3CO2A

Mlotik1 ion channel cyclic-nucleotide binding domain mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
GDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Mlotik1 ion channel protein
publication title Structural and Energetic Analysis of Activation by a Cyclic Nucleotide Binding Domain.
pubmed doi rcsb
source organism Mesorhizobium loti
total genus 26
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3co2A00
4LTAA 3SMHA 4X6QB 1Q3EA 4D7SA 4AQ2A 1Q43A 3LA7A 3WW2A 1WGPA 2PA7A 3EQEA 3I54A 4I01A 1JUHA 4I09A 4L11A 1SEFA 1NZCA 2XLAA 4KL1A 3OTFA 3LAGA 3SCFA 3IBMA 4FBFA 3TNQA 4LA3A 1ZNPA 4OFGA 4YRDA 1O5UA 4XFGA 3RYKA 4IETA 4BIFA 3BU7A 5JSPA 1G6NA 3OGJA 3OCPA 3I59B 5I0RA 3H7JA 2BNNA 2BGCA 1NE6A 4IEPA 2Q1ZB 1UIJA 5LEKA 1SQ4A 2D5HA 1O7FA 2ETEA 4XFIA 4AXOA 3BCWA 3KGLA 2F4PA 1X8EA 5LRSA 3WW4A 4XETA 1O3SA 1SFNA 4RD7A 2XGXA 4WBBA 5CVRA 4ONUA 2K9ZA 3OD0A 4I0BA 4QMAA 1DZRA 4KWLA 3R6SA 3CL1A 3GBFA 1EP0A 1OD5A 1EY2A 2ATFA 4UBHA 2EA7A 2GC1A 3WW1A 2N7GA 3QACA 4QXKA 4XFFA 1FT9A 3CO2A 5BXXA 5J48A 5FCCA 3EO6A 3H1YA 1WLTA 5C6CA 1ZZ7A 4LULA 3L2HA 2Q4SA 1V70A 4JV4A 1VP6A 1VR3A 2FMYA 3BPZA 1CAUA 1TQ5A 3H50A 3ELNA 3IIAA 3TNPB 5BUVA 1J3PA 4BH9A 2I45A 4I2OA 3H3UA 3CJXA 3LZZA 1LRHA 1RGSA 4PIYA 3S0MA 4META 1J1LA 1DZTA 5J3UA 2XKPA 2PFWA 3CF6E 3FE5A 1U12A 4HVRA 5AVPA 2KXLA 4HSLA 4A2UA 4IEVA 2OA2A 1UW8A 2MPFA 3E5UA 4UBGA 1O3TA 1OFNA 3D0JA 2PHDA 4F7ZA 3MZHA 1ZRDA 2XL7A 4IEOA 4KU8A 5FLIA 1ZRRA 3BB6A 3FHIB 3LA2A 2IXKA 5KHGA 3M3IA 4J1XA 4HVQA 4H7LA 5FQ0A 3NSTA 3BALA 1H1IA 1I6XA 4O9GA 1UD1A 2CAVA 2CAUA 1LKNA 2IXCA 2UYBA 3HIFA 4B29A 5CADA 4LEJA 4QGMA 4F8AA 3N4MA 2CGPA 5BY5A 2VPVA 3S7EA 1X82A 3NW4A 5KHHA 3KGZA 2ET1A 2H0VA 3LA3A 1QY4A 2O1QA 4E2SA 4Z07A 1ZX5A 2DCTA 1UIKA 3SHRA 4Q0UA 1J3RA 1WA4A 3ZDSA 4Q0VA 5I91A 2PYTA 5CU1A 4XFCA 2QJVA 2UY9A 1RUOA 3CLPA 2QCSB 1I5ZA 2IC1A 3H3ZA 2D5FA 3UKTA 4TLFA 1QXJA 1Q5OA 3KSCA 4QX5A 2B8MA 4R52A 1QXRA 1YFYA 4K8FA 4QM9A 4WVZA 1YFXA 1NYWA 5I0UA 1RTVA 2Y0OA 2PAKA 2D93A 4MZUA 3H1WA 1GQGA 1YUDA 4HN1A 2IXLA 2WFPA 3EJKA 3HQXA 4IEZA 3H1MA 1XRUA 3U11A 1YLLA 3ACLA 4MGKE 1DGRA 4HMZA 3VHRA 4X6RB 3D82A 4Q0PA 2PAEA 3ES4A 3LWCA 3UKVA 1H1MA 4QM8A 3SCHA 2IXJA 2GC0A 4HN0A 4MUVA 4MGZE 3I59A 1RC6A 4XF3A 3C3VA 1XE7A 3PVBB 1CAWB 1Y3TA 3S7IA 4LUKA 2MNGA 2ET7A 2K0GA 3NKTA 3RDIA 2CV6A 4FT8A 2Z69A 4YNIA 4MV2A 1ZZ6A 4O9EA 3RZZA 4BYYA 3B02A 3O14A 3QOPA 4EWDA 2VECA 2BNOA 4IERA 3ROUA 1CAXB 4HZFA 1J58A 1ZZ8A 4PIXA 3NL1A 4I3PA 1ZREA 5I93A 2E9QA 3IDBB 4Z82A 4I02A 3NJZA 4R8HA 1YFWA 2Q0AA 4IEUA 1PMIA 4ZU7A 3E6CC 1J59A 2XKOA 2PTMA 2P17A 1QWRA 3KCCA 2H6CA 4CYDA 4HBNA 1CAVB 1UCXA 2QDRA 1GQHA 3SXWA 3ETQA 1LB2A 2ZCWA 4XFHA 2GC3A 1CGPA 3RNSA 4EV0A 4KWJA 4NVPA 2OPKA 2O8QA 4IESA 1O5LA 1ZVFA 5J7MA 3I7DA 4Q29A 3HT1A 5JR7B 3E97A 1YHFA 2Q30A 5KBFA 4IEXA 5D1IA 5E1RA 3LOIA 3CEWA 4XF1A 5E16A 2H6BA 2IXIA 2IXHA 4HSJA 3RYPA 1YWKA 5FLJA 4FAHA 3RPQA 5C8WA 2OYZA 2GU9A 2QNKA 3ST7A 3U10A 3DL3A 4YSFA 4JTNA 3H9AA 4PJYA 2WC2A 4AVCA 2FQPA 1IPKA 1HW5A 4MH0E 4I0AA 4E2QA 4XF0A 3JZVA 1J3QA 1O3RA 3FX3A 3H8UA 5I8SA 4HLTA 1ZZBA 4AVBA 1OMIA 1UPIA 4EROA 4E2GA 2XLFA 5HI0A 4DINB 1ZRCA 4EWAA 2BYVE 1FXZA 3MYXA 4MGIE 1ZZ9A 4IEWA 2VQAA 2B9UA 2HJIA 3FWEA 4P9GA 1X8MA 3GYDA 2OZJA 4XF4A 2OZ6A 4ZU4A 1VJ2A 2QVSB 3SCGA 1NE4A 3WW3A 1NXMA 4WZCA 4L2NA 1ZRFA 5LEJA 3E5QA 3EBRA 2ZKLA 2EAAA 4JVAA 1PM7A 4MGYE 2XHKA 3PLQA 2BNMA 2C0ZA 4Q0QA 1Y9QA 3USSA 1X7NA 4ORFA 2PHLA 3E6BA 5I8YA 5I0SA 4KWKA 4J1WA 4YARA 2UY8A 4N9HA 1CAUB 5LRRA 2B5HA 4LA2A 4AVAA 4FAGA 3PNAA 2V09A 5FDBA 3U0ZA 2Z2SB 5FPXA 1XE8A 3UKNA 4QGLA 3IDCB 4IEYA 4QGNA 1EYBA 4XFBA 5KHIA 2PQQA 3MPBA 4LLOA 1YFUA 3NVCA 5T3NA 1CAWA 2XLGA 2GC2A 3G7DA 5BV6A 1FI2A 4XF9A 5EFUA 4HVOA 1IPJA 3KMHA 2GZWA 1O4TA 2MHFA 3FZ3A 4Q0SA 5JAXA 1LR5A 5FLHA 3ES1A 3DKWA 1DGWA 2PAMA 5JSRA 2EVXA 4MX3A 2BEOA 2GH2A 4KU7A 5KHKA 4XFAA 1CAXA 3MDPA 3E6DA 3FJSA 5FQ0B 4PIZA 3OF1A 5I0TA 4EWEA 1RL3A 2UYAA 3M70A 4IEQA 4LUMA 3IWZA 5KHJA 4UXAA 5FPZA 3EHKA 5F1RA 4GULA 5JSOA 3HT2A 1RUNA 3RYRA 3FFQA 4BHPA 2D40A 3DN7A 5JCTA 4JTOA 1CAVA 2XL9A 5BPXA 4AQ6A 4OLLA 4XEZA 1CX4A 1EPZA 2GAUA 4ZU5A 4N9IA 4D7TA 5EZWA 4YYOA 3DV8A 1OI6A 1O3QA 3D0SA 1ZZCA 5K8SA 2HKXA 1L3JA 3H7YA 5I8TA 3E5XA
chains in the Genus database with same CATH superfamily
2A3WA 4XILA 1DIWA 1PX4A 2WDBA 3SMHA 2P2KA 1Q3EA 4G3YC 3JD72 1W9SA 2VGDA 3TN93 3ZYFA 4D7SA 1V6NA 1STMA 1PIV2 5ACA3 1Q43A 4JQTA 1ENQA 4XJAA 2BGOA 3PMSA 3QLQA 2PA7A 3AKRA 3EQEA 2EXKA 3I54A 1JHJA 3AL5A 4QX1A 3N9OA 3O0WA 1SHWB 4I09A 5LK7B 1I9RA 5JPMB 4YW3A 4LR4A 3DYMA 5JI9A 3VL9A 1NZCA 3ENRA 4RS5B 3UESA 5CA6A 3OTFA 4NAMA 4JGYC 2EAKA 4D94A 5CBLA 2AH2A 5JOXA 2QZ2A 1D4VB 5GLWA 3P1IA 4AWDA 1VBB3 1OQ1A 2ZX1A 1RUD3 5ABJC 5F9TA 4KG0A 4IL7A 3M3QA 4IGQA 3OBRA 3IMNA 4CEYC 1KJLA 1F15A 1TVGA 1G6NA 2HWF1 3BU7A 1ND2A 4PQ9A 1AX2A 3AMPA 4LO8A 3URFA 3PURA 5I0RA 1NE6A 2R041 3ZYHA 1GOFA 2IZWA 1SQ4A 2D5HA 1DGLA 1W90A 2ZA9A 3Q8EA 4FQZA 3ZXKA 4FPEA 1V9U3 3DXTA 4NRMA 5DDJ3 3BCWA 3VD9A 3KCXA 4I3GA 2ZS6B 4MXWB 4S2HA 2XUEA 2ZKNA 2XWJB 4IUGA 3B00A 2WZPP 1RUG1 2Y6HA 5LRSA 3NNFA 3OBZA 4HG6B 1SFNA 2XBO2 5KXCA 