1Y43B

Crystal structure of aspergilloglutamic peptidase from aspergillus niger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
171
structure length
171
Chain Sequence
EEYCASAWVGIDGDTCETAILQTGVDFCYEDGQTSYDAWYEWYPDYAYDFSDITISEGDSIKVTVEATSKSSGSATVENLTTGQSVTHTFSGNVEGDLCETNAEWIVEDFESGDSLVAFADFGSVTFTNAEATSGGSTVGPSDATVMDIEQDGSVLTETSVSGDSVTVTYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspergillopepsin II light chain
publication title The three-dimensional structure of aspergilloglutamic peptidase from Aspergillus niger
rcsb
molecule tags Hydrolase
total genus 21
structure length 171
sequence length 171
ec nomenclature ec 3.4.23.19: Aspergillopepsin II.
pdb deposition date 2004-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1y43B00
3TRSB 2IFWA 1S2BA 1Y43B 2IFRA 1S2KA
chains in the Genus database with same CATH superfamily
4ZXKA 3T1MA 5A3PA 3H3ZA 2WQ4A 4M4PA 1NA1B 1OA2A 1ZA7A 1S0JA 4GH4C 4QXBA 4ZZ5A 3RYKA 2YV8A 3CF6E 4IE0A 3I2KA 1AR92 1W28A 2HWF3 4QQPA 4TYSA 1TG7A 4UBHA 4DXZA 4Q4V1 3C2UA 4YGEA 3D4KA 3MDPA 4CUAA 2EXKA 3D0SA 1ND3B 1ULOA 3VZLA 1W03A 4NWWA 3LOBA 4MADA 4Y22A 4YLZA 4LITA 4KGQA 2EIGA 2ZA9A 2YU1A 2IUWA 1XQNA 2PHFA 1YIPA 2RMU3 2RS33 4LKDA 1HB1A 2QTWB 2Q8DA 1JOPA 3N3HA 4CZSA 1QQP1 1ZBA2 2XBO1 4YARA 5EIYB 1YJLA 1VMHA 2GMEA 3G7DA 4XOGA 3U10A 5JMCA 3VBHB 3NW4A 1FNZA 2UWAA 4JGYC 3POFA 1CR7A 3D0JA 3AKRA 3FLPA 5IK8A 3VZJA 1FYUA 1SHWB 4AFBA 4DY5A 4IUGA 4HSLA 5JI7A 5CAZA 3O14A 5CG9A 1UO9A 5I0TA 3KT7A 2Q1FA 2UWBA 2E26A 2BOJA 1WGPA 2ET7A 3OB8A 4JDNA 3BB6A 4BM8A 1YFXA 3P3NA 5DAXA 3O7OA 4CP9B 5FO8B 5CB7A 1AYN3 1YLLA 2WS93 4FPGA 4P9GA 1KEXA 4N8MA 4Q4W2 2VBDA 3OGRA 5ERLA 5JXJA 2ZGOA 4XF4A 2UU8A 3LSDA 2JG8C 4BA6A 1IQDC 4BMEA 4L99A 2DVAA 1CVNA 5IVEA 1GP4A 5D8AC 5I8TA 4XPVA 4Y1ZA 1PGL2 4LHLA 2JDPA 1XB9A 1A6CA 4BPZA 4S2FA 3R6SA 5J37A 3OY8A 1AX1A 1WBFA 5L36A 4WZCA 5D21A 5IAXA 2XVGA 4JTOA 4M3CA 1CAUA 4CCJA 4OI0A 3I2HA 1GSLA 3GCXA 1LHUA 4Y33A 5C3OA 1EV12 3HQUA 4ORFA 2YG0A 1FT9A 2K46A 4AQ6A 1REEA 1YQ6A 3S57A 2DURA 1ASJ2 4KQ7A 1AR71 2NMOA 3AYEA 3I2FA 5FYYA 3HR9A 1RUG3 4HPKB 4XMIA 4FCAA 4CDXB 5J48A 4FOYA 4LO6B 2R042 3H42B 2VTXA 3ZSMA 3NRUA 4YG6A 2RR11 4PIZA 2FDKA 2NMNA 1N1SA 2QCSB 2DCJA 3QD6A 1UMHA 1ZRIA 3SKVA 4XBQA 1CD3G 1W2AX 4PCRA 1RUF3 2DCZA 4MXVA 4RS5C 4JGZA 4CCNA 1X82A 5BNNB 3SH5A 2OQ7A 1MQTA 4XFCA 1CAWB 2D40A 4HONA 5CNAA 4UFJA 2OUJA 5FY4A 2D7FA 2W95A 2R061 2A71A 2JE7A 5JLVA 1UZZA 3SCGA 1C4RA 1XBFA 3CQOA 4LLOA 5FK7A 4NHKA 5FZEA 1GMMA 2RDNA 4XJWA 1PHMA 4TN7A 2WT1A 5C6CA 4LHSA 4PI2A 3AKTA 4OMDA 5C4WA 3TEYA 2KR2A 4CEWC 3VL8A 3GJAA 4UWDA 5FJKA 1GKBA 4AGRA 4ET7A 2DFBA 2C9KA 2GN7A 2Y60A 3IMNA 1DGWA 2VNVA 1ZZBA 2EXIA 1W6OB 4TZDA 4IDZA 1LESA 1RUD1 2BP6A 4NE9A 4YG0A 4BZ4A 1IS5A 5F6LB 4KNCA 4AVTA 1JOBA 3MW2A 2WL1A 4FAGA 1DQ5A 1HRI2 2IFWA 2Q30A 4PLNA 1ZVFA 1LJ7A 3ZIXA 3DKWA 2A7AA 4LBJA 3VL9A 3TRSB 4NWVA 5DDJ1 3WQ0A 1DQ0A 2HH9A 3ACLA 3AYAA 3ME2A 2I45A 3MIEA 4HZFA 5L7OB 1N1VA 1R1A1 2JIJA 4RR3A 4RGGA 4MGKE 4NROA 1UOJA 4BOWA 5IUQA 4OI4A 5JZGB 2VMGA 2DCTA 3RWKX 3SHRA 1W8HA 4GB31 4ISRA 2W1QA 4KU7A 5FP4A 4XFFA 5JI9A 5BNOB 2VMEA 1GQHA 5BPXA 4PF1A 3HNBM 1TMF1 4Y24A 1H9WA 2JENA 3BUCA 4L9BA 4IEZA 1JBCA 2W08A 4OZXA 4XJ9A 1JZ7A 4KMQA 1CGPA 1W2OA 2VZVA 3KV4A 3AK0A 2XLFA 2ENRA 3J4UH 4YM0A 5A7OA 4XUNA 3T0BA 3VBSC 2QQKA 1YI9A 3ZKUA 2LTNA 1FAYA 2ZCWA 1ONAA 5HCBA 4BXFA 1QJU1 4KG0A 4KWUA 3IIIA 3O1TA 3A23A 5EFUA 5FAXA 3WX5A 1CJDA 2VQTA 2BNOA 2WO1A 2XHKA 2YXSA 2Q8EA 5ABJA 3WOGA 1IPJA 3EHKA 3N7JA 1YFYA 2VR4A 3N7LA 3RJ2X 2JDMA 1MACA 5C8WA 1J1TA 3WUDA 4HN0A 1JYNA 1W6PB 3CJXA 3WG1A 1VBE3 3QBQA 4GAZA 1LULA 4NHYA 4H7MA 1B35C 3VD7A 2CWMA 4K9SA 4QKNA 1VIWB 5CA6A 1PNGA 3TN92 2IXJA 1WW6A 5KHIA 1JU4A 3HWJA 4QQ2A 3ZDVA 4O9GA 1VB4A 1PZ7A 1UU6A 5F9TA 2VBBA 2VZOA 4FPJA 4PI0A 4FOWA 4QX7A 4ASMB 5A6ZA 4YZ5A 2I2SA 1UU4A 4HMZA 1ENSA 3NSTA 4N7UA 3POJA 1RGSA 1UW8A 2OX0A 3CMGA 3W5NA 1TVGA 2Y33A 1I1EA 1CESA 3R0RA 2R32A 2WO3A 4BQ3A 2YHJA 1J84A 1EY2A 4NIGA 4DFSA 1A3KA 2GC1A 2RHPA 4P9JA 3MGUA 3VDAA 1ZRRA 4XE9A 4E4ZA 2D6MA 5F39A 3T08A 5DAQA 2P17A 1BHGA 4QX8A 1MR5A 3A0KA 3LE0A 3O5SA 2WUHA 4OHZA 3GF6A 1RJ7A 1AHSA 2QDNA 3TEWA 5C71A 2VCBA 1COV2 2RM23 1Q8SA 4OI2A 2WZPP 1UIKA 1Y9QA 3ZYPA 1H1MA 2WNUA 4KGGA 1OLRA 4FAHA 5FO9B 2ZJCA 1BYHA 4E2QA 2WYSA 1PMHX 1VAKA 2XJPA 4P5YA 2P34A 4X8NA 2HWD2 1XNCA 3JD72 2I74A 4INDA 3M1HA 2R072 4NVPA 2VTFA 5KHHA 4BWOA 5BUVA 2D3SA 5FR3A 2ZGRA 1UY0A 3K2OA 2XUMA 4YM2A 5LBFA 4D6QA 3PMSA 1MZ5A 3FLRA 3PIJA 4JKMA 2BPA2 4B3NA 2GC3A 4BISA 4YZ1A 2C26A 3PLQA 1MS5A 1ZZ7A 3DYMA 3POGA 2VD7A 1AF9A 3TYJA 2HWC3 2DBIA 2RJLA 3WNKA 3FBMA 2D5FA 2ZAAA 1P8JA 3UT0A 3KVAA 1IGOA 2RS12 1BKZA 1LOEA 3JBG2 1XU1A 4YVWC 5FYVA 5FZFA 4QXHA 3WEZA 1RVF1 4UFMA 4DRRA 1FI2A 1O91A 4XQDA 1W6MB 3AXDA 1ODNA 5A3LA 3M2MA 4OULA 1MS8A 3ZSKA 4FSJA 3O0XA 4ZKTB 1LOCA 2VECA 4JC1A 4H2AA 1QH6A 3GCWA 4P08A 3POYA 2XVLA 5FTTC 1FOD2 3HIFA 1RHI1 5LCWL 1NLSA 1UX7A 1BK0A 3KT4A 4HVRA 3ZYIB 4QXCA 1Y9GA 5FBJA 2GN3A 3OPZA 4M4RA 1QDCA 5EHDA 3NJXA 3Q8FA 2DV9A 4QT6A 1QNYA 3LFIA 1RUC3 1GICA 4FP3A 4Q29A 3LGRA 4YGBA 1CX1A 1AJOA 1CZSA 2WT0A 1W8TA 2WBKA 4Q0PA 5A33B 5FP7A 1JMUB 