1Y43B

Crystal structure of aspergilloglutamic peptidase from aspergillus niger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
171
structure length
171
Chain Sequence
EEYCASAWVGIDGDTCETAILQTGVDFCYEDGQTSYDAWYEWYPDYAYDFSDITISEGDSIKVTVEATSKSSGSATVENLTTGQSVTHTFSGNVEGDLCETNAEWIVEDFESGDSLVAFADFGSVTFTNAEATSGGSTVGPSDATVMDIEQDGSVLTETSVSGDSVTVTYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspergillopepsin II light chain
publication title The three-dimensional structure of aspergilloglutamic peptidase from Aspergillus niger
rcsb
total genus 21
structure length 171
sequence length 171
ec nomenclature ec 3.4.23.19: Aspergillopepsin II.
pdb deposition date 2004-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1y43B00
2IFWA 3TRSB 1S2BA 2IFRA 1S2KA 1Y43B
chains in the Genus database with same CATH superfamily
3BOPA 3N7JA 3NSTA 1XNDA 1JZ5A 2WLPA 3KCXA 3B00A 2YBKA 2K9ZA 4FQ4A 2WWSA 3MICA 1PK6A 3RG0A 2PA7A 3E5UA 2UY9A 3K4ZA 5F37A 1RYYA 2Y26A 1LULA 5C4WB 4RR3B 4XBLA 1Q3EA 4AEJA 4CDWA 3IN9A 2R043 4QQ2A 1YHFA 2DF7A 2WINB 1D7PM 2EVXA 3VZJA 4COYA 4QHZA 4DUWA 1VMHA 2JDYA 3I4IA 2JX9A 2YFZA 3POWA 1UY2A 2J1UA 4QQHA 2R073 2NZ9A 4YM0A 4U2AA 2HWF1 1S2BA 2RM21 4QXBA 2OIIA 2Q8DA 4AZZA 4LUMA 1HX6A 1VLNA 1HQNA 4FP3A 5FWJA 2OS2A 4DXSA 4XJZA 2DCKA 2JG8A 3IBMA 4ISRA 3DKQA 4E2QA 2EF6A 1LENA 4AI2A 1LTEA 1JZ2A 2PTMA 1GWKA 3KCYA 1V6JA 2IXCA 3W20A 1DQ2A 1Z78A 3KS7A 5L7OA 2VL4A 1UOFA 3WF0A 5IVFA 3R4DB 1A78A 1OKQA 3LIGA 2VULA 1BKZA 2CYFA 2JDPA 3ZXGA 1RUOA 2JG9C 3PNAA 5JXIA 1G9BA 4QD2A 4CEWC 3O1OA 5GALA 1XSRA 2ZEXA 1QJX1 5BYNA 1KJRA 1EV11 1H2NA 1RL3A 4QX8A 4OHZA 3KV4A 2DV9A 4Q0UA 5CG9A 4HVRA 4GA9A 1U5YA 4XBQA 1KS5A 4IEUA 4H3WA 5A3LA 3OY8A 5JXHA 2PAKA 1ENQA 1YO8A 2GMEA 2Y8KA 3QBQA 4LBJA 4M3CE 5BY5A 5K7PA 1F9KA 4HN0A 2WRAA 2CGPA 2WFF1 3RZLA 2UU8A 2VTFA 1XSQA 2VW0A 2FD8A 2ZGUA 3HR9A 3ZYIB 5FZDA 1H4GA 1VAKA 4LORA 1PZ9A 4QQOA 1SQ4A 2LTNA 1Q43A 5DAWA 5CZKA 3GJBA 2DVFA 3WG4A 2UY8A 5BUVA 4XBNA 3I3MA 3KV9A 1O3QA 3IDEA 1RC6A 3K3NA 1LHUA 1LHOA 5G04L 4I3PA 2WDBA 1HRV1 4UF0A 1BBT2 3CJIC 3QCWA 2ZMNA 4AI1A 4A4AA 2W47A 3PIGA 4IV1B 1L7LA 1L7RA 4LULA 1GP5A 4TTGA 5SV5A 4NAMA 1V6KA 3N7LA 3VBRC 1XNBA 1IKPA 3TRSB 3RJ2X 2WO2A 2JENA 3VB9A 1TZOA 2J1RA 4Q4X2 1RUH1 1SCSA 3B9CA 1W8OA 1XYPA 2XG3A 4JQTA 4LO8A 4XJUA 4I0BA 1K3IA 1FX5A 1VBA2 3D82A 1LGCA 3AC0A 1UZZA 2VJXA 2FCUA 3VBOC 3VLBB 1F8VA 1GLHA 3AZZA 5T5JA 4L0PA 4D6SA 4INDA 4EQVA 1XU2A 3LF7A 4PDWC 1CESA 3ZN4A 5H9PA 1VB4A 3GALA 1UQXA 4MH0E 4CUAA 3BUCA 5HXVA 2QZ2A 2DWRA 4DQAA 4F7ZA 3MIGA 5BNPA 2E33A 2VMEA 1UYPA 3D0SA 4Y33A 1MEC1 2QKDA 4TZDA 4O7XA 3ZN5A 3VBUB 1UPIA 4FPEA 4QPIB 3AP6A 1CAUA 1UX7A 1CONA 1Q56A 2G19A 2WZR2 2HWC3 2RHPA 4XEZA 3SCGA 3WNMA 2JD9A 1UXZA 3VBFB 1QJY3 2YU1A 4KWJA 5T5PA 2PHRA 4WM8A 5DDJ3 1ENXA 1OOPC 3N9NA 3S5QA 3PVOA 5LA1A 4JRLA 5LRRA 2ZAHA 3N7MA 3WG3A 3VD5A 1GZWB 1NCRA 3UL2A 3IAPA 2WS91 2JIJA 3ZFGC 4JCKA 4BQXA 2WZR3 3POEA 2FZ1A 1ZA7A 3GCWA 4ZZ8A 1A34A 1IKQA 3JD73 1VBB1 4GH4C 2D6OX 3VBSC 1WLCA 1CIWA 5FMDA 1F5JA 5HXMA 1NXMA 2NQYA 2CTVA 3KM5A 3ILFA 1BMV1 4FPGA 3TWIA 5F5AA 1J1TA 4MXWB 2J1AA 2VCBA 4UOJA 5FPZA 5T5LA 1N1YA 2D3RA 3RDIA 1S2EA 2AEZA 4QPGC 4V1PA 4K1YA 1TME2 3SXWA 4XFGA 1HB2A 3M8LA 4XHXA 2PAEA 4MGSA 4XUNA 2WWUA 4COZA 3KF5A 2NM1A 4QMAA 4Y22B 5KXEA 3GDBA 1PIV3 1HQLA 4HBNA 1WW7A 4LHKA 4RHV1 5FZ3A 2Q8OA 3RZJA 1SACA 5CG8A 1AR83 5CYYA 3LGRA 3ZFFA 2PHDA 3ZIWA 4X8PA 4OHVA 4COVA 1RVF1 5C3RA 2HWB1 3RZZA 1J59A 1LHNA 3SKVA 5F2SA 3BU7A 3A0NA 1ZA4A 2VZUA 3DXUA 3KZ4C 4Q26A 2VCAA 2G4IA 4RQPC 3UNPA 3H8RA 5C33A 3AYCA 1PNGA 1MVQA 2VG9A 3MF9A 5GKAC 5A3WA 4ITCA 4QQPA 4YZ4A 3OD0A 3X29B 3JUUA 1FYUA 2PELA 1FMD2 1LOCA 1PO22 1V9U3 2UURA 2WNOA 3HBZA 4C1XA 1VB2A 3NKTA 2IUWA 3VUOA 4TWTA 1QY4A 1K45A 1W8FA 1I1EA 1DIWA 2F17A 3MFCA 4HFSA 1NYWA 2VZ1A 3LOIA 1ALYA 1G7YA 5JUVA 4DEQA 2ID4A 4Q0VA 2P17A 3N36A 1QQP1 1AL21 1S0GA 1UAIA 1YJLA 4IEZA 5BNOC 4FP2A 5FYHA 1OBNA 3URFA 4Q29A 4LHLA 2GC3A 3JBG3 4NWVA 1HB4A 1ULGA 3BU0A 5CFCC 1AR91 4XABA 4N43C 2ADDA 1O4YA 5EYYA 3O1SA 2QDRA 3QD6A 5I91A 2RDSA 4NPLA 4ZXEA 1TNFA 3AMPA 2IXHA 4FPKA 2YUEA 2C6SA 1XYNA 1CX1A 1O3SA 3OEAA 1UZ0A 3MLKA 3LA7A 1SMVA 2RMU3 3ZPOA 4AQSA 2RS11 4YZ2A 3V0BB 4D6RA 3MF6A 4LA2A 2QQLA 2ATFA 1HDKA 3H3LA 2VUCA 2XPJA 3RMYA 1IGOA 4GZ9A 4GJZA 4AXOA 2A6VA 1GOHA 1VRH1 4IV1A 4AHZA 3KF3A 4XAEA 2QTWB 1SFYA 5F5CA 1JYWA 1URXA 5JR7B 1TQ5A 5LBBA 5A7WA 3ZDSA 4NIHA 4LNVA 2K46A 1IQAA 1ACCA 3HMYA 3W5NA 4DY5A 3OF1A 4META 1ZRIA 2OX0A 3LDBA 4Q4Y1 3R6SA 2W2IA 1W9SA 2DYCA 3AVRA 4EYUA 2WZEA 3HNYM 2QQOA 1NA1B 5FREA 2D97A 5J98B 4JX0A 2W5FA 1LGBA 5DABA 2Y6FA 4IEXA 1PGL1 1ZYBA 2P3IA 4UFMA 3ZXFA 3S0MA 2JDZA 3I2FA 3T4HB 2OPWA 4BISA 1LODA 5F6KA 3B94A 2AGSA 4TYSA 1PVC1 3GZTB 3S7EA 3T09A 2P3YA 4A44A 2VW2A 3VD7A 3UK9A 2PFWA 1ZBE1 1COV2 4QHBA 5KWRA 4R9DA 1DQ5A 1W2NA 4LA3A 4OI1A 5LEKA 4M01A 4XCAA 1DG6A 2HKXA 4QPIA 2ZTNA 1XE7A 1BLZA 1GFF2 1O8PA 2ENRA 4JZRA 4XJWA 2BGPA 4ZS2A 2Q4SA 3A22A 2VXRA 1IPSA 3H1MA 2VZSA 3VBFA 5ABJB 2WNEA 2VMIA 4H7MA 1PMJX 5FTTC 1COV3 3LAGA 4A41A 3DXTA 2X8KA 1OVSA 3KT1A 4HK8A 4AGGA 3BIEA 1AJOA 4PQ9A 5F6LB 4AAPA 3IZOA 3WP6A 4BXSV 3C7FA 1OH4A 