3VBRB 1O8SA 1NCQC 2J1RA 1K5MC 2XGXA 2JE8A 1W8OA 2D6NA 1UX7A 3T0BA 1VBC1 3VZOA 5CKQA 1RHI1 3LCPA 1T2XA 3T2QA 1U5YA 2ZEZA 1JZ4A 1LNSA 3EMRA 1ULCA 5FYUA 3AX4A 2D3RA 2X10A 4I0BA 5FXZA 1DZRA 2VJXA 4Q1RA 3AKPA 4Z92B 5BNOB 1OD5A 2DCYA 2VTFA 3C7OA 4FXKB 3TWIA 5T5OA 2WNEA 4XMIA 2GC1A 2IVIB 3WW1A 4X8PA 2HLEA 1TNRA 2XJRA 2WO1A 2UWCA 3HD8B 4HK9A 5DG1A 5J48A 1A34A 3EO6A 2NMNA 5C6CA 1MS3A 2ZGQA 1BJQA 3I2IA 3AFGA 3L2HA 2Q4SA 1V70A 2QE3A 2FMYA 3K75B 5ANQA 2QQLA 5A33B 3M2MA 1RXGA 4Y4YA 2R7EB 3WQBA 3WV6A 3TNPB 2I74A 1ZYBA 3VBOB 1J3PA 3QBQA 2RDRA 3H3UA 4UFKA 3LZZA 1LRHA 2BFUL 3RJ2X 2WWUA 3POYA 1IG0A 3S6PA 4FOYA 2GNDA 1JYXA 1JUIA 4NRQA 1H4HA 1Q8QA 5FYMA 5C3SA 1LOBA 3VBHA 2J7MA 1ZA7A 2EIGA 1LOFA 2PHFA 1PZ9A 3CF6E 1SPPB 4DUWA 3FE5A 3WUDA 2HWE3 1U12A 4HVRA 5AVPA 3WQ7A 3AJYA 3WDXA 2P3KA 1M4WA 5JOWA 1YXWA 2E7AA 2VOKA 5EJZB 5FYYA 3USUA 4LT5A 1UW8A 4AI2A 3J26N 3A0NA 1Q56A 1AL0G 5FOJB 1W6OA 3LKJA 4IV3A 5CIRA 1N47A 2BWCA 1WCSA 3TYJA 1V6KA 3C2UA 3EYPA 3IN9A 5FLIA 4FOWA 4JRLA 1WA6X 4R9AA 1V0AA 4XTPA 5FTTC 2D6MA 1ZRRA 1NCRC 2AZ5A 4XQWA 2ARBA 3LA2A 1QJU2 1JW6A 1HRI1 3NJYA 4N53C 2JKXA 5FY0A 4CVUA 4FTEA 2EICA 2OKXA 5KHGA 3LEIA 3M3IA 2AEZA 1HLCA 4M4PA 2WN2A 3N7MA 4QPGA 5FQ0A 2BOIA 3RMYA 5FZFA 2MEV1 5G05L 4TYSA 4AFMA 2Q8DA 4FI9A 1GWMA 3U37A 4AHWA 2UYBA 2IWGB 1MS5A 1MZ6A 4LHSA 5SV5A 4BDVB 2PXJA 5CFDB 5LA0A 2ZACA 5A7WA 2RMU3 3NRUA 4AGGA 1A3KA 3MI8A 5FZMA 4D8MA 3D4KA 4DRRA 2LALA 4YFZA 3FLTA 2CGPA 5FMDA 5IK5A 2QDNA 1AJKA 1AYN2 2F17A 1Y4WA 1AR91 3ZYGA 4Q4X1 3KGZA 1UMHA 1IKQA 3QH6A 1KS5A 4W50A 2YG0A 2ZX0A 2RS52 4BISA 1X9PA 3CQOA 4PCRA 4BQ3A 2K46A 1HRV1 2V72A 1XSRA 2AEYA 1IQAA 4N43B 5CKNA 1UIKA 2WQ8A 3KV4A 5JUVA 4TLGA 3MICA 4GIQA 1J3RA 3NJXA 4Q0UA 1WA4A 2VVFA 4YM1A 1VRBA 4N7IA 3HVDA 1LECA 1QXPA 2PYTA 3WOGA 5I91A 5CU1A 1UZ0A 4XFCA 5GALA 1KD7A 2QJVA 2W39A 2UY9A 4Q4W2 4XXAA 5KC6A 3CLPA 2VL4A 2J1EA 3AYCA 2QCSB 3CMGA 4COYA 2R1BA 1ND2B 5D8AB 2XUMA 5DZEA 1HB3A 5FUNA 3T0DA 3UKTA 1PO11 5FZBA 2DUOA 4TLFA 4CP0A 5A70A 1Q5OA 2Q1FA 3KSCA 4GMP3 1POV1 3WNKA 5KXBA 5CG9A 1QXRA 2JG8C 2W68A 2R0HA 1ULPA 1YFXA 4YPJA 2DTWA 3A23A 2WR9A 3NAPC 1XE0A 4BIOA 2PHRA 5E8AA 2Y0OA 1UMIA 3POJA 4AYUA 2D93A 2R072 5A3UA 2WUHA 1TG7A 2WFF2 1BKZA 1MZEA 3I3MA 4AHZA 1GZWB 1GR3A 1RMU2 2R32A 3H1MA 2Y8KA 3GXUA 1WCKA 3JBG1 4H7MA 1YI9A 4X6RB 3D82A 4XAAA 5FK8A 2FD8A 1BYHA 5DG2A 4ET7A 3HBKA 4ZS3A 3BTAA 2RJKA 2ZGLA 5F32A 2W1SA 3PHMA 4HN0A 2HWC2 1C57A 1RC6A 1JZ6A 1KFUL 2QQMA 2WT0A 5FZ9A 4FCAA 1K42A 4QKFA 1BHGA 4ASMB 2FMDA 4XABA 3S7IA 4LUKA 1WMEA 2HWB1 1W2TA 4CDXA 4R4ZA 4WVMB 2P3JA 3B9IA 4EN8B 2BWAA 2A6YA 3NV4A 4GKXA 5CKMA 1LGCA 3TN92 4OUEA 1Q8PA 2K0GA 2ARXA 3WD5A 2CV6A 1W8NA 1S0GA 4BCUA 4NMIA 2G4IA 2CY6A 4YNIA 4E4SA 5FPLA 4FTBA 3KHCA 5EPAA 2BGPA 1O8PA 3ZIXA 4UW6A 1VMJA 4KBZA 2A7AA 4K3UA 1GYKA 2WNVC 4UI9L 4D6QA 4RS5C 3VBFB 2BNOA 4IERA 4Y24A 1LEDA 3OYWB 2JIJA 3W9AA 3I97A 4GH4C 1H30A 4PIXA 2W1QA 5C3PA 5C5TA 1ZREA 4LQRA 3U75A 4ES8A 1DYPA 1VBB2 3IDBB 4Y22A 5A3TA 1NKGA 4Z82A 3RZLA 4GB33 1GANA 1PX3A 1YFWA 2Q0AA 3AFKA 4MYEA 3VKOA 3E6CC 1HB2A 1UOFA 2YFUA 1ULEA 3VDDA 5H9SA 4BXFA 2OVUA 4DXTA 2OPWA 3LEGA 4QKBA 1VMHA 2XR4A 4YZ4A 4CUCA 1QDCA 2ZEWA 3K4ZA 1V9U2 2QQOA 3TAYA 5IATA 3VDBA 4AQTA 1CWPA 1DG6A 1FATA 4UF0B 2W52A 4LKFA 1JYVA 2V73A 1UNBA 1G9DA 4YWAA 5FYBA 1OD3A 5LASA 4FPHA 4OHWA 3UL2A 3WZ1A 3OOXA 3VBRC 1ZBE1 2P6CA 4NVPA 5BNNA 4QDRA 2XPJA 1UZYA 4E8DA 1VBC3 3FLPA 5C3OA 1ZVFA 1C5IA 3QCWA 5J7MA 4Q29A 3HT1A 5JR7B 2AENA 1YHFA 2YC4A 2BQPA 3AZXA 1EV11 2ZGPA 3LD8A 1RUI1 5FYSA 5K0UC 2FZ2A 1MS8A 5ERLA 5D1IA 4ITCA 2P3IA 2PLV1 5IT6A 1MQTA 4XF1A 5HXVA 1PMJX 1FPN2 1AYM3 1B35A 5B2GB 4HSJA 1LOCA 2LTNA 2QQKA 2J42A 1OPOA 5FLJA 1VBE1 3WXPA 1DQ0A 1W3VA 1G7YA 3AKSA 1AXYA 3HQUA 1W6PB 4XQDA 4XZUG 2OYZA 1W2NA 1WW7A 1YJKA 1N1SA 1SBFA 1D4M1 1UXZA 2GU9A 2W91A 4KGGA 3ST7A 3BUCA 5ANNA 3RJRA 3T4VA 4CEWA 2VCMA 3NJVA 3POIA 1NLSA 5FY4A 1QNWA 3H9AA 1QOOA 3I2GA 3VD5A 3BPSA 1LHWA 2WC2A 3AMQA 3KM5A 2FCUA 3WNXA 1X9TA 3PU3A 5BNPA 2BBAA 1UO9A 4XUPA 3T3YA 1BMV1 1IHMA 1SDWA 4XTMA 1GSLA 3UV9A 4Q4Y3 5LATA 5C4WB 1NLQA 1O3RA 3VKMA 1RUC1 4XJ9A 2HWE2 3AP6A 5I8SA 1L7QA 5IWFA 2QQUA 2DFBA 1C28A 1IZ3A 2G1MA 3FBMA 4IV1B 3TRSB 1NY72 4XCBA 4GMP0 1ZZ9A 2VZOA 2V5DA 1R1ZA 5GKAC 4D3WA 1GP4A 4GXLA 2HJIA 2ZGKA 4RN5A 2VW1A 4XXPA 2JECA 2JG9B 1WMDA 5F5AA 1OUSA 3GYDA 5T50A 5EHDA 3IMMA 2LRPA 4TSVA 4XF4A 4ZU4A 3ZYJB 1PVC3 5HV0A 2PHWA 2Y6FA 1NXMA 2HYKA 5FZGA 3T4HB 3I2DA 4Q27A 4A6SA 4WZCA 2P3YA 5CZKA 2OT7A 2NZ9A 4MADA 1YC61 3WNLA 2R061 2Y6GA 4W4ZA 4MGYE 4URAA 4NHMA 2BBVA 1Y9QA 3USSA 1C1LA 1DDLA 4ORFA 3VDCA 1KS4A 1RUF1 1PO23 3U4XA 4ZXKA 4MGSA 1UWWA 3LE0A 3WF3A 1OHFA 1RUE3 2NM1A 1DCSA 4COZA 1VB2A 1CAUB 4W65A 4LA2A 3B93A 4XQ4A 2ZMKA 1H8TB 1HIXA 4CRQA 2E63A 1O59A 4MO3M 4FP2A 2G9GA 5DPNA 5FPXA 3PUQA 4ASLA 1LU1A 4DY5A 4F3JA 2WL1A 1JZ2A 4FFFA 1SLIA 1KDKA 4K40A 5FK7A 2Y6KA 2YROA 1XNKA 4P5HA 3MPBA 4UW3A 2RM21 1HV1A 4YM0A 3ZVXA 5K4LA 3TB0A 3AC0A 1YFUA 1PIV3 2ID4A 1YQ8A 1UQXA 1QH7A 1RUJ2 2GC2A 3GZTB 2DWRA 4RGKA 2RG4A 4JDMA 5LA2A 1FI2A 5BV6A 2LM3A 1ND2C 5D8AC 5TSWA 4RR3A 4KWUA 4WM8A 3W21A 5JMCA 1ALYA 1LHNA 1PO13 3V56A 