1Y43B

Crystal structure of aspergilloglutamic peptidase from aspergillus niger
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
171
structure length
171
Chain Sequence
EEYCASAWVGIDGDTCETAILQTGVDFCYEDGQTSYDAWYEWYPDYAYDFSDITISEGDSIKVTVEATSKSSGSATVENLTTGQSVTHTFSGNVEGDLCETNAEWIVEDFESGDSLVAFADFGSVTFTNAEATSGGSTVGPSDATVMDIEQDGSVLTETSVSGDSVTVTYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspergillopepsin II light chain
publication title The three-dimensional structure of aspergilloglutamic peptidase from Aspergillus niger
rcsb
molecule tags Hydrolase
total genus 21
structure length 171
sequence length 171
ec nomenclature ec 3.4.23.19: Aspergillopepsin II.
pdb deposition date 2004-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1y43B00
2IFWA 3TRSB 2IFRA 1S2KA 1Y43B 1S2BA
chains in the Genus database with same CATH superfamily
1JZ8A 3N9NA 1LEDA 2ZMNA 2A6WA 2TEPA 1UIJA 4RSUA 1MS9A 3U10A 2ENRA 2XWBB 3FWEA 4ORFA 1JOJA 4KMQA 1W8FA 4XJAA 4BQWA 5FO8B 4ES9A 4NROA 3PHMA 3VDBA 4LLOA 4EN8B 3LAGA 4FQ4A 1MQTC 4LO5B 3I2KA 4XF9A 2V09A 5HCFA 3A0KA 3AK0A 4W4ZA 3ZPOA 1JTZX 2OPWA 4S2HA 1YWKA 1ZM1A 3E5XA 3K46A 4Y1XA 3VZKA 5A3MA 2ZXQA 1WW7A 1YI9A 3WR0A 5KHGA 2DCYA 1ZA7A 5HV0A 4UW4A 2PQQA 2D7FA 2R061 2CDOA 3C2UA 3ZXDA 4Z2WA 4GH4A 1GMMA 1QJZA 4YRDA 3D8CA 4CDXC 5I93A 3BCWA 4KGQA 3WUCA 2EIGA 3TOJA 4KQ7A 3LA3A 3R4SA 3WCRA 2E7QA 2VMCA 1OKQA 1WMFA 3E1F1 1FT9A 5C8CB 1SQ4A 3PU3A 4XXAA 1ASJ2 5F3CA 2NPIA 1WMXA 5A3UA 4ASMB 1QU0A 3H3UA 4YVWA 1JZ5A 1A78A 1EYBA 2VR4A 4AFAA 1DFQA 1ND3A 2Y6HA 4Q4W3 4A3ZA 2CHHA 2WQZC 2WR9A 4R9BA 5DABA 2VBDA 5JVVA 3WD5A 4HANA 1RUH3 4P9IA 2VW2A 2PFWA 3WQ7A 3EO6A 4E4HA 4XUTA 4YSFA 3ME2A 2RJ2A 1QH6A 4JVAA 2VPVA 1HXS1 5FZAA 4OI2A 2WWJA 2EA7A 1LRHA 4YM1A 4AQSA 5EV7A 5DDJ1 1ZVFA 3U11A 2GC3A 4HVQA 2PN5A 1MS5A 1S0DA 2G9ZA 3RMYA 2Z2SB 4DRRA 2J42A 3VKMA 4FPKA 3DYMA 2Q1FA 1EAH1 1UWWA 1DIWA 5GZFA 2WSUA 4CU8A 4B7EA 1UCXA 2P17A 4LOTA 4Q4Y2 3H8RA 3UJQA 5CKNA 5GALA 4TTGA 2VAUA 2XJVA 1AF9A 1Y4WA 1RUG2 2WNUB 4BQ5A 1HRI2 1O8PA 4QPIC 2VNRA 1D4M1 3IAQA 4YWAA 2VG9A 3RYPA 4GB33 2ID4A 4C0HA 1J59A 3NSTA 2VQAA 1SPPB 3JD71 2EAAA 3NJVA 4NPRA 4C8DA 3LPGA 3HVDA 4I2OA 4UFLA 4J1WA 4XBNA 1HKDA 1WWYA 1K3IA 5HV4A 3O1OA 3OYWB 1NCRC 2CAVA 2BNOA 4FFIA 4LMFA 2HLEA 2QDNA 1SLLA 1VBE1 1TNFA 2DDUA 2UWBA 1VAMA 4DXTA 4LXLA 1BK1A 5AC91 3AMHA 2ZGLA 5FY8A 2L9LA 1YC61 4RD7A 1OFSA 3LGRA 2GMPA 4Y1ZA 1ZZBA 2JG9B 2RMU1 4QGLA 1YFUA 3VBHB 3ZYJB 3SEEA 1RUE2 4JX0A 5FZ0A 4FPGA 4INDA 5DPNA 5BUVA 1PO13 2ZBJA 5L7OB 3I59A 4FPFA 2LTNA 3A23A 3ACGA 2WJSA 2HJIA 4MGIE 4DXSA 1VPHA 3B9CA 1DHKB 4ZY9A 4ATFA 2W08A 5L36A 1CR7A 1REFA 2G19A 1YYNA 5C33A 1XNCA 5F2SA 5FZ4A 2AC1A 1NE4A 1MQTB 1O7FA 5CVRA 5FYSA 5FLJA 4EYUA 4MXWB 2DVBA 4IE4A 4LJHA 1AYM1 1TME2 2VMEA 5DUVA 2WIIB 2A75A 5EJZB 4QKBA 3T2OA 2DU1A 1RUD1 2JENA 2VOVA 1VAKA 3EXUA 5FZIA 3M1HA 3GZAA 2ZOEB 4NAMA 4AEMA 1AYN1 1ASJ3 3LDBA 3MF6A 4CDXB 2PHUA 2XGXA 4IEVA 5A33B 1O3QA 2Z5WA 1WCQA 2H6BA 1O3TA 3ZXAC 4HOOA 3DF0A 3FUOA 5LK7B 3DUIA 3N36A 2HYXA 2VMDA 1SACA 2ZACA 1CX4A 3WDUA 3BGAA 1W39A 1C1FA 2HH9A 1W9SA 2JB8A 3H8OA 4COZA 3FJSA 2XBO1 4H7LA 5F5QA 1HRV3 1MS0A 5C3SA 4OMCA 1REDA 3OD0A 3DXUA 1T6BX 1MPXA 5A1FA 2KA3A 4Q26A 5DUXA 1O4ZA 3EJKA 2RM21 1KITA 4IGOA 5HPOA 5C9AC 4ES8A 2OUJA 2SBAA 3VBSC 2E7TA 3AP4A 4BQ1A 1IS4A 4B1MA 4Q4Y3 4H2AA 4QX7A 1UKGA 3GJBA 1J3PA 2JDAA 5F3IA 1UY4A 3GNEA 4WM7A 1U5XA 1XYOA 1ALYA 1C8NA 3ACLA 4XUNA 5D8AA 1V6IA 2VXRA 2WWSA 3U4SA 1F5JA 1W6NA 4ZS2A 3LIGA 3FZ3A 1L7QA 1JYVA 4R52A 1UMHA 1WLCA 3ST7A 4XZPA 2YGLA 2YC0A 2X8KA 5FZOB 1D4VB 1VJ2A 2VE1A 4AWDA 4IV1C 1SDWA 2P3KA 3IN9A 4IEZA 4QPIB 3TN91 4NN0A 1ZA4A 4SBVA 3GGLA 3EB7A 2ZKLA 2HWE3 1OURA 1CONA 1SDDB 1UU5A 2C5DA 4IEUA 5FP8A 3DKWA 3THDA 4N43A 4QX5A 3G6JB 1FMD2 1MZ6A 1RUI2 1W6QA 2PAKA 2YB7A 1DQ0A 3POIA 2CSGA 2VOXA 4QGNA 3H50A 5JZGC 1NCRB 2XOMA 3AFKA 2WFPA 3GALA 3H0OA 5HCAA 4P9LA 1BMV2 1UZWA 2W94A 4JHTA 3T2PA 4XBQA 4DS0A 5FP9A 3BUCA 4I02A 5J37A 4LBJA 3MPBA 1EV13 2A6XA 3RGBA 4ONUA 3ZXFA 1GOGA 2VOWA 4K21A 5H9QA 3ZFFC 4AK3A 4LIUA 2VUDA 5C3PA 4JDMA 1W3XA 2AENA 4QXBA 2P4EA 1UPSA 2LROA 3MF9A 1Y7BA 4K1ZA 3AMNA 4QX2A 2AR6A 4CCNA 2A3YA 4OUSA 5JOYA 2IXHA 2W1WA 4QHOA 5EJ1B 3WSOA 5FY5A 3KHBA 1VBC1 3BPZA 1G9DA 3VBFC 3RZLA 1AL22 2YU2A 4HVRA 3FFZA 3U37A 4Q4W1 2DU0A 2JDNA 2ZA9A 1RYYA 4LE4A 3B7MA 2Z69A 4MV2A 2AH2A 1JYNA 4MYEA 1RUH1 1TE1B 3DYOA 3NKTA 2J1TA 3M3IA 3A0NA 2V73A 3ABZA 4QX0A 4DZGA 1NLQA 1MS1A 4RHV3 1AXZA 1I6XA 2R16A 2VY0A 3A7QA 3D3AA 4Q4V2 1OPMA 4D69A 4NAOA 1AR73 2DFBA 2MPFA 3VHOA 2O14A 4IE7A 1W05A 2BV4A 3WDVA 2AYHA 3OBRA 2HWB2 4XFCA 2ZGMA 2UYBA 4XZUG 5DAPA 4LBQB 3AP7A 4NPLA 2BWAA 5A3OA 2WUHA 1DG6A 1GNZA 4XILA 3RI9A 4CDQC 4XC9A 2PHFA 5HXVA 4CCCA 1HB3A 1HJFA 1XE8A 3PDQA 1UIKA 1ZZ7A 1QNYA 5HBAA 4N53A 3PJYA 4Y22A 3O1TA 2FCTA 3CZJA 3WNPA 1JU4A 1LTEA 5A7SA 4GB31 1H4HA 2W92A 2OVUA 2UWCA 5KC5A 1NG0A 1AL0G 5C9AB 4QXCA 4M00A 1W2UA 3VBSB 4XDPA 5C70A 1VE0A 3FLTA 3ZR5A 1NXD1 3MLKA 1AR91 2OXBA 3N7KA 3ZFEC 1R1A3 4WVVA 4WZCA 1GWMA 1U5ZA 1ACCA 2I45A 2WT1A 1HV1A 1OA2A 2WLQA 2X5IA 4Z8BA 4F8AA 2A1XA 4DUVA 5IAVA 5K0UC 5CFDA 3BIEA 1AJKA 2XL9A 4CP9A 5I8YA 1RMU3 