1Y43B

Crystal structure of aspergilloglutamic peptidase from aspergillus niger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
171
structure length
171
Chain Sequence
b'EEYCASAWVGIDGDTCETAILQTGVDFCYEDGQTSYDAWYEWYPDYAYDFSDITISEGDSIKVTVEATSKSSGSATVENLTTGQSVTHTFSGNVEGDLCETNAEWIVEDFESGDSLVAFADFGSVTFTNAEATSGGSTVGPSDATVMDIEQDGSVLTETSVSGDSVTVTYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspergillopepsin II light chain
publication title The three-dimensional structure of aspergilloglutamic peptidase from Aspergillus niger
rcsb
molecule tags Hydrolase
total genus 21
structure length 171
sequence length 171
ec nomenclature ec 3.4.23.19: Aspergillopepsin II.
pdb deposition date 2004-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1y43B00
1S2KA 1S2BA 2IFWA 1Y43B 3TRSB 2IFRA
chains in the Genus database with same CATH superfamily
3IIAA 3SCGA 3HQUA 3MPPG 2Q8OA 5L7OA 3BB6A 2B5HA 4M01A 4AI0A 3HN3A 3NVCA 5F3IA 1Q8PA 1AR93 1J1TA 1YQCA 5FPLA 3S7IA 4CCNA 3LDKA 4WM7B 4CTEA 4XJZA 1TE1B 3OG2A 1C5HA 3LA2A 4NIHA 3N7LA 4LTAA 5FBZA 5E6HA 1S0CA 1XSQA 4ORFA 4RR3A 3DN7A 3FBMA 2UWCA 4GB32 3RI9A 2NMOA 3WDTA 5T3NA 3TN92 4FPOB 3WW4A 2G4IA 2H0VA 3T0BA 1TQ5A 1DLCA 3UKNA 5A6YA 4A41A 1KS4A 5I93A 2FZ2A 4D6RA 1DGWX 2ARBA 3OJBA 4RQPA 3OGGA 1W8HA 4IEWA 4WM8A 3MLJA 3LDRA 1NCQC 1UO9A 4XTMA 4FPFA 4QQPA 1K5MA 1O91A 2VZUA 4CRQA 3WDWA 2WA3A 5LA1A 4LITA 1YYNA 5FJKA 3J8F2 4QM9A 3EMRA 4RFT0 3WQ0A 4HL0A 2VBDA 4GMP1 1W39A 2VZRA 1BVP1 5L36A 4PQQA 5FYTA 2VVDA 2W68A 4YNIA 4AVTA 1OD3A 5JZGA 3SH5A 3FLRA 3MLLA 1N3QA 1XE0A 3F2ZA 4XDQA 4JTOA 3FN9A 4YARA 1RUNA 3THTA 4LOSA 2VVFA 3W21A 5FYZA 3ZDVA 1AHSA 3SLIA 4DFSA 1Z0HA 5KHGA 5JWPA 3MUZ1 1JYWA 1F8VA 2P6CA 2SLIA 3AKSA 1JZ6A 3I3EA 2HYXA 3KV6A 1WCKA 2QQUA 3THCA 4XDOA 1C8NA 4XETA 2AEZA 3OTFA 1QDCA 4PIZA 5C8CA 1RB8G 1QKQA 1SHWB 2YC2A 3UJOA 3ST7A 1JXNA 5I0DA 1PHMA 4AFCA 1RHI3 4NRMA 2C5DA 1OA2A 4XIKA 1V0AA 3SITA 4PIYA 3VKMA 1AYN1 1YIFA 2CY6A 1U5YA 4X8NA 4AVSA 1RUJ1 4KG8A 1FXZA 2HWE3 2PQSA 3VHOA 4QMAA 1SMVA 4BB3A 5C4WC 3MF9A 2XDVA 3K4AA 2ADDA 1H30A 2YU1A 4NVPA 4X8PA 1QF3A 5JPMB 1LAJA 4JHTA 2XOMA 4WM7A 4CCJA 4KL1A 1C28A 2RS32 4Z2AA 4XCBA 3PURA 1TNRA 2YPJA 2Z5WA 1RMU1 1OMIA 4MYEA 1YFYA 1W6QA 2W95A 5F7UA 1OOPC 3SH3A 2BWCA 2VC9A 2WT2A 5EIYB 1G9CA 4Q2FA 4NAMA 1IZ3A 5F5CA 3KV9A 5IFTA 2CTVA 1ALYA 4INDA 2JG9C 5EP9A 1RIRA 4MH0E 2VM9A 5H9QA 2XLFA 4BJ0A 3ILNA 2CL2A 4I0AA 5FYYA 1FNYA 3VBFC 5CADA 5JMCA 1GZ9A 1YJKA 3OBAA 4FPCA 2BGPA 2RR12 3MIBA 5FYMA 2WFF2 3MHZA 1GFF2 3POYA 4FPJA 1JMUB 4ASLA 4CU9A 5IFPA 3UNPA 2IXLA 1RUG3 3MI8A 4QXCA 4UW4A 1BKZA 4K40A 2BTVC 2AC1A 2BBVA 2LROA 5L73A 1HRI3 3LFMA 4FSJA 3HN1A 2HWD2 4OUEA 2JDZA 4IDZA 2PN5A 1R081 2R063 3R05A 4ZPIA 4LO8A 4LKEA 4XZUG 3O1PA 4XZPA 5CU1A 3LIGA 4OCTA 2NP0A 2P34A 3MIFA 4MGQA 1QJY1 2YFUA 2JB8A 3K48A 3VZJA 2P5BA 4MGZE 5A7QA 2OW4A 3CBNA 2BERA 1PGL2 2DDUA 5I8TA 1NE4A 1NXD1 2EVXA 1ZBE1 5IJRA 5KHIA 5JCTA 2JIJA 3INAA 4AEDB 3OUJA 4R9DA 4AI3A 2R6QA 3LOIA 3WZ1A 5JI9A 1HXS2 1NUKA 2RMU3 2RS51 2P4EA 4I30A 2VOWA 5HCBA 1MR5A 3ZOIA 4TZDA 2R062 5A6ZA 1SG3A 2PAEA 1RTVA 4ZXEA 2IXJA 2Z79A 2QVSB 4M3CE 5FZGA 4C0HA 4H14A 3PUAA 1CVNA 3CJIC 4I09A 2BQPA 2HWC2 1QXJA 2ZX0A 3R6SA 4AWDA 4CCOA 3OGJA 4JV4A 1QHDA 2N7GA 4L99A 1QU0A 4QQOA 4A3XA 1RHI1 1UZZA 1L7QA 1J3PA 1XNBA 1RUD2 1W8NA 4H7LA 1TNFA 4Q4Y2 3GGLA 4S2HA 1J59A 1VMJA 4P5HA 2VXRA 1HRV3 2D40A 5JMOA 2EAKA 5BNPC 1EP0A 1Q5OA 4YG0A 4EN8B 3HR9A 4IEOA 4L8QA 1DGRN 4M4RA 4B4RA 1W8OA 1W05A 2G9GA 3WUDA 3JB8A 4WZCA 3I2JA 1W8ZA 2C9AA 2Q0AA 5GM0A 4W6WA 1MQTA 2PXJA 2J1SA 1BQPA 1W9WA 3RYPA 3MDPA 4AW7A 4JVAA 1UKRA 4NAOA 3JD72 2BRTA 5FYUA 1X8MA 4AI9A 1BBT3 2HWF1 2HEVF 2V4VA 3KCCA 4OZXA 1C4RA 2Z2SB 3VHPA 2ET1A 3E5QA 2D5HA 4PBPA 3ZLIA 1ZRRA 1C8M3 1ZBA3 5C8WA 1GOHA 1V00A 1W6PB 4P9IA 2O0OA 5BNOB 1FV3A 1TG7A 4QX2A 1DZTA 1NLRA 4LKFA 4IQPA 4YFZA 5IVVA 5FR3A 4Q0UA 1JZ3A 1UF2C 2RJLA 2XKOA 3JBG3 1ZRCA 2WJSA 3IPVB 1PVC1 3IKWA 4LUMA 3IT8A 4ZZ5A 5A3LA 3I2IA 1H1AA 2RS12 3AFKA 1TMF3 1JYXA 1QDOA 2VNGA 2E63A 1GYKA 3A0KA 3WQBA 4E2SA 1QGLA 1JUHA 2VVEA 2BNMA 3ILRA 3UL2A 5K9YA 2QKDA 4JZRA 1TME3 2GU9A 3HJRA 2HBUA 1YFWA 4ONUA 3IZOA 2D3RA 3HAGA 4KWUA 2DVGA 1S4CA 3NV4A 2X05A 1LB2A 2WNEA 4AHZA 2GDFA 2NLRA 2FD8A 3LCPA 2BYVE 5EJ3A 1AR71 1BK0A 5ANQA 1VBA2 3WR0A 3WV6A 1GNYA 2HH9A 4PIXA 1OLRA 1PGW1 3FHIB 1N1VA 2D3SA 2KD7A 4PLMA 4QPIC 5JDBA 3AFGA 4FVVA 4LO6B 5CKNA 1COV3 1DFQA 3MFCA 1RUH3 5CKMA 5AVPA 3ZYHA 1GICA 2ZZQA 1VBE1 2DYCA 3TNPB 3VD5A 3WP6A 4BQ4A 4QX1A 2WA4A 1AJOA 1CJPA 5F39A 4OQ9A 1AR61 3GNEA 3WP5A 1NYWA 1Z7S1 4FPHA 2UYBA 1UMZA 5TSWA 2IXHA 1QJX1 4F3JA 3ZKYA 4MVTA 4HG6B 1F2NA 1SPPB 4RGKA 3N9QA 2V72A 4I02A 4O7XA 1W0PA 1NT0A 3T2OA 3RDIA 1HRV1 2JWPA 3C7EA 5GLTA 2WZR2 1FMD3 3S6PA 4AFBA 3RPQA 4EN0A 3RWKX 1N1SA 2Q8CA 1BMV2 5EJ1B 1LGCA 1VRH3 3VBOC 3GJBA 4LULA 3NNGA 4LE3A 2VMFA 2F4PA 3QLQA 5K0UB 3O1TA 3A23A 1IGOA 1W6PA 5C3OA 3O1RA 4FFGA 1Q8VA 2G1MA 2GNMA 3RZJA 5IUQA 5EJZB 1GQPA 2GSYA 1BBT1 2Y6HA 3RG0A 2FDKA 4OI0A 1KRIA 2XGXA 4RS5C 5FZIA 4LOTA 4CP0A 5FY5A 4C8DA 4MGKE 3TRSB 5H9RA 1CPNA 3KHCA 4XXPA 4L92A 4TN7A 1LRHA 2VUAA 4Q4V2 5FZMA 4BXFA 2CWMA 1CAWA 5LEKA 