3CO2A

Mlotik1 ion channel cyclic-nucleotide binding domain mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
GDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mlotik1 ion channel protein
publication title Structural and Energetic Analysis of Activation by a Cyclic Nucleotide Binding Domain.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
total genus 26
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3co2A00
4HMZA 1VR3A 4WBBA 3H7JA 4GULA 5BUVA 1ZZ7A 2UYBA 3O14A 3WW4A 4AVCA 3D0SA 3E5QA 3NSTA 4EWDA 2ZKLA 2BNNA 1CAVA 3HT1A 2VQAA 1CAWA 3HIFA 4FAHA 3TNQA 4I09A 1SEFA 4UXAA 1VJ2A 3ZDSA 4YSFA 1UD1A 3OTFA 4HVQA 4Q0UA 4MGIE 1QWRA 4F8AA 2GC3A 3H7YA 4J1WA 1ZZBA 3CLPA 2FQPA 1Y9QA 1UW8A 2XLFA 5AVPA 1CAUA 2KXLA 3H3ZA 3OGJA 3WW2A 3GYDA 1LRHA 1ZZ9A 3M70A 5JAXA 2ETEA 2K0GA 2HKXA 2UYAA 5JR7B 2IXKA 1J59A 4BYYA 4JV4A 3VHRA 2Q0AA 4I0BA 1CAXA 1O3RA 1FI2A 1O7FA 1FT9A 4E2SA 3H3UA 5T3NA 4I3PA 1YLLA 4LTAA 4NVPA 3ROUA 3UKNA 5EZWA 4Q0QA 5FLHA 4D7TA 2Q30A 3BPZA 3B02A 4ZU5A 2OPKA 5JCTA 3M3IA 4UBGA 3ELNA 1X8EA 2MPFA 3NL1A 1ZRCA 3FJSA 3S7EA 3GBFA 3LOIA 5FPXA 5LEJA 1OD5A 4D7SA 1XE7A 1YFXA 4LA2A 4XFGA 4JTOA 1ZNPA 3NVCA 2E9QA 2IXHA 2P17A 2MHFA 3DV8A 4O9GA 4J1XA 3BALA 1ZZCA 1PMIA 2H6CA 1YFUA 3FZ3A 3N4MA 4IEZA 3LA3A 2QCSB 1J1LA 4KWLA 3S7IA 3KCCA 3EHKA 5I0SA 5D1IA 3H8UA 3H1WA 3OCPA 4YARA 1IPJA 5CU1A 2WFPA 1EYBA 4MV2A 2OZ6A 4IEYA 2K9ZA 1I5ZA 3G7DA 5FCCA 2BGCA 4XFCA 3TNPB 1NYWA 1SFNA 2OZJA 2XKOA 3SHRA 2H6BA 4AQ2A 4ORFA 3IDCB 1ZZ8A 3CF6E 4ZU7A 3CO2A 2QNKA 5F1RA 4HN1A 4N9IA 1X82A 2QDRA 4MGYE 2B5HA 1Q3EA 3IWZA 1CAWB 1ZZ6A 2QJVA 1O3SA 3FE5A 2MNGA 3LZZA 4EWAA 2HJIA 2BEOA 1X8MA 4I01A 4WVZA 5I8TA 3BB6A 3DN7A 1JUHA 3IBMA 1L3JA 4IEPA 4KL1A 3E6CC 3MYXA 1ZRFA 2IXIA 4N9HA 2V09A 1OMIA 3IIAA 2ET7A 1OFNA 3MDPA 5BY5A 5J7MA 4MGZE 1ZX5A 2VPVA 1WA4A 2PFWA 3ACLA 4LLOA 3MPBA 4QM8A 1Q5OA 3E6DA 4XF1A 4XEZA 3I59A 4X6QB 3NW4A 2IXJA 4HLTA 4HVOA 5J48A 3BU7A 3E5UA 4YNIA 5JSOA 4XF3A 2OA2A 5EFUA 3KGZA 3R6SA 5FQ0B 1UPIA 1VP6A 2PTMA 4R8HA 2ZCWA 1CAXB 1GQGA 4Q0PA 1J3QA 3RYPA 4DINB 1QXJA 3OF1A 3FWEA 2GH2A 3U10A 2C0ZA 4HN0A 3E5XA 1J3RA 3QOPA 3DL3A 2D5HA 3H1YA 2Y0OA 5KHJA 3EJKA 3QACA 5CVRA 4LEJA 3ES1A 4XF4A 4EROA 2CV6A 2GZWA 4XFAA 2B8MA 1ZVFA 4MX3A 4PIZA 3IDBB 5KBFA 3JZVA 4KU7A 3ST7A 3U0ZA 5LRSA 3SCHA 5JSPA 2Q4SA 1UIKA 1OI6A 4E2GA 2CAUA 2Z2SB 4XF9A 4PIYA 4QGMA 4WZCA 5KHIA 4YYOA 2N7GA 4BIFA 1DZTA 2PHLA 1LR5A 2FMYA 5BPXA 5FLIA 4MGKE 3WW1A 4KWJA 1SQ4A 3UKVA 3H1MA 5I0TA 1O3QA 3E97A 4YRDA 2EA7A 4KWKA 4I02A 3OD0A 4XETA 2XKPA 5HI0A 1RUOA 1UCXA 5C6CA 4EWEA 4A2UA 1NZCA 4XFBA 1QY4A 1EY2A 3LAGA 4LULA 3RYRA 4PJYA 1WGPA 3H50A 1XE8A 3RNSA 4IESA 2D93A 2ATFA 3PNAA 3RDIA 4E2QA 2PHDA 4O9EA 4PIXA 5K8SA 4LUKA 4KU8A 1NE4A 4OFGA 3D0JA 5BXXA 1EPZA 2EVXA 4MUVA 5E1RA 1ZREA 1CGPA 2XLGA 2IC1A 1HW5A 5E16A 4ZU4A 1J58A 4FT8A 4Q0VA 1YFYA 4XFIA 1CAVB 1NE6A 4XF0A 3I54A 3NKTA 2XLAA 4QXKA 3UKTA 2I45A 3E6BA 2WC2A 1O5LA 3LWCA 4HSLA 3ES4A 4QGLA 3LA7A 2BNOA 1G6NA 3USSA 1EP0A 5I93A 5JSRA 4K8FA 2BYVE 1X7NA 3KSCA 2DCTA 3DKWA 2IXLA 1RL3A 2PQQA 1H1MA 2BNMA 4AVAA 1CAUB 3FHIB 3D82A 5I8YA 3NJZA 1NXMA 1YFWA 4IEWA 1PM7A 4LA3A 4UBHA 5J3UA 4R52A 1QXRA 4I0AA 3MZHA 1Q43A 2EAAA 1H1IA 3KGLA 2XL7A 1O5UA 3KMHA 5BV6A 1XRUA 3S0MA 1Y3TA 4P9GA 4AXOA 1YWKA 4IEOA 5CADA 2QVSB 1U12A 4F7ZA 1LB2A 3SMHA 3LA2A 3H9AA 1YHFA 4MH0E 5C8WA 3RPQA 5I0UA 4IEQA 5KHGA 5LEKA 2ET1A 3CL1A 4OLLA 1RTVA 4HVRA 4IEUA 2D40A 2PA7A 4XFFA 1RGSA 2B9UA 2UY8A 1YUDA 2VECA 4HZFA 2Q1ZB 3EQEA 1CX4A 5KHHA 2XHKA 4IEVA 3RZZA 4FAGA 4JVAA 2XL9A 1DGWA 5FPZA 2OYZA 4B29A 5FQ0A 1J3PA 5KHKA 2UY9A 4EV0A 5I0RA 3I7DA 4MZUA 2PAKA 1FXZA 5LRRA 1ZRRA 1IPKA 1GQHA 4Z07A 2PYTA 4AVBA 4I2OA 4Q29A 4CYDA 4JTNA 2GC1A 3FX3A 1O3TA 4BH9A 4Q0SA 3HQXA 3L2HA 2CAVA 3EO6A 2XGXA 3CEWA 3CJXA 4IEXA 4AQ6A 2CGPA 4LUMA 4BHPA 4IETA 3WW3A 1DZRA 2GC0A 1LKNA 3BCWA 4TLFA 2F4PA 3PVBB 3SCFA 1RC6A 3PLQA 2GAUA 4QX5A 4FBFA 2H0VA 2PAEA 5I91A 2D5FA 3SCGA 4XFHA 1ZRDA 5I8SA 4META 5FDBA 4QMAA 2GU9A 1DGRA 4L2NA 2Z69A 1O4TA 1V70A 4ONUA 1I6XA 3C3VA 3SXWA 4Z82A 3EBRA 4H7LA 5FLJA 2GC2A 2PAMA 2O1QA 1UIJA 3RYKA 4RD7A 4X6RB 4HSJA 4L11A 2IXCA 2O8QA 3HT2A 3FFQA 1TQ5A 4QM9A 4IERA 4QGNA 1RUNA 1WLTA 4HBNA 3U11A 3I59B 3ETQA
chains in the Genus database with same CATH superfamily
4HMZA 1HJGA 3WF2A 1G9BA 1N1TA 4DB5A 3ZPOA 4WBBA 5IK8A 3WG1A 2WO7A 4GB32 4GULA 5BUVA 1RXFA 4YFZA 3B00A 2ID4A 4XJ9A 1QDCA 1H30A 2OX0A 2P1BA 3OD4A 4OQ9A 2E32A 1VE0A 4CDQB 3WW4A 3D0SA 3E5QA 3OY8B 4PI2A 1JODA 2RDSA 3NSTA 5DDJ3 4EWDA 1T2XA 3Q8AA 3VD3A 2XJTA 2ZKLA 3RZMA 2W68A 1DZQA 2A70A 2P4EA 3AMNA 4HXCA 5KXCA 4KI5M 4L99A 4CDWA 2O8OA 1W2TA 3GCXA 3N9LA 4B4PA 2RS13 2WLQA 3DPRB 4W50A 1FATA 2BP6A 3TNQA 5IATA 4FTBA 3N3HA 3KV4A 1V6IA 1SEFA 2JG9B 4E27A 1VJ2A 4NUBA 1HQNA 2BERA 4YSFA 4XHBA 3M3EA 3OTFA 2ADEA 4QHOA 3QH7A 3AJYA 5L9VA 2R7EB 1QWRA 1SLIA 3H7YA 1XSRA 4XCBA 2HWF2 1RMU1 1D4M3 5DDJ1 3T0AA 3TYJA 1GZ9A 2W95A 4LOSA 1ZZBA 3SH4A 2BRTA 2VQUA 3K3NA 1A3KA 3C2UA 4BPZA 1UW8A 4NOTA 2ZJCA 2RS11 3AMPA 1JXNA 2ZX0A 2YROA 1CAUA 2FCVA 5J1XA 2P3IA 4K1ZA 4OZOA 4CU9A 2XUEA 1QQP3 1A8MA 3KHBA 1ZRIA 5FIXA 