2A6ZA 2RS33 1FPN2 3RWNA 5KC5A 5L7OB 1O91A 2GH8A 4OHYA 1PNGA 3AMQA 3KM5A 3VKFC 1YWKA 4FTSA 3CJIB 1QHDA 2ZX2A 2E51A 5BNPA 1KS5A 2VGDA 2RJKA 3AZWA 4B29A 4IEZA 3KCXA 2UY8A 3IKWA 4M3CF 1O3SA 1W39A 3BU7A 5DG1A 1VBA3 2WLPA 4R9DA 2ZKLA 1YRZA 3ZSEA 1GZCA 2IFWA 3V0BB 2WT2A 2WNVA 2DFBA 5C6CA 2AYHA 3UKNA 2VOKA 3IMNA 3GHNA 1RUH1 4C90A 4OI2A 1H2NA 1OFNA 1Q43A 4LBKA 4LHNA 5D8AB 1YYNA 3MFAA 3WCRA 2YY1A 3LZZA 1VRH2 5ACA3 2YC0A 1CAVA 1RUJ3 4FPGA 2MEV2 4PQ9A 4AWDA 2PHWA 1UF2C 2PLV3 3LGRA 3MFCA 2VQ0A 5FMOL 3WW3A 5SV5A 5JAXA 2D93A 3WXPA 4AEDB 4FAGA 5EFUA 1YIPA 1AYM3 3U10A 3O7OA 3ZYJB 2RHPA 4RHV2 3LOIA 5CVRA 2R32A 2XKPA 4PLNA 1RUD3 4IV1C 2TUNA 1RUF1 1JUIA 3TYJA 2VMGA 1LOEA 3AKPA 1IKPA 1ND3B 4XQDA 4COVA 2CWMA 3O14A 4LHKA 1WCSA 4FPKA 5H9RA 4AEMA 5K0UB 1RUI1 2B39A 3VZMA 1HV1A 4Z82A 3DGTA 4YM3A 4F83A 4XYXA 1UKGA 5CNAA 5E89A 1N1TA 2VXRA 2ZGNA 1F31A 1QXRA 3MW3A 1NXMA 2E63A 5A33A 1VBD1 3OBTA 4L92A 1SLCA 3VL8A 5I8TA 2VU9A 5T50A 3SNMA 4XXPA 4TWTA 1EPWA 4CDUB 5JLVA 1UKRA 2D3RA 4BOWA 4UW4A 5E88A 4FTBA 3SHRA 4NHMA 2DUOA 1RVF1 1AR72 1D4M2 1QJX1 4META 1RTVA 3KGZA 4XFCA 5GM0A 1K5MA 4RQPA 3M1HA 4JGYA 3HR9A 4XHBA 4Y20A 4CDQB 3A0NA 1O7FA 1Q8OA 1APNA 3ZSKA 4Q0SA 3AK0A 4ISQA 2JICA 4K1ZA 3ZFEB 4V1PA 3DPRA 1FPN1 4P9GA 3MW2A 4AVSA 4XF0A 3FMGA 3LCPA 1PHMA 4L97A 4GH4C 2ZMLA 3EXUA 5H9PA 3WG3A 2XJRA 1E57A 2WA4A 5K8SA 4DY3A 1L3JA 3NV4A 3ZXKA 1MZFA 1R083 4CEYB 4CDWB 2D3SA 4XBNA 4Z07A 4BIOA 1H8VA 4GMP3 2XL7A 4FP3A 4AFDA 4C1XA 1OFSA 4Q4Y2 5BV6A 4I09A 4RFT0 4XW3A 1HXS3 3ZXGA 3WQ0A 1N3OA 1SLIA 3A4UA 1MS9A 3VUOA 3MYXA 4K21A 1LR5A 2HWB3 2E53A 4MZUA 3RNSA 1QWRA 2HWF2 1LB2A 1VBC2 4Q4W2 1QNWA 2YHJA 4A7ZA 4IESA 4YM1A 1KJRA 4RS5C 1HX6A 1PZ9A 2RM22 2LM3A 2MEV1 4JDMA 3USUA 1PNFA 3VZLA 5C4WC 1G9AA 1RB8G 4WVZA 1SDWA 1YJLA 4XFHA 1AR63 4Y1XA 4ASMB 4DFSA 2A3WA 2VNRA 4XPVA 2O8OA 2QDRA 4S2DA 1WBFA 4Y1YA 5IUQA 1AYN3 1MQTB 4HKLA 2DCZA 3WP4A 1D2SA 4BLJA 4RHV1 4XHXA 2ET1A 3WHTA 1LHUA 2AENA 2BUKA 1ZRDA 4QQHA 1C57A 2DV9A 2X5IA 