1HX6A 4HK8A 2VTXA 3KZ4C 2RVAA 1BBT2 2RDSA 4Q0SA 1TME2 3WINE 4DUXA 3DKWA 1OFSA 1TMF1 3KS7A 3RFRA 3HR9A 3QD6A 5IK8A 2EVXA 2WS93 5DAWA 1SFYA 2XVKA 5FP4A 3ZFGB 2GH2A 2WO7A 2WZR1 1SG3A 4U2AA 1CAXA 3SQOA 4EN0A 3JBG3 5LB6A 4YM2A 4DUVA 4BLIA 5FYVA 2VW0A 5I0TA 4IEQA 4HXCA 3MIDA 1N1TA 2Q8EA 3IM0A 1DGWX 2ZGTA 1KITA 4K21A 2FDKA 3EHKA 4PIZA 4DXSA 5GLZA 5FIXA 2F4LA 2GMPA 4AEKA 1R081 4M0HA 4AF9A 5KXDA 4BXSV 2B46X 2C5DA 1WMXA 3ORJA 4BQYA 4BHPA 1PGW1 2CU5A 4KQ7A 1MEC3 2BTVC 2VMIA 1D0HA 4HT1T 5BNQA 2XL9A 1UF2C 4Y1VA 4XUTA 2V4AA 1NCQB 5BPXA 3VN4A 1DBNA 1JU4A 4AK3A 2D97A 3LEMA 4RQPA 4AQ6A 4LO6B 1EPZA 4YG0A 3B94A 4KGQA 4DXZA 5EZWA 3WNMA 2W95A 1CPNA 1HN0A 1OI6A 5DUWA 4SBVA 4XUNA 1JMUB 5C9AB 1O3QA 3GGLA 3D0SA 5K8SA 2HKXA 2QQVA 1L3JA 3H7YA 4PT6A 4M4RA 3I8TA 5DN2A 3RG0A 3UJOA 1W6NA 3WR0A 3LOBA 2PHUA 3FFZA 4AVSA 2WA4A 5B4NA 1GQPA 2VMHA 2OXBA 4X6QB 5IFTA 1AL21 1CJDA 4ZY9A 1YQ2A 1R091 3DYPA 3OBAA 5CISA 4FVVA 2W1WA 3LA7A 2JXAA 4ZONA 4LORA 2KR2A 4QPYA 4NIIA 1I1EA 2BOJA 3PTRB 4LO5B 1DF0A 4AFDA 4AVTA 2GH8A 2XLAA 4IV3C 1NLRA 2R042 2XJPA 3WX5A 3MIHA 1UMZA 4I0WB 1S2EA 2B4KA 2DU1A 3SCFA 4FBFA 3K4AA 5F2SA 5FKCA 3LDBA 3TNQA 1JYWA 1COV1 3H8OA 1O5UA 2R0FA 3WT3A 1YEWA 5FZOA 1LGBA 4LMFA 3SH4A 4LK6A 4XW3A 1QQP1 4A45A 5JSPA 4XYXA 2W1UA 4PBPA 3I59B 3H7JA 2WZEA 2CWSA 1UIJA 4L92A 1O7FA 1VBC2 3BIEA 4PQQA 1W9TA 2PHTA 1W8ZA 2GN7A 4ZS2A 1DLLA 1ULGA 1X8EA 4LBQD 3SC7X 2RS13 4CP9B 1OOPA 5KWRA 1MS4A 1QJU3 3ASIA 5F5CA 1O3SA 3WCSA 3SITA 1UU5A 5JOZA 4WBBA 1K45A 2YYOA 5FRAA 5JLVA 1LOAA 3MF9A 1SDDB 2K9ZA 4JKMA 3OD0A 1HJGA 1OKOA 3I3QA 3UETA 3ZR6A 2QTWB 1ND3A 4KWLA 1D2SA 2LROA 3K4DA 3LQCA 1W03A 1H1AA 2ATFA 4UBHA 1XNTA 2FHRA 1XQNA 2KM2A 3ZN6B 3VZMA 2N7GA 2GALA 5G04L 3QACA 4LBNA 1FT9A 4RR3B 4NPRA 2VD7A 3IT8A 2VMGA 2YPJA 4AVVA 4CSWA 3ECQA 1VP6A 1PZ7A 3BPZA 4P5YA 1TQ5A 4PLOA 1QNYA 4BM8A 4R9BA 4B8EA 2BVBA 1T6BX 1H9WA 4IV1C 4AI9A 2VMFA 3AVRA 3I3EA 4H2AA 3THTA 4I2OA 1POV0 1RGSA 4RYDA 4Q4W3 2VW2A 4PDWA 3ZPYA 2JB4A 4META 2FCVA 1WWYA 3POEA 3ZXDA 1CIYA 5J3UA 1W8WA 3OUJA 4JDNA 1AX1A 1V6JA 2CGNA 2JG9C 2Z4FA 4IGOA 4BQ4A 2EIEA 1Q8VA 5C8CA 1DHKB 5A32A 4LBJA 5A7PA 1RITA 3GCWA 1VBD1 3UK9A 2VZRA 3CIHA 4QB2A 2JG8B 3V65A 2ZAAA 2OUHA 2KXLA 3NAPB 2W94A 1H6XA 1QEXA 2BVVA 4A2UA 3KT1A 2A70A 2MEV2 4Z1VA 2VY0A 1WBLA 1O3TA 2QBXA 5A7NA 5A1FA 1F4AA 4IEOA 1WCUA 4KU8A 3HAGA 2Y6JA 1RMU3 4CDXC 5FZAA 2ORXA 5IVCA 1PO22 5A6ZA 4P02B 5A80A 1O91A 1C8M1 4JKKA 3AP7A 3NNGA 2IXKA 2UWAA 4MSVA 4WM7A 5EJ1B 4JGZA 4B4QA 4MGTA 1WCQA 1LOGA 2DYCA 2RS33 1AR92 4H7LA 4UFIA 2NYYA 1I6XA 4EN6B 1QJY1 1H8TC 5FY9A 1OA3A 2CAVA 1UY0A 4AEDA 1O6UA 1IPSA 1DFQA 1U5IA 4B29A 4BQ2A 5J09A 1QDOA 1HRV2 3K77A 2VUDA 5F6KA 4F8AA 3N4MA 2EF6A 1FOD1 2WNUA 1KJRA 2EXIA 5DAVA 3MW2A 2WKKA 5AC91 3V0BA 4P9JA 1QF3A 3ZYIB 4OQ9A 4ATEA 2GMEA 4GZ9A 2WAAA 1XNDA 1W28A 1W6MB 2VQTA 4M00A 3UGFA 3I49A 2H0VA 3LA3A 1QY4A 2O1QA 1NT0A 4E2SA 3SH3A 3VDDC 1QU0A 4Z07A 4C90A 1PO12 1ZX5A 1TEIA 2WNVB 3WF0A 4Y1XA 3O1VA 2D6LX 4SLIA 2VOVA 1AZDA 5FZIA 1DQ4A 4MG2A 4GH4B 1FX5A 1KQRA 2A6VA 3R4DB 1RUH1 4QQLA 3C7GA 3N9LA 4RA0A 1RVF1 2VH9A 3ZDVA 2WS92 5CG8A 1Y9GA 4RHV3 4FQ4A 4IXLA 4CZSA 1I5ZA 3KV9A 1S2BA 3ZFGC 5CYYA 4LITA 5H9PA 1OKQA 5BNNC 1V6MA 2ORZA 3JBG2 3PVEA 4YG3A 4Y5Z0 2DV9A 2DVDA 4JRAA 2B8MA 1XB9A 2JDNA 4QM9A 2UURA 1U5XA 2TEPA 1IS4A 1NYWA 1YIPA 5I0UA 5IW0A 4XOGA 1LCLA 3ZSLA 4KG8A 3VKFC 5L19A 3PUAA 1IKPA 1KEXA 5D21A 2IXLA 3BODA 1MQTC 3EJKA 3HQXA 1S2KA 1BK0A 2BP6A 1GU3A 5FZCA 1MEC2 1B35C 1DGRA 4HMZA 3VHRA 2X5IA 4NHXA 4FPYA 1W0OA 1XNCA 2OIIA 3PMEA 1QIQA 1Y43B 3LWCA 5C33A 1QOSA 1FV2A 2ZX4A 2GC0A 1ULDA 1W2AX 4LBQA 2E6VA 4G9SB 4EQVA 3BYWA 4HETA 4CCNA 2B39A 5K0UB 2AR6A 4AEJA 5C9AC 2VZTA 3MIFA 2ZAHA 1ENXA 1R1A3 2QQWA 5GJ6A 3WP6A 2WWJA 4ARYA 4CXXA 5FMOS 4DB5A 2A71A 4AEMA 2WRAA 1W2UA 1N1VA 3NNJA 4XAEA 5BNPC 1FPN3 2JE9A 1RJ8A 4XBQA 3GALA 3SEPA 3ZYPA 2VOXA 2WZ8A 4YGBA 1L7RA 2YUEA 1UOJA 3THPA 3WSOA 1DQ2A 4YZ3A 5FREA 4MV2A 4XJZA 1EAH1 5T54A 4QPIA 1OH3A 1P8JA 2VCCA 4XVHA 1JZ5A 1OH4A 1FNYA 1UU6A 2DTYA 4O9EA 4Q2FA 3ZFEA 2CSGA 3IPVB 2HYXA 3KCYA 3QOPA 1QJX1 1F31A 3M4FA 4Q8LA 1NUKA 3ROUA 1OF4A 3K3NA 4H3WA 1G9BA 4QQHA 1LULA 1H8VA 3OGVA 2E7QA 4I3PA 3VV1A 2E9QA 2VBBA 3U14A 2ZGSA 5F5QA 2D44A 5FP3A 4NPMA 3NO8A 3PUSA 1Z0HA 3VB9A 2AGSA 3SISA 4CU7A 2VM9A 3U1XA 4C0BA 4LBOA 2C26A 4R8HA 4ZU7A 4M3CE 4FSJA 3CDZB 1OBNA 1X36A 1ZBE2 3POFA 1IQDC 1U5ZA 2HWD1 2PTMA 4WVWA 3KCCA 1QWRA 1MS0A 1UAIA 5DAQA 5I0DA 3WVJA 3NV2A 4CYDA 1AR71 1CAVB 2VMCA 2A6XA 3N36A 1UCXA 1GZCA 2QDRA 2W5FA 4BQXA 4Q8KA 4YW2A 3POSA 1OPMA 2X8KA 1EV12 3ETQA 1RUI2 2DCKA 3DUIA 4H55A 1W6QA 2RS12 3DYOA 2JENA 1S1AA 3JU9A 1ULFA 1BZWA 2PLV2 2Y26A 4CXWA 1PGL2 3VHOA 3KB5A 1CZVA 2OPKA 2O8QA 1JXNA 4EZHA 3MUZ1 2NQYA 3KT7A 4P9IA 4L9BA 1LHVA 4IESA 3HPNA 3PTYA 4Y5SA 5LBCA 3X29B 5A6YA 2DUQA 5GZCA 1D4M2 2VNOA 2NMOA 2WYSA 3M7AA 1OLQA 2VE1A 2QQNA 2CWMA 5FZKA 1F8VA 4IDZA 2YHJA 4AI0A 1NQJA 3OSDA 5E1RA 1LU2A 2E33A 3H8XA 5K9YA 1BK1A 2H6BA 3MIGA 3OPZA 4AI3A 2ZGUA 4XUQA 1W0PA 1C1FA 1HKDA 2IXHA 3ZXJA 1CONA 4UFHA 4NWVA 4RR3C 4WM8C 3WG3A 1VB4A 1VBA3 3RPQA 1BMV2 1DGRN 3DKQA 5C8WA 3J9SA 1JOJA 3ZXEA 