4A45A 2CNAA 3GYDA 3I49A 4AI0A 1QJU3 3AP6A 4XJ8A 4AL9A 2PMWB 1QH7A 2B39A 2RDQA 2WKKA 3I2GA 4XTPA 1CD3G 2UU8A 4QX2A 3ZKUA 4BYYA 2HH9A 3PVOA 3VHRA 1MS8A 5F2SA 1W9YA 4QKBA 4I0BA 1TZOA 1DDLA 1AR83 1SDWA 2GMEA 2TBVA 1CQ9A 1NCRC 1ND2A 3AX4A 4NMIA 5FY7A 5JR2A 2ZGMA 1QQP1 1US3A 1W6NA 3ZR5A 5C3OA 2WDBA 3M3QA 1YLLA 1BCXA 4I3PA 4NVPA 3PIGA 5H9PA 3UKNA 5EZWA 1XPWA 4YZ2A 1QJU1 1ST8A 4D7TA 3BPZA 3B02A 3OGVA 2IZWA 4ZU5A 1GNYA 2ZS6B 2W0XA 2OPKA 2O0OA 4QXHA 4DMIA 4XJAA 1QJZA 3ELNA 3LEIA 5FPVA 3D4KA 1N3OA 3NL1A 4RS5C 1YQ6A 3POEA 1ZRCA 2DV9A 1QNYA 3GBFA 1IG0A 1J1TA 5FY1A 4Y5TA 4BLIA 1SLCA 4JHZA 4HETA 2J1RA 4D7SA 4CU7A 2VVFA 1VAKA 3CZUA 1FX5A 1ZBE2 1RUE3 1GOFA 3TEZA 2DU1A 4BQWA 3VHOA 4Q27A 3NVCA 4ZHNA 3B7MA 3VBSC 2W91A 5FREA 2E9QA 3NKGA 4BQYA 1BVVA 1ND3B 3ZR6A 5APAA 1Y9GA 3ZMOA 3LEKA 3DV8A 2I2SA 4O9GA 4P9IA 3BUCA 1BVP1 5JLVA 3BALA 1TME2 3KCXA 5ACA2 1W3XA 4YZ4A 1V6KA 3N35A 3WOGA 4DXZA 5EHDA 1WW6A 1QDOA 4IEZA 3N4MA 3ZN4A 2FZ1A 2VNRA 2VJXA 4DZGA 1OOPB 4FPCA 3BTXA 3KCCA 3VB9A 2R072 1RINA 3VBFB 5A1AA 5FR3A 2HEWF 1IPJA 1SPPB 1YQ8A 2VUAA 1EYBA 1VMFA 4LKSA 2OZ6A 4IEYA 1MVQA 3KQ4B 4MV2A 2C5DA 1UMIA 2R062 4XFCA 3AZVA 1TNRA 3RJRA 3DKQA 3WQBA 1WCQA 2XKOA 2Y33A 1UWWA 3CF6E 2W92A 2W08A 3GZUC 4UW5A 4DO0A 1N47A 4AQTA 4ZKTB 2QNKA 2WZR2 1NA1A 2ZGKA 4QQ2A 5LA9A 2X5IA 2WFF3 3O0XA 2ZX3A 2B5HA 1RUC2 2VNVA 2Y6JA 2ZMLA 5A3TA 3IWZA 4Y3OA 1LGCA 1XNAA 2BGPA 1ZZ6A 4P5YA 5JPMB 3VDDA 2QJVA 2QQOA 1PK6A 3KT7A 3LZZA 1V9U3 5ABJA 1ONAA 2HJIA 4LORA 4P9XA 1DG6A 1UOBA 4D69A 3SISA 2JB4A 3NV2A 1H6YA 5D2AA 3DN7A 1JUHA 3IBMA 1L3JA 4KL1A 2Y6LA 3MYXA 4LO5B 4N9HA 1ULOA 1DFQA 1IS6A 3MGUA 4NIAA 3IIAA 2ET7A 3P3PA 4Q4V2 4OQ8A 2WNVC 4KG8A 1AX0A 4CUAA 1OFNA 5T5PA 2V72A 5BY5A 4RHV2 3I8TA 5JDBA 1HRI3 2YXSA 2VPVA 1GFF2 4IV1C 4RYDA 2O14A 1V6NA 1OSGA 2BTVC 5C4WC 4LBQD 3AYCA 4IGQA 1ODNA 3MPBA 4M01A 4B4RA 3FMGA 4UFIA 4CUBA 2GNMA 4XEZA 1W6MA 1JH5A 3I59A 2VTXJ 2WNUB 1T6GC 5J48A 1SLBA 1C8M2 1CJDA 3FFZA 3OBAA 4QHZA 1S0FA 3O0WA 3BN6A 4PDWA 2C4XA 4U36A 3KGZA 2QBXA 3UT0A 2PTMA 2Y0IA 4CDQA 5JOXA 4Q0PA 1J3QA 1HRI1 4XILA 3I3MA 2A7AA 5C3SA 2EIDA 1JU4A 3JU9A 4XC9A 1YQ5A 3A21A 5T5LA 2W2IA 3NAPB 1FOD2 2D6OX 4WVMB 5JIUA 1LOBA 1UZZA 2V4AA 2D5HA 3DPRA 5A3PA 5C8CC 5KHJA 1SCRA 4LEJA 3ES1A 1CIWA 1WZXA 1UY2A 4XF4A 4CU8A 4CE8A 3I2JA 3SKJE 2B42B 2WJSA 3OBZA 2VMHA 2P3JA 1VMHA 1LESA 1LHVA 3QLQA 4XUTA 1ZVFA 4MX3A 4PIZA 5FZKA 5K0UC 3GDBA 3KVBA 2W47A 5KBFA 1IQDC 1BMV2 4LOTA 2DUQA 1Z78A 2NZ9A 4QPGB 1G9AA 3HMYA 2VE1A 2ZKNA 4CP9B 3SCHA 1W6OB 2X10A 2VMIA 2FDFA 3AL5A 1IS3A 1RHI2 4NHXA 1OI6A 3AYEA 3B01A 1KXGA 2OW4A 2RS33 4HONA 1CESA 2AGSA 4IL7A 1F5FA 2VZQA 4YYOA 4DRVA 4I30A 4GB33 3UGHA 5F3EA 2PHLA 3OUJA 3OYWA 2CL2A 5BPXA 2VO5A 2W3JA 4D94A 5FXVA 4Q4W2 3ZFFC 2EXKA 1LODA 3UKVA 1WBFA 2BUKA 4RR3B 4YRDA 5FZLA 3FUOA 4R9BA 4KWKA 1Q56A 2IFWA 1OA3A 3AKSA 2QUOA 4I02A 3OD0A 2XKPA 3RGBA 5A80A 2R32A 1Z7S2 4NR1A 1LOFA 4GB31 5C6CA 1AHSA 1WCDJ 3NNLA 1R082 1NZCA 2D44A 3RYRA 3VZKA 5LA1A 1WW7A 3EB7A 4PJYA 1WGPA 2G9ZA 1WD3A 2W1QA 3H50A 5FZ4A 3RNSA 3SKVA 5F5CA 2HWF3 4A7KA 3ASIA 2YBSA 3PNAA 1UZVA 5A3WA 5FZOA 3IB3A 3GJBA 4YM1A 4O9EA 2JG8A 5FP4A 5K8SA 4LUKA 3ITQA 2B4KA 4OFGA 4XVHA 1EPZA 3KCYA 1RJ7A 3P5BA 2Q8DA 3UV9A 4YVSB 3AC0A 4YM2A 3W58A 1CGPA 2FDKA 2XLGA 4RGKA 3WNMA 4BQ1A 1HW5A 4QAWA 2Y64A 4FT8A 3KF5A 4EN0A 4NHKA 4KWUA 1GQPA 1NLQA 1RITA 1UY4A 4LBLA 1NE6A 3T4HB 3WQ1A 2HWF1 3NKTA 3CIHA 3HVDA 1OT5A 1REDA 4P9JA 2LTNA 2XLAA 3ZLIA 1Y4WA 3GXUA 3VBHA 1LEDA 2I45A 2GN3A 2P3KA 2WSVA 4Q8KA 5FMBA 5H9QA 5C71A 1O5LA 4M3CE 4QGLA 4CCLA 1E5IA 3LA7A 4YZ5A 3T2PA 2QQJA 1VMJA 2WWUA 3PU8A 1AX2A 3VBRB 5J09A 1OPMA 5FMOL 3POFA 5GLUA 3SH3A 2RVAA 3ZN6A 5I93A 4FPGA 2WINB 1VB2A 2GP3A 4PBPA 4WM8C 3D5OA 4LKDA 3U37A 4W6XA 5LBFA 1X7NA 3IZOA 4LHLA 5AC92 4ARXA 3WG3A 4LHKA 2FDJA 5JXHA 4YZ3A 1HDKA 1H1MA 3E1F1 3TEYA 1YJLA 5H9SA 4Y1VA 4FVVA 1IHMA 1OUXA 2GN7A 3K4ZA 4LA3A 4OHYA 5J3UA 1O91A 4UBHA 2VCMA 3ACIA 1QXRA 3AP9A 1RJ8A 1DGLA 1FNZA 3MW4A 5F8PA 1ZBE3 4AAXA 1UMZA 2XL7A 1O5UA 1C4RA 4MO3M 4Y20A 4P9WA 2WR9A 1LAJA 2YC2A 3S0MA 3K51A 4E4SA 4CTEA 1MQTB 1QF3A 1W9TA 1DQ5A 2D6NA 4JC1A 2VULA 4BQ5A 2BPA2 1XE0A 5FUPA 3SMHA 2F4LA 1QOTA 2ZGRA 3U07A 1XXNA 1TME3 1YHFA 2PHXA 3B5LB 5LZ6A 4CDUC 1JU3A 1CZVA 2JE8A 5I0UA 4C1XA 4YW1A 4Y5SA 5FZ6A 2XONA 5C9AC 1UYXA 1X9TA 1ZBE1 2JKBA 5LEKA 1WCUA 1WCSA 2ET1A 4IQPA 4LBQB 1Q8OA 3JQXA 4BQ2A 4HVRA 1R1ZA 1JZ3A 3NJYA 2CDOA 1GUIA 3K4AA 1DYOA 2PA7A 2R063 1RUH2 2WT2A 4OMCA 4YM3A 3FBYA 1NX9A 1N1VA 1DGWX 3ETPA 5HPOA 1TME1 2K46A 5ACA1 2VMFA 4HZFA 5DAPA 1ENQA 2AACA 4N90A 4QQPA 1CZTA 4W4ZA 2WNUA 1XNCA 3RVHA 4XXAA 1EAH3 4JGZB 2R071 2XQXA 2JDAA 2W1SA 2WA4A 2XHKA 4IEVA 5A32B 2VW2A 4NWWA 5FZFA 4IGOA 3WNKA 3Q8BA 4JVAA 4NWVA 4AEJA 5A7QA 4DIQA 1O4YA 4M3CA 4B3NA 4Y33A 2PELA 2UY9A 1RUC3 3L2YA 3I7DA 2YGLA 4MZUA 4AI8A 2R061 3HBKA 2PAKA 3W21A 2DWRA 2OXBA 1FXZA 3NRUA 1UF2C 2GMPA 2HWB2 4Z07A 5D21A 2PYTA 1K42A 3NAPA 1T6BX 4PT6A 4I2OA 2QDNA 2ZZJA 4WVMA 2W52A 3ZVXA 5FK8A 1W2NA 2YBPA 3JUUA 1CIYA 1IQAA 4CEWB 3HNYM 3FX3A 2Z42A 4ATEA 1WLCA 1LNSA 5C5UA 2WZR1 1ULCA 2BFUL 3ZDVA 2ARCA 4N43B 2P37A 4AQ6A 1KEXA 1NAEA 