3CO2A

Mlotik1 ion channel cyclic-nucleotide binding domain mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
GDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPWSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Energetic Analysis of Activation by a Cyclic Nucleotide Binding Domain.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
molecule keywords Mlotik1 ion channel protein
total genus 26
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3co2A00
3KMHA 1ZZ9A 5J48A 1RTVA 4BIFA 2GH2A 3O14A 1NYWA 4QGMA 4IEXA 4XFAA 2MPFA 5FLJA 2IXJA 4KU7A 3USSA 1WGPA 4Q0PA 5C6CA 3QACA 2B9UA 2IC1A 3WW2A 4HSLA 4PIXA 2Q1ZB 1QY4A 4Z07A 3E5XA 2OA2A 2CV6A 4XFCA 3HT2A 4QMAA 2C0ZA 1Q5OA 4IEOA 2BNMA 4Q0UA 1J3QA 3N4MA 5LEKA 4LEJA 3DV8A 3BALA 3MYXA 1J1LA 4QGNA 2XL7A 3E6DA 3H8UA 4AQ2A 3DL3A 5FQ0B 4ZU5A 4XFHA 2VECA 1LKNA 2XL9A 1NXMA 2OYZA 2Q30A 4YRDA 2Z69A 2D5HA 3EJKA 3M70A 4EWAA 5KHJA 3C3VA 1UW8A 5CADA 4I02A 1NE6A 3LZZA 3OTFA 4FBFA 1IPKA 1GQGA 2D5FA 4LUMA 5FLIA 3IIAA 4FAGA 1UD1A 2GC0A 1ZVFA 2ET7A 4XF0A 2HJIA 1CAWA 1OD5A 3WW3A 2BGCA 2MNGA 2PYTA 3EQEA 3PLQA 4XFIA 3NJZA 1LRHA 3L2HA 4LUKA 1X8MA 1Q43A 2BYVE 2PHLA 3KCCA 4XF1A 1PMIA 3ROUA 4WBBA 1O3QA 3SMHA 1CX4A 4KWLA 5JR7B 3LAGA 3H7JA 2B8MA 5D1IA 3GBFA 2K0GA 3SHRA 4KL1A 3PNAA 2UYBA 5LEJA 1YFWA 4MZUA 2WFPA 3BPZA 4LULA 3S0MA 4XFGA 3LWCA 4MH0E 3E97A 4MX3A 3D82A 4YSFA 4Z82A 1Y9QA 1WLTA 4Q0SA 1NE4A 1V70A 2PAKA 4R52A 3H9AA 2BNNA 2CAVA 3OGJA 5CVRA 2OPKA 2UYAA 4N9HA 5BV6A 1ZRDA 2ETEA 1J3RA 3BB6A 1YFXA 2GC2A 3MDPA 4EROA 3NKTA 4N9IA 3E5UA 4WZCA 4QM8A 4BYYA 3HIFA 1YWKA 4BH9A 3E6CC 5JCTA 5EZWA 5T3NA 1O3SA 1J58A 2XLFA 4XF9A 1RL3A 4IEUA 3IWZA 4UBHA 4MGYE 5I8YA 2Z2SB 5I8TA 2IXCA 5I0UA 1VJ2A 2F4PA 1ZZ7A 4MGKE 4R8HA 5JSRA 1UPIA 2UY8A 3FZ3A 3QOPA 4L2NA 1XRUA 2QCSB 3E6BA 3SCHA 4BHPA 1ZRRA 2D93A 2Q0AA 3UKVA 4HVRA 3B02A 4PJYA 1IPJA 1GQHA 1FI2A 5E1RA 5K8SA 3LA2A 4B29A 4DINB 2O8QA 4XF4A 4F8AA 2V09A 1EP0A 2PAMA 5FPXA 4LA2A 1QWRA 2GZWA 4WVZA 3SCFA 1ZNPA 1ZX5A 2GC1A 3LA7A 2IXIA 3VHRA 3R6SA 3ACLA 3MZHA 1CAWB 5E16A 4MGZE 4XFFA 1DZTA 1OFNA 2PFWA 3FX3A 1YLLA 2CAUA 1CAUB 3D0SA 1NZCA 4K8FA 4UXAA 5BPXA 1OMIA 1I5ZA 1RUOA 3RYPA 4J1XA 3ELNA 3GYDA 4I3PA 4Q0VA 4JVAA 1O5LA 3RPQA 2P17A 3M3IA 1G6NA 1ZRFA 3NL1A 1YFUA 1L3JA 4P9GA 2BEOA 2QDRA 1QXJA 4HN0A 1YUDA 3BCWA 4IEPA 3ETQA 4AQ6A 3CJXA 1CAVA 4IETA 3DN7A 5HI0A 3H3ZA 4FAHA 5KBFA 2GC3A 3NW4A 2O1QA 3ES1A 2PAEA 1Q3EA 4IESA 1O7FA 1WA4A 1CAXB 4X6QB 5LRSA 4YNIA 2ZKLA 1ZRCA 2PA7A 4JTNA 2PHDA 3RNSA 5KHGA 2OZ6A 3LA3A 4Q29A 5KHIA 2EAAA 4EWEA 3KGLA 2HKXA 4AVCA 4IEZA 1SQ4A 1J59A 5JSPA 1EY2A 1Y3TA 3RYRA 1ZZCA 2B5HA 4QGLA 5EFUA 2XGXA 3E5QA 3H3UA 3LOIA 2BNOA 1EPZA 3H1MA 4E2SA 1CAVB 4AVBA 1X82A 4J1WA 2QJVA 1CAUA 3EBRA 1FXZA 1XE7A 4IERA 2XKOA 3UKNA 4IEYA 4I0BA 4O9GA 3S7EA 3WW4A 4MV2A 2VPVA 4F7ZA 5C8WA 3MPBA 1TQ5A 5BY5A 4QX5A 4FT8A 5FDBA 2Y0OA 4HVQA 3SCGA 2IXKA 4JTOA 5LRRA 3EHKA 4UBGA 4ONUA 3H7YA 2QNKA 2MHFA 3OF1A 5J7MA 3D0JA 1XE8A 4KWJA 1UCXA 3I54A 4CYDA 4META 5KHKA 5I91A 5I8SA 2XKPA 5FLHA 3ZDSA 4D7SA 3CEWA 5CU1A 5FQ0A 1OI6A 4HMZA 1ZZ8A 2WC2A 4GULA 5I0SA 3HT1A 1YFYA 4TLFA 5BXXA 3IDCB 2XLAA 5F1RA 1O5UA 4EWDA 1PM7A 4NVPA 1CAXA 4HN1A 1DZRA 2H6BA 3H1WA 3I59B 4D7TA 3RYKA 3WW1A 2IXHA 2QVSB 1LB2A 4HZFA 4OLLA 2I45A 4I2OA 4KU8A 4H7LA 1JUHA 2CGPA 4LTAA 2N7GA 1YHFA 2OZJA 3IDBB 2PQQA 3FE5A 1LR5A 5I0RA 3FJSA 3CO2A 4LLOA 2D40A 3U11A 3TNQA 4PIZA 3CF6E 4ORFA 4HBNA 1ZZBA 3U10A 4X6RB 4AXOA 1QXRA 2FQPA 2H6CA 5BUVA 1H1IA 2KXLA 1CGPA 4XF3A 2DCTA 4I01A 2ATFA 3I7DA 4IEWA 5I93A 4L11A 3SXWA 5J3UA 4YYOA 2VQAA 4E2GA 1VR3A 4XFBA 4A2UA 1O3TA 1J3PA 4HSJA 4PIYA 3G7DA 2PTMA 3FFQA 3RDIA 4QM9A 3I59A 1U12A 4JV4A 4I0AA 1O3RA 3H50A 4YARA 3FWEA 5KHHA 3OCPA 2FMYA 4LA3A 4E2QA 1X8EA 3KSCA 4XEZA 1VP6A 1ZREA 3NSTA 4RD7A 1UIJA 1X7NA 1EYBA 3U0ZA 4I09A 4Q0QA 3EO6A 4MUVA 4XETA 1RUNA 1I6XA 4MGIE 2EVXA 4ZU7A 3FHIB 2K9ZA 4HLTA 1H1MA 4EV0A 3UKTA 1RC6A 1O4TA 2ET1A 1RGSA 2GAUA 2E9QA 5JAXA 4O9EA 2ZCWA 3NVCA 2H0VA 2UY9A 2EA7A 1HW5A 4KWKA 4OFGA 2Q4SA 3OD0A 1UIKA 3ST7A 1SEFA 1SFNA 3IBMA 1ZZ6A 4ZU4A 3TNPB 5I0TA 2IXLA 3DKWA 5FPZA 2XLGA 3S7IA 3ES4A 1FT9A 3JZVA 3PVBB 4IEQA 5FCCA 3HQXA 4HVOA 4IEVA 2XHKA 5JSOA 1DGWA 3KGZA 4AVAA 3CL1A 5AVPA 3CLPA 4QXKA 1DGRA 3RZZA 2GU9A 3H1YA 3BU7A
chains in the Genus database with same CATH superfamily
1Q8OA 4BZ4A 1H2MA 2YG0A 2RMU2 2PHTA 5K0UC 4Y1VA 2ZX0A 4AEDA 1ENXA 1S0BA 2X5IC 1RTVA 5T54A 4BIFA 4QB1A 2J1TA 1EUTA 5EYYA 4CUCA 5JIUA 1OQDA 1AR93 2HEWF 3OGGA 1WLCA 2LS6A 4JGZB 3VHOA 4NE9A 2IXJA 2C4XA 4JHZA 4Q1RA 1DLCA 4RS5B 4YZ3A 1UOFA 2YUEA 3ZFEA 1TME3 1AXZA 4HSLA 2VCCA 2BTVC 4PIXA 2JWPA 2W0XA 2A71A 1LODA 2FDIA 1HDKA 2ZBJA 2E32A 3E5XA 2X10A 4YZ5A 1OKOA 4B7EA 4C91A 4R9AA 3I4IA 1MVQA 2DCKA 4P5HA 4AF9A 4BU2A 1ASJ1 3POSA 2DVGA 3ZPOA 2VZVA 4Q0UA 3M3EA 4IV1C 3HQUA 4CUBA 4LEJA 1PVXA 3BALA 3WDXA 3WG1A 1VB4A 2LUWA 4C8DA 5FOBB 3HJRA 1KXGA 4URAA 2XBO1 1UWWA 1AVBA 5K0UB 2P2KA 2B9VA 2B46X 5FQ0B 3VUOA 2EXJA 1NZIA 4JRLA 1NA1B 2AEZA 2XL9A 4RQPB 3T2OA 2OYZA 1W90A 2VNRA 3HNMA 3ORJA 4N43A 5KHJA 4LT5A 2BBAA 2WNVC 3AXDA 4I02A 1NE6A 1POV0 1SMVA 3BN6A 3LF7A 4YFWA 