2JEMA 2YBPA 3U10A 3KT4A 3DL3A 4DO0A 4UOJA 5FPAA 3AM2A 2Y60A 4DY3A 2XOMA 4Q26A 5HCHA 1LHOA 4AVCA 3NNMA 1A6CA 1UPSA 1HV0A 4QX8A 2FQPA 5E89A 1RUJ3 1VALA 2JDPA 4YVWA 3K3OA 2WJSA 5F6LB 1VRH1 1HW5A 5FXXA 2B45X 4V2VA 4ZKTB 3F2ZA 4E2QA 4OHVA 4D6SA 2X05A 5LA9A 1G9AA 4S2FA 4HL0A 1SLCA 1ZZBA 4HLTA 1OMIA 1UPIA 1G9FA 4OVEA 1AR83 1BBT3 4GAZA 3JXSA 1TME3 1VE0A 3O1OA 1XC6A 4NOTA 1IOAA 4Y20A 1PHMA 4EWAA 5LA1A 1JODA 3LFMA 3MFCA 3MYXA 4K9SA 4IEWA 1QGLA 2BU9A 2D6OX 1YIFA 3BGAA 2JX9A 3C7HA 3JD71 5APAA 4JDOA 2P34A 3MV01 3FWEA 3T2OA 2QUOA 4LK7A 4FPOB 2WLPA 2VBDA 2OZJA 4P9YA 1N3QA 2OZ6A 3EB7A 5IVYA 1VJ2A 5AVAA 2GP5A 1GBGA 3WW3A 3VZKA 5JXHA 5HV4A 3AB0A 4XJ8A 2RR11 1HJFA 3HMYA 4L2NA 1ZRFA 2DF7A 1W9YA 2RS32 3WNOA 1WMFA 3E5QA 3T2TA 2EAAA 3O0XA 4GD4A 4Y1YA 5IHRA 5GM0A 1PM7A 4HOOA 2B42B 3NKGA 5FYZA 4LBMA 4QX7A 2XJTA 2PHLA 5HBAA 3CZJA 2C9AA 1DYOA 5I8YA 1K12A 3N3HA 1SCSA 2DURA 3O0VA 1YQCA 2RM22 1J1TA 2BJSA 4YARA 2UY8A 3FBYA 2B5HA 2W0XA 3ZYRA 3OG2A 1BXHA 3RZGA 1TNFA 3GF6A 3UGGA 1H6YA 3PNAA 3ZM8A 4W6XA 4CDUA 4BQ5A 1XE8A 3ACGA 4QGLA 2XMLA 2W08A 3IDCB 5FZ0A 4J25A 3M3OA 5JPNB 4XFBA 2XBO1 2YBSA 3VBHB 4HPKA 2ZGMA 4CCLA 5LCWL 4DXRA 4LLOA 2PHXA 1VLNA 2RJLA 1RUH3 4FPGA 1TMF2 5DZGA 5F7UA 4BLJA 1W05A 1CAWA 4YVSA 1JZ3A 3I2OA 2YB7A 1CESA 1XSQA 3G7DA 4G4FA 4RHV2 2YY1A 4IE6A 4FPKA 3LB9A 4GWMA 3USUB 1SMVA 5GLUA 2WT1A 3NNLA 4A3XA 4FFIA 2HWF3 4HVOA 3GZUC 2VQUA 4MLOA 4YW7A 3P5BA 2B7YA 4PF5A 1VMFA 1W6OB 4IV3B 3U07A 2R043 3M1HA 4N90A 5JAXA 3DPRA 1DYKA 5FLHA 2DFCA 1YYNA 3I2KA 4YW6A 2JD4A 1DGWA 1KGYA 1CZSA 1HDKA 5JSRA 2V4VA 2VNVA 4TTGA 3D8CA 2Q5TA 4MX3A 4UWDA 3CHXA 2BEOA 5IAVA 4NIGA 1RUG3 3VBUA 4KU7A 5JR2A 5KHKA 1K5JA 3MDPA 3AXDA 3GHNA 5LK5A 5FZ7A 5JZGA 4QPGB 1GV9A 3E6DA 3MW3A 5FQ0B 3WP3A 5AFBA 3O1MA 3OF1A 4EWEA 2UYAA 2ZHKA 1OA4A 4LUMA 4Y3OA 5A6QA 3J8F1 5DUVA 5A7WB 1RHI3 1ND3C 5FPZA 3VBSA 5EYXA 1JZ7A 3BU0A 5IYYA 4BQWA 4GULA 3PIGA 3K51A 4JGYA 2EIDA 2ZTNA 4CDWA 3O1PA 2XONA 5J1XA 2D40A 1R1A2 3DN7A 4E4HA 1SLTA 4JTOA 2C24A 4BK4A 4COVA 1W0NA 2VZUA 5ABJA 5FFOC 1UOGA 1OQDA 1ZBA1 2FDHA 4XIKA 2YC2A 5DUXA 5FPVA 5CFCA 4CEYA 1GZTA 1AL22 1CX4A 4ZU5A 1OLRA 3PVOA 2VUJA 4LJHA 4C1WA 4OZOA 5DMYA 2VOWA 5J98B 4YW1A 2C6SA 2JD9A 1US2A 3RSJA 1UY2A 5HXMA 1IS6A 5LZ6A 3O1SA 4ISQA 4BK5A 4GA9A 4NIDA 3WQ0A 1DQ6A 1ASJ1 1QJX3 4JQRA 4QDQA 3VLBB 2Y34A 1GP6A 2KD7A 1UY4A 1D0GA 1C3HA 4FPJA 1COV2 4UFMA 5JVVA 1AR61 3TEYA 3UNPA 1WGPA 1K5MA 4QQPA 2EALA 3WDTA 1W8UA 4AW7A 1GFF2 4LOTA 1QJZA 3CZUA 4HKOA 4KL1A 5DUUA 3MIEA 1MZFA 3LAGA 3TEWA 4NWWA 1XNAA 3WY6A 5LW9A 1UU4A 4QAWA 5GZEA 1OQEA 1W39A 4UT5A 5T52A 2Y33A 4LIVA 2X29A 4XPVA 4XFGA 2RS51 3RYKA 2VNRA 3K46A 5FP7A 4QHBA 4IETA 4WM7C 4JGZC 3I3BA 3ZMNA 4BIFA 1TZOA 1GWLA 1HRI3 1QOTA 2YMZA 3AMHA 3ZPOA 1DQ1A 4Y1ZA 2BNNA 2BGCA 2DBNA 4AEDC 3RVHA 4CCOA 2P4EA 3MLJA 5LEKA 5FMOL 2MEV3 3T1LA 4MGQA 3SKJE 4XFIA 2ZHLA 4EN9B 1H2MA 4CDXB 2VR4A 1FMD1 5C70A 3INAA 3ZXAC 1H4GA 3OY8A 4UFLA 2ENRA 5C5UA 3WW4A 2IFWA 4XETA 4Q4V1 2A1XA 3J7NA 4OULA 4DIQA 3GCXA 1AR93 1S0JA 4BA6A 2FBEA 2ZZJA 4Q4X3 4YM3A 1JBCA 4XUOA 5KC5A 4ONUA 1VBA2 2R071 4DQAA 2D3PA 1UX6A 3PDQA 4EN7B 1OVSA 4AR2A 3O5SA 1HRV3 3JQXA 5DZFA 2WFF1 1REFA 4HPKB 2F6BA 4FXGB 1HXS1 1XU1A 3GBFA 3HNMA 5FZ3A 1EY2A 1BEV1 3WDYA 1XYPA 2EA7A 3ZXLA 4K7JA 3H42B 4OMCA 4Y22B 4YG6A 3AK0A 2YV8A 1NCRA 5H9RA 5EXOA 5FUPA 4P00B 5F8PA 1KXGA 4L99A 5LBBA 3VD7A 4N53A 2R6QA 1ZZ7A 5IAXA 1PK6A 2HWC1 2P37A 1LENA 4JV4A 3SH5A 4LBKA 3VDDB 1VR3A 1HQNA 2DU0A 4AFBA 3H50A 1JTZX 2ERFA 1POV3 3B69A 5FBZA 4CUGA 1AR82 1WCDJ 2Y64A 4N7UA 4BH9A 1CR7A 3CJXA 1OC1A 4LHKA 4DFSA 1NA1A 1DLCA 2YDEA 3WNPA 4NIAA 5ACA1 2BV4A 2X5IC 1QH6A 3GBGA 3H3LA 3ZSJA 5BNNB 2QZ3A 4JC1A 1GLHA 1SBDA 3DEMA 3W20A 3MF6A 4YGEA 2RJ2A 1C8M2 2E32A 4B4PA 3VKLA 3S5AA 1DU3D 1PNFA 4XACA 3KWVA 2RR13 4OUMA 3BTYA 3S57A 4LKDA 4Y33A 2MPFA 4UBGA 3ZOIA 5AFEA 1XYOA 1ZRDA 4D0QA 4F7ZA 4MVTA 1MQTB 2GN3A 2XL7A 5FY1A 4BMBA 1YCIA 1VBB1 2XQRA 2BRTA 1RUD1 4XMAA 2CGOA 1B35B 3DCQA 1OF3A 1N1YA 3FMGA 4OUSA 4H14A 4XBLA 4CP1A 5C3QA 1FOD2 5CFCB 3BB6A 2OQ6A 5FO7B 2HWB3 3ZSKA 5A7OA 3I2HA 1UKGA 2D3SA 2DCZA 4J1XA 3KVBA 4CEWB 2Y0IA 3RMXA 1GUIA 3BALA 1H1IA 3NSTA 4QPIC 1UD1A 5DDJ1 2IXCA 3NQHA 3VHPA 3ZX7A 2ZOEB 5HCBA 3ZFEC 3P3PA 2JE7A 4QWNA 3L9JT 4QD2A 5BNPB 3MBWA 4N8MA 4ZZ5A 4LKEA 5BY5A 2VPVA 1UZZA 3S7EA 3VBHC 3AVSA 3MPPG 5KHHA 1LOFC 1RUH2 2JWPA 2FDFA 1RVF2 3SLIA 5FXWA 1E5HA 2J1TA 3RZHA 4QKNA 2FDIA 4B1MA 1LESA 1REDA 2HWF2 5L7OA 3CBNA 1VAMA 3SHRA 4JKLA 4BOWA 1C5HA 1S0CA 2XJUA 4J6GA 3WG2A 3V0AA 2PN5A 2RE9A 1JYIA 4K1ZA 2VQ0A 5IFPA 1AJOA 5LY1A 4AI1A 1F9KA 3EXUA 3ILNA 5IVJA 1RUG2 2IC1A 1UY3A 1GMMA 3OD4A 2O0OA 4NHYA 4FOQA 4NUBA 1QXJA 2JDKA 4QPGC 4RGAA 5EYYA 1ZBE3 4CU8A 4QX5A 2WYFA 2R49A 3WEZA 1YFYA 4K8FA 4LE3A 1JZ8A 3FL7A 2EXJA 4FTSA 4W6WA 1RHI2 1RTVA 4NN0A 4QB1A 2ARCA 2FDGA 4MZUA 1GQGA 1YUDA 3S30A 4KMQA 1EV13 5T5LA 1RUI3 2WFPA 4WVVA 5FZHA 4DRVA 1US3A 4IEZA 3PVNA 1G9CA 3ILFA 3U11A 2XJQA 5FPUA 1YLLA 3ACLA 1DZQA 2PLV3 4DZGA 2E51A 4XCAA 1JOBA 5FJKA 1Z78A 4NIHA 3ATGA 3ES4A 3VUOA 4FOVA 3OGRA 3MV11 4AHXA 1ODMA 1PMHX 4QM8A 3SCHA 1VBE3 2IXJA 1LODA 3B7MA 5IK4A 1XXNA 4MGZE 