2ZHLA 2AUYA 3AP5A 3VBRA 2FDFA 3NVCA 4IV1B 1PO11 4CDUA 1FMD3 1U12A 2XONA 1JMUB 1B35A 2A3WA 4B4QA 2GU9A 4KWLA 3TWIA 2ZGNA 4D6SA 3PJQA 3JXSA 1J3RA 2D3RA 3PU8A 1D2QA 2YFZA 1OT5A 1Q8QA 1U5IA 4YM3A 5FQ0B 2RE9A 5JZGB 2A6VA 3IMMA 3HD8B 2BP6A 4E2QA 3IPVA 3I8TA 3N9OA 3NJXA 4Q2FA 1SBEA 3NNGA 4LORA 4GJYA 1IQAA 4NUBA 2DWRA 4IV3C 4QGMA 4M3CE 3AYDA 3QCWA 3PUHA 4O9EA 4OUMA 2ZZQA 1ZRIA 1BEV2 3OB8A 3L9JT 3IIIA 4FOVA 3B3QE 3ZFFB 5C3OA 2CTVA 1LOEA 3MIFA 2C26A 1AL23 1ASJ1 5I0RA 3JBG3 1E5IA 5FBZA 5LBFA 1WLDA 4AAPA 1BK0A 1G6NA 3JB4C 3URFA 4XTPA 3NNFA 2WQ4A 4K8RB 2XDVA 3MICA 2XMLA 3LEIA 3NV3A 4MGKE 4C91A 3VL8A 4GXLA 3VBFB 3JUUA 4Y5Z0 4BB3A 1PVXA 2DVGA 1MACA 3HOBA 5I8SA 1XSQA 2QE3A 5GLWA 1WBFA 3I3MA 1QJX2 5T5JA 2PELA 4A6SA 1H8TC 3H3ZA 3W58A 4CEYA 1GQHA 1W04A 4D7YA 5K7PA 3GZUC 1M06G 2Q1ZB 5A7WB 1HRV1 2VTXJ 2XUEA 3GF6A 1NLSA 4NHKA 4RGKA 4AFDA 4AOCA 4XBLA 5JXIA 5FYCA 3ZN6B 1MEC3 4B8EA 4D3WA 5FXWA 2PLV3 3FE5A 2E9QA 3VV1A 4JKLA 2GC2A 1UO9A 2VCAA 2VQUA 1CZVA 2QQIA 4A3XA 4FAGA 1QJU3 2WT2A 4QB2A 4XACA 2W68A 3VBUA 5C4WC 3K4ZA 4UW3A 5JSPA 3MLJA 3RZZA 3OTFA 4N7UA 3MIGA 4HONA 4XFHA 3RZGA 4Q4Y1 3BOWA 4QM8A 4A7YA 2UWAA 2JDHA 4ITCA 1QJFA 1DYKA 3DGTA 3UGGA 3HJRA 4Y33A 3J7NA 4E27A 1S2EA 2DCKA 4CDQB 1N47A 4K3UA 2C0ZA 3HQRA 4H55A 2Q1MA 2A71A 4V1PA 5IVFA 3P3NA 1XJAA 4H3WA 3VKOA 2HWD2 3U1XA 4QHZA 4DFSA 5EP9A 1A8MA 2B42B 2ZGTA 3MDPA 5A3WA 3UKTA 5GLTA 3IMNA 1LNSA 4XHBA 2HWE1 4AF9A 5JMOA 2DUPA 3AKTA 3LFMA 3AL6A 3OPTA 1V6JA 2DCZA 2EIEA 5E8AA 5JI7A 4UF0B 2N7GA 4RQPC 1JZ6A 2JKBA 1H1IA 1BCXA 2AEYA 3M70A 3ZFEB 1YHFA 1NCQC 2VXJA 5FR3A 5HI0A 1LR5A 1PMHX 3N3HA 3MV01 5FZFA 3WP5A 4E4ZA 2FDHA 4V2VA 4YW4A 2GMEA 1RJ7A 4LO7A 3WCSA 1EV11 4NWWA 5K0UB 1IHMA 4TZDA 1YFXA 4P9XA 4XFGA 4PJYA 5A70A 4DEVA 1GQGA 1LULA 3AKQA 4LE3A 5JIAA 2XLGA 3BN6A 4DY5A 3H1YA 4C1WA 2HEWF 2XG3A 4KH9A 2RDNA 1XQNA 4JDOA 3BOPA 3VLBB 5LK5A 1UX6A 2MNGA 3E97A 2NMOA 3K4DA 4QKNA 4UW6A 2C9KA 3I3QA 3K4AA 1GLHA 4XF1A 4XURA 4JQRA 1YCIA 2VCCA 1BEV3 2VOTA 4UI9L 4XFBA 4HL0A 4Z07A 3DKQA 2WWUA 2VUJA 3ZFGC 2PHDA 5LW9A 1RXGA 3MO4A 4LKDA 2TNFA 4CP0A 2CGOA 4XF3A 2Y6LA 1LOAA 3WNLA 4AI2A 4J1XA 4IV3B 4V2WA 3BKZA 1KFUL 1TG7A 3P3PA 4X6QB 1NY71 3SISA 2A70A 4EN7B 4LK7A 3TEXA 5LY1A 5T55A 5L9BA 2E6VA 4RHV1 3BTAA 4XMAA 5CYYA 1GU3A 5KHKA 2JDYA 1YIPA 1UL9A 3TNPB 4COYA 1LHUA 1AR71 1QJX3 1VBA2 5APAA 4FTBA 4IERA 4AW7A 4K7JA 1UYZA 3D0JA 3OEBA 2W5FA 5LASA 5ANQA 4BK5A 2ORXA 2QQVA 3VBOC 1NA1A 3ZM8A 5GZGA 5JXGA 2W91A 4HPKA 5G04L 1H8TB 4E9KA 5CAZA 5KXDA 4UFKA 3WINE 4D6QA 1RVF3 2BERA 2BVVA 3WQ1A 3H7YA 5ERLA 1G9AA 5IVYA 3R4UA 4Q0SA 3GXUA 2ERFA 4FFFA 5LB6A 2B4KA 3V0AB 1OOPA 1JYTA 5FMDA 3JZVA 3ACHA 3H3LA 5C4WB 4IEPA 4AQTA 1COV2 4MGYE 3ZSKA 2OPKA 3SNMA 3VDDA 1T6GC 2J1SA 4A44A 1MZFA 3LDKA 1LOCA 5FPXA 1DBNA 4CA9A 2ZAHA 4YG6A 2WRAA 5FIXA 5JLVA 4JKKA 5LCWL 2JG8C 1R1A1 4IEXA 5FK8A 5ACA3 3WNKA 5KWRA 2R1DA 1OMIA 4TWTA 3HMYA 3OJBA 1YO8A 1ZZ8A 3KD4A 5KC6A 2R073 5E6HA 2QQWA 3MI8A 1ZRFA 1RMU1 3UNPA 4LULA 5FZCA 2NZ9A 5FV3A 1FMD1 1C5IA 3NJYA 4IQPA 5F3EA 5BNQA 1AYM3 5FZ6A 3KGZA 2ORZA 3MV11 2JDPA 3T2QA 4MGTA 2VQ0A 3H42B 3ORJA 4GALA 4XDQA 1WD4A 2WS92 3ZYHA 2XPJA 1S0BA 2WA3A 1GOHA 3OBZA 5C5TA 1OA3A 3MHZA 2RJLA 4RQPB 5E16A 3WV6A 4AEDC 2ATFA 2PAMA 5A3LA 2R043 4YZ1A 5ABJC 1NCQB 1E5SA 2ZGRA 1CZSA 3QH7A 3WP4A 1ULGA 3IM0A 4D6RA 4F83A 3SCFA 2XH6A 4NJ4A 3M4FA 1XNAA 1AL21 1QJY2 3JBG1 5JDBA 2XR4A 4E2SA 3LE0A 4W8JA 3SMHA 1K5MC 2PA7A 3AMQA 3LWCA 4HZFA 2ZGQA 2CGNA 4UAPA 1LOGA 4K8FA 4RFRB 4QB1A 5JSOA 2RS12 1CESA 4CP1A 3BIWE 2NP0A 4QPGC 3I2JA 5L73A 1FI2A 2QVSB 5LRRA 2Y6JA 4OQ9A 1PVC3 2AZ5A 4NE9A 2R30A 5IATA 3OCPA 2YPJA 2XHNA 3EMRA 3ZFGB 2RVAA 4MVTA 1MVEA 1RIRA 3M3EA 5FO9B 3MBWA 3ZYIB 4LUMA 4JV4A 4PF5A 1HQLA 4AI8A 1QGLA 2RDSA 1MEC1 5EYXA 2PLV1 1NE6A 1VBD2 3O0VA 5FLIA 1WKYA 1SEFA 3VZMA 4CRQA 1DQ1A 1QJU1 1AX2A 2PHXA 5FYVA 3PTRB 4AVBA 4JGYC 1QQP2 4FOQA 3SH5A 3IZOA 5A6QA 1YRZA 4M4PA 5GM0A 2OT7A 2WNUA 3KB5A 5F6KA 3ROUA 1V70A 1WCDJ 2Y64A 2PAEA 5BNPA 2FZ2A 5L19A 3VBOB 1I1EA 1IZ3A 1W0NA 4BHPA 4S2GA 1G7YA 3ILRA 4GJZA 2GNMA 1VMJA 1V0AA 2VZRA 4OMDA 3I4IA 3HEIA 4XJ9A 1COV3 2IXCA 1AUYA 1OLQA 4Y4RA 1W6OA 3USSA 4M0NA 1JUHA 3CLPA 3DL3A 4FPJA 4Y26A 3J8F3 4GH4C 4RS5A 3NKGA 3USUB 2OUHA 3THPA 1DCSA 5I8TA 1CAXA 2QJVA 3T4HB 4K20A 4QPYA 2VZVA 2VTFA 2QQJA 3NAPA 1WGPA 1R64A 3LSEA 1X33A 3S7IA 1A3KA 1HLCA 3HT2A 1VMHA 4RR3A 2FMYA 3BTZA 3MIBA 2FCUA 3ZOIA 5FY4A 4QWNA 1CAUB 2VULA 2JG8B 1POV0 3ENRA 3MIHA 1ST8A 1V9U2 4TLFA 1XU2A 4DNYA 2EF6A 4UWDA 5BY5A 1VBC3 2BOIA 1AZDA 1UPIA 2JIJA 2YBSA 3J26N 4O65A 5GJ6A 3ZKUA 4I0WB 1OA4A 2A6YA 3RYKA 3ZYFA 1LOFC 1HQWA 1R083 4PHZA 2WS93 1ENQA 2IFWA 4AR2A 4A6OA 5CG8A 1VMFA 4W6YA 3KZ4C 4Q4X2 1A8DA 3TEWA 2E26A 4YZ4A 1H2LA 1Z78A 3W59A 2DTWA 3ALQA 4HBNA 5ANNA 4MXWA 3VKLA 5GZEA 3KV4A 1H2NA 4UOJA 1OPOA 3ECQA 4FPYA 3GHMA 4GKYA 1HN1A 2E31A 5T52A 4LNVA 4KBZA 1QHDA 1BEV1 4GMP0 4AEDB 4BM8A 2E32A 4CDXA 2NQYA 3O0WA 3HIFA 5ABJB 4FPCA 4PLOA 5A33A 1NZIA 2W39A 1XE7A 2O0OA 4MZUA 1DLCA 2Y8KA 4WM8C 1FATA 1PIV3 1W03A 4LR4A 5DAVA 1K45A 4GWNA 4NMIA 2ZHKA 3S57A 3S5AA 5FUIA 4NIDA 4ARYA 2E7AA 2HWC2 2JJ6A 2RS33 2D44A 1K5MB 3NWKA 1W9TA 4LHNA 1PHMA 4YGEA 2VH9A 