3VDDA 2D5FA 3O1MA 3LEMA 3PVOA 4E4HA 4C1XA 5DABA 5FY1A 4Q27A 3W5NA 5DG2A 4DRRA 2G1MA 4O65A 2WWSA 1W03A 3H8OA 2NM1A 1OD5A 3J7LA 2PYTA 4N53A 4GH4A 3THDA 5A3OA 1AL0G 3MW3A 5K9YA 1QJU2 4QKDA 5APAA 1RUD2 3OBTA 5IHRA 1RHI3 2G9ZA 5IVBA 2PHLA 1HJGA 1MZEA 2DDUA 1DBNA 2YU1A 1TME1 4CDXB 2WRAA 1VBB3 1JYVA 1HV1A 4DXRA 3LAGA 4AFMA 2B8MA 1L7QA 2AZ5A 2BDRA 2XUEA 3LQCA 2R1DA 3CJIB 1S2EA 5FP3A 3GBFA 1OF3A 3AB0A 3L2YA 3LDKA 5DDJ2 3SHRA 3VHNA 4AHWA 5JOXA 1D4VB 2BQPA 4LBOA 4GWMA 3P3NA 4W6YA 4Z92B 1BKZA 3LSEA 1QJY1 3S0MA 4PF1A 3LWCA 4MH0E 1W6PA 5CKNA 1WLTA 3AVRA 1NE4A 4KGGA 5LBBA 3T0AA 3SISA 2ZEYA 1V70A 3D4KA 3AFGA 1JXNA 2Q8CA 4MYEA 3LCPA 5A70A 1W6MA 4A7YA 2VOKA 2ZMNA 2P6CA 1W8TA 1GQPA 3VL9A 2X8KA 4L9BA 1UZ0A 5A3TA 3DCQA 1X9PA 2YGMA 3LSDA 1F35A 2NMNA 5FZCA 5J1XA 5C9AA 2RDSA 4HONA 2GC2A 2X29A 4EROA 4HK8A 2QQMA 4AI1A 2PHWA 4K1YA 3ZFGC 3O1RA 4BYYA 3OD4A 4DXZA 4ZPIA 2Q8OA 4DQAA 3ZM8A 5T5PA 4GIQA 3HNYM 5HXMA 2JG9A 5ABJA 3WOGA 5T3NA 1J58A 3ZXAC 2XLFA 3B7MA 3FLTA 4RYDA 1GMMA 4V1PA 4FVVA 3ZOIA 4FFFA 1F31A 5L9BA 1FNYA 1FYUA 4YGBA 1JI6A 5FY9A 2DFCA 1GBGA 1O4YA 4IEUA 4HKOA 4JHTA 5LA1A 4MG2A 3LEIA 1V6NA 1XYPA 3HBKA 3IWZA 1N1VA 2P3JA 4UBHA 5A33B 1RUC2 2A3WA 4RHV2 4Q4X3 1X33A 3WV6A 3J8F1 5C9AB 1XU2A 2GP3A 4OI4A 4YM0A 3RMYA 4LBLA 4R8HA 5FYVA 1W6PB 3BGAA 1UPIA 2HYKA 1JYIA 3QOPA 4X8NA 4KG0A 5FUPA 3THTA 5BNOA 1RUJ1 3KZ4C 4BHPA 4CDWB 1ZRRA 2WYSA 3A0NA 2YC0A 3HVDA 3N3HA 3Q8EA 4Q4W2 2PLV3 5DAPA 4E8CA 1QQP2 3B02A 5AVAA 3SEEA 1QQP1 2R32A 1IPJA 1GQHA 5F3CA 2JB4A 3USUA 5D21A 5E1RA 5K8SA 4L99A 1HN1A 2VNVA 2YGLA 2RS52 2Q8DA 4EZ4A 5A1AA 1CJDA 1S0CA 2C24A 3SH3A 3RWKX 2ILMA 1NQJA 3VBOC 2YZ4A 3I2OA 3AKSA 3DXUA 5EXOA 5LWBA 3WNMA 4QX3A 4WVZA 2GZWA 1FV3A 2X5IB 4XCAA 1GP6A 3AX4A 1JHJA 1V6KA 1ZNPA 3SCFA 2WZR2 3O1TA 5T50A 2VZSA 1W6OA 2JDAA 5C70A 5B4NA 5DAQA 4KG8A 4Y22A 5BNNB 4ATFA 1ULOA 1W99A 3HN3A 3JQWA 4KQ7A 4KI5M 3I2JA 1WMDA 2WO1A 5C4WB 3G6JB 1UYXA 3ZX7A 1YLLA 4AI9A 2W3JA 1LOFA 1SPPA 3AYCA 2F17A 3POIA 3O0WA 1VMFA 4A44A 3IZOA 4P00B 4K8FA 4UXAA 3T2PA 1H8TC 4FP3A 1C28A 1NLQA 1I5ZA 5CFDB 2R7EB 5JZGA 2WZPP 2WNEA 5AFEA 4Y4YA 2HWD2 1C8NA 1PNGA 4AVVA 1OA3A 2ZXQA 3QH7A 2WZR1 5J37A 5FMCA 3QLQA 1YFUA 2RMU1 4M3CE 4ARYA 1US2A 3BVCA 5FR3A 3P5BA 4P9GA 1MS3A 1POV3 4GQ7A 1QXJA 1YUDA 1SDDB 4W8JA 4LOTA 1C1FA 2DVDA 3GM8A 4IEPA 5A32B 2XPJA 1UMIA 5LY1A 2WJSA 4IETA 2A6ZA 2YFZA 5KBFA 3NW4A 2O1QA 2K2SA 3NWKA 3WY6A 4A3XA 4G3YC 2HEVF 4IESA 2VMIA 5IK7A 4C0BA 5C8CC 1DQ1A 4X6QB 1DGLA 1PK6B 1VBA1 2CDOA 3NV2A 5DAXA 1UZVA 5FP8A 3WLUA 5F7UA 4N7UA 2PMWB 2QDNA 2UURA 2ZKLA 3SKJE 3W58A 1AF9A 1OURA 2W1WA 4JTNA 4IV1A 4YM3A 1ZYBA 3MICA 2OZ6A 3LA3A 5KHIA 3MUY1 4XDOA 1K3IA 3NAPA 1JZ7A 1OH4A 3KGLA 1Y4WA 3CU7A 4WM8B 4WVMA 1J59A 1UAIA 5EJZB 4W65A 5FYZA 3RYRA 1ZZCA 4GH4C 3VD9A 4QX2A 2ZEXA 1HB1A 1RHI2 4QGLA 3VBFC 5BNPC 1D0GA 2AGSA 3JB8A 2XGXA 3A21A 3KQRA 3AK0A 1GZ9A 2BNOA 3NKGA 3H1MA 3FL7A 3R4DB 1JU3A 4AVBA 2WAOA 2B4KA 3OY8A 1CAUA 1VRH1 2WN2A 1JOPA 1FXZA 1XE7A 5FRAA 1OT5A 1IKQA 5FY4A 5T5LA 1WZXA 1MZ6A 2XKOA 2R063 3J7MA 1NKGA 2ZX3A 1FV2A 3S7EA 1XNDA 2VPVA 3C8XA 2OXBA 3AMMA 4KBZA 2G19A 1GOHA 1PZ7A 1RUG3 4NIDA 3HPNA 3VBUA 1QJU1 2J1SA 4ZONA 4XXPA 4NIIA 5BY5A 1S0GA 1CGPA 1KD7A 2Y0OA 3WSOA 3EMRA 1E5SA 4LQRA 1EV13 3SCGA 4JTOA 3J8F2 4AFAA 2FZ2A 5C33A 3EHKA 3VBOB 3BIWE 3H7YA 1MEC1 3U78A 1RUD3 4L8QA 1GV9A 3UT0A 4OI1A 2R16A 4C90A 1TMF2 1RUI1 4Y26A 1XE8A 5K7PA 1RB8G 5LA9A 3I54A 2RM21 4CYDA 4META 2B7YA 1X36A 1D4M3 5I91A 4XABA 1GKBA 5FLHA 4CCMA 4Q8KA 4MGSA 5M0TA 2QZ2A 3EXUA 4HPKA 1OI6A 4AW7A 4S2GA 4LLFA 1UMZA 3I3MA 2WC2A 2WS93 2Y64A 2A3YA 3WCRA 1AX1A 3WDUA 3WF3A 3U4SA 1COV2 4YGCA 3HT1A 3SH4A 1M06G 3K3NA 2DVBA 4TLFA 1TNRA 2XLAA 5F5IA 3C2UA 4UT5A 5FYHA 1MPXA 4AI3A 1RMU2 1DQ6A 1K5MB 4QPIC 5FK7A 1C8M2 4CU8A 2QZ3A 2R041 1JZ2A 2ZHNA 5FPVA 4GAZA 2D3PA 2DVAA 5FFOC 4NHKA 1HLCA 4CE8A 4PDWA 5LB6A 4ZKTB 3T30A 3WW1A 1YIPA 1XPWA 4H55A 4EN8B 1LB2A 3ZXJA 1JZ8A 4GALA 3WG3A 4YG3A 1UY3A 4Y3OA 4HZFA 4OLLA 4FFGA 3PJYA 1NCRA 1IZ3A 4H7LA 2VOTA 4BM8A 4I2OA 2DUPA 1JUHA 2DU0A 2RS11 3VD5A 5L19A 2CGPA 3AP5A 2WYFA 3AM2A 3IDBB 3OPWA 3FE5A 1AR63 2DV9A 1URXA 3FJSA 3WF0A 5DZEA 2BUKA 3OOXA 5A7QA 2D40A 4CCJA 1QJU3 2QQLA 3IMMA 2NQYA 4IV3B 2HWD1 3LGRA 3OSDA 3PIJA 4QU1A 2XJRA 5CB7A 1RJ8A 2HWF2 4HBNA 3AC0A 1ULEA 1MQTA 1BK0A 2ZGQA 4QU2A 2W9XA 4XIKA 2BFUS 4XUNA 1QXRA 3GZAA 4DNYA 4OHXA 3TN91 5EV7A 4YW6A 4MXWA 1H1IA 4RHV1 3WDYA 5FMOS 2KXLA 2OIIA 4FTBA 1RUI3 2H0BA 3HR9A 4I01A 4ITCA 2VW0A 4UWDA 4XIOA 1IGOA 5DZFA 2P3IA 4JCKA 1QMJA 1S55A 3I7DA 1LNSA 2WUHA 4XQ4A 3WVJA 5F9TA 1QDCA 3ZSMA 5FPUA 1UY2A 1VR3A 2WNVB 1WMFA 3J9SA 2I2SA 4QXCA 1W39A 5CKQA 5DAVA 1G9FA 1MR5A 3CJIC 4OULA 3O1OA 4YVSA 2HWC2 2PHRA 3AP7A 3O0XA 4PIYA 4CEYB 5CFCA 1LOFC 5JXHA 5GZGA 3F95A 3OUHA 1BQPA 3RDIA 2VBBA 2WL1A 3J26N 4LHLA 4YW3A 1U12A 3DGTA 3H50A 3W21A 1QJX2 4LBJA 1Q56A 5KHHA 2FMYA 4E2QA 1X8EA 1QH6A 1U0AA 3HBZA 4PQQA 4EJRA 2WZR3 1FPN2 1VP6A 5FYUA 4ZZ8A 1UIJA 4PT6A 2A75A 5JZGB 4QQLA 4EYUA 1FPN3 2BGOA 3IDEA 4XETA 3GXUA 5IJRA 3I3BA 5A7NA 5T52A 3V64A 1ND2A 5J98B 1F15A 2FDJA 2YC4A 3CZUA 2EVXA 2CGOA 1DYKA 2BGPA 4HLTA 5FK8A 2NPIA 1BLZA 