4IE5A 3MIBA 1D4M3 2XH6A 1MS1A 3THDA 3VD3A 3O1TA 3OPWA 3C3VA 3J7MA 4FPFA 4HANA 4QT6A 1XE7A 5C3RA 1CQ9A 4PI0A 4DEVA 5IJRA 4MXWA 1CJPA 3HBZA 4AG4A 3Q8CA 4BWOA 1QJX2 1UY1A 4XDOA 5DABA 3SKVA 4A42A 5JXGA 3T2PA 2XVGA 5A1AA 4WM8B 3T09A 1WW5A 2ZX2A 4PBOA 3WDUA 2E26A 1NAEA 3RDIA 1Q8OA 3N35A 2Z69A 1UL9A 4FT8A 3VBRA 1AR63 4NPLA 5FP9A 3KF5A 1RUC3 1IG3A 3T08A 3LSDA 5FZ4A 4BJ0A 2RMU1 5FMBA 5A7SA 1LOEA 1NA1B 2CTVA 2X09A 3TEXA 3B01A 1CVNA 2OQ7A 2VECA 5JMOA 4M3CA 1CAXB 4HZFA 5DQ0A 3OPTA 1W8HA 1ZZ8A 1AR72 2WA3A 3OJBA 5BNOA 2G19A 3LF7A 4NHKA 2VXRA 4P9XA 1YI7A 3WUCA 1AVBA 2QFEA 1S4CA 4UFJA 3H8RA 5F39A 4CPBD 5C71A 3N9QA 1HRI2 4F83A 3AP9A 1YJLA 2IUWA 2YBKA 4IEUA 4LPLA 4OHXA 4V2WA 5HPOA 1AF9A 1H2NA 1W99A 2YGLA 4BMEA 2JICA 2H6CA 4CCKA 3AZYA 3JCIA 2R063 5A33A 4CU9A 2CL2A 4PI2A 4E4DX 1YNAA 3VBOA 2ILMA 1GQHA 1SACA 4HFSA 1GNZA 5F3IA 4YLZA 3SXWA 4RQPB 3FN9A 3RZKA 1RUF3 1PNGA 2GC3A 3RNSA 4EV0A 5C7GA 1JYNA 3FLRA 3WF2A 4AFAA 4FFGA 2FDJA 2VZ3A 4ZZ8A 4KWJA 3UT0A 3ZKYA 4Q4X2 3ZKUA 1SPPA 4AOCA 5B4XA 1WD4A 1O5LA 3VD4A 4JHZA 1QMJA 3I7DA 1Q8SA 4OI1A 1W6NB 5KBFA 3E97A 2Q30A 3PUIA 4NHLA 4LE4A 1HXS3 5DAXA 5F3GA 3BTXA 1BEV3 3J7LA 2RM23 5FUIA 1F5JA 1V00A 4HONA 1QKQA 4QPWA 3RS6A 1MS9A 2J1SA 2IXIA 4XHXA 1A8DA 5GZGA 2QQIA 3RYPA 2GDFA 4FAHA 4Z2WA 2ADEA 4K1YA 1C8NA 2C9KA 1S55A 5LY2A 1JS9A 2QNKA 1GP5A 3FUOA 4E8CA 4YSFA 4JTNA 4W6YA 4OI0A 1UZVA 4YGCA 3N9NA 4DS0A 3WHUA 5CFDA 4PHZA 1TMF3 4B7KA 5FZOB 3VBUC 5FY5A 4C8DA 4QHOA 3GNEA 5FR3A 3AYAA 5JZGC 2VZPA 1J59A 4QXHA 2A6ZA 2WZR3 4MH0E 2JDAA 3KV5A 1S0BA 3ME2A 4GWJA 3UGHA 3W58A 3W59A 4XF0A 1T6GC 3JZVA 2W9XA 3FX3A 1X33A 4IW3A 4RSUA 3WDVA 4DPNA 1OLMA 4EROA 5KXEA 1REEA 4L0PA 3VBSC 1YRZA 4E2GA 5HI0A 4DINB 5J36A 4OHYA 2RR12 1CPMA 2BYVE 1FXZA 4MGIE 1E5IA 4N43A 4AI8A 3Q8AA 2VAUA 5ISLA 1OOPB 4CDWC 2B9UA 5F2WA 1R083 4HKLA 5JXJA 2D6PA 2VBPA 5A7QA 5FKBA 4P9GA 1ZRIA 1APNA 1X8MA 2ZHMA 2E7TA 5CFCC 2DVAA 2CYFA 3ALQA 2HWB2 2QVSB 4GB31 5LBFA 3OGGA 3H0OA 1NE4A 2RDQA 3AKQA 5D8AA 4CCJA 1SLAA 5A3NA 1ND3B 3POGA 4EYUA 4RFT0 3EBRA 4U36A 1MPXA 1HQWA 2ZKLA 4JVAA 4CEWC 1GICA 4D6RA 2JB8A 3RI9A 3M8LA 2XHKA 4AQSA 2BNMA 1AXKA 4X8NA 4DOUA 2YU2A 1XBFA 5L73A 1MR5A 3WG4A 5BYNA 3R4UA 2D7FA 2JJ6A 1AX0A 4QX0A 1F2NA 1GZWA 5FYTA 1AL23 4AAPA 4N9HA 1VIWB 1R093 2WABA 2VCAA 4FAGA 2L9LA 4M3CF 4S2GA 2V09A 3RZMA 5FDBA 4GKYA 1JU3A 5CAZA 1SLBA 5FY7A 4M3CB 4PDWB 1UYPA 1E5SA 4IEYA 3AZWA 4QGNA 3Q9OA 1LHUA 4KBBA 4AGRA 2PQQA 2TNFA 3BVCA 2JDZA 4A4AA 5C8CB 2Q8CA 4QU2A 5A32B 3WQ1A 1AYM1 1Y9MA 2Z79A 2XLGA 1COV3 3R4SA 3D6EA 4XDPA 3ZXFA 4XE9A 4WVMA 3KVAA 3BN6A 3UYJA 5IVVA 3ZLIA 1QQP3 3KMHA 2P5BA 2GZWA 3GHMA 2MHFA 3APBA 3FZ3A 5J96B 2SBAA 2GP3A 3J8F2 5L36A 2C4XA 1LR5A 3GDBA 3RI8A 3ES1A 3VGIA 3AJZA 3BKZA 1JYTA 3POBA 3IZOA 1W3XA 2VZQA 3MFAA 3ZSEA 4OMDA 2XHNA 3Q8BA 4DEQA 1NX9A 4CPBA 1XYNA 2VZ1A 2KA3A 4WM7B 4JGZB 3VBFA 3OYWA 3PJQA 4XFAA 2ZHNA 5IVFA 4Q4Y1 5A3LA 2Z5WA 1CX1A 3FJSA 3LPFA 2UU8A 2CDPA 3HNBM 3M70A 5T55A 4AEDB 1MVQA 2IVJA 1ZBA2 2J1UA 4E4ZA 4YZ5A 4AE2A 5FZEA 3ZMOA 1VBE2 1MZ5A 3AYEA 4YW5A 3NMBA 2A73B 2WNUB 3CNAA 1GOGA 3WF4A 1UZWA 5F1RA 1Z7S1 3V0BB 3HT2A 1RUNA 1W9WA 3RYRA 3FFQA 2WQ4A 1J84A 3LEKA 3A0KA 5JCTA 2UWBA 1DQ5A 1PVC1 1VAVA 2ZJCA 1ASJ2 4URTA 1NG0A 4IE4A 5FBJA 1BLZA 1PK6C 3OUIA 4UF0A 4XEZA 3THCA 2AYHA 2J1VA 2VXJA 3MLKA 5IUQA 4UW5A 4D7TA 1AR62 3DV8A 5DXDA 4OZXA 1LJ7A 1RUC2 5D2AA 1SZBA 2JKBA 2FCTA 2O8OA 3ITQA 1ZZCA 2ZX3A 1PO21 4ES9A 5FZ1A 3ZFFA 1NA1C 3DGTA 1XNBA 4LHNA 5I8TA 2ET1A 3E5XA 1RUE1 2WIIB 2BUKA 1CN1A 3OEAA 4LTAA 5FJHA 2E53A 2H0BA 4K6BA 4QB6A 3Q8FA 2ZXQA 5LBEA 4AQ2A 4BPZA 4BU2A 1ZM1A 3BOWA 3VZJA 4E27A 1V6IA 3HEIA 3LDRA 3ABZA 3WW2A 5FY8A 1MACA 1HB1A 4QHZA 4I01A 1JUHA 5IVEA 4CP2A 1VBD3 4NE9A 2VZSA 1N3OA 2YPDA 5DAPA 5IK7A 3GJBA 2D98A 1OUXA 2G9FA 2NLRA 4XURA 4L11A 4CU6A 1W6PA 1SEFA 2QKDA 4FFHA 4LIUA 3IBMA 2R062 3U78A 2JDMA 2YFZA 4PF1A 3W5NA 3HN1A 4LA3A 1PIV1 2X5IB 1ZNPA 4CCCA 4OFGA 4YRDA 1BQPA 1FMD2 1OLME 1RUF2 1W04A 4RQPC 4Y26A 5JIUA 5JXIA 1L7LA 2W87A 3HOBA 3LPGA 4ARXA 1C8M3 3KQ4B 1S0FA 4ATFA 4Q4V2 3OGJA 4D69A 3D5OA 3OCPA 4QQOA 2NPIA 4LBQB 3FHQA 2E31A 4RGGA 5A3MA 3KQRA 4QDSA 5EIYB 4IEPA 2O14A 2FZ1A 2Q1ZB 4QXBA 5C4WA 4QX3A 4R4XA 2P6HA 1O4YA 2ETEA 2X53S 1QJY3 4AXOA 1HB4A 4CCDA 1V6LA 2RDNA 2ZMLA 3KGLA 2B9VA 2F4PA 3OEBA 4GJZA 4IV1A 2QQPA 2WS91 1H0BA 3A21A 4AGVA 4CDQA 2VUAA 1NOVA 1FOD3 5F5IA 1HXS2 1SFPA 1ZA4A 4LOSA 3T30A 5AC93 3VL8A 3GM8A 1BEV2 4AAXA 5A1LA 3K48A 2JG9A 5IVBA 4JHTA 4XBNA 1WZXA 4RD7A 3FUQA 5F37A 5CVRA 4QPIB 2R16A 3ZO0B 3ACHA 2VU9A 5L7OC 3JB8A 5FYIA 2W46A 3ZFEB 4QMAA 1KFXL 3R6SA 3AZZA 3CL1A 3ON7A 3W5MA 4B7EA 4LNVA 3S5QA 2Z42A 1FV3A 1R64A 1MEC1 1RINA 1EP0A 2K2SA 4Q1PA 1W06A 1VAKA 3N9PA 3RGBA 5F3EA 3MHZA 1RVF3 2C1FA 2XXZA 4QXKA 3CO2A 4XFFA 1YO8A 3I4IA 5FYHA 5FCCA 5BXXA 3WDWA 3ZIWA 1F4HA 3H1YA 1WLTA 4GQ7A 3D3AA 1ODNA 3CJIA 2WZR2 5ACA2 2VCBA 1PZ8A 1X50A 2TUNA 4LULA 3WCRA 5SV8A 2VO5A 1CAUA 1SLLA 3AZVA 4C91A 3ELNA 5EV7A 3IIAA 1H8TA 4CCEA 5BUVA 2I45A 1H2LA 3VZLA 4PIYA 1JN2P 1W6QB 1Y7BA 5JIAA 3S0MA 4E9KA 1OOPC 1R082 1J1LA 1DZTA 1UYZA 3LSEA 2XKPA 4Z2AA 3A7QA 2OUJA 3F95A 1PGW2 1RUD2 2PFWA 4Y1UA 