3DPRC 1MZ6A 5HCHA 1Y9MA 2VTXJ 2CU5A 3DKQA 4PHZA 4IXLA 2NZ9A 3BGAA 1CZTA 5JIUA 2FCUA 2MPFA 4OHWA 2UYAA 4XUPA 4A6OA 1UYYA 3EBRA 4AZZA 5CAZA 3PU8A 1UOJA 1XPWA 2O8OA 4CDQB 3A0NA 2OZJA 4QQLA 4RGGA 4XCAA 5C6CA 1U0AA 5CZKA 3GZAA 1D4M2 1O5UA 3MZHA 3ZYJB 4BIFA 3BU7A 3FFZA 1BZWA 4OFGA 3G7DA 4CXYA 4HKWA 5GZFA 1X50A 1NE6A 2B39A 4LPLA 2CDOA 4N43B 5IVCA 5FXXA 1NCQB 1FOD2 4EN7B 5FREA 1FX5A 4IE7A 5A3UA 2ZMNA 4GMP0 4Z2WA 4YGBA 4XHXA 5FP4A 3SISA 1UMHA 5JI7A 2AR6A 3AK0A 4AAXA 1BJQA 1SPPA 4PCRA 1J3QA 2QQNA 1OQ1A 2CYFA 4BU2A 5E88A 4LA2A 2W3JA 5LRRA 5E1RA 2VCMA 3KT1A 1SBEA 1Y9GA 5LRSA 4G9SB 1LECA 4RA0A 4LJHA 4TYSA 4QPWA 5BNQA 4RL7A 4NO4A 1O8PA 3TAYA 1RVF1 4K9SA 2VO5A 1LOCA 1SLBA 3ETQA 3VD7A 4U2AA 4XACA 2W91A 5BUVA 3B3QE 5ANNA 2DCZA 4HXCA 3H1MA 5L9VA 5K0UA 3WT3A 4BH9A 5A7WB 3POBA 3T30A 3LEGA 2ZGMA 3O1MA 4P9XA 2YB7A 3NV2A 1DQ1A 3T0AA 5A3NA 2GP5A 4ASKA 4Q4X1 4DQAA 5A3TA 2VQTA 4XXAA 3S30A 1BLZA 2KXLA 3WG2A 3VKOA 1W9SA 4B1MA 3OGSA 5CG8A 1UYXA 4FFHA 1YIPA 5G04L 2ZACA 4JGZC 1AX2A 3SC7X 4JQRA 3ZN6B 1DZQA 2VCAA 1TVGA 3RMXA 5HCFA 4AHWA 2TBVA 3PDQA 3ZX7A 4UW5A 1RJ7A 2A5ZA 1AYM2 1FI2A 1XNAA 2BOIA 1O7FA 2OUHA 1US3A 1H2MA 2EXHA 3ZSEA 4P9GA 1CQ9A 5JXJA 4AE2A 5DUUA 1I3HA 2HLEA 2PHTA 3WDVA 5C5TA 1W2UA 1PO23 1Q8QA 1US2A 4A7ZA 1QQP3 5A7SA 2X09A 2XH6A 3RYKA 1V9U1 3HNMA 3T0DA 2XJUA 4YW5A 4CDQA 2XMLA 3K46A 1MS9A 2XWJB 2HBTA 1RUE3 1DCSA 4LHSA 3ENRA 1GUIA 4CCKA 1PMJX 4CDUA 1HQWA 1W06A 1QNWA 5A3WA 4N53A 4K1ZA 3URFA 4DOUA 1A3KA 3VBFB 2XPJA 2E7TA 4HANA 2YMZA 5K4LA 2B46X 2VUCA 2Y26A 2HEWF 4XJ8A 2PLV2 1UWWA 4O9EA 3WDUA 1MQTC 2RE9A 4B7KA 1QJEA 1DQ4A 4UXAA 5GALA 4E2GA 1XOYA 5C9AC 3FUOA 4COUA 1YQ8A 5CYYA 4BMBA 2JENA 1J58A 3AP5A 2ZHKA 1ULGA 3M70A 2IWGB 4E8CA 3UETA 1IS4A 3VZMA 2E9QA 2QQLA 1UIKA 4DINB 2WKKA 1RGSA 1RUC1 2QE3A 3I2FA 4QDSA 4QU1A 3WQ7A 1EUTA 2UWBA 4L9BA 1NA1A 3AJZA 1LKNA 3NRUA 2VMDA 1J3RA 3KVBA 3NNJA 1FT9A 2JE7A 4Q0PA 5FYBA 5A7WA 4MSVA 4COVA 3UKVA 1EAH2 1NCRC 4Q29A 3GBGA 4GH4C 2FBEA 4Y5Z0 2KM2A 1D4VB 1NQJA 3WD5A 2JB4A 3KF3A 1AR83 1WCDJ 4GULA 4H7MA 1HB4A 1L3JA 1SLIA 4AI1A 3WF4A 2VZ1A 1VBB3 4ZS3A 4ES9A 1SBDA 2CHHA 4NIAA 3RZHA 1OUSA 3CMGA 1IHMA 4YG6A 3ACLA 3N7KA 3MUY1 2RDNA 3P6BA 4IESA 3SCHA 1DLLA 5BNNB 3CJIB 1EUUA 1MS8A 1SDWA 1W6NB 3AZZA 3M3CA 4H2AA 2RDSA 5DZFA 2ORZA 2GH8A 1WMXA 4IL7A 1R092 1W8WA 1HLCA 4XW3A 3B9CA 2WZ8A 1QXRA 2DTWA 1ZNPA 1W2AX 4IUGA 4ZU5A 2ID4A 3PL0A 4RYDA 2DUQA 2VG9A 3MLKA 2A6ZA 2DVDA 2ZHLA 1DIWA 3M3IA 1CAXB 4OMDA 2GP3A 2UU8A 1IPKA 2R073 2ZPXA 4LR4A 3NAPC 1REFA 1A8DA 2BV4A 3LGRA 4Z82A 2NN8A 2NM1A 4CEYC 5C70A 2YUEA 3UESA 2WNVB 4LBOA 2XVLA 1HDKA 2WT0A 4MUVA 1MZEA 4Q4W1 5ABJC 1VJ2A 1OFNA 1VMHA 1RUF2 4UF0B 1R1A3 4EN9B 1QQP1 3ZYRA 2CNAA 4JQTA 1JI6A 1WW5A 2D5FA 1WLTA 3C2UA 3ZMOA 1PIV2 4D7TA 2C9KA 3CHXA 4Q1PA 5A3PA 5FY4A 2W39A 2ENRA 2ZXQA 4Q8LA 5FPAA 3SCFA 5ISLA 1VBC3 2B42B 2MEV3 4DXTA 2JDPA 2Z69A 1O4TA 3MW2A 2PHRA 3D8CA 4IV3C 4SLIA 4CEWC 1G9AA 4M0HA 1K42A 4Q27A 4EV0A 3I54A 3Q8BA 1QJU2 2QQWA 4AG4A 3PMSA 4JDOA 2FMYA 1GANA 2P2KA 3AL5A 4FPEA 4OLLA 3SNMA 1PNFA 2DVAA 2PELA 1W8UA 4ZHNA 2GC2A 4BQ5A 4XFGA 4CCEA 2JDKA 1OT5A 3NJXA 3VBUC 4J25A 5LBEA 2G9ZA 2R49A 3Q9OA 4FOWA 3POWA 4F7ZA 4Y1YA 2QNKA 5ACA3 1ULDA 5CG9A 1H4HA 4YWAA 3WNOA 3J4UH 2W87A 3PJYA 1HJFA 3ZKUA 2XBO1 4B3NA 5IVJA 3ME2A 2NQYA 2VZTA 3H1WA 4JGYC 1SLLA 1YCIA 3TEWA 1GWKA 2ZKLA 1GLHA 4PLOA 3ZSJA 3I59B 2JDNA 1EPWA 5BNNA 1LODA 4AVVA 1W6NA 1V6KA 1F35A 2WLQA 5FZ4A 5LY2A 3D4KA 3PJQA 5APAA 2VAUA 1Q43A 1KDKA 1AVBA 4QX3A 1OBNA 4Y26A 5KXEA 1PO12 4L2NA 1CAVB 2VCBA 4P14A 3VBRA 3W20A 4AQSA 1JYCA 4HKLA 5FXWA 4BDVB 2X5IC 1G9DA 2RHPA 4CCLA 5JSPA 1CAXA 3U0ZA 1BCXA 2B7YA 3ZDSA 2Y6FA 3TEXA 4S2GA 1XYPA 1YQ2A 2FCTA 3FHQA 3POIA 3RZKA 4Z07A 1S1AA 5FPUA 5I0SA 2VOVA 1DHKB 2WNVA 5CKQA 3I3MA 1ENRA 3PIJA 5GZDA 1ULCA 1QJFA 1VAVA 1GWLA 1RXGA 2I45A 4OQ8A 4YVSB 1VRBA 3BI3A 1K45A 2YG0A 3FUQA 4IE6A 1X82A 5DAWA 1QOSA 3HQXA 3IM0A 1EV11 4TSVA 3GM8A 2RM21 2W46A 3J7MA 4GB33 2B4KA 3D6EA 1AZDA 1IS3A 2IVJA 3TN93 3H8RA 3CL1A 2OVUA 3WQ1A 4GKYA 3BOWA 3ZXJA 4IE4A 5I0TA 2OQ7A 1CN1A 5KWRA 3VB9A 2IFRA 5IVYA 5AFEA 2OT7A 4FI9A 4XMAA 5GLUA 1E5IA 5DABA 2GMEA 5B4XA 3ACGA 3KVAA 5T54A 3LSDA 5LBFA 5CFDB 4IETA 4BIOA 3JB4C 1VBC1 1AF9A 2QQIA 3N9NA 2FQPA 2MEV1 4XJUA 1UCXA 2DVFA 4HETA 1UY1A 2RDQA 4CCMA 5T5PA 2AGSA 1UPIA 4QT6A 3ATGA 2BVBA 3ABZA 3IB3A 4D69A 3FJSA 1XC6A 4MG2A 3HWJA 1VB2A 3J8F3 4IGQA 4JX0A 2WYFA 2QCSB 2WZEA 3L2YA 4HVRA 3VD3A 2ZKNA 2R041 3DPRB 4D8MA 4CP9B 1UU4A 2GC0A 2QBXA 2V73A 1GP4A 1XNTA 3AJYA 3BIWE 3AVSA 3ZSMA 4R9AA 1IPJA 2D43A 1W0OA 4YGDA 3D0SA 2XG3A 3ZFGC 1I1EA 4COWA 5IYYA 1GV9A 4AGGA 3I59A 3AZYA 1VPHA 4QPGA 4YG3A 1RUJ2 3AC0A 5A1AA 2VR4A 1OD5A 1ZZ9A 2DVBA 1W2TA 2JJ6A 2ZOEB 2WZPP 1D2SA 2WO7A 5JAXA 2EIBA 1X7NA 3E6DA 2WQ8A 3ES1A 4D7SA 2JE8A 1CAVA 1DG6A 4ARYA 1U12A 5FV3A 2YGMA 4FFIA 2BU9A 3VHRA 1YLLA 2DFCA 1YO8A 2SBAA 4YW2A 4I2OA 1SBFA 3EXUA 2CAUA 4LK7A 4IV1C 4UBGA 5FMCA 1OQDA 2DUOA 5FLJA 1HB1A 1YQ6A 2WS93 2A75A 1UKGA 1PK6B 5IHRA 3NJYA 3H9AA 4HT1T 3VD4A 1ULEA 5T5OA 2ZX4A 2OKXA 2BEOA 4KI5M 4YPJA 1JZ7A 1T6BX 1UN1A 2XLGA 4KBZA 2VBBA 2RS33 5BXXA 3APBA 4HOOA 2ETEA 4YVSA 3RYRA 3UGGA 5M0TA 4X6RB 1OSGA 4KG0A 