5FPBA 1AR72 2CGPA 4N8MA 2Y6HA 1RYYA 1RUC1 1UKRA 1DZRA 1VLNA 2BZDA 4IETA 2UURA 3WW3A 4BK5A 2F6BA 1W3VA 3VLBB 3O5SA 2CWSA 1GZTA 2WN3A 1HV0A 1JOBA 1QMJA 1O59A 5GLTA 2Z79A 4QPGA 4UFMA 2VH9A 3IKWA 4CDXC 4AEDB 2TUNA 4CP9A 1W6OA 2A6VA 3ZFGC 2H0VA 4FBFA 5C3PA 1BYHA 1YQCA 1ULFA 1LU1A 2PAEA 2ZHNA 3VHNA 1HRV2 5H9RA 1C8M3 3TEWA 2D5FA 2VUDA 3NMBA 2YZ4A 1OQDA 1W2AX 4Q4V1 5I8SA 2D97A 1O8SA 4YVWB 2NMOA 1DGRA 4L2NA 4RHV1 3BVCA 5IYYA 2D43A 1KFXL 3CMGA 4AGGA 2Y34A 4Z82A 1CR7A 3WZ1A 2O1QA 3HNBM 5BNOC 5DXDA 1F8VA 1OF3A 1H9PA 2X29A 3GZTB 1FOD3 5E6HA 4OZXA 2DURA 3RQ0A 3JXSA 4L11A 5IWFA 2IXCA 2J1UA 2DU0A 1C8M1 4UWDA 3V65A 3FFQA 1R093 5BNPC 2BVBA 3V0BB 1OPOA 3B69A 3VDCA 1RUD2 2YC4A 3OEBA 4XDQA 3UK9A 1AYN3 4LIVA 2Q1FA 1VR3A 3KLSA 2JDNA 5JVVA 2PN5A 1AXKA 4JRAA 4QU1A 5IAXA 1A6CA 3UL2A 1FOD1 2YFUA 2YB7A 3IN9A 3SEPA 2EXJA 4OHVA 4CRQA 1YIFA 4FOWA 3ZFEC 1RHI3 1ZZ7A 4NHMA 1MEC2 4E9KA 1JOPA 4A3XA 1MS4A 5DABA 2VR4A 4QWNA 2EIEA 4PI0A 3THCA 2AEYA 3N7KA 3WDTA 1DP0A 1K5MC 2WNOA 2DUOA 4JDNA 1V6MA 2Y6KA 2HBTA 1UMHA 4IGPA 1GZWB 5FOJB 4QX8A 2JX9A 1CAWA 1BMV1 3RWNA 2YMZA 3HIFA 1H2KA 4EN8B 3T0BA 2DVAA 3WR0A 3JD72 1W6QB 5FWJA 4GH4A 1CONA 2ZAHA 1RHI1 1POV3 3M4FA 1R1A2 3NJVA 2VMGA 3VBRA 4F8AA 2CWMA 3LD8A 1Z7S3 4N53C 1G7YA 4XIKA 3KHCA 4AHZA 2D6KA 3T0DA 1HV1A 1G9FA 3BTYA 3LCPA 2FQPA 4JGYC 3PMSA 3POJA 1Y9QA 2G4IA 4FPYA 5T50A 4ZXKA 1NCRB 4GIQA 4Q4W1 5BNQA 3L9JT 2XJSA 1TNFA 4YW6A 1JZ4A 1MS9A 2XLFA 2XJVA 5AVPA 3VZNA 2VM9A 4YGBA 4YPJA 3MBWA 3OGJA 4CVUA 2RM22 3HN3A 1UZ0A 4BZ4A 2AUYA 5EWSA 3EYPA 4YGCA 3LPFA 4AK3A 1LTEA 1CWPA 1ZZ9A 1ULDA 1URXA 2ETEA 2KR2A 4FP3A 1Z7S1 5JR7B 4K6BA 4RS5B 4OYUA 1R081 3HOBA 4E8CA 2FDIA 4FFHA 1J59A 2NP0A 4XACA 2Q0AA 3LSEA 1CAXA 4YGDA 1O3RA 5F2WA 4B1MA 2XG3A 4BMBA 1QH6A 4CEYA 5CFCC 3ZYFA 1Z0HA 4A42A 4E2SA 3J26N 1S2BA 5KXEA 3VBSB 4AG4A 1DF0A 4HT1T 2FDHA 2XVKA 2XBO2 1XNKA 4CCKA 3ROUA 1V6JA 2WO3A 1DQ2A 2VZ1A 4Q0QA 5FZ3A 5FLHA 4C91A 3AKQA 5DG2A 4A4AA 3IM0A 1E5SA 1LENA 3NNGA 3O1TA 1PHMA 1W8OA 1X8EA 2MPFA 3WV6A 3ORJA 3UESA 4ES9A 3LIHA 1CPMA 4Z2AA 2RMU2 2NN8A 3T2OA 1OD5A 1VBC2 1MS3A 4XMAA 2JENA 1WWYA 1V0AA 2VCAA 4DXSA 4JTOA 5DMYA 3ZSJA 2W1WA 3VBOC 1W8WA 1GP4A 4JGZA 2IXHA 1QKQA 2P17A 3MIHA 4IE7A 4P14A 3BTZA 1AJOA 4FI9A 1DHKB 4LE4A 2W9XA 5LBBA 4G9SB 4J1XA 1RUG2 1Y43B 3J8F2 1PMIA 2JICA 5AC91 3VL8A 3LA3A 1B35C 5FZ0A 1JS9A 1PIV2 2B46X 5FY0A 1COV2 2OIIA 1FMD2 2IUWA 4FOYA 5IHRA 3H1WA 1MS1A 4CEWA 2WABA 1VIWB 5CU1A 2QQWA 1VBE2 4LK7A 5GLVA 2GALA 1PMJX 3IMMA 4S2FA 2K9ZA 4WV8A 4LKFA 4AGVA 5FCCA 4IE5A 4YW5A 5JI7A 4XAAA 1NYWA 2VZ3A 3GNEA 1SFNA 4YLZA 3SHRA 2YDEA 5EV7A 2Q8EA 2ZX4A 2H6BA 4QU2A 4XZUG 3OPTA 3IDCB 1ZZ8A 3ZYRA 3I2HA 1RUH3 1LULA 2VW1A 2RDRA 4QB1A 4DY3A 4ZU7A 5FOBB 1JYXA 2WYSA 4NAOA 4D0QA 4HN1A 2WNVB 3ME2A 4M0NA 1BBT2 3ZSEA 2QDRA 3HEIA 5CG8A 1OXCA 1F4HA 1PO12 1Q3EA 2LRPA 4IV1B 4AHYA 3VDBA 5C4WB 3X29B 4GWJA 5GM0A 1YRZA 4FQ4A 1GOGA 4P02B 3MI8A 3FLRA 1O3SA 3N9MA 5FO9B 3VKOA 3OUIA 4ZS2A 3BIEA 2MNGA 3VZJA 3I3DA 4DRRA 3AYAA 5FBZA 1RMU3 2IFRA 5D8AA 4I01A 1KDMA 1L7LA 5I8TA 1RUH1 3BB6A 3AM2A 2YBKA 4IEPA 1PGW2 2A3WA 2E53A 2P34A 4G3YC 4M00A 4JAAA 3E6CC 3WNNA 5CFDC 4RL7A 3PUSA 2BDRA 1REEA 2ADDA 4RGGA 4GKYA 5BNNC 4DUXA 4D6SA 3MDPA 1N1YA 2E51A 4KG0A 4MGZE 4UFLA 1ZX5A 2ORXA 2QFEA 4CDWC 1BHGA 1WBLA 3OBTA 4KMQA 2PFWA 1AR73 3MF6A 3T2QA 3ACLA 1ENXA 2DVBA 3PUHA 4LLOA 2DCKA 3CBNA 4BLJA 1XBFA 4QM8A 1XC6A 3E6DA 1QJY2 5B4XA 1JMUB 5C8CB 2ZGLA 1HN1A 2LW8A 3C7FA 4AEMA 2HWB1 2VY0A 3E5UA 1PM4A 4YNIA 1OH4A 1FV2A 3IIIA 4EYUA 4M4PA 3MIDA 3RYPA 4R8HA 5K0UB 1HRV3 1AL22 4QQHA 1QXJA 1AR71 1U5ZA 1P8JA 3OF1A 1HXS2 1PGSA 3U10A 3VHPA 5L36A 3KV9A 1NQJA 4Q4X2 3DL3A 3M2MA 3AP7A 1AR92 3V0AB 1C8NA 2Y0OA 3H1YA 3WF0A 1IZ3A 1W6PB 1W2OA 2R042 3APBA 3QACA 4SLIA 4DXRA 3AP4A 2ARAA 2CV6A 2GZWA 2ORZA 4AEKA 4W6YA 4XFAA 2NPIA 1HB4A 4XIOA 4AF9A 5HXVA 4DPNA 1HRV1 3LEGA 4IE4A 3ZFFB 4AVTA 3JBG2 2IVJA 2YU1A 2YYOA 2FZ2A 3KV6A 5DG1A 3AFKA 2E7AA 2HBUA 4Q1RA 5FV3A 1NY72 1Q8VA 3WHUA 3I2FA 3KM5A 3CKHA 1ND2C 3MW2A 4UT5A 3ST7A 2EAKA 5L19A 5LRSA 2A5ZA 5JSPA 2VW0A 4UI9L 5FYZA 1A8DA 1GWLA 1YJKA 4KGGA 5EJZB 2D6LX 3FUQA 2VUJA 2CGOA 1OQEA 2WWSA 5KHIA 2PHWA 2F17A 5FXXA 4Y4RA 2A6XA 4L9BA 1EV12 1MEC3 3MV11 4CXYA 2QQIA 2FMYA 3NWKA 5FLIA 2WWJA 4PF5A 4I0WB 2J22A 2ZEXA 2R0HA 2B9VA 4MGSA 4XUQA 5FY9A 3LSDA 5LCWL 3FHAA 2EXHA 3JCIA 1HB3A 4XJZA 1RUD1 4CCJA 2QQVA 4UFHA 3FC0A 4CA9A 1D2SA 1APNA 4K40A 4MXWB 3N9OA 3VBSA 1AR62 5J98B 3JD73 2BVVA 4CPBA 1YC61 3AZZA 4P00B 1AX1A 5CAZA 5FYMA 3LAGA 3ZYHA 4MGTA 1MEC1 1XE8A 5DZEA 5F3IA 2VAUA 1LOAA 5FJKA 1JOJA 2VXJA 1LGNA 5FPAA 2ATFA 1VBA2 5L73A 3CJIC 5EJ1B 1N3PA 1WLWA 4PBOA 4E2QA 4FPHA 4QX0A 4D8MA 1U5IA 2DVFA 4PIXA 3O1MA 4Y5Z0 1OVPA 4FO9A 3D0JA 1NT0A 1UYZA 1GNZA 3DUIA 2J1SA 5L7OA 1TMF2 3JD71 3QCWA 4WM8B 4XE9A 2P5BA 3NQHA 2V73A 3IAQA 4SBVA 4Y1ZA 1WD4A 4YZ1A 3MLJA 5GJ6A 1PZ8A 3IAPA 1R1A1 1LOCA 1YFYA 5A3MA 1CAVB 4XF0A 2JE9A 3R05A 3KS7A 5FY8A 4Z1VA 2RS52 4X8PA 3G6JB 2E63A 4QXKA 2X5IC 3UKTA 3ZXJA 3MUY1 3E6BA 1GV9A 3LWCA 4OUSA 1VBB2 3ATGA 1S0JA 1AZDA 5E8AA 2WT0A 1G6NA 4XCAA 1S4CA 2JD4A 3VDDC 1PK6C 2X53S 3WP3A 1S0DA 2RM21 5FYYA 5JSRA 