1QJX1 3V56A 2Y6GA 4RYDA 4JRLA 1SHWB 1BBT3 2BZDA 2WT0A 3ILNA 4DB5A 4XMIA 5E89A 2W87A 4FT8A 4HLTA 1APNA 2Y60A 3KM5A 4QPGB 1ZBE3 1OFNA 2CV6A 2GMMA 3AZYA 2G1MA 3VD3A 3J9SA 4MHRA 4X6RB 2P34A 5LA1A 1RVF1 3BALA 2YGMA 3ZYPA 2ADDA 4AEJA 5D2AA 1AR93 5LY2A 5FZDA 2FDJA 3MFCA 3KT4A 1STMA 4HMZA 2B46X 2P3YA 2QBXA 2PYTA 5FPVA 2JXAA 4G4FA 4QKDA 4A45A 2LALA 3KCXA 4TLGA 1K12A 2HEYF 2QCSB 4JGYB 2YG0A 3POJA 3ASIA 1CGPA 3T1LA 3WXPA 1U5YA 2YHJA 1GZWB 2D6MA 1N3QA 3AYEA 3ETQA 1E5HA 1NX9A 5FZOA 4ASLA 4ZHNA 3RZHA 4OYUA 1LENA 4MLOA 3MUY1 5ACA1 1ZRRA 4QPIA 1RUOA 4FPOB 1PNGA 4UBHA 2XLFA 2VJXA 1SCSA 3JQWA 3EBRA 4NHYA 2R071 2JD4A 1BLZA 3M3OA 4CUBA 1WLTA 5DZEA 1IQDC 3C3VA 4HVOA 1FXZA 4BOWA 2QUOA 3KWVA 2OA2A 1MZ5A 1NCRA 1PK6C 1RUJ2 1WCSA 4L0PA 2XJUA 2I2SA 3UESA 3WF4A 3WNOA 5FYBA 1PGW2 4U36A 5FZ1A 1IPJA 2ZGOA 1S0EA 4BYYA 4JC1A 1O4TA 4HT1T 5IWFA 2OS2A 3PUAA 1WCUA 3AYCA 4COWA 1J84A 5LATA 3AMPA 4DINB 1FOD2 2YZ4A 5EPAA 4RFT0 2Q8EA 3OPZA 2XB6C 2R041 4FTEA 5A7NA 2NMNA 4Q4X3 3D5OA 2W47A 2VC9A 1CIWA 2WNEA 1L7LA 3CJIC 4CDWC 1IG0A 2YV8A 1QXRA 5BPXA 3PLQA 3U75A 3W9AA 5HCHA 2RDRA 3CL1A 5FZHA 2FCVA 4I30A 2DV9A 4JTOA 2ZHMA 4QB6A 2WAOA 1AR82 1UD1A 4LIVA 2FZ1A 1OLRA 4BXFA 2PHLA 3ZYGA 1SFYA 2EVXA 1S4CA 3B94A 4XABA 1UYPA 4YM2A 5CNAA 3ITQA 4O9GA 4WM7C 2YBPA 1PO22 2P5BA 3NL1A 1RUC2 2O8OA 2EAKA 4I3PA 2VVDA 1PVC1 2BNNA 4CPBA 3ATGA 2VNOA 1OD5A 2RS52 2RR12 2WZR2 3CIHA 3FHAA 4EWDA 1DLLA 2HWC3 1FPN2 5BNNC 1REEA 1US2A 2DVAA 3C7FA 1C5HA 2XQXA 3SKVA 2WBKA 4WM8B 1XPWA 1JOPA 3TYJA 1ZRDA 3FHIB 5IVVA 2F4PA 1RUG3 1VB4A 4FPLA 1HRI3 4OHVA 4LBQA 5DUWA 2XWJB 4HSLA 5HCBA 3GBWA 3VL9A 1KGYA 2JD9A 1YQ5A 4QKFA 4LUKA 4N43C 3WQ0A 3KT1A 2YFUA 3ZO0B 3KF5A 4XAEA 3FBYA 4IDZA 2W95A 5IAXA 3UGFA 4N9HA 1I9RA 3FHQA 2K0GA 4YFZA 5JR2A 5I0UA 3CNAA 1H6YA 2P3JA 4IEQA 5EXOA 4AVTA 3U14A 2R49A 2WNVC 4E2GA 1JZ2A 3LEMA 3NV4A 5C9AA 3B02A 2EALA 4YZ3A 3FLPA 1S1AA 1LOBA 3VBSA 1COV1 5J96B 1H1MA 1RUE3 2ILMA 3MFAA 2UY9A 4XPVA 1WMDA 3SXWA 5FLHA 3AX4A 4WBBA 3J8F1 3MPPG 2QQNA 3I59B 3WG4A 1LB2A 4WVMB 1GANA 2XHKA 4LEJA 3ZXGA 4DEQA 3H9AA 3SITA 3HN1A 4XTMA 4DOUA 3UGHA 4W50A 4TYSA 4ATEA 3VUOA 5DAQA 1PGL2 3ZX7A 1W8HA 3ZXEA 1CAWA 1ZZ9A 5JR7B 1C4RA 1KDMA 4OI0A 2SLIA 5DUUA 3JQXA 2VZOA 1GICA 3RMXA 3TAYA 3H1MA 1JZ4A 2VVEA 1ULFA 1ODNA 4J25A 4JZRA 5IUQA 5A80A 1JHNA 1RUJ3 4DPNA 3I2HA 5IYYA 3GBFA 1LECA 1TME3 5JIUA 3H7JA 1GYKA 1CPNA 4Y1YA 3ZR6A 1Y43B 3CKHA 1UOGA 4PIXA 1H9WA 4OUEA 4Z1VA 1R081 5C3QA 1PZ8A 1XNTA 2WS91 5FQ0A 5JZGA 4R9AA 1PK6B 3FBMA 1UMZA 5C71A 4AQ2A 1WA4A 3LSDA 1OUXA 1OQ1A 4HSJA 4IXLA 4BZ4A 4COVA 4CYDA 4Z2AA 3U0ZA 1UAIA 1MS8A 5G05L 4XCAA 3WG3A 4O61A 1C1LA 4IESA 1VBB2 2XQRA 3LQCA 4KBBA 3I2OA 1SLAA 4GAZA 5A32B 3ZFFA 4B4RA 1PM7A 1GUIA 2YUEA 3I2FA 1W8TA 3D82A 3OGGA 4IL7A 3O1MA 5GLZA 1ULCA 5DAXA 5HXMA 1NZCA 3I3DA 4W65A 5FREA 4Y20B 4YNIA 5FY7A 4I3GA 4MGZE 3A22A 4LA3A 4A7ZA 2K2SA 1H2MA 1PIV1 4N53C 2DUOA 3CJIB 4CDWB 3D4KA 3Q8FA 3VBFA 3AM2A 5J1XA 2D93A 5JOXA 2JIGA 4W6WA 2W3JA 3T08A 2J1RA 4RGGA 2WKKA 1RUF2 2R0HA 2RS31 4Y5SA 4AHYA 4YYOA 5FKBA 5A7PA 2R1BA 2Y33A 2RR13 5FMOL 1BBT1 5A7WA 4FCAA 2JDZA 4NWVA 5FBJA 1IS6A 2J22A 3PL0A 5T5OA 3FUQA 1FPN3 1F5FA 4IEYA 3ZN6A 4DIQA 3S30A 4WM7B 3H8XA 4EN0A 1ZBE1 4YG3A 1X36A 2TBVA 3HNYM 5E1RA 3WT3A 1ODMA 1X7NA 5JPMB 1W6NB 3G7DA 2X5IC 1NQJA 1W06A 3NNMA 1NXMA 5BNOA 5CFDC 5IVEA 2B9VA 4HXCA 4URTA 5F2WA 5BNNB 3VBRC 3N35A 4Q1PA 1MS4A 2R6QA 3POEA 5IJRA 1EPWA 3FN9A 5FFOC 2RJKA 1VR3A 3I2DA 1W2OA 3AVRA 4LBLA 4RL7A 3UL2A 4AVCA 4ARXA 1AR62 4CDQA 5FZ3A 4NRMA 1S0IA 4N43B 3WY6A 3ZMOA 1OVPA 3UT0A 5FZKA 1RUI3 1UMIA 1W6QB 3CF6E 4CXWA 5CFCC 2YC2A 5K9YA 3BI3A 2XUMA 4F3JA 1AHSA 1ND2A 1OH4A 4SLIA 2CWMA 1RL3A 1XYPA 2WNVB 2VW0A 4K1YA 4J6GA 5J98B 1C8M2 1YI7A 3Q8AA 2IWGB 3W5MA 1POV3 2H6CA 2F6BA 2WSVA 2FDKA 1Y3TA 2BGPA 2GNDA 2VMFA 5T50A 3ZXLA 5IT6A 3CZUA 4DQAA 1S0JA 1H1AA 2CWSA 3S6PA 4HN1A 1SMVA 2ARXA 4XOGA 3LF7A 3OBTA 5JCTA 3WNXA 3I49A 3B01A 1Q8VA 4BIFA 2CY6A 4GWIA 2IUWA 3W21A 3UKVA 4AHWA 1NYWA 2WFF2 4NVPA 2Y6FA 3SHRA 5A7QA 4CCKA 4EWAA 1JXNA 4OQ8A 1O59A 1CJDA 2EXJA 4WVZA 5C3RA 1UYYA 4Q4X1 4JCKA 4YVSA 2WINB 4XDOA 1UYXA 2ZX2A 3E5UA 2WO2A 1O8SA 2Q5TA 5FYYA 2AEZA 1HV0A 1SBDA 1RXFA 2XJQA 1JOBA 4YFWA 1HXS2 1LAJA 3T0DA 4PF1A 3KS7A 5BV6A 2D43A 4Q4V3 3WVJA 2CU5A 4PDWC 3AVSA 2IXJA 5SV5A 3VBUC 4FP3A 2VBPA 5A3NA 5FMCA 2GP5A 3J7LA 2LW8A 3SQOA 1ULPA 2Q8DA 2FHRA 5FCCA 4XUQA 3GYDA 4Y3OA 2HWB3 1OLMA 3NNLA 2LUWA 3KV6A 1JUIA 1EAH2 3WUDA 1DZQA 5FPBA 2WZ8A 4CCDA 4GD4A 3S0MA 1W8OA 3K77A 2QDRA 1KFXL 5FY1A 4BQ3A 1X8EA 2DBNA 4L9BA 5H9SA 1KS5A 1XNBA 1OD3A 2HWC1 3GJAA 5FP3A 5KR7A 2XXZA 4XFAA 2O8QA 2QTWB 1GBGA 2BYVE 3FMGA 3KT7A 4N53B 1Z7S2 3NW4A 1F9KA 1RUG1 3WNMA 3WP6A 1HRI1 1D4M2 4OVEA 3PVOA 5EIYB 4GA9A 5AFEA 2WABA 5I0DA 3JD72 4M3CF 1LGCA 2IC1A 1H8TA 2VQTA 3C7OA 1AX1A 5IW0A 2NYYA 3AKRA 1UXXX 2VNVA 1PMJX 1VRH2 4Q27A 4AHZA 1VBE2 4BQYA 4CXYA 5JXJA 4QU1A 1SLBA 4YGDA 1RITA 1SZBA 5F39A 3ZYRA 5AC92 2XL7A 4YW5A 3NNJA 4AFMA 4BK4A 3V0AA 5IK4A 1HW5A 5F1RA 5T5PA 4PBPA 3ZVXA 2X5IB 4K6BA 2VM9A 2FMDA 4RA0A 2GN3A 3POWA 5IHRA 4AQ6A 5CFDB 3DPRC 1Q3EA 1RUE1 1AR63 1SLCA 2VUAA 3FLRA 3O14A 4N9IA 1C3HA 3VBRB 4A42A 3F95A 4MSVA 5DMYA 