1H6XA 2CGNA 3T4VA 3SEPA 5FY1A 1PGSA 1W2NA 2RJKA 1POV0 3UYJA 5AC91 3AXDA 3NNLA 5IATA 3VDDB 1KD7A 3H3ZA 4O65A 3WLUA 2O1QA 2ILMA 4CDWC 1LOBA 1QOOA 2C26A 5CA6A 5DXDA 2I74A 2WS92 3O0VA 2YXSA 3ILFA 3AZWA 4URAA 1Q8SA 1DGRA 5F5QA 1PZ8A 1R082 5F9TA 2LALA 5CFDA 1B35C 5IK7A 3ZN4A 3EO6A 4BK5A 1NKGA 2HEYF 4G3YC 2RR13 4NIIA 1WBFA 2VPVA 2WFF3 2R16A 3PTRB 5FYVA 4TXWA 5IK8A 1ND3B 1OLQA 1H8TB 4OYUA 1MVQA 3WDYA 1QJY2 3WNLA 3WSOA 1VP6A 2HWD3 4GALA 1AR91 1ZBE2 1XYOA 2W94A 3AP7A 4LXLA 4PJYA 3KSCA 4QB6A 1I5PA 4NHKA 2FHRA 3AVRA 1OF3A 2BGOA 1ZRIA 3CIHA 3IDBB 3ZXGA 4D6QA 3NO8A 1QJZA 2QFEA 2RS52 3QH7A 2WL1A 3S5QA 4LIUA 1HN0A 4TWTA 3LSEA 2WIIB 1W3XA 4QX5A 4W6XA 5C5UA 2X8KA 3OOXA 4UOJA 2LS6A 3ROUA 4TTGA 3VN4A 3CNAA 5FP7A 4EWDA 1CJDA 4Z8BA 4K20A 1WLCA 1V6MA 2XB6C 1PMIA 1T2XA 3O0XA 3CKHA 4UWDA 1S0BA 4Y4RA 4AFDA 4HONA 1UOBA 4XF9A 1GP5A 1OC1A 3LIHA 2C6SA 1UMIA 2PYTA 3DECA 1DQ5A 1OA4A 1YJLA 1HXS3 2PA7A 1REEA 3OD4A 4AQ6A 5CFCB 1OQEA 4MADA 3WF2A 1H0BA 2GZWA 2H0BA 2PHUA 4MOAA 4A6SA 3AP9A 4JHZA 2VE1A 2UWAA 3E5UA 5JPNB 1YRZA 1RJ8A 3IAQA 1PK6A 2D6PA 5F3EA 2HWC3 4CDXC 2Y6KA 4DMIA 1ND2C 4DY3A 2EXKA 4NOTA 3U10A 4QKNA 4XF3A 2XQRA 2E6VA 2J1RA 2WQZC 5A7NA 5JOZA 1OLME 1RUD3 4Y24A 5LZ6A 1O6UA 1O5LA 1SLCA 4Q4Y3 5FO8B 3NV1A 4NN0A 5J7MA 4DB5A 2JDHA 1W6MB 4JDMA 3C7HA 2JD4A 1DYPA 3KZ4C 5EFUA 2OUJA 2HWF2 2HWB3 2ZS6B 3VDDA 1NAEA 1JH5A 3MEPA 1HX6A 1WMDA 4J1WA 5D8AC 1IG0A 3NV3A 5FCCA 1UYZA 3ZFFC 1D0GA 3KHBA 4YGCA 3IAPA 2ZAHA 1XQNA 4DS0A 3GYDA 2VH9A 3PTYA 4KU7A 3VBHB 1M06G 3FE5A 3JD73 2A7AA 2BNOA 2H6BA 4MZUA 2QQKA 3N36A 1HB2A 1PVC2 1ND3A 3HNBM 1H8TA 3ZR5A 3RJ2X 4UW6A 2HWE1 4JKKA 2AEYA 4LKDA 1LHNA 4LO4B 2BUKA 4LHNA 4K3UA 2HWB2 5L9BA 3T1MA 4BQWA 4JDNA 5LK7B 2VZOA 4XE9A 3WP4A 1RUOA 3I3DA 4XTPA 2ZGOA 3P1IA 2RR11 3GHMA 3J7NA 4CU7A 1QH6A 1Y4WA 3VBSC 3K2OA 1X9TA 2DU1A 5FMDA 3QOPA 1LHWA 2B45X 2Y64A 5D21A 5DQ0A 1JZ2A 1UNBA 2RS13 2VMEA 4XOGA 1AR72 1WW4A 2XJSA 4FOVA 5FAXA 1V6OA 3A4UA 2VW2A 2CGOA 4FPGA 5FLIA 3GXUA 2WNUC 2ERFA 4QAWA 4HVQA 2JG8B 1KGYA 4PDWC 4XBNA 1CZVA 3HPNA 3N9OA 4P5YA 3J9SA 1V6LA 3LPFA 3PVOA 2JECA 2Q1ZB 1YUDA 5CFCA 2XHKA 4OI1A 2W52A 2WINB 2W1QA 1AR62 1PGL1 3VLBB 1OXCA 1VBA3 2JDAA 1Z7S2 1RUG1 4LBLA 5IWFA 3KF5A 2GMPA 4AHXA 3PUHA 1QJX2 3N7MA 3UJQA 3GHNA 4XURA 2IUWA 2RJ2A 4B8EA 1IPSA 2XL7A 1HXS1 2VW1A 1HRI1 3ALQA 3DYMA 5B2GB 2AENA 1E5RA 3PVNA 2R061 1QNYA 1LOAA 2A3YA 3X29B 1RINA 3RJRA 3C7GA 4AEDA 2VUDA 3BU0A 2BVVA 3H3LA 2CGPA 3UGFA 1JTZX 1UY2A 5L7OC 2XJRA 5L19A 2V5YA 3VBUB 2VMCA 4JAAA 3KV4A 1O3TA 2QZ2A 3K4DA 5FZOB 1RUD1 3ELNA 5LATA 2IC1A 3USUB 4F83A 4UFMA 2E51A 4I0BA 4YRDA 3K3NA 1Q56A 4JGYB 1ENSA 4RR3C 3VBHA 2WZR3 5F6KA 3WHTA 5FZ1A 4DUXA 2RMU1 2VECA 3GJAA 4I3GA 5HV0A 2C1FA 1GP6A 3DL3A 4NRQA 4CU6A 2OIIA 3MW4A 3PIGA 2Q1FA 1STMA 1OVPA 1CR7A 1OVSA 5F8PA 3WNKA 4AI2A 2Q1MA 3VHNA 3ZFEB 3R4DB 4RQPC 5HV4A 1P8JA 4AEJA 3JU9A 3N3HA 4Y5SA 3QCWA 4WM8C 5SV5A 2P37A 3W58A 4GJYA 3ITQA 5DAXA 1K5MC 3C3VA 4NHMA 2WABA 3RS6A 1ENQA 1X8EA 5LBBA 5FUIA 5JIAA 1GZTA 4FPYA 3OB8A 4GZ9A 4AAPA 1XRUA 1VBD2 2VMHA 4Q4V3 4YW3A 3V64A 5JZGC 2BDRA 4GD4A 3VZNA 5J3UA 5EHDA 4YVWB 3LWCA 3W59A 2JG8A 2R0FA 4HVOA 2ZEWA 4H55A 5BNOA 2VQ0A 3MW3A 1YNAA 1UY3A 2CAVA 4DEVA 3LE0A 3ZYBA 3SH4A 2QQJA 1LGNA 1E5SA 1WW7A 1ZZBA 1RUI3 1POV3 3IPVA 2YBPA 4HMZA 4MV2A 4QQ2A 4ASMB 3O1OA 2P17A 4PQ9A 4LHLA 4D6SA 1C8M1 1XB9A 1ZBA1 5HPOA 1D4M3 1LOGA 2ES3A 5C8CC 5JXHA 4MGYE 1TEIA 1Q8OA 3D5OA 4PI2A 3NKTA 4JKMA 5C3PA 2BJSA 2YPDA 3VL9A 4XC9A 5FZKA 2IXIA 3U78A 2Y0IA 2WNOA 3JBG1 2PAMA 1U5IA 3MO4A 3AB0A 1FOD3 1FPN2 1RVF2 4AGVA 4FQZA 1O4ZA 1TMF1 1XNCA 4XFIA 1O59A 4LBKA 5HBAA 2W92A 5KC6A 1O3SA 3M2MA 1AL23 4WM7C 4EWEA 2QDNA 1RUI2 2FDJA 5AFBA 2X53S 1TME1 3USUA 3HNYM 4YFWA 3ON7A 1Q3EA 5FZLA 1XSRA 2P3IA 5HXMA 4C90A 3ACHA 3T3YA 1JYIA 1HW5A 1CX4A 3FL7A 3D3AA 3OUIA 4IEYA 4QB2A 4JRLA 2J1UA 1LENA 3VKLA 2DCYA 4FAGA 2WSUA 1I6XA 5LCWL 2BZDA 1OF4A 2ZX3A 3ZFEA 1MZ5A 4YM2A 1SLAA 5FKBA 3EYPA 3GZUC 1CONA 1LJ7A 2Q5TA 2TNFA 2WZR1 4RD7A 1S0JA 3C7FA 1DYKA 1ZZ6A 3IWZA 5LB6A 1AL22 2P3YA 1COV1 1JW6A 2E7QA 5F2WA 5IVFA 1RUH1 4XUNA 5IAVA 2WWSA 1IQDC 2BWAA 4IEUA 3HMYA 1YI7A 3BALA 1UZ0A 2YBKA 1MEC2 4A7YA 1W2OA 2LW8A 4FXKB 5FZ3A 4QGNA 1AYM3 5LASA 3DYPA 5F1RA 1C57A 1DZRA 5JSOA 1BEV2 3BUCA 4FP2A 5CBLA 4YVWA 3IIIA 3PNAA 3UV9A 1VLNA 1S0EA 4P02B 3GCWA 1ZA7A 5T55A 4KGQA 3AMMA 4AI8A 5K8SA 1FMD1 2XHNA 4LLOA 1HKDA 4X6QB 2ZABA 3NNMA 5KXBA 3TYJA 1H8VA 1VRH1 3LF7A 3KLSA 3AL6A 4M00A 3ZXAC 4CDWB 5GKAC 1OH4A 1F4AA 3KQ4B 2H6CA 1LOEA 2CWSA 3ES4A 4GA9A 3MV01 1OUXA 4XJ9A 5DAVA 2J1VA 3D0JA 1G7YA 4YW4A 4C1WA 3KT4A 1LOFA 5C4WB 4EQVA 2VU9A 4M3CB 4E27A 4K7JA 3H8XA 5FIXA 2G19A 4Z1VA 4JTNA 5JSRA 2PLV3 1F9KA 1RUC2 1BVVA 3NJVA 2ZEYA 3PMEA 2K9ZA 4CPBD 4XBQA 4KMQA 3NW4A 1RYYA 2I07B 2YROA 1OOPB 4D7YA 4OULA 4FQ4A 2ORXA 4CU8A 3R4SA 1J84A 4NMIA 2ZGRA 3AMQA 3E1F1 4QHBA 1H2NA 3WINE 3O5SA 1WWYA 2JG9B 5FZBA 2WWJA 1FOD1 4BA6A 2EIDA 1UIJA 3WXPA 4XFHA 3T08A 1O8SA 5A32B 4WV8A 5H9SA 3VV1A 1W6OB 4CP1A 1KFXL 4FPLA 5A1LA 2J1AA 1VAKA 3GCXA 4GAZA 1DQ0A 1PZ7A 3LA3A 4N43A 4DUWA 4UFJA 2E53A 1NCQA 2PTMA 4QD2A 4RN5A 4YW7A 4FT8A 4Q1RA 1EAH3 2GC3A 4N7UA 1HB3A 2EXJA 4FXGB 4QWNA 1IS5A 3CLPA 