3VKFC 5AC92 1X9PA 3JUUA 3P1IA 4AI9A 5D2AA 1D4M2 3ZN6A 3EJKA 1LGBA 1POV1 3HBZA 1OT5A 1GZTA 4Q4Y3 3UGHA 4S2GA 1K5MA 2ADDA 5KC5A 4PDWA 3KVBA 1QU0A 1GFF2 1H0BA 4Q0SA 1DQ2A 2P3IA 4TSVA 4AFMA 5LEKA 1PO22 1GOFA 1SLLA 2JG8B 4BQ2A 2PLV2 3M3OA 1RMU2 2JDKA 3O0WA 3MV01 4YZ4A 2QFEA 1OQDA 5D8AB 4FBFA 3VDDC 2YROA 3CDZB 5CKMA 5EYYA 2VO5A 1S0FA 5FZCA 1S4CA 3MICA 5HCFA 1LU2A 1HIXA 1LGCA 3VZKA 3QH6A 2WZ8A 4IXLA 4I0BA 3VZOA 1ULCA 2HWB2 5ISLA 1TME1 2CDPA 1PX3A 5LK7B 2CAUA 4ZU4A 1WCDJ 2VQAA 4LK6A 4Y4YA 2Z42A 4M00A 3DL3A 5E89A 4A6OA 3HJRA 3VN4A 1NCRA 2WYFA 2XL9A 3I97A 5A3WA 1OH4A 2FCTA 4XUTA 3LEMA 3BN6A 2ZTNA 3KD4A 3WR0A 4C1WA 5HV4A 2VMDA 2EIEA 4IE6A 2PN5A 3WP3A 5KBFA 3U37A 1WLCA 1NQJA 2ZGUA 1MVQA 3AVRA 3TEZA 4LBQA 1V00A 2PHLA 4CU6A 1QY4A 4XMAA 1WW7A 3DXTA 1XPWA 4RS5B 2Q5TA 3HNYM 1EUTA 1VBB3 3GBWA 4C1XA 2WZR1 3JB4C 3RGBA 2JB8A 3VD4A 3P5BA 2UURA 4LTAA 3AB0A 2VUAA 2ZHNA 3V65A 3N35A 4Y20B 5I8YA 1MEC3 4CE8A 2ZMLA 2X5IA 4AI2A 1JZ5A 5F5QA 2CGNA 3BTAA 3OG2A 3DPRC 5GLTA 2VQ0A 1UF2C 4YWAA 4I01A 1RXGA 1XRUA 2EICA 5A70A 3TOJA 2E63A 2C5DA 4NO4A 4UT5A 3WSOA 5A7WA 1AL22 4FXGB 3MIGA 1PO12 1RC6A 4YYOA 1REFA 2ARBA 4P5HA 4CEWB 1X7NA 2PHRA 2VY0A 3OUJA 1D0GA 5K7PA 2QQLA 1BBT3 4WZFA 3NNLA 2GNBA 4YFWA 4K8FA 2QQJA 1J83A 1CN1A 3BOPA 5FZLA 1QKQA 1QEXA 3L2YA 4P14A 1H4GA 1UZYA 1FPN2 3DGTA 1F31A 2XOMA 4AEDA 3ACIA 1Z7S3 3DN7A 3KMHA 3LA7A 5C8CA 1N47A 1UZVA 1G9FA 4Y1UA 2CTVA 1XXNA 2PQQA 1AVBA 4MOAA 3GHNA 2WNVA 4L0PA 2BU9A 2VNRA 5F7UA 1WA6X 2O14A 3N9MA 1OKQA 1O59A 5DZEA 4MHUA 1LECA 1AR83 1D2QA 2HEYF 1KITA 2EIDA 1AXKA 2OPKA 2ZEXA 3HAGA 3U78A 2WLPA 3N9OA 1Y7BA 3IKWA 4L8QA 4Q8KA 3GDBA 4WM7A 1G8WA 4N53A 1VB2A 2XUEA 1UCXA 5F3EA 5FY9A 3UL2A 3T30A 2HWF1 3VBUC 4AFAA 2FD8A 5EYXA 1UNBA 2VVFA 2BBVA 3ZFEA 2DCKA 2PELA 1PGSA 3LZZA 4YW1A 1W2NA 1RUI3 5ANQA 2BV4A 4EN7B 1MPXA 3C7FA 2ZAHA 1G9CA 2FZ2A 2HBUA 4HK9A 4DEQA 4LNVA 1Y3TA 3VBSB 1NA1A 4IW3A 4WVWA 4RYDA 4D0QA 1S2KA 4GQ7A 1T6GC 4I0AA 5EJZB 1EUUA 5FXVA 1OVPA 4JV4A 1F5FA 1U5ZA 3I2IA 1DYPA 3FL7A 1SPPB 1W9YA 1CX4A 2GMPA 1DIWA 3LQCA 2B39A 1ENQA 3IAPA 4N43A 4Q1RA 1SLBA 2PMWB 4QHZA 3RZKA 1YEWA 2A6XA 3QLQA 1OVSA 1PVC3 2DVBA 1UOBA 3B00A 3POSA 4YFZA 4DUXA 1DYOA 4C8DA 1OUSA 3VB9A 1ND3A 2BWCA 2NQYA 3MHZA 1QQP2 1AYN1 2RS52 1QJZA 4YSFA 2WS91 1BEV3 1XE8A 2CL2A 2DUOA 1DFQA 1RTVA 2OA2A 1X36A 3NV1A 2Y6JA 4LULA 3BODA 4G9SB 4ZXEA 1XYNA 4AI0A 2VVEA 3C3VA 4OVEA 4DPNA 3VBHA 1S0BA 4XHXA 3KF5A 1JYVA 3KGLA 3AZZA 4LT5A 4UFLA 5L9RA 3LEKA 2QQVA 4YVSC 2NLRA 1J3RA 1MVEA 2W92A 4H7LA 2QKDA 3QOPA 3C7EA 1ST8A 5A32B 3ZR6A 4CDWA 5IVBA 2GSYA 1W8NA 1IOAA 4XF3A 1Q8OA 1UY1A 2Y6HA 3NNJA 4K6BA 5J1XA 3MF9A 1JXNA 4E2GA 5JMOA 2Y34A 2PQSA 1QJX2 3MUY1 3PUQA 4AK3A 1LTEA 1W3XA 4CDQC 3B69A 4UFKA 3ZYFA 5FMBA 2GC2A 1RUG1 5FKCA 2L9LA 3KS7A 4MO3M 1GNYA 5FZ1A 1K5MB 5JOYA 3I3QA 3NAPC 2LUWA 2PAMA 1HW5A 1OFNA 1NZIA 1S0DA 3RI8A 4XDPA 1V70A 1QJY2 5A3MA 4Y4RA 5C9AA 5FWJA 3NKTA 2BZDA 4Z07A 1GWLA 1C8NA 4LOTA 5I0UA 4GULA 3T0AA 1RUF1 2A5ZA 1S0EA 3SH4A 1EV13 2VNOA 3HEIA 1HRV2 4LPLA 3AJYA 4L11A 3WNOA 2UYBA 2DVGA 3J7MA 5TSWA 4AGGA 3L9JT 2W5FA 2Y64A 4YZ2A 4AXOA 2R043 4HPKA 2RR12 4IEPA 2LS6A 4CDXA 4PBOA 2D6LX 3B3QE 4NPMA 1WD4A 5L9BA 4QQHA 4A2UA 1EPZA 4R8HA 3SLIA 1UPSA 4W8JA 2J7MA 5BV6A 3BU0A 3IPVB 1WLDA 5FZ3A 5FPUA 4KWJA 3ZXGA 2VQUA 1R092 4IL7A 4YVWB 1HN0A 3E5UA 1GR3A 5FLIA 2G4IA 3HD8B 3EO6A 5EQUA 5SV8A 4L2NA 2H0VA 3NWKA 1YFWA 4LBQB 2RVAA 4SLIA 3FFZA 1OF3A 3ETPA 4LEJA 3USSA 1IG0A 3IDAA 1K12A 2DU1A 1PK6C 3IDBB 4OHWA 5BNNA 3O1RA 1O3SA 2WWSA 2BVBA 2F4LA 4IE7A 4BQYA 1CAWA 2Y0OA 3DCQA 1N1TA 3EB7A 2FMDA 4PHZA 1WCUA 4E8DA 2YFUA 2PAEA 3W58A 4E4HA 5LY1A 1LENA 1OPOA 3WP4A 1YQ8A 2XDVA 5FBZA 1DP0A 4P9LA 3J8F2 5A1LA 2WLQA 3FHQA 3K48A 3N9QA 1JUHA 2FCUA 1AYM2 5JIAA 5BNPC 3MIDA 5A1AA 2AEYA 2GZWA 3OTFA 4DEVA 1W9SA 1LCLA 5A7WB 1C5IA 5LA0A 1C5HA 1U12A 2ES3A 1L7RA 1OLMA 1W6QB 5E88A 1BXHA 2CHHA 1OLQA 1W6OA 2XLGA 3EBRA 3KV9A 2B7YA 3N9PA 2EAKA 4JZRA 3DF0A 5H9QA 1OMIA 3VDDB 3WT3A 5KC6A 1HQWA 1HRI3 3PVNA 2V5DA 1NOVA 4WV8A 5CISA 3POEA 1GZ9A 1CWPA 3JZVA 4M0NA 5T55A 4QDRA 4AVAA 4EQVA 4LUKA 3TNQA 2P5BA 2Z5WA 4NN0A 4URAA 1QXRA 1ND2C 3AFKA 1LKNA 4HT1T 1MZFA 4AVCA 4Q0QA 5EJ3A 3PURA 5L7OA 2LALA 3N7MA 3V0AB 4P02B 4EN0A 2JJ6A 1PZ9A 2W87A 4COYA 3N4MA 2RDSA 3ETQA 3M3QA 2JB4A 1WMXA 2PHWA 5FZMA 3WP5A 5CKNA 2EAAA 1WW4A 4M0HA 1TMF2 4OHVA 1DQ4A 5CKQA 4GIQA 1KDMA 5BNOA 1UMIA 5KR7A 2BEOA 1N1YA 3CKHA 4JQTA 1H2KA 3AYCA 3VBRC 4BB3A 3ZFEB 2R0FA 1VBE1 2AH2A 1WUVA 4Q27A 2ZMKA 5GJ6A 3WF2A 2X05A 3FMGA 4BH9A 2JDZA 1ZZ8A 2MEV2 3FHIB 1DQ1A 3OBTA 4XJ8A 4DUVA 4UI9L 1MS3A 4QX1A 4AHZA 5FREA 2BGOA 2JKXA 1HV0A 1PX4A 1SDWA 3BI3A 1K5JA 2QBXA 4XEZA 3OJBA 4B29A 4Y5TA 1S55A 4CYDA 2AYHA 2Z79A 3E1F1 4X8PA 4Y26A 2WC2A 1ENXA 3WW2A 3BIWE 4QGMA 3RWNA 3CNAA 1JYXA 1S2EA 3DPRB 2AACA 3POWA 1QH7A 3T2TA 4HKWA 3I2OA 5LW9A 1OXCA 2IXHA 1R083 4NAOA 5T3NA 4N43B 1W6PA 5FYTA 4URTA 2BW8A 5FZIA 1NUKA 1NYWA 3TN93 1OQEA 3JQWA 3NNGA 4MUVA 3AMNA 4D3WA 3I54A 4FPYA 3HQRA 1R1ZA 4I3GA 4Q4X3 1FMD2 2OKXA 3URFA 4COWA 3QCWA 3BYWA 4MVTA 3W59A 4KBZA 4NIAA 5KXBA 5FUPA 2RM21 2ARCA 2VZRA 1Y4WA 2R7EB 3AP7A 4LO4B 4R9BA 4LOSA 2HEWF 5F3IA 3D82A 2ZGLA 2WQ8A 