5F6KA

Crystal structure of the mll3-ash2l-rbbp5 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
182
structure length
176
Chain Sequence
RVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDSSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/protein binding
molecule keywords Set1/Ash2 histone methyltransferase complex subunit ASH2,Set
publication title Structural basis for activity regulation of MLL family methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 176
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5f6kA00
5JIUA 2E63A 2FBEA 3UV9A 4X8PA 5JI7A 4B3NA 4P9LA 4B8EA 5F6LB 4QT6A 4KG0A 2LM3A 4N7UA 2IWGB 2VOKA 3KB5A 5F6KA 5JIAA 3TOJA 5C33A 2YUEA 4WVMB 4WVMA 4N7IA 4P9JA 5JI9A 3ZO0B 4XW3A 4P9IA 4X8NA 4V1PA 2WL1A 2YYOA
chains in the Genus database with same CATH superfamily
3WDYA 1NT0A 4XF9A 4XUOA 5IW0A 3V65A 4QX8A 4AWDA 1Q8PA 2WZEA 5JI7A 1VJ2A 2D6LX 4CDXC 1VPHA 2UURA 2WA3A 1C28A 5ANNA 1HN0A 3T4HB 2E9QA 4OHZA 2VD7A 1C8M2 2K0GA 2VULA 3IPVB 2PHLA 4HPKB 4IE4A 1PK6C 1RHI3 1SHWB 1XJAA 5A7OA 1VBE2 2LROA 4FXKB 4H14A 2WO1A 1N1TA 5CFDC 1YQ2A 3GXUA 1KXGA 1W39A 4L0PA 5A3WA 4Z1VA 1KDKA 2AYHA 2YFZA 1EV13 1W9FA 3WF3A 4H7LA 4XXAA 3BI3A 2FDGA 4DRVA 3EXUA 3T2QA 4PDWC 1QGLA 1LU2A 2W94A 4XDPA 5JCTA 2Q1FA 3HPNA 1RMU3 3ZXAC 5JIUA 4NJ4A 2D6MA 1PMJX 4K6BA 1F35A 1XNAA 4XQ4A 3RWNA 3MHZA 4XFHA 3PJQA 5DUWA 4Q0SA 5DZGA 4B3NA 4TTGA 4NE9A 2VTFA 5AVAA 2FHRA 5EV7A 2Y38A 3AKSA 1LHOA 3W20A 3OBZA 2W3JA 1EUTA 1T6GC 2RDQA 4LHSA 4XE9A 1DGRA 3DL3A 3SEEA 3EB7A 2BEOA 4MGIE 1R1ZA 4I0BA 1US3A 4UT5A 1COV2 4Q0QA 5FLIA 3TAYA 4M0HA 3VUOA 3OEAA 2B5HA 5A7SA 2VL4A 2ZGNA 5FP8A 3AB0A 1RB8G 4FSJA 1BMV1 1DP0A 1ZZ7A 1GP4A 3B93A 4CEYC 4LQRA 1W6PA 5EHDA 3MF9A 4N90A 2VW0A 2VZSA 3WW4A 1HB1A 1ZM1A 1HN1A 2PAKA 2WT1A 1NZIA 1ZBA3 2GMMA 4YM0A 1O3TA 1BJQA 1HQWA 4MXWA 1W0NA 3SITA 3ZYFA 5J96B 1GMMA 1ULCA 3ALQA 4CDUB 1SLIA 4N53B 3WG1A 1RYYA 4NRPA 3F2ZA 1UYXA 5J7MA 3TEYA 2X53S 1VE0A 3PUIA 1JODA 2ZBJA 5CZKA 3JBG1 3OUIA 2EA7A 1ZREA 4P9GA 1HRV3 1O8PA 1EP0A 3OPTA 4QQPA 2GNDA 2VZPA 3HIFA 4QX1A 4JGZB 4FBFA 1LGNA 5C8CA 2L9LA 3PHMA 5L9VA 1AR92 4B8EA 2R7EB 3C8XA 4KWKA 1BBT1 4UBHA 1XNTA 1UYPA 4W6XA 3GYDA 1RUD1 3DXUA 1RJ7A 5EJZB 1TNFA 2UWBA 3IDBB 3O1UA 3QOPA 4Y3OA 3O7OA 4CEWA 2Q8OA 1ZRIA 4AI8A 2HJIA 5FO8B 2X5IA 1AYN2 3I59A 3NV4A 1XBFA 4K21A 3JQWA 1ZZ8A 1K3IA 2VZQA 1XYOA 3AP6A 1AR61 4W50A 5FPAA 4B7KA 5I91A 4ZS2A 3I2GA 1CX4A 3LFMA 4EJRA 1QOSA 3JD72 3VBOB 2P17A 4I3GA 2VZRA 5DQ0A 3HBZA 1UYZA 