4G3YC 5B2GB 1DZRA 3TN92 3WINE 1Z0HA 4YGDA 5I93A 3R4DB 4COWA 3QD6A 1AL0G 1OSGA 3VBOC 2GH2A 5J3UA 4LO5B 4BHPA 1NE6A 3VKNA 2ZJCA 1H8TA 3ASIA 4P9WA 4XF1A 1F5JA 2R073 4J6GA 4CDXB 1J1TA 4AI1A 2ATFA 4BQ1A 1PO23 1FV2A 2GAUA 2Y26A 1ASJ2 2TBVA 1EV13 1VBB2 3GBFA 2JJ6A 4M3CA 4XILA 2WL1A 5FPZA 3D8CA 1S0GA 3LA2A 1AR71 3FLPA 4LLOA 5CFCA 3JD73 2IC1A 2WWSA 3AKQA 3WDUA 2ZX1A 1H1IA 2NLRA 2QDNA 1TNFA 1V9U1 4U2AA 4LE3A 1DG6A 4D7YA 2UURA 4QQ2A 4I0AA 3ROUA 3NSTA 4KU8A 1G86A 3EQEA 2E7AA 4Q27A 4E4DX 3NAPA 1C8M3 4JV4A 1KXGA 4FQZA 1BBT3 1J1LA 4M3CB 1W6MB 4C91A 3PMSA 4FQ4A 4AFAA 3D5OA 1WW4A 1GQGA 5KWRA 2VNOA 1XXNA 2B46X 4NHKA 3LSDA 2D43A 1N1YA 2HEWF 1QF3A 4OUMA 3MPPG 2E7QA 3Q9OA 1Y3TA 4S2GA 4Y1VA 1JTZX 4XBLA 2ZMKA 3RJ2X 2TEPA 2XBO2 3QBQA 1WA4A 5JDBA 1NA1C 3ZFGC 3ZFFB 2R1DA 4K3UA 1Q56A 2OIIA 1ZM1A 4Q0VA 5FO9B 5L36A 2ZGQA 1OQDA 1S0FA 2HWC2 4HVRA 2WJSA 3WP6A 2RMU3 2H0VA 4TLFA 3RS6A 3AYDA 5AFBA 2GU9A 1A8MA 3WD5A 4D69A 3PVOA 1DDLA 4N43B 5EXOA 4N7UA 4BCUA 2OUJA 2HWF1 1VBC1 2B42B 2ZZQA 4Q4W1 5C9AA 3FZ3A 2AZ5A 2JKBA 1PK6B 1ZBE3 1H2MA 1ZBA3 3V56A 4KG0A 2NZ9A 3BTAA 1HRI3 3HD8B 1W0PA 1AJKA 2XG3A 3B7MA 4PDWC 2WNEA 4XF9A 1NXD1 2ZHKA 3VBSA 2ENRA 4N7IA 1ZVFA 1VAMA 3BOPA 4X6RB 4YVSA 1BMV2 1RUG3 1B35A 4B3NA 1F8VA 2YYOA 4ES8A 1W6NA 2ZGMA 5T54A 4LUKA 2QCSB 1COV1 3THTA 1U5IA 1SCRA 2RS32 4QPIC 2D5HA 3TN91 4MGIE 4YW5A 2DFCA 1WMDA 4COUA 5JZGA 4AI0A 3VBSB 2D6NA 4HPKA 3WVJA 3OY8B 2PHTA 3UKTA 5CAZA 4AHZA 3ILFA 1HRV3 2GDFA 1UD1A 5GLTA 1S0JA 1AX2A 1A6CA 1LU1A 1DQ5A 1IOAA 1G8WA 5FFOC 1W0OA 2DTWA 3AJYA 3I54A 4MXWA 3I8TA 1ASJ1 5FQ0A 2D5FA 5F5QA 1JBCA 4HPKB 1GSLA 1C8NA 1DGWA 4CEWA 3GHMA 1UU5A 4LEJA 1N1SA 1N1VA 2DCYA 4XE9A 1POV3 4E2GA 5ACA2 1HKDA 1OA3A 1H4GA 1RUJ2 3KT1A 4DS0A 3N36A 4URTA 4F8AA 2IXHA 2K9ZA 1DQ4A 4CTEA 4X8NA 4Q1RA 2WNUB 3KS7A 3HAGA 5GZGA 5C9AC 2HEVF 4IEPA 3WNXA 5KHGA 5FQ0B 4KWJA 4YFZA 3BODA 4R9BA 3RDIA 1W6QA 2ZGLA 5CADA 2CGOA 3IBMA 1J58A 2HKXA 1AVBA 1AR81 1UZZA 2W52A 1RUD2 4UW6A 3C2UA 2H0BA 2XBO1 