4QHOA 1W3VA 2ZX4A 2GU9A 5DG2A 4CP2A 4B4PA 3MLLA 3C7HA 3FN9A 1SG3A 4AHWA 2JX9A 2WNEA 3LSEA 3M3IA 1H8TC 2OIIA 4CDWB 3PDQA 5T5LA 4C0HA 3ROUA 3VBOA 4PF5A 3PNAA 2HWC1 2EALA 2LM3A 2VC9A 3SISA 4AOCA 2XQXA 5FYMA 4IEYA 1J3QA 1DCSA 4XETA 4JHTA 1COV3 1X8EA 2YBKA 4HKOA 2Q1ZB 4HVQA 4YW6A 4S2DA 2B4KA 5LBEA 3ORJA 5C9AB 2HWD3 3JD73 5FZ9A 2R073 5FZ6A 3LIGA 3TEXA 4OI1A 3MF6A 2P3YA 2BTVC 3MFAA 4QQLA 2A6ZA 2VGDA 1POV0 4LK7A 1AR63 2HYXA 3J7LA 1H6XA 5LBCA 1ZBE3 4GH4A 1BVP1 3M4FA 4A41A 1O4TA 2RS13 4MGSA 4IV1C 1RUC1 1DBNA 3JBG3 5LA9A 4H14A 2A6YA 3CZUA 1WCQA 4PLOA 3KM5A 5A3OA 1S0GA 3HBKA 4G4FA 4OCTA 4DXSA 1VLNA 2G9GA 1C3HA 1W6MA 4CDUC 5LA1A 1W6NB 4WVMB 1AXZA 4KI5M 3RDIA 4Q4Y1 2C0ZA 1FOD3 1F4AA 2ZMNA 4JRAA 5FOBB 4QDQA 2PYTA 5FY8A 3E6BA 4PIYA 5I0DA 1TZOA 1V6KA 3KHCA 1C8M1 2JG9C 5FPBA 5J98B 2FDHA 3S30A 1QOSA 1SDDB 2VZUA 2WFPA 5SV5A 2GMMA 2QQOA 3WDUA 2VXJA 4CCKA 4DB5A 4JGYA 3T4HB 5AC93 2B8MA 4YVSB 3RZJA 3AP5A 4OQ9A 1Q8QA 3VBFC 3O1MA 3MBWA 1S1AA 5A33A 1D4M3 3ZSLA 1DF0A 2V4VA 3TAYA 2PTMA 1H30A 4LBLA 5JAXA 4NRQA 3ZIWA 4YGDA 2IWGB 3ZXKA 3CZJA 3IDEA 5I0RA 1OFSA 3MI8A 3GXUA 1PM7A 3AFGA 4CDQB 1HQLA 3FLTA 5DN2A 5C3RA 1PO23 4NIHA 5A7PA 1IG3A 4MX3A 2PLV3 3WW3A 1RMU3 3H7YA 4OUMA 2JG8A 5F5CA 4OFGA 3NAPB 1TE1B 2BBAA 3W21A 4IEWA 4RHV2 5D8AA 4YW4A 1RITA 2V4AA 1ZRFA 1YCIA 4NOTA 3BGAA 3EXUA 2E9QA 4ITCA 4CXXA 2CSGA 4I2OA 4NJ4A 2DYCA 4J1XA 4B7EA 2HWB3 2A6WA 3N9LA 4XABA 4GWMA 3ZXDA 1XNAA 4F3JA 4MG2A 5AVAA 3I59A 1VBB1 2A3XA 4I0WB 5CBLA 3VD9A 1VRH3 1UZWA 3UK9A 4D7TA 1MEC1 5FK8A 1DQ6A 2Y38A 5GZCA 2RJKA 3H1YA 4AWDA 4JTNA 1CIWA 4UOJA 4P9XA 5HPOA 3R4SA 1RINA 1QNWA 2IXCA 3LDKA 4E2SA 2WZR2 4EE2A 1UD1A 1LOFC 4JVAA 4RS5A 5ACA3 2RE9A 2E32A 1H2NA 1O5LA 5B2GB 1BBT1 2PHTA 4XAEA 4PBPA 4Q8LA 1RUH2 3NL1A 2GNDA 5CFDB 3F95A 4GMP3 4YM1A 3U75A 3CEWA 4Y20A 5IHRA 2SLIA 1SZBA 4Z92B 1Z7S1 2Y0IA 5FYBA 1OOPC 1BJQA 1RUJ2 4XUPA 4DRVA 1ZNPA 3PL0A 2W47A 1YQCA 1WMDA 1AL23 1DLLA 3USUB 4YPJA 1L3JA 1PO13 4U36A 2KD7A 1HXS1 2BNNA 3CHXA 2PFWA 1SBFA 2ZXQA 3N36A 5BNQA 1KDKA 4D69A 5BNPB 1AR81 2VUDA 4CEWA 3ACHA 3AKPA 1LR5A 3ZYBA 4UFHA 2ZGKA 4MXWB 5FQ0B 4A3ZA 2NZ9A 5F3CA 5JSRA 1V6LA 4ZY9A 5JSPA 5CYYA 4O61A 3C7OA 3ILRA 5JXHA 3PU8A 1US2A 3SCFA 1AJKA 3HNMA 5FKBA 4DUWA 1YNAA 3KHBA 3BU7A 5FUIA 5HXVA 5LY2A 3B94A 4AAXA 3MIHA 5CIRA 2J1AA 1RUI1 1WMEA 4K20A 2QQWA 4YG3A 4FPLA 2CGPA 4J1WA 2BFUL 1XNBA 2WDBA 1ND2B 1QJFA 3ATGA 1HJGA 3O12A 2TUNA 5F8PA 5FYCA 3WQ1A 3H0OA 2XJRA 3KGZA 1VBD2 5GLZA 4AAPA 4OQ8A 2D6PA 2BQPA 2E7AA 2ZPXA 4CCMA 4LIUA 1W99A 4B4RA 3VBOB 4LBKA 2AZ5A 3ZMOA 1JHNA 3IZOA 3LFMA 3FBYA 2D3RA 4Y5SA 1LRHA 2J22A 5HCHA 1IHMA 1PVC1 3DV8A 4CP1A 4BJ0A 1VBC2 3VBRB 2JKBA 1K42A 2BVVA 3WF0A 1H1AA 3CJIC 2AENA 4QPIC 5GZGA 5DXDA 1BEV1 4LE4A 2B5HA 3H50A 2QQNA 2BGCA 4DXTA 2ZGMA 4IESA 3VBSA 3GGLA 2DWRA 1QMJA 1U5IA 1R64A 5CU1A 2YY1A 3NJVA 2P2KA 3MPPG 3LPGA 3ZFFC 1F35A 2Y6FA 5J36A 3D3AA 3U4SA 4GH4B 1SPPA 4AQTA 1ENRA 1GBGA 1BQPA 2ZACA 4XFBA 1PIV2 4S2HA 1AYN2 4YGCA 2WS92 4OHYA 5JOXA 2EVXA 1NY72 1QQP3 3ACFA 3ZDSA 3POIA 2RS53 2VZ3A 1S2BA 1GUIA 4NPRA 2K2SA 5HI0A 4UW4A 1NCQC 2OXBA 1B35A 2OZ6A 3OUHA 4IEUA 1H4HA 3DXUA 5JR2A 3PTRB 2J42A 1VAVA 5FUNA 4BQXA 1O8SA 1JW6A 4GWNA 4IGOA 3VV1A 1TNRA 3VHNA 2IC1A 1F15A 3J7HA 1PMIA 3JU9A 4PQQA 5T5JA 5JVVA 4AG4A 3WD5A 4COVA 4Y1YA 2WN2A 3HVDA 2D6OX 3OEBA 5DAPA 4FQZA 4R9CA 5FXXA 4BHPA 1MS9A 5FO7B 2IVJA 2DUPA 4XQWA 1EV11 5A32A 3WW1A 4R9AA 1JHJA 4JGYB 3OSDA 1VBA1 2D98A 5FZ7A 4BQ4A 1QJX3 5DG1A 1H8TB 4XDOA 4LO7A 1SFPA 4CU7A 1UOGA 2J1VA 3IT8A 2R041 5FY0A 3HMYA 3LF7A 1QJY3 2X29A 3ZXLA 2NN8A 1MZEA 4IEOA 1RUE2 3GBGA 3THCA 1YI7A 2IVIB 2IXLA 3FFQA 4CP0A 1QDOA 4FTBA 1RL3A 4GJYA 4MGIE 3DYOA 1M06G 3WG2A 5KHGA 1HRV3 3VLBB 4RQPC 1VP6A 3PUIA 1W05A 4META 3SQOA 3ZYGA 4O9EA 4YW2A 1OF4A 3I59B 5DZFA 1LU1A 4GXLA 4CCDA 4BE3A 3L2HA 1RIRA 5JSOA 2XJTA 2CU5A 3U0ZA 3S5AA 5CZKA 2B42B 3I8TA 4IV1B 1VAMA 1FATA 1W8OA 5I8SA 3V64A 3ZFGC 1R093 1G9BA 3IAQA 4FP2A 3K77A 1Q56A 2ZS6B 3IPVA 1AX0A 3A4UA 1SLAA 3VKLA 4YVWA 1V9U2 5F37A 4Z1VA 1W04A 4XJUA 3IBMA 2VXRA 2NM1A 4KU8A 2ARAA 3AVSA 3VHOA 3UNPA 1EYBA 1V6MA 1EPWA 3MPBA 4UW5A 4XURA 5FZDA 3UKNA 2XH6A 2X8KA 4CXYA 4M3CE 1ZA4A 4AHXA 5A3TA 2AEZA 3RPQA 4FPKA 3NO8A 2WFF2 4LA3A 2JG9B 2HWE2 1JODA 2JDAA 1QXPA 1B09A 1W0NA 2CWSA 2WIIB 5G05L 1HRI1 5K0UC 3T1LA 1ULEA 3J8F3 3INAA 3S6PA 1H2MA 1OSGA 1AYM3 4IE4A 5FY5A 3VBFB 2FDFA 3AZVA 3CBNA 5E8AA 2GALA 1YC61 1X50A 3DUIA 3O0VA 4DQAA 2VOVA 5FPVA 3T2OA 1EAH1 4CU8A 3S0MA 3LKJA 5IWFA 1DDLA 2WQZC 2WZEA 4UF0A 4RA0A 3IWZA 2OVUA 4AQ2A 4QPWA 3FJSA 4P9WA 5BYNA 3I2JA 1UQXA 1LODA 4IEXA 1W6QA 3KCYA 4QU1A 1HN1A 5F5AA 2E7TA 1GOHA 3Q8EA 2ZX1A 2YBPA 3OBAA 1UU5A 1Y43B 3NMBA 4W65A 1GZWB 3PIGA 4GKYA 5FYUA 3U11A 3VDDA 3S7EA 1FV2A 1SEFA 3WQ7A 3I49A 2QQPA 2ZBJA 2DDUA 1UXXX 4LJHA 2GDFA 4XCBA 1XJAA 2D93A 4YZ3A 2TBVA 3WINE 3RSJA 4JKKA 2UY8A 4ONUA 4D8MA 2A75A 1SLCA 3V0AA 1QHDA 3SH3A 3H1WA 2IXKA 3BCWA 1A8DA 4QB6A 3WHTA 1LOAA 3VUOA 4HG6B 5FP8A 5T52A 3OPTA 3NQHA 4QB1A 4EWAA 5EXOA 3W9AA 4XUQA 2JDYA 2RG4A 2XL7A 3J7NA 4Q1PA 5C5TA 2KA3A 5IK7A 4NHLA 5FIXA 3UJOA 2DBNA 4BCUA 3ITQA 4ATEA 1R081 3MIFA 5M0TA 2MEV3 5GALA 1YIFA 2XB6C 1OC1A 1UWWA 4HETA 4NMIA 