1H1MA 5FZHA 4COWA 5IW0A 1AR61 2WR9A 2CGNA 1LGBA 5FZ3A 2HWB1 1QNYA 4ET7A 3P6BA 3KCYA 4K40A 1TEIA 3WQBA 4COVA 1KJRA 2PHUA 2WIIB 1KDKA 1PM4A 1W8ZA 2V72A 3NVCA 1COV1 1QJX1 1XSQA 4V2WA 1AYN2 2QBXA 2R49A 2UY9A 3DYOA 1I3HA 3N9LA 3K3OA 2HBUA 1I1EA 4OFGA 4GH4B 1UKGA 4DZGA 5GALA 2D3SA 5FPAA 3OBZA 4KBBA 1ZZ6A 3BUCA 4NRQA 1DDLA 4K8RB 4DY5A 4RSUA 1DGRN 3KS7A 5HCBA 3JB4C 3BI3A 1RUF1 3IMNA 1QQP3 1YXWA 1DF0A 2XONA 5DUVA 1SLCA 1GWMA 4P9YA 3ES4A 3UJOA 1HJFA 5FCCA 2HWE2 3N9QA 5FZKA 2XHKA 1DGWA 1JOJA 1ONAA 4UFJA 2FHRA 5FWJA 1SLLA 5AVPA 1MS0A 2CL2A 2PN5A 1NCQA 4QXKA 3W9AA 2WLPA 2VMHA 3BOWA 4LBQB 4XJZA 4YVWC 5BNQA 3BPSA 3LE0A 1MQTC 4JGZC 3ILFA 4E4DX 4P9JA 3ZFFA 1W9TA 3BU7A 1Z78A 5FYIA 1H6XA 3KMHA 4GWJA 1GNZA 2O14A 5KC5A 1A34A 1AUYA 2E7TA 1OA2A 2GH2A 2PELA 2JICA 3O14A 4QHBA 1IS6A 1NYWA 1AL22 2D6LX 4QGMA 4SLIA 4B7KA 5KXDA 4E8DA 4IEXA 1SCSA 3TWIA 3ZDVA 3I2GA 4OQ8A 5CA6A 4KU7A 3USSA 3I2HA 1WGPA 2RDQA 4Q0PA 1UY1A 1ENRA 5B4XA 2B9UA 2IC1A 4L92A 1STMA 3TAYA 1ZM1A 1E57A 3B9IA 3AMQA 1RUJ2 5CKMA 1GZWB 1YEWA 5F2SA 4CEYC 2ARAA 1C4RA 3HAGA 1SBDA 1B35A 1QHDA 2WO3A 1QY4A 5C8CA 3SKVA 4CVUA 1WBLA 3VBHA 4W6WA 4C0HA 1PGL2 2RR11 4K9SA 4XTPA 3VN4A 4XFCA 3WNOA 1PO22 4JQRA 5FZ9A 5FO7B 1H2LA 1SFPA 1Q5OA 2GN3A 3LDBA 3UGHA 3S57A 2A7AA 4QDSA 4DS0A 3NAPC 5LEKA 4ASMB 2VW1A 2JKXA 3MYXA 3NNFA 4LO5B 2IUWA 1EUUA 1ZBE1 2XL7A 4NRPA 3KQ4B 4OUSA 4XQDA 2WA3A 1J1TA 1NCQB 1ULPA 2XJTA 3KT7A 3DL3A 1RUF3 4ZU5A 2ADDA 5F6LB 1UXXX 5FIXA 1V6JA 5SV5A 4LNVA 1LKNA 2W52A 1NXMA 1S0EA 2R073 4DXTA 5J96B 2Q30A 1NXD1 2RS32 2Z69A 4B3NA 2WNUB 3AKPA 2QQKA 2NYYA 1UW8A 4BQ1A 1NUKA 5GLZA 1QOOA 3OTFA 5A6ZA 1IPKA 1RJ7A 2BVBA 2VQTA 1GQGA 5C3RA 4LUMA 2WNOA 1LGCA 4FAGA 1LENA 1UD1A 2GC0A 2OUHA 5BNOB 5KWRA 1OD3A 4WZFA 4DIQA 2JDKA 1UY0A 1CPNA 4RR3C 1DHKB 2NN8A 1VBC1 4HK9A 3K75B 5IK8A 4CCNA 1UOGA 3U37A 1AR92 5FPBA 1PIV1 2Q8EA 1RXGA 4FOQA 5IFPA 4S2HA 4ZS2A 1VBD1 2A6VA 2EXKA 3L2HA 3RFRA 3C7GA 4LMFA 4AHYA 5FBZA 1Q43A 2BYVE 2EAKA 4NHYA 1N3PA 3ETPA 1O3QA 4KWLA 2JX9A 2A70A 3RS6A 4LHNA 3VZKA 2A73B 1KFXL 1F9KA 4LBNA 4ISRA 1DU3D 4EN0A 3N9OA 1Y9MA 4GB32 5LEJA 5FZEA 1H6YA 1SBFA 1UYPA 2WNUC 2WKKA 3KF5A 3I97A 5FZLA 1HXS2 1FMD3 1OOPB 3ACFA 2WS92 4ZY9A 2KM2A 2GDFA 1FOD3 4LULA 1Z7S3 2YFUA 3E97A 4MX3A 4YSFA 3NQHA 4Z82A 2VTXA 5DG1A 1B35C 2FCUA 2OVUA 1WWYA 3GBWA 4BQYA 4ASLA 5HXVA 3NNMA 3JD72 3ZYGA 3MO4A 1GZTA 4GWIA 1C5IA 3H9AA 5IYYA 2BZDA 2BNNA 4GJZA 2CAVA 1RINA 2YDEA 2Z79A 4GKXA 4ASKA 1D2QA 1YYNA 1DGWX 5G04L 2W87A 2WFF3 3PJQA 1HQWA 1CJPA 4JDMA 5K0UA 5T55A 1ZRDA 3MIDA 3CIHA 4YM1A 3TN92 3PUQA 4OCTA 1J3RA 1QF3A 1DFQA 2VZRA 4G9SB 4LITA 1WCSA 3HOBA 2XHNA 3LPGA 3FLRA 4UFHA 3TRSB 4WZCA 5HCAA 1OLMA 1OOPC 4GD4A 3OPZA 3WF1A 4NHXA 1YWKA 2VUCA 3OBAA 4BH9A 2D6OX 4Y1YA 3POBA 2E7QA 5EZWA 5A1FA 1GFF2 2YB7A 4D69A 3ZXEA 3VDBA 2XJUA 3RJ2X 4RGAA 1FX5A 5F3IA 4Y33A 1LGNA 1TNFA 4XF9A 3RRDA 1RL3A 2EXHA 2LTNA 2IVIB 1UOJA 2R6QA 4AEDC 2ZHMA 4BOWA 5IVCA 4TTGA 1XE0A 5FZOA 1RUH1 4MGYE 5I8YA 2Y6JA 4FPGA 1QJX3 2HWD3 2WT0A 2CYFA 2IXCA 3T3YA 2JG8C 1H8VA 3ZXKA 1VJ2A 2F4PA 1ZZ7A 1WMXA 3UK9A 3EYPA 3RI8A 4NIGA 2CHHA 3MF6A 1OVPA 1RUF2 3FZ3A 1U5XA 4DO0A 1XRUA 3HD8B 4OMCA 1WKYA 5FXZA 2J22A 5KXBA 1CWPA 3Q9OA 2RHPA 4WM7A 3IAQA 3ZFFB 4HVRA 3VBHC 4PJYA 2J1UA 1QIQA 2ZGMA 1FMD1 3ZKUA 3AZYA 3N7JA 2VR4A 2RM22 3T4HB 3LFIA 4PBOA 2G9FA 2ORXA 4H14A 4NOTA 4A6OA 4B29A 2R062 1FOD2 4DINB 1BMV2 1H2NA 4P9LA 1ASJ3 4PHZA 2EIBA 2V09A 2EALA 1BBT1 1QDOA 4BXSV 1GP5A 3M1HA 1JYXA 4XVHA 3PVEA 3S30A 2AC1A 1A3KA 2WFF1 2GC1A 1IS3A 2QE3A 2WBKA 4KGQA 2JKBA 3LA7A 4GA9A 1YO8A 3N7LA 4N7IA 3FMGA 4W6XA 4XJUA 3I8TA 1LOBA 4Y4RA 4NO4A 4CUAA 3PMEA 4TYSA 4XOGA 1ZBA3 4XFFA 1DZTA 1OFNA 2PFWA 3VLBB 3FX3A 1R082 5ABJC 4P08A 4DEQA 4YFZA 2GMPA 5E6HA 3CNAA 3O0VA 5LK5A 4YVWA 3MFAA 2FBEA 3AJYA 2FDGA 5FY7A 5BPXA 1W8FA 2KD7A 1OMIA 1N1SA 2CY6A 1Q8PA 2D44A 5A6QA 1HB4A 1RUH3 1RUC3 1VBC2 3GYDA 1EAH1 4JVAA 4Q0VA 1D7PM 1O5LA 1AZDA 4NHLA 1BMV1 3ECQA 2WINB 4AE2A 4Z1VA 4UF0B 4AEDB 3ABZA 3NL1A 1RUG2 3KV4A 4UW3A 1W6QB 4FQZA 4K3UA 1L3JA 4AHZA 1GR3A 1LAJA 2ZGKA 4DB5A 2QDRA 3NNJA 2OQ6A 2LW8A 4HN0A 1N47A 3OGRA 3WDTA 4TWTA 3T1MA 3BCWA 4OZXA 1W9FA 3U75A 5JLVA 3AZZA 4OHYA 2Z5WA 3CJXA 4AQ6A 1OLQA 1CAVA 5EHDA 2IVJA 3DN7A 3ZVXA 3SEPA 4A7ZA 5HI0A 1VBE3 2ENRA 1Z0HA 4QKFA 1BVP1 3FUQA 2PAEA 2QTWB 3VZNA 2RR12 1W28A 5L9RA 4WM7C 1TE1B 2E26A 3WNNA 5LRSA 2W1QA 5JMCA 1ENQA 2E51A 3FHAA 3B3QE 3T2QA 3UGFA 4AGRA 1ZRCA 2PA7A 4JGYB 2PHDA 2SBAA 1NLRA 2OS2A 1RITA 5CFDA 3RNSA 5LZ6A 1F5JA 2YBKA 3ZSEA 2XJPA 4UYBA 5IFTA 2EAAA 2GMEA 1CPMA 1XNTA 2HKXA 1W9SA 2SLIA 4AVCA 2ARBA 3JCIA 3MLJA 4JX0A 2D6PA 4YZ1A 3V56A 1EY2A 1Y3TA 4IW3A 1UN1A 3V0BB 3LFMA 3POEA 1WLDA 2YY1A 1REDA 4YVSC 4PCRA 3N7MA 4D8MA 3I2IA 5JOWA 2D6KA 4BK5A 4NROA 1J84A 2WLQA 4P9IA 4QDQA 1XB9A 3AKQA 4NRMA 3VKLA 4YZ2A 1SFYA 1W2UA 1EPZA 1X82A 5A7WB 2QJVA 3WQ1A 2WSVA 5JVVA 4OHWA 4CDQA 2GN7A 3C7FA 3MFCA 1LULA 3UKNA 4K1ZA 5FXXA 3WNXA 5C5TA 4I0BA 1KS5A 4O9GA 5C8WA 1Q8VA 3GCXA 4YLZA 5F39A 3VBRA 4B1LA 2Y6GA 4AGGA 3M3CA 3DKQA 1OBNA 2OX0A 3M2MA 3T4VA 4Y5SA 1BXHA 2AREA 2FCVA 5GLVA 4FT8A 2ZZJA 4HVQA 4Q5OA 3D3AA 3M4FA 4C1WA 5K4LA 2C5DA 4KMQA 