2JDUA 1OSGA 1IS3A 4BZ4A 1EPWA 4DMIA 3KLSA 2OW4A 2VULA 4HSLA 4V1PA 2GNMA 1I5PA 4IEVA 4MHUA 2OA2A 2WSUA 3E5UA 4A44A 4XC9A 3L2YA 1OFNA 3D0JA 2PHDA 5T5JA 5DDJ2 1AUYA 3PUHA 5HCAA 3MZHA 4A41A 2EXHA 2WO3A 4UYBA 3MGUA 5L9VA 3WHTA 3WNNA 3FHIB 1POQA 3WF1A 1D2QA 3POWA 4YZ1A 3ZFGA 4M01A 3TEZA 4PLMA 3AMNA 1JYCA 2WO2A 1NXD1 4HVQA 3T1MA 1AHSA 1UOBA 1R092 2ZEXA 4INDA 4O9GA 2CAUA 1LKNA 2ZEYA 3HIFA 5CADA 3B9CA 4ZXEA 2YGMA 4LEJA 3RRDA 1EAH3 1ENRA 2P1BA 2PQSA 4QKDA 1W8TA 1FAYA 4AHYA 3O1UA 4PDWC 4QGMA 1EUUA 5FAXA 4QXCA 2RS11 4ZHNA 4YVWB 1QJU1 2ZZQA 5GZFA 5EJ3A 1X82A 5JOYA 5BNOC 1PGL1 4AL9A 3IAPA 3NW4A 1VPHA 3PIJA 5C8CC 2YZ4A 4GALA 1H9PA 2HBUA 3ZN4A 2W2IA 1F5FA 4LBLA 1NCQA 1BVP1 4ZPIA 4NJ4A 4Y20B 1WLWA 1PM4A 5M0TA 3IB3A 1QQP2 1N3PA 2DCTA 1QJEA 4Q5OA 3DF0A 5FXVA 2HWD3 2YU1A 2RV9A 2ZBJA 3ZYBA 3ZDSA 4OCTA 4Q0VA 1W8FA 2HEYF 3VBOC 1AYN1 2GNTA 5C9AA 3J7HA 3OGSA 3A22A 5FMCA 1AR73 2R1DA 3U4SA 3VHNA 1IGOA 2LS6A 1RUOA 3RWKX 3UJQA 3AMMA 2HBTA 5LWBA 2I2SA 1RB8G 2OX0A 2D5FA 3H3ZA 4I30A 5GZDA 2A75A 3P6BA 2ES3A 3ACIA 1AXZA 4QQ2A 1G86A 1ENSA 4R52A 1YQ6A 2EIBA 4HKWA 4WVZA 1GOHA 4L97A 3T0AA 3R05A 2OS2A 4P9LA 4A6OA 4CDQB 2PAKA 4Q4W1 1OA2A 1ULOA 2WNUC 4IE0A 3MUY1 3H1WA 4FPLA 1UYXA 1Z7S3 3M3CA 4HN1A 4AZZA 4XHBA 2VUCA 2VC9A 2XWBB 5KR7A 1W2OA 2DVGA 1XRUA 2ZGRA 4YFWA 4OYUA 4MGKE 2XB6C 1GNYA 2VTXJ 4EJRA 2DDUA 4Q0PA 2CDOA 4CDUB 2PAEA 2A6WA 4OQ8A 4NAOA 2NN8A 2PMWB 3RZJA 2HH9A 4EZ4A 4O65A 1H1MA 3UKVA 5A3PA 3MLLA 3BI3A 3WLUA 1HN1A 2ARAA 4CTEA 1LAJA 3PJYA 4MUVA 4AFCA 3I59A 3IDEA 1V6OA 2VZVA 4QX2A 3AL6A 1OVPA 4KI5M 4TXWA 4XF3A 5F3CA 3E1F1 1RMU1 2BPA2 5CFDC 4O61A 5CEHA 1LEMA 2A3YA 2RMU2 1CAWB 3PVBB 4YVSB 1Y3TA 1ST8A 2DVBA 5FZ8A 5L9BA 4XJWA 4Y4RA 2MNGA 4EE2A 3CJIB 2NP0A 2ET7A 5FWEA 2BDRA 4IE7A 2DBIA 2RS31 3C7EA 4CP9A 3DXUA 1VRH3 3JQWA 3N9MA 3NKTA 4C0HA 3AP4A 4KH9A 4A7YA 4K8RB 4IGPA 3BOPA 4MOAA 3WG1A 3DPRB 1GNHA 1VBD2 2XDVA 4RFRB 1ZZ6A 4WZFA 4M0NA 2PELA 4R9CA 4N43C 1M06G 3HQRA 3PU8A 4D7YA 5A3OA 1WUVA 2XJSA 4RL7A 2Y6LA 3B02A 3N7LA 3O14A 3RZZA 2VG9A 4BYYA 3VBUB 4EWDA 5FZLA 2IFRA 1C4RA 5FOBB 4TWTA 3TN91 1J58A 2WNOA 3JD73 5JZGB 5H9QA 3KD4A 3NL1A 1SCRA 1PVXA 5I93A 2Q8OA 4BE3A 2GMMA 2AC1A 3ZN6A 3I3DA 1JH5A 3VBSB 3OB8A 1WW4A 3G6JB 3NJZA 4I02A 4OHZA 3HNYM 1PMIA 1SBEA 2XKOA 2RHPA 1WBFA 2P17A 2XVLA 1CD3G 4JGYB 4B4RA 4CDWB 4K20A 1S0EA 1QJY2 2DCJA 4HBNA 3GZEA 5A6XA 4L8QA 5ABJB 1LGNA 4RHV1 1LB2A 5A3WA 2ZCWA 2WT2A 4XFHA 2QQJA 1TE1B 4YGDA 3RWNA 4LO4B 4CEYB 1CGPA 4CCMA 2BFUS 2WQZC 5AC92 1HQLA 2VNGA 4CA9A 2WLQA 3KF3A 2WN3A 4MHRA 1XJAA 2AACA 4NR1A 2LUWA 2G9ZA 3P3NA 1W9FA 2J1AA 5GLVA 1V9U1 1EUTA 1OURA 2JG8A 1UXXX 3ETPA 3KV6A 3O12A 3NAPA 1WKYA 4NROA 3ZSMA 4IEXA 2JIGA 3MO4A 3VZNA 3ACFA 1GWKA 2GSYA 3LIGA 4COUA 3AYDA 3HWJA 2XBO3 2WINB 2W47A 3CEWA 2D43A 3LOIA 5E16A 3C8XA 1K5MB 2BZDA 4B3NA 4A7ZA 1YWKA 2VMEA 1URXA 4KNCA 5CNAA 1XU2A 3WP4A 2XQXA 1KRIA 2GNBA 3LGRA 4GWNA 1A8MA 3O7OA 4CE8A 1BCXA 1R1A1 3A4UA 3HJRA 2YC0A 4B1LA 1CZTA 4PJYA 4PLNA 3ZR5A 1IS5A 1FPN1 2ZGOA 3VBFC 4LLFA 1BVVA 1IPKA 1RJ7A 4W8JA 1GKBA 1UYYA 1WLDA 1J83A 4XDQA 2WBKA 4I0AA 3V64A 2VOTA 4R9DA 4XJUA 1QJFA 5T5PA 5J37A 4LO7A 1J3QA 2Q1MA 5FO9B 3H8UA 4GB32 4AVBA 1JHNA 3K2OA 1UKRA 1W6MA 2XLFA 3J8F3 5FZ6A 3CKHA 4FO9A 1ZRCA 4GWIA 5JI7A 3OY8B 3IAQA 1FNZA 3TBDA 1S0DA 2VQAA 1JI6A 2WNVA 1U0AA 4RS5A 2DUPA 3VDAA 3ILRA 4UW4A 5E88A 4GH4A 1XPWA 5HCFA 2A3XA 4XZPA 2CHHA 1KDMA 1G8WA 4TZDA 2HWE1 1B09A 1MVEA 3OUHA 3SCGA 3I2JA 1ZBA3 1O4ZA 4TN7A 1NY71 5FZDA 4P9WA 1ONAA 5LEJA 2D6KA 3VKNA 1ACCA 4YW4A 4COWA 3O1RA 3PLQA 1NZIA 2C0ZA 2VMDA 4XIOA 1RIRA 4Q0QA 3IDAA 4FPCA 1EAH2 3IIIA 1X7NA 3ZFFC 3ZXGA 4OI2A 4IQPA 1NCRB 3AP5A 3E6BA 4BQ1A 4ASKA 2ZGNA 5L9RA 4YVWC 4N53B 4KWKA 3M3EA 1ASJ3 3J4UH 4C1XA 4J1WA 1PK6B 5I0SA 3RQ0A 5FV3A 1AYM2 5LRRA 3AXEA 1GZ9A 4YZ2A 4AVAA 4JCKA 4Z8BA 4BB3A 5FWJA 4NRPA 2W3JA 4NO4A 3BTZA 3I2FA 2HEVF 3OBTA 3N7JA 3C7FA 5FPBA 2Z2SB 3CU7A 1D7PM 2ZMNA 3U0ZA 3UKNA 1S0IA 2AUYA 2TBVA 4ISRA 2HWD2 1EYBA 4LXLA 2W92A 5E6HA 5KHIA 3GBWA 2DVFA 3N7KA 4GJYA 1AYN3 1I3HA 5K0UA 4CUBA 1CIWA 1WW6A 3DECA 2AREA 3NVCA 5T3NA 3ZFFB 5FYCA 1E57A 1NQDA 2RS53 4O7XA 2ZPXA 4Y5TA 2SLIA 1VBA1 3SEEA 5EQUA 4XF9A 3SNMA 4WV8A 5EFUA 3FHAA 4Q4Y2 5EWSA 1IPJA 1YQ5A 5C4WC 1O4TA 4FP3A 3JB4C 2R30A 3WP5A 5JDBA 3B3QE 2VVDA 3GZAA 2YXSA 3PL0A 4LKSA 4CDQC 2PAMA 3FC0A 4P14A 5CB7A 3ZN5A 3LFIA 3TOJA 1RUJ1 1Z7S2 1FMD3 4JX0A 1RYYA 3IPVA 2WSVA 4S2DA 4CUAA 2LW8A 4Q4V3 4JAAA 3NV3A 1OT5A 1DP0A 2CNAA 3NV1A 3GJAA 2VVEA 3LDKA 1PVC2 4GMP1 4OI4A 1UN1A 2HEWF 1RL3A 2BW8A 2XG3A 1AR81 1BBT1 4QU1A 2V5YA 1TME1 3LIHA 4CDUC 1XOYA 3IWZA 4P08A 5KHJA 3MEPA 4UXAA 5GLTA 1WD3A 2R073 4UAPA 4LHLA 3AKTA 1E5RA 5JSOA 1WLCA 2WFF3 5K7PA 2XJVA 1LTEA 2Y38A 3NWKA 5FO8B 3IKWA 2I07B 2J22A 1CAVA 4YVSC 4CXYA 1PGSA 5EP9A 3MW4A 1RUE2 3CJIC 4OLLA 3R0RA 5L7OB 1FYUA 1VRH2 2GAUA 4N9IA 1QHDA 2HWC3 2JDYA 2WWSA 2ZABA 4YYOA 1RXFA 2BERA 1A78A 3DPRC 1H2KA 3V0AB 3BIWE 1JOPA 1OXCA 3B5LB 5FP8A 3HN3A 2JDHA 4A7KA 2WAOA 1K3IA 4A3ZA 4DNYA 4MXVA 2ADDA 3QH7A 5JWPA 1F35A 3KHBA 2A5ZA 3JUUA 4JZRA
chains in the Genus database with same CATH topology