3ASIA 3DV8A 3POEA 1SEFA 3B01A 4XMIA 4DIQA 2ZGSA 2Q8DA 1XJAA 3GBFA 3B69A 2UY9A 3RGBA 3UGHA 1LHOA 1VIWB 4QHOA 3AKTA 1QY4A 2YU2A 3U75A 2QTWB 5DZGA 4HZFA 5FY7A 5GLWA 3T2TA 5C33A 1C1LA 1ND2B 1WD3A 3CEWA 4K6BA 1R093 4CYDA 5DG2A 3V65A 3LEKA 2DF7A 1WCUA 3B94A 3MV11 4Q4W2 4NPRA 1FNZA 5EPAA 5EXOA 4AVCA 1R64A 2OPWA 4DO0A 1IKQA 4K21A 1UL9A 3LFIA 4CPBA 2F4LA 4SBVA 4QXKA 5EWSA 4BLIA 2EIGA 4GWIA 1AUYA 1AYM1 3VGIA 1SFPA 2DBIA 2CSGA 3BYWA 2J1EA 4CZSA 3CO2A 1WLDA 3DYOA 3ZN6A 1JOBA 2GMMA 2MHFA 4XUQA 3I2DA 4LHKA 1VAMA 1RUF3 5FRAA 1POQA 5C4WA 4XF4A 3CU7A 5FPZA 5HXVA 3AZXA 4M3CA 1LULA 4YZ3A 5T50A 5CIRA 2BGCA 4NHXA 3PLQA 1LEMA 2VZPA 3M8LA 5FZCA 1PIV3 3OY8B 4B4QA 2XUMA 2OX0A 1OFSA 1CESA 3O12A 4HKOA 5BNPB 1DP0A 1OOPA 2QQPA 4AF9A 4Q26A 1SFNA 5A80A 1QJU3 3HIFA 1Y43B 2JG9A 1JYVA 1UPSA 2XBO2 4D94A 1H9WA 4RHV3 5E16A 2Z4FA 4N90A 5JOYA 5HI0A 4R9BA 3LD8A 2R1BA 1IQAA 1PO21 5DUVA 5A32A 3VBFA 5FXZA 2WBKA 1RXFA 1LHUA 1W9TA 2YYOA 4DXZA 4ZXKA 2EICA 2R0HA 2ZBJA 4FBFA 1JHJA 4W6YA 4AR2A 2Y33A 2XUEA 5BPXA 4EJRA 1F15A 3CZUA 3BPZA 1RUE1 4PF5A 3ZR6A 3OBRA 4BQ1A 5LW9A 2WNUB 4AQ2A 5KXCA 2WO2A 2EAAA 5DDJ3 4NIGA 4NWVA 4ARXA 2ZHMA 1LU2A 4P9LA 1UX7A 3AMHA 4W4ZA 2BNNA 4YW1A 4CUBA 1G8WA 4QPYA 4IW3A 4BISA 4J1XA 3HQRA 3N7JA 5GZEA 3AM2A 1NY71 3NSTA 4D0QA 2ADEA 4RHV2 3NJZA 1K3IA 3POJA 4C91A 1ASJ2 3VKNA 3R0RA 1W8TA 2OZ6A 2VNOA 2WUHA 4BXSV 1W8FA 5CB7A 2Y60A 3DGTA 5AVAA 4KU8A 2VULA 1PO13 4OHVA 2J1TA 3N9PA 4LT5A 3ETPA 5J37A 1C1FA 2EA7A 4E4SA 4ET7A 3SKJE 5DDJ2 2ZGLA 1KDMA 2E32A 5I91A 1VE0A 5B4NA 2RM22 3M7AA 2V09A 3WNXA 5L7OB 3ZVXA 5CISA 1R091 3DF0A 4DXRA 1F4HA 3GBWA 3NQHA 4LBJA 3WW2A 3CJIA 3ZN5A 1NZIA 4K1YA 5KBFA 5GLZA 1T6GC 1YQ5A 4QPIB 1AR81 1WMEA 2DFBA 3LDBA 4YGEA 1SLTA 2QUOA 4GWJA 4LMFA 5IW0A 3OY8A 1VBB1 3JUUA 2XXZA 4M4PA 4E2QA 4OHYA 1MS5A 4R4XA 4CSWA 1JODA 4YW6A 3SMHA 3U11A 5A6XA 2LM3A 2V5DA 3POFA 2PAKA 5BNPA 1LGBA 1W9FA 2GNTA 1JS9A 1WLWA 3KV5A 3FLPA 1IG3A 4NRPA 3ZM8A 4BMEA 1GZWB 4GMP3 2R042 2ZHNA 3AXEA 3K51A 3P3NA 1ZA4A 2VXJA 3WDXA 4NE9A 2FZ1A 1AX0A 3WX5A 1ZREA 3TB0A 1R1ZA 1WKYA 2JD9A 4UFKA 3E6CC 4UF0A 1ULPA 3ORJA 2OXBA 4HFSA 3ZXLA 4L97A 2R071 4NHLA 1CAUB 2XJPA 3LEIA 3GDBA 3VBOB 1QJU1 4NPMA 5JZGB 2WYSA 4UBHA 3ZSLA 3PVEA 2JDUA 2ZJCA 4O61A 5FZ7A 5FZHA 4BOWA 2KR2A 1ZX5A 4FP3A 5H9PA 5A3OA 1R1A1 1UZYA 4Y3OA 1E5HA 1GOGA 3AP4A 2X29A 3ZPYA 2VY0A 2VTXA 4Q0QA 5JVVA 1XE8A 1ODMA 1JHNA 4L11A 2BBAA 4RFRB 4XFAA 4XF1A 3TBDA 2YBSA 4CXWA 5JXIA 3PUSA 1ZRDA 3WG3A 5K0UC 1G86A 1S0DA 4RS5B 1MPXA 4PLNA 5FMOS 4C1XA 1RUJ3 1SCSA 4ZU7A 4AGRA 4B1LA 5FKCA 1F5FA 1H2KA 1O4YA 3N9MA 3N9LA 3H8OA 5FYCA 2XL9A 3CF6E 2DU0A 3OPWA 5FYHA 2P3KA 3AKQA 4QGLA 4JC1A 4E4HA 1PZ9A 5J98B 1JYTA 3Q8EA 4LE4A 1QXPA 1WUVA 4BQYA 1AXKA 3VDBA 1RMU3 2NMNA 1HN1A 2I2SA 2QDRA 5F32A 1OH3A 1WD4A 5AC92 5A70A 1LOFC 1DGLA 2WRAA 3E5XA 3HD8B 3Q8FA 4A2UA 4NJ4A 3JXSA 5LWBA 1PO11 4PBOA 3SEEA 2LUWA 3ZYIB 2HKXA 4BK4A 1AYN2 3JCIA 2D97A 3W5MA 5ACA1 1JOJA 3P3PA 4A42A 5J09A 1GQGA 1SACA 3PHMA 2VNVA 3H50A 4IEZA 3VUOA 2QZ3A 2DCJA 4QPIA 3B7MA 4QGMA 1UZVA 3H8UA 1W6QB 5FO7B 2ZGKA 3GF6A 1JU3A 2OS2A 4LIVA 1V6JA 3HOBA 2WAOA 5FWEA 4CCCA 4CCDA 5FUNA 3PVBB 3AKRA 3VZLA 2A73B 4CDQC 5K7PA 5DG1A 3T2QA 4YM1A 4KWLA 1AJKA 4QB1A 1W3VA 3FMGA 1C3HA 1LHVA 3M1HA 4W65A 4EZHA 4YM3A 1X33A 3HT1A 4CDUC 1RMU2 4P08A 5EYYA 4N53C 5FK7A 4OHZA 1N1TA 4BE3A 3W5NA 2ZGUA 1GZWA 5LK5A 3B93A 3NL1A 4FTEA 2EXIA 1AR92 2Q4SA 2Y38A 1L7RA 4EE2A 4N43C 1R083 4UFHA 5L9RA 2EF6A 3WNNA 2ZCWA 5FZ0A 3OGRA 3FHAA 4BZ4A 4AK3A 4MGTA 4ISQA 3T1LA 4ES8A 1PNGA 3I2KA 3KS7A 1FATA 1XNDA 3AYAA 1FV2A 3HVDA 3RQ0A 4E8DA 1GKBA 1V6NA 1CAUA 1QJY3 3A22A 4FOYA 1KJLA 3M4FA 4N8MA 5C7GA 1JZ8A 1DF0A 3VBOA 4DY5A 1FAYA 1CIWA 1BK1A 5JXGA 4HLTA 4ZS2A 2YC0A 1ZBE3 2DCTA 1KQRA 1CGPA 4FPKA 1UAIA 4YLZA 3ZXEA 4R9CA 1WA4A 5CNAA 5HCAA 2RS53 1NA1C 4BQ3A 2PHLA 5FTTC 5FZFA 3ZYFA 3TOJA 2VZ3A 2ZZJA 3A7QA 3NWKA 2C24A 4GB31 4B4PA 4AL9A 2AZ5A 4RS5A 4Y5TA 3FFQA 3TN91 4XEZA 1ZM1A 2XJVA 3I8TA 4K8FA 3NNFA 4JGZB 4NPLA 3ZYPA 4CA9A 3U4SA 1CIYA 4YZ4A 2WT1A 2EIEA 5I8SA 4JKLA 2XONA 5FBJA 2YGLA 1QMJA 2HYKA 1N47A 1SCRA 1GNHA 3M3QA 5KR7A 2GNBA 3DPRA 2PHFA 4CP9A 1JYNA 4S2FA 2IXCA 4LA3A 1UOGA 4N9HA 4O9GA 4BCUA 5C3QA 3J26N 2B8MA 4FO9A 5G05L 1SQ4A 1IS6A 2OYZA 2R32A 2JX9A 5FY8A 4U36A 2DWRA 1AXZA 4TLGA 1CD3G 3IBMA 3J8F1 4LLFA 2RDRA 3MIDA 4R4ZA 4DZGA 4H3WA 5F3GA 2GALA 1ZZ8A 2W1UA 2P3JA 5FLHA 5DUWA 2WSVA 5JOWA 2YZ4A 2A1XA 2GN7A 4I3PA 3TEZA 5FPVA 4Y22B 2VZQA 5LA0A 4M0NA 1RHI2 2PHDA 3OYWB 1MZFA 3OUHA 1D0HA 4I01A 4B29A 2CV6A 2HWF3 4NUBA 3B5LB 5FMOL 4NROA 5JOXA 1CX1A 4V2WA 1CPMA 4HSJA 3SHRA 2O8QA 2HWE2 3OSDA 3TNQA 1WA6X 4Q8KA 1MQTB 3MIEA 1YHFA 4FTSA 3ZYGA 1MACA 4YSFA 4I0WB 4PI0A 3MYXA 2XVKA 4P00B 1DQ6A 1ULOA 1PX3A 1PM4A 3I2HA 5C9AB 1WBLA 4D3WA 2Y34A 2TEPA 2YFZA 2YC4A 2VMGA 1PVC3 2ZX2A 4Q0VA 3BTYA 4HSLA 2ZGPA 1AL0G 1LNSA 4RSUA 2WS91 4QU2A 5LA9A 2GAUA 4FFFA 3WW1A 4COZA 4QX7A 4XBLA 3WCSA 1LEDA 1C5IA 2C4XA 3ZMNA 2JEMA 3VZKA 5EV7A 5T5LA 4E9KA 4KQ7A 4XF0A 5I8YA 1ST8A 1XE7A 2RS31 4AXOA 1NCRB 2AUYA 1QWRA 4GH4B 1QH7A 1BXHA 3ZXKA 2Z42A 4Y33A 4MXVA 4A45A 3D82A 2HJIA 1PMHX 2VUJA 3LA7A 3POGA 4LORA 4BQ2A 4NR1A 1ODNA 5IVEA 1HQLA 1AR73 4LQRA 