2BNMA 1FV3A 4Q4X1 2QNKA 4D6RA 1W9TA 4EZHA 1RXFA 4HOOA 2VVDA 2RMU1 2RS31 4UBGA 3JXSA 1CPNA 3KB5A 5GZDA 3AL6A 3UESA 2V09A 3NJZA 1AR93 1A34A 2WAAA 4Q4V2 3DPRA 4BU2A 4N9IA 2X10A 4W6XA 1OOPB 3OPWA 1IKPA 5FZ0A 3OYWA 1BZWA 4WM8C 2D5HA 4FT8A 2Z2SB 4K1ZA 1F9KA 3KZ4C 2Q0AA 3ZN4A 4HSJA 4DNYA 3WW4A 4QGLA 4NIDA 1OA4A 2H6BA 5F1RA 1FMD3 2QVSB 3M3EA 2YYOA 2XBO2 1B35B 3Q8AA 1QWRA 4D6SA 1COV1 2YC0A 2YDEA 2W0XA 5C70A 1XYPA 1ZBA3 2G1MA 4RL7A 5EV7A 3O1OA 2VMHA 1YXWA 2O8QA 2PA7A 3TWIA 4E8CA 5CFCC 4TLGA 4EN6B 5HXMA 3WZ1A 5FV3A 4DXRA 3JD71 4AVBA 2R071 4D7YA 4HN1A 3WNXA 4QM9A 5T50A 1UYZA 3C8XA 4XXAA 4IGPA 1JH5A 5LEJA 3M8LA 2LROA 3K4ZA 1AR61 5FZ8A 2ETEA 4ZS3A 3VZNA 1LHOA 2JD9A 1DGRN 2XJVA 1ZBE1 3BALA 4QAWA 5FZ4A 4CEYC 4COUA 1OKOA 2ID4A 4Q4W3 4ZHNA 3I4IA 2RS11 3MW3A 3JBG1 2IFRA 2CV6A 4QGNA 1N3OA 3VBUA 2GH2A 2ATFA 4IEQA 4XIOA 4CXWA 1TQ5A 5FMOS 1GV9A 4LBNA 2KM2A 1GANA 4QM8A 5CG8A 2XKPA 3QACA 4KG8A 2J1TA 2WKKA 1CAXB 2YPDA 3DKQA 3GZUC 1U0AA 2J1SA 4IV3C 4QX5A 3VHPA 3VZMA 1IS3A 4B4QA 3AMQA 1ZRCA 4GZ9A 3BOWA 4BLJA 2ERFA 1AR72 2ZGPA 3RZGA 4QPGC 4DIQA 5C3PA 1RUC2 3KV5A 1KJRA 2QDRA 1ULGA 5GKAC 1ASJ3 1YYNA 2JECA 2VUCA 4R4XA 3UGGA 5EJ1B 1Q8VA 5JOWA 3ZFFB 1FX5A 4CRQA 4YRDA 3K75B 1KS4A 2F4PA 1J59A 5HV0A 4M3CF 5AC91 3VDBA 1AUYA 5FXWA 4LMFA 2ZGTA 3RNSA 5J3UA 1D4M1 3Q8BA 3POBA 2UWCA 5GM0A 1W6NA 3LD8A 3ASIA 4WVMA 1OUXA 1DGWX 3THDA 5KHJA 1C8M2 4EYUA 1NCQB 2SBAA 4OUEA 3CL1A 1PO21 1C57A 4AFDA 4J25A 4GA9A 1Z0HA 3N9NA 3PJQA 1RMU1 2ZX0A 4K8RB 2XJQA 2ADEA 2R062 4LQRA 1G86A 3MO4A 1WKYA 1UZ0A 2BDRA 1NLQA 2W52A 5LBBA 3ZN5A 4LBMA 2HWB1 5C7GA 4YVSA 2HBTA 4O7XA 1WCSA 2YZ4A 1X9TA 2ZHLA 3HQXA 3I3DA 3ALQA 5LRRA 3VD3A 5JZGC 2BGPA 1RB8G 2GH8A 4BQWA 1VRH1 1ALYA 2XWJB 2R30A 4FPFA 4C0BA 2WSVA 4BIOA 2FDIA 5FXZA 1GWMA 1SCSA 5EWSA 4CDQA 3H8OA 3T09A 4Y5Z0 1W39A 3FX3A 3B93A 3FUOA 4GALA 1RUD2 4UF0B 4RHV3 1GU3A 3NAPA 1CZVA 5H9PA 4HKLA 2XXZA 3JB8A 2ZZQA 5EP9A 1YUDA 5K9YA 2VPVA 2RDQA 2QQMA 1TEIA 1W9WA 4ZU5A 3WQBA 1DGLA 4PLMA 5IVVA 2HEVF 3KQ4B 4XILA 5A80A 2ILMA 1UX6A 5ACA1 4RQPB 5CVRA 1E5HA 5DDJ2 3ZYJB 4QKDA 1MEC2 2VZPA 3PUAA 5JOZA 4JAAA 3M7AA 1UYPA 5BXXA 1R1A2 5J96B 2W1WA 4R9DA 4Z2WA 4RFT0 1E5RA 2X53S 3KWVA 4P00B 5A3UA 2B45X 4QQOA 4GMP1 1O3RA 3PUSA 4E27A 1O5UA 1K3IA 3B9IA 4NR1A 2JXAA 5LASA 3VKNA 5A3NA 3PVBB 4GB32 4XFIA 4AF9A 1GYKA 2PHUA 3BTXA 4CUCA 1GWKA 4XZUG 2R49A 2Q8CA 3ZFGB 1AL21 1UKGA 3LA2A 5DZGA 1PO11 5I0SA 3SXWA 1UIJA 1UPIA 2ZGNA 4TLFA 1SBDA 4LKEA 4B7KA 1REDA 2Y8KA 1OURA 1QOOA 2WN3A 3OD0A 4L97A 5FLHA 4XFGA 2D44A 5FCCA 1SFYA 5JR7B 1LOGA 3NNFA 5H9SA 3OUIA 1RUH3 5J09A 5DUXA 1PK6A 2JDNA 3LCPA 3RMYA 5A7SA 2VMIA 4LE3A 2WWUA 2X09A 1QJU2 3SMHA 3EMRA 3ON7A 5CFDA 3GHMA 3ZKYA 3ZLIA 4MGYE 2EA7A 2Q1MA 1LOBA 2TNFA 3DYPA 2VULA 1RUJ3 1HXS2 2BRTA 1YJKA 1T2XA 1NZCA 5K0UB 3KLSA 1PGW1 1RYYA 2LW8A 4XC9A 1HDKA 3AM2A 3USUA 1G9DA 5GLWA 1APNA 1LAJA 1HV1A 4IE5A 3FWEA 4IQPA 4QPYA 2VUJA 4CPBD 2BYVE 3AP6A 4LBOA 3T3YA 5BNPA 4IETA 3OYWB 1ZZ9A 2AGSA 1V6IA 3B9CA 1NQDA 1JS9A 4XXPA 5L19A 4D94A 4A45A 2FQPA 3P3PA 1FNYA 1W06A 4A7KA 3U4XA 2KXLA 4MXWA 3WDVA 2GAUA 1WLTA 2N7GA 3U14A 3H1MA 3K4DA 5FQ0A 3T4VA 1W8FA 3V0BA 4AEMA 1PZ8A 1XNDA 1QXJA 1OD3A 3I3EA 3ACGA 4LXLA 3I3MA 4W6YA 3ZO0B 3D5OA 2PXJA 1ND2A 1IS4A 1VBD3 3W20A 5DAWA 1W9FA 2J1EA 4BK4A 3A22A 2CY6A 4DMIA 2OZJA 1O6UA 4BYYA 4Q0VA 4CUBA 3BPSA 1VE0A 4U2AA 1UYYA 2NPIA 4RFRB 2E33A 1PVC2 3OGSA 3UGFA 5FFOC 4AEJA 1IPSA 5DMYA 4KBBA 4HLTA 3WCRA 3ZVXA 2Z69A 1DZQA 3FE5A 2OQ6A 1JZ6A 4JGZC 1DG6A 1D0HA 1VBC3 1BEV2 2FHRA 4XF1A 3VBUB 3WF4A 4BMBA 3H8XA 3I2DA 1BLZA 4P9YA 4AL9A 5IVJA 1YWKA 2XHNA 2RS51 2YC4A 4GWJA 4QKFA 2WSUA 1MQTC 3GZTB 4UAPA 3RJRA 1XSRA 1Z78A 5L9VA 3ELNA 5DUVA 4N9HA 4XDQA 2F17A 1ACCA 2HKXA 4COZA 4MSVA 3THPA 4XTPA 3J26N 3IMMA 2FBEA 1K45A 4W4ZA 1NXD1 1JTZX 2D97A 5E16A 4OLLA 4KWKA 2P1BA 3LDBA 4HL0A 5KXEA 2P6CA 1E5IA 3O1UA 1QOTA 1PIV3 5FOJB 1AL0G 2Y6GA 2F6BA 4PT6A 1CAVB 4CTEA 1DZRA 5C4WC 4NHXA 1RVF2 3J9SA 3O1SA 1UY3A 3D8CA 4ZS2A 4G3YC 3LPFA 5IAVA 1QJX1 4WM8B 4C90A 2HLEA 3IIAA 4X6RB 4YW7A 4FQ4A 1O8PA 2Y6KA 2D43A 4QX3A 4CCOA 1J3PA 2AR6A 2XR4A 2JD4A 2WAOA 2WINB 4FPCA 1RHI2 1SACA 4XF0A 4JDMA 1Q5OA 1L7QA 2WWJA 1QJY1 2H0BA 1U5YA 4FXKB 1JYTA 2ZEWA 1BMV1 1XU2A 2VBPA 4NHMA 5CFCB 2VMCA 3W5MA 1ULFA 1VBA2 4XACA 4XHBA 4IGQA 4XFHA 3JCIA 4NRPA 3ZM8A 1GNHA 1HRV1 3OGVA 2JE9A 1IKQA 3UKVA 5IJRA 3WDTA 5LZ6A 1UY4A 1C1FA 3TNPB 5A6QA 2VCCA 4RR3C 4DOUA 2DFCA 5APAA 4FPOB 3FZ3A 2G19A 4MYEA 1MS1A 5DUUA 3HN3A 4BK5A 5IFPA 3VKMA 1H8TA 3ABZA 3PMEA 4Q5OA 1UY2A 2YFZA 1YFUA 3WF1A 2C6SA 5FPZA 1GZCA 4CEYB 1S0CA 1VMJA 4BLIA 2RV9A 1RUE3 3B7MA 1WCKA 5LRSA 1R091 5DUWA 4XVHA 4MLOA 3ILFA 2G9FA 4Y1VA 2W2IA 2ZABA 3LEIA 4XYXA 2OYZA 4N90A 3IN9A 1T6BX 1TME2 1US3A 4IV3B 4HFSA 5LK5A 1BVVA 1JOJA 1BK1A 3B02A 2FDJA 4E4SA 3GZEA 5AFBA 2VCAA 4QPGB 3UETA 2BERA 1OI6A 4FVVA 4N7IA 1UOFA 4XIKA 5ABJC 1KD7A 2DF7A 3NKGA 4CCCA 4XBLA 3WNPA 3DECA 4UW3A 1LHWA 3J8F1 2VL4A 4IV1A 4LA2A 3LA3A 2D6KA 5A7QA 4QKBA 5C3SA 1V9U3 1AYM1 1HB3A 1HB4A 2WABA 4QMAA 3S7IA 4FFHA 2B9UA 2W94A 4CDUA 2A6VA 4MGQA 4XF9A 3DEMA 2VZ1A 3GYDA 2R1DA 3OCPA 3LDRA 1CJPA 1UL9A 3KCCA 4XCAA 1ZYBA 4GJZA 4ZZ8A 1JZ3A 5FYIA 4K3UA 2WFF3 