4AI9A 3ZN4A 1S55A 4FFGA 3PUIA 4LBOA 4GQ7A 4P5HA 5FUNA 3R4DB 1QDOA 2I74A 1TNRA 4AXOA 4FBFA 5J3UA 4XEZA 4JAAA 1YEWA 4CEWA 4U2AA 1W8WA 4LO4B 5FWEA 3LB9A 3Q8CA 1YNAA 2ZZJA 1JH5A 4NPMA 4UW5A 1C28A 1PZ9A 1S2BA 2VOKA 4AEKA 3O1SA 1C8M3 1XNDA 4LKFA 5CFCB 3ZDSA 1GZTA 1G8WA 1D0HA 2B45X 2Y34A 4QDQA 3GHNA 1LESA 2EICA 1D2SA 4KG0A 2ZMLA 2EIBA 1SBFA 1RUJ1 3AKSA 4YW1A 5J09A 3DYPA 1LGBA 1TME1 5F5AA 5FO7B 3RVHA 1UZZA 3L2HA 5IK8A 4HG6B 3HT1A 4Q0PA 5IK5A 3NV2A 3BPSA 1QH7A 1AYN2 4NO4A 4MGQA 1X82A 5EQUA 3NMBA 4OCTA 3H8UA 1JW6A 3WP3A 4P00B 4FPHA 2WFF3 3N9LA 4LHLA 3VB9A 3D0SA 4XUOA 5FXXA 4D0QA 1DZRA 1OI6A 1UXZA 4ISQA 4YW3A 2ARCA 1JZ7A 2VCMA 1W2NA 2VL4A 5H9PA 2QQUA 4JGZA 4BMEA 3OUJA 4DRVA 3INAA 5FZLA 4EROA 1MVQA 2BRTA 1ZRCA 2WO7A 1UOJA 1K5JA 2J7MA 4XF4A 5F5CA 3RZKA 2UURA 4BA6A 3L2YA 3AP6A 5DG2A 4PIYA 2XBO2 1F4HA 3WDXA 5B4NA 1NKGA 1DQ2A 1N1TA 4XFIA 4E4SA 1U0AA 4FOYA 2FD8A 2JE8A 5FJHA 4XQDA 4Y1UA 2ZJCA 1AXYA 2FDGA 1IGOA 1PM4A 4KWKA 1DGRA 1HB1A 1OC1A 1OOPC 3LD8A 4BE3A 1HJGA 3B00A 3M8LA 2D97A 4MX3A 1UY3A 1YIFA 3OY8B 2BNMA 4PDWB 3VBUB 4R9CA 2JWPA 3VN4A 3ZSMA 1K42A 1QDCA 3ZFGA 2GC0A 3VDDC 1ULEA 5A6XA 2RR11 1GWKA 3OOXA 4BDVB 1FPN1 5FMOS 4CUAA 4QQOA 2C1FA 1W6PB 5CIRA 1AJOA 4RGAA 1Z7S3 4EWEA 2JE7A 4MGSA 5FZ7A 2F4LA 2ZX3A 1HDKA 2VU9A 4R9DA 4ZZ8A 3T2TA 4XE9A 1UNBA 2D6OX 2BVBA 3EHKA 3RRDA 4OHZA 2QNKA 3UKNA 2V5YA 4XJWA 1GOFA 1W3VA 1DGLA 5KXEA 1GKBA 4NIHA 2HWD3 2VW1A 2QKDA 1TQ5A 1VRH3 5CG9A 2AGSA 1EP0A 4QU2A 1G9CA 3R0RA 1TEIA 2HYKA 4P08A 1R092 5FZ9A 2EXHA 2B7YA 2GAUA 3E5QA 3ZPYA 3RNSA 2Q8OA 1RUI1 1T2XA 4I0AA 1GR3A 1KXGA 1UY2A 3LA2A 5T54A 4G3YC 4LO6B 4M3CB 4BQ2A 1IOAA 3MW2A 3GCWA 4CSWA 1BMV1 3OGJA 1ZZ6A 4ZPIA 2ZCWA 1GNHA 1W2AX 3QBQA 4Z82A 3QLQA 4D8MA 4DXRA 5FPUA 1LEMA 1BVVA 2GALA 3IAPA 5JPNB 4EE2A 3V0BB 1QY4A 1O5UA 2GNBA 2XJTA 1POV1 1W0PA 2B5HA 1H0BA 2GSYA 2HWF2 2ZGSA 3DPRB 4AI0A 1PGL1 1DGWX 3R05A 2G9GA 4FPEA 1DYOA 2WDBA 3POBA 1CVNA 4YGCA 4EZ4A 4F7ZA 2KD7A 1CAUA 2JG8A 1TMF2 2VVFA 1LJ7A 5FUPA 4Y1VA 3K51A 4XFFA 3AJYA 4QQHA 5C8CA 4OI4A 1H30A 4P9GA 3LFIA 4TXWA 4QDSA 3QACA 4CCOA 4E8CA 1GNYA 5F5IA 4NHXA 3PMSA 4XJ8A 2QZ2A 5F6LB 3IB3A 4IGPA 3N9MA 4OI1A 2ZX0A 4L2NA 4AFCA 2TUNA 2VMHA 3AXDA 3J7MA 4D7TA 5FP4A 3DV8A 4A4AA 3UETA 4Q0UA 4CVUA 4PLMA 2MEV2 4AI3A 3VHRA 4URAA 1RGSA 1EUUA 2BGCA 3C8XA 4Q4V1 4YW7A 4IEWA 4KI5M 3VHPA 2D6LX 4ZU7A 3LKJA 3ZLIA 3UV9A 1LHOA 2WAAA 1I5PA 4KWUA 4Q8KA 1VBA3 1QWRA 2WZEA 3T09A 5D1IA 1CX1A 4IUGA 4R8HA 3SH3A 3SLIA 2HWB1 1BQPA 1KD7A 3ZYBA 1POQA 5BNPC 1Y9MA 1CAVB 4G9SB 3HR9A 3FX3A 3NO8A 4CTEA 1ZREA 2VECA 3AYAA 3LA7A 1ZZCA 4DMIA 1NT0A 4PQQA 3SKJE 1AXKA 3LCPA 2ETEA 5F8PA 2YDEA 2ZGUA 4CCLA 3PUSA 4FFHA 3VDAA 5T5LA 2BPA2 2EXIA 4GZ9A 1FYUA 1N3OA 4GB32 3VD5A 4RS5C 3OGSA 1OOPB 4QPGA 3T0AA 1SPPA 2R7EB 1A6CA 3PIGA 2MHFA 1CJPA 3K75B 2D6PA 3I54A 2W0XA 2JDKA 3HQUA 3NAPC 2NLRA 2ET7A 3KMHA 2K46A 3OYWA 4UBGA 3SCGA 3VDDB 4RR3C 4CU7A 1F4AA 1W6MB 3ZXKA 4P5YA 5T3NA 4QHBA 4XCBA 2D5HA 2V4VA 1ZBA2 1N1SA 5FWJA 1W8UA 1CZTA 2H0VA 4I0BA 1LCLA 2JG9A 2ZMKA 4S2FA 3VBHA 4ZXEA 2ZS6B 2ZHNA 4WVWA 5CKMA 3CMGA 1LGNA 3F2ZA 4M4RA 3BB6A 4JGYA 4YVWC 3UK9A 3AZVA 4CP2A 1E57A 1AR61 2J1VA 4GWMA 1ND3C 1PO12 1ULOA 1IPSA 3GZTB 1GZWA 1R093 2WO1A 2YYOA 5L7OA 2VMGA 4EQVA 1V6LA 2ZEWA 1X9TA 3ES4A 2QFEA 4X8PA 5FZEA 3IBMA 5H9RA 3VZLA 1YQ2A 2HBTA 3GCXA 3V64A 1C57A 3WEZA 4LKEA 2PQSA 2WYSA 3PVEA 1LHNA 3HNBM 1S0GA 3AB0A 4Y5TA 2GH2A 5CU1A 2NN8A 2DVDA 2OZJA 3LOIA 4XJZA 4LBMA 1NLRA 4Y4YA 4YZ5A 3RJRA 1C8M1 5L9RA 4CU6A 1QMJA 4ZU5A 4A41A 2HWF3 3LEKA 3OGVA 3AKPA 1MQTA 4BWOA 5A1AA 4PBOA 2HKXA 5JI9A 5CA6A 3VGIA 3WHTA 5FYUA 1VAVA 3A4UA 2Q0AA 4GWJA 3CJXA 5C7GA 3U78A 2DCJA 1O6UA 4A2UA 1TMF3 2C6SA 4HKOA 4AZZA 1MS3A 3OUHA 4UFIA 1ZNPA 3QOPA 1JZ3A 3ZSEA 1G9FA 2WN3A 5FPLA 3ZSJA 1LU2A 1XOYA 2WFF1 4B7KA 1QJY3 3N4MA 4OFGA 3KF3A 3AC0A 2DTYA 4B29A 1UN1A 4XVHA 5FOJB 5JAXA 1OKOA 2DUQA 3MEPA 4L8QA 4AGGA 2RS13 3WW4A 2VTXA 3KHCA 3AFGA 2DBIA 1LOFA 3WQBA 2GZWA 3MW3A 5JSRA 2MEV3 3KQRA 1OQDA 1HRV2 3PVNA 4QAWA 1VLNA 4OHXA 4A7KA 3PNAA 4AGRA 2A7AA 5D21A 1WLWA 4MHUA 3O1VA 4Q0VA 3GM8A 2RV9A 4OLLA 3RQ0A 1VBD3 4Q5OA 1KEXA 2W2IA 2W52A 5I91A 3T30A 1DGRN 1F2NA 2VZUA 1UF2C 1ONAA 2WYFA 1YUDA 2UY8A 4ZONA 5BXXA 2WZPP 3IDCB 2CNAA 1F35A 1LODA 1QQP3 2YU1A 2ZEYA 4QQPA 4WM8A 3Q9OA 2YXSA 1YLLA 1S0FA 5BNPB 4HKLA 4NOTA 1LHWA 5FZBA 2GN7A 1Z7S1 3WDTA 1YJKA 2RDQA 2UYAA 4UT5A 3ACIA 3T3YA 5FAXA 4NHLA 2ZKNA 3ZKYA 4XYXA 4EZHA 5A3TA 2ET1A 3HBKA 1HB4A 1H2KA 1MR5A 3POSA 1DF0A 2IVJA 1W6OB 4AVAA 2HWD1 2D98A 3VZNA 3BYWA 4QX8A 1VRH1 5FXZA 5B2GB 5JUVA 4RS5B 2HWE2 4H7MA 4YW6A 3TNQA 2PHTA 4AVSA 5J48A 1YQCA 1ZBA3 1CAXB 5FMBA 5LBEA 2E63A 5BYNA 5AFBA 3TEZA 1WW4A 3NAPB 4QD2A 4QQ2A 2VZPA 1PMIA 4RR3B 3WG1A 2A3XA 2IXKA 3OF1A 1DDLA 1XU1A 4GH4B 4IGQA 4LHKA 5DN2A 1W90A 1DQ6A 5EHDA 4FO9A 3FFQA 1SG3A 5SV8A 4BXSV 5FKCA 1FX5A 4IEOA 2PHWA 1L7RA 1V9U3 2GDFA 2IVIB 4WVMA 2WC2A 2YPDA 1EV12 4OHWA 4H14A 5JOWA 3AJZA 3UYJA 3T1MA 4YVWB 4HN0A 4QXHA 4BQXA 2Q8CA 1ND3B 1NQDA 1WZXA 3HNMA 3VKNA 2D5FA 3O0XA 3SH4A 1W0OA 4R4ZA 3B93A 3WW1A 4CCJA 3AL5A 2D3PA 2JX9A 1LKNA 2CL2A 4KU7A 4AHXA 3H1WA 2EIDA 3Q8EA 2KR2A 1UU6A 4DUXA 3CHXA 2LRPA 5B4XA 1IG3A 4LOSA 1UU4A 