5LRRA 5BNOC 1B09A 1RUJ3 1JW6A 1RUI2 5F3GA 3K51A 2MHFA 3OF1A 5L73A 1H9PA 2VUDA 4KWJA 1UCXA 1IS4A 1QEXA 1RVF1 1SG3A 4Y1ZA 2XB6C 3HQRA 2BP6A 2JENA 5KHKA 4OHVA 2RR13 3R4SA 1GICA 5I8SA 1S0DA 1YIFA 1PZ9A 4CEWC 1JYCA 2ZJCA 5CU1A 3ZO0B 1W8NA 2YHJA 2ZPXA 3ZFGB 2AUYA 2WO2A 2VJXA 2JIJA 3KM5A 4ZXKA 1HRV1 2MEV1 2ZGPA 3BYWA 2JDMA 2Z4FA 3MLLA 4P14A 1JHNA 4Y1UA 5I0SA 3R0RA 4DUXA 4JGYC 5JOZA 3WINE 3WQ7A 4Z8BA 1G9CA 3T08A 1D0HA 4XQWA 4DEVA 1WW6A 2XWJB 2VMCA 3CMGA 1R092 2QUOA 1O5UA 2VTXJ 3N9PA 2G9GA 2ZGNA 3P1IA 1BCXA 1VBD3 4HN1A 4LBMA 3BTXA 1DZRA 4YZ4A 1RHI1 3H1WA 4D7TA 5H9SA 5BYNA 4Q4W1 1U5IA 3UYJA 4BB3A 3IDAA 4NN0A 1TG7A 2QVSB 1NX9A 4QHZA 4QDRA 2BW8A 1VBE2 2VTFA 1HRI2 1V9U2 3GF6A 5GM0A 5IK5A 1ULGA 2L9LA 2NZ9A 2JD4A 3ALQA 3N36A 4KU8A 5F5CA 5FY8A 4AG4A 4FO9A 1AR72 4AQSA 3BTYA 4Q4V1 1YHFA 2N7GA 2UWCA 3WDWA 4CU9A 4DRVA 1UQXA 5ANQA 1AXKA 1C57A 2PQQA 2VO5A 1YQ5A 4AEJA 1LR5A 3POWA 4YG0A 1KITA 4CDWA 5I0RA 3CO2A 1PGL1 4LLOA 3N35A 5GZDA 3IIIA 3PIGA 1PIV3 2VMDA 2WABA 2RMU3 2ZAHA 1OH3A 2A3XA 3ZN6B 2K46A 3U10A 4X6RB 1KRIA 4D0QA 1POV1 2H6CA 1YQ8A 5A1LA 5J09A 4GMP0 2BJSA 4LBQA 3PHMA 2VZ3A 1PVC2 1RXFA 1CZVA 2XBO3 2ATFA 2Y0IA 3NO8A 4CCDA 5FOJB 1JZ3A 1TMF1 4L11A 4B1MA 1CR7A 3KT4A 4IV3A 4YYOA 4BQXA 4PDWB 2QQPA 4XFBA 4A2UA 1XOYA 4BA6A 4HSJA 3VD3A 1ZBA2 2XVGA 2RS12 1O6UA 1XU1A 4J6GA 1BBT2 2WS91 1QU0A 5H9PA 2PTMA 2EIDA 3PTRB 4BXFA 2CU5A 2EF6A 2C9AA 1ND3C 2WA4A 1BHGA 1UYYA 4XMAA 1LTEA 3SH5A 2FDKA 4JV4A 1O3RA 3HEIA 1F5FA 4YARA 4LHKA 3OCPA 1S2BA 4N53B 1W6OB 4IE5A 3LEGA 3OBRA 4XEZA 2P34A 2KA3A 3H8RA 1VBD2 3Q8AA 1JBCA 3LIGA 3NSTA 4Q4W3 2C9KA 4W50A 5HV0A 4BIOA 3WP5A 1REFA 4QPGC 2J1EA 1ULCA 2D6MA 4CPBD 1NCRB 3RI9A 1RUNA 1X50A 1AR82 1XNBA 2VMFA 2K9ZA 1AR81 2XJQA 3LEKA 2XG3A 2EIEA 4J25A 4JKKA 4EV0A 4OI0A 4AFBA 2ET1A 3I3QA 1V6LA 2VUAA 1LESA 5DN2A 4A41A 2GAUA 1IPSA 1AJKA 5A32A 1PO21 2FMDA 2ERFA 2VVDA 2DUQA 2ES3A 3MV01 2F6BA 4AQTA 1DQ5A 3POFA 4FP2A 5L9VA 4ATEA 5JPMB 2EA7A 1YNAA 2C26A 4LIUA 3T09A 3ACGA 1Q8QA 1UXZA 3NAPB 2Q4SA 1AYM1 1KDMA 1PK6A 2WWJA 3IB3A 3OD0A 3GCWA 2VXJA 3ST7A 3WQ0A 2AR6A 1W8WA 1SEFA 4P02B 3IBMA 2Y33A 3DPRC 3NNLA 4NWWA 3AZXA 4AK3A 1L7RA 2JECA 4QPIA 1LECA 2P3YA 2RM23 3BOPA 3DKWA 4JZRA 1W04A 4AEMA 4RS5A 2W08A 4YW7A 5FPZA 3IPVB 3PDQA 2XLGA 3S7IA 2OT7A 1ZBA1 2RJ2A 2ORZA 1FT9A 4CDUB 4DMIA 2RS53 1NY72 1UYZA 4IEVA 4AVAA 4CP9B 1S1AA 1NCRC 1BBT3 4D6QA 3OG2A 4BLJA 1XJAA 1YJLA 2XXZA 2HYXA 1W6MB 2GU9A 3BTAA 3H1YA 5FMBA 1PGW2 3IKWA 1JOBA 2DTYA 4AFDA 4AAXA 4JAAA 4AZZA 1ZA7A 5JDBA 4O61A 4P9XA 4ES9A 2R043 2P5BA 2GALA 5J48A 4IE0A 4B8EA 3EB7A 4LOSA 2XH6A 4XFAA 3J8F3 1GLHA 3HMYA 1NLSA 1AL21 3K2OA 1WBFA 1S4CA 1FAYA 2ZAAA 3VDDC 2BOIA 3B9CA 3ZYPA 1MS1A 3WW2A 3O1VA 4FPHA 4PLNA 4AR2A 2VMEA 3NV1A 3O1UA 4XZUG 2Q1ZB 4JRAA 2XOMA 2YC2A 2RJKA 5EIYB 3O1SA 4BCUA 3ENRA 2OUJA 4XJ8A 4QPGB 1EAH3 3HT2A 2V4VA 4FPFA 4NMIA 4QMAA 3AL5A 1LEDA 2AENA 5F37A 4A42A 2BNMA 3SNMA 4E4SA 2DURA 3H3LA 1J3QA 4XAAA 5GLWA 1VALA 3DV8A 5LASA 1R091 2Y60A 4RHV3 3K4AA 4HPKB 1Y7BA 4QGNA 1Y9GA 3E6DA 3GDBA 4CPBA 3QH6A 4LHSA 1H4HA 3SLIA 3QBQA 4AQ2A 3ZR5A 4XACA 5FZDA 3VBSB 5LY2A 2VECA 4XJWA 1SBEA 5FZIA 1ENSA 1VAVA 2W91A 3NNGA 3AFKA 1UX6A 2D5HA 3JBG2 1HKDA 1W6NB 3PTYA 3ACIA 4FXGB 3USUB 1CIYA 4GB31 1PO12 4UFKA 5CADA 5DZGA 2JDHA 5J36A 5DUUA 2OQ7A 3LZZA 3ZFEC 1SPPB 1VIWB 1W06A 2GP5A 3ZIXA 4JDNA 1QJEA 4CP1A 1G9DA 5H9QA 2JDUA 3IIAA 1VRH3 5FZGA 1W2TA 5GKAC 4MHUA 4XF0A 3SQOA 4AEKA 2X5IA 1CAWA 3WHUA 3AZWA 1OHFA 1A78A 1G9BA 2HLEA 3EQEA 3PLQA 2ZMLA 3JUUA 4FPYA 4XFIA 4TLGA 4F3JA 3KWVA 1MACA 1LRHA 2J1RA 2ZS6B 3OYWB 2B39A 2TEPA 5B2GB 4GKYA 3KCCA 2DVFA 1TME2 5A6YA 1FPN1 4FXKB 5AC91 2VNGA 1CX4A 1DQ4A 1MEC3 1XNCA 5JR7B 3VZLA 2LM3A 2FD8A 5D1IA 4QXHA 2K0GA 4XC9A 2F4LA 4MVTA 4MXWB 3CQOA 3PNAA 1OKQA 2UYBA 4M4RA 1YFWA 1MS9A 2R1BA 4N8MA 2Y6LA 3BPZA 2DCYA 3GZTB 4BPZA 3KF3A 2BWAA 1WCUA 3B00A 4R4ZA 4XFGA 1ASJ2 1XXNA 3D82A 2BRTA 1OF4A 3RZJA 3RMXA 4Q0SA 1VBA3 2VAUA 4AL9A 1JS9A 1LOEA 3PURA 3POJA 1W9WA 3DUIA 5JXIA 1W6NA 1W2OA 1XYNA 4R52A 3DEMA 4YWAA 1XNKA 3VHPA 2W68A 2LRPA 1MQTB 3PL0A 4LK6A 4BMBA 2IFWA 3WX5A 3OGJA 2DCZA 2IWGB 5JUVA 4YVWB 4LO4B 3DYMA 4COUA 3GALA 4XXAA 3GZUC 4NWVA 3VL8A 2VH9A 4WM8A 4OHZA 2VBDA 1FNZA 3BTZA 2RJLA 1SLIA 2R071 2RS33 3B01A 1XNAA 4A4AA 2YBSA 2W47A 3MDPA 5FY0A 4FTEA 3NKTA 1UU5A 3MIHA 2VL4A 4QX1A 3ZFEB 4LKSA 3NRUA 3VD7A 2ZGTA 5FXVA 3E6CC 4RFRB 2J42A 2Q5TA 1YJKA 2VMGA 1APNA 4RN5A 3ZXDA 3AXEA 2WZ8A 2BVVA 1YI7A 4FPCA 3VBFB 5BNPB 2RG4A 1K45A 2MEV3 3MUZ1 3OJBA 1NA1C 2ZKNA 4V2VA 1C3HA 5E88A 4UI9L 4WV8A 4EE2A 4D3WA 4QPIB 5HBAA 4LKFA 1WW7A 3OUIA 4IGQA 1PNFA 5T5JA 5CG9A 3CDZB 1JU4A 1RUG1 2V73A 2Z2SB 5D2AA 5I8TA 4CCKA 4URTA 3AMHA 5DMYA 4GWNA 5IVFA 1AYN3 5FJKA 3FN9A 1AYM3 5JSRA 1PK6C 1C8M1 2WDBA 4NR1A 1GNYA 2QCSB 2Z42A 2VCAA 3E6BA 1YQ6A 2BERA 4YW2A 3SCHA 2C1FA 3UKVA 4M00A 1CX1A 2GNMA 2PQSA 3D8CA 4RQPA 1NY71 2X09A 1IS5A 2HWC3 3HNBM 1QJFA 4N43C 1QJY2 1FOD1 3I2FA 3LA2A 1SZBA 4Q4V2 3AMNA 5FY5A 2VU9A 5A6XA 1AR62 1ND2C 4D6SA 3K48A 1ND3A 1GSLA 4BQ3A 4XF4A 3TEYA 5FTTC 3MI8A 2PAMA 4LJHA 3UL2A 3WXPA 2WWUA 3THPA 5FPXA 4CXXA 3GJAA 2ZHLA 1QWRA 4LBKA 3W20A 4Y5Z0 