3WXPA 1XYNA 5ABJC 1Q8PA 1NKGA 2BOJA 2XWJB 4QPIA 2QZ3A 5IVEA 2DCTA 2WS92 1SACA 2IXLA 2WYFA 2PQQA 5T5OA 5EQUA 2BNMA 4CDUB 1ODMA 3CQOA 4PLMA 2D6MA 3D82A 4B4QA 4CUGA 3NJZA 3A4UA 4IEWA 1DQ4A 5C9AB 4I0AA 1VBC3 4XUPA 4YW7A 4TN7A 3WSOA 2EAAA 2WNVA 2KA3A 5EXOA 1H2LA 3WP4A 3KGLA 4A7ZA 2FHRA 5BV6A 2XBO1 4IV1A 1XRUA 5FUNA 3WVJA 3PU3A 3I4IA 3MLLA 5FFOC 4LPLA 2GP5A 4IEOA 1QJX2 1E5HA 5CADA 2R0FA 1ZBA2 4TZDA 1U12A 4O61A 4F7ZA 3ILNA 4WM7C 5EIYB 1OHFA 1RXGA 2A75A 3H9AA 3OY8A 4MH0E 3UJQA 2YPJA 5C8WA 4QDQA 2VU9A 4PDWC 4CCNA 1X36A 5F5QA 3GM8A 4AE2A 2DUPA 2HWE2 2RMU1 2A6YA 3DECA 4E8DA 1PIV3 1VBC1 4CDQC 3UETA 4QDRA 3ZXLA 4AFCA 1ZYBA 1FPN2 1AL0G 1LOEA 4L8QA 4PCRA 4OLLA 3N9QA 1RTVA 2JEMA 4Y24A 3ZXFA 1RUF2 1TE1B 1JHNA 2JG9A 1DQ6A 2J7MA 2ZACA 4NRQA 1SG3A 4Q4Y2 5KR7A 3CZJA 1RUG1 5AFBA 2UY8A 2P3YA 3J8F1 4AAPA 4OULA 2VG9A 4LO6B 4RSUA 2CTVA 4YGEA 5I0DA 4BM8A 5GALA 2I07B 5A33B 3GZAA 4AQSA 3EQEA 1RUJ2 1PIV1 1PMHX 1I3HA 2HWD2 5KHHA 4ZONA 1COV1 1FMD1 3A7QA 4NHYA 2WAOA 4KGQA 1H4HA 3FL7A 4V2WA 2HYKA 3GZEA 4RFT0 1VBE1 5L9BA 4B29A 3VKMA 2G9GA 4EV0A 2VGDA 1C5IA 4OI0A 5C70A 2BV4A 5KWRA 3ZYIB 1ZRRA 3WDUA 1IPKA 4JX0A 1GQHA 1PVC2 2XVLA 4CDXB 4CCDA 4ZXEA 3ZFGB 4FTSA 1GNHA 1X50A 1KS4A 1LJ7A 4CYDA 1POQA 1OBNA 4RQPB 1VB4A 1HB2A 4P08A 3AP5A 1W9WA 2A6ZA 1K12A 4UOJA 3WUCA 4B7EA 1QIQA 1W6PA 1OFSA 3PTYA 1BBT1 1DGRN 3J7LA 2DVDA 4LUMA 4RGAA 1ENSA 1PO11 1HX6A 2HWC2 3DF0A 4BHPA 3DYPA 4AFMA 1ASJ2 1UY0A 1XU1A 5FJHA 3PMEA 1MR5A 5BNOB 2FBEA 2XWBB 3K77A 4IXLA 4CXWA 3WINE 1SBFA 2BGOA 3P6BA 4O65A 4B8EA 4TLFA 3SCFA 3PVBB 3PUIA 2WQZC 1QJY3 2GAUA 2GDFA 2XOMA 3J4UH 3PLQA 4IW3A 3VBUC 1ZM1A 3FLTA 2XH6A 1PGW1 3ABZA 3ZYGA 4ARYA 2RJLA 1F5JA 3S5QA 2R30A 5LK7B 3IMNA 5BNPB 1MZ5A 2QTWB 3WDXA 1F35A 3WLUA 1NCQB 2LROA 3RWKX 1O4TA 1V70A 2JG8C 1SDDB 3AYDA 2D98A 3H3LA 1AL23 2YPDA 5FZ1A 2DFCA 3C3VA 2EIGA 1ND3A 2ZZQA 2GC2A 1HXS3 4MYEA 5DN2A 3I97A 1BK1A 1OUSA 1QJY1 2NM1A 3ZFEB 1HN0A 1UNBA 4Q4X3 4HFSA 3WD5A 5C3RA 4Z2WA 2PXJA 4X6RB 1JYTA 2E7QA 1DLCA 4QX3A 5HCBA 1KITA 2WZPP 4DY5A 1PX4A 1ULGA 1OOPA 2R043 2VOWA 1K5MB 3AVSA 1IS4A 4FPLA 1TQ5A 4QM9A 2KM2A 3VBFA 1C1FA 2IWGB 2VC9A 1W2UA 5HXMA 4QGNA 3VZOA 1KS5A 3VBHC 1SPPA 5IVYA 1AL21 3U11A 2WN2A 3JBG3 2ES3A 2QQNA 1QGLA 3INAA 1HXS1 1BLZA 1XJAA 2B45X 1X9PA 4H14A 5FYCA 3SNMA 3H7JA 4AI3A 1UY1A 3EXUA 1OLQA 3MICA 4GJZA 4KQ7A 1E57A 4Q4X1 1AR91 4N7UA 5KC5A 1AJKA 4FFFA 2XDVA 4DQAA 4GWIA 1BEV2 2UYBA 2R041 3O14A 4IDZA 1VBD2 3VL9A 4BXFA 5A3UA 2Y38A 1IS5A 1WCKA 3GCWA 3AKPA 4IV3C 4JGYB 4AGRA 5A3NA 1C5HA 2GSYA 3IDEA 4BE3A 1EV13 5B2GB 1OA4A 2BNNA 1CAVA 2FMDA 2CGNA 2V4VA 2VQAA 3HT1A 2Y26A 3JBG1 5IK7A 3MW3A 4FAHA 1NY71 2ZGNA 4BCUA 4TWTA 1NQDA 3N7JA 2R16A 1G9DA 3R4SA 4H3WA 3AL6A 4I09A 1F31A 4UXAA 3KT1A 3ZDSA 5ACA3 2VNOA 5FZHA 1UD1A 5FY4A 5FZDA 3KQRA 3MIBA 4QX7A 4XW3A 1NLRA 3D8CA 4MGIE 3S6PA 1AR63 4JQRA 4C0HA 2FDGA 2R073 1D0GA 4XZPA 1EV11 3CLPA 5CFCB 5K9YA 2WZEA 1VBA3 3ZYJB 2VVDA 2VQ0A 4MHRA 4JKLA 2WIIB 2WO2A 2KXLA 2ZHMA 2VOTA 3KZ4C 4HG6B 3SC7X 5C9AA 2FCUA 4XABA 3WW2A 5FMOS 3M70A 5JAXA 3MIGA 1AR61 1TMF3 2PLV2 3AFGA 4R9AA 5G05L 4HL0A 2WZR3 1H8TC 3WCRA 3WNOA 2DVGA 3TEXA 3A0NA 3BODA 2VZVA 5GZEA 2XR4A 3BPSA 3UJOA 3THPA 5KXBA 3RZGA 2WNUC 2YUEA 3OOXA 1VBA1 3P3NA 1HQWA 2RS53 1O7FA 1FT9A 3OEAA 3VBOB 5F6KA 2CSGA 4M4RA 3MIEA 4GMP1 3QH6A 2ZEYA 2WSUA 3H3UA 1LHOA 5T3NA 3VD5A 5IUQA 3C8XA 4RA0A 1KRIA 4BISA 1WW5A 3U14A 1TMF1 4ZY9A 4AFAA 1V6OA 4CU6A 3M3IA 1B35B 1QOSA 4R4ZA 3ACHA 4Q4V3 3FJSA 3IDAA 4Y1XA 4MVTA 3S7EA 3LFMA 3LOIA 2WS93 5DAQA 2Z4FA 5FPXA 1G86A 5JZGC 5LEJA 2RS51 4RHV3 2BQPA 5A3OA 2A3YA 4XDOA 3NNFA 1XE7A 1BKZA 4FP2A 1YFXA 3AMQA 3RSJA 2VZPA 1B09A 1ZNPA 5IVJA 1UOGA 1VBB1 3T08A 2HEVF 1H9WA 1LU2A 3VGIA 4OMDA 3Q8CA 2VMEA 3FN9A 5FZMA 3H42B 4QX1A 1WMDA 4LXLA 2Z5WA 4XTMA 3POSA 5FYUA 4QPGC 1AXZA 3Q8EA 1WKYA 5JIAA 2H6CA 4AFDA 5A6XA 3MHZA 3LE0A 3ZN5A 1QJX3 1J1LA 2QCSB 2WS91 4KWLA 3S7IA 4BDVB 2I74A 1D4M2 5ISLA 4ASMB 5D1IA 5LBCA 2K2SA 1AF9A 2WBKA 3AZYA 2RJ2A 3H8UA 4RQPA 1CZSA 4YFWA 4YARA 5F3GA 5C5TA 4URTA 2X8KA 4RR3A 2EXIA 5FZ8A 1OLME 3LF7A 3ZXAC 1CPNA 3H8RA 2JDHA 3RZLA 1I5ZA 4BQ4A 3G7DA 3ZXGA 5CBLA 1IKPA 1YCIA 2XXZA 4AZZA 1PNGA 2PHFA 2OZJA 3MFCA 3A22A 1RUF3 5A7WB 4AQ2A 2EIBA 1JUIA 1QJX1 4OI4A 4YW4A 1ZBA1 3TN92 4Q4Y3 5CFDB 2J1AA 4QXBA 1FV3A 4N9IA 5F39A 1X82A 5BNNB 3OJBA 4C90A 2BFUS 3WNXA 4CUCA 2HWE1 1W8NA 3ON7A 2JECA 2HWD3 4CDWB 5GLZA 1AR82 3AK0A 3HQUA 1LCLA 1VRH2 5FK7A 5BNPA 3POWA 1FPN1 4OCTA 4GD4A 3USUB 3FE5A 4XXPA 2AENA 3BOWA 1Q8SA 4BQ3A 3RZHA 4EWAA 5A7SA 1NCQA 1RUF1 4YVSA 5IFPA 1REFA 1WA6X 3U4XA 1I5PA 2OUHA 3UGFA 3MUZ1 1OLRA 4TSVA 5FKCA 1GBGA 4ISRA 4NROA 4Q4Y1 3GF6A 1PVC3 4FOQA 4LO7A 1ZRFA 5EJ3A 4KH9A 1OMIA 4UFKA 5FY5A 4NIDA 4Q4W3 1S2KA 4QPWA 4W8JA 5K7PA 3ZIWA 3EMRA 1RUJ1 4BQXA 1S55A 2HWD1 3KT4A 5JUVA 2QQLA 5J7MA 5JOWA 3LDBA 3M3CA 1WA4A 4FPEA 3B93A 3R4DB 3UGGA 2VZUA 1RUE2 2Y8KA 3NO8A 3HAGA 3THDA 3ACFA 4QB2A 2JXAA 1YI7A 3IPVB 5IFTA 5T52A 3M3OA 4MLOA 4K8RB 2ZAAA 1R083 4GH4C 3THTA 2YG0A 2IXJA 2ZMNA 3NW4A 1US2A 3QBQA 4HVOA 3OPWA 1PVC1 3BU7A 1BK0A 2P2KA 1V00A 4QKFA 4Z92B 1LHUA 2ZMKA 5JSOA 4EJRA 1K45A 5FZEA 3VD4A 