3L9JT 4YW4A 4ASLA 5FIXA 4Z2AA 1F5JA 3BGAA 4KU7A 3UKTA 4R9AA 4PF1A 5FPLA 3ZKYA 1MVQA 3SMHA 4IDZA 3H8XA 2MHFA 5H9PA 2JE7A 3I2JA 4YZ4A 4WM8B 4DPNA 1W2NA 2VGDA 4L92A 3WW2A 3B94A 3CL1A 2UYAA 1MS3A 4YVSC 1UQXA 4N43C 1OA4A 4XFBA 5HBAA 2G9ZA 3HBKA 5GKAC 4LBLA 2XJRA 3KV5A 4RHV3 4YW6A 5FP3A 3ZFGC 1G8WA 4RR3C 2OVUA 1O6UA 2QQPA 4D0QA 2FDJA 4LE3A 1VAKA 2DUQA 5JZGA 1UPIA 2WQZC 2BOIA 4GULA 4BA6A 5IYYA 5CVRA 1OC1A 1PVC3 4PLNA 1JZ2A 4MGTA 1BEV2 2VVEA 1F31A 2DBIA 1QNWA 1M4WA 4IV3C 2SLIA 1WWYA 4HBNA 2VUDA 4MGSA 4RA0A 2ZCWA 3PL0A 5I8YA 3KS7A 2WBKA 1JS9A 4RQPA 4MH0E 4QDQA 2PAMA 3KF5A 2ZZQA 2AC1A 3H0OA 1ACCA 1HXS3 1YRZA 2IZWA 1JZ7A 3SH4A 1CAXB 1UIKA 3FHIB 4XIKA 4P5YA 1V6LA 2HWB1 3DYMA 2PMWB 5F1RA 1AL22 4CCOA 4PI2A 3VL9A 4RFRB 3ZOIA 3IKWA 4DFSA 4UFKA 1R081 1UOBA 1EAH1 4FTSA 5C3OA 1X82A 2FZ1A 1PZ9A 3JXSA 3NNGA 4FVVA 4JQRA 5JSPA 3ZFEC 1RIRA 3B01A 1R093 4XZUG 3RZKA 2ATFA 1J83A 2JEMA 2RS51 1RUF1 2DVBA 4FPLA 1SBDA 4NO4A 4RSUA 3O14A 5FZLA 2ZEZA 3MPPG 1K45A 3WG2A 1UOFA 4A7YA 1OLME 4DRRA 3ZYBA 4D7TA 2QQIA 1B35A 4AFMA 1DQ4A 5FZ6A 4AVVA 5FZ9A 4KL1A 3MDPA 4G9SB 3IN9A 4JDNA 4QXCA 1AHSA 5FY5A 1VBA1 1XXNA 4HL0A 4AQSA 5K7PA 4YVWA 3VZMA 3JUUA 1TVGA 3LD8A 2BBVA 2Q30A 3E6BA 4QKNA 1OLMA 4P9LA 1ZRCA 5F6LB 4MGZE 5FP4A 4BQ1A 3V0BA 2VOKA 3NNLA 3PVBB 2RS32 4A6OA 1UIJA 5JPMB 2VC9A 3GZTB 4ZZ8A 3MI8A 2UWAA 4LHKA 1PGW1 2JG8C 5D8AA 2JDUA 2VH9A 4YZ5A 4LMFA 1OMIA 2RMU1 1AL0G 3ACFA 1TME2 3V64A 1W9SA 2CGPA 3A22A 2ORXA 4ISRA 4RFT0 1WA4A 1YQ5A 1VBB2 2AGSA 3DYPA 1VBD1 4UXAA 4COYA 1O4TA 4AQ6A 4DY5A 4DB5A 5K8SA 5BY5A 3SCHA 1W6PB 1W8ZA 5FPVA 4E4HA 3KV9A 2QQOA 1GP6A 2BERA 1RUH3 4FQZA 4Y26A 5C3PA 3H9AA 3WP6A 3VDCA 4QQOA 3VKMA 1H30A 2VZ3A 4OI0A 5FFOC 2GDFA 2A3YA 4MXWB 1YI7A 3UYJA 5A1LA 3VD9A 1PO13 4ZZ5A 3SXWA 2VZ1A 1X9PA 2Z42A 4BMEA 4Y22A 5FZ3A 4WM7A 2TNFA 1RJ8A 1YEWA 5EFUA 2LUWA 3POBA 2YC0A 1NQJA 4LK6A 4MUVA 4Q29A 1C1FA 3J8F3 1PO23 1W6MA 4YG3A 3AL6A 2VBBA 2HWC1 4AEDA 3MIHA 5C8CB 2Y60A 3LFIA 3KCXA 4LKDA 3UV9A 2XR4A 3POWA 5H9QA 2BFUS 3D3AA 3M7AA 3MW2A 5FJHA 3VD3A 2BWCA 2EF6A 4YZ3A 4NHMA 5C3RA 2R6QA 3R4SA 4LJHA 4AAPA 5FZ8A 5JIAA 3A0NA 3ZKUA 2ARBA 2VNOA 5A32A 4IGPA 5DN2A 2R063 4CEWB 2GNTA 1OOPA 5FZGA 2JDMA 5C4WA 1JW6A 2X5IB 1NCQC 3I59B 4R8HA 4BQXA 4CDQA 2A6VA 2N7GA 5GZGA 1XU1A 3VDBA 2XHKA 2ZGTA 1XNDA 2G19A 5FPZA 1PHMA 4AVSA 5EJ1B 5K0UA 3TB0A 2HWE1 5DAWA 3KHCA 1I5PA 3USUA 4QX0A 4CP1A 4LNVA 3T30A 4CCNA 2ZHMA 2MEV2 3T1LA 4EE2A 1W06A 1KFXL 5HCAA 1DLLA 1UNBA 4AI3A 5HV0A 3NV1A 1L3JA 3AP5A 1IPKA 