4RSUA 5DPNA 5JUVA 2HWE3 3AJZA 5F32A 1XE7A 3K51A 4IERA 2CDOA 5F2WA 3R4UA 4FFIA 4B1MA 2V5YA 2JG9A 1PK6B 5I91A 4ES9A 4R4ZA 5IVCA 1JN2P 4IEVA 1FXZA 1XYOA 2YPJA 1WA4A 3BVCA 4XZPA 3JQXA 3IDCB 1EAH2 1Q43A 3ZXAC 2GP5A 3VBFA 1PNFA 2J1RA 1WZXA 5A6YA 4JRLA 2ARXA 1F2NA 2A70A 3PJYA 4Q26A 1IS6A 4BIFA 4DO0A 2W3JA 2PHXA 4TXWA 4X6QB 1NLRA 3WDWA 4QHBA 2WO2A 3LIHA 1ZX5A 3X29B 1HJFA 3KT1A 2WNUC 4I30A 3VKOA 5AVPA 5FZBA 3U07A 3H3LA 4JQRA 4ISQA 3SITA 1STMA 1GZWA 1FPN3 5F3GA 3V0BB 4E4DX 3EQEA 3FC0A 2MEV1 1QF3A 2BJSA 1G7YA 5FZOA 5JPNB 3MYXA 4RGKA 1CQ9A 1ZM1A 3WCSA 3I3BA 4K40A 2B46X 2GC0A 2ET1A 4K21A 2R6QA 3ZMNA 4BDVB 5I93A 2XG3A 2VM9A 3D6EA 1VR3A 3Q9OA 3NV3A 4EV0A 1X33A 4TTGA 1E57A 1S0IA 5GLUA 2W91A 3KSCA 4Q2FA 3VGIA 3RZLA 1GP5A 2JIGA 2HWF2 2WO7A 5FP3A 4NIIA 2VOWA 2XWBB 1R082 1D2SA 1AR91 1Q3EA 1YO8A 3A21A 2R16A 5K4LA 3ZXEA 2YGMA 5T54A 3SCHA 2VMFA 4HVOA 4M01A 1OLME 5FYHA 5A7NA 4Y22B 3WNNA 3E5QA 3SKJE 3H3UA 3ENRA 5LATA 4Q4X2 1GQGA 3AMHA 5D1IA 4Z8BA 2Z4FA 5JXGA 5KHKA 1LOFA 2ZHMA 3CU7A 2RMU2 3MIBA 2RS32 1FMD1 1KFXL 2VZTA 5DQ0A 2XJUA 3UYJA 2WNOA 4B1LA 5FMOL 4XAAA 5B4XA 1SLTA 3AYDA 2ZZJA 2QJVA 3BTYA 4QU2A 4NUBA 3WV6A 1ZBA1 2MPFA 4LO8A 1VPHA 4KWLA 3UV9A 4AVSA 3PU3A 4OZOA 4Q4V3 5JXIA 1SMVA 2P3JA 1LNSA 1VJ2A 4UW6A 4AQSA 4NPLA 1XOYA 1OOPA 3APBA 4CCLA 4OHXA 3H8RA 1K5MC 1WMFA 2OW4A 4CVUA 4PDWC 4ZONA 1N3PA 1SQ4A 3OBZA 1OH3A 1SBEA 2VOXA 2VW0A 3WVJA 1OPMA 4AR2A 5CADA 2XBO3 1UYXA 3GBFA 4Q4W1 4W50A 4MGZE 1WBLA 5C33A 1Y9MA 2CNAA 1HLCA 1ODMA 1W0OA 1J58A 3K46A 4V2WA 3OY8B 3NVCA 1KJLA 4FOQA 2XJSA 1MS0A 5H9RA 4DZGA 4M3CB 4ARYA 1CAUB 3AP9A 1PGL1 2ZHKA 3HPNA 4A7YA 3ZYHA 4CU9A 3I2GA 2YBSA 1M4WA 1AR62 2GP3A 3WP6A 5FY1A 1RJ8A 1I5PA 1CIYA 1NCRC 1YRZA 1ZBE2 3AX4A 3AZWA 1TNFA 3VBRA 4YNIA 1ULPA 5FZHA 1I3HA 3O1PA 2PAKA 1W90A 1RUG2 2XONA 2VU9A 4OYUA 1ASJ1 4RD7A 3MLKA 5DAVA 2G9ZA 4JHZA 1JYWA 1RUNA 4ASLA 1F5JA 5GZFA 2A1XA 3MFCA 3LEGA 1JZ4A 4FFGA 4TWTA 1CONA 1VMFA 2P37A 1Q8PA 1H6YA 4AVVA 3THTA 2QQIA 3GNEA 3MEPA 2NP0A 4JGZB 5FZGA 1RUF2 3AZYA 2EXJA 4JDOA 1NG0A 4Y3OA 4A3XA 2XQRA 1CAXA 1JZ8A 1MQTB 3CJIA 4QPIA 1AR73 1W0PA 2YU2A 1AZDA 3K3NA 2DVFA 3U1XA 3WLUA 1UAIA 1NXMA 2X5IC 1XNTA 2IZWA 4FPEA 1OHFA 4QX2A 1QGLA 3OD4A 2E31A 4XFAA 4SBVA 3WG3A 3OBRA 5EZWA 2O8OA 1VRBA 3RZMA 5IYYA 3ZFFA 2R1BA 2R0HA 2RR13 4AZZA 4AEKA 5IVFA 2RJ2A 2C9AA 4LUMA 4AHYA 5C4WB 4A6SA 5E1RA 2ORZA 1C8M3 2O1QA 2UY9A 1C1LA 3ZXJA 1MS4A 1URXA 2ZEZA 1N3QA 3B5LB 3ST7A 1RUOA 1L7LA 1NCQA 2ZGSA 4FOVA 3HN1A 4EN8B 2YB7A 4ZPIA 4CCEA 4A44A 4CDUB 4ASKA 5CEHA 2FMYA 5BY5A 4Z2AA 4A7ZA 4AEDC 1PVXA 5FMCA 5C8CC 5JPMB 3ZYRA 4FO9A 4EWEA 4RHV1 4GKXA 2R063 2RDRA 4GMP0 1LGNA 1H1IA 1X8MA 4WVVA 2WNVC 3RYRA 1XC6A 1I9RA 2WA4A 4I02A 3GJBA 4HBNA 1VRH2 1O4ZA 4C91A 2UYAA 2V72A 4MHRA 4Z82A 1KQRA 4OMCA 3A7QA 5LWBA 4XTMA 1JI6A 3G6JB 3N7KA 2AC1A 4RR3B 4WM7C 2Q4SA 4N53C 5ANNA 3VDCA 1W2TA 3KQRA 3KV6A 3LWCA 5FYZA 3GALA 2VJXA 5FP9A 3KCXA 4FI9A 3ZFEC 2C1FA 3RMXA 1RUD3 3V56A 5HCAA 3WG4A 5EPAA 2XKOA 3NNMA 4XBNA 4JX0A 5F6KA 1I6XA 1ULDA 2D3PA 2FZ1A 2W9XA 5FPXA 4J6GA 2C4XA 2CAVA 4GD4A 5ACA2 1OD5A 4LR4A 3NV4A 2VAUA 2OT7A 5C3QA 5LB6A 3AKSA 4HANA 2XPJA 1LEDA 5DDJ3 1NA1C 1WD3A 2QUOA 2ZEYA 1O7FA 4AGVA 5JDBA 4DINB 2FDGA 4RQPA 1R1A3 1RUH1 2W46A 5FZOB 1OBNA 4MV2A 3S5QA 1GOGA 3HOBA 3AMPA 1SFNA 3P6BA 2VH9A 5FY7A 5ABJB 2VNGA 1SCRA 4GB33 4N43C 4BQ5A 5IK5A 5LA2A 1CZTA 2JE8A 1RUJ1 2CYFA 2K9ZA 4ES8A 5JIUA 3OEAA 2E51A 1POQA 3OF1A 1OQ1A 1LHVA 1ND3C 2WR9A 1TMF3 2ZKLA 4XW3A 5IW0A 3ZFGA 3WNLA 3ZSJA 1IQAA 4BXSV 1D4VB 2ORXA 2YC2A 4I09A 4LIVA 2QE3A 1VBE2 5A6XA 5IVYA 3ILNA 2DTWA 3WY6A 2W1UA 1NAEA 4F8AA 5L73A 3VBHC 1HX6A 5IATA 1QJU3 1O4YA 3TN91 4H55A 1DYKA 1XE0A 3RFRA 4Q0UA 4W6WA 3O1VA 1KXGA 1PGW2 3WDYA 2DVDA 4HXCA 5FDBA 1HXS3 3C7GA 3K3OA 2VG9A 2WRAA 4CDWC 1LB2A 4LLFA 1LEMA 2OUHA 2QZ2A 5K0UA 3PHMA 2AUYA 4UFIA 1DHKB 4K1YA 1AXYA 4Y1XA 1EP0A 4AI3A 4QD2A 1YHFA 2XLAA 4QWNA 4MH0E 1IPKA 4FTSA 3RG0A 1VBD1 5FRAA 1D7PM 4K7JA 2YMZA 4AE2A 1JYIA 3ZXFA 3FUQA 5G04L 3RZHA 3HT2A 3WDXA 3WUCA 1GP6A 2GNTA 5C9AC 2IXIA 2OS2A 3PVEA 2E7QA 3VD5A 3MZHA 4ATFA 1W2UA 1DLCA 4WBBA 3E5XA 1W8UA 2WNUB 4YM3A 2RM22 1HB2A 4QDSA 2JWPA 4JCKA 1KS5A 1JYCA 3SC7X 1VBC1 3RZZA 3H9AA 4NRMA 1O3QA 4LHKA 1I5ZA 1A78A 2K0GA 4AYUA 1JUIA 2OPWA 3CIHA 2HWD1 3CO2A 2P3KA 5KWRA 1IZ3A 4LBQD 2FCVA 4QXKA 3RRDA 1XNKA 4CDXC 2JEMA 2HWC2 1A8MA 3ZR5A 1H2LA 4LHNA 4QB2A 4LO5B 3HT1A 4YW3A 5GLVA 1PIV1 4AW7A 4FPHA 1LHNA 4LORA 2XGXA 1V6NA 3B01A 2P6HA 2Q8OA 4B8EA 4F7ZA 1NY71 3BTZA 3LAGA 5F2SA 2A73B 1V6OA 3AKQA 2EXHA 2DU0A 4V2VA 4PIXA 5BNNC 5IK4A 4EZ4A 1UN1A 5FYSA 2BFUS 4PJYA 1WWYA 3NV2A 4V1PA 2EIBA 4EWDA 3RYPA 3H8UA 3IM0A 2VOKA 3Q8CA 4DY3A 3CJIB 4QPIB 4XJAA 5IT6A 3R4DB 1FOD1 3PUHA 5T5OA 4MZUA 1ZRDA 2J1UA 1J1LA 5IFTA 1RVF3 3RQ0A 4CP9A 1NE6A 5K8SA 1CAVA 1HKDA 2I07B 1HQNA 3ZN6B 4CUGA 2ZKNA 4UYBA 1QJEA 3F2ZA 1KFUL 1NT0A 2Y26A 3RVHA 4LKSA 2TEPA 4WM8A 2AREA 4PDWB 4Q4Y2 3ZPOA 1AX2A 2YUEA 2DTYA 4FFFA 1RHI3 2JDUA 3K4AA 4HK8A 2DUQA 5FZKA 1BMV2 3MW4A 1UXZA 1YQ5A 2W39A 4GWIA 2ZOEB 3NJYA 3WHUA 4D7SA 4CPBA 1RUE1 4CA9A 3A0NA 2V73A 1G6NA 2MNGA 5FLJA 1VBA3 2PLV1 4MGTA 1NKGA 3VHRA 3PTYA 3T0DA 1PM4A 3GZAA 4H3WA 5FMDA 5CFCA 5JCTA 