2A71A 5EFUA 4JKMA 4CP1A 3PVEA 1UPIA 1F9KA 5F6LB 2WLPA 3B9IA 4NPMA 1ND2B 2ZGPA 2GH2A 1K5JA 2D6PA 3MIFA 3MEPA 1OLMA 2HWC1 2OQ6A 1SMVA 1W6NB 1U5XA 2C0ZA 1ASJ1 3E5XA 4JHTA 1J3RA 4F3JA 5IK4A 1MQTA 3QOPA 2BBAA 1FNYA 5DAWA 3ZIXA 1MS5A 4S2HA 3EJKA 4UW6A 5CVRA 4CP2A 4EROA 3URFA 4JRLA 2OPWA 1MVEA 1KFUL 2R49A 3PHMA 3POGA 4CCEA 3OB8A 2PHUA 4I3GA 4S2GA 1M06G 1XSQA 1H6XA 3PDQA 4DEQA 1X33A 4H7MA 3U4SA 3N7MA 5CKMA 5HV0A 1H2MA 2WFF2 3B3QE 3B94A 3IDBB 3OGGA 4CEYC 3JZVA 3ZSLA 2Y6FA 4LBQA 1PZ9A 3U0ZA 1W8FA 3MPPG 1S2EA 4ITCA 3BTAA 1UIKA 4LT5A 4E2GA 2PQSA 5AC93 2W5FA 4FPJA 1V9U2 2D3PA 4CP0A 2Z2SB 3LEMA 1DIWA 3I2DA 4PIYA 4TLGA 2N7GA 4BIFA 5GZGA 1LR5A 3LIGA 5DAXA 3MO4A 2FD8A 5LWBA 5EP9A 3CJIB 4KNCA 3I3BA 4HPKB 5DAVA 3WP5A 3WY6A 3O1SA 5A32A 2AC1A 4KWJA 2VCBA 1SQ4A 5FYIA 2RR12 3BIWE 3H1MA 4GWMA 1KGYA 4MXVA 4N7IA 1O3QA 5JWPA 3M1HA 4LBJA 2OVUA 1NZIA 4Y1YA 2VOXA 1UX6A 2HLEA 5HI0A 4XETA 1A34A 2VBDA 2BU9A 2G9FA 1F4AA 5FO8B 1RUOA 4COWA 4A7YA 3HPNA 4Q1PA 3VN4A 4FPFA 4A2UA 4XFBA 1QY4A 1BEV1 4GWNA 3NV4A 2P6HA 3DXTA 3PVNA 4OI1A 4IESA 1VBD1 2X5IB 5ANQA 2AH2A 4N43A 1B35A 2PHDA 4MOAA 1W03A 4UW4A 3H8XA 1C1LA 4R9CA 1OC1A 5FUIA 3TBDA 3OPZA 5CZKA 4LHSA 1NE4A 2A3XA 3AVRA 3D3AA 4FQZA 3VDDB 3H0OA 1JZ7A 1PK6B 2WQ8A 2XJUA 2BOIA 1BJQA 5ABJB 2EVXA 5LA0A 1ZREA 5E1RA 2JD9A 4OVEA 4LE3A 4JZRA 2IC1A 2WZ8A 5E16A 1V6LA 4ZU4A 4AEDA 4COVA 1DLLA 4J25A 5CG9A 1ALYA 5TSWA 4YG0A 2XMLA 1YQ2A 3VUOA 2GNBA 3B9CA 1XB9A 3NNJA 4Y22B 2Q5TA 2VCCA 3I54A 2R6QA 4TXWA 1Q8QA 5FBJA 1GWMA 3MV01 2QQMA 4ATFA 2C9KA 3I3EA 5ERLA 4V1PA 1DQ1A 1POV0 2LALA 4L97A 3BOPA 4HSLA 4YVWA 4AW7A 1JYNA 1DYPA 1H4GA 1YEWA 4H55A 3USSA 5JOZA 2HWB3 5FAXA 1EP0A 5J36A 1CVNA 1W6MB 5CISA 2XPJA 4E4ZA 1XYPA 1HLCA 4WM7B 2DF7A 2RS32 5D8AC 2DDUA 3DKWA 2PLV1 1NG0A 3ZM8A 1CX1A 2Q1MA 1YYNA 3ILRA 4PDWB 2IVIB 5A7WA 5T5JA 4AVAA 4O7XA 4CZSA 3FHIB 1UN1A 5I8YA 2GH8A 1NXMA 5FWEA 3V0BA 3MZHA 1ULEA 5CFDA 5FRAA 5FXWA 1OQ1A 5LBEA 4OUEA 2VMCA 4C1WA 4U2AA 5BNNA 2D3RA 2DFBA 1OF4A 2DYCA 4OI2A 1N3QA 1HJFA 1D2QA 5ANNA 4DNYA 1WUVA 3WG2A 1Y3TA 4P9GA 4AXOA 2JDMA 4DS0A 1GYKA 1W9SA 4DUWA 4Y4YA 3OG2A 5AFEA 2VL4A 3USUA 4A44A 3I2IA 2QVSB 3AXEA 3AZXA 1LB2A 1XYOA 1MPXA 1OH3A 1UXXX 5GZDA 4WZFA 4W65A 5FP9A 4OHZA 5E88A 4IEQA 4LJHA 1DCSA 4QHBA 4XDPA 5DUWA 3VKLA 1GZWA 4EN9B 3LPGA 1J83A 1LOGA 4NJ4A 3BI3A 4GA9A 2D3SA 2WAAA 5FZGA 5EYXA 4F83A 4P5HA 1W6QA 4IEUA 2D40A 5E89A 1ULPA 4XFFA 5IVVA 1RGSA 3ENRA 1GP5A 3N9PA 3IPVA 2QQPA 2ERFA 2OQ7A 1XNBA 4MHUA 1YUDA 1UL9A 3AMHA 1VAMA 3K4DA 3NJXA 3OYWB 5A1LA 3HN1A 3O1PA 3OSDA 2Q1ZB 3TN93 1CX4A 4MSVA 4E4HA 1D4M1 2DCZA 2RG4A 5FP8A 5A6ZA 2Y60A 1L7RA 1UZWA 3RZZA 1W99A 1NCRA 1RUD3 3V64A 4Q26A 4Y26A 4HOOA 3WT3A 1IPSA 1DGWA 2XL9A 1W90A 1J3PA 1VPHA 2PHRA 4GJYA 1XNDA 4DUVA 1H0BA 2GNDA 4NIGA 1VRH3 3RRDA 2ZA9A 3T09A 1S0BA 1NUKA 2CY6A 5FYSA 3O1RA 2UWCA 4AVBA 3VBUB 3J9SA 4Q29A 3PL0A 4JTNA 2W94A 4RS5A 5JXJA 2GC1A 3TN91 3VKFC 4AVVA 4JDOA 3ACGA 3BU0A 4L0PA 3GBWA 1W0PA 3DGTA 3HQXA 3HD8B 2CAVA 2XGXA 4IEXA 3CJXA 4MGQA 4YG6A 5FZOB 5FO7B 3RJ2X 2JG8B 3AB0A 2YGMA 3WQ0A 2WO1A 1WW4A 3W9AA 1AR81 2ZEZA 2E31A 3NV1A 4AI9A 1VRH1 3RMXA 5FP7A 5FZ9A 1U0AA 3MF9A 3DYOA 4ASLA 1R1A3 3BCWA 4ISQA 3I2KA 5IK5A 3ZSMA 1W0OA 3FBMA 5A3LA 1MS0A 1AXYA 1PGL2 2HYXA 3H8OA 1IOAA 2RJKA 4BU2A 3DYMA 3SCGA 4AI2A 2JJ6A 1D0HA 3LFIA 1ZRDA 3VBHB 5FDBA 3K46A 2XB6C 2ZGOA 3A23A 3JB4C 3UYJA 3CJIA 2RM23 4HPKA 2Q8CA 1GOHA 2W87A 5FYHA 3FHQA 4HKLA 1I6XA 3ZXDA 5GZCA 1RUE1 3AKTA 1SLLA 1S0EA 3R0RA 1TG7A 4H7LA 4XYXA 5FLJA 2L9LA 3ZN6B 1F2NA 3RG0A 1UIJA 4TYSA 5L7OC 4TTGA 2C6SA 1NA1C 4XMIA 5F3CA 2UWAA 1EUUA 1G9CA 4HSJA 4R4XA 2ZBJA 3PUQA 3WG4A 3WQ7A 4IV3B 4INDA 2O8QA 3HT2A 4A6OA 3WDYA 4QDSA 1W8UA 3U78A 2CDPA 1VAVA 4BB3A 2DTYA 3O12A 1EAH2 4A6SA 2VZRA 2XBO3 5LY1A 1S0GA 4AHWA 4HBNA 1KJRA 3DXUA 5F5AA 3ETQA 3VKNA 3WX5A 3WNLA 2VTFA 1LEMA 4Y20B 3J7MA 4COYA 5FZCA 1DQ0A 1CN1A 1D4VB 3FLPA 2H0BA 3WF1A 4LMFA 1XNTA 3GALA 1SBDA 1SZBA 2QQKA 2C26A 1UU6A 2ZOEB 3AMMA 2AEZA 4BJ0A 4URAA 3I3QA 4QPIC 4K7JA 4BMEA 1AYM2 1PZ7A 2RMU3 5SV8A 4AVCA 5IVCA 3BGAA 3WEZA 1O8PA 1JZ8A 3OGRA 4Y22A 5FP3A 1ZA4A 1GKBA 1UZYA 5GLWA 5C4WA 2WFF1 1VRBA 2RR13 3D6EA 5A70A 2ZGSA 2G1MA 2NYYA 2VUCA 2QKDA 3T3YA 2C1FA 1RUG3 5FYVA 1YIPA 4AWDA 3J8F3 5FTTC 5A7NA 2ARXA 4HVQA 4DOUA 3ZPYA 1GR3A 1V9U1 1UXZA 2CHHA 4Q0UA 1H8TB 4K1YA 2GC3A 5LATA 1COV3 1FMD3 4BXSV 2VBPA 4J1WA 4WM7A 2JWPA 3TB0A 3BYWA 4A41A 2VTXA 4NN0A 4GALA 1VBE3 5B4NA 1JYIA 1W04A 3PURA 2YC0A 3POYA 4XBQA 4XQWA 1GLHA 2RR11 4M3CB 3JB8A 3DPRC 3H3ZA 5FMDA 4LIUA 2CYFA 2WT1A 3TRSB 3LOBA 3RS6A 2ZX1A 2JB8A 1LECA 2JG9C 1WMFA 1GSLA 2MEV2 4AFBA 5C8CA 1LRHA 1JI6A 2ZXQA 2K0GA 2HKXA 2UYAA 4IE0A 2BWCA 1W8TA 3N7LA 4MADA 5HCHA 1UPSA 2IXKA 1L7QA 4EN6B 1H1AA 2KD7A 2VNGA 1NXD1 1BBT3 4JV4A 4XJUA 5JZGB 3O7OA 1PO13 5K0UA 3LGRA 1PVXA 1FI2A 2PHTA 3WDWA 1R092 3S5AA 1G8WA 3SITA 3RMYA 4C0BA 1SFYA 3Q8FA 4BIOA 1K3IA 4LTAA 1AYN2 1OKOA 4Q8LA 1W9FA 4QXCA 4HANA 1LHWA 4QPYA 2Q30A 3V0AA 1DBNA 3POIA 2YFZA 5JCTA 4Q5OA 4UBGA 2RHPA 3SLIA 1RUI2 4KBBA 5HBAA 1PNFA 2WL1A 1QJEA 1UYYA 2V5DA 3I2OA 4LBKA 1QNWA 2ARBA 2ILMA 3U1XA 3BKZA 3ZFFA 3K75B 4KBZA 5AVAA 3UNPA 