2XVGA 2ZX1A 1Q56A 2ZGPA 4EJRA 5KXBA 1QXPA 5F32A 1PK6A 4OZOA 3POYA 1DGWA 5FZGA 3IIAA 2WL1A 4L99A 2VZ3A 3AP9A 2ADEA 1FNYA 2PTMA 4N90A 1FV2A 1NY72 4HETA 5D8AC 3CDZB 1R1ZA 5A3PA 5JWPA 3S5QA 3OBAA 4CU9A 3PTYA 2P2KA 5FY0A 2BOJA 3JU9A 4RHV2 3ZIWA 3IWZA 4BISA 4P9JA 3N7JA 5A32A 4FXGB 1WUVA 5CBLA 1XBFA 4IE6A 3BVCA 1CWPA 2OKXA 1AR72 3CU7A 3FC0A 3VD4A 3KSCA 4ISRA 4Y20A 4QPWA 1Y9GA 1VBA1 3P6BA 4LO8A 2Y26A 4KL1A 5J36A 1KQRA 3I3BA 1IKPA 3CJIA 4NIIA 4CDWA 2GP3A 2J1UA 2YBKA 4FSJA 3U07A 2VZQA 1OVSA 3NJZA 3WF1A 4LQRA 1URXA 2HBUA 2XKPA 4Q29A 1UW8A 2C24A 2OZ6A 3KCYA 4I09A 5EWSA 3WF3A 4S2DA 4ET7A 5IVCA 3B5LB 1KJRA 2VUCA 2B9UA 3PIJA 3WG2A 3PURA 2YC4A 1RUNA 1Z0HA 4FXKB 1US3A 1W99A 2IFRA 2WO3A 3E6DA 1M4WA 1UKRA 1SLTA 2XLAA 5LBBA 1X50A 2F17A 1YJLA 2B39A 3KCCA 5BNNA 4AFBA 1HX6A 1R1A2 4JRAA 2VO5A 2ARAA 1SFNA 3WDWA 4QDRA 3IT8A 4UFJA 4FQZA 3VD7A 2FDIA 1QNWA 4E4DX 2YMZA 1RMU2 2JICA 5KXCA 4JDNA 4GIQA 4CE8A 4FOWA 2W46A 4IV1A 4MG2A 1NUKA 3LOBA 1R091 4IW3A 2HEVF 1V6NA 4IE0A 3RI8A 4L97A 4B4PA 1DU3D 2ZTNA 3P5BA 5KHIA 2XVLA 2WNVA 4CCMA 3B9IA 3RDIA 1L3JA 4X8NA 4P9WA 4ZZ5A 3ZN5A 1TZOA 3RWKX 3ILFA 5A7OA 2VZSA 4MXVA 2DCTA 3WW2A 1FOD3 1V00A 2CAUA 2HWF1 2CGPA 2NM1A 1UQXA 2C4XA 2JEMA 2BFUL 1RHI2 3LEGA 5KBFA 2X09A 3WZ1A 3FL7A 3M3QA 4KWJA 4XETA 2W1SA 4WV8A 1TMF1 3E6CC 3DN7A 2AREA 3ACFA 1JHJA 1I5ZA 1W9WA 2ZAAA 3UJOA 5IK7A 2JB4A 4LITA 4EN9B 3LIHA 3JBG2 4LTAA 3ON7A 3R6SA 4BQ4A 1QJY1 4D94A 3AZWA 5ISLA 2VZ1A 1CQ9A 1AR83 1JU3A 5DAWA 5IFTA 2RS11 4B1LA 2OQ6A 2X53S 3SCHA 1J1LA 1G86A 1PO23 5LA9A 1DQ5A 2YY1A 2ZEZA 1RUC3 2MEV1 4META 1H6XA 3GBGA 4PT6A 3TBDA 4KGGA 4XW3A 2IZWA 3WF2A 4YM0A 2RS53 3SEPA 1Q8OA 2WZR3 1H8VA 2G9FA 1O91A 4N7IA 5BNOC 5FY9A 3THCA 5LRSA 3IDAA 5FYHA 4BIOA 1MEC2 2JDUA 2PLV2 5D8AB 1QJEA 4ZXKA 4CXXA 5DQ0A 5C5UA 2GC1A 1VBD1 1OSGA 2D40A 5KHHA 1QJU2 1V6MA 4IE5A 2AACA 3V65A 1JYXA 1YQ8A 5E88A 1OLME 3HQXA 1W2TA 2Q30A 4B3NA 1QQP1 4AVVA 5M0TA 1W28A 3APBA 5LA0A 4OHYA 2XVKA 4CDUC 3IDBB 1IKQA 4P14A 1B35C 2BTVC 3HWJA 1XE0A 2W9XA 4BH9A 1ZX5A 5C8WA 1ND2C 2ARBA 3ELNA 1LU1A 2IXIA 3RG0A 1EY2A 3M3CA 3MIEA 3PUQA 1F8VA 4HFSA 1Q8SA 2BUKA 3LPFA 2BQPA 1EUTA 2QQKA 4FI9A 3WW3A 4LA2A 1S0CA 1WBLA 2V72A 1PNFA 1G9BA 4YG0A 2JDMA 4HKWA 1ZBA1 4W6XA 2WA4A 4DY3A 1CPMA 5I0TA 3K2OA 4K40A 3KVBA 3NV1A 2VGDA 2R32A 2R062 4GKXA 4AG4A 3VDCA 4CUGA 4C90A 4BMBA 1CAWB 4UFMA 4UF0A 2ES3A 3M7AA 2VZTA 3OUIA 1N1VA 3C7HA 3Q8BA 3O12A 3ZFEA 2VD7A 4KG8A 1Y9QA 4NIAA 4XIOA 3I3EA 1V9U1 3OSDA 4YVSC 5K0UA 5L9VA 5EJ3A 2DVFA 3MW4A 5FYZA 1QF3A 3RZMA 2JECA 4NR1A 2V4AA 4QX3A 4YGBA 2Y6KA 4ZKTB 1OBNA 2QZ3A 4CEYC 4LKSA 3K48A 3KVAA 5CFCA 2OW4A 2KM2A 2X05A 2E53A 4Q1RA 1OQEA 5DG1A 5FPAA 2BGOA 2DURA 4GMP3 1RHI3 3LDRA 1GQPA 3IDEA 3J4UH 1DQ4A 3P1IA 5EZWA 1VBB3 1HB2A 3ZSLA 2QQOA 4XF0A 2ZX4A 1DZTA 3KQ4B 3ETPA 1BYHA 3O5SA 2ZGKA 3MUZ1 3O7OA 1N3PA 5DDJ2 5F37A 3ZXJA 2UU8A 5IFPA 3WNNA 4BLJA 1JYCA 4MUVA 1UY0A 2GH8A 4ASKA 1XB9A 3MYXA 1KJLA 1VALA 4IV3A 4QXKA 3WOGA 4LLFA 5K4LA 1D7PM 1XRUA 3CBNA 2BWCA 1NAEA 3RPQA 3RWNA 1GP5A 2ZEXA 5DZGA 3WX5A 5LZ6A 4FTSA 1HN0A 3RZJA 2OX0A 3LZZA 4Q0QA 5FXVA 3HPNA 5FZ8A 2FBEA 1RUF3 4JQTA 2P37A 3AXEA 3OD4A 1V6OA 4Q8LA 3BTXA 1W9YA 5CADA 1OHFA 3DEMA 3O1UA 1GP4A 2Z42A 4Y22B 1WW5A 4P02B 4MADA 5FYTA 3TB0A 2JE9A 4UFHA 1Q43A 3E6BA 2W1QA 3QD6A 3OY8A 4JKMA 5FJKA 4CCEA 1O3RA 4PDWA 3CQOA 1F31A 1H4GA 1RVF2 1OH3A 2P6CA 4XXPA 3OGRA 2JKXA 5FP7A 4YPJA 5BNOB 2G4IA 1LHVA 1QEXA 4LHSA 1MZEA 1VB2A 2QQMA 5F3GA 1D0GA 3BTYA 1RB8G 5JMCA 5IVBA 3THTA 4PI0A 1W6PA 2Y0OA 2E51A 3ES1A 1CN1A 3RS6A 2RMU2 4AL9A 5C4WA 1JI6A 1YFYA 2A6ZA 3C7GA 1WW6A 4CEWC 1AVBA 1ENRA 1RINA 2CDPA 1UOBA 4BU2A 5CISA 2H0BA 4CP9B 4IETA 1FV3A 1IS3A 1FNZA 4TSVA 5IVJA 3ZIXA 4D7SA 3SC7X 4CPBD 4DXZA 4CDUB 3X29B 5C6CA 4M0HA 1O5LA 1X9PA 2PMWB 3MGUA 1B35B 3WDYA 1RJ8A 4E8DA 5ACA2 1ZYBA 3RSJA 3N9PA 3NQHA 1ND2B 1JYWA 1B09A 1GWLA 2R072 3KV5A 4P9YA 3BU0A 1YFWA 3DCQA 4LBQD 5CZKA 5LWBA 2B8MA 1CIYA 2P3IA 4AI1A 4COUA 5DZFA 2BDRA 3AZXA 2K9ZA 2LM3A 3S7EA 2R063 3PMEA 3IPVB 1SLIA 1EPZA 2PHRA 1AYM2 4M3CA 1KDKA 1J3QA 1J83A 1WMEA 5FTTC 1OUSA 1RUD2 1PGW1 1UOFA 2LS6A 2WLPA 3A21A 1GSLA 1QOTA 2Q4SA 1HQNA 3VD9A 3JCIA 4JGZC 2VBBA 3V0BA 1W9FA 3I97A 3POFA 4YLZA 3DPRA 3C7EA 1GV9A 1FOD1 4FVVA 4RQPA 4BJ0A 5CB7A 1N1YA 4I01A 2R042 4C0BA 1NCQA 4QM9A 1RC6A 3BODA 2V5DA 2BFUS 2X29A 1KRIA 3POGA 4YVSB 2QQPA 2DF7A 1QXJA 4XAAA 4CUCA 4NRPA 1Q8PA 1BJQA 1NA1C 3AMMA 3OPWA 1RTVA 1HXS3 2J1AA 1QIQA 3DECA 4MOAA 3D6EA 1BZWA 3QH6A 4CEYB 4EN6B 1NOVA 3N7MA 2DYCA 3EYPA 1QOSA 3N9QA 3U4XA 4LBNA 1IPKA 5DDJ3 2YROA 5JXHA 1AR81 1E5RA 2E33A 2Y38A 5FDBA 5GKAC 2RM22 3T0BA 4FP2A 5FYIA 3K3NA 1EAH3 1PO21 1QKQA 4TN7A 1UZYA 3RYRA 1PVC2 1RUC1 1YQ6A 5FK7A 4UYBA 3TRSB 1VP6A 5F9TA 3RFRA 1FAYA 5FZMA 2RS51 5JOZA 2WZR1 2D6NA 1WA6X 1JBCA 3AZZA 1UZ0A 5FOBB 5EYYA 3GDBA 1GZ9A 3VZJA 1XSRA 3O1RA 4WZFA 2OIIA 2RG4A 5DXDA 4OZXA 1ENXA 1D4M3 4LK6A 1H9PA 2C9AA 1CAVA 1UY1A 3CO2A 4RN5A 5EFUA 4Z92B 3KV9A 3JD73 4PIZA 1J58A 2KXLA 4LPLA 3VZOA 2A73B 1XC6A 2VNGA 1QOOA 5GZCA 3TN92 2D6KA 3DXTA 1KS4A 4XQ4A 5AVAA 1V6KA 1VBE3 2XJPA 3HBZA 1PX3A 3VBOA 4ZU4A 2BJSA 5FYMA 1PZ7A 3HN3A 5AC93 5FRAA 2A5ZA 4PI2A 4HK9A 5GZDA 3WLUA 