3O1SA 2DCKA 5FY0A 3UT0A 1JU4A 3MIGA 4J6GA 4JGZA 1RUG2 1W03A 2A6YA 5FFOC 4QKDA 4JCKA 3RI8A 5C3SA 4LBQD 3OCPA 2W1SA 1H1MA 1YEWA 3T2PA 5A7OA 3WHUA 4B7EA 1K12A 1HRI2 2AACA 5FZDA 3FLTA 2ZA9A 5A7PA 2W5FA 5EQUA 4Y1XA 4V1PA 4MGSA 3A21A 3AKPA 3PUQA 1U5ZA 2RV9A 4CVUA 4ZZ8A 1VBE3 2AH2A 2ZEXA 5BNNC 2WFF1 3EB7A 2ZEZA 4KWKA 4M3CF 1AR63 3AP6A 3WNPA 1LU1A 2TUNA 4E4DX 4HN0A 2WLPA 1Z7S3 5GLVA 2VZSA 3DXUA 3RRDA 4ATFA 3RMYA 3BVCA 1QJX3 2E26A 1VR3A 3NAPB 4CP2A 3VBRC 2A3XA 4XHBA 2HWD1 2X10A 4FTBA 4CEYB 4COYA 1UX6A 1PGW2 1WCQA 4ZY9A 5A6QA 4BPZA 2GH2A 4NWWA 4Y22A 5ABJB 3WP3A 2XJTA 5FDBA 2RMU2 3OYWA 2GN3A 5DAPA 1OKQA 3CQOA 3V56A 2JDYA 3BPSA 5F6LB 2ARAA 4XQDA 1MS1A 2WNVC 4XPVA 1OKOA 1VBE2 3GZEA 5LBCA 3T4HB 3VDCA 1EYBA 4XUTA 4P9JA 3EHKA 3H1YA 1WGPA 2YV8A 5C9AA 4IV3B 1UZWA 4MGIE 4CEWB 4LUKA 3B9IA 3ZIXA 4QM8A 5F3CA 3K75B 2ZGTA 1ZYBA 5LY1A 4HK9A 4DRRA 1HRV2 1W6MA 2E31A 5FYSA 3BTXA 2VGDA 5GJ6A 2HWC1 4DRVA 4YZ5A 3DUIA 5BYNA 2UY8A 4IE5A 1YC61 2D98A 3I3BA 2A6XA 2E7AA 3WG4A 4BYYA 3QD6A 5JR7B 1XBFA 2VW0A 2WR9A 3AYEA 3OD0A 3WW3A 5IAXA 2J7MA 3IMMA 1NCRA 3AX4A 3L9JT 3H3UA 4GH4A 4Q4Y1 1S2EA 2PMWB 5J48A 1S0GA 3RWNA 1HJGA 2QQMA 2VOXA 1BBT2 4XQWA 3LKJA 2FDIA 2HWB1 4AVAA 5FMBA 5F37A 5JUVA 1CAWB 1NG0A 4XFCA 1VBD3 1C8M2 1TZOA 1ZBA2 5KXDA 2W47A 2AYHA 2FDFA 3M3OA 4DPNA 4ZKTB 2WQ4A 2YHJA 2WO1A 4EROA 2L9LA 4EZ4A 4P9WA 2OPKA 5EYXA 1I5ZA 1H4GA 1BYHA 3H7YA 3I49A 1NQDA 3THPA 3JD71 1A34A 3JBG2 1EPZA 4QPGC 3JQXA 2ARXA 2X5IB 3BODA 4HBNA 3BKZA 1RL3A 3I7DA 1TMF2 4LKSA 3SQOA 4FAHA 5FZ8A 1YXWA 3USSA 3NAPA 2PFWA 3WOGA 1GU3A 3KD4A 4NIDA 1TME2 2VZVA 1V6IA 5FP3A 4QX0A 4CEYA 4CUAA 4KGGA 2A70A 2DUPA 5FJHA 4C0BA 1YFUA 4OHXA 5ABJA 1MS0A 2Y8KA 3TWIA 3DXTA 3V0AB 2KA3A 2FMDA 1FPN3 1RVF3 5KHKA 1JBCA 1LCLA 1Y7BA 2RS11 2NYYA 3OPZA 4TLFA 4UW3A 2ET7A 2D93A 4AFAA 3O7OA 4Y1ZA 3RZZA 3DKWA 3I3QA 2ZGQA 4IE0A 1RITA 3ECQA 3MFAA 3AYCA 3K3OA 4UI9L 4YVSC 1XU2A 3KM5A 1WW6A 1DBNA 1SZBA 4Q4X3 1N3OA 2R7EB 2VCCA 5DZEA 3VD9A 4IV3A 1ZRFA 1GWMA 1Y9QA 4CEWA 1PM7A 1COV2 1JN2P 1W9YA 1JZ4A 3U1XA 1RUH2 1F31A 5FQ0B 3V0BB 2A6WA 3KGLA 1M4WA 2ZMKA 3EJKA 1REDA 3W9AA 5F5AA 1VBA1 1KITA 1XXNA 3E6BA 1OI6A 1W28A 4FCAA 4XVHA 2DURA 5FP8A 4LBNA 2XWBB 4XUOA 2VOTA 3HT2A 2MNGA 2PQQA 3J7HA 4WBBA 3BIEA 1KEXA 3VBUA 5D2AA 1XYNA 5CFDC 4GWMA 1XU1A 5FZOA 1OHFA 1UW8A 1O3QA 1OPOA 2VOKA 2D3PA 1E57A 3LZZA 4E4ZA 1FMD2 4Q4X2 4ISRA 3VBSB 3LPGA 2XR4A 4MLOA 4JGYA 1MEC3 2BP6A 1VRH2 5FPBA 1V9U3 3OF1A 4MHUA 2Q8EA 3ZFGB 3U4XA 2EALA 1DU3D 2Y6LA 1S0IA 1UY4A 4EYUA 1UD1A 2G9FA 4A44A 3EQEA 5D1IA 2RG4A 1BEV3 1GNZA 1HIXA 5A3MA 3BCWA 4N9IA 2VNRA 4WVWA 4DNYA 1YI9A 1KXGA 2IXKA 1D7PM 3JZVA 2VD7A 4XAAA 5FZAA 1Z78A 1BMV1 2RVAA 1VBD1 4DUVA 1UQXA 1OURA 3K77A 2X5IA 5FZEA 3LOBA 2D6NA 2WO3A 4MXWB 4IV1B 4CDUB 2LTNA 3ZPOA 2Y0OA 4N53B 4Y20B 3IN9A 1GR3A 5FZ9A 2IZWA 2XLAA 1V9U2 3WG1A 4CXXA 4Y1UA 5GZCA 3GALA 2VQUA 4OZOA 2R1DA 4KNCA 3WF0A 1GSLA 2ZX1A 3KMHA 3OBTA 3V0AA 4EN6B 1ULFA 1AX1A 2ZAAA 1RUC3 3ZIWA 1PK6C 1NX9A 4Z92B 1IOAA 1UXXX 2C0ZA 4QQHA 4K8RB 4BHPA 3KCXA 4XQ4A 2W1WA 4LBQB 1V70A 4DEQA 3I2OA 5J36A 3N35A 3WUCA 2JICA 4Q4V1 5J1XA 4IERA 1NOVA 5DAQA 3VDAA 1DGWA 1UOFA 2R30A 3JQWA 3R4UA 5I0RA 2B9VA 1H9PA 1FPN1 2XQXA 2A6VA 4QHZA 4AEMA 3TEYA 1H2LA 5A1FA 1NA1B 2JKXA 3VDDC 4AOCA 5FQ0A 2XJQA 1G6NA 5DPNA 3SXWA 3S0MA 4WVMB 3V0BA 2FDHA 1WCSA 3QBQA 1B35B 1GMMA 3E97A 4QXHA 1FYUA 3AZVA 1RUI1 1POV1 5C3RA 3RZLA 4LK6A 1X9PA 1CZSA 4GXLA 1D4M1 1UY0A 3Q8AA 5IK5A 3CJXA 3MICA 3KWVA 3FWEA 4PF1A 4Q5OA 4UAPA 1O3RA 4KWJA 3N4MA 3KGZA 1A8MA 1HQNA 3BTAA 3MPBA 1K5JA 5JR2A 1D2QA 1ND3C 4YM0A 1H8TC 3MBWA 4GWNA 3I4IA 4QDQA 4V2VA 2JKBA 5FY9A 5E8AA 1ZZ7A 2VJXA 4DXSA 4CUGA 2BOJA 4RGAA 3U37A 3RZGA 3OBZA 3IMNA 2K46A 2YY1A 3ZFGA 4BQXA 1KFUL 3PUIA 4YZ1A 1G9FA 2Y6JA 4GQ7A 1AL21 1N3PA 5BV6A 2W0XA 3AMNA 4Q4W3 2O14A 4CE8A 3L2HA 2PHWA 3T09A 2ARCA 4F8AA 2PHXA 4XFBA 3FC0A 1Y3TA 3IDEA 1MEC1 3POSA 1DQ2A 4N7IA 4CUCA 2Q30A 3O0WA 4URTA 4UYBA 2LRPA 1BEV1 1URXA 4MXWA 4AVBA 1YWKA 4IV1A 1XNKA 3G6JB 3O1UA 2VMIA 2A3WA 4OUMA 4XABA 4XJAA 4Y20A 4IEQA 1UYPA 4XIOA 3THDA 1GZCA 4CDXB 4ZU4A 2D6OX 1H6YA 5CFCC 1HV0A 3OEBA 2OA2A 3IDAA 3WVJA 4WVVA 3F95A 4G4FA 1ACCA 1HV1A 2WN2A 4HPKB 5FUPA 2WC2A 1PO22 1DYOA 2V4AA 2F6BA 3VZOA 1QQP2 2P1BA 2OQ6A 2NPIA 3P5BA 3LAGA 4META 1OLMA 4LBQA 3AYDA 4S2DA 2WFPA 3WF1A 3U07A 4UFLA 1J1LA 1RUE2 5FZ6A 3KT7A 4CDWA 2D6MA 3QACA 5D8AB 1MS3A 1LR5A 2XBO3 4AEDC 5DMYA 2K0GA 3ZFFB 2BFUS 2J42A 1JZ5A 3MF6A 2E33A 5SV8A 3O14A 1NZCA 2ZMLA 4WVMA 1NY72 1B35A 2AREA 5FK8A 2BPA2 3GZTB 5C71A 1MS4A 4KH9A 4LEJA 1I9RA 3S7EA 3H0OA 2D6KA 3AMPA 4W50A 4A3ZA 3M3EA 2FDGA 3RNSA 4Y4YA 1S55A 3VBHC 4MO3M 4HN1A 5BY5A 2W9XA 3HBKA 2WAAA 1VMFA 5KHJA 5LEJA 1MVEA 3B00A 2FCVA 3NKGA 5FP9A 1S0FA 3MGUA 3ZXDA 2PLV1 4AEKA 2GC1A 4BWOA 4WVZA 1S2KA 3KCYA 3BN6A 3C8XA 1GQHA 3CDZB 1ZVFA 1ASJ3 4P9YA 2QQVA 5EZWA 4KBBA 4XILA 5T5JA 3VKFC 1IKPA 4IGOA 1W0NA 3NMBA 2JDMA 1W6OA 3H7JA 4L0PA 3ZO0B 3VBRB 1AXYA 4AYUA 4PT6A 2DBNA 5IK4A 2BW8A 3S5AA 1WZXA 4QX8A 1EY2A 4Q0SA 3RVHA 3VL8A 2VQAA 4YYOA 1AR82 3U14A 1X36A 2ATFA 3DEMA 3KB5A 3OEAA 4IGPA 4PDWB 1NLSA 4XAEA 3ZXFA 1EV13 4BLJA 2DV9A 2RM23 1VBB2 2WDBA 1F5JA 2P6HA 1YFXA 1VB4A 