3ALQA 4LA2A 1UAIA 2W1UA 4XFGA 3SH5A 1A78A 5JXGA 4COZA 3OBRA 5FPLA 3T30A 3ZO0B 1AUYA 1LOFC 3OGSA 1RVF2 2MHFA 3JQWA 4NPLA 2EICA 4YWAA 4MG2A 3RZKA 3GGLA 1NOVA 2HEYF 2RE9A 1UKGA 1ZZCA 5IJRA 5BYNA 2LM3A 1YFUA 3FZ3A 4PHZA 4AVSA 1BQPA 2RS31 2J42A 5F32A 2QZ2A 2SBAA 3EHKA 3VDAA 4NAMA 4NPRA 3VBUA 4WVWA 1FYUA 5I0SA 3LDKA 4NHLA 2E6VA 3O0VA 3OCPA 3POBA 4FTEA 1QOOA 3MLKA 4GAZA 4XPVA 5FZBA 4LK6A 2WFPA 2J1VA 4JDMA 3T4VA 3WDVA 3TAYA 2C24A 2BGCA 3ZOIA 1TVGA 1AR93 3TNPB 1ND3C 4MXWA 4V2VA 4ZPIA 1NLSA 1WMXA 3GHNA 4HK8A 2A1XA 3WUDA 3WHTA 4HKOA 2VOKA 4ORFA 5F37A 2ZPXA 4PF1A 1RB8G 3ZXEA 3CO2A 1JHJA 1HQLA 2NMNA 3AKRA 1SBEA 1W05A 1OOPC 3W59A 5F1RA 2J1TA 2ZHLA 4LITA 3VBFC 4H2AA 4MGYE 5SV5A 1JYCA 4XQDA 5IVBA 2OT7A 4ZZ8A 1OD3A 1CAWB 2B7YA 4S2DA 4RN5A 5G04L 4FSJA 1IG3A 4ET7A 5F7UA 2VXRA 1ZA7A 3VV1A 4N53B 5T55A 5LY2A 2Q8OA 1Y7BA 4WM8A 2BEOA 4GH4B 3MFAA 4QT6A 1UU5A 4AI1A 2VZSA 1X8MA 3K48A 4WVZA 5GKAC 3OUHA 1PX3A 4FXGB 4COUA 1O4ZA 1F15A 1WLDA 2IXIA 4NE9A 3VZMA 3SQOA 2V09A 1PO22 2XVGA 3HBZA 2J1EA 5FPUA 4NIIA 3LKJA 1ENRA 4IE6A 4JCKA 2A73B 2XQRA 4CCOA 5A6YA 1UYPA 2VZOA 1FAYA 1SLAA 5JPNB 1GICA 2JDPA 3CHXA 3P1IA 4IV3A 5F9TA 1HKDA 2OUJA 1WMEA 1ACCA 1CJPA 3LQCA 1IKQA 2XJQA 2VMDA 3AZWA 5J96B 4L92A 1Q5OA 3SEEA 4XF1A 5CIRA 2OKXA 3T1MA 2WRAA 1QU0A 4DEVA 4X6QB 3HJRA 4HLTA 4XJWA 5CA6A 1JTZX 2W39A 1UY3A 2ZGTA 2RV9A 2XJPA 4K21A 4XF3A 5IVFA 1OURA 2OA2A 2A6WA 4CDUA 3R6SA 5FQ0B 3T1LA 1VP6A 2R1DA 2ZCWA 1CAXB 1GQGA 2E26A 1BZWA 2ZGUA 4GMP3 4CEYB 5CYYA 4QD2A 4UFJA 4DINB 3FWEA 1SFPA 3S57A 3W5NA 4PLNA 1SLTA 2DBNA 4HN0A 1XU2A 2WA3A 3KV5A 1EUTA 4W6WA 4BA6A 1W28A 3WP6A 3ZX7A 5LASA 4CPBD 4XQ4A 5C33A 3KWVA 1OA2A 2DTWA 5FXZA 5M0TA 2JKXA 3HNMA 4QQLA 4LQRA 2WNEA 1LHNA 2W46A 1D7PM 1PGL1 4LO4B 2B8MA 2LS6A 5HCFA 1S0CA 1H8TA 2ZTNA 3CNAA 3KVAA 5LW9A 3C7HA 4NIHA 1VBB3 4PLOA 1W8ZA 4P9LA 2RDNA 4KU7A 1MACA 5EPAA 1UX7A 2DCJA 2AR6A 4NRMA 4Y1UA 3W20A 1I1EA 2DCYA 3NAPC 4PQ9A 4AOCA 2Q4SA 3AJZA 1H2NA 2CAUA 4QB6A 4XF9A 4QGMA 3J7NA 4WZCA 3PTRB 5LA2A 2X05A 2BJSA 1RMU2 5DDJ2 5FZ7A 1IGOA 1DZTA 2E7TA 2P6CA 5JXIA 5A33A 2NLRA 1S1AA 1SHWB 2X09A 4Q2FA 1AYM3 4UF0B 4B7KA 4MGKE 3WW1A 5DUUA 1W06A 2RS12 5I0TA 1JZ6A 2JIJA 3E97A 2YHJA 2QE3A 4C8DA 5JZGA 1EAH1 2G19A 2EA7A 4LKEA 1RIRA 4XBNA 5IAVA 2DBIA 3ZSKA 2ZGQA 1UCXA 1ZBA3 4CDXA 3S30A 2ZHKA 3ZFGA 5JMCA 5IW0A 2SLIA 4LLFA 4EWEA 1EY2A 3HR9A 3R4UA 4LULA 4RFRB 2BW8A 2TNFA 4JQTA 5T54A 1AYM1 2HWE3 3ZMNA 2D93A 4OHXA 4PQQA 3RDIA 3K2OA 2JDKA 3PJYA 3ILFA 5GZFA 5KXDA 1FPN3 4RQPC 4LHNA 3AXDA 1GMMA 1QQP2 2AYHA 4KU8A 4RR3C 5J37A 3A0KA 5BXXA 3WCSA 1QJU2 3GBGA 5DUXA 2WUHA 4ASKA 4NO4A 5BNOA 3U75A 1XQNA 1C28A 3NV3A 4MUVA 4BK4A 1UQXA 4AYUA 2JE7A 3WNPA 5D8AB 1J58A 5CKQA 4UAPA 2MEV3 4Q0VA 1KJLA 2JDYA 5CEHA 4XFIA 4YW3A 3RI8A 3ZKYA 1RUJ3 1KQRA 1MZ6A 2VD7A 3TWIA 4Z8BA 4D6QA 4UW3A 2LUWA 2WC2A 4EZHA 4XURA 5FZIA 4B1LA 4D7YA 2YU2A 3ES4A 5CKNA 2BNOA 4D6RA 3K3OA 5C3QA 4QKNA 5F5IA 1MZFA 1VALA 2AREA 3KF3A 3VD9A 1KD7A 4HK9A 4M0HA 2GMMA 3VD7A 4OUMA 1GU3A 1NCQC 4K8FA 3KD4A 5DPNA 4QQOA 1EPWA 2BYVE 2MEV1 3KSCA 4YVSC 3ZFEA 4IUGA 1MZEA 2XJRA 1JZ5A 1JYVA 3O1OA 5EYYA 1QEXA 1YO8A 1RL3A 1HIXA 2CU5A 4K9SA 4FPOB 1K5MA 1RUI3 1SCSA 4FXKB 4GMP0 5HV4A 4JKKA 1CAUB 2JDUA 4EN7B 2EF6A 2ZX2A 1YFWA 4FCAA 4OHWA 1PM7A 2HWC3 4FFIA 2V5YA 4R52A 5DZFA 4AHXA 4ZZ5A 1ASJ3 1H8VA 5JMOA 1UU4A 1Q43A 1R091 3GHMA 1H1IA 5JI9A 3ECQA 2BBVA 3KMHA 1C57A 3VBRC 1GANA 4XUOA 1AYN1 4XHXA 5L9RA 4HKWA 2D7FA 5CNAA 5C7GA 1RVF3 1YWKA 4EQVA 2XHNA 4YG3A 3QD6A 1GWKA 1OKQA 4N53A 5FKBA 2VVEA 3LA2A 3W5MA 1RUI1 2VBBA 1UO9A 2R1BA 4JGYA 3RPQA 5FZAA 1E5RA 1BXHA 2NQYA 4EE2A 3C7OA 2E33A 5KHGA 3F95A 3PIJA 4CSWA 3GJAA 1S0IA 1LGBA 3CL1A 4CXXA 2YY1A 3LDRA 5A7OA 1RVF1 3PUAA 2ZEWA 4A3ZA 1MQTC 2B9UA 2QQUA 5A6QA 5JOYA 1JYWA 3DCQA 4CCMA 2YV8A 5CB7A 2VECA 2JDZA 1POV1 3ZXKA 5LB6A 5HCAA 1QHDA 4NRPA 2AZ5A 3HWJA 2C9AA 2WQ4A 5LK5A 5CFCA 1U5YA 3N36A 4FAGA 1QJFA 1UOJA 5FPZA 2OYZA 5FQ0A 1YNAA 4LR4A 5A7PA 4FPKA 4WVVA 5KHKA 3O1UA 5I0RA 5KC6A 2EALA 4LBMA 1DU3D 1JN2P 1W0NA 4LNVA 5K4LA 3KB5A 5LRRA 2XUMA 3CDZB 1BEV3 3M7AA 4J6GA 1VBD3 3ZYPA 4UYBA 2ENRA 1O3TA 4EZ4A 1C3HA 3C7GA 4K3UA 4BH9A 1UOFA 1YXWA 4GKXA 4GZ9A 1HRI2 2VQTA 3L2HA 3C7EA 4Q0SA 5FMCA 3RZJA 1PO23 3CEWA 3EO6A 4JGZC 4ES8A 1J84A 1STMA 3Q9OA 4X8NA 3VBOA 1I9RA 4XUNA 3O1VA 4GXLA 4P9YA 1O6UA 2GC0A 3PJQA 2Y6GA 1LKNA 4G4FA 4LBNA 3T2TA 5L7OB 1JBCA 1GZCA 3WF4A 2JIGA 4XBLA 3LB9A 1NA1B 1W8HA 2F4PA 1QXPA 3J7HA 3NNMA 1RC6A 4LO8A 4QX5A 4E4DX 5IT6A 1N1SA 4M3CF 2GNTA 4QKDA 5A1FA 4CEWC 3WF3A 1KDKA 1TEIA 3HQRA 1PO21 5I91A 1R64A 2FCTA 4XFHA 3IT8A 3CU7A 5FYBA 4N43C 1Y9MA 4META 4BOWA 4QMAA 2GU9A 5FYTA 1JW6A 2Z69A 4ONUA 4UF0A 5DUVA 4CCCA 4AR2A 3TOJA 1DYKA 3SXWA 2VOVA 2OS2A 3EBRA 2PAMA 2PLV3 3V56A 4BWOA 1GP6A 1HB1A 3F2ZA 1XOYA 3N9NA 3RYKA 3ZYBA 4LBOA 4QPIB 4AEDC 4DXTA 1JZ2A 4RD7A 2TEPA 4XOGA 3RI9A 4XAEA 4DFSA 4R9DA 4D3WA 4K20A 4YM0A 5DZGA 3RFRA 1W39A 4YW2A 4IERA 4FFGA 2VZTA 1M4WA 1AVBA 3DEMA 5DQ0A 1RUNA 4GQ7A 4ZS3A 3M8LA 1WLTA 2UWBA 4YVWC 2BWAA 3I59B 3VZLA 4FOVA 2ZABA 1OVSA 1YI9A
chains in the Genus database with same CATH topology