5SV8A 1BZWA 1TVGA 1V0AA 1VE0A 5CG8A 4FTSA 3IN9A 3KHBA 4Q8LA 5IVYA 3R6SA 3CKHA 3B69A 3ZFGA 3MPPG 3MZHA 1MEC2 2W95A 1CAWB 1DIWA 1UU4A 3AVSA 2PHXA 3FBYA 2Q1MA 5E16A 1HB3A 4E27A 4MGZE 4N43B 5FBJA 3RSJA 4FSJA 3GNEA 1AL23 5EPAA 3JBG1 3LIHA 4XZPA 2CAUA 4WM7B 3P3PA 2EXIA 3RGBA 2B42B 1UKRA 5FUIA 4R9CA 1N1YA 3RQ0A 3KHCA 1QH7A 3K46A 4XBNA 2XQRA 5CZKA 4BWOA 2WO7A 4PI0A 1RUOA 2HWB3 3INAA 3RYPA 3OB8A 4J1XA 3ELNA 5A3PA 5CAZA 3R4UA 1KFUL 3T2TA 3M3IA 1G6NA 1RMU3 4CUGA 1N3OA 3PUAA 5IAVA 4FPEA 3DPRA 2XUMA 1LHUA 5KC6A 1ND3B 3SITA 3O5SA 4FPJA 1UX7A 2BBVA 3WF2A 3ETQA 2UWAA 3NJXA 1OUXA 3JQXA 1AR83 3H3ZA 4FAHA 2QQUA 2HBTA 1WD4A 3ZYBA 1QOSA 3M7AA 3KB5A 3ES1A 4B4QA 1Q3EA 1G7YA 1QJY3 1O7FA 1WA4A 4Q2FA 4EN6B 5A3LA 1DCSA 4BQ4A 3VBHB 3OYWA 5ABJB 4A3ZA 4CEYA 5CFCB 5FYYA 4INDA 1OXCA 5LATA 3O1PA 3VZJA 4CEWA 4Q4Y3 1PHMA 4DPNA 4QB6A 4MO3M 4RGKA 2W1SA 4EWEA 2VULA 1IQDC 2ZABA 5FZ7A 1SQ4A 4XDQA 5A7PA 1WMEA 1W8HA 2V5YA 2ZOEB 3A7QA 2GSYA 3N9MA 1PMJX 4P5YA 3UGGA 5JXGA 1H8TB 3E5QA 4IL7A 1JYNA 1MS4A 3M8LA 5E89A 3BKZA 1V9U1 1CAVB 5FP9A 2GNBA 3AP6A 3EBRA 4PDWC 2VD7A 1PO13 4IERA 4CDXC 4S2FA 3WG2A 2CNAA 4PQ9A 3ZYFA 3C7HA 3LD8A 4IEYA 1AR73 4CU7A 3IT8A 5DXDA 4LO7A 4MV2A 3WEZA 3WW4A 4F7ZA 3FBMA 5DPNA 2D97A 2ZGRA 3ZSLA 5GLTA 4BLIA 1BEV3 1GYKA 3ILNA 5A33A 3RJRA 3MIFA 4Q4X1 1JZ6A 3ZN4A 4AVSA 2WQZC 4NIAA 5FDBA 4LO8A 1PIV2 5DUWA 2IXKA 4YPJA 4LO6B 4QXBA 5F2WA 1KGYA 4HOOA 2BU9A 2XR4A 4ONUA 4A6SA 5IATA 1ZBE3 2PLV1 4H7MA 1XSRA 4JKMA 4WVVA 3OEBA 3D0JA 4BE3A 4QX8A 3K77A 5GZFA 5FZ4A 4R9DA 2YBPA 4O7XA 1R083 4QB2A 5L7OC 5JMOA 3A23A 1KEXA 2BPA2 3PMSA 5FO8B 2ZGSA 1OQ1A 1Q8SA 4JC1A 2W94A 2JJ6A 4XPVA 4D7SA 4FFIA 4BISA 1W0OA 2QFEA 1DP0A 5FYTA 5JIAA 3WCSA 1H8TA 4GULA 1UL9A 1HV0A 5A3UA 1CIWA 4UOJA 1V00A 2YMZA 1A8MA 1R093 3A0KA 3VBUB 2Y26A 1FATA 1YFYA 2MEV2 3AYEA 3MIEA 5FKCA 4AGVA 1GWKA 4XW3A 4QPWA 4UW5A 5F1RA 2TBVA 1MS8A 1HB2A 1PM7A 2Y6FA 2ZGLA 1UZZA 4NVPA 1CAXA 4EWDA 3OUJA 1OLME 2VGDA 5ACA2 1IG0A 2A6WA 3I59B 5DDJ3 1GZCA 1C8M3 5AC93 1VRH2 2IXHA 1ST8A 4LPLA 1CVNA 3BU0A 5JXJA 1PO11 2WNVA 4IGOA 1PZ8A 2I45A 1OVSA 3WNPA 4CDQB 4ZZ5A 3DECA 3ME2A 1R1ZA 2HWC1 2CWSA 3KV5A 4LTAA 2OZJA 5DAWA 4XAEA 3VBSC 2VCMA 2W92A 3PVNA 4NHMA 3VBUC 3ZFFC 2QQVA 4QX7A 5FP4A 5ANNA 1T2XA 1RUE2 4M3CA 3TNQA 4IE6A 3CF6E 4Q4Y2 1QGLA 4ORFA 1LHVA 4QQ2A 4NIHA 1ZZBA 4QWNA 4XYXA 4AXOA 2FQPA 5LBEA 1O59A 1SHWB 1OQEA 1XQNA 3BIEA 3CHXA 4L0PA 4QPGA 3ZYIB 4I3GA 2DCTA 4AHXA 5EWSA 4BDVB 2NP0A 4IEWA 2OPWA 4TSVA 1LOAA 1IHMA 2P37A 4LXLA 4NJ4A 2AACA 3SXWA 5J3UA 3CJIA 5L7OB 4XILA 3ZMOA 1O3TA 5FYCA 2JDYA 1US3A 1RIRA 4ES8A 3VBSA 2E6VA 2WAAA 3GBGA 4QM9A 5ISLA 3I59A 5AFBA 5HCFA 4MGTA 4OQ9A 1YI9A 2ZX1A 4I0AA 1RUE1 2JE7A 4QKNA 3WD5A 3FWEA 4M01A 1A8DA 2ZGOA 4WVMB 3THCA 4FFHA 3MEPA 4UF0A 5F3EA 2R042 1VMHA 2QQNA 5C9AC 3BODA 2VVFA 1ZBE2 2FDFA 4FPKA 4A45A 1GUIA 5FZ0A 1RMU1 3L9JT 4GXLA 3D5OA 3RZMA 2V5DA 2CDPA 1K5JA 4RD7A 1UZWA 1X7NA 3WNKA 1G8WA 4LE3A 4Q0QA 4ZS3A 1I6XA 4MGIE 3SC7X 4Q4V3 2TUNA 4NAOA 3FHIB 1CZTA 2R061 4RA0A 3UKTA 1RC6A 5A3WA 2FDHA 1RGSA 4UFMA 3PU8A 4N90A 3V0AA 2QQJA 4JDOA 1Z7S1 1H2KA 1S0IA 4O9EA 3UNPA 2RV9A 1UY4A 2EIGA 1EAH2 1AYM2 4DFSA 3KVBA 1J83A 4GZ9A 2JE9A 1HW5A 2Q1FA 4KWKA 4Q4X2 4D6RA 3QCWA 4QAWA 3QD6A 3ON7A 4Q4Y1 3WR0A 4SBVA 1UIKA 4IGPA 1OLRA 5IT6A 3VZMA 4CXYA 2VZ1A 1SFNA 1K5MA 4AI2A 4ZU4A 5F32A 4K7JA 5I0TA 1CONA 2DU1A 5A7SA 1P8JA 2IXLA 1W0PA 2D7FA 3ASIA 1EPWA 4XBQA 4Y5TA 2OKXA 1D4M1 1WCKA 1R1A3 3KVAA 3ZSKA 5FWEA 4IEQA 3HQXA 4HVOA 5JSOA 1W8OA 3PU3A 5EJ1B 5HCHA 4JGZA 3CL1A 5H9RA 3GJBA 1YQCA 3GZEA 2DUOA 3URFA 1IQAA 2DFBA 4EZHA 4UFIA 3GHNA 1DGRA 1JODA 2AYHA 3J4UH 2WSUA 3ZYRA 2W5FA 5IAXA 2VBPA 1ODNA 4D94A 2JXAA 2JEMA 2D98A 1ZZ9A 1DQ0A 3VV1A 2C6SA 1SDWA 4CCEA 4KNCA 1IG3A 1KS4A 2A5ZA 4RFT0 3VBRB 1JUIA 3RZKA 4D7YA 2MPFA 5FLJA 4WVWA 3B5LB 5IWFA 1JYTA 3JXSA 1EV12 1QNWA 2JDZA 3QACA 5FZ1A 3MHZA 2P6HA 2WT1A 4CP2A 5C6CA 5LK7B 3IM0A 4I30A 3V65A 2RS13 4HT1T 2VY0A 2W2IA 2XQXA 3WUCA 2HWB2 4NUBA 5FAXA 3WP6A 5GJ6A 1VBE1 2FZ1A 4PLMA 5CNAA 4Z07A 1WCDJ 2RE9A 4IDZA 4H3WA 2OA2A 3F2ZA 1Z7S2 2VC9A 4PF5A 4K6BA 3OGVA 2CV6A 1AX2A 5BNNC 2HH9A 5JZGC 5FYMA 5FV3A 2C0ZA 1CD3G 4IEOA 1AHSA 1VLNA 2XDVA 3Q8CA 3TEXA 1W0NA 5C4WC 4XJAA 3TOJA 2KR2A 3H8XA 2YPDA 2WN3A 4GJYA 3N4MA 1J1LA 1GOGA 4QX0A 1ALYA 1PMHX 2Y6HA 1JMUB 5KXCA 1RUD1 2X05A 5LA0A 5JI7A 3ZN5A 1SLTA 3H8UA 3WUDA 4IV3C 4P9WA 4CCLA 4XUQA 3CBNA 4XFHA 4TN7A 1HX6A 2HWE3 4YRDA 3EJKA 3RZGA 4EWAA 3M70A 3MLKA 4FPOB 1ZA4A 3RWNA 3C3VA 1HRI1 1XBFA 3ZLIA 3AYAA 2QQIA 4F83A 5ACA3 4FBFA 2D3RA 1DZQA 1QKQA 1V9U3 3U1XA 1O4ZA 4FOWA 5FLIA 3VZOA 1M4WA 2XMLA 4QQHA 3WDVA 4BQ5A 1OOPA 1T6GC 5EP9A 1ZVFA 2ET7A 2CSGA 4U36A 5C71A 1O8PA 2HJIA 1JTZX 4IV1B 1GNHA 2J7MA 2P1BA 1BK1A 3WW3A 2BGCA 2R30A 3JD71 2MNGA 1ODMA 4HXCA 3UESA 4CDWC 3PUHA 2VZPA 4OI2A 3ZN6A 1RUC1 3NJZA 2JG8B 4IE4A 4XHXA 3M3OA 5FYSA 5GZEA 5CEHA 3ILRA 2Y34A 4LUKA 1UO9A 5EYXA 1X8MA 2FCTA 1E5IA 1UPSA 4TZDA 4XF1A 4AI0A 1PMIA 2E7AA 3ROUA 4WBBA 5D8AC 3SMHA 2ZACA 4COYA 1AXYA 3H7JA 2ZZQA 4CU6A 3PUSA 1FMD2 1HXS3 3C7EA 1PVC3 1CQ9A 2D6NA 3AZVA 3LKJA 1JYWA 3OY8B 2VZTA 4KL1A 1RVF3 4MZUA 1VBA2 3TEZA 5TSWA 1I9RA 