3HPNA 4XJ8A 4E8DA 5KC5A 3RI9A 3CZUA 3L9JT 2PHTA 2YB7A 5F8PA 1XJAA 2W92A 1R1A2 2QQKA 2YBSA 1BEV3 3HBKA 3ON7A 4MLOA 1DHKB 2BVVA 3MDPA 3TB0A 4F8AA 4EV0A 1WCUA 2G9FA 2WFPA 4CXYA 1YIFA 4XTMA 1P8JA 4OULA 3SC7X 5C8CC 3PU8A 3WG2A 2DUOA 4MXWA 3KV5A 1H8TA 4AEDC 5A3NA 4Z2WA 4NJ4A 1C8M2 1VBE2 5GLTA 1JUHA 2QQNA 4LIVA 4Y5SA 1A3KA 1R1A3 4OUSA 4PI0A 5E1RA 3NJYA 3UKVA 3KT4A 2VY0A 2DVAA 1RUJ2 3J7HA 5GM0A 2DDUA 3ZR5A 4Y22A 2CU5A 2WKKA 2VZ3A 4LKSA 4DS0A 2FHRA 1VBE3 4TLFA 3ZSKA 4AF9A 4YZ5A 5EJZB 3LKJA 4GJYA 5ACA2 2LALA 3AKQA 3B7MA 4JKMA 4NHKA 5A7OA 4AR2A 5C9AA 1W9YA 3EXUA 3W9AA 4CUBA 3VKMA 1RUJ3 3KGZA 3O0XA 4CVUA 2G1MA 2B7YA 3PMEA 1AX0A 1JXNA 1RXFA 1JOJA 2R0FA 2WJSA 4FSJA 3MIHA 4LBMA 4OHYA 5ACA3 3HVDA 1H2MA 1OLRA 2GNMA 1T2XA 1CGPA 3ZSMA 3BPSA 5BNNB 4NHXA 2R1DA 3FFZA 5DAVA 3DPRB 3K48A 4KH9A 5LBEA 4PIZA 4ONUA 1BJQA 1WMEA 2GAUA 2FDKA 2IXJA 1Z0HA 4XFFA 3E5QA 2LUWA 1IPJA 4E2SA 5IK7A 5JOYA 4RFRB 3PJYA 3E5XA 2VO5A 2D44A 4U36A 2VGDA 4Y1UA 3BI3A 4MADA 3ZKUA 4QX5A 4GD4A 2NMOA 1H0BA 5AC93 4KG0A 5FKCA 1R083 3ACHA 1O6UA 2A75A 1O8SA 4RS5B 4B4QA 2W52A 1PK6C 3AZVA 3NKGA 4Y4YA 1H6XA 1UZWA 2P6CA 2AR6A 1R091 1YEWA 3LEKA 1B09A 1WBLA 1LAJA 1QIQA 1D4M2 4AFBA 2ZABA 5FKBA 1GOGA 4LBNA 2C1FA 4ATFA 3L2YA 5JMCA 4AWDA 4CDWC 3V0BA 2GP5A 3P3PA 4QM9A 2FQPA 5I8SA 2CNAA 1V0AA 4JC1A 5KXDA 3AKSA 5A7NA 3F95A 1U5IA 1YIPA 1VR3A 5FLJA 4R9BA 5KHIA 1I5ZA 5LBFA 1UIJA 5GLZA 4B7KA 2L9LA 1RHI1 3MBWA 1RXGA 2ZCWA 1K5MB 1OF3A 2DFCA 4D8MA 1C5HA 3ILRA 2JG8C 3ELNA 1NUKA 3M3QA 2IC1A 3AKRA 4HZFA 2VNRA 1OQ1A 3A23A 4RD7A 1QJFA 4BQYA 2IXIA 3VBHB 3F2ZA 3NNFA 4D69A 1J83A 1XPWA 3ZXJA 3LSDA 3OG2A 4QDQA 4RA0A 1I3HA 1C3HA 2WQ4A 1NA1A 4FCAA 5L7OC 1RUG2 1W9FA 2YDEA 2YHJA 2QNKA 1GQHA 5I93A 4BM8A 2W1SA 1OH3A 4Q1PA 1ASJ2 3ETPA 4YW4A 1VBC1 4KI5M 4JGZA 3ALQA 2HEYF 3RWKX 3ZOIA 5FY0A 4JTNA 4YPJA 4CCDA 3OCPA 1WZXA 2BU9A 4IEVA 4E2GA 3K3OA 1CZSA 4AI0A 4YZ1A 1OURA 4C0BA 4QXCA 5IVCA 3AB0A 1ASJ3 5FZ9A 3KVAA 3I54A 1A8MA 4PIYA 1GMMA 2F6BA 1SDWA 4ES9A 1CVNA 3MUZ1 1GSLA 1RUD2 2PHXA 1SBDA 2PHWA 1ZM1A 3VN4A 2MEV1 3OTFA 2EAAA 3ZYPA 1G9FA 3FX3A 4IXLA 5T50A 3MV11 1Y9GA 5JZGB 5GZCA 2VVDA 1W6PA 1S0EA 1WCQA 1FNYA 2ET1A 1YQ6A 5IVBA 1H9PA 1OLQA 4FXKB 3W58A 3U0ZA 4ORFA 3OGVA 1SLCA 1FI2A 2QQVA 3LB9A 4URTA 5EHDA 3P5BA 2C24A 1RUE1 3R4UA 2YXSA 4UFKA 1ND3B 5LRSA 1D2QA 1Z7S2 1XRUA 1ZZ7A 2XL9A 5FP3A 2XL7A 4IE4A 1RMU2 1QOOA 3WNXA 2B9UA 4PBOA 2W87A 1YCIA 2YC0A 2D7FA 3HNBM 4HANA 4LO4B 3U75A 3HQRA 1CAWB 4CTEA 5K0UC 5LY1A 1EUUA 4RGKA 1HKDA 2PHFA 3PMSA 3CNAA 4IEQA 3UYJA 2V72A 4GIQA 4ZONA 5FYSA 3ZYHA 3DF0A 2A71A 1LKNA 1AR73 3WLUA 1H9WA 1NKGA 3PJQA 3S6PA 1DGWX 1PX4A 1UMZA 2ARCA 2OW4A 5FXWA 1DDLA 4FI9A 4LO5B 2UWAA 1YFXA 4MHUA 2OZ6A 3N3HA 3O1VA 5A32A 5BNPC 2YU2A 4PLNA 4XE9A 5CVRA 1N3PA 5F3EA 3UGHA 3VHPA 1SLLA 3N9LA 5FOBB 1KXGA 1GWMA 1WUVA 2ZX3A 5FZOB 2WT2A 2ZGLA 5F7UA 1OKOA 1TMF3 1EPWA 1UKRA 1O4TA 4NN0A 2JIGA 2NYYA 2GH2A 1UO9A 2YC2A 1R1ZA 4WM8C 3DPRA 4Y1ZA 5FXXA 2YPDA 1BQPA 1IQDC 2Q5TA 4PCRA 2RS52 2VBBA 1A6CA 3WDWA 3C2UA 3INAA 5EJ1B 1W90A 1YNAA 1STMA 3GHMA 1NCRC 1X33A 3PLQA 5IFPA 3VDCA 1FPN2 3B5LB 5B4NA 1HRI3 5K8SA 2P4EA 4YWAA 4BLJA 4JHTA 3RYRA 4PT6A 4V2WA 4AOCA 3T2OA 2PLV1 3N7KA 4S2FA 3RPQA 4K3UA 3AYDA 4RS5A 3VDAA 2BRTA 3FFQA 4QAWA 1RUF2 1TG7A 5J7MA 5L36A 4XW3A 4JKKA 2RE9A 3NVCA 1LOAA 3VZLA 4DINB 5A3PA 5GLUA 2WWJA 4ATEA 2VZOA 2C9AA 2P2KA 3IT8A 2VZQA 3BTAA 4Y1YA 2ZAAA 1B35B 1RUC1 5JMOA 2BGOA 5I0DA 4ARYA 2WZPP 1JYIA 1XOYA 1RUF3 2ZGNA 4S2DA 3LEGA 1A8DA 1AYN1 3ZFFC 3ACGA 2E26A 3T0DA 2F4PA 4GKYA 1NOVA 3H1WA 5GZDA 2PXJA 3WNPA 2VU9A 2YGMA 3HT2A 1N1VA 2GC1A 5DN2A 4Q4V3 2DUQA 5IW0A 1NLSA 2JDHA 4EROA 3O0VA 2RV9A 3NW4A 3UKNA 3VV1A 1LB2A 5DZFA 1I5PA 1LOBA 3LPFA 2Y64A 1LOEA 2OXBA 3GBGA 4FTSA 3BYWA 3K2OA 4AVSA 2VPVA 4H14A 1W9WA 2WYFA 3Q8FA 3FBMA 4WM7B 1PGW1 3NQHA 4FBFA 1NY72 1HIXA 5FZ6A 4XZUG 2WNUB 3RJRA 3RNSA 3FN9A 3WT3A 4DXRA 4CUCA 5KHJA 4MGTA 4B7EA 4LLOA 1OLMA 2J42A 3PL0A 4LKDA 4CSWA 1PNFA 1HB1A 4M00A 1HN0A 1W8ZA 5G05L 1QGLA 2V5DA 1RUC3 1UZYA 5FMCA 4B8EA 3KHCA 1KFXL 1GU3A 3RYPA 1R64A 1AR62 3GBWA 3ZYBA 3AZYA 1VBD2 3WF4A 4Z2AA 1GWLA 4XJ9A 3QACA 2LROA 5C3OA 4L97A 2P5BA 4LBQB 4YM2A 2H0VA 4BQ5A 2XBO1 3VHRA 1WW5A 5A70A 2VQTA 2VCCA 4XTPA 1I9RA 1NAEA 1V6IA 2QBXA 2XJPA 4ZU4A 1BK1A 1HQWA 4CCEA 2WSUA 1W06A 4ZHNA 3I59A 5A3UA 2YZ4A 4OMDA 4YLZA 3KT7A 4J1WA 4D7SA 2XVGA 4IV1C 5A3MA 1S1AA 2ZGSA 4BCUA 3PHMA 2WNVB 4QDSA 4BJ0A 4K40A 1ND3A 5D8AB 4QM8A 4EJRA 4DRRA 1ULFA 3KB5A 5B2GB 3FHIB 1MS5A 1RUI1 1H30A 4YVSB 1PO11 2B4KA 4GB31 5FPUA 2DTYA 3ZIXA 2XLAA 5FZCA 1FOD2 2O8QA 4LKEA 3J8F3 3S57A 2R042 2VZVA 3MIEA 1ODMA 5A3TA 2VOTA 4Z1VA 3OBZA 1EAH3 1GQGA 1OVPA 2KM2A 3CL1A 5KHHA 4AVBA 5FR3A 4OHWA 1ZREA 2VNVA 2R072 1L3JA 3AM2A 2DUPA 4QB2A 1EP0A 4LOTA 1OA3A 5FFOC 1FOD3 1Q8PA 4XMAA 1RTVA 5FY5A 2YYOA 5FP7A 4LMFA 3ZYRA 3O7OA 1O3RA 1NX9A 1VMFA 4CUGA 2A3WA 3A7QA 5I0SA 4A2UA 1OUSA 3B01A 1GICA 1HB3A 1IOAA 1OQEA 1U5ZA 1DFQA 1UMHA 3ES4A 4KWLA 3VBFC 4CEYB 3VL9A 3I3QA 3L2HA 1AYM1 2R32A 4NPMA 4YW6A 3ES1A 2MNGA 2PQSA 4DY3A 3GYDA 1UU6A 1GOFA 2ADEA 2C4XA 4XDPA 5FYCA 3ZXEA 1YXWA 3LPGA 2WO1A 4Z82A 5HCHA 5JSPA 3HAGA 3OSDA 2XR4A 4CU7A 3JCIA 3ZXAC 5IK4A 