1H2NA 1RUE2 3IWZA 1UMHA 1GOHA 4LT5A 2I2SA 3GZAA 4A4AA 3AMHA 2OQ7A 2PLV1 3IB3A 3DKWA 2E51A 5D21A 4P9JA 4Q26A 1X8EA 2IXJA 2LALA 2Y6GA 1PGSA 1MZ6A 3AYAA 5DDJ1 4LBQD 5LK7B 4QGMA 1C8M3 1QJY1 4CCJA 4BZ4A 4V2VA 1JYWA 5GZFA 5GZEA 1W8TA 4Y5Z0 4WVVA 2WNUC 1VBE3 4GB31 3ILFA 4Q4V1 2VAUA 3GGLA 3LQCA 1RHI2 4FXGB 4LULA 5C3SA 5JZGB 4GXLA 2OT7A 3W58A 2B46X 4LK7A 4Z92B 1DLCA 2LRPA 2P6CA 5FZIA 4NIDA 1RUJ1 4CCCA 3DF0A 4HKLA 1QJFA 4LUMA 4RQPB 5H9SA 1EV12 2CL2A 3E97A 3N9NA 2PELA 2JD4A 1VLNA 4M0NA 4BQ5A 1W3VA 4H55A 5DAVA 2WWUA 4XFCA 3WW3A 2Y0IA 1RMU2 1B09A 1GSLA 1LHUA 4ATEA 4AF9A 5FQ0A 3ZVXA 1ASJ3 3NSTA 1Y7BA 1XOYA 4YM1A 5HXVA 2H6CA 1ENRA 4QX3A 4PLMA 3V0AA 3VZLA 3H3LA 2RG4A 1AR72 2B8MA 1OVSA 1QQP1 3WF1A 3FBYA 4QD2A 3HWJA 2BRTA 3THPA 5A7WA 3BPSA 3WF2A 2D5HA 4FP2A 3POGA 4OI2A 5KHGA 4P9YA 2EAAA 1CJDA 1UW8A 1OPOA 3APBA 5FLHA 2IVIB 3RMYA 3UGHA 1GZWA 3VHRA 1B35B 1Q43A 1W6NA 1RUC3 4XF0A 2VM9A 5LA0A 1QHDA 3PMSA 5JR2A 3T09A 3LEKA 5FCCA 1Y4WA 2OA2A 3CO2A 4QM9A 3WV6A 2WWJA 4L8QA 3LA3A 1OI6A 2BOJA 2BPA2 3BB6A 1RINA 4XTMA 1AR83 1IZ3A 4YVWB 4CUBA 4H7MA 3NKTA 1G7YA 4AVBA 1FV2A 1OT5A 1NUKA 4O7XA 5E89A 2R1BA 4BQ3A 5JSRA 3AXEA 3V0BB 4XABA 5DUVA 5F8PA 3S30A 1S2BA 4Q4Y2 3A23A 2MPFA 5D8AB 5C33A 5BNOA 1HRV2 2UU8A 3ZN6A 4YG6A 3NNFA 4Y1VA 3DYOA 1OQDA 1AR93 3UJOA 2ARAA 5F7UA 3EQEA 3RI8A 1UYYA 3U0ZA 1JU3A 2VZOA 3ZM8A 1LAJA 2VECA 2ZGUA 1GR3A 4S2DA 1COV1 3KCCA 2XWJB 3TN92 1QEXA 5BUVA 3AMPA 1BLZA 3POSA 4CU8A 5F3IA 4KWLA 1AYN3 1OKQA 4QPIA 4LO8A 2ETEA 5T50A 3W9AA 1OLRA 4MHRA 1WCSA 4OYUA 3U1XA 1EPWA 3C3VA 4EZ4A 2XBO2 3I3EA 3WG4A 2ZABA 4JRAA 3LAGA 5K9YA 3N7KA 5T5JA 3JD73 4NIIA 3NNJA 4Y22B 4WM7B 2J7MA 1ULOA 5A6XA 4CCEA 3WUCA 1TMF3 3WHUA 2GMPA 2ZEYA 1W0PA 4GAZA 3ZX7A 2GC1A 2RM23 5FYUA 3Q8FA 1HJFA 2WZ8A 5GLUA 1ENXA 2WNVB 1W6MB 4LBOA 5FZKA 4AEDB 1ZZ9A 2O14A 4P00B 1UZ0A 2GH2A 2VPVA 3D0JA 3VBSA 2SBAA 1VBC3 5KBFA 5BXXA 4Y33A 3I7DA 1S2KA 1DYOA 1H6YA 1HV0A 5E88A 2KR2A 4U36A 1S0JA 2OX0A 4Q0PA 4RHV2 3FWEA 1KS5A 4PBOA 4S2GA 1BYHA 1QNYA 5A32B 1IQDC 3IDEA 1LEDA 2RR13 4FPGA 4B4RA 4FQ4A 2EIDA 1IG3A 1OOPB 3VKOA 5C4WB 2HWD1 4CDQB 1LENA 2NPIA 3B02A 3I2HA 3OUJA 5CFCA 4UFIA 4BOWA 4GMP1 5L19A 3J9SA 5E16A 3NJVA 1F8VA 5K4LA 4FPJA 4D3WA 5K0UB 4B1LA 5C9AC 1CPNA 4ARYA 2W1UA 3H7JA 3USUB 4EN0A 2P34A 3B00A 2Y6FA 2GMEA 5FPXA 2VBPA 2TEPA 1HXS2 5DXDA 4D6QA 1LOFC 1AL23 2FCUA 1PIV2 3N9OA 5FTTC 2VNRA 3VKFC 2GC2A 4JRLA 3ZYRA 3CKHA 3ORJA 4A7KA 1PM7A 1JN2P 2JIGA 1LODA 2WA4A 5ANQA 3RSJA 4G4FA 3PUAA 3R4UA 1FPN2 3AZYA 1RUI3 