2DCYA 1JZ2A 2H6CA 2VOTA 4JKLA 3EYPA 1GNZA 1UMZA 2VZSA 3AC0A 3BIEA 2A3YA 2LRPA 2VZQA 4KL1A 5HBAA 5L7OC 1KRIA 1WW5A 5A1FA 1POV3 4R52A 4AI1A 1NCRB 3T2PA 5T5PA 3CLPA 3LOIA 3E97A 4RGAA 1H9PA 4E9KA 4UXAA 1WLWA 3ZSEA 3RI9A 2C24A 5CFDC 5BNOC 2Y6LA 3AL5A 3FHAA 2D6NA 4L92A 3TBDA 2ZGQA 3UJQA 4A42A 4AFCA 4CEYA 1ZZCA 5AFEA 1V9U1 2QZ3A 1F4HA 1MZ6A 4FTEA 1O3TA 3E6CC 3LB9A 4PQ9A 4ARXA 5C5UA 4XUOA 1GLHA 1TME3 2VW2A 1SLIA 2E53A 3OGJA 5FPLA 2A3WA 2VE1A 2XMLA 2E6VA 5E6HA 2B9VA 3BKZA 5GZEA 2GNMA 2MHFA 1VBB2 4F83A 4IV3A 1VALA 1JU3A 3UKTA 2BWAA 2WFF1 2CGOA 5FPAA 2HWE1 3M70A 1ZZ6A 2X5IB 4QPGA 5JWPA 4XJZA 3T2QA 4P9IA 1F8VA 2VW1A 3KF3A 3MLJA 1E5SA 1DGRA 2JDHA 2VTXJ 4EN9B 4EJRA 2W68A 3GM8A 1UKRA 3R05A 4OUSA 2BUKA 5FJHA 2VCMA 1H8VA 1U5XA 3AZXA 3ECQA 3PVOA 5F5IA 2W1SA 5DABA 2O0OA 3E6DA 1NX9A 3BPZA 4AI8A 3ZX7A 5FWEA 2P4EA 2XVKA 2HJIA 2WZR3 3WNMA 1V6JA 1BBT2 1W8WA 2YGLA 2WA3A 2BOIA 2HYKA 5KXCA 3ZOIA 1GQPA 4LKFA 2WJSA 2ZX3A 2ZX2A 3M3CA 3H7JA 3OGGA 4AEDB 1QIQA 2EF6A 3ES4A 5C8CB 4RN5A 3AMMA 1KGYA 5KXDA 1G9AA 3RS6A 1Z7S2 5B4NA 2WNVB 1FPN1 1EAH3 1ZREA 4CSWA 4I3PA 3WF3A 3SEEA 1OA3A 3MV11 5FZAA 1BCXA 5JZGA 3SNMA 1DZTA 3VBOC 3WXPA 3IB3A 3AP4A 1AR82 4WM7B 3ZPYA 2NYYA 1YQ2A 4N53B 3ES1A 1CPMA 4WVZA 2PHDA 1XSQA 1C28A 4QX0A 4BQ1A 4DS0A 4EROA 4NAMA 1W8ZA 3OOXA 1PMJX 4KH9A 4A4AA 3TB0A 3MUZ1 1V0AA 4YW5A 3AXEA 1DU3D 2JICA 3QH7A 2WT2A 4ZU7A 4O65A 3SEPA 5J7MA 1NE4A 4XQ4A 3I7DA 1RUI2 2QQUA
chains in the Genus database with same CATH topology
4ZXKA 3T1MA 3H3ZA 2WQ4A 1NA1B 1OA2A 1S0JA 4GH4C 3RYKA 2YV8A 3CF6E 1AR92 2HWF3 4QQPA 4TYSA 4UBHA 4DXZA 4Q4V1 3C2UA 4YGEA 3D4KA 3MDPA 2EXKA 3D0SA 1ND3B 3VZLA 4NWWA 3LOBA 4Y22A 4YLZA 4KGQA 2EIGA 2ZA9A 1XQNA 2PHFA 1YIPA 2RMU3 2RS33 3N3HA 4CZSA 1QQP1 1ZBA2 2XBO1 4YARA 1YJLA 4XOGA 2GMEA 3G7DA 3U10A 5JMCA 3VBHB 3NW4A 1FNZA 2UWAA 4JGYC 1CR7A 3D0JA 3AKRA 3FLPA 5IK8A 3VZJA 1FYUA 4AFBA 4DY5A 4HSLA 5JI7A 5CAZA 3O14A 5CG9A 5I0TA 3KT7A 2UWBA 1WGPA 2ET7A 4JDNA 4BM8A 3BB6A 5FO8B 1YFXA 3P3NA 3O7OA 5CB7A 1AYN3 1YLLA 2WS93 4FPGA 4P9GA 4Q4W2 2ZGOA 4XF4A 2UU8A 3LSDA 2JG8C 4BA6A 4BMEA 4L99A 2DVAA 1CVNA 5D8AC 5I8TA 4XPVA 4Y1ZA 1PGL2 4LHLA 4BPZA 1A6CA 4S2FA 3R6SA 5J37A 3OY8A 1AX1A 1WBFA 5L36A 4WZCA 2XVGA 4JTOA 4M3CA 1CAUA 4OI0A 1GSLA 1LHUA 1EV12 4ORFA 1FT9A 4AQ6A 1REEA 2DURA 1ASJ2 4KQ7A 1AR71 2NMOA 3AYEA 3HR9A 1RUG3 4HPKB 4XMIA 4FCAA 4CDXB 5J48A 4FOYA 4LO6B 2R042 3ZSMA 4YG6A 2RR11 4PIZA 2NMNA 1N1SA 2QCSB 2DCJA 3QD6A 4XBQA 1CD3G 4PCRA 1RUF3 2DCZA 4MXVA 4RS5C 4JGZA 1X82A 5BNNB 3SH5A 1MQTA 4XFCA 1CAWB 2D40A 5CNAA 2OUJA 2D7FA 2R061 2A71A 2JE7A 5JLVA 1UZZA 3SCGA 1C4RA 4LLOA 4NHKA 4XJWA 1PHMA 2WT1A 5C6CA 3AKTA 5C4WA 4CEWC 3VL8A 1GKBA 4AGRA 2DFBA 2GN7A 3IMNA 1DGWA 1ZZBA 2EXIA 1W6OB 4TZDA 1LESA 1RUD1 4YG0A 4BZ4A 1IS5A 5F6LB 4KNCA 4AVTA 3MW2A 2WL1A 4FAGA 1DQ5A 1HRI2 2IFWA 2Q30A 4PLNA 1ZVFA 1LJ7A 3ZIXA 3DKWA 2A7AA 4LBJA 3VL9A 3TRSB 4NWVA 5DDJ1 3WQ0A 1DQ0A 3ACLA 3AYAA 3ME2A 3MIEA 2I45A 4HZFA 5L7OB 1N1VA 1R1A1 4RR3A 4RGGA 4MGKE 4BOWA 5IUQA 4OI4A 5JZGB 2VMGA 2DCTA 3SHRA 4GB31 4ISRA 4KU7A 5JI9A 4XFFA 5BNOB 1GQHA 5BPXA 1TMF1 4Y24A 1H9WA 2JENA 4L9BA 4IEZA 1JBCA 2W08A 4OZXA 4XJ9A 1CGPA 3AK0A 2XLFA 2ENRA 3J4UH 4YM0A 3VBSC 1YI9A 2LTNA 1FAYA 2ZCWA 1ONAA 5HCBA 1QJU1 4KG0A 5EFUA 5FAXA 3WX5A 1CJDA 2BNOA 2XHKA 2YXSA 5ABJA 3WOGA 1IPJA 3EHKA 3N7JA 1YFYA 3N7LA 3RJ2X 5C8WA 1MACA 1J1TA 3WUDA 4HN0A 1W6PB 3CJXA 3WG1A 1VBE3 3QBQA 1LULA 4H7MA 1B35C 2CWMA 4K9SA 1VIWB 5CA6A 1PNGA 3TN92 2IXJA 1WW6A 5KHIA 3HWJA 4QQ2A 4O9GA 1VB4A 1PZ7A 1UU6A 5F9TA 4FPJA 4FOWA 4ASMB 4YZ5A 2I2SA 1UU4A 4HMZA 1ENSA 3NSTA 4N7UA 1RGSA 1UW8A 1I1EA 1CESA 3R0RA 2R32A 2YHJA 1EY2A 4DFSA 1A3KA 2GC1A 2RHPA 4P9JA 3MGUA 1ZRRA 4XE9A 4E4ZA 2D6MA 2P17A 1MR5A 3A0KA 3O5SA 4OHZA 3GF6A 1RJ7A 1AHSA 2QDNA 1COV2 2RM23 1Q8SA 4OI2A 2WZPP 1UIKA 1Y9QA 3ZYPA 1H1MA 2WNUA 4KGGA 1OLRA 4FAHA 5FO9B 2ZJCA 1BYHA 4E2QA 1VAKA 2XJPA 2P34A 4X8NA 2HWD2 1XNCA 3JD72 2I74A 4INDA 3M1HA 2R072 4NVPA 5KHHA 4BWOA 5BUVA 2D3SA 2ZGRA 4YM2A 2XUMA 2BPA2 3PMSA 1MZ5A 3FLRA 4B3NA 2GC3A 4YZ1A 3PLQA 1MS5A 1ZZ7A 1AF9A 3TYJA 2HWC3 2RJLA 3FBMA 2D5FA 2ZAAA 1IGOA 2RS12 1BKZA 1LOEA 3JBG2 1XU1A 4YVWC 4DRRA 1RVF1 1FI2A 1O91A 4XQDA 1W6MB 3AXDA 5A3LA 3M2MA 4OULA 1MS8A 3ZSKA 4FSJA 3O0XA 4ZKTB 1LOCA 2VECA 4JC1A 1QH6A 3POYA 2XVLA 5FTTC 1FOD2 3HIFA 1RHI1 1NLSA 3KT4A 4HVRA 3ZYIB 2GN3A 3OPZA 1QDCA 2DV9A 4QT6A 1QNYA 4FP3A 1RUC3 1GICA 4Q29A 3LGRA 4YGBA 1AJOA 2WT0A 4Q0PA 5A33B 5AC92 3VKFC 3JUUA 1D4M2 3ZN6A 3EJKA 1LGBA 1POV1 3HBZA 4Q4Y3 4S2GA 1K5MA 5KC5A 4PDWA 1QU0A 1GFF2 1H0BA 4Q0SA 1DQ2A 2P3IA 4TSVA 4AFMA 5LEKA 1PO22 1SLLA 2JG8B 2PLV2 3M3OA 1RMU2 3O0WA 4FBFA 4YZ4A 2QFEA 1OQDA 5D8AB 3VDDC 2YROA 5EYYA 1S0FA 3MICA 5HCFA 1LU2A 1HIXA 1LGCA 3VZKA 3QH6A 4IXLA 4I0BA 3VZOA 1ULCA 2HWB2 1TME1 5LK7B 2CAUA 4ZU4A 1WCDJ 2VQAA 4Y4YA 5E89A 2Z42A 4M00A 3DL3A 3VN4A 1NCRA 2XL9A 3WR0A 2ZTNA 3KD4A 4C1WA 2PN5A 3WP3A 5KBFA 1WLCA 1NQJA 2ZGUA 1MVQA 4LBQA 1V00A 2PHLA 1QY4A 4XMAA 1WW7A 4RS5B 2Q5TA 1VBB3 3GBWA 4C1XA 2WZR1 3JB4C 4LTAA 2UURA 3AB0A 2VUAA 2ZHNA 3V65A 3N35A 4Y20B 5I8YA 1MEC3 2ZMLA 2X5IA 4AI2A 5F5QA 2CGNA 3BTAA 3DPRC 5GLTA 2VQ0A 1UF2C 4I01A 1XRUA 