4Q2FA 5KHGA 4FFIA 3WUDA 5IVEA 2BERA 4IV3B 4XIOA 3WNKA 1F15A 4P9WA 4IESA 1N1TA 2FBEA 3TN91 2ERFA 2XHNA 4D6QA 2JEMA 2JKBA 4M3CB 5FPAA 5C70A 5JI7A 2W95A 2OKXA 2HWF2 1ST8A 1H8TC 5F3GA 1NT0A 1S4CA 1GNHA 2JB4A 2XKPA 2ET7A 5E6HA 3WVJA 4HETA 3H8XA 3O0WA 3IMMA 2VVFA 2P3KA 1QNWA 3ZFEA 1TEIA 2UWBA 2BQPA 1B35A 3JQXA 3LDKA 1W8UA 3H7YA 3KQRA 2HWF3 2RM23 4PI2A 1XC6A 1JI6A 1ONAA 2D6KA 3IPVA 4DPNA 3DGTA 1POQA 4SLIA 3TEWA 4LTAA 1RJ8A 4QDRA 4HONA 3ZN6A 3ZPYA 5C9AC 4L9BA 4XF9A 3RFRA 2O1QA 1UX6A 1NCQB 4XDQA 5EWSA 1JBCA 4DUXA 1BBT1 5T5OA 1LHVA 1IPKA 4AW7A 1OPOA 3KCCA 3K51A 2WFF2 2XVKA 3CF6E 3ITQA 4FT8A 3WNNA 1GKBA 2Z4FA 2BFUS 5BXXA 3VDDA 4QPYA 1C4RA 4KU7A 1WW6A 1QJX3 5FBJA 4DOUA 1EV13 4UW6A 4WM7A 5JOXA 2VQ0A 1C57A 4K8RB 1MZEA 3EB7A 4YFWA 3T0AA 3N4MA 5C3PA 2JE9A 1V6MA 3TEXA 4GMP0 4JAAA 4Q4X1 2ZOEB 2DBIA 5FYBA 4IERA 1S0IA 2JDUA 5FO8B 5H9SA 2VVEA 3OUHA 2WFF3 1VBA1 3T2PA 5IK8A 4CU9A 1S0JA 1OXCA 1PZ7A 4YGDA 1EYBA 4BMEA 3FE5A 5FZKA 4AQTA 1OA4A 4D3WA 2WO3A 4XF3A 3I3BA 4FOYA 1X82A 2HWC2 2PHLA 3I2GA 3WDYA 4LBQA 5JPMB 3C7OA 1OSGA 1QJY2 4QGLA 4QXKA 5FP9A 5FY8A 4EWEA 3I8TA 2VH9A 4Q8LA 3B93A 3DN7A 3K4AA 5DDJ2 4KL1A 3SHRA 5K4LA 4ZS3A 3M3OA 4F83A 4HKLA 4HVOA 1HRV3 1QDCA 3KWVA 4XUOA 2D98A 4JDNA 5FUNA 5L19A 3KV6A 1GP6A 4J25A 3WW1A 3U4XA 1V00A 5FZEA 4OUMA 4MGYE 3I7DA 3MEPA 4I2OA 3ECQA 4CDXB 1HLCA 1BCXA 1QXRA 3JD72 4Q27A 4DRVA 2TNFA 3ZR6A 5D8AA 2FCTA 1DGWA 3ZXKA 3PTYA 4YW1A 2ZMKA 1RUH3 3ASIA 3VHOA 5I8TA 3TEZA 4YVSA 3B9IA 4NIIA 4I02A 2QQUA 4NO4A 2BUKA 4P08A 4OQ8A 2D6LX 3HN1A 3U11A 2IWGB 2P34A 4MVTA 1NA1C 2JJ6A 2J1TA 4CU6A 5L9RA 1W0NA 3HWJA 2PMWB 1F5FA 1WCDJ 4CXWA 1PIV2 4XPVA 5JI9A 3SKJE 3ZVXA 5FYTA 1AR82 4JGZC 3RZGA 2E53A 2P3JA 1MEC3 2GC0A 3OB8A 4IEWA 1AXKA 1LRHA 4RR3A 5C4WA 5IAXA 4HPKB 3AP9A 1DYPA 3CKHA 3ZSEA 4LHSA 4ASLA 4WZCA 4R8HA 1NZIA 5CEHA 1UW8A 3BVCA 2YV8A 1NE4A 4NOTA 5DAPA 3WQ0A 3ILNA 4AHWA 4CEYA 1WKYA 5GLWA 2BWAA 4CEWB 1BMV2 2VNOA 2XHKA 1V9U2 1AX2A 2AACA 2BGCA 3Q9OA 4LT5A 1Y4WA 2F4LA 2KXLA 2P1BA 2OQ6A 2WS93 4MOAA 2OT7A 3PVNA 3KGLA 4R9AA 2JWPA 2MPFA 5DG2A 3I2OA 1VBB3 1BVVA 1TVGA 2ORZA 1OF4A 3QLQA 4LR4A 1VPHA 4W8JA 5L73A 3D6EA 5H9QA 1QNYA 3FUOA 3RZKA 4E4ZA 1FMD1 1PO21 3GNEA 2GMMA 4IE0A 4RHV2 5FP4A 2Q0AA 4LBOA 5TSWA 3JBG2 3H0OA 4CP2A 1AJKA 1BXHA 2R1BA 4B1MA 3WW3A 4R4XA 1AHSA 2W3JA 2FCVA 2VCMA 3ABZA 2HBUA 3RMXA 1LOFA 3JXSA 4NR1A 1POV0 4FAHA 4E4SA 4KWUA 1CAVB 3M3EA 4YW5A 5FYIA 2XLGA 5CB7A 4CCKA 4RHV3 2RMU2 3CJIB 5FP8A 1UF2C 3ROUA 1DQ1A 2ZGOA 2CHHA 5I0UA 2Q8EA 1JYXA 4URAA 1RVF3 5EZWA 2HWB3 5F9TA 4L8QA 1DF0A 3AKTA 4C90A 1MZ6A 2QZ3A 2R16A 2XDVA 1QEXA 3T1MA 5FJHA 4D7TA 1NCQA 2R6QA 5K9YA 2BFUL 3PIJA 1G9DA 1IZ3A 2FDJA 1JZ7A 1QQP2 2HH9A 1WLTA 1AL22 3H3UA 3CMGA 3ETQA 2B5HA 3M4FA 4NHMA 4EN8B 4A45A 1G8WA 1QOSA 4WZFA 2DBNA 3LD8A 3VBOB 1WA4A 1KDKA 1N47A 4AAXA 3ZM8A 3DPRC 1SLTA 4BZ4A 1AR92 4KWKA 3WNOA 5LW9A 1OC1A 2R30A 1AXYA 1W0PA 4XOGA 1XE0A 4QKFA 1E5RA 3PUSA 1QQP3 2W68A 2WSVA 4GWJA 1AL23 4QGMA 3I49A 3OOXA 2VMHA 3LCPA 3AMMA 2BVBA 5FXVA 3O1TA 2K2SA 3NRUA 4CE8A 3POSA 4I30A 2UYAA 4E4DX 1AR93 3V65A 3ORJA 4Y4RA 1JYNA 2E31A 5T3NA 1DGRN 3J26N 1IS6A 2O14A 2KA3A 2ZGMA 4NPRA 4I0AA 4YRDA 3V64A 4RS5C 1CWPA 4GULA 1LU2A 1OOPB 1D4VB 3AP5A 4COUA 4DFSA 2GMPA 3HIFA 3MGUA 4QU1A 5LCWL 2RS13 3EJKA 4OYUA 3WW4A 5HBAA 1QF3A 2Z79A 3MFAA 1S0BA 3VBUA 4HVQA 1OMIA 3CU7A 4FPHA 2VXJA 2VUDA 1VRH3 3HNMA 1QU0A 1PZ8A 3EMRA 4K20A 3VBSB 1D0GA 2HWE1 4DB5A 2FMYA 4YG0A 1BEV2 3MV01 4DIQA 2RDRA 1V6LA 3ME2A 2BW8A 2W08A 3OGJA 4KMQA 4AHXA 4Q4Y3 4YZ3A 1GZWA 3I2DA 4Y26A 3BCWA 1MR5A 4EN9B 4QPGB 1J58A 4A7YA 1GZTA 1Q8OA 3RZHA 5IK5A 2Y6JA 1D0HA 2GSYA 3KMHA 3SITA 1S0CA 5C7GA 1CQ9A 4J6GA 1ULPA 1VJ2A 4P02B 4LE3A 4QKNA 1W9TA 4W6YA 1S0DA 3N9PA 3FZ3A 4CCNA 1DZTA 2XQXA 4CU8A 3OGRA 1UD1A 5C5TA 1PMHX 3D8CA 1F4AA 2J1EA 4DXTA 2ZGPA 1C8M1 1PVC3 4YW2A 3CIHA 4AFDA 3THCA 1ZBE3 2GC2A 5FMBA 2D5FA 3V0AB 2EIBA 4LQRA 1D2SA 5FOJB 4RQPB 1VP6A 2W1UA 4HKOA 2Y0OA 5FYUA 2X05A 3NV4A 3M3CA 2YMZA 1QHDA 2UWCA 5IUQA 3Q8EA 1ULOA 3VD4A 1MQTB 3OGGA 3MIDA 3OJBA 1UY4A 2D6MA 1E5SA 5EP9A 2BNNA 2EALA 3OEBA 2PN5A 2IVJA 2JE8A 4CEWA 4XC9A 4GXLA 2ZXQA 2WO7A 3FC0A 5FK7A 1HJFA 2Q8CA 4LEJA 1NQJA 5GLVA 1RJ7A 1EPZA 2ZMLA 3FMGA 2A6XA 4QXHA 5FLIA 2YG0A 1KQRA 4FXGB 5FUPA 4YARA 5BNOB 1SZBA 3POGA 3H9AA 2B8MA 1TNRA 1VAMA 3NJXA 5F5IA 4YM3A 1SFNA 5CFCB 2RVAA 3RGBA 4N43B 2R49A 4BB3A 4BMBA 1ND3C 2BBVA 1ZZ6A 1UY3A 5AC92 1J84A 3P3NA 1R082 1XNTA 3JZVA 1IG0A 1GR3A 2XONA 1FV2A 2PHUA 4RFT0 4ZU7A 1BK0A 1G86A 2WR9A 2Y60A 4LLFA 2ARAA 4IE6A 4XXPA 4AGVA 1JOPA 1DQ0A 3FHAA 4GWNA 4MUVA 2TUNA 4UI9L 4JTOA 4AEMA 4PHZA 2OUJA 1T6BX 3AVSA 1D4M1 2JXAA 1BVP1 4W6WA 5CBLA 2D40A 1X50A 2E51A 5IT6A 5KHKA 1X7NA 2CAVA 5A33B 4HT1T 1W6QB 1DBNA 2XUEA 1CR7A 3EBRA 3IWZA 5T54A 4CP9B 2ZKNA 2ZX1A 2W1QA 3VKNA 4RGGA 3EQEA 1S55A 2Q1FA 3AX4A 4HOOA 4YGBA 4CDQB 5DZGA 3S7IA 5C3QA 5FMOS 4BHPA 1XQNA 5F3IA 4GWIA 4PF5A 1J3PA 1X9TA 4DZGA 3WF1A 1R092 4QKDA 4QU2A 1OI6A 3JQWA 5DZEA 3CEWA 2DVBA 4XMIA 3MW4A 5A32B 1FNZA 5LA9A 2IFWA 1H4HA 1RUG1 2W94A 4XXAA 5F1RA 4FPFA 3WZ1A 3LFIA 5CNAA 1GQPA 5FZIA 2PYTA 4AFMA 3CQOA 3WY6A 3K77A 2PAMA 5EJ3A 2W1WA 3PTRB 3M70A 4YYOA 1R093 4ASKA 4BQ3A 