4PQQA 1UO9A 5IHRA 2ZS6B 3R0RA 2IXCA 5FUIA 4YVSA 4DS0A 1W03A 4DUVA 1JZ4A 3MW3A 5A1AA 4JDOA 1AJKA 1H8TC 2VQTA 5BNPC 1IS6A 3VHNA 1S0BA 3P6BA 2W1WA 4WVWA 4LBKA 1MPXA 4CUGA 1NXMA 4IEOA 4C0HA 5L73A 2P3YA 3WY6A 3OOXA 5IAVA 3T3YA 2RV9A 1SCSA 1SFPA 5I0SA 3NJXA 3W5MA 2F4LA 1A6CA 1H8VA 1J1TA 3V56A 5KHKA 1X33A 4CP2A 1GNYA 1AYM3 1SCRA 5DUXA 1HJGA 2BP6A 2ORZA 4YGBA 1BEV1 5FQ0B 5A6YA 3HQXA 3ACLA 2ZTNA 1YI9A 2RS33 2W39A 1E5IA 4QKFA 5FK7A 5SV5A 1LB2A 3KQ4B 3N9MA 1GKBA 2XONA 3V0AB 2RVAA 1Z0HA 2WFF1 1W99A 4XDQA 5FXWA 1TME3 4S2HA 5F5QA 2UY8A 3O12A 3KM5A 2DFCA 3C7HA 1DG6A 5T54A 1AF9A 5FZAA 5A7WB 4XXPA 3MLKA 1A8MA 4KMQA 1RXGA 3DKQA 5EZWA 5EYYA 4YZ1A 3RZGA 1J3QA 4YW3A 5A33A 1IQAA 5LZ6A 3FUQA 2GZWA 3OPZA 1C5IA 3AC0A 3G7DA 4HN0A 4IW3A 4QU2A 3VBUC 3AYCA 3OD0A 4RS5C 2GP5A 2JB8A 1GZWB 1D0GA 1TQ5A 1MZFA 5I0RA 1ZZ6A 4CPBD 2R073 3BOPA 1W6NB 2AR6A 1RUH2 1QWRA 1ULGA 3M3OA 5FPUA 4UFMA 3BALA 3EO6A 3LB9A 5A7NA 2WZPP 2B45X 2ENRA 4AHZA 3PU3A 3IAQA 1DZQA 4BXFA 2W2IA 2YROA 1PO12 3RZMA 1CX1A 1AX0A 4XTPA 1ULDA 2WDBA 3UGGA 4M4PA 4PT6A 3O1PA 1YQ6A 3C2UA 1NYWA 4KWUA 5HV4A 4LIVA 1C5HA 2VOXA 1ZX5A 3GCWA 3MIDA 1BVVA 4GJZA 4LBNA 3ZDSA 3ZXFA 1PO22 3KV6A 2YG0A 2VE1A 3ZN6B 5BNOB 2E33A 1YHFA 2V5YA 4Z07A 3WP3A 4XF1A 1CN1A 4XF4A 1POV1 1O3SA 1MQTA 2Z4FA 4NOTA 2JICA 5LY1A 1GZ9A 2D3PA 3H1YA 4JAAA 4OLLA 3AXDA 3SC7X 2V4AA 5FY4A 3N7MA 2WQ8A 4Z8BA 2VCAA 4COUA 3NO8A 3OEBA 2YPDA 5G04L 1CJPA 1OURA 1LOBA 4YGEA 1OD5A 4GD4A 4JGYA 4YWAA 3SISA 3PTRB 3ZFFA 4QPIB 4DMIA 2W68A 1PMHX 3OBAA 5H9RA 3HT2A 5IWFA 2R062 4IE7A 3WXPA 2WO2A 1RL3A 2VMHA 1VBB1 3K51A 3ACIA 4QX5A 4ZONA 5T5OA 4BPZA 5JDBA 3BU7A 4NHKA 4OI4A 3WQ1A 4D94A 5IVJA 1VRH1 1W05A 3ETQA 4IEVA 2Y6KA 3THDA 2VMEA 2UY9A 1WLCA 1WLWA 4KQ7A 3RI9A 4BLIA 1GV9A 2QCSB 4KG8A 2Z2SB 1R1A1 3W21A 4I2OA 1NAEA 5A7QA 4NWWA 1RUE3 4LKEA 2VZVA 2Q0AA 5AC92 2JX9A 2YB7A 3JU9A 3RYPA 1JYXA 3POEA 2ARXA 1ND3A 2C0ZA 4EWDA 1JUIA 1UPSA 4XQWA 4FCAA 2OS2A 1FOD3 3DXTA 3FLTA 4GZ9A 1A78A 1O91A 1XYPA 2C5DA 2IC1A 4PCRA 4XURA 5FXVA 5FZHA 3RFRA 1WCDJ 2XKOA 3NV2A 1NA1C 1POV0 4YW2A 2CV6A 1H1MA 5JXJA 3MUY1 2A6ZA 3FHAA 1V6JA 5FZFA 3SNMA 4LEJA 1GOGA 4K8RB 4XFIA 1YJKA 2D6PA 1UMIA 5FXXA 4PIXA 3D5OA 1MZEA 4B7EA 5CFCB 2P37A 2IXHA 1OKOA 4NRQA 2JD9A 3SQOA 4CP9A 1O7FA 5ACA1 4U2AA 4NN0A 2XUMA 3B9CA 3H1MA 3PUSA 3VBHC 5CG8A 1UY3A 1WGPA 3LEGA 2NP0A 1MEC1 2A7AA 5HCBA 2CY6A 1QIQA 3VDDC 2EAKA 4XFGA 1HQLA 4I30A 5KHHA 4IERA 4MG2A 5L7OC 2LM3A 5EPAA 4CCDA 3I54A 3U75A 3GJAA 3ZYGA 1ASJ2 1JH5A 1DGWA 1GP5A 5FPBA 