4OVEA 1LTEA 4FOQA 4NHYA 1OA3A 3J7LA 2JE9A 4IEVA 2JG8C 3UKTA 5IT6A 1PVXA 1EAH1 3MIHA 5LA2A 5GZGA 4CDXA 5BNOC 3S57A 5I0UA 3PU3A 2IFWA 1ND2A 2UURA 2JIGA 1UXZA 5E89A 5FXVA 1ZZCA 4A7KA 2Y6GA 3FX3A 4W8JA 3ACIA 4ITCA 4HK8A 4YZ2A 3I97A 2J22A 4HPKA 3C7OA 2W08A 1JOPA 2VBPA 5A33B 1J83A 2R072 3IDCB 5KC5A 4LBMA 3OGVA 4WZFA 1EV12 1KJRA 1SDDB 2VTFA 1KS5A 5DN2A 4LO5B 3FZ3A 3HEIA 2R043 4OI2A 4AHYA 4XYXA 4LO7A 5D8AA 4GIQA 2DTYA 1R1A2 4R8HA 3ZFFA 1G9BA 4QKBA 5IVBA 4QXBA 1H1IA 4ZONA 1B09A 2D7FA 4RR3B 5F2SA 5FOJB 1QOTA 1QEXA 2XKPA 2JXAA 2QQOA 3DCQA 4IEPA 4UFIA 4QKFA 4AFMA 3ZSKA 2WWUA 1VBC2 1CWPA 1GOFA 2MEV2 3H42B 4XDPA 5KHHA 2XVGA 4GKXA 4MHRA 1W99A 1W04A 1SFYA 2W2IA 1RUF1 1GBGA 3LQCA 4IEXA 1JUIA 4LNVA 3LEMA 2CDPA 1ONAA 1WMFA 1U5XA 2K2SA 4RQPB 1A78A 2D44A 1VALA 2D6LX 4MX3A 1W90A 1PIV1 4QPGB 4WM8B 1OPMA 1QIQA 4OI4A 3VBSA 4XJWA 2GNDA 1K5MB 3KQRA 2IVIB 4XFFA 3WF3A 4Y1VA 3ZFEC 2QJVA 3BOPA 5J96B 5JLVA 2ZGNA 3RFRA 4EWAA 5FWJA 3UK9A 5ACA2 1NXMA 3RZMA 4ATEA 4JRAA 1LESA 1NLQA 3OPTA 3WEZA 4BM8A 2YDEA 1PX4A 2BFUL 2WNUA 4RHV1 5CEHA 3HBZA 3QH6A 5T52A 1ASJ1 5FYIA 4PDWA 4AQTA 1APNA 1ENXA 1S2BA 2WN3A 3WNMA 5AC93 3BTZA 1N1YA 1DDLA 2A71A 5FPXA 2VL4A 4A4AA 3FBYA 4OMCA 1AYN3 4YVWC 5DUXA 2B9UA 3WY6A 2F17A 4OUSA 3CZJA 1A6CA 3K4ZA 5ERLA 4GJZA 5DDJ1 4UT5A 3Q8CA 3ACFA 5CVRA 3WCRA 5FOBB 1UU6A 5FO9B 1BHGA 4QDRA 5C8CB 2ZTNA 1L7LA 3O1VA 4R52A 5F5IA 1RC6A 3B02A 1UU5A 3RSJA 3LB9A 5A33A 3SKVA 3I2GA
chains in the Genus database with same CATH topology
3IIAA 3SCGA 3MPPG 2Q8OA 5L7OA 3BB6A 2B5HA 4M01A 4AI0A 3NVCA 1Q8PA 1AR93 1J1TA 3S7IA 4WM7B 4CTEA 4XJZA 1TE1B 1C5HA 3LA2A 3N7LA 4LTAA 5FBZA 1S0CA 4ORFA 4RR3A 3DN7A 3FBMA 2UWCA 4GB32 3RI9A 2NMOA 3WDTA 5T3NA 3TN92 4FPOB 3WW4A 2G4IA 2H0VA 1TQ5A 3UKNA 1KS4A 5I93A 2FZ2A 1DGWX 2ARBA 3OJBA 4RQPA 3OGGA 4IEWA 4WM8A 3MLJA 1NCQC 4XTMA 4FPFA 4QQPA 1K5MA 1O91A 4CRQA 3WDWA 2WA3A 1YYNA 3J8F2 4QM9A 4RFT0 3WQ0A 4HL0A 4GMP1 1W39A 1BVP1 5L36A 2VVDA 2W68A 4YNIA 4AVTA 5JZGA 3SH5A 3FLRA 3MLLA 1N3QA 4XDQA 4JTOA 4YARA 1RUNA 3THTA 2VVFA 1AHSA 3SLIA 4DFSA 1Z0HA 5KHGA 5JWPA 1F8VA 2SLIA 3AKSA 1WCKA 1C8NA 4XETA 3OTFA 1QDCA 4PIZA 5C8CA 1RB8G 1QKQA 3UJOA 3ST7A 1JXNA 1PHMA 4AFCA 1RHI3 4XIKA 2C5DA 1OA2A 3SITA 4PIYA 3VKMA 1AYN1 1YIFA 2CY6A 1U5YA 4X8NA 4AVSA 1RUJ1 4KG8A 1FXZA 2HWE3 3VHOA 4QMAA 1SMVA 5C4WC 3MF9A 1H30A 4NVPA 4X8PA 1QF3A 5JPMB 4WM7A 4KL1A 1C28A 2RS32 1TNRA 2YPJA 2Z5WA 1RMU1 1OMIA 4MYEA 1YFYA 1W6QA 1OOPC 3SH3A 2BWCA 2WT2A 1G9CA 4Q2FA 1IZ3A 2CTVA 1ALYA 4INDA 2JG9C 1RIRA 4MH0E 5H9QA 2XLFA 3ILNA 2CL2A 4I0AA 1FNYA 3VBFC 5CADA 5JMCA 1GZ9A 1YJKA 4FPCA 2RR12 3MIBA 2WFF2 4ASLA 1GFF2 3POYA 4FPJA 2IXLA 1RUG3 3MI8A 4UW4A 1BKZA 4K40A 2BTVC 2BBVA 5L73A 1HRI3 4FSJA 3HN1A 2HWD2 2JDZA 2PN5A 1R081 2R063 3R05A 4LO8A 4XZPA 5CU1A 2NP0A 2P34A 3MIFA 1QJY1 3K48A 3VZJA 4MGZE 2OW4A 1PGL2 5I8TA 1NE4A 1NXD1 2EVXA 1ZBE1 5KHIA 5JCTA 3INAA 4AEDB 4R9DA 4AI3A 2R6QA 3LOIA 3WZ1A 5JI9A 1HXS2 2RMU3 2RS51 4I30A 5HCBA 2VOWA 1MR5A 4TZDA 2R062 2PAEA 1RTVA 2IXJA 2Z79A 2QVSB 4M3CE 4C0HA 4H14A 1CVNA 3CJIC 4I09A 2BQPA 2HWC2 1QXJA 2ZX0A 3R6SA 4AWDA 3OGJA 4JV4A 1QHDA 2N7GA 4L99A 1QU0A 4QQOA 4A3XA 1RHI1 1UZZA 1XNBA 1J3PA 1RUD2 4H7LA 1TNFA 4Q4Y2 4S2HA 1J59A 4P5HA 2VXRA 1HRV3 2D40A 2EAKA 5BNPC 1EP0A 1Q5OA 4YG0A 4EN8B 3HR9A 4IEOA 4L8QA 1DGRN 4B4RA 2G9GA 3WUDA 3JB8A 4WZCA 2C9AA 2Q0AA 5GM0A 4W6WA 1MQTA 1BQPA 3RYPA 4AW7A 3MDPA 4JVAA 1UKRA 3JD72 1X8MA 1BBT3 2HWF1 2HEVF 3KCCA 4OZXA 1C4RA 2Z2SB 3VHPA 2ET1A 3E5QA 2D5HA 4PBPA 1ZRRA 1C8M3 1ZBA3 5C8WA 1V00A 1W6PB 4P9IA 2O0OA 5BNOB 1FV3A 1DZTA 1NLRA 4IQPA 4YFZA 4Q0UA 1UF2C 2RJLA 2XKOA 3JBG3 1ZRCA 2WJSA 3IPVB 1PVC1 3IKWA 4LUMA 3IT8A 5A3LA 1H1AA 2RS12 3AFKA 1TMF3 1QDOA 2VNGA 2E63A 1GYKA 3A0KA 4E2SA 1QGLA 1JUHA 2VVEA 2BNMA 3ILRA 3UL2A 5K9YA 2QKDA 1TME3 2GU9A 1YFWA 4ONUA 2D3RA 3HAGA 2DVGA 3NV4A 1LB2A 2WNEA 4AHZA 2GDFA 2NLRA 3LCPA 2BYVE 5EJ3A 1AR71 3WR0A 1VBA2 3WV6A 4PIXA 1OLRA 1PGW1 3FHIB 1N1VA 2D3SA 4QPIC 4PLMA 5JDBA 3AFGA 4FVVA 4LO6B 1COV3 1DFQA 3MFCA 1RUH3 5AVPA 1GICA 2ZZQA 1VBE1 2DYCA 3TNPB 3WP6A 2WA4A 1AJOA 1CJPA 1AR61 3GNEA 3WP5A 1NYWA 1Z7S1 4FPHA 2UYBA 1UMZA 5TSWA 2IXHA 1QJX1 4F3JA 4MVTA 1F2NA 4I02A 1W0PA 3RDIA 1HRV1 5GLTA 2WZR2 1FMD3 3S6PA 4AFBA 3RPQA 4EN0A 1BMV2 1N1SA 1LGCA 1VRH3 3VBOC 4LULA 4LE3A 2F4PA 3QLQA 5K0UB 1IGOA 1W6PA 1Q8VA 2GNMA 5IUQA 3RG0A 2GSYA 1BBT1 4OI0A 1KRIA 2XGXA 4RS5C 4CP0A 4MGKE 3TRSB 5H9RA 1CPNA 4XXPA 4L92A 1LRHA 2VUAA 4Q4V2 2CWMA 1CAWA 5LEKA 3DPRC 1MZ6A 4IXLA 2NZ9A 5JIUA 2MPFA 4OHWA 2UYAA 3EBRA 5CAZA 2O8OA 4CDQB 3A0NA 2OZJA 4QQLA 4RGGA 5C6CA 1U0AA 3GZAA 1D4M2 1O5UA 3MZHA 3ZYJB 4BIFA 3BU7A 3FFZA 1BZWA 4OFGA 3G7DA 4HKWA 5GZFA 1X50A 1NE6A 2B39A 4N43B 1NCQB 1FOD2 5FREA 1FX5A 2ZMNA 4GMP0 4Z2WA 4YGBA 4XHXA 3SISA 5JI7A 2AR6A 3AK0A 1BJQA 4PCRA 1J3QA 1OQ1A 2CYFA 5E88A 4LA2A 5LRRA 5E1RA 3KT1A 1SBEA 5LRSA 4G9SB 1LECA 4RA0A 4TYSA 5BNQA 4RL7A 4NO4A 3TAYA 1RVF1 4K9SA 1LOCA 1SLBA 3ETQA 4U2AA 5BUVA 3B3QE 2DCZA 3H1MA 5K0UA 3WT3A 4BH9A 2ZGMA 4P9XA 3NV2A 1DQ1A 4Q4X1 4DQAA 4XXAA 3S30A 2KXLA 3WG2A 3VKOA 5CG8A 1YIPA 2ZACA 4JGZC 1AX2A 4JQRA 3ZN6B 1DZQA 3RMXA 5HCFA 4AHWA 2TBVA 3ZX7A 4UW5A 1RJ7A 2A5ZA 1AYM2 