4NHMA 3WF0A 1SFPA 4BPZA 3I7DA 3ZDVA 1OF4A 2RMU3 1BXHA 4L92A 4PLNA 4PQ9A 4DO0A 1GP6A 3J7HA 2QQLA 2R0FA 2XJSA 1W8NA 1JS9A 4M01A 3W5NA 5LA2A 1W6MA 1DP0A 2I07B 1PX4A 4YZ2A 3J8F2 4JTNA 1VRBA 3USUA 3CEWA 1ENSA 4ZS3A 1HIXA 2OQ7A 1XYNA 4CEWB 3K3OA 5A6YA 2OYZA 3WHUA 1OF3A 2WQ8A 5A1LA 5C8CC 5LEJA 2BBVA 3PVBB 1J1TA 2EXKA 1P8JA 3BU7A 2VCBA 1F15A 4AE2A 5AVPA 4AAXA 4HK8A 1YXWA 1S2KA 2J1EA 2P1BA 2ZPXA 4QMAA 4QX1A 4XUPA 2BBAA 1O4YA 4BCUA 1VBC2 3IKWA 5A6ZA 4JHZA 2XKOA 2Z4FA 2BEOA 3VHNA 4PCRA 4AGVA 1RUD3 4Q4W2 1R082 1BVP1 2XJRA 3NRUA 4KNCA 3OEAA 3I2IA 5FPZA 1AYN3 1JODA 1RUH2 3O1PA 3M2MA 2X10A 2PXJA 1Q5OA 1IS5A 1WCKA 4KU8A 4XQWA 1AX0A 4C1XA 4GMP1 1TVGA 4GULA 1OXCA 2IXLA 4XJUA 3T4VA 1RHI1 3VKFC 1JYIA 3B69A 1VBB1 4N8MA 4NRQA 4JGZB 4MH0E 5GLVA 2P6HA 4YW2A 4LBKA 4MO3M 3RJ2X 5KHJA 4XHXA 5CEHA 3W20A 2RHPA 2Z79A 3N7LA 4AEDA 3TEYA 5GLUA 5ABJA 3I2GA 5J7MA 1A34A 2XBO3 1BHGA 2WN2A 4DUWA 4YARA 5I0SA 4XIKA 1SCRA 2VMIA 2CYFA 1PIV2 1PGSA 2WNUC 1DYPA 4R4XA 4FAHA 3ZMNA 1NA1B 1W8ZA 2W1UA 3EQEA 4EV0A 2RM23 1VIWB 2RS32 4HPKB 1K5MA 5LBCA 2D3SA 1RUF1 5F7UA 3MLLA 1ULDA 1BBT2 3MIDA 4LT5A 4NIGA 3HAGA 1XXNA 5K8SA 1UZVA 1UX7A 4QT6A 4CZSA 2Y0IA 4AYUA 1ZBE2 1O3SA 1GZCA 1XNKA 2ZABA 4QQLA 3JB8A 4Y24A 4O7XA 1X8MA 5CKQA 1I3HA 2JG9C 4L11A 3OG2A 3VBHC 2BU9A 2WNOA 2FQPA 4OULA 2O1QA 4UXAA 1AR92 5LEKA 1BKZA 3GZEA 4BLIA 1WD3A 3KGLA 5L7OC 1CD3G 1JN2P 1GFF2 2BW8A 2DFCA 2GNTA 3KLSA 3TN93 3MZHA 4K9SA 5TSWA
chains in the Genus database with same CATH topology
1LEDA 2ZMNA 2A6WA 2TEPA 1UIJA 4RSUA 1MS9A 3U10A 2ENRA 2XWBB 3FWEA 4ORFA 1JOJA 4XJAA 5FO8B 4ES9A 3PHMA 4LLOA 4EN8B 3LAGA 4FQ4A 1MQTC 4LO5B 4XF9A 2V09A 5HCFA 3A0KA 3AK0A 1JTZX 4S2HA 1YWKA 1ZM1A 3E5XA 4Y1XA 3VZKA 5A3MA 5KHGA 3WR0A 1WW7A 1YI9A 2DCYA 4UW4A 2PQQA 2D7FA 2R061 3C2UA 3ZXDA 4Z2WA 4GH4A 1QJZA 4YRDA 4CDXC 3D8CA 5I93A 3BCWA 4KGQA 3WUCA 2EIGA 3TOJA 4KQ7A 3LA3A 3R4SA 3WCRA 2E7QA 1OKQA 1WMFA 1FT9A 5C8CB 1SQ4A 4XXAA 1ASJ2 2NPIA 4ASMB 1QU0A 3H3UA 4YVWA 1A78A 1EYBA 4AFAA 1DFQA 1ND3A 4Q4W3 2WQZC 4R9BA 5JVVA 3WD5A 4HANA 1RUH3 4P9IA 2VW2A 2PFWA 3WQ7A 3EO6A 4YSFA 3ME2A 1QH6A 4JVAA 2VPVA 1HXS1 4OI2A 2EA7A 1LRHA 4YM1A 4AQSA 5EV7A 5DDJ1 1ZVFA 3U11A 2GC3A 4HVQA 2PN5A 1MS5A 1S0DA 3RMYA 2Z2SB 4DRRA 3VKMA 4FPKA 1EAH1 1DIWA 5GZFA 2WSUA 4B7EA 1UCXA 2P17A 4Q4Y2 3UJQA 5GALA 2XJVA 1AF9A 2WNUB 1RUG2 1HRI2 4QPIC 2VNRA 1D4M1 2VG9A 3RYPA 4GB33 4C0HA 1J59A 3NSTA 2VQAA 3JD71 2EAAA 4NPRA 4I2OA 4J1WA 4XBNA 1HKDA 3OYWB 1NCRC 2CAVA 2BNOA 2QDNA 1SLLA 1VBE1 1TNFA 2UWBA 1VAMA 1BK1A 5AC91 3AMHA 2ZGLA 4RD7A 1OFSA 3LGRA 2GMPA 4Y1ZA 1ZZBA 2JG9B 2RMU1 4QGLA 1YFUA 3VBHB 3ZYJB 1RUE2 4FPGA 4INDA 5BUVA 1PO13 2ZBJA 5L7OB 3I59A 4FPFA 2LTNA 2WJSA 2HJIA 4MGIE 3B9CA 1DHKB 4ATFA 2W08A 5L36A 1CR7A 1REFA 1YYNA 5C33A 1XNCA 1NE4A 1O7FA 1MQTB 5CVRA 5FLJA 4MXWB 2DVBA 5DUVA 1AYM1 1TME2 2WIIB 2A75A 2DU1A 1RUD1 2JENA 2VOVA 1VAKA 3EXUA 3M1HA 3GZAA 2ZOEB 4AEMA 1AYN1 1ASJ3 3MF6A 4CDXB 2PHUA 2XGXA 4IEVA 5A33B 1O3QA 2Z5WA 2H6BA 1O3TA 3ZXAC 3DF0A 3FUOA 5LK7B 3DUIA 3N36A 1SACA 2ZACA 1CX4A 3WDUA 1W39A 1C1FA 4COZA 3FJSA 2XBO1 4H7LA 5F5QA 1HRV3 1MS0A 1REDA 3OD0A 2KA3A 4Q26A 5DUXA 1O4ZA 3EJKA 2RM21 1KITA 5C9AC 4ES8A 2OUJA 2SBAA 3VBSC 2E7TA 3AP4A 4BQ1A 1IS4A 4Q4Y3 1UKGA 1J3PA 3GNEA 4WM7A 1U5XA 1XYOA 1ALYA 1C8NA 3ACLA 5D8AA 1V6IA 2VXRA 2WWSA 1F5JA 1W6NA 3FZ3A 4R52A 1WLCA 3ST7A 4XZPA 2YGLA 2YC0A 2X8KA 1D4VB 1VJ2A 4AWDA 4IV1C 1SDWA 2P3KA 3IN9A 4IEZA 4QPIB 3TN91 4NN0A 1ZA4A 4SBVA 2ZKLA 2HWE3 1CONA 1UU5A 2C5DA 4IEUA 3DKWA 4N43A 4QX5A 3G6JB 1FMD2 1MZ6A 1RUI2 1W6QA 2PAKA 4QGNA 1DQ0A 5JZGC 2VOXA 3H50A 1NCRB 3AFKA 3H0OA 2WFPA 3GALA 5HCAA 4P9LA 1BMV2 4XBQA 4DS0A 4I02A 5J37A 4LBJA 3MPBA 1EV13 2A6XA 4ONUA 3ZXFA 2VOWA 4K21A 3ZFFC 5H9QA 4AK3A 4JDMA 2AENA 1UPSA 3MF9A 1Y7BA 4K1ZA 3AMNA 2AR6A 2A3YA 4OUSA 5JOYA 2IXHA 1VBC1 3BPZA 1G9DA 3VBFC 1AL22 4HVRA 3FFZA 4Q4W1 2DU0A 2ZA9A 4LE4A 3B7MA 2Z69A 4MV2A 2AH2A 4MYEA 1RUH1 1TE1B 3NKTA 3M3IA 3A0NA 2V73A 4DZGA 1MS1A 4RHV3 1AXZA 1I6XA 2R16A 2VY0A 4Q4V2 1OPMA 4D69A 1AR73 2DFBA 2MPFA 3VHOA 3WDVA 2AYHA 3OBRA 2HWB2 4XFCA 2ZGMA 2UYBA 4LBQB 3AP7A 2BWAA 1DG6A 1GNZA 4XILA 3RI9A 4CDQC 5HXVA 2PHFA 1XE8A 1UIKA 1ZZ7A 1QNYA 5HBAA 4N53A 3PJYA 4Y22A 1LTEA 4GB31 1H4HA 5KC5A 2OVUA 2UWCA 1NG0A 1AL0G 5C9AB 4M00A 1W2UA 3VBSB 3FLTA 1NXD1 3MLKA 1AR91 3N7KA 3ZFEC 1R1A3 4WVVA 4WZCA 1U5ZA 2I45A 2WT1A 1HV1A 1OA2A 2WLQA 2X5IA 4Z8BA 4F8AA 5K0UC 5CFDA 1AJKA 2XL9A 5I8YA 1RMU3 2ZHLA 2AUYA 3AP5A 3VBRA 3NVCA 4IV1B 1PO11 4CDUA 1FMD3 1U12A 1B35A 2A3WA 4B4QA 2GU9A 4KWLA 3TWIA 2ZGNA 3PJQA 1J3RA 2D3RA 1D2QA 1Q8QA 1U5IA 4YM3A 5FQ0B 2RE9A 5JZGB 2A6VA 3HD8B 4E2QA 3IPVA 3I8TA 4Q2FA 1SBEA 1IQAA 2DWRA 4IV3C 4QGMA 4M3CE 3AYDA 3QCWA 4O9EA 4OUMA 2ZZQA 1BEV2 3L9JT 3ZFFB 4FOVA 3B3QE 2CTVA 1LOEA 3MIFA 1AL23 1ASJ1 5I0RA 3JBG3 5FBZA 1WLDA 1G6NA 3JB4C 3URFA 4XTPA 2WQ4A 3MICA 3NV3A 4MGKE 4C91A 3VL8A 4GXLA 3VBFB 3JUUA 4Y5Z0 1PVXA 2DVGA 1MACA 5I8SA 2QE3A 5GLWA 1WBFA 1QJX2 5T5JA 2PELA 4CEYA 1H8TC 3H3ZA 3W58A 5K7PA 1GQHA 4D7YA 1M06G 3GZUC 2Q1ZB 1HRV1 3GF6A 4NHKA 1NLSA 4AFDA 4XBLA 3ZN6B 1MEC3 4B8EA 4D3WA 2PLV3 3FE5A 2E9QA 3VV1A 2GC2A 4A3XA 4FAGA 2WT2A 1QJU3 3VBUA 5C4WC 2W68A 