5IVBA 2WRAA 5F5IA 1AR73 2IXKA 3WD5A 4IV1C 1F4AA 2H0BA 1TEIA 5A3NA 2MEV1 2VXJA 5CAZA 1ZNPA 4NR1A 5A6ZA 3CJIC 4YVSB 3SCFA 3ZXLA 1DQ5A 1X8MA 2NLRA 1V6IA 1Y43B 4LPLA 4XJWA 4XFAA 2HH9A 3C7FA 4XDOA 4EV0A 5CKMA 2YBKA 4UAPA 5L36A 3WHTA 5FZDA 2O8OA 4NHYA 4O9EA 1OUSA 1JOJA 1O4ZA 5D2AA 3T08A 4A6SA 4FAHA 4AE2A 5CA6A 3I2FA 5L7OB 2C9AA 1RUC2 5GLWA 3S57A 1LTEA 1BVP1 1XRUA 1WW6A 3KF3A 3AVSA 1V6KA 1U5YA 2V5DA 1RHI1 1KEXA 4ZY9A 4YM3A 1CZVA 1XE0A 2ZAHA 3VL8A 1AR82 4CDWC 3S7EA 3VBFA 4TYSA 3WDWA 3AMQA 2YFUA 5A1FA 4NWVA 3ECQA 4YGCA 1XPWA 1EV11 1YLLA 4Q4Y3 3WG3A 5FMCA 4R9BA 3H8OA 4WZCA 4UW5A 4INDA 4DO0A 1RMU1 2Y33A 2IUWA 2GC3A 5BNNC 4TLFA 4Q2FA 2DF7A 4DXSA 2YU2A 5A33B 1OSGA 2FDFA 1QJZA 3IMNA 4FPCA 1S4CA 5FZEA 1ULEA 3VZNA 3TN93 1WKYA 2FQPA 2OQ6A 1RXFA 1HQNA 3ZLIA 1NCRC 3HD8B 1I5ZA 2WAAA 4D7SA 4QB1A 2DVAA 1BCXA 1UMZA 1LOGA 1NQDA 1GNZA 3ZSKA 5FDBA 2XBO3 1V9U2 5F39A 2WINB 4CRQA 4IL7A 1JXNA 2ZX3A 4JZRA 4K7JA 3I2OA 2YV8A 3I2DA 4R4ZA 2XJPA 1OFNA 4YSFA 1CAVA 1XNKA 1BK0A 1UX7A 1WLTA 5FJKA 2Q8EA 2XUEA 3C7EA 3HN3A 3J7MA 3B69A 4X8PA 4Y24A 3FLRA 1UY4A 3A4UA 2RDNA 4Y5SA 4ATFA 1CAUA 1TMF2 2BW8A 3DPRA 1UCXA 1ZBA1 5A3TA 1OQ1A 5IVVA 5EIYB 3ZXGA 5LCWL 4CE8A 5CYYA 3GALA 5DAQA 2RM22 1HLCA 2OKXA 5CNAA 1WMFA 4LR4A 1C1LA 5FKBA 4P14A 4BXSV 5FYCA 2TUNA 4BHPA 3FX3A 1MQTB 4DY3A 4QHOA 3BCWA 1VBC2 4MV2A 4P9IA 4BMBA 4K20A 4PIYA 1H6XA 5TSWA 1BZWA 1HRV1 3MIGA 5A3OA 4QPGA 4RGGA 3WX5A 2RHPA 2WS93 2DURA 1OQEA 4JGYB 3ZFFB 3IT8A 5IUQA 2RR12 2ZAAA 3SHRA 2R042 1RTVA 1OD3A 1JOBA 2DCJA 1OLQA 2YHJA 2A3WA 5CIRA 3JB8A 3VBRA 2DTYA 4NHLA 4DINB 1MACA 4JHZA 4MOAA 3FBMA 1I1EA 1NOVA 2R0FA 1Q8QA 1NX9A 4Q4X2 4NVPA 4NROA 5F2SA 5LASA 3MLJA 4W6WA 3U37A 1PIV3 1HRI3 3LKJA 4MGKE 4QXBA 3CQOA 3PVOA 4AG4A 4C8DA 2DUPA 3S5QA 4XJ9A 5L9BA 4A2UA 1DCSA 1EUUA 1ND3B 2GN7A 1KS4A 1FPN3 2AENA 4B29A 1HW5A 1LJ7A 4BQ2A 2HEVF 3UKNA 1RUI2 1AZDA 1Q8OA 4UYBA 2YU1A 4CDUC 4FT8A 4PIZA 2P6HA 5B4NA 4N53C 3PVNA 5C5UA 2W08A 1VMJA 2XLAA 2OPWA 2XXZA 2VMIA 5A6QA 2XPJA 1KGYA 4JTOA 2YUEA 3NJZA 4G3YC 4PJYA 2EXHA 3AFGA 1OF4A 3MW4A 4A3ZA 3VDAA 3NAPA 5GLVA 2VMDA 1UZWA 3ZYIB 4A42A 4E8DA 4PQ9A 2V4VA 4CP9B 4FFFA 1WMXA 1X7NA 4K40A 4GWNA 4JGZC 4RHV1 5E6HA 5J36A 3WNXA 2AACA 2V72A 2WZR3 2ZGQA 1LHWA 3EJKA 3LGRA 4XVHA 2Q5TA 2VJXA 1JYIA 5JUVA 2EIBA 2FCVA 2I74A 2TBVA 2P4EA 1BQPA 3LSEA 1UOGA 3BTXA 1AYM2 3EBRA 5JVVA 1SLBA 1PVC1 3K4ZA 5FMDA 4ASKA 1AJOA 3L2YA 1GBGA 4HSLA 3MV01 4KH9A 3WT3A 1NE4A 4MX3A 4UFJA 5JXGA 3CJXA 2ZACA 4AVTA 4JKLA 1SG3A 4AHXA 4FFGA 1LU1A 