1GP4A 1YFWA 5JSOA 2WIIB 1JODA 4Y5TA 3QH7A 3T3YA 1M4WA 5FPVA 3E6CC 1Y9QA 3ZFEC 1B35C 4QB6A 3H8OA 4L92A 2D5HA 2VC9A 2A70A 5FQ0B 1NXD1 5ABJA 5JCTA 1RHI3 1AL0G 4S2GA 3OUJA 3RI8A 1RUD1 5CISA 2RR11 3P6BA 2E7QA 4BYYA 4ET7A 4AK3A 4Z8BA 4AEDB 4JHZA 2A1XA 1LHWA 2RJ2A 3CO2A 4EWDA 4CRQA 4ZU5A 5CKNA 1W6OB 3UJQA 1H2LA 5KR7A 3NNLA 2ETEA 3ST7A 1WBFA 1WGPA 4YVWB 3PUAA 4BQ4A 1K5JA 1W6MB 2E7AA 4UW3A 1ODNA 4Y3OA 3OPTA 4B1LA 5EFUA 3VDDC 2I74A 2EXIA 1VBC3 1OLME 3HN3A 4Y1XA 5F32A 1ZZCA 4Q4W1 4WM7C 4NIDA 1RMU1 1AR72 1ZBA1 3AFGA 4XZPA 2YPJA 2HWD1 1H1MA 4CP1A 2BZDA 2FZ2A 4E9KA 1MZFA 5JAXA 4BWOA 1GNZA 2IZWA 3FUQA 4BQWA 5HPOA 4OFGA 1OFNA 3EO6A 5APAA 2OQ7A 5FCCA 1MQTA 3D3AA 1J1LA 4LBQD 2B45X 2RR13 1TMF2 4YG6A 1YC61 2XB6C 5FZ7A 2XWBB 2BJSA 1RUE2 2MEV3 2DCZA 1UOBA 3POFA 3QOPA 4JGYB 4V2VA 5FXZA 4D94A 5JR2A 3O1PA 4OVEA 2ZZQA 4CDUB 1W2TA 3AXEA 1LNSA 3MIFA 4LO6B 2K0GA 3I3DA 3UESA 1PVXA 2FDIA 4ARXA 1JHNA 5LY2A 1XBFA 4XF4A 4B29A 1S0FA 1XNKA 3LA2A 4NE9A 4XJAA 5FY7A 1HRI2 1RUE3 5BNNA 2EXKA 4NHYA 2FMDA 1SBEA 2Q1ZB 2RS51 5D8AC 5JWPA 4IW3A 1O59A 3WDTA 1JYTA 2VUAA 5JVVA 1PK6B 4YM1A 2J7MA 4XAAA 3WCSA 4YVSC 3KVBA 1FPN1 1MS4A 2YC4A 3SQOA 4HN1A 3TNPB 3T2QA 4CPBD 4GKXA 4N53B 4Q8KA 2ZEZA 4CDWB 1DYKA 2JB8A 4YW7A 4OMCA 3OPWA 1XNCA 4TLGA 1W3XA 2CDPA 5FZAA 1POV1 4C8DA 4JQRA 4CCMA 1LECA 4NWWA 1Q5OA 3AP7A 2A5ZA 2X53S 2XLFA 1XXNA 3J7NA 4YW3A 4P9JA 1QJU1 2EXJA 1SLAA 3ZX7A 3PVEA 5C4WC 5A33A 1UU5A 4FO9A 4FPLA 4RR3C 4EN0A 5LZ6A 2Z2SB 1W6QA 3BIWE 1G9AA 3UKTA 1VAVA 3AMHA 2DU1A 3MLLA 4Q4V2 2ILMA 5FMOL 1QWRA 4H2AA 4L2NA 5L7OB 1HXS1 4HXCA 4MGIE 2V5YA 5L9BA 4CDQA 2I07B 4CEYC 1E5IA 2EIGA 1K5MA 2LS6A 2PLV2 2X29A 5DUXA 3ZLIA 4CP0A 2X10A 4E27A 3NL1A 3W59A 4IGQA 3PVBB 5IFTA 4PLOA 5J09A 4FPCA 3VBHA 4UBGA 2WBKA 3IMNA 3BTZA 2CV6A 4FOWA 3VKOA 3BALA 3WDVA 4BH9A 4EE2A 4E8CA 1J3RA 3BGAA 2ZGKA 1WWYA 1QKQA 2DCJA 2PLV3 1FATA 2X5IB 2W39A 3MUY1 1RUC2 3POYA 3D5OA 5AFBA 2HJIA 5FDBA 5KC6A 1AYN2 1WCSA 3B02A 5GZEA 3MZHA 3NNJA 4Q1RA 3PUIA 4W65A 3R4SA 1WW4A 4LK7A 4ZKTB 1W05A 4CCJA 1LOFC 4LO7A 2ZBJA 2ZHLA 3G6JB 5E16A 3FWEA 4O65A 1NZCA 3MI8A 1QXPA 4UF0B 2R061 4IL7A 4G3YC 1SLIA 1AR61 4XFCA 4EWAA 5J3UA 4IGOA 1DP0A 4N7UA 1VBD1 3ENRA 4Q0PA 1AYN3 2WN3A 1FV3A 4KBZA 4H7LA 4OZXA 4CXXA 3NO8A 1KEXA 2AZ5A 5JDBA 3O1UA 1RUNA 2CSGA 3H1YA 3HEIA 5LA0A 4DXZA 3T08A 4A42A 3EYPA 3T30A 3LIHA 1KITA 1ZRRA 4XETA 3U4SA 4NRQA 1PGW2 1SBFA 4LXLA 5FYYA 4LKFA 4NHLA 1SDDB 1VRBA 1YQ2A 2P6HA 1NCQC 2PQQA 2V73A 2DVDA 3ATGA 3POJA 4YG3A 5FK8A 1UU4A 5SV8A 4M4RA 5JZGA 4MYEA 3ACLA 3I3EA 3IAQA 1DQ6A 4YVWA 5A7SA 5M0TA 1YFYA 1Q8VA 2CWMA 5K0UB 2FDHA 2YROA 1PM4A 1UOGA 2OVUA 4QX0A 1YRZA 5FBZA 4M3CF 2RS31 3J8F2 1KJLA 1W3VA 3RZMA 1XNAA 1OHFA 3ACIA 5KXBA 1EAH2 4IGPA 1W2AX 5IJRA 5BV6A 2JKXA 4M0HA 4GQ7A 1REDA 1AX1A 1SLBA 2VMCA 3CBNA 3OYWB 4M4PA 4Z92B 4XCBA 1UWWA 1V6OA 2R063 2RJLA 1CAWA 1ZNPA 2ZHMA 5IVYA 2R041 1CZTA 2ZEYA 5FYZA 3WSOA 4DO0A 3WCRA 5FPXA 1CAUB 4P9LA 5T55A 1DGLA 4CCOA 1UMIA 2AUYA 2CGOA 5DUVA 2J1VA 1E5HA 2R071 4WM8B 3POBA 2XBO3 4KU8A 2EA7A 3RWNA 4JGYA 4AQ2A 3BTYA 1HV1A 2XMLA 3C7HA 1X8EA 4UYBA 4CDUA 4FOQA 2Z69A 4P9GA 2VZPA 5A1FA 5H9RA 2FDGA 2ZGRA 2HYXA 4H55A 4K6BA 1JS9A 5FZOA 3VBUC 1PO12 4QPIC 2OUHA 5A6YA 3NV1A 3U07A 3VZKA 1LGNA 1X8MA 3PUHA 2WAOA 4TN7A 1MS0A 4QGNA 4WBBA 3TNQA 4EZHA 1CPMA 1IS4A 2CAUA 3AZXA 1ULEA 3UJOA 1US3A 4OCTA 1ZRDA 4PLMA 1RUI3 5CFDB 4K7JA 1JYCA 2EAKA 3BOWA 3VD3A 1IS3A 4KG8A 3LE0A 1PO13 1QJZA 2RDQA 4GB33 5HI0A 4A6SA 4Y5Z0 2J22A 2HLEA 4ZXKA 4P9IA 4N53A 4NUBA 2HEVF 5B4XA 4PBPA 1QDOA 4RN5A 4CZSA 2QQPA 1ZX5A 2DCTA 4OZOA 4AEKA 3IDBB 5FWEA 2JDNA 5CA6A 2QJVA 4UXAA 5LATA 1MACA 2OYZA 3ZO0B 3ZFFB 2RM22 2Y6LA 3E6BA 4TXWA 1KD7A 3PDQA 1AYM2 1PMIA 4DEVA 2ZX0A 1KRIA 1ZZ9A 5CU1A 1UIKA 2H6CA 3ZXLA 2GZWA 1C1LA 1OUXA 2IFRA 2WQZC 2VBDA 3O14A 2V4VA 3I2JA 3H8UA 1SG3A 1AYM3 4AI9A 1NLQA 2XJTA 4MXVA 3TN92 3CHXA 5ANNA 4BPZA 2TBVA 1MZ5A 2B46X 2CDOA 3WW2A 3WX5A 3UV9A 1AZDA 1JZ4A 1REFA 1QJX2 1EV12 5JSRA 5I0TA 1CIYA 4N9HA 1W2UA 3TN93 4I01A 4QX7A 2X5IA 4FTEA 4HKWA 2AREA 3NV2A 4XHBA 4ES8A 3FLPA 2WA4A 2ZKLA 5LK5A 1BZWA 1W8WA 2WNUA 2ZX2A 4LK6A 2BWCA 2C0ZA 3OBAA 3ZKYA 3BTXA 4UFJA 3AXDA 4JRAA 3KD4A 2Y34A 3AJZA 1YQ5A 4AL9A 2Z5WA 2E7TA 3DYOA 4FFHA 1HRV2 2WZ8A 1WMFA 1JZ6A 1CN1A 1O91A 1UY0A 3GF6A 2HWC1 3PURA 5CKQA 5D21A 2WC2A 4CYDA 1QJY1 3U14A 3UGFA 5DDJ1 1KFUL 4IE7A 4MO3M 5A7WB 1HW5A 1ND2B 5FZFA 3VZOA 5DXDA 1FXZA 1BBT3 5IAVA 1YFUA 5DMYA 4BLIA 5CIRA 2AC1A 1RUH2 3NAPB 4I09A 4AFAA 4IETA 5JIUA 4MSVA 2WZR1 2ZGQA 2RDNA 2E6VA 4IEYA 5K0UA 3WF3A 4UT5A 1YI7A 3JD71 3OD4A 3MO4A 1ENRA 4MG2A 2WNVA 2VW1A 2RG4A 3R0RA 2CY6A 2ZGTA 4A3ZA 2VOWA 4XFHA 4Q4X3 1ZVFA 2VMGA 5C8WA 3I2IA 2DU0A 4QKBA 3GZUC 1YWKA 1VBA3 5FO7B 3WP3A 1AXZA 3OYWA 3TAYA 2RJKA 3TYJA 3RYKA 4CPBA 4FQZA 2IVIB 1MEC2 3FLRA 1OQDA 2G9ZA 1F35A 4NROA 1CX4A 4OI2A 3BPZA 1PIV1 4XQDA 2GP3A 3OBRA 3WHTA 1WMDA 1AR81 1MPXA 4W50A 1J3QA 3LEIA 3OUIA 4NAOA 3WD5A 1TME1 2C26A 2VAUA 5AVPA 4QX2A 3JB8A 4NRPA 5C3SA 1DGRA 1AF9A 1W2OA 3B3QE 2WS92 4AHYA 5FZ8A 5JOZA 4MGZE 5A3OA 2QQJA 5IYYA 4KGGA 5J36A 2C9KA 3T2TA 3WQ7A 1F31A 2XGXA 1VBB2 4AVVA 5ABJC 3GHNA 3BN6A 3GGLA 1I6XA 5IATA 3VDBA 1U0AA 4C1WA 