1FI2A 1O7FA 2OUHA 1H2MA 2EXHA 3ZSEA 4P9GA 1CQ9A 4AE2A 5DUUA 1I3HA 2PHTA 3WDVA 1W2UA 1PO23 1Q8QA 4A7ZA 1QQP3 2XH6A 3RYKA 1V9U1 2XJUA 4YW5A 4CDQA 1MS9A 2XWJB 1RUE3 3ENRA 4CDUA 1HQWA 1QNWA 3URFA 4N53A 4K1ZA 4DOUA 1A3KA 3VBFB 2XPJA 2E7TA 4HANA 2YMZA 2B46X 2Y26A 2HEWF 4XJ8A 2PLV2 4O9EA 3WDUA 1MQTC 2RE9A 4B7KA 1DQ4A 4UXAA 5GALA 4E2GA 5C9AC 3FUOA 4COUA 4BMBA 2JENA 1J58A 3AP5A 2ZHKA 1ULGA 3M70A 2IWGB 1IS4A 3VZMA 2E9QA 1UIKA 4DINB 2WKKA 1RGSA 1RUC1 2QE3A 3WQ7A 2UWBA 4L9BA 1NA1A 3AJZA 1LKNA 1J3RA 1FT9A 2JE7A 4Q0PA 4MSVA 4COVA 3UKVA 1EAH2 1NCRC 4Q29A 3GBGA 4GH4C 2FBEA 4Y5Z0 2KM2A 1D4VB 1NQJA 3WD5A 4H7MA 1AR83 1WCDJ 4GULA 1L3JA 1SLIA 4AI1A 4ES9A 1VBB3 1SBDA 1IHMA 4YG6A 3ACLA 3N7KA 4IESA 3SCHA 1DLLA 5BNNB 3CJIB 1MS8A 1W6NB 1SDWA 3AZZA 3M3CA 5DZFA 2GH8A 4IL7A 1R092 1HLCA 4XW3A 3B9CA 1QXRA 2DTWA 1ZNPA 4ZU5A 2DUQA 2VG9A 3MLKA 2A6ZA 2DVDA 2ZHLA 1DIWA 3M3IA 1CAXB 2UU8A 1IPKA 2R073 2ZPXA 4LR4A 3NAPC 1REFA 1A8DA 3LGRA 4Z82A 2NN8A 2NM1A 4CEYC 2YUEA 2WNVB 4LBOA 2XVLA 1HDKA 2WT0A 4MUVA 1MZEA 4Q4W1 5ABJC 1VJ2A 1OFNA 1RUF2 1R1A3 4EN9B 1QQP1 3ZYRA 2CNAA 1WW5A 2D5FA 1WLTA 3C2UA 3ZMOA 1PIV2 4D7TA 4Q1PA 2W39A 2ENRA 4Q8LA 3SCFA 1VBC3 2B42B 2MEV3 2Z69A 1O4TA 3MW2A 2PHRA 3D8CA 4IV3C 4SLIA 4CEWC 1G9AA 4M0HA 4Q27A 4EV0A 3I54A 1QJU2 4AG4A 3PMSA 4JDOA 2FMYA 1GANA 2P2KA 4FPEA 4OLLA 3SNMA 1PNFA 2DVAA 2PELA 2GC2A 4XFGA 3VBUC 2R49A 3Q9OA 4FOWA 3POWA 4F7ZA 4Y1YA 2QNKA 5ACA3 1ULDA 5CG9A 1H4HA 3J4UH 3PJYA 2XBO1 4B3NA 3ME2A 2NQYA 3H1WA 4JGYC 1SLLA 1YCIA 2ZKLA 1GLHA 4PLOA 3ZSJA 3I59B 1EPWA 5BNNA 1LODA 4AVVA 1W6NA 1V6KA 2WLQA 3D4KA 3PJQA 1Q43A 1KDKA 1AVBA 4Y26A 5KXEA 1PO12 4L2NA 1CAVB 4P14A 3VBRA 4AQSA 1JYCA 4HKLA 2X5IC 1G9DA 2RHPA 5JSPA 1CAXA 3U0ZA 1BCXA 2B7YA 3ZDSA 4S2GA 1XYPA 4Z07A 1S1AA 5I0SA 2VOVA 1DHKB 2WNVA 1ENRA 5GZDA 1ULCA 1VAVA 2I45A 4YVSB 3FUQA 1X82A 1QOSA 3HQXA 3IM0A 1EV11 4TSVA 2RM21 4EN7B 4GB33 3D6EA 1AZDA 1IS3A 3TN93 3CL1A 2OVUA 3WQ1A 4GKYA 3BOWA 3ZXJA 5I0TA 1CN1A 5KWRA 2IFRA 5AFEA 4XMAA 5GLUA 2GMEA 5T54A 3LSDA 5CFDB 4IETA 4BIOA 3JB4C 1VBC1 1AF9A 2FQPA 2MEV1 4XJUA 1UCXA 2DVFA 4HETA 5T5PA 2AGSA 1UPIA 4QT6A 3ATGA 2BVBA 4D69A 3FJSA 3HWJA 1VB2A 3J8F3 2QCSB 3L2YA 4HVRA 2ZKNA 2R041 3DPRB 1UU4A 2GC0A 2V73A 3AJYA 3BIWE 3ZSMA 4R9AA 1IPJA 2D43A 1W0OA 4YGDA 3D0SA 2XG3A 3ZFGC 1I1EA 4COWA 1GV9A 4AGGA 3I59A 3AZYA 4QPGA 4YG3A 1RUJ2 1OD5A 1ZZ9A 2DVBA 2JJ6A 2ZOEB 2WZPP 1D2SA 5JAXA 1X7NA 3E6DA 3ES1A 4D7SA 1CAVA 1DG6A 1U12A 2YGMA 3VHRA 1YLLA 2DFCA 1YO8A 2SBAA 4YW2A 4I2OA 1SBFA 3EXUA 2CAUA 4IV1C 4UBGA 1OQDA 2DUOA 5FLJA 2WS93 2A75A 1UKGA 1PK6B 3H9AA 4HT1T 1ULEA 5T5OA 2ZX4A 2BEOA 1UN1A 2XLGA 2RS33 5BXXA 3APBA 4YVSA 2ETEA 3RYRA 4X6RB 1OSGA 4KG0A 2CGNA 1PGSA 2RJKA 5AC91 1POV0 3AXDA 3VDDB 1KD7A 3H3ZA 3WLUA 2O1QA 2ILMA 4CDWC 1LOBA 1QOOA 5CA6A 5DXDA 2I74A 2WS92 3O0VA 2YXSA 3ILFA 3AZWA 1Q8SA 1DGRA 5F5QA 1PZ8A 1R082 5F9TA 2LALA 5CFDA 1B35C 5IK7A 3ZN4A 3EO6A 2HEYF 4G3YC 2RR13 5IK8A 1WBFA 2VPVA 2WFF3 2R16A 1ND3B 1OLQA 1H8TB 1MVQA 3WDYA 1QJY2 1VP6A 2HWD3 4GALA 1AR91 1ZBE2 1XYOA 4PJYA 3AP7A 3KSCA 4NHKA 2FHRA 3ZXGA 3IDBB 3NO8A 1QJZA 2QFEA 2RS52 3QH7A 2WL1A 4TWTA 3LSEA 2WIIB 4QX5A 4W6XA 3U4XA 2X8KA 3ROUA 3VN4A 3CNAA 4EWDA 4Z8BA 1CJDA 4K20A 1WLCA 1V6MA 2XB6C 1PMIA 3O0XA 1S0BA 4AFDA 4XF9A 2PYTA 1DQ5A 1OA4A 1YJLA 1HXS3 2PA7A 1REEA 3OD4A 4AQ6A 5CFCB 1OQEA 1H0BA 2GZWA 2H0BA 2PHUA 3AP9A 2UWAA 3E5UA 5JPNB 1YRZA 1RJ8A 1PK6A 2D6PA 2HWC3 4CDXC 4DMIA 1ND2C 4DY3A 2EXKA 4NOTA 3U10A 4XF3A 2E6VA 2WQZC 5JOZA 1RUD3 4Y24A 4Q4Y3 1O5LA 1SLCA 5FO8B 5J7MA 3NV1A 4NN0A 4DB5A 1W6MB 4JDMA 2JD4A 1DYPA 3KZ4C 5EFUA 2OUJA 2HWF2 2HWB3 2ZS6B 3VDDA 1JH5A 3MEPA 1HX6A 1WMDA 4J1WA 5D8AC 3NV3A 5FCCA 3ZFFC 1D0GA 4YGCA 2ZAHA 1XQNA 4DS0A 3GYDA 2VH9A 3PTYA 4KU7A 3VBHB 1M06G 3FE5A 3JD73 2A7AA 2BNOA 2H6BA 4MZUA 3N36A 1PVC2 1ND3A 1H8TA 3RJ2X 4UW6A 2HWE1 1LHNA 4LO4B 2BUKA 4LHNA 4K3UA 2HWB2 3T1MA 4JDNA 5LK7B 4XE9A 3WP4A 1RUOA 4XTPA 2ZGOA 2RR11 3GHMA 1QH6A 3VBSC 2DU1A 3QOPA 1LHWA 2B45X 2RS13 4XOGA 1AR72 1WW4A 2XJSA 4FOVA 5FAXA 1V6OA 3A4UA 2VW2A 2CGOA 4FPGA 5FLIA 2WNUC 2ERFA 4HVQA 2JG8B 4PDWC 4XBNA 3J9SA 1V6LA 3PVOA 2JECA 2Q1ZB 1YUDA 5CFCA 2XHKA 4OI1A 2W52A 2WINB 1AR62 1PGL1 3VLBB 1VBA3 1Z7S2 1RUG1 4LBLA 2GMPA 4AHXA 4B8EA 1QJX2 3N7MA 3UJQA 3GHNA 2XL7A 1HXS1 2VW1A 1HRI1 3ALQA 5B2GB 2AENA 3PVNA 2R061 1QNYA 1LOAA 2A3YA 3X29B 1RINA 3RJRA 4AEDA 2BVVA 2CGPA 1JTZX 5L7OC 2XJRA 5L19A 2V5YA 3VBUB 4JAAA 1O3TA 2QZ2A 1RUD1 3ELNA 2IC1A 3USUB 4F83A 2E51A 4I0BA 4YRDA 1Q56A 4JGYB 1ENSA 4RR3C 3VBHA 2WZR3 5F6KA 3WHTA 2RMU1 2VECA 4I3GA 2C1FA 3DL3A 2OIIA 3MW4A 1CR7A 4AI2A 2Q1MA 3VHNA 3ZFEB 3R4DB 4RQPC 4AEJA 3JU9A 3N3HA 3QCWA 4WM8C 5SV5A 2P37A 3W58A 1K5MC 3C3VA 4NHMA 3RS6A 1ENQA 1X8EA 5JIAA 4FPYA 1XRUA 1VBD2 2VMHA 4Q4V3 4YW3A 3V64A 5JZGC 3VZNA 5J3UA 4YVWB 3LWCA 3W59A 2JG8A 2R0FA 4HVOA 4H55A 5BNOA 2VQ0A 3MW3A 1YNAA 2CAVA 3SH4A 1LGNA 1WW7A 1ZZBA 1RUI3 1POV3 3IPVA 4HMZA 4MV2A 4ASMB 4QQ2A 2P17A 4PQ9A 4LHLA 1C8M1 1ZBA1 1D4M3 1LOGA 2ES3A 5C8CC 4MGYE 1TEIA 1Q8OA 3D5OA 3NKTA 3VL9A 2IXIA 2Y0IA 3JBG1 2PAMA 1U5IA 3AB0A 1FOD3 1FPN2 1RVF2 4AGVA 4FQZA 1O4ZA 1TMF1 1XNCA 4XFIA 4LBKA 5HBAA 5KC6A 1O3SA 3M2MA 1AL23 4WM7C 