5E8AA 1AR71 1PO23 2WFPA 1UF2C 3K4DA 4IE7A 3Q8FA 5CIRA 4AAPA 3B93A 4BK4A 1COV3 2OW4A 5GZCA 2A6YA 1Y9QA 4EN9B 1NCQC 3NV4A 4JQTA 1AJOA 4Y20A 5CYYA 4MHRA 4XUOA 4YW1A 4JGYA 2PAKA 2VNOA 3S5QA 2JB8A 5FZ6A 1DQ2A 4PI2A 1I5PA 5FZOB 5IUQA 2IFRA 5CVRA 5HPOA 1OFSA 3AP4A 5A7OA 4MXVA 1W2AX 3T1LA 5DUXA 4YGEA 2OPKA 2UYAA 5JI9A 2E31A 1LU2A 2P3KA 4N9HA 4CCCA 5BV6A 2ETEA 3ZXFA 3ZYJB 4Y22B 4YW4A 4DUWA 3BB6A 2RDNA 1YFXA 1NOVA 2VVEA 4CEWB 3TYJA 5FZ8A 3VDAA 4N9IA 3KCXA 2BOJA 3E5UA 4QM8A 1W3VA 3HIFA 4FQ4A 3I3EA 5DDJ1 2YU2A 1HN0A 4HL0A 3W5MA 3DPRB 2GNTA 5JCTA 3AKTA 3ZYHA 1O3SA 2IZWA 4QD2A 5F5QA 1N1TA 3MIBA 4I0WB 4NPMA 4FOVA 4FCAA 3K4ZA 3J7NA 2P4EA 4R9BA 1UU6A 3ITQA 3AMPA 4MSVA 1WD3A 1VPHA 3FFZA 4M0HA 4B4RA 5JR2A 1MZFA 1V6MA 1DYPA 2D43A 4QKBA 1GU3A 4CA9A 3V0BA 5I0UA 3RZLA 1RYYA 3LB9A 4MGKE 2ADEA 3B94A 4OUEA 3UETA 5FUNA 5A80A 2ZEWA 2UY8A 1F2NA 1GP4A 1SLAA 4RR3B 4L2NA 1KJLA 2UU8A 3O7OA 1F4HA 4QPYA 1ACCA 4CSWA 3KD4A 1CESA 1PVC1 3ZR6A 2D93A 2Q0AA 4AFCA 5C5UA 4R4XA 2Y8KA 3T0DA 3IPVA 4XDPA 2XWBB 2VQUA 5C8CB 2E53A 2XJSA 3VDDB 5I0DA 4CDUA 4E9KA 1CZSA 1FI2A 1YCIA 4XCBA 3UV9A 2VM9A 5BNNA 5FYBA 3U07A 2VZQA 1N3QA 1ULDA 1T6BX 1R1A2 1DG6A 2VCBA 2O8QA 4F8AA 1EP0A 4OYUA 1VAKA 4CDXA 2HWF3 2R0FA 5FJHA 2VW2A 1OC1A 3X29B 4LA2A 1BVVA 1HRV3 5CFDC 5GLUA 3ATGA 1ZX5A 5LW9A 3RG0A 2DYCA 4LBQD 5EQUA 4XUPA 2JE8A 4XJ9A 2IXIA 3UJQA 5C3OA 1LU1A 3MW2A 3VHRA 1VBB2 3ACLA 1W9YA 2XVKA 1WLWA 4LKDA 3AYDA 1SLBA 4EN7B 1K12A 1SACA 3ACHA 2WT2A 3OEAA 1S0JA 3KT1A 5FXWA 1WUVA 1F4AA 1NQDA 1WA6X 2VOWA 3PUIA 1CAUB 2BV4A 1NZCA 3D0SA 4LR4A 4CZSA 2PXJA 1JH5A 1ZRIA 2Y6KA 5A3NA 1REEA 4RGGA 1H4GA 4I3PA 4FPLA 3VBRC 4LORA 3RPQA 3VB9A 3GHMA 4LIVA 1C1LA 1LOCA 2YYOA 3O12A 2WFF2 4Q1PA 2P17A 4A7KA 4EQVA 3ZMNA 1AR91 1ZRFA 3RZHA 4NPRA 1S0FA 1RUH2 4OMDA 4Y1XA 5D8AA 4FI9A 4YM2A 4Y24A 4AWDA 4BQWA 2BEOA 1EV11 5LBCA 2YPJA 5CISA 3TN93 3S6PA 4XE9A 2PLV2 4Z2WA 2WQ8A 2DBIA 1UOBA 2ZX4A 2DBNA 3A4UA 3DYPA 3ZIWA 2GC3A 1TMF3 2JG9B 2HWE1 5FZAA 3AJZA 3LOBA 2ZA9A 2NLRA 1A6CA 5A7WA 1XC6A 1R1A1 1U5YA 2V4AA 2ZX2A 1CAXB 4OZOA 1IOAA 1HRI3 3E1F1 2ZHKA 4DXSA 2RS51 4YNIA 2LALA 1GWLA 3POYA 5FREA 4K21A 2JDPA 3MBWA 4M4PA 5KHGA 3N9NA 4Q29A 1HRV2 5IVVA 4DUVA 1HQNA 2QKDA 4AVTA 3WF4A 4UAPA 3VKOA 2ZMKA 2DCJA 3W59A 4HKLA 3WT3A 4IEZA 5G05L 2QQWA 4GMP3 4XUTA 2I07B 4CCOA 1AX0A 2E63A 2J1VA 4DOUA 5JSPA 2ARXA 5L36A 1KQRA 2B5HA 5KR7A 2AEYA 5IK4A 4XHBA 2AH2A 4LKEA 1JZ4A 4OUMA 3ZXLA 5EFUA 1W05A 3H3UA 4TXWA 3LPFA 3TEWA 2G4IA 2YXSA 3C7OA 5FZFA 1GANA 3LOIA 4XTMA 2R0HA 4OVEA 4E2SA 4CDQC 1ULFA 2ID4A 2VXRA 4J1WA 5CFCC 1NAEA 1HXS1 1UZYA 1VAMA 3D6EA 1K42A 2GMMA 3KV9A 3I3DA 3VBOA 1R64A 4MLOA 1BEV2 1O91A 4W4ZA 5FKBA 3ZSJA 1BJQA 1SCRA 1V6OA 1VBC3 3NJYA 3ZXGA 5IVEA 3MPBA 1YRZA 2YV8A 4N53C 3VKFC 4QQPA 1TQ5A 2WZEA 2J1AA 2GNDA 3LDRA 5HV4A 1POQA 4QX5A 3T0BA 1AYN1 1DYOA 3JU9A 3HN1A 3VGIA 4BQ2A 1XYOA 3OPTA 1B35B 1TZOA 1VBB1 3APBA 4UBGA 1OPMA 3U14A 5DQ0A 4CXWA 5C3SA 2QNKA 4ZXEA 2W1UA 2A6XA 4G4FA 4XMIA 5C7GA 5J7MA 5FZBA 3AL6A 4DY3A 4H2AA 4XBLA 2NMOA 4Y20B 4YGDA 3TB0A 4COZA 5JOYA 5ERLA 5LCWL 1LCLA 5A3MA 2GH8A 2XKPA 2WQ4A 4UW4A 3ZDSA 1LHNA 4GB33 3CEWA 2LROA 5FQ0A 4CP9A 3Q8BA 4E4ZA 3V0AB 1E5RA 3N7KA 1BYHA 1NA1A 4HMZA 4YG6A 1ZZ8A 2HEYF 4HANA 2VG9A 4UFLA 5KXEA 3A22A 1W8UA 5F6KA 2PHFA 1F8VA 1LHWA 5BXXA 1GOFA 1Y43B 3IDCB 3M3QA 5C3PA 1JZ5A 3VBFA 5BNPA 1LHOA 1OSGA 4AYUA 4QT6A 5LBFA 4BJ0A 2B45X 3DXTA 2ZEZA 3I49A 4X8PA 3I2DA 3WG4A 2H6BA 1QOTA 3RYKA 3VD4A 1LJ7A 3ZKYA 5ACA1 1MS5A 1E5HA 3H42B 4RQPC 4YVSB 1UMHA 4NAMA 1MZ5A 2EICA 1ND2B 1X9TA 1YC61 1VB2A 1DLLA 1LEMA 2A1XA 1PGSA 1WCQA 2XJVA 3JD73 4XURA 1BEV1 4RR3A 1D2SA 3U11A 1PX3A 3WHTA 1PGW1 4FOYA 1U5ZA 3GGLA 4PIZA 3VDCA 3IAPA 4NPLA 3MGUA 4WM8C 3WP3A 5FPLA 1K5MC 1OA4A 3FLPA 1W6QA 2UWBA 2O8OA 5FMOL 5BUVA 4CRQA 1C5HA 4Q26A 1G9AA 4MGQA 1PX4A 1G86A 2BFUL 4S2DA 2QQOA 4XF3A 4Z2AA 4HG6B 1RVF2 1OPOA 3CZJA 1R081 5I93A 2JD9A 4B4PA 1D4M2 1MVEA 4M3CB 2VQAA 4RS5C 4HKWA 4E2GA 2JIGA 2BWCA 2O0OA 1QJZA 2ZTNA 5T5OA 4CTEA 1J3PA 1OUSA 5FMDA 5FO9B 1VMJA 3FHQA 4HETA 3G7DA 1WW4A 1H9WA 2YROA 5D8AB 2VE1A 4AI8A 3FFQA 2CWMA 1YQ2A 3NMBA 4AOCA 2RVAA 4QHOA 2Y38A 1QXPA 2XVLA 3FUOA 1S2KA 3OGSA 4IQPA 2ZGUA 5F5AA 5F8PA 4LA3A 4RL7A 3KSCA 1LOGA 3J7HA 1NG0A 4BMEA 4UW6A 4MADA 3ZPYA 3WNLA 1IKPA 2ARCA 3DF0A 2DWRA 1W2NA 4CP0A 1ZREA 4M0NA 4ZHNA 3TBDA 4L97A 3I2KA 1EYBA 3U0ZA 2R072 4I09A 2JG9C 4ISQA 4JKLA 3EO6A 1H1AA 4MUVA 2TNFA 5LA2A 1VRBA 5C3QA 4M3CF 4ZU7A 2W39A 5IVJA 2X53S 1HIXA 2VZUA 3RVHA 4CDUC 1O4TA 1UNBA 5CBLA 3AP9A 4MOAA 1H30A 2VOVA 4IUGA 2RDRA 1NT0A 2E9QA 5JAXA 5FP7A 3AKRA 2ZCWA 4HFSA 3S5AA 2VUJA 2H0VA 5FZMA 2HWF1 2W46A 3FC0A 3MV11 2JG8A 2CTVA 3NJVA 1CN1A 3KLSA 4LE4A 1WW5A 3HWJA 3MF9A 3H0OA 4GMP1 4U2AA 1JN2P 3TNPB 4KWUA 3POGA 3R05A 4QQOA 2XBO2 3VKNA 1L7LA 4PLOA 3WP4A 5AC92 5JPNB 2E33A 5L7OA 2RS31 1O8SA 1GZWA 3MW4A 4LK7A 5EJ3A 3U4XA 2VQ0A 4YW5A 2DF7A 3VKMA 2WNUA 1HQLA 2VOXA 3JZVA 3KV6A 3PVBB 4ARXA 3JBG3 4PBPA 1W3XA 5JWPA 3NV3A 3KGZA 4KH9A 3CLPA 2JDNA 1RUE3 4K20A 5C4WA 3MIGA 2VZOA 4IXLA 1H0BA 2I74A 1V6IA 3RZZA 2DTWA 3WZ1A
chains in the Genus database with same CATH topology