2JG9B 2H6BA 1SPPB 2BBAA 1V9U1 2O0OA 5A6XA 3FL7A 2HYKA 5CFDA 1H8TB 1UNBA 2BNOA 3M1HA 2A6YA 4I3GA 4XQWA 3J9SA 3DV8A 3ZYJB 3O1MA 1BYHA 4Q5OA 3R05A 4IV3A 4YSFA 1SCRA 1LESA 4K9SA 4X6RB 2VTXA 5DPNA 2BOJA 2ZA9A 1WD4A 3SEEA 4M3CA 2A7AA 3JBG1 1UXXX 2BP6A 1JHJA 4Y1VA 5FO9B 3VL8A 1TME3 1CZVA 1RVF2 1BHGA 2HWB2 3WR0A 2YBPA 1UZVA 2G9GA 4KNCA 5C9AB 2VOXA 4XQ4A 1EUTA 4ZPIA 3RRDA 3WQBA 5FZBA 3DYMA 3C7EA 4KQ7A 1UYXA 2RMU1 1O7FA 3LDRA 5FJKA 4AGRA 1WLWA 3U10A 3WP5A 2IXLA 3H7JA 1GBGA 1QMJA 2VZRA 1MQTC 5A1LA 4X6QB 5FUIA 3ZSJA 2VR4A 1ZRCA 3D4KA 4BQ2A 3OGSA 2WA3A 3VBRB 5DQ0A 5FZMA 4XFAA 4A7KA 3HJRA 4D0QA 4Y20B 5J96B 1CJPA 1OA2A 1NLRA 1YYNA 3JU9A 4O9EA 4WVMB 5A6QA 2XQRA 4IEPA 3ZMOA 4BE3A 4P9XA 3A0KA 1LOGA 4FFFA 3HT1A 4C91A 1KGYA 3GBFA 1FMD3 3M2MA 1PO23 4LHNA 3ZSLA 2B39A 2WABA 2WQ8A 4R52A 4CCLA 3GM8A 1H8VA 1Y7BA 3M7AA 4HSLA 5BNNC 3MHZA 4MX3A 4UAPA 2SLIA 5DG1A 1W28A 4PDWB 2XJSA 5FZHA 4LPLA 2CL2A 3MPBA 4NIGA 2D43A 5FZGA 4JVAA 1CPNA 4ZY9A 3WOGA 1JU3A 5LASA 1ULCA 5IHRA 1REEA 4IUGA 2RS12 3SISA 5J37A 2ZPXA 4IE5A 1TE1B 1C8NA 2GDFA 3DKWA 2LM3A 1GZCA 4A7ZA 4FOVA 4DMIA 5CADA 1OPMA 1VRH2 1MS8A 2VQUA 5EIYB 5HV4A 1JU4A 1V6NA 1XE8A 5A7PA 1ND2A 5IVJA 1COV1 4P5YA 4PIXA 4WVWA 2QDNA 4Q4Y2 4KBBA 3ZFGB 4XF0A 3NNGA 2B9VA 3AKPA 3NAPA 4JDMA 3IKWA 4JKLA 4UFHA 3LEMA 2QQIA 4GH4B 4HLTA 5ANQA 1OD5A 3LFMA 5E8AA 4CDXA 1BEV1 1ZRFA 2VZTA 4CDQC 1PGL2 1K5MC 1U12A 4LOSA 5JOWA 2N7GA 4JGZB 5ERLA 1PVC2 2BOIA 3VBHC 1GANA 4LBKA 5BNQA 3VZMA 2AYHA 4FPOB 1ZBE2 4QPWA 1R1A1 2QFEA 1K12A 1KS4A 4HL0A 3AZWA 4NRMA 4P5HA 4TSVA 3THDA 3WDUA 3W5MA 2JDKA 2LRPA 2CWSA 2W0XA 5L9VA 2GNDA 1UKGA 5D1IA 5C71A 5LK7B 4BIFA 1W8NA 3N9OA 2WYSA 3APBA 2E9QA 1G9CA 4PF1A 2BNMA 2HWE2 2ZEWA 1VBE1 5HCFA 2WN2A 3OBTA 3QH6A 2Y0IA 2VMDA 3SNMA 4UBHA 5J1XA 5FZ4A 3EHKA 3NJVA 3P1IA 4B3NA 1W8TA 3ACFA 4HPKA 2QVSB 3TBDA 1RUJ1 1W39A 3NWKA 2R0HA 1JMUB 2JECA 5CKMA 1WMXA 4BK5A 3VZNA 1W6PB 2ZACA 2HWE3 2VBPA 4YGCA 5ACA1 2KD7A 2DFBA 1L7QA 1IHMA 1S2KA 2LW8A 1QXJA 3GJAA 3WF2A 2P37A 2JG9A 4XFBA 5F3CA 1SPPA 2EIDA 2JICA 3LZZA 3VGIA 5IVVA 5C6CA 4BA6A 1GNYA 5LA2A 3DYPA 4AG4A 5JZGC 1W0OA 3KQ4B 1N3OA 3WNLA 3NNMA 5E88A 1XU1A 2C5DA 4YVWC 5EV7A 1RINA 3DCQA 5I8YA 5CAZA 1W99A 1QJEA 3OPZA 4MGKE 3IIAA 5A7QA 4QX1A 1C8M3 5AC91 4C0HA 4UW4A 4N9IA 1JTZX 4OHXA 4R4ZA 1R081 2XOMA 2JDMA 2VD7A 5FYMA 1WA6X 2GH8A 3USSA 1CAVA 3GZEA 5F2WA 1O4ZA 4AVTA 4XUTA 1LCLA 3WV6A 3CJIA 1WCKA 3JB4C 1GZ9A 4UFIA 2UYBA 4UFLA 1PHMA 2VTXJ 2X09A 3BODA 5DUWA 1OFSA 2AEYA 5EQUA 2QCSB 5EYXA 3H50A 3VBRA 5FPLA 4BDVB 3A21A 1OD3A 4LJHA 1APNA 3MPPG 4G4FA 4JGYC 3I97A 4Y20A 2JDAA 1O3TA 1UL9A 1AVBA 3AYAA 2GNBA 3C7GA 4OUEA 4Q0QA 4WVMA 4BOWA 4CDUC 2E32A 3AK0A 3WEZA 4CCCA 4GALA 4L99A 5HCBA 1Y9MA 2QE3A 4XFIA 2HBTA 3GXUA 4RSUA 1RIRA 3G7DA 4OQ9A 3HD8B 2ZHNA 4NVPA 1YUDA 3LQCA 4UWDA 2W91A 3VBOA 3W21A 2ARXA 1DYOA 3ZDVA 1H6YA 4IDZA 3AL5A 4JV4A 1C28A 4Y24A 1M06G 4OI0A 1W8HA 4DUVA 2AENA 4PDWA 5FPBA 3ZYFA 4A6OA 1Q8SA 2ZHKA 1UPSA 5FY4A 2XWJB 1UOJA 4R9CA 5FAXA 3TOJA 3E6DA 3WXPA 2D6NA 4HK9A 4N53C 5JLVA 5F5QA 3DECA 4QX3A 1FAYA 4WV8A 4AE2A 2D3PA 1UN1A 4XURA 3CLPA 3MW3A 4GMP1 4IEOA 4AI8A 2BEOA 4LBLA 3FBYA 2Y6GA 4RYDA 1ASJ1 1OOPA 2ZX4A 4K8FA 1RHI2 2V4AA 1D4M3 1WLDA 3J7LA 2GALA 5AVAA 1ENSA 4QQLA 4AVAA 4KGQA 2JD4A 1W6NB 1CAXB 1LJ7A 4PQQA 5FY9A 1UYZA 2VMFA 2W9XA 4L11A 1NE6A 1LU1A 5FV3A 3ZFGA 4DNYA 3RQ0A 3RSJA 1ZZ8A 3C3VA 3O5SA 1E57A 1MS9A 1JH5A 3B69A 4GH4A 3VBSA 3AJYA 1VALA 4EN6B 4BU2A 4P00B 5D2AA 5E89A 5GJ6A 1W03A 3S30A 1LEDA 5C8CB 1Q8QA 3SH3A 3T4VA 3J7MA 5AFEA 3IM0A 4LIUA 3RS6A 4EZ4A 2WLQA 1AUYA 1GYKA 1VBC2 1YI9A 2VM9A 3AMNA 4QPGA 3J4UH 2XJVA 1FT9A 2EIEA 4BQ1A 1F2NA 5JXGA 3CDZB 3CZJA 2VQAA 2NN8A 1RUG3 5JPNB 4WVVA 3IDAA 4GMP3 3AYEA 3NJZA 5GZGA 2X5IC 1Y43B 2HEWF 2E63A 3BKZA 2GU9A 4E4HA 3SEPA 1Z7S1 2YY1A 3A4UA 1AR71 3UT0A 1HJGA 1OT5A 1JW6A 2WNUC 2RR12 3V0AA 4EN7B 1HN1A 2XJQA 1GV9A 1ULDA 2DCYA 2XKOA 1W04A 4MV2A 3VKFC 2MEV2 1Y3TA 4RQPA 1UY1A 3MW2A 5FY1A 2EXHA 5LB6A 4IQPA 4XUQA 3SH5A 1VE0A 3USUB 3I2KA 1KDMA 3ZMNA 5DAQA 2GNTA 3U1XA 3UGGA 5HV0A 3VHNA 1JZ3A 5LWBA 3I59B 2DVGA 4HSJA 1RUD3 2GN3A 1TMF1 3WDXA 3AP4A 1LR5A 5GZFA 5I0RA 3DL3A 1V70A 4NMIA 4YFZA 3TEYA 3SCFA 1MVEA 2VE1A 4Q0SA 2WT1A 4RGAA 4XF1A 2VECA 1MS3A 3PU3A 4Q4W2 1JZ8A 2ZS6B 1PGSA 1ZBA2 3N9MA 4BK4A 1IS5A 2A3YA 2MHFA 2XXZA 1H2KA 5ISLA 4AVCA 4GAZA 2D3SA 2HWD2 4WVZA 5BNOA 5FZ1A 4M0NA 4O9GA 4LUKA 2A3XA 3N9QA 1HRI1 1DLLA 1CD3G 4OLLA 3CJXA 5DUUA 5KBFA 2TEPA 4B4RA 5CFCA 1Z7S3 1YQCA 2WNVC 1U5XA 2WT0A 4N43A 4Q4W3 3E1F1 3KSCA 4N90A 1RMU3 5LBCA 1SEFA 1WD3A 1ZBA3 2KR2A 4MGQA 1GUIA 4XILA 4S2HA 1JUIA 2WAAA 4FPJA 2HWD3 4J1XA 2ZZJA 4RL7A 4W6XA 2Y6HA 1SFPA 1G6NA 3PUQA 4P9YA 1O5UA 2BYVE 3BB6A 2J1SA 1XYOA 2NPIA 2NP0A 1VMJA 2Y38A 2QQWA 3VKLA 1QH6A 3IDCB 1JN2P 3SH4A 4AFCA 1DZRA 4QWNA 2B42B 4QT6A 2VOKA 1C1FA 2XH6A 1DCSA 3WHUA 5KXCA 4LITA 5JXJA 1RUF1 4MZUA 4AI3A 5A1AA 1UCXA 5F39A 1DU3D 3GCXA 1K42A 2JG8B 3M3IA 2A73B 2BDRA 3Q8CA 2JE7A 2Y6KA 3E97A 4Q4V1 4CP9A 1F4HA 2VUJA 1CJDA 4XDOA 3U78A 4LE4A 1NG0A 4O61A 3WUCA 1N3QA 3HOBA 4N8MA 3K4DA 3RVHA 2RS53 3FHQA 2ORXA 1RB8G 3LSEA 5FZLA 3DEMA 2XJUA 1IG3A 2SBAA 3Q8BA 4FVVA 4ISQA 2GN7A 3SLIA 4ZZ5A 