4ZS3A 1D2QA 2QKDA 4AHYA 1HXS1 1OA2A 4S2FA 5LK5A 4UFLA 4DUXA 1W6QA 2ERFA 1ZBE3 4J6GA 2XHNA 2XJVA 3MF6A 2E31A 4P08A 5EQUA 1YFWA 3TWIA 2J1TA 3W59A 2CYFA 3WDUA 3VBOC 1AXKA 2AEYA 4K8FA 5DPNA 3TEXA 1KJRA 4A7ZA 3O1OA 1QH6A 5KHJA 4XACA 1LEMA 2Q8DA 2EVXA 2JWPA 3WDTA 1NY71 1HV1A 1R091 1YFXA 3HN1A 5FYBA 2P3JA 3RVHA 2FDIA 2R072 3K48A 4WM8C 1JOPA 4LBJA 3LDBA 5C3QA 3NJYA 3S6PA 3ZXEA 2AREA 3ENRA 1J3PA 1H2MA 4O65A 3ZPYA 3SKJE 5IATA 1K5MA 2J1SA 1Q5OA 3U4SA 3VBFB 2GC0A 3KVBA 3WDVA 2V09A 2ZZJA 3Q8AA 2Q8CA 2F17A 4LO5B 4UOJA 3GBFA 2ZHKA 2E32A 4WVZA 4CUAA 3AP9A 3JB4C 1UX6A 2YYOA 2XJQA 2YMZA 1UKRA 4L2NA 1CIYA 4PHZA 3KHBA 5CKNA 3DGTA 4Y1XA 3M4FA 5FYSA 1KQRA 3POIA 4NHXA 4JQTA 1W8OA 3FHQA 4CP0A 3I4IA 2UYBA 4HXCA 3ZIXA 3HR9A 2QBXA 3ZMOA 4A3XA 4EQVA 2CSGA 5FUNA 3WNLA 4GIQA 1LNSA 2K2SA 2WC2A 1CAWA 5F5CA 4E4SA 4TLGA 4LO4B 4M00A 4CZSA 1PNGA 2G9GA 2RE9A 2VR4A 3PUQA 4PI0A 4E2QA 1YC61 2HWF3 4LKSA 1GOFA 3LA7A 3EHKA 1CAVB 4QXHA 1RVF3 3B9IA 2YGLA 4AK3A 1N3QA 5L9RA 1RUH1 4QQHA 1CAUB 3DPRB 2JG9A 3QH7A 3AKRA 2IFWA 3BVCA 1OA3A 3M3CA 1D7PM 5AC93 1ODNA 2XJSA 4UWDA 3OF1A 3CMGA 3PURA 1AX2A 2I45A 2GN3A 2FMYA 1PO11 2BV4A 3IMMA 2E7TA 2JJ6A 5IJRA 4CCLA 3MPBA 1EYBA 1IS4A 4GH4A 3VD4A 1G9AA 2W87A 3U4XA 1FOD2 2BQPA 4BYYA 3R6SA 1SFYA 3J8F1 1PO21 5ISLA 4OUMA 4URAA 5T52A 4QPGB 2B42B 1ND2A 2BJSA 3OGVA 3ZMNA 1IKQA 4AOCA 5CEHA 1P8JA 3LCPA 3WQ0A 1HX6A 2NQYA 3VBRB 2JDNA 3CDZB 2DDUA 2FZ2A 1BMV2 4E9KA 1US2A 1W04A 1XC6A 3BYWA 3WVJA 1Q8SA 4LIUA 1Z7S3 1H4GA 4OVEA 4OQ9A 2C26A 4LO6B 4DXZA 2WUHA 1UAIA 4JC1A 1CIWA 4BQWA 1F5FA 4IEXA 3RZLA 2R061 5CB7A 4I09A 5LBFA 3ZR6A 5JSOA 1NLQA 4BE3A 1WMEA 1DQ1A 2KD7A 2F4PA 2W1SA 3URFA 3IIIA 3KT7A 5ABJA 5JPNB 5FMOL 3TNQA 1DHKB 2NM1A 3NKGA 3MV11 4A45A 2CWSA 1PX4A 4F83A 3LDKA 2OW4A 4QU1A 2BNOA 4AXOA 3K3NA 2GP3A 3DCQA 3H8UA 3UETA 2ZHLA 2UWCA 2GALA 2XMLA 4QDRA 1OPMA 4CDXA 1BK1A 2VQUA 3AZWA 4LLFA 1W8WA 5EP9A 3U11A 5FZBA 4IE5A 2X09A 3NAPB 1Z78A 3MGUA 1PK6A 2OYZA 5J37A 2QQKA 4Q0UA 1BBT2 4OMCA 5C8CC 5C7GA 3JZVA 1I3HA 1C8M1 5B4XA 1AVBA 4LBMA 5CFDA 1O8SA 1UN1A 3H3UA 1RUD2 2B7YA 3GJBA 3RNSA 3BIWE 2GSYA 2G9FA 4HK9A 1VBE1 5IVFA 4OUEA 4QX2A 3I2IA 4UF0A 5FV3A 4PDWA 1CZSA 2JDYA 4SBVA 5E1RA 1UZVA 5T3NA 4F3JA 5LWBA 2PYTA 2C24A 2E7QA 4N9HA 1UWWA 2JDHA 2PA7A 3MICA 2XJTA 3KB5A 1MS5A 4FTBA 1AR62 2ZOEB 4XHBA 3TOJA 1UF2C 4CEWC 1ZZCA 5L7OA 2X5IC 1RC6A 3IM0A 1S0DA 3C7OA 2PFWA 4XMIA 5BYNA 2VMGA 4O9GA 5CG9A 1W6QB 3Q8EA 1LR5A 2GU9A 4IEPA 5BPXA 1CVNA 1ASJ1 2ZKLA 3QD6A 3OYWA 1KFUL 1D4VB 3IAPA 