1Q8OA 4BZ4A 1H2MA 2RMU2 2PHTA 5K0UC 4Y1VA 2ZX0A 4AEDA 1ENXA 1S0BA 2X5IC 1RTVA 5T54A 4BIFA 5JIUA 5EYYA 1OQDA 1AR93 2HEWF 3OGGA 1WLCA 4JGZB 3VHOA 2IXJA 4Q1RA 4RS5B 4YZ3A 2YUEA 3ZFEA 1TME3 1AXZA 4HSLA 2BTVC 4PIXA 2W0XA 2A71A 1LODA 1HDKA 2ZBJA 3E5XA 4YZ5A 4B7EA 4C91A 4R9AA 3I4IA 1MVQA 2DCKA 4P5HA 4AF9A 1ASJ1 3POSA 2DVGA 4Q0UA 3M3EA 4IV1C 4LEJA 1PVXA 3BALA 3WDXA 3WG1A 1VB4A 2LUWA 5FOBB 1KXGA 2XBO1 1AVBA 5K0UB 2P2KA 2B46X 5FQ0B 3VUOA 2EXJA 4JRLA 1NA1B 2XL9A 4RQPB 2OYZA 2VNRA 4N43A 5KHJA 4LT5A 2WNVC 3AXDA 4I02A 4YFWA 1NE6A 1POV0 1SMVA 3VDDA 2D5FA 3PVOA 4C1XA 4Q27A 5DG2A 4DRRA 2WWSA 2NM1A 1OD5A 2PYTA 4N53A 4GH4A 1AL0G 3MW3A 5K9YA 1QJU2 1RUD2 3OBTA 1RHI3 2PHLA 1MZEA 1DBNA 4CDXB 1TME1 1VBB3 1HV1A 3LAGA 4AFMA 2B8MA 2AZ5A 2R1DA 3CJIB 3GBFA 3VHNA 3AB0A 3L2YA 5DDJ2 3SHRA 4AHWA 5JOXA 1D4VB 2BQPA 4LBOA 4GWMA 3P3NA 4W6YA 4Z92B 1BKZA 3LSEA 1QJY1 3S0MA 3LWCA 4MH0E 1W6PA 1WLTA 1NE4A 4KGGA 3SISA 1V70A 3D4KA 3AFGA 1JXNA 4MYEA 3LCPA 1W6MA 4A7YA 2VOKA 2ZMNA 3VL9A 2X8KA 4L9BA 2YGMA 3LSDA 2NMNA 5C9AA 2GC2A 2X29A 4EROA 4HK8A 4AI1A 2PHWA 4K1YA 3ZFGC 4BYYA 3OD4A 4DXZA 2Q8OA 4DQAA 5T5PA 4GIQA 2JG9A 5ABJA 3WOGA 5T3NA 1J58A 3ZXAC 2XLFA 3B7MA 3FLTA 4V1PA 4FVVA 1F31A 1FNYA 1FYUA 4YGBA 2DFCA 1GBGA 1O4YA 4IEUA 4HKOA 1V6NA 1XYPA 3IWZA 1N1VA 2P3JA 4UBHA 5A33B 1RUC2 2A3WA 4RHV2 4Q4X3 1X33A 3WV6A 3J8F1 5C9AB 1XU2A 4OI4A 4YM0A 3RMYA 4LBLA 4R8HA 1W6PB 1UPIA 2HYKA 1JYIA 3QOPA 4X8NA 4KG0A 3THTA 5BNOA 1RUJ1 3KZ4C 4BHPA 4CDWB 1ZRRA 3A0NA 3N3HA 2YC0A 4Q4W2 2PLV3 1QQP2 3B02A 5AVAA 1QQP1 2R32A 1IPJA 1GQHA 3USUA 5E1RA 5K8SA 4L99A 2YGLA 2RS52 1CJDA 1S0CA 3SH3A 2ILMA 1NQJA 3VBOC 2YZ4A 3AKSA 5EXOA 4WVZA 2GZWA 1FV3A 2X5IB 3SCFA 3AX4A 1V6KA 1ZNPA 2WZR2 5T50A 1W6OA 4KG8A 4Y22A 5BNNB 4ATFA 3JQWA 4KQ7A 1WMDA 5C4WB 3G6JB 3ZX7A 1YLLA 1LOFA 3AYCA 3O0WA 4K8FA 4UXAA 1H8TC 4FP3A 1C28A 1I5ZA 5CFDB 5JZGA 2WZPP 2WNEA 5AFEA 4Y4YA 2HWD2 1C8NA 1PNGA 4AVVA 1OA3A 3QH7A 2WZR1 5J37A 3QLQA 1YFUA 2RMU1 4M3CE 4P9GA 1MS3A 1POV3 4GQ7A 1QXJA 1YUDA 1C1FA 2DVDA 4IEPA 5A32B 2XPJA 2WJSA 4IETA 2A6ZA 5KBFA 3NW4A 2O1QA 2K2SA 3NWKA 3WY6A 4A3XA 4G3YC 2HEVF 4IESA 2VMIA 5IK7A 4C0BA 5C8CC 1DQ1A 4X6QB 1DGLA 1PK6B 1VBA1 3NV2A 3WLUA 4N7UA 2QDNA 2UURA 2ZKLA 3W58A 1AF9A 4JTNA 4YM3A 4IV1A 1ZYBA 3MICA 2OZ6A 3LA3A 5KHIA 3NAPA 3KGLA 3CU7A 4WM8B 4WVMA 1J59A 1UAIA 4W65A 3RYRA 1ZZCA 4GH4C 4QGLA 1RHI2 3VBFC 5BNPC 1D0GA 2AGSA 3JB8A 2XGXA 3KQRA 3AK0A 1GZ9A 2BNOA 3NKGA 3H1MA 3R4DB 4AVBA 3OY8A 1CAUA 1VRH1 1FXZA 1XE7A 5FRAA 5T5LA 1IKQA 1MZ6A 2XKOA 2R063 2ZX3A 1FV2A 3S7EA 1XNDA 2VPVA 3AMMA 1PZ7A 1RUG3 3VBUA 1QJU1 4XXPA 5BY5A 1CGPA 1S0GA 1KD7A 2Y0OA 3SCGA 1EV13 4JTOA 3J8F2 4AFAA 2FZ2A 5C33A 3EHKA 3VBOB 3BIWE 3H7YA 1MEC1 1RUD3 4L8QA 1GV9A 4OI1A 2R16A 4C90A 1TMF2 1RUI1 4Y26A 1XE8A 5K7PA 1RB8G 3I54A 2RM21 4CYDA 4META 2B7YA 1X36A 1D4M3 5I91A 1GKBA 5FLHA 4Q8KA 2QZ2A 3EXUA 4HPKA 1OI6A 4AW7A 4S2GA 4LLFA 1UMZA 2WC2A 2WS93 2A3YA 3WCRA 1AX1A 3WDUA 1COV2 4YGCA 3HT1A 3SH4A 1M06G 4TLFA 2DVBA 3VBUC 1TNRA 2XLAA 3C2UA 4AI3A 1RMU2 1DQ6A 1K5MB 4QPIC 1C8M2 2QZ3A 2R041 2ZHNA 2D3PA 2DVAA 5FFOC 4NHKA 1HLCA 4PDWA 4ZKTB 3WW1A 1YIPA 4H55A 4EN8B 1LB2A 3ZXJA 4GALA 3WG3A 4YG3A 4HZFA 4OLLA 3PJYA 1NCRA 1IZ3A 4H7LA 4BM8A 4I2OA 2DUPA 1JUHA 2DU0A 2RS11 5L19A 2CGPA 3AP5A 3AM2A 3IDBB 3FE5A 1AR63 2DV9A 1URXA 3FJSA 5DZEA 2BUKA 2D40A 1QJU3 2NQYA 4IV3B 2HWD1 3LGRA 5CB7A 2XJRA 1RJ8A 2HWF2 4HBNA 1ULEA 1MQTA 2ZGQA 4QU2A 4XIKA 2BFUS 1QXRA 3GZAA 4DNYA 4OHXA 3TN91 5EV7A 4MXWA 1H1IA 4RHV1 3WDYA 5FMOS 2KXLA 2OIIA 4FTBA 1RUI3 2H0BA 3HR9A 4I01A 4ITCA 2VW0A 4XIOA 5DZFA 1IGOA 3ZIWA 2P3IA 4JCKA 1QMJA 1S55A 3I7DA 4XQ4A 3WVJA 5F9TA 1QDCA 3ZSMA 2WNVB 1VR3A 1WMFA 3J9SA 2I2SA 1W39A 1G9FA 1MR5A 3CJIC 4OULA 4YVSA 2HWC2 3AP7A 2PHRA 3O0XA 4PIYA 4CEYB 5CFCA 1LOFC 5GZGA 1BQPA 3RDIA 2WL1A 3J26N 4LHLA 4YW3A 1U12A 3DGTA 3H50A 1QJX2 4LBJA 1Q56A 5KHHA 2FMYA 4E2QA 1X8EA 1QH6A 1U0AA 3HBZA 4EJRA 2WZR3 1FPN2 1VP6A 1UIJA 2A75A 5JZGB 4QQLA 1FPN3 3IDEA 4XETA 5T52A 3V64A 1ND2A 5J98B 2EVXA 2CGOA 1DYKA 4HLTA 2NPIA 1H1MA 4COWA 1AR61 2CGNA 1LGBA 2HWB1 1QNYA 3KCYA 4K40A 1TEIA 4COVA 1KJRA 2PHUA 2WIIB 1KDKA 3NVCA 1COV1 1QJX1 1AYN2 2R49A 2UY9A 1I3HA 1I1EA 4OFGA 4GH4B 1UKGA 4DZGA 5GALA 2D3SA 4KBBA 1ZZ6A 1DDLA 4DY5A 4RSUA 1DGRN 3KS7A 5HCBA 3JB4C 1RUF1 3IMNA 1QQP3 1YXWA 1DF0A 5DUVA 1SLCA 4P9YA 3ES4A 3UJOA 5FCCA 2HWE2 2XHKA 1DGWA 1JOJA 1ONAA 2FHRA 1SLLA 5AVPA 1MS0A 2CL2A 2PN5A 1NCQA 4QXKA 3W9AA 2WLPA 2VMHA 3BOWA 4LBQB 4XJZA 4YVWC 5BNQA 1MQTC 4JGZC 3ILFA 4E4DX 4P9JA 3ZFFA 3BU7A 1Z78A 3KMHA 1GNZA 5KC5A 1AUYA 2E7TA 1OA2A 2GH2A 2PELA 2JICA 3O14A 4QHBA 1IS6A 1NYWA 1AL22 2D6LX 4QGMA 4SLIA 4B7KA 5KXDA 4IEXA 1SCSA 3TWIA 5CA6A 4KU7A 3USSA 1WGPA 4Q0PA 1ENRA 2B9UA 2IC1A 4L92A 3TAYA 1ZM1A 1E57A 3B9IA 3AMQA 1RUJ2 1GZWB 4CEYC 1C4RA 3HAGA 1SBDA 1B35A 1QHDA 1QY4A 5C8CA 1WBLA 3VBHA 4W6WA 4C0HA 1PGL2 2RR11 4K9SA 4XTPA 3VN4A 4XFCA 1PO22 4JQRA 5FO7B 1H2LA 1Q5OA 2GN3A 2A7AA 4DS0A 3NAPC 5LEKA 4ASMB 2VW1A 3MYXA 4LO5B 1ZBE1 2XL7A 4OUSA 4XQDA 2WA3A 1J1TA 1NCQB 2XJTA 3KT7A 3DL3A 1RUF3 4ZU5A 5F6LB 1V6JA 5SV5A 4LNVA 1LKNA 2W52A 1NXMA 1S0EA 2R073 5J96B 2Q30A 1NXD1 2RS32 2Z69A 