3T0BA 5CFDC 1FPN3 3MLJA 3N35A 2OA2A 5FIXA 1QJU2 2A6WA 3GZAA 3OY8B 3S5AA 1H1IA 3V56A 2ARBA 3H3ZA 4IV3C 3LWCA 1QOTA 4P14A 3ZFEB 2I45A 2Z42A 3THPA 4B4PA 1H1AA 2Q1MA 2Q30A 3U37A 1JYVA 4I0WB 4HG6B 1N1SA 5IWFA 1POV3 3NMBA 3KLSA 1X36A 3Q8AA 2NLRA 2O8OA 4XUPA 4A3XA 1DLCA 1HXS2 3IPVB 1RITA 1NY71 3THTA 5A6ZA 1US2A 4QB1A 1ZZBA 2QUOA 1UYYA 1QJU3 1T6GC 2NMNA 2WUHA 5J48A 4PJYA 1QH7A 1W6NA 1CAXA 3ZN6B 2XVLA 5EPAA 1YJKA 3O12A 2BTVC 4X8NA 3C8XA 1RGSA 2D93A 3IIIA 1HXS3 1HV0A 5FYVA 5FQ0A 3K75B 4YGEA 3MYXA 3KHBA 4UW5A 3O1RA 3UETA 2OZJA 1X9PA 3ZXDA 5LEJA 3VDDB 5EXOA 2AH2A 4NIAA 5C8CA 1LEMA 3LOBA 3T1LA 1NQDA 3H42B 2D6PA 4AEDA 5DAXA 4G9SB 1JOBA 2DTWA 2R7EB 4FTBA 3POIA 2I2SA 1PX3A 4GWMA 4BXFA 1W6OA 2FDFA 4N7IA 4FPYA 3WINE 2XUMA 4XIKA 3D0JA 5BPXA 1W6MA 4BIOA 2R062 3FJSA 5JIAA 3J8F1 4XYXA 4D7YA 3DUIA 1YQ8A 3AMQA 3I2HA 1EAH1 2A6ZA 2EICA 5FZ0A 3VD9A 3AFKA 4HMZA 5T52A 5FLHA 2BPA2 3LA3A 4FAGA 2DURA 2YFUA 4XACA 4OI4A 5HCAA 2W46A 2XBO2 3AL6A 5BNPB 2OPKA 4FFGA 2ES3A 2VOVA 3HQUA 1YLLA 1FOD1 4YNIA 4ASMB 1SHWB 2QQMA 1AR63 1MS1A 2H0BA 4MHRA 3USUA 5A80A 1VBD3 4COWA 3ZYGA 3HQXA 1XB9A 4AQ6A 4SBVA 3FLTA 5C5UA 4Z07A 1VIWB 1PM7A 4F3JA 4QHOA 2CGNA 2XJRA 3WG1A 2RS32 3WQ1A 1DZQA 2WL1A 3WP4A 3IB3A 3SCHA 4CA9A 3MIBA 3NV3A 1ND2C 4K21A 1NCRB 2IXKA 1RUI2 4JDOA 1C5IA 1EY2A 3K46A 2ZJCA 5FRAA 3NAPC 4GB32 4K1ZA 4W4ZA 1DQ4A 2Y33A 3SMHA 4XVHA 2VNGA 4AYUA 2BV4A 1O5LA 2YGLA 2V09A 2RS33 4CDXC
chains in the Genus database with same CATH topology
3BOPA 3N7JA 3NSTA 1XNDA 2WLPA 3KCXA 3B00A 2K9ZA 4FQ4A 2WWSA 3MICA 1PK6A 3RG0A 2PA7A 3E5UA 2UY9A 2Y26A 1LULA 5C4WB 4RR3B 4XBLA 1Q3EA 4AEJA 4CDWA 3IN9A 2R043 4QQ2A 1YHFA 2DF7A 2WINB 2EVXA 3VZJA 4COYA 3I4IA 2JX9A 3POWA 4QQHA 4YM0A 2R073 2NZ9A 4U2AA 2HWF1 1S2BA 2RM21 2OIIA 4LUMA 1HX6A 1VLNA 1HQNA 4FP3A 4XJZA 2DCKA 2JG8A 3IBMA 4ISRA 4E2QA 2EF6A 1LENA 4AI2A 1LTEA 2PTMA 3KCYA 1V6JA 2IXCA 1DQ2A 1Z78A 3KS7A 5L7OA 3R4DB 1A78A 1OKQA 2VULA 1BKZA 2CYFA 3ZXGA 1RUOA 2JG9C 3PNAA 1G9BA 4QD2A 4CEWC 5GALA 1QJX1 5BYNA 1KJRA 1EV11 1H2NA 1RL3A 4OHZA 2DV9A 4Q0UA 5CG9A 4HVRA 4GA9A 1U5YA 4XBQA 1KS5A 4IEUA 4H3WA 5A3LA 3OY8A 2PAKA 1ENQA 1YO8A 2GMEA 3QBQA 4LBJA 5BY5A 4M3CE 5K7PA 1F9KA 4HN0A 2CGPA 2WFF1 2UU8A 2VW0A 2ZGUA 3HR9A 3ZYIB 1H4GA 1VAKA 1PZ9A 4QQOA 1SQ4A 2LTNA 1Q43A 2DVFA 3WG4A 2UY8A 5BUVA 4XBNA 1O3QA 3IDEA 1RC6A 1LHUA 1LHOA 4I3PA 1HRV1 1BBT2 3CJIC 3QCWA 2ZMNA 4AI1A 4IV1B 4LULA 5SV5A 3VBRC 1V6KA 3N7LA 1XNBA 1IKPA 3TRSB 3RJ2X 2JENA 4Q4X2 1RUH1 1SCSA 3B9CA 1XYPA 2XG3A 4LO8A 4XJUA 4I0BA 1FX5A 1VBA2 3D82A 1LGCA 1UZZA 3VBOC 3VLBB 1F8VA 1GLHA 3AZZA 5T5JA 4INDA 1XU2A 3ZN4A 4PDWC 1CESA 5H9PA 1VB4A 3GALA 4MH0E 5HXVA 2QZ2A 2DWRA 4DQAA 4F7ZA 3MIGA 5BNPA 3D0SA 1MEC1 2QKDA 4TZDA 3ZN5A 3VBUB 1UPIA 4FPEA 4QPIB 3AP6A 1CAUA 1CONA 1Q56A 2WZR2 3SCGA 2HWC3 2RHPA 4XEZA 3VBFB 1QJY3 4KWJA 5T5PA 2PHRA 4WM8A 5DDJ3 1ENXA 1OOPC 3PVOA 4JRLA 5LRRA 2ZAHA 3N7MA 3WG3A 1GZWB 1NCRA 3UL2A 2WS91 3ZFGC 4JCKA 2WZR3 2FZ1A 1IKQA 3JD73 1VBB1 4GH4C 2D6OX 3VBSC 1WLCA 1CIWA 1F5JA 1NXMA 2NQYA 2CTVA 3KM5A 3ILFA 1BMV1 4FPGA 3TWIA 1J1TA 4MXWB 5FPZA 5T5LA 1N1YA 2D3RA 3RDIA 4QPGC 4V1PA 4K1YA 1TME2 3SXWA 4XFGA 3M8LA 4XHXA 2PAEA 4COZA 2NM1A 4QMAA 4Y22B 5KXEA 4HBNA 1PIV3 1HQLA 4LHKA 1WW7A 4RHV1 2Q8OA 5CG8A 1SACA 1AR83 3LGRA 3ZFFA 2PHDA 3ZIWA 4X8PA 4OHVA 4COVA 1RVF1 2HWB1 3RZZA 1J59A 1LHNA 3BU7A 3A0NA 1ZA4A 3KZ4C 4Q26A 4RQPC 2G4IA 5C33A 3AYCA 1PNGA 1MVQA 2VG9A 3MF9A 5GKAC 4ITCA 4QQPA 4YZ4A 3OD0A 3X29B 3JUUA 1FYUA 2PELA 1FMD2 1LOCA 1PO22 1V9U3 2UURA 3HBZA 4C1XA 1VB2A 3NKTA 3VUOA 4TWTA 1QY4A 1I1EA 1DIWA 3MFCA 4HFSA 1NYWA 3LOIA 1ALYA 1G7YA 4Q0VA 2P17A 3N36A 1QQP1 1AL21 1S0GA 1UAIA 1YJLA 4IEZA 5BNOC 4FP2A 3URFA 4Q29A 4LHLA 2GC3A 3JBG3 4NWVA 1ULGA 5CFCC 1AR91 4N43C 5EYYA 1O4YA 2QDRA 3QD6A 5I91A 1TNFA 3AMPA 2IXHA 4FPKA 2YUEA 1XYNA 1O3SA 4YZ2A 4AQSA 3MLKA 3LA7A 1SMVA 2RMU3 2RS11 3V0BB 3MF6A 4LA2A 2ATFA 1HDKA 2XPJA 3RMYA 1IGOA 4AXOA 2A6VA 1VRH1 4IV1A 4AHZA 1SFYA 1URXA 5JR7B 1TQ5A 3ZDSA 4LNVA 1IQAA 3HMYA 4DY5A 3OF1A 4META 4Q4Y1 3R6SA 2DYCA 1NA1B 5FREA 2D97A 5J98B 1LGBA 1PGL1 4IEXA 1ZYBA 2P3IA 3ZXFA 3S0MA 2JDZA 1LODA 5F6KA 3B94A 2AGSA 4TYSA 1PVC1 3GZTB 3S7EA 2VW2A 3UK9A 2PFWA 1ZBE1 1COV2 4QHBA 5KWRA 4R9DA 1DQ5A 4LA3A 4OI1A 5LEKA 4M01A 1DG6A 2HKXA 4QPIA 2ZTNA 1XE7A 1GFF2 2ENRA 4XJWA 2Q4SA 2VXRA 3H1MA 3VBFA 5ABJB 2WNEA 2VMIA 4H7MA 5FTTC 1COV3 3LAGA 2X8KA 3KT1A 4HK8A 4AGGA 1AJOA 4PQ9A 5F6LB 3WP6A 4XJ8A 5KC5A 3RI9A 3L9JT 2PHTA 1R1A2 1BEV3 4MLOA 1DHKB 2BVVA 3MDPA 3TB0A 4F8AA 4EV0A 2G9FA 2WFPA 1YIFA 4XTMA 4OULA 5C8CC 3WG2A 2DUOA 4MXWA 4AEDC 1H8TA 1C8M2 1VBE2 5GLTA 1JUHA 1A3KA 1R1A3 4OUSA 5E1RA 3UKVA 3KT4A 2VY0A 2DVAA 1RUJ2 5GM0A 4Y22A 2WKKA 4DS0A 2FHRA 1VBE3 4TLFA 3ZSKA 4AF9A 4YZ5A 5ACA2 3LKJA 2LALA 3AKQA 3B7MA 4NHKA 5C9AA 3EXUA 3W9AA 3VKMA 1RUJ3 3KGZA 3O0XA 2B7YA 3PMEA 1AX0A 1JXNA 1JOJA 2R0FA 2WJSA 4FSJA 3MIHA 4LBMA 4OHYA 5ACA3 1H2MA 1OLRA 2GNMA 1CGPA 3ZSMA 5BNNB 2R1DA 3FFZA 3DPRB 3K48A 4KH9A 4PIZA 4ONUA 1BJQA 1WMEA 2GAUA 2IXJA 1Z0HA 4XFFA 3E5QA 2LUWA 1IPJA 4E2SA 5IK7A 5JOYA 3PJYA 3E5XA 2D44A 4U36A 2VGDA 4Y1UA 4QX5A 2NMOA 1H0BA 5AC93 4KG0A 1R083 2A75A 4RS5B 4B4QA 2W52A 