2A3WA 4XILA 1DIWA 3SMHA 2P2KA 1Q3EA 4G3YC 3JD72 2VGDA 3TN93 4D7SA 1V6NA 1PIV2 5ACA3 1Q43A 1ENQA 4XJAA 3PMSA 3QLQA 2PA7A 3AKRA 3EQEA 2EXKA 3I54A 3O0WA 5LK7B 4I09A 1I9RA 5JPMB 4YW3A 4LR4A 5JI9A 3VL9A 1NZCA 3ENRA 4RS5B 5CA6A 3OTFA 4JGYC 2EAKA 4D94A 5CBLA 2AH2A 5JOXA 2QZ2A 1D4VB 5GLWA 4AWDA 1VBB3 1OQ1A 2ZX1A 1RUD3 5ABJC 5F9TA 4KG0A 4IL7A 3M3QA 3OBRA 3IMNA 4CEYC 1KJLA 2HWF1 3BU7A 1G6NA 4PQ9A 1ND2A 1AX2A 3AMPA 4LO8A 3URFA 5I0RA 1NE6A 2R041 2IZWA 1SQ4A 2D5HA 1DGLA 2ZA9A 4FQZA 3ZXKA 4FPEA 1V9U3 5DDJ3 3BCWA 3KCXA 4I3GA 2ZS6B 4MXWB 4S2HA 2ZKNA 2XWJB 3B00A 2WZPP 1RUG1 5LRSA 1SFNA 2XBO2 5KXCA 3VBRB 1NCQC 1K5MC 2XGXA 2D6NA 3VZOA 1VBC1 1RHI1 3LCPA 1U5YA 1ULCA 3AX4A 2D3RA 4I0BA 1DZRA 4Q1RA 3AKPA 4Z92B 5BNOB 1OD5A 2DCYA 4FXKB 3TWIA 5T5OA 2WNEA 4XMIA 2GC1A 3WW1A 4X8PA 1TNRA 2XJRA 3HD8B 2UWCA 5J48A 4HK9A 5DG1A 3EO6A 2NMNA 5C6CA 1MS3A 2ZGQA 1BJQA 3AFGA 3L2HA 2Q4SA 1V70A 2QE3A 2FMYA 5A33B 3M2MA 4Y4YA 3WV6A 3TNPB 2I74A 1ZYBA 3VBOB 1J3PA 3QBQA 3H3UA 3LZZA 1LRHA 2BFUL 3RJ2X 3POYA 3S6PA 4FOYA 2GNDA 1JUIA 1H4HA 1Q8QA 1LOBA 3VBHA 2EIGA 1LOFA 2PHFA 1PZ9A 3CF6E 3FE5A 3WUDA 2HWE3 1U12A 4HVRA 5AVPA 3WQ7A 3AJYA 3WDXA 2P3KA 1M4WA 5JOWA 1YXWA 2E7AA 2VOKA 3USUA 4LT5A 1UW8A 4AI2A 3J26N 3A0NA 1Q56A 1AL0G 5FOJB 1W6OA 3LKJA 4IV3A 5CIRA 1N47A 2BWCA 1WCSA 3TYJA 1V6KA 3C2UA 3IN9A 5FLIA 4FOWA 4JRLA 4R9AA 4XTPA 5FTTC 2D6MA 1ZRRA 1NCRC 2AZ5A 4XQWA 2ARBA 3LA2A 1QJU2 1JW6A 1HRI1 4N53C 4FTEA 5KHGA 3M3IA 1HLCA 3N7MA 4QPGA 5FQ0A 3RMYA 2MEV1 4TYSA 4AFMA 4AHWA 2UYBA 2IWGB 1MS5A 1MZ6A 5SV5A 5CFDB 2ZACA 2RMU3 4AGGA 1A3KA 3MI8A 4DRRA 2CGPA 3D4KA 2LALA 4YFZA 3FLTA 5IK5A 2QDNA 1AJKA 1AYN2 1AR91 3ZYGA 4Q4X1 3KGZA 1IKQA 3QH6A 1KS5A 2ZX0A 2RS52 4PCRA 4N43B 1HRV1 1IQAA 1UIKA 3MICA 4GIQA 1J3RA 4Q0UA 4YM1A 1WA4A 2VVFA 4N7IA 1LECA 1QXPA 2PYTA 3WOGA 5I91A 5CU1A 4XFCA 5GALA 1KD7A 2QJVA 2W39A 2UY9A 4Q4W2 4XXAA 5KC6A 3CLPA 3AYCA 2QCSB 4COYA 2R1BA 1ND2B 5D8AB 2XUMA 5DZEA 3UKTA 1PO11 2DUOA 4TLFA 4CP0A 1Q5OA 3KSCA 4GMP3 5KXBA 1POV1 5CG9A 1QXRA 2JG8C 2W68A 2R0HA 1YFXA 2DTWA 3NAPC 4BIOA 2PHRA 5E8AA 2Y0OA 4AYUA 2D93A 2R072 2WFF2 1BKZA 1MZEA 4AHZA 1GZWB 1GR3A 1RMU2 2R32A 3H1MA 1WCKA 3JBG1 4H7MA 1YI9A 4X6RB 3D82A 1BYHA 5DG2A 3BTAA 2RJKA 2ZGLA 3PHMA 4HN0A 2HWC2 1C57A 1RC6A 1KFUL 2WT0A 4FCAA 4ASMB 2FMDA 3S7IA 4LUKA 1WMEA 2HWB1 4CDXA 4R4ZA 4WVMB 2P3JA 3B9IA 4EN8B 2BWAA 2A6YA 3NV4A 4GKXA 1LGCA 3TN92 1Q8PA 2K0GA 2ARXA 3WD5A 2CV6A 1S0GA 4BCUA 2G4IA 2CY6A 4YNIA 4E4SA 4FTBA 3ZIXA 4UW6A 2A7AA 4K3UA 1GYKA 2WNVC 4RS5C 3VBFB 2BNOA 4IERA 4Y24A 1LEDA 3OYWB 3W9AA 4GH4C 1H30A 4PIXA 1ZREA 4ES8A 1DYPA 1VBB2 3IDBB 4Y22A 4Z82A 4GB33 1GANA 1YFWA 2Q0AA 3AFKA 4MYEA 3VKOA 3E6CC 3VDDA 1ULEA 5H9SA 2OVUA 4YZ4A 1QDCA 1V9U2 3TAYA 4AQTA 1DG6A 1FATA 2W52A 2V73A 1G9DA 4FPHA 4OHWA 3UL2A 3WZ1A 3VBRC 1ZBE1 4NVPA 5BNNA 2XPJA 1UZYA 1VBC3 3FLPA 1ZVFA 1C5IA 3QCWA 5J7MA 4Q29A 3HT1A 5JR7B 2AENA 1YHFA 2BQPA 3AZXA 1EV11 2ZGPA 1RUI1 5K0UC 2FZ2A 1MS8A 5D1IA 4ITCA 2P3IA 2PLV1 5IT6A 1MQTA 4XF1A 5HXVA 1FPN2 1AYM3 1B35A 5B2GB 4HSJA 1LOCA 2LTNA 1OPOA 5FLJA 1VBE1 3WXPA 1DQ0A 3AKSA 1G7YA 4XQDA 1AXYA 1W6PB 2OYZA 1WW7A 1YJKA 1N1SA 1SBFA 1D4M1 4KGGA 2GU9A 3ST7A 3RJRA 4CEWA 1NLSA 1QNWA 3H9AA 1QOOA 1LHWA 2WC2A 3AMQA 3KM5A 3WNXA 5BNPA 1BMV1 1IHMA 1SDWA 4XTMA 1GSLA 3UV9A 4Q4Y3 5C4WB 1O3RA 3VKMA 1RUC1 4XJ9A 2HWE2 3AP6A 5I8SA 2DFBA 1C28A 1IZ3A 3FBMA 4IV1B 3TRSB 1NY72 4GMP0 1ZZ9A 1R1ZA 5GKAC 4D3WA 4GXLA 2HJIA 2ZGKA 2VW1A 4XXPA 2JECA 2JG9B 1WMDA 3GYDA 5T50A 4TSVA 4XF4A 4ZU4A 3ZYJB 1PVC3 2PHWA 1NXMA 2HYKA 3I2DA 4Q27A 4WZCA 2NZ9A 2R061 4MGYE 4NHMA 2BBVA 1Y9QA 3USSA 1C1LA 1DDLA 4ORFA 1KS4A 1RUF1 1PO23 3U4XA 4ZXKA 1OHFA 1RUE3 2NM1A 4COZA 1VB2A 1CAUB 4W65A 4LA2A 3B93A 4XQ4A 2ZMKA 1H8TB 1HIXA 4CRQA 2E63A 4FP2A 2G9GA 5FPXA 4ASLA 4DY5A 1LU1A 4F3JA 2WL1A 1SLIA 1KDKA 4K40A 2YROA 1XNKA 4P5HA 3MPBA 4UW3A 2RM21 1HV1A 4YM0A 3ZVXA 3TB0A 1YFUA 1PIV3 1QH7A 1RUJ2 2GC2A 3GZTB 2DWRA 4JDMA 5BV6A 1FI2A 2LM3A 1ND2C 5D8AC 5TSWA 4RR3A 4WM8A 5JMCA 1ALYA 1LHNA 1PO13 3V56A 1HX6A 4HK8A 3KZ4C 1BBT2 4Q0SA 1TME2 3WINE 3DKWA 1OFSA 1TMF1 3KS7A 3HR9A 3QD6A 5IK8A 2EVXA 2WS93 1SFYA 2XVKA 3ZFGB 2GH2A 2WZR1 4U2AA 4EN0A 1CAXA 3JBG3 4YM2A 4BLIA 2VW0A 5I0TA 4IEQA 3MIDA 1N1TA 3IM0A 1DGWX 2ZGTA 1KITA 4K21A 3EHKA 5GLZA 2GMPA 4AEKA 1R081 4M0HA 4AF9A 5KXDA 2B46X 2C5DA 4BHPA 1PGW1 4KQ7A 1MEC3 2BTVC 2VMIA 1D0HA 4HT1T 5BNQA 2XL9A 1UF2C 4Y1VA 4AK3A 5BPXA 1NCQB 4AQ6A 3VN4A 1DBNA 2D97A 4RQPA 4LO6B 1EPZA 4YG0A 3B94A 4KGQA 4DXZA 5EZWA 1CPNA 1OI6A 5DUWA 4SBVA 1O3QA 5C9AB 3D0SA 5K8SA 2HKXA 1L3JA 3H7YA 3UJOA 3RG0A 3I8TA 1W6NA 3WR0A 3LOBA 2PHUA 3FFZA 4AVSA 2WA4A 2VMHA 4X6QB 1AL21 1CJDA 1R091 4FVVA 3LA7A 2JXAA 4QPYA 1I1EA 4LO5B 1DF0A 4AFDA 4AVTA 2GH8A 2XLAA 4IV3C 1NLRA 2R042 2XJPA 3WX5A 3MIHA 1UMZA 4I0WB 3SCFA 2DU1A 4FBFA 3TNQA 1COV1 1O5UA 2R0FA 3WT3A 1LGBA 3SH4A 4XW3A 1QQP1 5JSPA 4XYXA 4PBPA 3I59B 3H7JA 2CWSA 1UIJA 4L92A 1O7FA 1VBC2 2PHTA 2GN7A 1DLLA 1ULGA 1X8EA 4LBQD 2RS13 1OOPA 5KWRA 1MS4A 1QJU3 3ASIA 1O3SA 3WCSA 3SITA 1UU5A 5JOZA 4WBBA 5FRAA 2YYOA 5JLVA 1LOAA 3MF9A 2K9ZA 3OD0A 1ND3A 4KWLA 1D2SA 1H1AA 2ATFA 4UBHA 2FHRA 1XQNA 2KM2A 3ZN6B 3VZMA 