3UNPA 4D69A 1RUG3 1L7QA 1U5ZA 3HT1A 1C3HA 4IETA 4XAEA 4I01A 4QPYA 5DZEA 5FP7A 3UK9A 4UI9L 3M70A 5C70A 4IEZA 4CEYA 2W91A 3M8LA 4OCTA 4R9DA 4Y1ZA 2ZPXA 4ONUA 4Y1YA 1V9U3 3FMGA 3ME2A 1QDCA 3CU7A 2VCCA 3KZ4C 3QBQA 4AVAA 4QKDA 1ONAA 3D4KA 3ZIWA 1K5MB 4BM8A 5I8SA 1QXRA 3GZUC 4J1XA 1HIXA 4ES8A 4GJYA 2WT0A 3T1MA 1REEA 1JYVA 2WR9A 1RUC1 3HOBA 1UU4A 5JZGC 4GWJA 1CESA 4BJ0A 3U78A 3H8RA 1ALYA 1JZ3A 1S0IA 3FC0A 1YIFA 1AR81 4BCUA 3BTZA 3RGBA 2E26A 4HT1T 2DCYA 2VUAA 1GANA 2J1AA 2VG9A 3FE5A 4Q27A 4RQPC 1QJU3 1YCIA 3MFAA 4B1MA 3LOIA 4WBBA 2HWB2 5C8WA 5CADA 2ARCA 3AX4A 1S0CA 1T6BX 1NKGA 1EAH2 2PN5A 4JCKA 1CAWB 3VKLA 2WS92 4LLOA 1JYCA 1PNFA 2I07B 2R043 1AR91 3WCSA 3ZXJA 4C1WA 1LULA 5DAPA 4E2SA 3E1F1 4IESA 5CU1A 5GLTA 1JZ6A 3BPZA 4X8NA 2LS6A 4EN9B 1PMIA 3CZUA 5SV8A 3RQ0A 1IOAA 3U07A 4CSWA 4EN8B 1GZTA 1VR3A 4AL9A 1FMD3 2PHFA 3RMXA 4Q4X3 4I0AA 4AGRA 5A70A 4AQTA 2XQXA 1VMHA 4N9IA 3ST7A 2VW2A 5A3MA 2DCTA 1W6OA 1ODMA 2RS13 2Q4SA 2D6KA 4IGQA 1W9TA 3UT0A 1AYN1 2JG9B 2ZX1A 1DZRA 1EY2A 1W9YA 4M4RA 1V6OA 4QT6A 2GAUA 1H2KA 2Z79A 3S7IA 3VN4A 2DBNA 3GF6A 1HRI2 4HVRA 1K12A 1B35C 2CTVA 2PHTA 3C7GA 5LEKA 4HONA 2WO7A 3JD71 4GH4B 3ZYJB 1WW7A 4KBBA 2FDKA 2RDSA 3CIHA 3M2MA 3L2HA 3UESA 4EROA 4LUKA 2X8KA 1TMF1 1L7LA 4YW5A 5AFEA 3LIHA 1TNRA 1LGBA 2OZ6A 1Y9QA 4YVWC 3HAGA 5AFBA 4IXLA 3OD4A 2QQMA 2CDOA 2RM21 4LOTA 4N43A 3WF4A 2XVGA 5KHIA 1ND2B 2JE8A 1PGW2 1KDMA 1KJLA 4X6QB 4NIAA 1GU3A 2RMU2 4XZPA 4RR3A 1WLDA 3ZFGA 2ZEWA 5JMOA 3OPWA 5F32A 3QACA 1JHJA 1VBC1 1NZCA 5D8AC 2A6WA 4HANA 1LOCA 1C57A 1VBD2 1UXXX 3F95A 5F3EA 3WNPA 4GMP0 1MS9A 3O0VA 3HVDA 4IV3A 2WZR2 3FFZA 4R4XA 3ZDVA 4HMZA 4BH9A 1V70A 4QGNA 5IVYA 5IK4A 1W2UA 3E6CC 4AFAA 2KM2A 1XNCA 2VZUA 2HEYF 4Z82A 4BLJA 4CXWA 4V1PA 4AI0A 2R0HA 5ABJB 1VP6A 3WZ1A 3LPGA 4XCBA 3AJZA 2WFPA 1APNA 1NG0A 4MVTA 4CTEA 2C6SA 4CU6A 3ITQA 4BISA 2A6YA 1DDLA 4KBZA 1S0GA 4D6SA 2DU0A 4XMAA 1H2LA 4KWJA 4OQ8A 3P1IA 3RJ2X 1I9RA 5J09A 5FO7B 1AL21 1D4M3 2DVDA 1ZBE2 5F6KA 3ZFEA 2CNAA 4WM7C 4CCKA 1CZTA 2D40A 3VGIA 4CDXB 5B2GB 1QJX3 3D0SA 3MEPA 5IK7A 4CU7A 3S5AA 2ET7A 2HWC2 3AJYA 3RWKX 1PK6B 1VIWB 4TSVA 1RUI1 4KI5M 2WNVC 1ULFA 4CVUA 4AEDC 1SEFA 3WP5A 2YC4A 4KGGA 1J1LA 5FZCA 2AEZA 3OGGA 1GQHA 4AEKA 4L99A 4BK5A 1U0AA 5CFDB 5LRRA 1MS0A 1O59A 2VO5A 5AVPA 3O1RA 3VBSB 5FBJA 4UF0B 1SPPA 1DQ2A 4AI1A 4PDWB 4B4QA 4IEQA 2ZA9A 1E5RA 3Q8CA 3HEIA 4IEUA 4RN5A 5APAA 5KC6A 3CF6E 3DUIA 3UGFA 4DOUA 2PXJA 1W2OA 3QLQA 5ERLA 5C4WC 1OOPC 4HSJA 1N1SA 4IE6A 5GM0A 3HNYM 1DYPA 1ULPA 