3TOJA 2E63A 2C5DA 4NO4A 1AL22 4FXGB 3MIGA 1PO12 1RC6A 4YYOA 1REFA 2ARBA 4P5HA 4CEWB 1X7NA 2PHRA 2VY0A 1D0GA 5K7PA 1BBT3 4WZFA 2GNBA 4YFWA 4K8FA 3BOPA 1CN1A 1QKQA 3L2YA 4P14A 1H4GA 1UZYA 1FPN2 3DGTA 1F31A 4AEDA 1Z7S3 3DN7A 3KMHA 3LA7A 5C8CA 1N47A 4Y1UA 1G9FA 2CTVA 1XXNA 2PQQA 1AVBA 3GHNA 2WNVA 2VNRA 1OKQA 5DZEA 1LECA 1KITA 1AR83 1D2QA 2OPKA 1AXKA 2HEYF 3HAGA 4K6BA 4Q8KA 2WLPA 1Y7BA 3IKWA 4L8QA 4WM7A 1G8WA 4N53A 1VB2A 3UL2A 1UCXA 2HWF1 3VBUC 4AFAA 5EYXA 2VVFA 2BBVA 3ZFEA 2DCKA 2PELA 1PGSA 3LZZA 4YW1A 1RUI3 4EN7B 1G9CA 2ZAHA 2FZ2A 4HK9A 4LNVA 1Y3TA 3VBSB 1NA1A 4WVWA 1S2KA 4GQ7A 1T6GC 4I0AA 4JV4A 1F5FA 1U5ZA 1DYPA 1CX4A 2GMPA 1DIWA 2B39A 1ENQA 4N43A 4Q1RA 1SLBA 2A6XA 3QLQA 1PVC3 2DVBA 3B00A 3POSA 4YFZA 1ND3A 2BWCA 2NQYA 1QQP2 1AYN1 2RS52 1QJZA 4YSFA 2WS91 1BEV3 1XE8A 2CL2A 2DUOA 1DFQA 1RTVA 2OA2A 1X36A 3NV1A 4LULA 3BODA 4G9SB 4AI0A 1XYNA 4DPNA 2VVEA 3C3VA 4OVEA 3VBHA 1S0BA 4XHXA 3KGLA 3AZZA 4LT5A 4YVSC 2NLRA 1J3RA 1MVEA 4H7LA 2QKDA 3QOPA 5A32B 4CDWA 2GSYA 1IOAA 4XF3A 1Q8OA 3MF9A 1JXNA 4E2GA 1QJX2 4AK3A 1LTEA 4CDQC 3B69A 2GC2A 1RUG1 3KS7A 1K5MB 5JOYA 3NAPC 2LUWA 2PAMA 1HW5A 1OFNA 1S0DA 3RI8A 1V70A 1QJY2 5A3MA 5C9AA 3NKTA 4Z07A 1C8NA 5I0UA 4GULA 1RUF1 2A5ZA 1S0EA 3SH4A 1EV13 2VNOA 1HRV2 3AJYA 4L11A 2UYBA 2DVGA 5TSWA 4AGGA 3L9JT 4YZ2A 4AXOA 2R043 4HPKA 2RR12 4IEPA 4CDXA 4PBOA 2D6LX 3B3QE 1WD4A 4QQHA 4A2UA 1EPZA 4R8HA 3SLIA 1UPSA 5BV6A 3IPVB 1WLDA 4KWJA 3ZXGA 1R092 4IL7A 4YVWB 3E5UA 1GR3A 5FLIA 2G4IA 3HD8B 3EO6A 5SV8A 4L2NA 2H0VA 3NWKA 1YFWA 4LBQB 4SLIA 3FFZA 4LEJA 3USSA 4OHWA 2DU1A 1PK6C 3IDBB 5BNNA 1O3SA 2WWSA 2BVBA 1CAWA 2Y0OA 5CFDC 1N1TA 2FMDA 2PAEA 3W58A 1LENA 1OPOA 3WP4A 5FBZA 4P9LA 3J8F2 2WLQA 3K48A 1JUHA 1AYM2 5JIAA 5BNPC 3MIDA 3OTFA 2GZWA 1LCLA 1C5IA 1C5HA 1U12A 2ES3A 1W6QB 5E88A 1BXHA 1OLQA 1W6OA 2XLGA 3EBRA 2B7YA 2EAKA 3DF0A 5H9QA 1OMIA 3VDDB 3WT3A 5KC6A 1HQWA 1HRI3 3PVNA 4WV8A 1NOVA 1GZ9A 3JZVA 4M0NA 5T55A 4AVAA 4LUKA 3TNQA 2Z5WA 4NN0A 1QXRA 1ND2C 3AFKA 1LKNA 4HT1T 1MZFA 4AVCA 4Q0QA 5EJ3A 5L7OA 3V0AB 2LALA 3N7MA 4EN0A 2JJ6A 1PZ9A 4COYA 3N4MA 3ETQA 3M3QA 2PHWA 3WP5A 2EAAA 1WW4A 4M0HA 1TMF2 4OHVA 1DQ4A 4GIQA 1KDMA 5BNOA 2BEOA 1N1YA 1H2KA 3AYCA 3VBRC 3ZFEB 2R0FA 1VBE1 2AH2A 1WUVA 4Q27A 2ZMKA 5GJ6A 4BH9A 3FMGA 2JDZA 1ZZ8A 2MEV2 3FHIB 1DQ1A 3OBTA 4XJ8A 1MS3A 4AHZA 5FREA 1HV0A 1SDWA 4XEZA 3OJBA 4B29A 1S55A 4CYDA 2AYHA 2Z79A 4X8PA 4Y26A 2WC2A 1ENXA 3WW2A 3BIWE 4QGMA 3RWNA 3CNAA 3DPRB 3POWA 1QH7A 3T2TA 4HKWA 2IXHA 1R083 5T3NA 4N43B 1W6PA 4URTA 2BW8A 1NYWA 3TN93 1OQEA 3JQWA 4MUVA 3AMNA 4D3WA 3I54A 4FPYA 4I3GA 1R1ZA 4Q4X3 3URFA 1FMD2 4COWA 3QCWA 4MVTA 3W59A 5KXBA 2RM21 4LO4B 3AP7A 4R9BA 2HEWF 3D82A 2ZGLA 4CP2A 2ZX4A 2GU9A 5DG2A 4B4PA 3MLLA 4AHWA 2JX9A 2WNEA 3LSEA 3M3IA 1H8TC 2OIIA 4CDWB 5T5LA 4C0HA 3ROUA 3VBOA 4PF5A 3PNAA 2HWC1 2EALA 2LM3A 3SISA 4IEYA 1J3QA 4XETA 1COV3 1X8EA 4HKOA 2Q1ZB 4HVQA 4S2DA 5C9AB 2HWD3 3JD73 2R073 4OI1A 3MF6A 2BTVC 3MFAA 4QQLA 2A6ZA 2VGDA 1POV0 1AR63 1ZBE3 4GH4A 1BVP1 3M4FA 1O4TA 2RS13 4IV1C 1RUC1 1DBNA 3JBG3 4H14A 2A6YA 4PLOA 3KM5A 1S0GA 4G4FA 1VLNA 2G9GA 1C3HA 1W6MA 4CDUC 1W6NB 4WVMB 1AXZA 3RDIA 4Q4Y1 2C0ZA 1FOD3 2ZMNA 4JRAA 5FOBB 2PYTA 3E6BA 4PIYA 1V6KA 1C8M1 2JG9C 5J98B 3S30A 1QOSA 2WFPA 5SV5A 2GMMA 3WDUA 4DB5A 4JGYA 5AC93 2B8MA 4YVSB 3AP5A 3VBFC 1Q8QA 1S1AA 5A33A 1D4M3 3ZSLA 1DF0A 3TAYA 2PTMA 1H30A 4LBLA 5JAXA 3ZIWA 4YGDA 2IWGB 3ZXKA 3IDEA 5I0RA 1OFSA 3MI8A 1PM7A 3AFGA 4CDQB 1HQLA 3FLTA 1PO23 4MX3A 2PLV3 3WW3A 1RMU3 3H7YA 4OUMA 2JG8A 4OFGA 3NAPB 1TE1B 4IEWA 4RHV2 5D8AA 4YW4A 1RITA 1ZRFA 1YCIA 4NOTA 3EXUA 2E9QA 4ITCA 4I2OA 2DYCA 4J1XA 4B7EA 2HWB3 2A6WA 4GWMA 3ZXDA 4F3JA 5AVAA 3I59A 1VBB1 2A3XA 4I0WB 1VRH3 3UK9A 4D7TA 1MEC1 1DQ6A 2Y38A 5GZCA 2RJKA 3H1YA 4AWDA 4JTNA 1CIWA 4P9XA 3R4SA 1RINA 1QNWA 2IXCA 4E2SA 2WZR2 1UD1A 1LOFC 4JVAA 4RS5A 5ACA3 2RE9A 1H2NA 1O5LA 5B2GB 1BBT1 2PHTA 4PBPA 4Q8LA 1RUH2 3NL1A 2GNDA 5CFDB 4GMP3 4YM1A 3CEWA 4Y20A 4Z92B 2SLIA 1Z7S1 2Y0IA 1OOPC 1BJQA 1RUJ2 4DRVA 1ZNPA 3USUB 1WMDA 1AL23 1DLLA 1L3JA 1PO13 4U36A 1HXS1 2BNNA 2PFWA 1SBFA 3N36A 5BNQA 1KDKA 4D69A 5BNPB 1AR81 4CEWA 3AKPA 1LR5A 2ZGKA 4MXWB 5FQ0B 5JSRA 2NZ9A 5JSPA 1V6LA 3ILRA 3SCFA 1AJKA 1YNAA 3BU7A 5HXVA 3B94A 3MIHA 5CIRA 1RUI1 1WMEA 4K20A 4YG3A 4FPLA 2CGPA 4J1WA 2BFUL 1XNBA 1ND2B 3ATGA 3O12A 3WQ1A 2TUNA 3H0OA 2XJRA 3KGZA 1VBD2 5GLZA 2D6PA 2BQPA 2E7AA 2ZPXA 4B4RA 3VBOB 4LBKA 2AZ5A 3ZMOA 1JHNA 3FBYA 2D3RA 1LRHA 1IHMA 1PVC1 3DV8A 4CP1A 1VBC2 3VBRB 2JKBA 2BVVA 1H1AA 3CJIC 2AENA 4QPIC 5GZGA 5DXDA 1BEV1 4LE4A 2B5HA 3H50A 2BGCA 2ZGMA 4IESA 3VBSA 2DWRA 1QMJA 1U5IA 5CU1A 2YY1A 2P2KA 3MPPG 3ZFFC 5J36A 4GH4B 4AQTA 1ENRA 1GBGA 1BQPA 2ZACA 4XFBA 1PIV2 4S2HA 1AYN2 4YGCA 2WS92 4OHYA 5JOXA 2EVXA 1NY72 1QQP3 3ZDSA 2RS53 4NPRA 1S2BA 2K2SA 5HI0A 4UW4A 1NCQC 1B35A 2OZ6A 4IEUA 1H4HA 1VAVA 1JW6A 4GWNA 3VV1A 1TNRA 3VHNA 2IC1A 1PMIA 3JU9A 5T5JA 5JVVA 4AG4A 3WD5A 4COVA 4Y1YA 4BHPA 2D6OX 4FQZA 4R9CA 1MS9A 5FO7B 2DUPA 4XQWA 1EV11 5A32A 3WW1A 4R9AA 4JGYB 1VBA1 2D98A 1QJX3 5DG1A 1H8TB 4LO7A 3IT8A 2R041 3HMYA 1QJY3 2X29A 3ZXLA 2NN8A 1MZEA 4IEOA 1RUE2 3GBGA 4CP0A 1YI7A 2IXLA 3FFQA 4FTBA 1QDOA 1RL3A 