1PK6C 3AZVA 3NKGA 4Y4YA 2AR6A 1R091 1B09A 1WBLA 4AFBA 1D4M2 2ZABA 4LBNA 2C1FA 4ATFA 3L2YA 5JMCA 4AWDA 4CDWC 3V0BA 3P3PA 4QM9A 5I8SA 2FQPA 2CNAA 5KXDA 4JC1A 3AKSA 1U5IA 1YIPA 1VR3A 5FLJA 4R9BA 5KHIA 1I5ZA 4B7KA 1UIJA 5GLZA 1RHI1 2ZCWA 1K5MB 2DFCA 1C5HA 3ILRA 2JG8C 3ELNA 3M3QA 2IC1A 3AKRA 4HZFA 2VNRA 1OQ1A 4RD7A 2IXIA 3VBHB 4D69A 3ZXJA 3LSDA 4RA0A 1I3HA 1C3HA 2WQ4A 1NA1A 4FCAA 5L7OC 1RUG2 2YDEA 2YHJA 2QNKA 1GQHA 5I93A 4BM8A 4Q1PA 1ASJ2 4YW4A 1VBC1 4JGZA 3ALQA 2HEYF 4JTNA 3OCPA 4IEVA 4E2GA 4AI0A 4YZ1A 4C0BA 3AB0A 1ASJ3 3I54A 1A8MA 4PIYA 4ES9A 2F6BA 1SDWA 1CVNA 1GSLA 1RUD2 2PHXA 1SBDA 2PHWA 1ZM1A 3VN4A 2MEV1 3OTFA 2EAAA 3ZYPA 1G9FA 3FX3A 4IXLA 5T50A 5JZGB 5GZCA 2VVDA 1W6PA 1S0EA 1FNYA 2ET1A 1H9PA 1OLQA 4FXKB 3W58A 3U0ZA 4ORFA 4URTA 1SLCA 1FI2A 3LB9A 3R4UA 1RUE1 2YXSA 1ND3B 5LRSA 1D2QA 1Z7S2 1XRUA 1ZZ7A 2XL9A 2XL7A 1RMU2 1QOOA 3WNXA 2B9UA 4PBOA 4LO4B 1YCIA 2YC0A 2D7FA 4HANA 4CTEA 1CAWB 5K0UC 1HKDA 2PHFA 3PMSA 3CNAA 4IEQA 4GIQA 3DF0A 2A71A 1LKNA 1AR73 3WLUA 1H9WA 3PJQA 3S6PA 1DGWX 1UMZA 2OW4A 1DDLA 4LO5B 2UWAA 1YFXA 2OZ6A 3N3HA 5A32A 5BNPC 4XE9A 4PLNA 5CVRA 1N3PA 3VHPA 1SLLA 5FOBB 1KXGA 1WUVA 2ZX3A 2WT2A 2ZGLA 1TMF3 1EPWA 1UKRA 1O4TA 4NN0A 2NYYA 2GH2A 1R1ZA 4WM8C 3DPRA 4Y1ZA 1BQPA 2Q5TA 4PCRA 2RS52 1A6CA 3WDWA 3C2UA 3INAA 1YNAA 3GHMA 1NCRC 1X33A 3PLQA 1FPN2 3B5LB 1HRI3 5K8SA 4BLJA 3RYRA 2PLV1 3N7KA 4S2FA 3RPQA 4K3UA 3AYDA 4RS5A 5L36A 3FFQA 1RUF2 5J7MA 4XW3A 2RE9A 3NVCA 1LOAA 3VZLA 4DINB 5GLUA 4ATEA 2C9AA 2P2KA 3IT8A 3BTAA 4Y1YA 2ZAAA 1B35B 1RUC1 2WZPP 1JYIA 4S2DA 1RUF3 2ZGNA 1A8DA 1AYN1 3ZFFC 2F4PA 4GKYA 1NOVA 3H1WA 5GZDA 2VU9A 2YGMA 3HT2A 1N1VA 2GC1A 4Q4V3 2DUQA 1NLSA 4EROA 3O0VA 3UKNA 3NW4A 3VV1A 1LB2A 5DZFA 1LOBA 1LOEA 3GBGA 4FTSA 4AVSA 2VPVA 4H14A 3FBMA 4WM7B 1PGW1 4FBFA 1NY72 1HIXA 3WT3A 2WNUB 3RJRA 3RNSA 5KHJA 4B7EA 4LLOA 1PNFA 4M00A 4B8EA 1QGLA 1RUC3 1UZYA 1KFXL 3RYPA 1AR62 3GBWA 3AZYA 1VBD2 4XJ9A 3QACA 4L97A 4LBQB 4YM2A 2H0VA 2XBO1 3VHRA 1WW5A 4XTPA 1I9RA 1V6IA 2XJPA 4ZU4A 1BK1A 1HQWA 2WSUA 3I59A 2YZ4A 4YLZA 3KT7A 4J1WA 4D7SA 2XVGA 4IV1C 1S1AA 2ZGSA 4BCUA 3PHMA 2WNVB 4K40A 1ND3A 5D8AB 4QM8A 4EJRA 4DRRA 1ULFA 3KB5A 5B2GB 3FHIB 1MS5A 1RUI1 1H30A 4YVSB 1PO11 4GB31 2DTYA 3ZIXA 2XLAA 1FOD2 2O8QA 3J8F3 2R042 3MIEA 4Z1VA 1EAH3 1GQGA 2KM2A 4AVBA 3CL1A 5KHHA 4OHWA 1ZREA 2R072 1L3JA 3AM2A 2DUPA 1EP0A 1OA3A 5FFOC 1FOD3 1Q8PA 4XMAA 1RTVA 2YYOA 3ZYRA 3O7OA 1O3RA 2A3WA 5I0SA 4A2UA 3B01A 1GICA 1OQEA 1IOAA 1U5ZA 3ES4A 1DFQA 4KWLA 3VBFC 3VHOA 4CEYB 3VL9A 3L2HA 1AYM1 2R32A 3ES1A 2MNGA 4DY3A 3GYDA 1UU6A 3ZXEA 1YXWA 4Z82A 5JSPA 3HAGA 3JCIA 3ZXAC 5IK4A 4Q2FA 5KHGA 3WUDA 4IV3B 4XIOA 4P9WA 4IESA 1N1TA 2FBEA 3TN91 2ERFA 2JEMA 2JKBA 4M3CB 5JI7A 2HWF2 1H8TC 1GNHA 2XKPA 2ET7A 3WVJA 4HETA 3O0WA 2VVFA 2P3KA 1QNWA 3ZFEA 1TEIA 2UWBA 2BQPA 1B35A 3JQXA 3H7YA 3KQRA 2HWF3 2RM23 2D6KA 1ONAA 3IPVA 4DPNA 3DGTA 4SLIA 4LTAA 1RJ8A 3ZN6A 3ZPYA 5C9AC 4L9BA 4XF9A 2O1QA 1UX6A 1NCQB 4XDQA 5EWSA 1JBCA 1BBT1 5T5OA 1LHVA 1IPKA 4AW7A 1OPOA 3KCCA 3K51A 2WFF2 2XVKA 3CF6E 4FT8A 1GKBA 2BFUS 5BXXA 3VDDA 4QPYA 1C4RA 4KU7A 1WW6A 1QJX3 4DOUA 1EV13 4UW6A 4WM7A 5JOXA 2VQ0A 1C57A 1MZEA 4YFWA 3N4MA 2JE9A 1V6MA 4GMP0 4JAAA 4Q4X1 2ZOEB 4IERA 1S0IA 5FO8B 5H9SA 2VVEA 2WFF3 1VBA1 5IK8A 1S0JA 1PZ7A 4YGDA 1EYBA 4BMEA 3FE5A 4AQTA 1OA4A 4D3WA 4XF3A 4FOYA 1X82A 2HWC2 2PHLA 3WDYA 5JPMB 4LBQA 4QGLA 1OSGA 1QJY2 4QXKA 4EWEA 3I8TA 2VH9A 4Q8LA 3B93A 3DN7A 5DDJ2 4KL1A 3SHRA 4F83A 3M3OA 4HKLA 4HVOA 1HRV3 1QDCA 2D98A 4JDNA 5L19A 3WW1A 3U4XA 1V00A 4OUMA 4MGYE 3I7DA 3MEPA 4I2OA 3ECQA 4CDXB 1HLCA 1BCXA 1QXRA 3JD72 4Q27A 4DRVA 2TNFA 5D8AA 3ZXKA 1DGWA 3PTYA 4YW1A 2ZMKA 1RUH3 3ASIA 5I8TA 4YVSA 3B9IA 4I02A 4NO4A 2BUKA 2D6LX 3HN1A 3U11A 2IWGB 2P34A 4MVTA 1NA1C 2JJ6A 3HWJA 1F5FA 1WCDJ 1PIV2 4XPVA 5JI9A 3ZVXA 1AR82 4JGZC 2E53A 2P3JA 1MEC3 2GC0A 4IEWA 4RR3A 1AXKA 1LRHA 5C4WA 4HPKB 3AP9A 1DYPA 3ZSEA 4ASLA 4WZCA 4R8HA 1UW8A 2YV8A 1NE4A 4NOTA 3WQ0A 4AHWA 3ILNA 4CEYA 5GLWA 2BWAA 4CEWB 1BMV2 2VNOA 2XHKA 1V9U2 1AX2A 2BGCA 3Q9OA 4LT5A 2KXLA 2WS93 3PVNA 3KGLA 4R9AA 2MPFA 5DG2A 1VBB3 1BVVA 4LR4A 3QLQA 5L73A 3D6EA 5H9QA 1QNYA 3FUOA 4E4ZA 1FMD1 1PO21 3GNEA 2GMMA 4RHV2 2Q0AA 4LBOA 5TSWA 3JBG2 3H0OA 4CP2A 2R1BA 1AJKA 1BXHA 3WW3A 4R4XA 1AHSA 3RMXA 1LOFA 4NR1A 1POV0 4FAHA 4E4SA 1CAVB 3M3EA 4YW5A 2XLGA 5CB7A 4RHV3 2RMU2 3CJIB 3ROUA 1UF2C 1DQ1A 2ZGOA 5I0UA 1RVF3 5EZWA 2HWB3 5F9TA 4L8QA 1DF0A 3AKTA 4C90A 1MZ6A 2QZ3A 2R16A 3T1MA 4D7TA 1NCQA 2R6QA 5K9YA 2BFUL 1G9DA 1IZ3A 1QQP2 1WLTA 1AL22 3H3UA 3ETQA 2B5HA 3M4FA 4NHMA 4EN8B 1G8WA 1QOSA 4WZFA 3VBOB 1KDKA 1N47A 1WA4A 3DPRC 1SLTA 4BZ4A 1AR92 4KWKA 2R30A 1AXYA 1W0PA 4XOGA 4QGMA 1QQP3 2W68A 2WSVA 1AL23 2VMHA 3LCPA 3AMMA 2BVBA 2K2SA 3POSA 4I30A 2UYAA 4E4DX 1AR93 3V65A 5T3NA 1DGRN 3J26N 1IS6A 2KA3A 2ZGMA 4NPRA 4I0AA 4YRDA 3V64A 4RS5C 4GULA 1LU2A 1OOPB 1D4VB 3AP5A 4COUA 4DFSA 2GMPA 3HIFA 3MGUA 2RS13 3EJKA 3WW4A 5HBAA 1QF3A 2Z79A 3MFAA 1S0BA 3VBUA 4HVQA 1OMIA 3CU7A 4FPHA 1VRH3 1QU0A 1PZ8A 4K20A 3VBSB 1D0GA 2HWE1 4DB5A 2FMYA 4YG0A 1BEV2 1V6LA 3ME2A 2BW8A 2W08A 3OGJA 4AHXA 4Q4Y3 4YZ3A 1GZWA 3I2DA 4Y26A 3BCWA 1MR5A 4EN9B 4QPGB 1J58A 4A7YA 