3HQXA 1OA2A 1AR91 2PELA 1ZZ6A 4PIYA 4WVMA 2YUEA 4PIXA 1LRHA 4BWOA 3B93A 2OUHA 3WW2A 2RS51 4KU7A 3MICA 2W0XA 1D0HA 2IXKA 4QPYA 1H9WA 1W6QB 3KGLA 1BEV2 2YZ4A 1R1A1 1SLBA 2BNOA 2WS93 4QU2A 1N3PA 4NN0A 1D0GA 3VN4A 1GNHA 3CU7A 4LTAA 1XQNA 5DUUA 2UYAA 1YI7A 4NOTA 5DUVA 1ZYBA 4I02A 4E9KA 4FO9A 3WDWA 2A6VA 2IXIA 2WZPP 4YG3A 1O4TA 4AXOA 3AJZA 1GKBA 1IS4A 1I5ZA 1OA4A 5SV8A 2CV6A 4O9EA 2Q8OA 3MIEA 3LKJA 1D4VB 1Z7S1 4IERA 3CO2A 3ZMOA 4E2SA 2X29A 1CR7A 4GKYA 1PVC1 3AKTA 4IEXA 3VDDC 4YYOA 3ZN6A 4BMBA 2BFUL 1CAXA 4MSVA 3FLRA 5HCAA 4P9JA 4COYA 2F4PA 3E5UA 5ABJA 3RMXA 4FPFA 2ZGPA 1RMU3 1MS3A 1UIJA 1SLLA 5JVVA 3IIAA 5T5LA 1LOCA 4YG0A 4GALA 1CAUA 1KJLA 1AX0A 3RMYA 3VBRC 1QOTA 4DZGA 4BIFA 3IDCB 4AFMA 1X7NA 2XH6A 4XF3A 3RYKA 1QH7A 1REDA 1HXS2 4FXGB 2XKOA 4I3GA 4EN6B 3RYRA 3ATGA 4JAAA 4XTMA 2R1BA 3U07A 5GZEA 2HWB2 2PHXA 1FOD1 4GKXA 4OLLA 4YG6A 3ECQA 4FPJA 2VECA 1G9CA 3GBGA 4LBQD 5CG8A 1V70A 1BK1A 1CAUB 3AP9A 5JPNB 2JE9A 5CFDC 3B00A 5J48A 1KDMA 1IZ3A 2P34A 1AR62 1GV9A 3VBHB 1NQDA 4ZU7A 1MVEA 4WZFA 1DGRA 2DVBA 2VVDA 3TNQA 3FUQA 1IS5A 4NWVA 4OHVA 3POYA 4IV3A 3T2TA 2CY6A 4FBFA 2B45X 4CP1A 3GNEA 4YVWA 1LEMA 1RHI1 3ZXLA 1RUD1 3W58A 1JH5A 2LALA 4AEKA 3WW4A 1LHWA 1RUC2 2XL9A 2IZWA 3MIGA 4KNCA 1G9BA 4M0NA 3WP5A 1KDKA 4XFAA 3BB6A 1LULA 3NL1A 3AKSA 5F6LB 1C5HA 1ALYA 4JRLA 3QOPA 1FAYA 1JYIA 2OYZA 1MEC2 4DQAA 1BEV1 1R1ZA 5AC93 2R072 2R49A 1GYKA 2YDEA 1GICA 4YRDA 4BA6A 5DZEA 1ZRRA 1OOPB 1PO22 2WZR3 1OD5A 5IK8A 1EV12 3UK9A 1J3RA 1PZ8A 4LBQA 1LOFA 1NG0A 2AUYA 4E4SA 3M3IA 5C8CC 1LEDA 3VGIA 4KQ7A 1TME3 2JG8C 3WUDA 1PO12 2JECA 3WDYA 4OI1A 3ZN4A 1XYPA 2K0GA 2GC1A 3OGJA 5HBAA 2DCKA 3EJKA 3IPVB 5BNNC 3CJXA 4ATFA 1N47A 4I2OA 1LCLA 2ZS6B 4HKOA 4H55A 3POSA 3VBUC 1SBEA 1C8M2 3VHPA 1NCRA 1W6OB 1X50A 2QNKA 4QGNA 3GZUC 1BBT2 3MI8A 1TMF3 2GN3A 2W08A 4LBQB 4LA2A 1J59A 1WGPA 4QPGA 5FBZA 3GBWA 3CJIA 4H7LA 1CAWA 3M4FA 4YZ4A 2D6PA 1ZA4A 1ND2C 4YW2A 4N53C 1FV3A 4FAHA 4A7KA 3AFGA 3O12A 4OI0A 3MDPA 4IQPA 5D1IA 