2N7GA 2GALA 3QACA 4LBNA 1FT9A 4RR3B 4NPRA 3IT8A 2VMGA 2YPJA 4AVVA 3ECQA 1VP6A 1PZ7A 3BPZA 1TQ5A 4PLOA 1QNYA 4BM8A 4R9BA 4B8EA 2BVBA 1H9WA 4IV1C 3THTA 4I2OA 1POV0 1RGSA 4Q4W3 2VW2A 4PDWA 3ZPYA 4META 3ZXDA 5J3UA 4JDNA 1AX1A 1V6JA 2CGNA 2JG9C 5C8CA 1Q8VA 1DHKB 5A32A 4LBJA 1RITA 1VBD1 3UK9A 2JG8B 3V65A 2ZAAA 2OUHA 2KXLA 3NAPB 2BVVA 4A2UA 3KT1A 2A70A 2MEV2 4Z1VA 2VY0A 1WBLA 1O3TA 4IEOA 4KU8A 3HAGA 1RMU3 4CDXC 1PO22 1O91A 1C8M1 3AP7A 4MSVA 2IXKA 2UWAA 4WM7A 4JGZA 4B4QA 1LOGA 2DYCA 2RS33 1AR92 4H7LA 2NYYA 1I6XA 4EN6B 1QJY1 1H8TC 4AEDA 1OA3A 2CAVA 5J09A 4B29A 1DFQA 1U5IA 1QDOA 1HRV2 5F6KA 4F8AA 3N4MA 2EF6A 1FOD1 2WNUA 1KJRA 2EXIA 3MW2A 2WKKA 5AC91 3V0BA 4P9JA 1QF3A 3ZYIB 4ATEA 2GMEA 1XNDA 1W6MB 4M00A 2H0VA 3LA3A 1QY4A 2O1QA 4E2SA 3SH3A 3VDDC 1QU0A 4Z07A 4C90A 1PO12 1ZX5A 1TEIA 2WNVB 4Y1XA 2D6LX 4SLIA 2VOVA 1AZDA 1DQ4A 4GH4B 1FX5A 1KQRA 2A6VA 3R4DB 1RUH1 4QQLA 4RA0A 1RVF1 2VH9A 2WS92 5CG8A 4RHV3 4FQ4A 4IXLA 4CZSA 1I5ZA 3ZFGC 1S2BA 5H9PA 1OKQA 5BNNC 1V6MA 3JBG2 3PVEA 4YG3A 4Y5Z0 2DV9A 2DVDA 4JRAA 2B8MA 4QM9A 2UURA 1U5XA 2TEPA 1IS4A 1NYWA 1YIPA 5I0UA 4XOGA 1LCLA 3ZSLA 4KG8A 3VKFC 5L19A 1IKPA 2IXLA 3BODA 1MQTC 3EJKA 3HQXA 1S2KA 1MEC2 1B35C 1DGRA 4HMZA 3VHRA 2X5IA 4FPYA 1W0OA 1XNCA 2OIIA 3PMEA 1Y43B 3LWCA 5C33A 1QOSA 1FV2A 2ZX4A 2GC0A 1ULDA 4LBQA 2E6VA 4G9SB 4HETA 2B39A 5K0UB 2AR6A 4AEJA 5C9AC 3MIFA 2ZAHA 1ENXA 1R1A3 5GJ6A 3WP6A 4DB5A 5FMOS 2A71A 4AEMA 5BNPC 1W2UA 1N1VA 1FPN3 2JE9A 1RJ8A 4XBQA 3GALA 3ZYPA 2VOXA 4YGBA 2YUEA 3THPA 1DQ2A 4YZ3A 5FREA 4MV2A 4XJZA 1EAH1 5T54A 4QPIA 1FNYA 1UU6A 2DTYA 4O9EA 4Q2FA 3ZFEA 3QOPA 3IPVB 3KCYA 4Q8LA 1QJX1 1F31A 3M4FA 3ROUA 4H3WA 1G9BA 4QQHA 1LULA 1H8VA 2E7QA 4I3PA 3VV1A 2E9QA 2ZGSA 5F5QA 2D44A 3NO8A 1Z0HA 2AGSA 3SISA 4C0BA 4LBOA 4R8HA 4ZU7A 4M3CE 4FSJA 1X36A 1ZBE2 1J59A 1U5ZA 2HWD1 4WVWA 2PTMA 3KCCA 1QWRA 1MS0A 1UAIA 3WVJA 3NV2A 4CYDA 1AR71 1CAVB 3N36A 2A6XA 1UCXA 1GZCA 2QDRA 4Q8KA 4YW2A 3POSA 1OPMA 2X8KA 1EV12 3ETQA 1RUI2 2DCKA 3DUIA 4H55A 1W6QA 2RS12 2JENA 1S1AA 3JU9A 1ULFA 1BZWA 2PLV2 2Y26A 1PGL2 3VHOA 3KB5A 2OPKA 2O8QA 1JXNA 2NQYA 3KT7A 4P9IA 4L9BA 1LHVA 4IESA 3PTYA 3X29B 2DUQA 5GZCA 1D4M2 2VNOA 2NMOA 3M7AA 1OLQA 1F8VA 2CWMA 2YHJA 4AI0A 1NQJA 5E1RA 1LU2A 5K9YA 1BK1A 2H6BA 3MIGA 3OPZA 4AI3A 2ZGUA 3ZXJA 1W0PA 1C1FA 1HKDA 2IXHA 1CONA 4NWVA 4RR3C 4WM8C 3WG3A 1VB4A 1VBA3 3RPQA 1BMV2 1DGRN 5C8WA 3J9SA 1JOJA 3ZXEA 2JEMA 3U10A 3KT4A 3DL3A 3AM2A 4DY3A 4Q26A 1LHOA 4AVCA 1A6CA 1UPSA 1HV0A 5E89A 2FQPA 1RUJ3 1VALA 4YVWA 5F6LB 2WJSA 1VRH1 1HW5A 2B45X 4ZKTB 4E2QA 4OHVA 1G9AA 4S2FA 4HL0A 1SLCA 1ZZBA 4HLTA 1OMIA 1UPIA 1G9FA 4OVEA 1AR83 1BBT3 1TME3 4NOTA 1IOAA 4Y20A 1PHMA 4EWAA 3MFCA 3MYXA 4K9SA 4IEWA 1QGLA 2D6OX 1YIFA 2JX9A 3JD71 4JDOA 2P34A 3FWEA 2QUOA 4FPOB 2WLPA 4P9YA 2OZJA 1N3QA 2OZ6A 1VJ2A 1GBGA 3WW3A 3VZKA 3AB0A 4XJ8A 2RR11 3HMYA 4L2NA 1ZRFA 2DF7A 2RS32 1WMFA 3E5QA 3T2TA 2EAAA 3O0XA 4Y1YA 5GM0A 1PM7A 2B42B 3NKGA 4LBMA 2XJTA 2PHLA 5HBAA 2C9AA 5I8YA 3N3HA 1SCSA 2DURA 3O0VA 2RM22 1J1TA 4YARA 2UY8A 3FBYA 2B5HA 2W0XA 3ZYRA 1BXHA 1TNFA 3GF6A 3PNAA 4W6XA 4CDUA 1XE8A 4QGLA 2W08A 3IDCB 3M3OA 5JPNB 4XFBA 2XBO1 3VBHB 4HPKA 2ZGMA 4LLOA 2PHXA 1VLNA 2RJLA 1RUH3 4FPGA 1TMF2 5DZGA 4BLJA 4YVSA 1CAWA 1CESA 3G7DA 4G4FA 4RHV2 2YY1A 4FPKA 3LB9A 4GWMA 3USUB 1SMVA 5GLUA 2WT1A 4A3XA 2HWF3 4HVOA 3GZUC 4MLOA 2B7YA 4PF5A 1W6OB 4IV3B 3U07A 2R043 3M1HA 4N90A 5JAXA 3DPRA 1DYKA 5FLHA 2DFCA 1YYNA 2JD4A 1DGWA 1HDKA 5JSRA 3D8CA 2Q5TA 4MX3A 2BEOA 1RUG3 3VBUA 4KU7A 5KHKA 3MDPA 3AXDA 3GHNA 5LK5A 5JZGA 4QPGB 1GV9A 3E6DA 3MW3A 5FQ0B 3WP3A 5AFBA 3OF1A 4EWEA 2UYAA 2ZHKA 1OA4A 4LUMA 3J8F1 5DUVA 1RHI3 1ND3C 5FPZA 3VBSA 5EYXA 4GULA 3K51A 4JGYA 2ZTNA 4CDWA 2D40A 1R1A2 3DN7A 1SLTA 4JTOA 4COVA 5ABJA 5FFOC 1ZBA1 1OQDA 4XIKA 5DUXA 5CFCA 4CEYA 1AL22 1CX4A 4ZU5A 1OLRA 3PVOA 2VUJA 4C1WA 2VOWA 5J98B 4YW1A 3RSJA 1IS6A 4ISQA 4GA9A 3WQ0A 1DQ6A 1ASJ1 1QJX3 4JQRA 3VLBB 1D0GA 1C3HA 4FPJA 1COV2 5JVVA 1AR61 1WGPA 1K5MA 4QQPA 2EALA 3WDTA 4AW7A 1GFF2 1QJZA 4HKOA 4KL1A 5DUUA 3MIEA 1MZFA 3LAGA 4NWWA 3WY6A 1UU4A 5GZEA 1OQEA 1W39A 5T52A 2X29A 4XPVA 4XFGA 2RS51 3RYKA 2VNRA 4QHBA 4IETA 4WM7C 4JGZC 3ZMNA 4BIFA 1QOTA 1HRI3 2YMZA 3AMHA 1DQ1A 4Y1ZA 2BNNA 2BGCA 4AEDC 3MLJA 5LEKA 5FMOL 2MEV3 3T1LA 4XFIA 2ZHLA 4EN9B 1H2MA 4CDXB 1FMD1 3INAA 3ZXAC 1H4GA 3OY8A 2ENRA 3WW4A 2IFWA 4XETA 4Q4V1 4OULA 1AR93 1S0JA 4BA6A 2FBEA 2ZZJA 4Q4X3 4YM3A 1JBCA 5KC5A 4ONUA 1VBA2 2R071 4DQAA 2D3PA 1UX6A 4EN7B 3O5SA 1HRV3 3JQXA 5DZFA 2WFF1 1REFA 4HPKB 2F6BA 4FXGB 1HXS1 1XU1A 3GBFA 1EY2A 1BEV1 3WDYA 1XYPA 2EA7A 3ZXLA 4K7JA 4YG6A 4Y22B 3AK0A 2YV8A 1NCRA 5H9RA 5EXOA 1KXGA 4L99A 4N53A 2R6QA 1ZZ7A 1PK6A 2HWC1 2P37A 1LENA 4JV4A 3SH5A 4LBKA 3VDDB 1VR3A 1HQNA 2DU0A 4AFBA 3H50A 1JTZX 2ERFA 1POV3 3B69A 5FBZA 1AR82 1WCDJ 4N7UA 4BH9A 1CR7A 3CJXA 4LHKA 4DFSA 1NA1A 2YDEA 5ACA1 2X5IC 1QH6A 3GBGA 3ZSJA 5BNNB 2QZ3A 4JC1A 1GLHA 1SBDA 3MF6A 4YGEA 1C8M2 4B4PA 3VKLA 1DU3D 1PNFA 2RR13 4OUMA 2MPFA 4UBGA 5AFEA 1XYOA 1ZRDA 4F7ZA 4MVTA 1MQTB 2GN3A 2XL7A 4BMBA 1YCIA 1VBB1 4XMAA 5AVAA 1RUD1 2CGOA 1B35B 4OUSA 1N1YA 3FMGA 4XBLA 4H14A 4CP1A 5CFCB