1Q8OA 5IK5A 1D0HA 2GSYA 3KMHA 3SITA 1S0CA 1CQ9A 4J6GA 1VJ2A 4LE3A 4W6YA 1S0DA 3FZ3A 1DZTA 1UD1A 3D8CA 2ZGPA 1C8M1 1PVC3 4YW2A 4AFDA 3V0AB 1ZBE3 2GC2A 2D5FA 1D2SA 5FOJB 4RQPB 1VP6A 4HKOA 2Y0OA 3NV4A 3M3CA 2YMZA 1QHDA 2UWCA 5IUQA 1MQTB 3OGGA 3MIDA 3OJBA 2D6MA 2BNNA 2EALA 2PN5A 4CEWA 4GXLA 3FC0A 4LEJA 1NQJA 5GLVA 1RJ7A 1EPZA 2ZMLA 3FMGA 2A6XA 5FLIA 5BNOB 1KQRA 4FXGB 4YARA 3H9AA 2B8MA 1TNRA 1VAMA 4YM3A 1SFNA 5CFCB 4N43B 2R49A 4BMBA 2BBVA 1ND3C 1ZZ6A 5AC92 3P3NA 1R082 3JZVA 1GR3A 1FV2A 2PHUA 4RFT0 4ZU7A 1G86A 4LLFA 4AGVA 4XXPA 1DQ0A 4GWNA 4MUVA 2TUNA 4JTOA 4AEMA 2OUJA 5CBLA 1D4M1 2JXAA 1BVP1 4W6WA 5IT6A 2D40A 1X50A 2E51A 5KHKA 1X7NA 2CAVA 5A33B 4HT1T 1W6QB 1DBNA 1CR7A 3EBRA 3IWZA 5T54A 2ZKNA 2ZX1A 3VKNA 4RGGA 3EQEA 1S55A 3AX4A 4YGBA 4CDQB 5DZGA 3S7IA 5FMOS 4BHPA 1XQNA 4PF5A 1J3PA 4DZGA 1R092 4QU2A 1OI6A 3JQWA 5DZEA 3CEWA 2DVBA 4XMIA 3MW4A 5A32B 1FNZA 5F1RA 2IFWA 1H4HA 1RUG1 4XXAA 4FPFA 3WZ1A 5CNAA 2PYTA 4AFMA 3WY6A 2PAMA 5EJ3A 3M70A 4YYOA 1R093 1YFWA 5JSOA 2WIIB 3QH7A 1M4WA 3E6CC 1Y9QA 3ZFEC 1B35C 4L92A 2D5HA 5FQ0B 2A70A 1NXD1 5ABJA 5JCTA 1RHI3 1AL0G 4S2GA 3RI8A 1RUD1 2RR11 2E7QA 4BYYA 4AK3A 4Z8BA 4AEDB 1LHWA 3CO2A 4EWDA 4CRQA 4ZU5A 1W6OB 3UJQA 1H2LA 2ETEA 3ST7A 1WBFA 1WGPA 4YVWB 1W6MB 2E7AA 4UW3A 5EFUA 3VDDC 2I74A 2EXIA 1VBC3 4Y1XA 1ZZCA 4Q4W1 4WM7C 1RMU1 1AR72 1ZBA1 3AFGA 4XZPA 2YPJA 2HWD1 1H1MA 4CP1A 2FZ2A 4E9KA 1MZFA 5JAXA 4BWOA 1GNZA 2IZWA 3FUQA 4OFGA 1OFNA 3EO6A 5FCCA 1MQTA 1J1LA 4LBQD 2B45X 2RR13 1TMF2 4YG6A 2XB6C 2XWBB 1RUE2 2MEV3 2DCZA 3QOPA 4JGYB 4D94A 4OVEA 2ZZQA 4CDUB 3AXEA 3MIFA 4LO6B 2K0GA 1PVXA 1JHNA 4XF4A 4B29A 1S0FA 1XNKA 3LA2A 4XJAA 1HRI2 1RUE3 5BNNA 2EXKA 2FMDA 1SBEA 2Q1ZB 2RS51 5D8AC 5JWPA 3WDTA 2VUAA 5JVVA 1PK6B 4YM1A 3WCSA 4YVSC 1FPN1 1MS4A 3TNPB 4HN1A 4Q8KA 4GKXA 4N53B 4CDWB 1DYKA 1XNCA 1POV1 4JQRA 1LECA 4NWWA 1Q5OA 3AP7A 2A5ZA 2X53S 2XLFA 1XXNA 4YW3A 4P9JA 1QJU1 2EXJA 1SLAA 3ZX7A 3PVEA 5C4WC 5A33A 1UU5A 4FO9A 4FPLA 4RR3C 4EN0A 1G9AA 2Z2SB 1W6QA 3BIWE 3UKTA 1VAVA 3AMHA 2DU1A 3MLLA 4Q4V2 2ILMA 5FMOL 1QWRA 4L2NA 5L7OB 1HXS1 4MGIE 2V5YA 4CDQA 2I07B 4CEYC 2EIGA 1K5MA 2X29A 2PLV2 5DUXA 4CP0A 4E27A 3NL1A 3W59A 3PVBB 4PLOA 5J09A 4FPCA 3VBHA 4UBGA 3IMNA 2CV6A 4FOWA 3VKOA 3BALA 3WDVA 4BH9A 1J3RA 2ZGKA 1QKQA 2DCJA 2PLV3 1FATA 2X5IB 2W39A 1RUC2 3POYA 3D5OA 5AFBA 2HJIA 5FDBA 5KC6A 1AYN2 1WCSA 3B02A 5GZEA 3MZHA 4Q1RA 4W65A 3R4SA 1WW4A 4ZKTB 1LOFC 4LO7A 2ZBJA 2ZHLA 3G6JB 5E16A 3FWEA 1NZCA 3MI8A 1QXPA 2R061 4IL7A 4G3YC 1SLIA 1AR61 4XFCA 4EWAA 5J3UA 4Q0PA 4N7UA 1VBD1 3ENRA 1AYN3 1FV3A 4H7LA 4OZXA 3NO8A 5JDBA 2AZ5A 1RUNA 3H1YA 4DXZA 1KITA 1ZRRA 4XETA 1PGW2 1SBFA 4NHLA 2PQQA 3ATGA 5T52A 4YG3A 1NCQC 2V73A 2DVDA 5SV8A 1UU4A 5JZGA 4MYEA 3ACLA 1DQ6A 4YVWA 1YFYA 1Q8VA 2CWMA 5K0UB 2YROA 2OVUA 1YRZA 5FBZA 4M3CF 2RS31 3J8F2 1KJLA 1OHFA 5KXBA 1EAH2 5BV6A 4M0HA 4GQ7A 1REDA 1AX1A 1SLBA 3OYWB 4Z92B 1V6OA 2R063 2RJLA 1CAWA 1ZNPA 2ZHMA 2R041 5FPXA 3WCRA 1CAUB 4P9LA 5T55A 1DGLA 2AUYA 2CGOA 5DUVA 2R071 4WM8B 2XBO3 4KU8A 2EA7A 3RWNA 4JGYA 4AQ2A 1HV1A 1X8EA 4CDUA 4FOQA 2Z69A 4P9GA 5H9RA 2ZGRA 4H55A 4K6BA 3VBUC 1PO12 4QPIC 2OUHA 3NV1A 3U07A 3VZKA 1LGNA 1X8MA 4WBBA 1MS0A 4QGNA 3TNQA 1CPMA 1IS4A 2CAUA 3AZXA 1ULEA 3UJOA 1ZRDA 4PLMA 1RUI3 5CFDB 4K7JA 1JYCA 2EAKA 3BOWA 1IS3A 4KG8A 5HI0A 1PO13 1QJZA 4GB33 4Y5Z0 4ZXKA 4P9IA 4N53A 2HEVF 4PBPA 1QDOA 4CZSA 2QQPA 1ZX5A 2DCTA 4AEKA 3IDBB 5CA6A 2QJVA 4UXAA 1MACA 2OYZA 3ZO0B 3ZFFB 2RM22 3E6BA 1KD7A 1AYM2 1PMIA 2ZX0A 1KRIA 1ZZ9A 5CU1A 1UIKA 2H6CA 3ZXLA 2GZWA 1C1LA 2IFRA 2WQZC 3O14A 3H8UA 1AYM3 2XJTA 4MXVA 3TN92 4BPZA 2TBVA 1MZ5A 2B46X 3WW2A 3WX5A 3UV9A 1AZDA 1REFA 1QJX2 1EV12 5JSRA 5I0TA 4N9HA 1W2UA 3TN93 4I01A 2X5IA 4FTEA 4HKWA 2AREA 3NV2A 4XHBA 4ES8A 3FLPA 2WA4A 2ZKLA 5LK5A 1BZWA 2WNUA 2ZX2A 2BWCA 2C0ZA 3AXDA 4JRAA 3KD4A 3AJZA 2Z5WA 2E7TA 1HRV2 1WMFA 1CN1A 1O91A 3GF6A 2HWC1 4CYDA 2WC2A 1QJY1 5DDJ1 1KFUL 1HW5A 1ND2B 3VZOA 5DXDA 1FXZA 1BBT3 1YFUA 4BLIA 5CIRA 5JIUA 1RUH2 3NAPB 4I09A 4AFAA 4IETA 4MSVA 2WZR1 2ZGQA 4IEYA 2E6VA 5K0UA 1YI7A 3JD71 3OD4A 1ENRA 2WNVA 2VW1A 3R0RA 2CY6A 2ZGTA 2VOWA 4XFHA 4Q4X3 1ZVFA 2VMGA 5C8WA 2DU0A 3GZUC 1YWKA 1VBA3 5FO7B 3WP3A 1AXZA 3OYWA 3TAYA 2RJKA 3TYJA 3RYKA 4FQZA 1MEC2 3FLRA 1OQDA 1CX4A 4OI2A 3BPZA 1PIV1 4XQDA 3OBRA 3WHTA 1WMDA 1AR81 1J3QA 3WD5A 1TME1 5AVPA 3JB8A 1DGRA 1AF9A 3B3QE 2WS92 4AHYA 5JOZA 4MGZE 4KGGA 5J36A 3T2TA 3WQ7A 1F31A 2XGXA 1VBB2 4AVVA 5ABJC 3GHNA 1I6XA 1U0AA 4C1WA 2JG9B 2H6BA 2O0OA 1V9U1 2HYKA 5CFDA 1H8TB 2BNOA 3M1HA 2A6YA 4I3GA 4XQWA 3J9SA 3DV8A 3ZYJB 1BYHA 3R05A 4IV3A 4YSFA 1SCRA 1LESA 4K9SA 4X6RB 2ZA9A 1WD4A 4M3CA 2A7AA 3JBG1 4Y1VA 5FO9B 3VL8A 1TME3 1RVF2 3WR0A 2HWB2 2G9GA 4KNCA 5C9AB 2VOXA 4XQ4A 3RRDA 4KQ7A 2RMU1 1O7FA 4AGRA 1WLWA 3U10A 3WP5A 2IXLA 3H7JA 1GBGA 1QMJA 1MQTC 4X6QB 3ZSJA 1ZRCA 3D4KA 2WA3A 3VBRB 4XFAA 4A7KA 4Y20B 5J96B 1CJPA 1OA2A 1NLRA 1YYNA 3JU9A 4O9EA 4WVMB 4IEPA 3ZMOA 4BE3A 4P9XA 3A0KA 1LOGA 4C91A 3HT1A 3GBFA 1FMD3 3M2MA 1PO23 4LHNA 3ZSLA 2B39A 4R52A 1H8VA 1Y7BA 3M7AA 4HSLA 5BNNC 4MX3A 2SLIA 5DG1A 4PDWB 2XJSA 2CL2A 3MPBA 2D43A 4JVAA 1CPNA 3WOGA 1ULCA 1REEA 2RS12 3SISA 5J37A 2ZPXA