4GMP1 1XNKA 4IV3C 3LSEA 3A0KA 4EN8B 2RMU2 1C28A 3V0BA 1KS4A 4AFCA 3KMHA 3THPA 2NQYA 3VV1A 4DINB 4QPGB 1NCQC 1KD7A 4Z1VA 2EALA 3AP5A 2WKKA 4QT6A 2NP0A 1CAWB 4GIQA 3LAGA 2DTYA 2PHDA 4P14A 5D8AA 4HANA 2UWBA 1OHFA 1IPKA 1ZBA2 1V6LA 2RS13 4PLMA 5EV7A 1HRI2 1EAH1 1O5LA 2Y0IA 4WM8C 1AR61 1NE4A 5LEJA 5FAXA 1NZCA 4FSJA 4BH9A 3AM2A 1YCIA 1ZX5A 2XVKA 4FCAA 1QJU3 4WM7C 3ZXAC 1CJDA 5JOWA 1HQNA 1RUG2 1XNBA 3B69A 4AEDA 1AZDA 3CNAA 3KT7A 2ZPXA 2QE3A 1ULEA 4YFWA 4JGZC 1LOFC 1LENA 4UXAA 5I0SA 4G9SB 4LO6B 3MLLA 1SBFA 2JXAA 2R6QA 1GFF2 4FPOB 2BGCA 2Y38A 3VBFC 1RUC1 4N9HA 1RIRA 5LRSA 4YLZA 3WDXA 2QJVA 4QX5A 5I8YA 4HK9A 1SLAA 1ND3A 1CPNA 1BKZA 1G9DA 2VPVA 5K0UA 4RL7A 2CTVA 1LHOA 5FO7B 1HRV2 1JUHA 3N4MA 2CAVA 5TSWA 3PVBB 1RGSA 5DXDA 2GMEA 1GR3A 3O0XA 1MEC1 3SLIA 1UPSA 3WY6A 5L7OC 2R071 1UU4A 2P3KA 4HMZA 5FREA 1DQ2A 4Y1UA 3WW1A 4LE4A 1PO21 2CWSA 3DL3A 1A3KA 2ZMNA 1MZ5A 5A3LA 1DYKA 3NO8A 4CDUA 2OZ6A 3AZYA 2GN7A 1DFQA 3M3CA 2A6WA 1G7YA 3PVEA 3VZNA 1PO11 1R091 3PVNA 3ZO0B 1AL23 2VVEA 3PJYA 5BNOC 4F7ZA 3T1LA 5I0TA 2ZKNA 3WX5A 1QJZA 4CDQA 2A3XA 4FTEA 2JEMA 3ETQA 2A71A 3R4UA 1ZZCA 3E6BA 3FC0A 3ZIXA 4KGGA 1C8M1 5BNPC 1JOJA 1FMD3 1FYUA 4GH4B 4INDA 3ZFEA 3ZYGA 4AVTA 4IEUA 4PBOA 4XZPA 2XWJB 1VBE3 1REFA 3H9AA 4QGMA 1LJ7A 1UMZA 1XNDA 4K1YA 3MGUA 3WDVA 4Y4YA 1PGW2 2DVDA 3UKVA 5JIAA 4M3CE 1DBNA 2WNVC 1N3QA 1KFUL 4LT5A 1S2KA 2NYYA 1S0DA 4KH9A 4OHZA 4BMEA 2VOWA 4CDWA 4CEYA 2B8MA 2RMU1 2FMDA 4P9LA 3WG2A 3BCWA 4X6QB 5L73A 1OLQA 4E27A 1XRUA 2OA2A 3KCCA 1QY4A 2WFF3 2YGLA 2PTMA 4Y1ZA 1LTEA 4C0HA 3M2MA 1A8DA 3RQ0A 5KXCA 4FT8A 3M70A 4RS5B 1U0AA 4FPEA 4Q4X3 2WS92 4HT1T 2JG9B 2ZX3A 1VR3A 3PTYA 4DOUA 1YFYA 3MLJA 5K0UC 3INAA 5C4WB 1ZBA1 3J8F3 3IM0A 4ONUA 1WMEA 1O3TA 4AQ2A 4IEWA 1AXZA 1KQRA 2HWD3 2VOVA 3S30A 1QOOA 3APBA 3CEWA 4A2UA 3OD0A 4JTNA 4XJUA 2GALA 1RUG1 5FLIA 1ULGA 2ZGSA 3IWZA 5I0UA 4Q26A 4AI8A 5KHJA 2LUWA 2ARBA 5KHHA 1G6NA 1MQTA 3DV8A 1CPMA 3ELNA 5GZFA 2YMZA 3ZSLA 1V6KA 2BVBA 4ISRA 1WW6A 2A6YA