4EWEA 2QDNA 1RUI2 5AFBA 2X53S 1TME1 3USUA 4YFWA 1Q3EA 2P3IA 4C90A 1JYIA 1HW5A 1CX4A 4IEYA 4JRLA 1LENA 3VKLA 2DCYA 4FAGA 2WSUA 1I6XA 2ZX3A 3ZFEA 1MZ5A 4YM2A 1SLAA 3GZUC 1CONA 1LJ7A 2Q5TA 2TNFA 2WZR1 4RD7A 1S0JA 1DYKA 1ZZ6A 3IWZA 1AL22 1COV1 1JW6A 2E7QA 1RUH1 2WWSA 2BWAA 4IEUA 3HMYA 1YI7A 3BALA 1MEC2 4A7YA 4FXKB 4QGNA 1AYM3 5F1RA 1C57A 1DZRA 5JSOA 1BEV2 4FP2A 5CBLA 4YVWA 3PNAA 3UV9A 1VLNA 1S0EA 5T55A 4KGQA 3AMMA 4AI8A 5K8SA 1FMD1 4LLOA 1HKDA 4X6QB 2ZABA 5KXBA 3TYJA 1H8VA 1VRH1 3KLSA 4M00A 3ZXAC 4CDWB 5GKAC 2H6CA 1LOEA 2CWSA 3ES4A 4GA9A 4XJ9A 3D0JA 4YW4A 1G7YA 4C1WA 3KT4A 1LOFA 5C4WB 2VU9A 4M3CB 4E27A 4K7JA 4Z1VA 4JTNA 5JSRA 2PLV3 1F9KA 1RUC2 1BVVA 3PMEA 2K9ZA 4XBQA 3NW4A 2I07B 2YROA 1OOPB 4D7YA 4OULA 4FQ4A 3R4SA 2ZGRA 3AMQA 4QHBA 3WINE 1H2NA 3O5SA 2JG9B 1FOD1 4BA6A 1UIJA 3WXPA 4XFHA 5A32B 4WV8A 5H9SA 3VV1A 1W6OB 4CP1A 1KFXL 4FPLA 1VAKA 4N43A 1DQ0A 1PZ7A 3LA3A 2E53A 1NCQA 2PTMA 4QD2A 4FT8A 4Q1RA 1EAH3 2GC3A 4N7UA 2EXJA 4FXGB 4XMIA 1IS5A 3CLPA 3ASIA 3DV8A 1SEFA 3B01A 2ZGSA 3GBFA 3B69A 2UY9A 1LHOA 1VIWB 3AKTA 1QY4A 5DZGA 4HZFA 5GLWA 3T2TA 5C33A 1C1LA 1ND2B 1WD3A 3CEWA 4K6BA 1R093 4CYDA 5DG2A 3V65A 2DF7A 3B94A 4Q4W2 4NPRA 1FNZA 5EXOA 4AVCA 1IKQA 4K21A 1UL9A 5EWSA 4SBVA 4QXKA 4BLIA 2EIGA 1AUYA 1AYM1 3VGIA 4CZSA 3CO2A 1WLDA 3ZN6A 2GMMA 2MHFA 3I2DA 4LHKA 1VAMA 1RUF3 5FRAA 5C4WA 4XF4A 3CU7A 5FPZA 5HXVA 3AZXA 4M3CA 1LULA 4YZ3A 5T50A 5CIRA 2BGCA 3PLQA 1LEMA 3M8LA 1PIV3 3OY8B 4B4QA 2XUMA 1OFSA 1CESA 3O12A 4HKOA 5BNPB 1OOPA 2QQPA 4AF9A 4Q26A 1SFNA 1QJU3 3HIFA 1Y43B 2JG9A 1UPSA 2XBO2 4D94A 1H9WA 4RHV3 5E16A 4N90A 5JOYA 5HI0A 4R9BA 2R1BA 1IQAA 1PO21 5DUVA 5A32A 3VBFA 1LHUA 2YYOA 4DXZA 4ZXKA 2R0HA 2ZBJA 4FBFA 4W6YA 5BPXA 4EJRA 4BQ1A 3BPZA 1RUE1 4PF5A 3OBRA 2WNUB 4AQ2A 5KXCA 2EAAA 5DDJ3 4NWVA 2ZHMA 1LU2A 4P9LA 3AMHA 4YW1A 2BNNA 1G8WA 4QPYA 4J1XA 3N7JA 5GZEA 3AM2A 1NY71 3NSTA 4RHV2 3NJZA 4C91A 1ASJ2 3VKNA 3R0RA 2OZ6A 2VNOA 5CB7A 3DGTA 5AVAA 4KU8A 2VULA 1PO13 4OHVA 4LT5A 5J37A 1C1FA 2EA7A 4E4SA 5DDJ2 2ZGLA 1KDMA 5I91A 2RM22 3M7AA 2V09A 3WNXA 5L7OB 3ZVXA 1R091 3DF0A 3GBWA 4LBJA 3WW2A 3CJIA 3ZN5A 4K1YA 5KBFA 5GLZA 1T6GC 4QPIB 1AR81 1WMEA 2DFBA 4YGEA 1SLTA 2QUOA 3OY8A 1VBB1 3JUUA 4E2QA 4OHYA 1MS5A 4R4XA 3SMHA 3U11A 2LM3A 2PAKA 5BNPA 1LGBA 2GNTA 1WLWA 3FLPA 4BMEA 1GZWB 4GMP3 2R042 2ZHNA 3AXEA 3K51A 3P3NA 1ZA4A 3WDXA 2FZ1A 1AX0A 3WX5A 1ZREA 3TB0A 1R1ZA 3E6CC 4HFSA 3ZXLA 4L97A 2R071 4NHLA 1CAUB 2XJPA 3VBOB 1QJU1 5JZGB 4UBHA 3ZSLA 3PVEA 2ZJCA 4BOWA 5H9PA 1ZX5A 4FP3A 1R1A1 1UZYA 3AP4A 2X29A 3ZPYA 2VY0A 4Q0QA 5JVVA 1XE8A 1JHNA 4L11A 4XFAA 4XF1A 3TBDA 1ZRDA 3WG3A 5K0UC 1G86A 1S0DA 4RS5B 4PLNA 5FMOS 4C1XA 4ZU7A 1RUJ3 1SCSA 4AGRA 1F5FA 1H2KA 1O4YA 2XL9A 3CF6E 2DU0A 2P3KA 3AKQA 4QGLA 4JC1A 1PZ9A 5J98B 4LE4A 1QXPA 1WUVA 1AXKA 1RMU3 2NMNA 2I2SA 2QDRA 5AC92 1WD4A 1LOFC 1DGLA 3E5XA 3HD8B 4A2UA 1PO11 4PBOA 2LUWA 3ZYIB 2HKXA 1AYN2 3JCIA 2D97A 5ACA1 1JOJA 3P3PA 5J09A 1GQGA 1SACA 3PHMA 3H50A 4IEZA 3VUOA 2QZ3A 2DCJA 4QPIA 3B7MA 4QGMA 3H8UA 1W6QB 5FO7B 2ZGKA 3GF6A 1V6JA 3PVBB 3AKRA 3VZLA 2A73B 4CDQC 5K7PA 5DG1A 4YM1A 4KWLA 1AJKA 3FMGA 1C3HA 1LHVA 3M1HA 4W65A 4YM3A 1X33A 3HT1A 4CDUC 1RMU2 5EYYA 4N53C 4OHZA 1N1TA 4BE3A 2ZGUA 1GZWA 5LK5A 3B93A 3NL1A 4FTEA 2EXIA 1AR92 2Q4SA 2Y38A 4N43C 1R083 2EF6A 2ZCWA 4BZ4A 4AK3A 4ISQA 3T1LA 4ES8A 1PNGA 3KS7A 1FATA 1XNDA 3AYAA 1FV2A 3RQ0A 1GKBA 1V6NA 1CAUA 1QJY3 4FOYA 1KJLA 3M4FA 1DF0A 3VBOA 4DY5A 1FAYA 1CIWA 1BK1A 4HLTA 2YC0A 1ZBE3 2DCTA 1KQRA 1CGPA 4FPKA 1UAIA 4YLZA 3ZXEA 4R9CA 1WA4A 5CNAA 5HCAA 2RS53 1NA1C 2PHLA 5FTTC 3TOJA 3NWKA 2ZZJA 4GB31 4B4PA 2AZ5A 4RS5A 3TN91 3FFQA 4XEZA 1ZM1A 2XJVA 3I8TA 4K8FA 4JGZB 3ZYPA 4YZ4A 2WT1A 5I8SA 2YGLA 1QMJA 2HYKA 1N47A 1SCRA 1GNHA 3M3QA 2GNBA 3DPRA 2PHFA 4S2FA 2IXCA 4LA3A 4N9HA 4O9GA 4BCUA 3J26N 2B8MA 4FO9A 1SQ4A 1IS6A 2OYZA 2R32A 2JX9A 4U36A 2DWRA 1AXZA 1CD3G 3IBMA 3J8F1 4LLFA 4DZGA 3MIDA 4R4ZA 4H3WA 2GALA 1ZZ8A 2P3JA 5FLHA 5DUWA 2WSVA 5JOWA 2YZ4A 2GN7A 4I3PA 4Y22B 4M0NA 1RHI2 2PHDA 3OYWB 1MZFA 1D0HA 4I01A 4B29A 2CV6A 2HWF3 3B5LB 5FMOL 5JOXA 1CPMA 4HSJA 3SHRA 2O8QA 2HWE2 3TNQA 4Q8KA 1MQTB 3MIEA 1YHFA 4FTSA 3ZYGA 1MACA 4YSFA 4I0WB 3MYXA 2XVKA 5C9AB 1DQ6A 1WBLA 4D3WA 2TEPA 2VMGA 1PVC3 2ZX2A 4Q0VA 4HSLA 2ZGPA 1AL0G 4RSUA 2WS91 4QU2A 2GAUA 4COZA 3WW1A 4XBLA 3WCSA 1LEDA 1C5IA 3ZMNA 2JEMA 3VZKA 5EV7A 5T5LA 4E9KA 4KQ7A 4XF0A 5I8YA 1XE7A 2RS31 4AXOA 1NCRB 2AUYA 1QWRA 4GH4B 1QH7A 1BXHA 3ZXKA 2Z42A 4MXVA 3D82A 2HJIA 2VUJA 3LA7A 4NR1A 1HQLA 1AR73 2DCKA 3MIGA 4J6GA 4JGZA 1RUG2 5FFOC 2A6YA 3RI8A 4JCKA 4LBQD 3OCPA 3WHUA 1H1MA 4B7EA 1HRI2 3FLTA 2ZA9A 4Y1XA 4V1PA 3AKPA 1U5ZA 1VBE3 2AH2A 5BNNC 2WFF1 4KWKA 4M3CF 1AR63 3AP6A 1LU1A 2TUNA 4E4DX 4HN0A 2WLPA 1Z7S3 5GLVA 4ATFA 3RRDA 3RMYA 1QJX3 1VR3A 3NAPB 4CP2A 3VBRC 2A3XA 4XHBA 2HWD1 4FTBA 4CEYB 4COYA 1UX6A 1PGW2 4BPZA 2GH2A 4NWWA 4Y22A 5ABJB 3WP3A 2XJTA 5FDBA 2RMU2 3OYWA 2GN3A 1OKQA 3V56A 5F6LB 4XQDA 1MS1A 2WNVC 4XPVA 1VBE2 1EYBA 4P9JA 3EHKA 3H1YA 1WGPA 2YV8A 5C9AA 4IV3B 4MGIE 4CEWB 4LUKA 3B9IA 3ZIXA 4QM8A 2ZGTA 1ZYBA 4HK9A 4DRRA 1HRV2 1W6MA 2VGDA 5GJ6A 2HWC1 4DRVA 4YZ5A 3DUIA 5BYNA 2UY8A 3WG4A 2D98A 2A6XA 2E7AA