5JSPA 4UW3A 3MLJA 3RZZA 3OTFA 4N7UA 3MIGA 4XFHA 4Q4Y1 3BOWA 4QM8A 4A7YA 2UWAA 4ITCA 1DYKA 3DGTA 4E27A 2DCKA 4CDQB 1N47A 4K3UA 2C0ZA 4H55A 2Q1MA 2A71A 4V1PA 3P3NA 4H3WA 3VKOA 2HWD2 4DFSA 1A8MA 2B42B 2ZGTA 3MDPA 3UKTA 5GLTA 3IMNA 4XHBA 2HWE1 4AF9A 2DUPA 3AKTA 1V6JA 2DCZA 5E8AA 5JI7A 2N7GA 4RQPC 2JKBA 1H1IA 1BCXA 3M70A 3ZFEB 1YHFA 1NCQC 5HI0A 1LR5A 4E4ZA 3N3HA 3WP5A 4YW4A 2GMEA 1RJ7A 4LO7A 3WCSA 1EV11 4NWWA 5K0UB 1IHMA 4TZDA 1YFXA 4P9XA 4XFGA 4PJYA 1GQGA 1LULA 3AKQA 4LE3A 5JIAA 2XLGA 4DY5A 3H1YA 4C1WA 2HEWF 2XG3A 4KH9A 1XQNA 4JDOA 3BOPA 3VLBB 5LK5A 1UX6A 2MNGA 3E97A 2NMOA 4UW6A 1GLHA 4XF1A 4JQRA 1YCIA 1BEV3 4XFBA 4HL0A 4Z07A 2VUJA 3ZFGC 2PHDA 2TNFA 4CP0A 2CGOA 4XF3A 1LOAA 4AI2A 4J1XA 4IV3B 1KFUL 3P3PA 4X6QB 1NY71 3SISA 2A70A 4EN7B 5T55A 2E6VA 4RHV1 3BTAA 4XMAA 5KHKA 1YIPA 1UL9A 3TNPB 4COYA 1LHUA 1AR71 1QJX3 1VBA2 4FTBA 4IERA 4AW7A 4K7JA 3D0JA 3VBOC 1NA1A 5GZGA 4HPKA 1H8TB 4E9KA 5CAZA 5KXDA 3WINE 1RVF3 2BVVA 3WQ1A 3H7YA 1G9AA 3R4UA 4Q0SA 2ERFA 3V0AB 1OOPA 3JZVA 5C4WB 4IEPA 4AQTA 1COV2 4MGYE 3ZSKA 2OPKA 3SNMA 3VDDA 1T6GC 1MZFA 5FPXA 1LOCA 1DBNA 2ZAHA 4YG6A 5JLVA 2JG8C 1R1A1 4IEXA 5ACA3 5KWRA 2R1DA 1OMIA 4TWTA 3HMYA 3OJBA 1YO8A 1ZZ8A 3KD4A 5KC6A 2R073 1ZRFA 3MI8A 1RMU1 4LULA 2NZ9A 1FMD1 1C5IA 4IQPA 5BNQA 1AYM3 3KGZA 2VQ0A 4XDQA 4GALA 1WD4A 2WS92 2XPJA 1S0BA 2WA3A 1OA3A 2RJLA 4RQPB 5E16A 3WV6A 4AEDC 2ATFA 2PAMA 5A3LA 2R043 4YZ1A 5ABJC 1NCQB 2ZGRA 3QH7A 3WP4A 1ULGA 3IM0A 4F83A 3SCFA 2XH6A 3M4FA 1AL21 1QJY2 3JBG1 5JDBA 4E2SA 3SMHA 1K5MC 2PA7A 3AMQA 3LWCA 4HZFA 2ZGQA 2CGNA 1LOGA 4K8FA 5JSOA 2RS12 1CESA 4CP1A 3BIWE 2NP0A 4QPGC 5L73A 1FI2A 2QVSB 5LRRA 1PVC3 2AZ5A 2R30A 3OCPA 2YPJA 3ZFGB 4MVTA 1MVEA 1RIRA 3M3EA 5FO9B 3ZYIB 4LUMA 4JV4A 4PF5A 1HQLA 4AI8A 1QGLA 1MEC1 5EYXA 2PLV1 1NE6A 1VBD2 3O0VA 5FLIA 1SEFA 3VZMA 4CRQA 1DQ1A 1QJU1 1AX2A 2PHXA 4AVBA 4JGYC 1QQP2 4FOQA 3SH5A 1YRZA 5GM0A 2WNUA 3KB5A 3ROUA 5F6KA 5BNPA 1V70A 1WCDJ 2PAEA 2FZ2A 5L19A 3VBOB 1I1EA 1IZ3A 4BHPA 4S2GA 1G7YA 3ILRA 2GNMA 3I4IA 4XJ9A 1COV3 2IXCA 1AUYA 1OLQA 1W6OA 3USSA 4M0NA 1JUHA 3CLPA 3DL3A 4FPJA 4Y26A 3J8F3 4GH4C 4RS5A 3NKGA 3USUB 2OUHA 3THPA 5I8TA 1CAXA 2QJVA 4K20A 4QPYA 3NAPA 1WGPA 3LSEA 1X33A 3S7IA 1A3KA 1HLCA 3HT2A 4RR3A 2FMYA 3MIBA 1CAUB 2VULA 2JG8B 1POV0 3ENRA 3MIHA 1V9U2 4TLFA 1XU2A 4DNYA 2EF6A 5BY5A 1VBC3 1AZDA 1UPIA 3J26N 5GJ6A 4I0WB 1OA4A 2A6YA 3RYKA 1LOFC 1HQWA 1R083 2WS93 1ENQA 2IFWA 5CG8A 4W6YA 3KZ4C 4Q4X2 1A8DA 4YZ4A 1H2LA 1Z78A 3W59A 2DTWA 3ALQA 4HBNA 3VKLA 4MXWA 5GZEA 1H2NA 1OPOA 3ECQA 4FPYA 3GHMA 4GKYA 5T52A 4LNVA 1QHDA 1BEV1 4GMP0 4AEDB 4BM8A 4CDXA 2NQYA 3O0WA 3HIFA 5ABJB 4FPCA 4PLOA 5A33A 2W39A 1XE7A 2O0OA 4MZUA 4WM8C 1FATA 1PIV3 4LR4A 4GWNA 2ZHKA 2E7AA 2HWC2 2JJ6A 2RS33 2D44A 1K5MB 3NWKA 4LHNA 1PHMA 4YGEA 2VH9A 1QJX1 3V56A 4JRLA 1BBT3 3ILNA 2WT0A 4DB5A 4XMIA 5E89A 4FT8A 4HLTA 1APNA 3KM5A 4QPGB 1ZBE3 1OFNA 2CV6A 2GMMA 3AZYA 3J9SA 4X6RB 2P34A 1RVF1 3BALA 2YGMA 3ZYPA 4AEJA 1AR93 3MFCA 3KT4A 4HMZA 2B46X 2PYTA 2JXAA 4G4FA 2LALA 3KCXA 2QCSB 2HEYF 4JGYB 3ASIA 1CGPA 3T1LA 3WXPA 1U5YA 2YHJA 1GZWB 2D6MA 1N3QA 3AYEA 3ETQA 4ASLA 1LENA 4MLOA 5ACA1 1ZRRA 4QPIA 1RUOA 4FPOB 1PNGA 4UBHA 2XLFA 1SCSA 3JQWA 3EBRA 2R071 2JD4A 3M3OA 1WLTA 5DZEA 3C3VA 4HVOA 1FXZA 4BOWA 2QUOA 2OA2A 1MZ5A 1NCRA 1PK6C 1RUJ2 1WCSA 2XJUA 2I2SA 1PGW2 4U36A 1IPJA 2ZGOA 1S0EA 4BYYA 4JC1A 1O4TA 4HT1T 3AYCA 4COWA 3AMPA 4DINB 1FOD2 2YZ4A 4RFT0 3OPZA 2XB6C 2R041 4FTEA 2NMNA 4Q4X3 3D5OA 1CIWA 2WNEA 3CJIC 4CDWC 2YV8A 1QXRA 5BPXA 3PLQA 3W9AA 3CL1A 4I30A 2DV9A 4JTOA 2ZHMA 1AR82 1UD1A 2FZ1A 1OLRA 2PHLA 3ZYGA 1SFYA 2EVXA 3B94A 4YM2A 5CNAA 4O9GA 4WM7C 1PO22 3NL1A 1RUC2 2O8OA 2EAKA 4I3PA 2VVDA 1PVC1 2BNNA 3ATGA 2VNOA 1OD5A 2RS52 2RR12 2WZR2 4EWDA 1DLLA 2HWC3 1FPN2 5BNNC 1REEA 2DVAA 1C5HA 4WM8B 3TYJA 1ZRDA 3FHIB 2F4PA 1RUG3 1VB4A 4FPLA 1HRI3 4OHVA 4LBQA 5DUWA 2XWJB 4HSLA 5HCBA 3GBWA 3VL9A 4LUKA 4N43C 3WQ0A 3KT1A 3ZO0B 3FBYA 4N9HA 1I9RA 2K0GA 4YFZA 5I0UA 3CNAA 2P3JA 4IEQA 5EXOA 4AVTA 2R49A 2WNVC 4E2GA 3NV4A 5C9AA 3B02A 2EALA 4YZ3A 3FLPA 1S1AA 1LOBA 3VBSA 1COV1 5J96B 1H1MA 1RUE3 2ILMA 3MFAA 2UY9A 4XPVA 1WMDA 3SXWA 5FLHA 3AX4A 4WBBA 3J8F1 3MPPG 3I59B 3WG4A 1LB2A 4WVMB 1GANA 2XHKA 4LEJA 3ZXGA 3H9AA 3SITA 3HN1A 4XTMA 4DOUA 1PGL2 4TYSA 4ATEA 3VUOA 3ZX7A 3ZXEA 1CAWA 1ZZ9A 5JR7B 1C4RA 1KDMA 4OI0A 2SLIA 5DUUA 3JQXA 1GICA 3RMXA 3TAYA 3H1MA 2VVEA 1ULFA 5IUQA 1JHNA 1RUJ3 4DPNA 3GBFA 1LECA 1TME3 5JIUA 3H7JA 1GYKA 1CPNA 4Y1YA 1Y43B 4PIXA 1H9WA 4Z1VA 1R081 1PZ8A 2WS91 5FQ0A 5JZGA 4R9AA 1PK6B 3FBMA 1UMZA 4AQ2A 1WA4A 3LSDA 4HSJA 1OQ1A 4IXLA 4BZ4A 4COVA 3U0ZA 4CYDA 1UAIA 1MS8A 3WG3A 1C1LA 4IESA 1VBB2 4KBBA 1SLAA 5A32B 3ZFFA 4B4RA 1PM7A 4IL7A 2YUEA 3D82A 3OGGA 5GLZA 1ULCA 1NZCA 4W65A 5FREA 4Y20B 4YNIA 4I3GA 4MGZE 4LA3A 4A7ZA 2K2SA 1H2MA 1PIV1 4N53C 2DUOA 3CJIB 4CDWB 3D4KA 3VBFA 3AM2A 2D93A 5JOXA 4W6WA 4RGGA 2WKKA 1RUF2 2R0HA 2RS31 4AHYA 4YYOA 2R1BA 2RR13 5FMOL 1BBT1 4FCAA 2JDZA 4NWVA 1IS6A 5T5OA 3FUQA 1FPN3 1F5FA 4IEYA 3ZN6A 3S30A 4WM7B 4EN0A 1ZBE1 4YG3A 1X36A 2TBVA 5E1RA 3WT3A 5JPMB 1X7NA 1W6NB 3G7DA 2X5IC 1NQJA 1NXMA 5BNOA 5CFDC 4URTA 5BNNB 3VBRC 3N35A 4Q1PA 1MS4A 2R6QA 