4MGIE 1M06G 3WG2A 5KHGA 1HRV3 3VLBB 4RQPC 1VP6A 4META 3ZYGA 4O9EA 4YW2A 3I59B 5DZFA 1LU1A 4GXLA 4BE3A 3L2HA 1RIRA 5JSOA 2XJTA 3U0ZA 2B42B 3I8TA 4IV1B 1VAMA 1FATA 5I8SA 3V64A 3ZFGC 1R093 1G9BA 4FP2A 1Q56A 2ZS6B 3IPVA 1AX0A 3A4UA 1SLAA 3VKLA 4YVWA 1V9U2 4Z1VA 4XJUA 3IBMA 2VXRA 2NM1A 4KU8A 3VHOA 1EYBA 1V6MA 1EPWA 3MPBA 4UW5A 3UKNA 2XH6A 2X8KA 4M3CE 1ZA4A 4AHXA 3RPQA 4FPKA 3NO8A 2WFF2 4LA3A 2JG9B 2HWE2 1QXPA 1B09A 2CWSA 2WIIB 1HRI1 5K0UC 3T1LA 1ULEA 3J8F3 3INAA 3S6PA 1H2MA 1OSGA 1AYM3 3VBFB 3AZVA 5E8AA 2GALA 1X50A 3DUIA 3O0VA 4DQAA 2VOVA 1EAH1 3S0MA 3LKJA 1DDLA 2WQZC 4RA0A 3IWZA 2OVUA 4AQ2A 3FJSA 4P9WA 5BYNA 1LODA 4IEXA 1W6QA 3KCYA 2E7TA 2ZX1A 1UU5A 1Y43B 4W65A 3U11A 1GZWB 3VDDA 4GKYA 5AFBA 3S7EA 1FV2A 1SEFA 3WQ7A 2QQPA 2ZBJA 2GDFA 2D93A 4YZ3A 2TBVA 3WINE 3RSJA 2UY8A 4ONUA 2A75A 1SLCA 3V0AA 1QHDA 3SH3A 3H1WA 2IXKA 3BCWA 1A8DA 3WHTA 1LOAA 3VUOA 5T52A 4EWAA 5EXOA 3W9AA 2XL7A 4Q1PA 2KA3A 5IK7A 4NHLA 3UJOA 4BCUA 4ATEA 1R081 3MIFA 2MEV3 5GALA 1YIFA 2XB6C 4HETA 2BNMA 1FV3A 4Q4X1 2QNKA 2VVDA 2RMU1 2RS31 4UBGA 1CPNA 3KB5A 5GZDA 2V09A 3NJZA 1AR93 4Q4V2 3DPRA 4N9IA 4W6XA 1OOPB 1IKPA 3OYWA 1BZWA 4WM8C 2D5HA 4FT8A 2Z2SB 4K1ZA 1F9KA 3KZ4C 2Q0AA 3ZN4A 4HSJA 4DNYA 3WW4A 4QGLA 1OA4A 2H6BA 5F1RA 1FMD3 2QVSB 3M3EA 2YYOA 2XBO2 1B35B 1QWRA 1COV1 2YC0A 2YDEA 2W0XA 1XYPA 1ZBA3 4RL7A 5EV7A 2VMHA 1YXWA 2O8QA 2PA7A 3TWIA 5CFCC 4EN6B 3WZ1A 3JD71 4AVBA 2R071 4D7YA 4HN1A 3WNXA 4QM9A 5T50A 4XXAA 1JH5A 5LEJA 3M8LA 1AR61 2ETEA 3VZNA 1LHOA 1DGRN 2XJVA 1ZBE1 3BALA 4CEYC 4COUA 4Q4W3 3I4IA 2RS11 3MW3A 3JBG1 2IFRA 2CV6A 4QGNA 1N3OA 3VBUA 2GH2A 2ATFA 4IEQA 4XIOA 1TQ5A 5FMOS 1GV9A 4LBNA 2KM2A 1GANA 4QM8A 5CG8A 2XKPA 3QACA 4KG8A 2WKKA 1CAXB 3GZUC 1U0AA 4IV3C 4QX5A 3VHPA 3VZMA 4B4QA 1IS3A 1ZRCA 3AMQA 3BOWA 4BLJA 2ERFA 1AR72 2ZGPA 4QPGC 1RUC2 1KJRA 2QDRA 1ULGA 5GKAC 1ASJ3 1YYNA 2JECA 4R4XA 5JOWA 1Q8VA 3ZFFB 1FX5A 4CRQA 4YRDA 1KS4A 2F4PA 1J59A 4M3CF 5AC91 1AUYA 2ZGTA 3RNSA 5J3UA 1D4M1 2UWCA 5GM0A 1W6NA 3ASIA 4WVMA 1DGWX 5KHJA 1C8M2 1NCQB 2SBAA 3CL1A 1PO21 1C57A 4AFDA 4GA9A 1Z0HA 3PJQA 1RMU1 2ZX0A 2XJQA 2R062 1G86A 2W52A 3ZN5A 4LBMA 2HWB1 4YVSA 1WCSA 2YZ4A 5LRRA 2ZHLA 3HQXA 3ALQA 5JZGC 1RB8G 2GH8A 1VRH1 1ALYA 2XWJB 2R30A 4FPFA 4C0BA 2WSVA 4BIOA 1SCSA 5EWSA 4CDQA 4Y5Z0 1W39A 3FX3A 3B93A 3FUOA 4GALA 1RUD2 4RHV3 3NAPA 5H9PA 4HKLA 3JB8A 2ZZQA 1YUDA 5K9YA 2VPVA 1TEIA 4ZU5A 1DGLA 4PLMA 2HEVF 4XILA 2ILMA 1UX6A 5ACA1 4RQPB 5CVRA 5DDJ2 3ZYJB 1MEC2 5JOZA 4JAAA 3M7AA 5BXXA 1R1A2 5J96B 4R9DA 4Z2WA 4RFT0 2X53S 2B45X 4QQOA 4GMP1 1O3RA 4E27A 1O5UA 3B9IA 4NR1A 2JXAA 3VKNA 3PVBB 4GB32 4XFIA 4AF9A 1GYKA 2PHUA 2R49A 3ZFGB 1AL21 1UKGA 3LA2A 5DZGA 1PO11 5I0SA 3SXWA 1UIJA 1UPIA 2ZGNA 4TLFA 1SBDA 4B7KA 1REDA 1QOOA 3OD0A 4L97A 5FLHA 4XFGA 2D44A 5FCCA 1SFYA 5JR7B 1LOGA 5H9SA 1RUH3 5J09A 5DUXA 1PK6A 3LCPA 3RMYA 2VMIA 4LE3A 1QJU2 3SMHA 5CFDA 3GHMA 4MGYE 2EA7A 2Q1MA 1LOBA 2TNFA 2VULA 1RUJ3 1HXS2 1YJKA 1NZCA 5K0UB 3KLSA 1PGW1 1G9DA 1HDKA 3AM2A 3USUA 5GLWA 1APNA 1HV1A 4QPYA 3FWEA 4IQPA 2VUJA 2BYVE 3AP6A 4LBOA 5BNPA 4IETA 3OYWB 1ZZ9A 2AGSA 1V6IA 3B9CA 1NQDA 5L19A 4XXPA 4D94A 2FQPA 3P3PA 1FNYA 4A7KA 3U4XA 2KXLA 4MXWA 3WDVA 2GAUA 1WLTA 2N7GA 5FQ0A 3H1MA 3V0BA 4AEMA 1PZ8A 1XNDA 1QXJA 4W6YA 3ZO0B 3D5OA 1ND2A 1IS4A 1VBD3 2CY6A 4DMIA 2OZJA 4BYYA 4Q0VA 4U2AA 2NPIA 1PVC2 5FFOC 4AEJA 4KBBA 4HLTA 3WCRA 3ZVXA 2Z69A 1DZQA 3FE5A 4JGZC 1DG6A 1D0HA 1VBC3 1BEV2 2FHRA 4XF1A 3VBUB 4BMBA 3I2DA 4P9YA 1YWKA 3RJRA 2RS51 3VBRA 2WSUA 1MQTC 3GZTB 1Z78A 3ELNA 5DUVA 4N9HA 4XDQA 4COZA 2HKXA 4MSVA 3THPA 4XTPA 3J26N 2FBEA 1NXD1 1JTZX 2D97A 5E16A 4OLLA 4KWKA 5KXEA 4HL0A 1QOTA 1PIV3 5FOJB 1AL0G 2F6BA 5C4WC 1CAVB 4CTEA 1DZRA 1RVF2 3J9SA 3D8CA 4G3YC 1QJX1 4WM8B 4C90A 3IIAA 4X6RB 4FQ4A 2D43A 1J3PA 2AR6A 2JD4A 2WINB 4FPCA 1RHI2 1SACA 4XF0A 4JDMA 1Q5OA 4FXKB 1QJY1 2H0BA 1U5YA 1BMV1 1XU2A 4NHMA 5CFCB 1ULFA 1VBA2 4XHBA 4XFHA 3JCIA 1GNHA 1HRV1 2JE9A 1IKQA 3UKVA 3WDTA 1C1FA 3TNPB 4DOUA 4RR3C 2DFCA 4FPOB 3FZ3A 4MYEA 1MS1A 5DUUA 3VKMA 1H8TA 3PMEA 1YFUA 5FPZA 1GZCA 4CEYB 1S0CA 4BLIA 1RUE3 3B7MA 1WCKA 5LRSA 1R091 5DUWA 4MLOA 3ILFA 2G9FA 4Y1VA 2ZABA 4XYXA 2OYZA 4N90A 3IN9A 1TME2 4IV3B 4HFSA 5LK5A 1BVVA 1JOJA 1BK1A 3B02A 4E4SA 4QPGB 1OI6A 4FVVA 4N7IA 5ABJC 4XIKA 1KD7A 2DF7A 3NKGA 4XBLA 4UW3A 1LHWA 3J8F1 4IV1A 4LA2A 3LA3A 2D6KA 1V9U3 1AYM1 4QMAA 3S7IA 2B9UA 4CDUA 2A6VA 5CBLA 4XF9A 3GYDA 2R1DA 3OCPA 1CJPA 1UL9A 3KCCA 1ZYBA 4K3UA 2WFF3 4RSUA 2HWE3 3AJZA 1XE7A 3K51A 4IERA 3R4UA 2V5YA 2JG9A 1PK6B 5I91A 4ES9A 4R4ZA 1JN2P 4IEVA 1FXZA 1XYOA 2YPJA 1WA4A 4XZPA 3JQXA 3IDCB 1EAH2 1Q43A 3ZXAC 3VBFA 1PNFA 4JRLA 2ARXA 1F2NA 2A70A 3PJYA 4Q26A 1IS6A 4BIFA 2PHXA 4X6QB 1NLRA 3WDWA 4QHBA 3X29B 1ZX5A 3KT1A 2WNUC 4I30A 3VKOA 5AVPA 3U07A 4JQRA 4ISQA 3SITA 1GZWA 1FPN3 3V0BB 4E4DX 3EQEA 3FC0A 2MEV1 1QF3A 1G7YA 5JPNB 3MYXA 1CQ9A 1ZM1A 3WCSA 4K40A 2B46X 2GC0A 2ET1A 4K21A 2R6QA 3ZMNA 5I93A 2XG3A 3D6EA 3Q9OA 1VR3A 4EV0A 3NV3A 1X33A 1E57A 1S0IA 5GLUA 4Q2FA 3KSCA 3VGIA 2HWF2 2VOWA 2XWBB 1R082 1D2SA 1AR91 1Q3EA 1YO8A 2R16A 3ZXEA 2YGMA 5T54A 3SCHA 4HVOA 4M01A 4Y22B 3E5QA 3H3UA 3ENRA 4Q4X2 1GQGA 3AMHA 5D1IA 4Z8BA 5KHKA 1LOFA