4HMZA 1G9BA 1N1TA 4DB5A 4WBBA 5IK8A 3WG1A 4GB32 4GULA 5BUVA 4YFZA 3B00A 4XJ9A 1QDCA 1H30A 3OD4A 4CDQB 3WW4A 3D0SA 3E5QA 3OY8B 3NSTA 5DDJ3 4EWDA 2XJTA 2ZKLA 2W68A 1DZQA 2A70A 3AMNA 5KXCA 4L99A 4CDWA 2O8OA 4B4PA 2RS13 2WLQA 3DPRB 1FATA 3TNQA 4FTBA 3N3HA 1V6IA 1SEFA 2JG9B 4E27A 1VJ2A 1HQNA 4YSFA 4XHBA 3M3EA 3OTFA 3QH7A 3AJYA 1QWRA 1SLIA 3H7YA 2HWF2 1RMU1 1D4M3 5DDJ1 3TYJA 1GZ9A 3SH4A 1ZZBA 1A3KA 3C2UA 4BPZA 1UW8A 4NOTA 2ZJCA 2RS11 3AMPA 1JXNA 2ZX0A 2YROA 1CAUA 2P3IA 4K1ZA 1QQP3 1A8MA 2CNAA 3GYDA 4AI0A 1QJU3 3AP6A 4XJ8A 2WKKA 1QH7A 2B39A 4XTPA 1CD3G 2UU8A 4BYYA 3PVOA 3VHRA 1MS8A 4I0BA 1DDLA 1AR83 1SDWA 2GMEA 2TBVA 1CQ9A 1NCRC 1ND2A 3AX4A 2ZGMA 1QQP1 1W6NA 3M3QA 1YLLA 1BCXA 4I3PA 4NVPA 3UKNA 5H9PA 5EZWA 4YZ2A 1QJU1 4D7TA 3BPZA 3B02A 2IZWA 4ZU5A 2ZS6B 2W0XA 2OPKA 2O0OA 4DMIA 4XJAA 1QJZA 3ELNA 3D4KA 1N3OA 3NL1A 4RS5C 1ZRCA 2DV9A 1QNYA 3GBFA 1J1TA 4BLIA 1SLCA 4HETA 4D7SA 2VVFA 1VAKA 1FX5A 1ZBE2 1RUE3 2DU1A 3VHOA 4Q27A 3NVCA 3B7MA 3VBSC 5FREA 2E9QA 3NKGA 1BVVA 1ND3B 3ZMOA 3DV8A 2I2SA 4O9GA 4P9IA 1BVP1 5JLVA 3BALA 1TME2 3KCXA 5ACA2 4YZ4A 1V6KA 3N35A 3WOGA 4DXZA 3N4MA 1WW6A 1QDOA 4IEZA 3ZN4A 2FZ1A 2VNRA 4DZGA 1OOPB 4FPCA 3KCCA 2R072 1RINA 3VBFB 2HEWF 1IPJA 2VUAA 1EYBA 4MV2A 2OZ6A 4IEYA 1MVQA 2C5DA 2R062 4XFCA 3AZVA 1TNRA 3RJRA 2XKOA 3CF6E 3GZUC 2W08A 4UW5A 1N47A 4AQTA 4ZKTB 2QNKA 2WZR2 1NA1A 2ZGKA 4QQ2A 2X5IA 2WFF3 3O0XA 2ZX3A 2B5HA 1RUC2 2ZMLA 3IWZA 1LGCA 5JPMB 1ZZ6A 3VDDA 2QJVA 1PK6A 3KT7A 3LZZA 1V9U3 5ABJA 1ONAA 2HJIA 4P9XA 1DG6A 4D69A 3SISA 3NV2A 3DN7A 1JUHA 3IBMA 1L3JA 4KL1A 3MYXA 4LO5B 4N9HA 1DFQA 1IS6A 3MGUA 3IIAA 2ET7A 3P3PA 4Q4V2 2WNVC 4KG8A 1AX0A 1OFNA 5T5PA 5BY5A 4RHV2 3I8TA 5JDBA 2YXSA 1HRI3 2VPVA 1GFF2 4IV1C 1V6NA 1OSGA 2BTVC 5C4WC 4LBQD 3AYCA 3MPBA 4M01A 4B4RA 3FMGA 2GNMA 4XEZA 1W6MA 1JH5A 3I59A 2WNUB 1T6GC 5J48A 1SLBA 1C8M2 1CJDA 3FFZA 1S0FA 3O0WA 4PDWA 4U36A 3KGZA 2PTMA 2Y0IA 4CDQA 5JOXA 4Q0PA 1J3QA 1HRI1 4XILA 2A7AA 3JU9A 5T5LA 3NAPB 1FOD2 2D6OX 4WVMB 5JIUA 1LOBA 1UZZA 2D5HA 3DPRA 5C8CC 5KHJA 1SCRA 4LEJA 3ES1A 1CIWA 4XF4A 2B42B 2WJSA 2VMHA 2P3JA 1LESA 1LHVA 3QLQA 1ZVFA 4MX3A 4PIZA 5K0UC 5KBFA 1BMV2 2DUQA 1Z78A 2NZ9A 4QPGB 1G9AA 3HMYA 2ZKNA 3SCHA 1W6OB 2VMIA 1IS3A 1RHI2 1OI6A 3AYEA 3B01A 1KXGA 2OW4A 2RS33 1CESA 2AGSA 4IL7A 1F5FA 4YYOA 4DRVA 4I30A 4GB33 2PHLA 3OYWA 2CL2A 5BPXA 4D94A 4Q4W2 3ZFFC 2EXKA 1LODA 3UKVA 1WBFA 2BUKA 4RR3B 4YRDA 3FUOA 4R9BA 4KWKA 1Q56A 2IFWA 1OA3A 3AKSA 2QUOA 4I02A 3OD0A 2XKPA 2R32A 1Z7S2 4NR1A 1LOFA 4GB31 5C6CA 1AHSA 1WCDJ 1R082 1NZCA 2D44A 3RYRA 3VZKA 1WW7A 4PJYA 1WGPA 3H50A 1WD3A 3RNSA 2HWF3 4A7KA 3ASIA 3PNAA 4YM1A 4O9EA 2JG8A 5K8SA 4LUKA 4OFGA 1EPZA 3KCYA 1RJ7A 3UV9A 3W58A 4YVSB 4YM2A 1CGPA 2XLGA 4BQ1A 1HW5A 4FT8A 4EN0A 4NHKA 1RITA 4LBLA 1NE6A 3WQ1A 2HWF1 3NKTA 4P9JA 1REDA 2LTNA 2XLAA 3VBHA 1LEDA 2I45A 2GN3A 2P3KA 2WSVA 4Q8KA 5H9QA 1O5LA 4M3CE 4QGLA 3LA7A 4YZ5A 1AX2A 3VBRB 5J09A 1OPMA 5FMOL 5GLUA 3ZN6A 3SH3A 5I93A 4FPGA 2WINB 1VB2A 4PBPA 4WM8C 3D5OA 4W6XA 1X7NA 4LHLA 5AC92 3WG3A 4LHKA 4YZ3A 1HDKA 1H1MA 1YJLA 5H9SA 4Y1VA 4FVVA 1IHMA 2GN7A 4LA3A 4OHYA 5J3UA 1O91A 4UBHA 1QXRA 3AP9A 1RJ8A 1DGLA 1FNZA 3MW4A 1ZBE3 1UMZA 2XL7A 1O5UA 1C4RA 4Y20A 4P9WA 3S0MA 3K51A 4E4SA 4CTEA 1MQTB 1QF3A 1DQ5A 2D6NA 4JC1A 2VULA 2BPA2 3SMHA 1QOTA 2ZGRA 3U07A 1XXNA 1TME3 1YHFA 2PHXA 3B5LB 4CDUC 5I0UA 4C1XA 4YW1A 5C9AC 1ZBE1 2JKBA 5LEKA 2ET1A 1WCSA 4IQPA 4LBQB 1Q8OA 3JQXA 4HVRA 1R1ZA 2PA7A 2R063 1RUH2 2WT2A 4YM3A 3FBYA 1N1VA 1DGWX 1TME1 5ACA1 4HZFA 1ENQA 4N90A 4QQPA 2WNUA 1XNCA 4XXAA 1EAH3 4JGZB 2R071 2XHKA 2WA4A 5A32B 4IEVA 2VW2A 4NWWA 4AEJA 4JVAA 4NWVA 1O4YA 4M3CA 4B3NA 2PELA 2UY9A 1RUC3 3L2YA 3I7DA 2YGLA 4MZUA 4AI8A 2R061 2PAKA 2DWRA 1FXZA 1UF2C 2GMPA 2HWB2 4Z07A 2PYTA 3NAPA 4I2OA 2QDNA 2ZZJA 4WVMA 2W52A 3ZVXA 3JUUA 1IQAA 4CEWB 3FX3A 2Z42A 4ATEA 1WLCA 2WZR1 1ULCA 2BFUL 4N43B 2P37A 4AQ6A 2CGPA 1AR72 4IETA 1RUC1 1UKRA 1DZRA 1VLNA 3WW3A 2UURA 2F6BA 3VLBB 3O5SA 2CWSA 1HV0A 1QMJA 5GLTA 2Z79A 4QPGA 2VH9A 3IKWA 4CDXC 4AEDB 2TUNA 1W6OA 2A6VA 3ZFGC 2H0VA 4FBFA 1BYHA 1ULFA 1LU1A 2PAEA 2ZHNA 3VHNA 1HRV2 5H9RA 1C8M3 2D5FA 2YZ4A 1OQDA 4Q4V1 5I8SA 2D97A 4YVWB 2NMOA 1DGRA 4L2NA 4RHV1 2D43A 1KFXL 4AGGA 4Z82A 1CR7A 3WZ1A 2O1QA 1F8VA 5BNOC 5DXDA 1H9PA 2X29A 3GZTB 1FOD3 4OZXA 2DURA 3RQ0A 4L11A 2IXCA 2DU0A 1C8M1 3V65A 3FFQA 1R093 5BNPC 2BVBA 3V0BB 1OPOA 3B69A 1RUD2 3UK9A 4XDQA 1AYN3 1VR3A 3KLSA 5JVVA 2PN5A 1AXKA 4JRAA 1A6CA 3UL2A 1FOD1 3IN9A 4CRQA 2EXJA 4OHVA 1YIFA 4FOWA 3ZFEC 1RHI3 1ZZ7A 4NHMA 1MEC2 4E9KA 4A3XA 1MS4A 3N7KA 3WDTA 1K5MC 2DUOA 4JDNA 1V6MA 1GZWB 5FOJB 2JX9A 1CAWA 1BMV1 3RWNA 2YMZA 3HIFA 1H2KA 4EN8B 2DVAA 3WR0A 3JD72 1W6QB 4GH4A 1CONA 2ZAHA 1RHI1 1POV3 3M4FA 1R1A2 2VMGA 3VBRA 4F8AA 2CWMA 1Z7S3 4N53C 1G7YA 4XIKA 4AHZA 2D6KA 1HV1A 1G9FA 3LCPA 2FQPA 4JGYC 3PMSA 1Y9QA 2G4IA 4FPYA 5T50A 4ZXKA 1NCRB 4GIQA 4Q4W1 5BNQA 3L9JT 2XJSA 1TNFA 1MS9A 2XLFA 2XJVA 5AVPA 3VZNA 4YGBA 3OGJA 2RM22 4BZ4A 2AUYA 5EWSA 4YGCA 4AK3A 1LTEA 1ZZ9A 1ULDA 1URXA 2ETEA 4FP3A 1Z7S1 5JR7B 4K6BA 4RS5B 1R081 1J59A 2NP0A 2Q0AA 3LSEA 1CAXA 4YGDA 1O3RA 2XG3A 4BMBA 1QH6A 4CEYA 5CFCC 1Z0HA 4E2SA 