1EPWA 5FFOC 2RJKA 1VR3A 3I2DA 4LBLA 4RL7A 3UL2A 4AVCA 1AR62 4CDQA 3WY6A 3ZMOA 1S0IA 4N43B 1RUI3 1W6QB 3CF6E 5CFCC 5K9YA 2XUMA 4F3JA 1AHSA 1ND2A 4SLIA 2CWMA 1RL3A 1XYPA 2WNVB 2VW0A 4K1YA 4J6GA 5J98B 1C8M2 1YI7A 2IWGB 1POV3 2H6CA 2F6BA 2WSVA 1Y3TA 5T50A 2GNDA 3ZXLA 5IT6A 4DQAA 1S0JA 1H1AA 2CWSA 3S6PA 4HN1A 1SMVA 2ARXA 4XOGA 3OBTA 5JCTA 3WNXA 3B01A 1Q8VA 4BIFA 2CY6A 3UKVA 4AHWA 1NYWA 2WFF2 4NVPA 3SHRA 4EWAA 1JXNA 1CJDA 2EXJA 4WVZA 4Q4X1 4JCKA 4YVSA 2WINB 2ZX2A 3E5UA 2Q5TA 1HV0A 1SBDA 2XJQA 4YFWA 1HXS2 3KS7A 5BV6A 2D43A 4Q4V3 3WVJA 4PDWC 2IXJA 5SV5A 3VBUC 4FP3A 2FHRA 5FCCA 3GYDA 2HWB3 2LUWA 1JUIA 1EAH2 3WUDA 1DZQA 3S0MA 2QDRA 1KFXL 1X8EA 4L9BA 5H9SA 1KS5A 1XNBA 2HWC1 4XFAA 2O8QA 1GBGA 2BYVE 3FMGA 3KT7A 4N53B 1Z7S2 3NW4A 1F9KA 1RUG1 3WP6A 1D4M2 1HRI1 4OVEA 3PVOA 4GA9A 5AFEA 3JD72 4M3CF 1LGCA 2IC1A 1H8TA 1AX1A 2NYYA 3AKRA 4AHZA 1VRH2 4Q27A 1VBE2 1SLBA 4YGDA 1RITA 3ZYRA 5AC92 2XL7A 4YW5A 4AFMA 3V0AA 5IK4A 1HW5A 5F1RA 5T5PA 4PBPA 3ZVXA 2X5IB 4K6BA 2FMDA 4RA0A 2GN3A 3POWA 4AQ6A 5CFDB 3DPRC 1Q3EA 1RUE1 1AR63 1SLCA 2VUAA 3FLRA 3O14A 4N9IA 1C3HA 3VBRB 4MSVA 3ZN4A 1S55A 4LBOA 4P5HA 4GQ7A 3R4DB 1QDOA 2I74A 1TNRA 4AXOA 4FBFA 5J3UA 4XEZA 4JAAA 4CEWA 4U2AA 4LO4B 3LB9A 1YNAA 2ZZJA 1JH5A 4UW5A 4AEKA 1C28A 1PZ9A 1S2BA 2VOKA 1C8M3 1XNDA 5CFCB 3ZDSA 2B45X 1G8WA 1D0HA 3GHNA 1LESA 1D2SA 4KG0A 2ZMLA 3AKSA 1SBFA 1RUJ1 4YW1A 5J09A 1LGBA 1TME1 5FO7B 1UZZA 3L2HA 5IK8A 3HT1A 4Q0PA 5IK5A 3NV2A 1QH7A 1AYN2 4NO4A 1X82A 3WP3A 3H8UA 1JW6A 4FPHA 2WFF3 4LHLA 3D0SA 1DZRA 1OI6A 4ISQA 4YW3A 5H9PA 4JGZA 4BMEA 4DRVA 3INAA 4EROA 1MVQA 1ZRCA 4XF4A 2UURA 4BA6A 3L2YA 3AP6A 5DG2A 4PIYA 2XBO2 3WDXA 1DQ2A 1N1TA 4XFIA 4E4SA 1U0AA 4FOYA 4XQDA 4Y1UA 2ZJCA 1AXYA 1IGOA 4KWKA 1DGRA 1OOPC 4BE3A 3M8LA 3B00A 2D97A 4MX3A 3OY8B 1YIFA 2BNMA 4PDWB 3VBUB 4R9CA 3VN4A 3ZSMA 1QDCA 3ZFGA 2GC0A 3VDDC 1ULEA 2RR11 1FPN1 5FMOS 4QQOA 2C1FA 1W6PB 5CIRA 1AJOA 4RGAA 1Z7S3 4EWEA 2JE7A 2ZX3A 1HDKA 2VU9A 4R9DA 3T2TA 4XE9A 2D6OX 3EHKA 2BVBA 3RRDA 3UKNA 4OHZA 2QNKA 2V5YA 4XJWA 1DGLA 5KXEA 1GKBA 2HWD3 2VW1A 2QKDA 1TQ5A 1VRH3 5CG9A 2AGSA 1EP0A 4QU2A 1G9CA 3R0RA 1TEIA 2HYKA 1R092 2EXHA 2B7YA 2GAUA 3E5QA 3ZPYA 3RNSA 2Q8OA 1RUI1 4I0AA 1GR3A 1KXGA 3LA2A 5T54A 4G3YC 4LO6B 4M3CB 1IOAA 3MW2A 1BMV1 3OGJA 1ZZ6A 2ZCWA 1GNHA 3QBQA 4Z82A 3QLQA 1LEMA 1BVVA 2GALA 5JPNB 3V0BB 1QY4A 1O5UA 2GNBA 2XJTA 1POV1 1W0PA 2B5HA 1H0BA 2GSYA 2HWF2 2ZGSA 3DPRB 4AI0A 1PGL1 1DGWX 3R05A 2G9GA 4FPEA 4YGCA 4F7ZA 1CVNA 1CAUA 2JG8A 1TMF2 2VVFA 1LJ7A 4Y1VA 3K51A 4XFFA 3AJYA 4QQHA 5C8CA 4OI4A 1H30A 4P9GA 3QACA 3PMSA 4XJ8A 2QZ2A 5F6LB 4AFCA 4OI1A 2ZX0A 4L2NA 2TUNA 2VMHA 3AXDA 4D7TA 3DV8A 4Q0UA 4PLMA 2MEV2 4AI3A 3VHRA 1RGSA 2BGCA 4Q4V1 4IEWA 3VHPA 2D6LX 4ZU7A 3LKJA 3UV9A 1LHOA 4Q8KA 1VBA3 1QWRA 5D1IA 4R8HA 3SH3A 3SLIA 2HWB1 1BQPA 1KD7A 5BNPC 1CAVB 4G9SB 3HR9A 3FX3A 3NO8A 4CTEA 1ZREA 2VECA 3AYAA 3LA7A 1ZZCA 4DMIA 1AXKA 3LCPA 2ETEA 2YDEA 2ZGUA 2BPA2 5T5LA 2EXIA 1FYUA 1N3OA 4GB32 4RS5C 1OOPB 4QPGA 1A6CA 2MHFA 1CJPA 2D6PA 3I54A 2W0XA 3NAPC 2NLRA 2ET7A 3KMHA 4UBGA 3OYWA 3SCGA 3VDDB 4RR3C 1W6MB 3ZXKA 5T3NA 4QHBA 2D5HA 1ZBA2 1N1SA 2H0VA 4I0BA 1LCLA 2JG9A 2ZMKA 4S2FA 3VBHA 2ZS6B 2ZHNA 4WVWA 4CP2A 1LGNA 3UK9A 3BB6A 4JGYA 4YVWC 3AZVA 1E57A 1AR61 4GWMA 1ND3C 1PO12 3GZTB 1GZWA 1R093 2YYOA 5L7OA 2VMGA 1V6LA 3ES4A 4X8PA 5H9RA 2QFEA 3VZLA 3IBMA 3V64A 1C57A 3PVEA 1LHNA 1S0GA 3AB0A 2GH2A 5CU1A 2NN8A 2DVDA 2OZJA 3LOIA 4XJZA 4LBMA 1NLRA 4Y4YA 4YZ5A 3RJRA 1C8M1 1QMJA 4ZU5A 2HWF3 3AKPA 1MQTA 4BWOA 4PBOA 2HKXA 5JI9A 5CA6A 3VGIA 3WHTA 1VAVA 3A4UA 2Q0AA 3CJXA 2DCJA 4A2UA 1TMF3 4HKOA 1MS3A 1ZNPA 3QOPA 3ZSEA 1G9FA 3ZSJA 1LU2A 2WFF1 4B7KA 1QJY3 3N4MA 4OFGA 2DTYA 4B29A 1UN1A 5FOJB 5JAXA 2DUQA 3MEPA 4L8QA 4AGGA 2RS13 3WW4A 3AFGA 1LOFA 2GZWA 3MW3A 5JSRA 2MEV3 3KQRA 1OQDA 1HRV2 3PVNA 4A7KA 1VLNA 4OHXA 3PNAA 4AGRA 2A7AA 1WLWA 4Q0VA 4OLLA 3RQ0A 1VBD3 2W52A 5I91A 1DGRN 1F2NA 1UF2C 1ONAA 1YUDA 2UY8A 5BXXA 2WZPP 3IDCB 2CNAA 1LODA 1QQP3 4QQPA 4WM8A 3Q9OA 2YXSA 1YLLA 1S0FA 5BNPB 4HKLA 4NOTA 1LHWA 2GN7A 1Z7S1 3WDTA 1YJKA 2UYAA 5FAXA 4NHLA 2ZKNA 4XYXA 2ET1A 1H2KA 1MR5A 3POSA 1DF0A 1W6OB 4AVAA 2HWD1 2D98A 3VZNA 1VRH1 5B2GB 4RS5B 2HWE2 4H7MA 3TNQA 2PHTA 4AVSA 5J48A 1ZBA3 1CAXB 2E63A 5BYNA 5AFBA 1WW4A 3NAPB 4QD2A 4QQ2A 1PMIA 4RR3B 3WG1A 2A3XA 2IXKA 3OF1A 1DDLA 1XU1A 4GH4B 4LHKA 5SV8A 1DQ6A 4FO9A 3FFQA 1FX5A 4IEOA 2PHWA 1V9U3 4WVMA 2GDFA 2WC2A 4OHWA 1EV12 4H14A 5JOWA 3AJZA 3T1MA 4YVWB 4HN0A 1ND3B 1NQDA 3VKNA 2D5FA 3O0XA 3SH4A 1W0OA 4R4ZA 3B93A 3WW1A 2D3PA 2JX9A 1LKNA 2CL2A 4KU7A 4AHXA 3H1WA 1UU6A 1UU4A 2XVGA 2ZX1A 1Q56A 2ZGPA 4EJRA 5KXBA 1QXPA 1PK6A 3POYA 1DGWA 3IIAA 2WL1A 4L99A 3AP9A 2PTMA 1FNYA 4N90A 1FV2A 1NY72 4HETA 5D8AC 1R1ZA 5JWPA 3PTYA 2P2KA 3ZIWA 3JU9A 4RHV2 3IWZA 4P9JA 3N7JA 5A32A 4FXGB 1WUVA 5CBLA 1AR72 3CU7A 3FC0A 3KSCA 4ISRA 4Y20A 1VBA1 4LO8A 2Y26A 4KL1A 5J36A 1KQRA 1IKPA 3CJIA 4CDWA 4FSJA 3U07A 3NJZA 1URXA 2XKPA 4Q29A 1UW8A 2OZ6A 3KCYA 4I09A 5EWSA 4S2DA 3B5LB 1KJRA 2B9UA 3WG2A 1RUNA 1Z0HA 4FXKB 2IFRA 3E6DA 1M4WA 1UKRA 1SLTA 2XLAA 1X50A 1YJLA 2B39A 3KCCA 5BNNA 4AFBA 1HX6A 1R1A2 4JRAA 1SFNA 3WDWA 3IT8A 4FQZA 1QNWA 4E4DX