4B3NA 2WNUB 3AKPA 2NYYA 1UW8A 4BQ1A 5GLZA 1QOOA 3OTFA 1IPKA 1RJ7A 2BVBA 1GQGA 4LUMA 1LGCA 4FAGA 1LENA 1UD1A 2GC0A 2OUHA 5BNOB 5KWRA 4WZFA 1CPNA 4RR3C 1DHKB 2NN8A 1VBC1 4HK9A 5IK8A 1AR92 1PIV1 4FOQA 4S2HA 1VBD1 2A6VA 2EXKA 3L2HA 4AHYA 5FBZA 1Q43A 2BYVE 2EAKA 1N3PA 1O3QA 4KWLA 2JX9A 2A70A 3RS6A 4LHNA 3VZKA 2A73B 1KFXL 1F9KA 4LBNA 4ISRA 1DU3D 4EN0A 4GB32 5LEJA 1SBFA 2WNUC 2WKKA 1FMD3 1HXS2 1OOPB 2WS92 2KM2A 2GDFA 1FOD3 4LULA 1Z7S3 4YSFA 3E97A 4MX3A 4Z82A 5DG1A 1B35C 2OVUA 3GBWA 4ASLA 5HXVA 3JD72 3ZYGA 1C5IA 3H9AA 2BNNA 2CAVA 1RINA 2YDEA 2Z79A 4GKXA 1D2QA 1YYNA 1DGWX 2WFF3 3PJQA 5K0UA 1HQWA 1CJPA 4JDMA 5T55A 1ZRDA 3MIDA 4YM1A 3TN92 1J3RA 1QF3A 1DFQA 4G9SB 1WCSA 3FLRA 3TRSB 5HCAA 4WZCA 1OOPC 3OPZA 1YWKA 4BH9A 2D6OX 4Y1YA 2E7QA 5EZWA 1GFF2 4D69A 3ZXEA 2XJUA 3RJ2X 4RGAA 1FX5A 1LGNA 1TNFA 4XF9A 3RRDA 1RL3A 2EXHA 2LTNA 2R6QA 4AEDC 2ZHMA 4BOWA 1RUH1 4MGYE 5I8YA 4FPGA 1QJX3 2HWD3 2WT0A 2CYFA 2IXCA 2JG8C 1H8VA 3ZXKA 1VJ2A 2F4PA 1ZZ7A 3UK9A 3RI8A 3MF6A 1RUF2 3FZ3A 1U5XA 5KXBA 1XRUA 3HD8B 3Q9OA 2RHPA 4WM7A 3ZFFB 4HVRA 3VBHC 4PJYA 2ZGMA 1FMD1 3AZYA 3N7JA 2RM22 4PBOA 2G9FA 4H14A 4NOTA 4B29A 2R062 1FOD2 4DINB 1H2NA 4P9LA 1ASJ3 2V09A 2EALA 1BBT1 1QDOA 3M1HA 3PVEA 3S30A 1A3KA 2WFF1 2GC1A 1IS3A 2QE3A 4KGQA 2JKBA 3LA7A 4GA9A 1YO8A 3N7LA 4N7IA 3FMGA 4W6XA 4XJUA 3I8TA 1LOBA 4NO4A 3PMEA 4TYSA 4XOGA 1ZBA3 4XFFA 1DZTA 1OFNA 2PFWA 3VLBB 3FX3A 1R082 5ABJC 4YFZA 2GMPA 3CNAA 3O0VA 5LK5A 4YVWA 3MFAA 2FBEA 3AJYA 5BPXA 1OMIA 1N1SA 2CY6A 1Q8PA 2D44A 1RUH3 1RUC3 1VBC2 3GYDA 1EAH1 4JVAA 4Q0VA 1O5LA 1BMV1 1AZDA 4NHLA 3ECQA 2WINB 4AE2A 4Z1VA 4AEDB 3NL1A 4UW3A 1RUG2 1W6QB 4FQZA 4K3UA 1L3JA 4AHZA 1GR3A 2ZGKA 4DB5A 2QDRA 4HN0A 1N47A 3WDTA 4TWTA 3T1MA 3BCWA 4OZXA 5JLVA 3AZZA 4OHYA 2Z5WA 3CJXA 4AQ6A 1OLQA 1CAVA 3DN7A 3ZVXA 5HI0A 4A7ZA 1VBE3 2ENRA 1Z0HA 3VZNA 1BVP1 3FUQA 2PAEA 2RR12 4WM7C 1TE1B 5LRSA 5JMCA 1ENQA 2E51A 3B3QE 4AGRA 1ZRCA 2PA7A 4JGYB 2PHDA 2SBAA 1NLRA 1RITA 5CFDA 3RNSA 1F5JA 3ZSEA 2XJPA 2EAAA 2GMEA 1CPMA 4AVCA 2HKXA 2SLIA 2ARBA 3JCIA 3MLJA 4YZ1A 2D6PA 3V56A 1EY2A 1Y3TA 1UN1A 3V0BB 1WLDA 2YY1A 1REDA 4PCRA 3N7MA 5JOWA 2D6KA 2WLQA 4P9IA 3VKLA 3AKQA 4YZ2A 1SFYA 1W2UA 1EPZA 1X82A 2QJVA 3WQ1A 2WSVA 5JVVA 4OHWA 4CDQA 2GN7A 3MFCA 1LULA 3UKNA 4K1ZA 3WNXA 4I0BA 1KS5A 4O9GA 5C8WA 1Q8VA 4YLZA 3VBRA 4AGGA 3M3CA 3M2MA 1BXHA 2AREA 5GLVA 4FT8A 2ZZJA 4HVQA 3M4FA 4C1WA 2C5DA 5LRRA 5BNOC 1B09A 1RUJ3 1JW6A 1RUI2 3K51A 2MHFA 3OF1A 5L73A 1H9PA 4KWJA 4YVSC 1UCXA 1IS4A 1RVF1 4Y1ZA 2XB6C 2JENA 5KHKA 4OHVA 2RR13 3R4SA 1GICA 5I8SA 1S0DA 1YIFA 1PZ9A 4CEWC 1JYCA 2ZJCA 5CU1A 3ZO0B 2YHJA 2ZPXA 3ZFGB 2AUYA 3KM5A 4ZXKA 1HRV1 2MEV1 2ZGPA 3MLLA 4P14A 1JHNA 4Y1UA 5I0SA 3R0RA 4JGYC 5JOZA 3WINE 3WQ7A 4Z8BA 1G9CA 1D0HA 4XQWA 1WW6A 2XWJB 1R092 2QUOA 1O5UA 2G9GA 2ZGNA 1BCXA 1VBD3 4HN1A 4LBMA 1DZRA 4YZ4A 1RHI1 3H1WA 4D7TA 5H9SA 5BYNA 4Q4W1 1U5IA 4NN0A 2QVSB 2BW8A 1VBE2 3GF6A 1HRI2 1V9U2 5GM0A 5IK5A 1ULGA 2NZ9A 4KU8A 2JD4A 3ALQA 3N36A 4AG4A 4AQSA 4FO9A 1AR72 4Q4V1 1YHFA 2N7GA 2UWCA 3WDWA 4DRVA 1AXKA 1C57A 2PQQA 4AEJA 4CDWA 1LR5A 3POWA 4YG0A 1KITA 5I0RA 3CO2A 1PGL1 4LLOA 3N35A 5GZDA 1PIV3 2RMU3 2ZAHA 2A3XA 3ZN6B 3U10A 4X6RB 1KRIA 1POV1 2H6CA 5J09A 4GMP0 4LBQA 3PHMA 1PVC2 2Y0IA 2XBO3 2ATFA 3NO8A 5FOJB 1TMF1 4L11A 1CR7A 3KT4A 4IV3A 4YYOA 4PDWB 2QQPA 4XFBA 4A2UA 4BA6A 4HSJA 1ZBA2 2XVGA 2RS12 1XU1A 4J6GA 1BBT2 2WS91 1QU0A 5H9PA 2PTMA 2EF6A 2C9AA 1ND3C 2WA4A 4XMAA 1BMV2 3SH5A 1LTEA 4JV4A 1O3RA 1F5FA 4YARA 4LHKA 3OCPA 1S2BA 4N53B 1W6OB 3OBRA 4XEZA 2P34A 2KA3A 1VBD2 1JBCA 3NSTA 4Q4W3 4BIOA 3WP5A 1REFA 4QPGC 1ULCA 2D6MA 1NCRB 3RI9A 1RUNA 1X50A 1AR82 1XNBA 2K9ZA 1AR81 2XJQA 4OI0A 2XG3A 4EV0A 4AFBA 2ET1A 1V6LA 2VUAA 1LESA 2GAUA 1AJKA 5A32A 1PO21 2FMDA 2ERFA 2VVDA 2DUQA 2ES3A 2F6BA 4AQTA 1DQ5A 4FP2A 4ATEA 5JPMB 2EA7A 1YNAA 1Q8QA 3NAPB 2Q4SA 1AYM1 1KDMA 1PK6A 3OD0A 3ST7A 3WQ0A 2AR6A 1SEFA 3IBMA 3DPRC 4NWWA 3AZXA 4AK3A 2JECA 4QPIA 1LECA 3BOPA 2RM23 4AEMA 3DKWA 4RS5A 2W08A 5FPZA 3IPVB 2XLGA 3S7IA 1ZBA1 4DMIA 1FT9A 4CDUB 2RS53 1NY72 4IEVA 4AVAA 1S1AA 1NCRC 1BBT3 4BLJA 1YJLA 3BTAA 1W6MB 2GU9A 3H1YA 1PGW2 3IKWA 4AFDA 2DTYA 5JDBA 4JAAA 4P9XA 4ES9A 2R043 5J48A 2GALA 4B8EA 2XH6A 4XFAA 3J8F3 1GLHA 3HMYA 1NLSA 1AL21 1WBFA 1FAYA 2ZAAA 3VDDC 3B9CA 3ZYPA 1MS1A 3WW2A 4FPHA 4PLNA 3NV1A 2Q1ZB 4JRAA 2RJKA 4BCUA 3ENRA 2OUJA 4XJ8A 4QPGB 1EAH3 3HT2A 4FPFA 4QMAA 1LEDA 2AENA 2BNMA 3SNMA 4E4SA 2DURA 1J3QA 5GLWA 1VALA 3DV8A 1R091 4RHV3 4HPKB 1Y7BA 4QGNA 3E6DA 3QH6A 1H4HA 3SLIA 3QBQA 4AQ2A 3VBSB 2VECA 4XJWA 1SBEA 1ENSA 1VAVA 3AFKA 1UX6A 2D5HA 3JBG2 1HKDA 1W6NB 3PTYA 4FXGB 3USUB 4GB31 1PO12 5CADA 5DZGA 5J36A 5DUUA 3LZZA 3ZFEC 1VIWB 3ZIXA 1G9DA 4JDNA 4CP1A 5H9QA 3IIAA 1VRH3 5GKAC 4XF0A 4AEKA 2X5IA 1CAWA 3WHUA 3AZWA 1OHFA 1A78A 1G9BA 3EQEA 3PLQA 2ZMLA 3JUUA 4FPYA 4XFIA 4F3JA 1MACA 1LRHA 2ZS6B 3OYWB 2B39A 2TEPA 5B2GB 4GKYA 3KCCA 2DVFA 1TME2 1FPN1 4FXKB 5AC91 2VNGA 1CX4A 1DQ4A 1MEC3 1XNCA 5JR7B 3VZLA 2LM3A 5D1IA 2K0GA 4MVTA 4MXWB 3PNAA 1OKQA 2UYBA 1YFWA 1MS9A 2R1BA 3BPZA 2DCYA 3GZTB 4BPZA 2BWAA 3B00A 4XFGA 4R4ZA 1ASJ2 1XXNA 3D82A 3RMXA 4Q0SA 1VBA3