3J26N 1S2BA 5KXEA 3VBSB 4AG4A 1DF0A 4HT1T 2XVKA 2XBO2 1XNKA 3ROUA 1V6JA 1DQ2A 4Q0QA 4C91A 5FLHA 3AKQA 5DG2A 3IM0A 1LENA 1PHMA 1X8EA 2MPFA 3WV6A 4ES9A 1CPMA 2RMU2 2NN8A 1OD5A 1VBC2 1MS3A 4XMAA 2JENA 4JTOA 3ZSJA 3VBOC 4JGZA 2IXHA 1QKQA 2P17A 3MIHA 4P14A 1AJOA 1DHKB 4LE4A 4G9SB 4J1XA 1RUG2 1Y43B 3J8F2 1PMIA 2JICA 5AC91 3VL8A 3LA3A 1B35C 1PIV2 2B46X 1COV2 2OIIA 1FMD2 4FOYA 3H1WA 1MS1A 4CEWA 1VIWB 5CU1A 5GLVA 1VBE2 2GALA 4S2FA 2K9ZA 4WV8A 4AGVA 5FCCA 4YW5A 5JI7A 1NYWA 4YLZA 3GNEA 1SFNA 3SHRA 2YDEA 5EV7A 2ZX4A 2H6BA 4QU2A 3IDCB 1ZZ8A 3ZYRA 5FOBB 1RUH3 1LULA 2VW1A 4ZU7A 4DY3A 4HN1A 2WNVB 3ME2A 4M0NA 1BBT2 3ZSEA 2QDRA 5CG8A 1PO12 1Q3EA 4IV1B 4AHYA 5C4WB 3X29B 5GM0A 1YRZA 4FQ4A 3MI8A 3FLRA 1O3SA 5FO9B 3VKOA 2MNGA 3VZJA 4DRRA 3AYAA 5FBZA 1RMU3 2IFRA 5D8AA 4I01A 1KDMA 5I8TA 1RUH1 3BB6A 3AM2A 4IEPA 1PGW2 2A3WA 2E53A 2P34A 4G3YC 4M00A 4JAAA 3E6CC 5CFDC 4RL7A 1REEA 4RGGA 4GKYA 5BNNC 3MDPA 1N1YA 2E51A 4KG0A 4MGZE 1ZX5A 2QFEA 4CDWC 1WBLA 3OBTA 2PFWA 1AR73 3MF6A 3ACLA 1ENXA 2DVBA 4BLJA 4LLOA 2DCKA 4QM8A 3E6DA 1QJY2 5C8CB 2ZGLA 4AEMA 2HWB1 2VY0A 3E5UA 4YNIA 1FV2A 3MIDA 3RYPA 4R8HA 5K0UB 1HRV3 1AL22 4QQHA 1QXJA 1AR71 1U5ZA 3OF1A 1HXS2 1PGSA 3U10A 3VHPA 5L36A 1NQJA 4Q4X2 3DL3A 3M2MA 3AP7A 1AR92 3V0AB 1C8NA 2Y0OA 3H1YA 1IZ3A 1W6PB 3APBA 2R042 3QACA 4SLIA 3AP4A 2CV6A 2GZWA 4AEKA 4W6YA 4XFAA 2NPIA 4XIOA 4AF9A 5HXVA 4DPNA 1HRV1 4AVTA 3ZFFB 3JBG2 2YYOA 2FZ2A 5DG1A 3AFKA 2E7AA 4Q1RA 3WHUA 1NY72 1Q8VA 3KM5A 3MW2A 1ND2C 3ST7A 2EAKA 5L19A 5LRSA 2A5ZA 5JSPA 2VW0A 1A8DA 4KGGA 1YJKA 2D6LX 3FUQA 2VUJA 2CGOA 1OQEA 2WWSA 5KHIA 2PHWA 2A6XA 4L9BA 1EV12 1MEC3 2FMYA 3NWKA 5FLIA 4PF5A 4I0WB 2R0HA 3LSDA 3JCIA 2EXHA 4XJZA 1RUD1 3FC0A 1D2SA 1APNA 4K40A 4MXWB 3VBSA 1AR62 5J98B 3JD73 2BVVA 3AZZA 1AX1A 5CAZA 3LAGA 1MEC1 1XE8A 5DZEA 1LOAA 5L73A 1JOJA 1LGNA 2ATFA 1VBA2 3CJIC 1N3PA 1WLWA 4PBOA 4E2QA 4FPHA 1U5IA 2DVFA 4PIXA 4Y5Z0 4FO9A 3D0JA 3DUIA 1GNZA 5L7OA 1TMF2 3JD71 3QCWA 4WM8B 4XE9A 4SBVA 2V73A 4Y1ZA 1WD4A 4YZ1A 3MLJA 5GJ6A 1PZ8A 1R1A1 1LOCA 1YFYA 5A3MA 1CAVB 4XF0A 2JE9A 3R05A 3KS7A 4Z1VA 2RS52 4X8PA 3G6JB 2E63A 4QXKA 2X5IC 3UKTA 3ZXJA 3E6BA 1GV9A 3LWCA 4OUSA 1VBB2 3ATGA 1S0JA 1AZDA 5E8AA 2WT0A 1G6NA 2JD4A 3VDDC 1PK6C 2X53S 3WP3A 1S0DA 2RM21 5JSRA 3WXPA 1XYNA 5ABJC 1Q8PA 2XWJB 4QPIA 2QZ3A 2DCTA 2WS92 1SACA 2IXLA 2PQQA 5T5OA 2BNMA 4CDUB 4PLMA 2D6MA 3D82A 4B4QA 3NJZA 3A4UA 4IEWA 1DQ4A 5C9AB 4I0AA 1VBC3 2EAAA 2WNVA 2KA3A 5EXOA 1H2LA 3WP4A 3KGLA 4A7ZA 2FHRA 5BV6A 2XBO1 4IV1A 1XRUA 3WVJA 3I4IA 3MLLA 5FFOC 4IEOA 1QJX2 5CADA 2R0FA 1ZBA2 4TZDA 1U12A 4F7ZA 3ILNA 4WM7C 1OHFA 2A75A 3H9AA 3OY8A 4MH0E 3UJQA 2YPJA 5C8WA 2VU9A 4PDWC 1X36A 5F5QA 4AE2A 2DUPA 2HWE2 2RMU1 2A6YA 1PIV3 1VBC1 4CDQC 3ZXLA 4AFCA 1ZYBA 1FPN2 1AL0G 1LOEA 4L8QA 4PCRA 4OLLA 1RTVA 2JEMA 4Y24A 3ZXFA 1RUF2 1TE1B 1JHNA 2JG9A 1DQ6A 2ZACA 4Q4Y2 1RUG1 5AFBA 2UY8A 3J8F1 4OULA 2VG9A 4LO6B 4RSUA 2CTVA 4YGEA 4BM8A 5GALA 2I07B 5A33B 3GZAA 4AQSA 3EQEA 1RUJ2 1PIV1 2HWD2 1I3HA 5KHHA 1COV1 1FMD1 4KGQA 1H4HA 2HYKA 4RFT0 4B29A 1VBE1 3VKMA 2G9GA 4EV0A 2VGDA 1C5IA 4OI0A 5KWRA 3ZYIB 1ZRRA 3WDUA 1IPKA 4CDXB 1GQHA 1PVC2 2XVLA 3ZFGB 4FTSA 1GNHA 1X50A 1KS4A 1LJ7A 4CYDA 4RQPB 1VB4A 3AP5A 2A6ZA 3WUCA 4B7EA 1W6PA 1OFSA 3PTYA 1BBT1 1DGRN 2DVDA 4LUMA 4RGAA 1ENSA 1PO11 1HX6A 2HWC2 3DF0A 4BHPA 4AFMA 1ASJ2 1XU1A 3PMEA 1MR5A 5BNOB 2FBEA 2XWBB 4IXLA 3WINE 1SBFA 4B8EA 4TLFA 3SCFA 3PVBB 2WQZC 1QJY3 2GAUA 2GDFA 3J4UH 3PLQA 3VBUC 1ZM1A 3FLTA 2XH6A 1PGW1 3ZYGA 2RJLA 1F5JA 2R30A 5LK7B 3IMNA 5BNPB 1MZ5A 3WDXA 3WLUA 1NCQB 1O4TA 1V70A 2JG8C 3AYDA 2D98A 1AL23 2DFCA 3C3VA 2EIGA 1ND3A 2ZZQA 2GC2A 1HXS3 4MYEA 1BK1A 1QJY1 2NM1A 3ZFEB 4Q4X3 4HFSA 3WD5A 4Z2WA 4X6RB 2E7QA 5HCBA 2WZPP 4DY5A 1KITA 1ULGA 1OOPA 2R043 2VOWA 1K5MB 1IS4A 4FPLA 1TQ5A 4QM9A 2KM2A 3VBFA 1C1FA 2IWGB 1W2UA 4QGNA 3VZOA 1KS5A 3VBHC 1AL21 3U11A 3JBG3 2ES3A 1QGLA 3INAA 1HXS1 2B45X 4H14A 3SNMA 3H7JA 4AI3A 3EXUA 1OLQA 3MICA 4KQ7A 4Q4X1 1E57A 1AR91 4N7UA 5KC5A 1AJKA 4DQAA 1BEV2 2UYBA 2R041 3O14A 1VBD2 3VL9A 2Y38A 1IS5A 1WCKA 3AKPA 4IV3C 4JGYB 4AGRA 1C5HA 2GSYA 3IDEA 4BE3A 1EV13 5B2GB 1OA4A 2BNNA 1CAVA 2FMDA 2CGNA 2VQAA 3HT1A 2Y26A 3JBG1 5IK7A 3MW3A 4FAHA 1NY71 2ZGNA 4BCUA 4TWTA 1NQDA 3N7JA 2R16A 1G9DA 3R4SA 4H3WA 4I09A 1F31A 4UXAA 3KT1A 3ZDSA 5ACA3 2VNOA 1UD1A 3KQRA 3MIBA 4XW3A 1NLRA 3D8CA 4MGIE 3S6PA 1AR63 4JQRA 4C0HA 2R073 1D0GA 4XZPA 1EV11 3CLPA 5CFCB 5K9YA 1VBA3 3ZYJB 2VVDA 2VQ0A 2WIIB 2KXLA 2ZHMA 3KZ4C 5C9AA 3WW2A 5FMOS 3M70A 5JAXA 3MIGA 1AR61 1TMF3 2PLV2 3AFGA 4R9AA 4HL0A 2WZR3 1H8TC 3WCRA 2DVGA 3A0NA 3BODA 5GZEA 3UJOA 3THPA 5KXBA 2WNUC 2YUEA 1VBA1 3P3NA 1HQWA 2RS53 1O7FA 1FT9A 3VBOB 5F6KA 3MIEA 4GMP1 3QH6A 2WSUA 3H3UA 1LHOA 5T3NA 5IUQA 4RA0A 1KRIA 1WW5A 1TMF1 4AFAA 1V6OA 3M3IA 1B35B 1QOSA 4R4ZA 4Q4V3 3FJSA 4Y1XA 3S7EA 4MVTA 3LOIA 2WS93 5FPXA 5JZGC 5LEJA 1G86A 2RS51 4RHV3 2BQPA 2A3YA 1XE7A 1BKZA 4FP2A 1YFXA 3AMQA 3RSJA 1B09A 1ZNPA 1VBB1 2HEVF 1H9WA 1LU2A 3VGIA 1WMDA 2Z5WA 4XTMA 3POSA 4QPGC 1AXZA 5JIAA 2H6CA 4AFDA 3ZN5A 1QJX3 1J1LA 2QCSB 2WS91 4KWLA 3S7IA 2I74A 1D4M2 4ASMB 5D1IA 2K2SA 1AF9A 3AZYA 3H8UA