2HWE2 3QH6A 1W8UA 1URXA 4Q4W3 3VHOA 4CDQC 3INAA 1SBEA 1DF0A 1AYM1 2BNMA 3MZHA 3BTYA 3NQHA 4K1YA 4O61A 5K0UC 1Y9GA 2JG8A 1N1YA 2EXJA 1FYUA 3ES1A 4DIQA 2W0XA 4XILA 3OYWB 2QUOA 2RS31 4AEMA 1JUHA 4ITCA 4MADA 3PVEA 5E8AA 3I8TA 4FFIA 2C1FA 4R52A 1TME1 1YQCA 2VMFA 4CEYB 2PHDA 3OG2A 4KU8A 3D6EA 2WSUA 1C8NA 3H3ZA 4E4ZA 3IBMA 3MO4A 5JAXA 1QJY2 3LOBA 4AAXA 4XQDA 1XU2A 3RS6A 1DQ0A 2ET1A 2E53A 3KT1A 4GB32 2HWF2 2AUYA 4Q4V2 2WYFA 4OULA 5F2WA 4UW3A 4Y20A 2F6BA 1RVF2 1W90A 4NIHA 4WZFA 2Y8KA 2R071 5KWRA 1LRHA 3WF0A 4AI9A 1RUJ2 1SFNA 1JHNA 3WNOA 2ZGLA 2WIIB 4META 2RJKA 4I0WB 4UW4A 1FAYA 1X9TA 4TN7A 4YG0A 4AQ2A 4QAWA 2GNMA 4QMAA 2XG3A 3E5QA 4AGVA 1XQNA 4SLIA 5LY2A 1VB4A 3E5XA 1LHVA 3PU8A 4XUQA 3RZZA 1U12A 5KXDA 4D7YA 2A71A 2Y6LA 3AK0A 5IVCA 1YXWA 4MLOA 1OHFA 3AYDA 1GWMA 1OH3A 2XWBB 2D93A 4HFSA 4Q8KA 4ISQA 4AHWA 2GH8A 2ES3A 1HB2A 2JKXA 4DXTA 4TXWA 1BHGA 3OJBA 4LHNA 2HLEA 2WO3A 1GWLA 1JZ8A 2XLGA 1NCQA 3GNEA 4FP3A 4JKKA 1WCQA 2XH6A 4MYEA 3CNAA 4NPRA 1Z7S2 5FXZA 1W6OB 1STMA 4CCMA 2ZHNA 3AZXA 3KVAA 4QHZA 3T2PA 4ORFA 2YZ4A 5FYIA 1W8FA 3ZYPA 2EXIA 5FRAA 5FYYA 3U14A 4TZDA 4YYOA 3CEWA 2PHRA 3K77A 2Y34A 2Q1ZB 4PBPA 2HBUA 3WLUA 3AFKA 3I3QA 2YGMA 3IIAA 2BGCA 3LSDA 4LA3A 3KGLA 4ZU5A 5IAXA 4PLOA 2ILMA 3IDCB 1WD3A 4M3CE 3ZYHA 1C4RA 2WWSA 5IFPA 4ZXEA 2ADEA 3JBG3 3GM8A 3H50A 4N43B 4YRDA 1RUE1 2D7FA 3AZZA 1WW5A 4QKBA 3ILNA 3TNPB 1QXPA 2VVFA 4NUBA 4XUTA 3ACHA 3ZFGB 4RR3B 1YFUA 1RUOA 4FPYA 2P5BA 4UW6A 3RPQA 1FOD1 5KXCA 2XVKA 2R16A 2WNUA 1BBT3 4M3CA 5BNOC 1UY1A 4MSVA 1TE1B 1ZA4A 2BGPA 3AMMA 1GICA 2CAVA 3VV1A 5HPOA 3LWCA 1RUD3 1TZOA 3KSCA 4HK8A 1D0HA 2QJVA 4IV3B 1O5UA 3KQRA 3LIGA 1UXZA 1UU6A 1REDA 5FAXA 3ZN5A 3HQUA 3WNNA 4XW3A 5FYZA 1DFQA 1JTZX 1AR63 1PGL2 3NVCA 1MS8A 4GKYA 2QVSB 1UOJA 4QPIC 2BGOA 1G9DA 2C4XA 5LEJA 3WR0A 1GQGA 2VOTA 4B4PA 1JYNA 4IE0A 2WSVA 1HKDA 2KA3A 3ZFEB 5A3LA 2D3SA 3M3QA 3NRUA 3FL7A 1W0OA 4K3UA 3ZSMA 2MNGA 1AR71 1RUG2 2W5FA 4K9SA 1G86A 4LHLA 2Y6HA 5JR7B 4XJAA 3D82A 4AFCA 2OPKA 4HVOA 2NMOA 2QQLA 3OY8A 3T0DA 2V73A 3VBSC 3O1VA 4XJUA 5F3GA 4COWA 2EXKA 4J1WA 3SLIA 3WCRA 1SPPB 1GYKA 2YC2A 5LBEA 2K9ZA 4XCAA 4RL7A 3KMHA 4LO7A 2HKXA 1H4HA 1AXZA 2HWD2 3CZJA 5F3CA 1JZ5A 1V6MA 2P3KA 2EALA 2YPJA 4N7UA 4NPLA 5FZ4A 3OTFA 2WN3A 2ZXQA 2BVBA 4XUNA 5IK5A 4AEJA 4P02B 2XOMA 4GA9A 2O8QA 2BTVC 5GALA 4W6YA 1HDKA 4YARA 1DGLA 4C1XA 1IHMA 4NAMA 4YZ2A 5CFCC 5JLVA 4OMDA 2LTNA 2JG8B 3ZO0B 4XAAA 3GBGA 2HWB3 3LEIA 4FO9A 3ZPOA 2W1QA 1QJU2 3LF7A 3OBRA 5FYTA 1VALA 4JKMA 4Q4Y1 1AX1A 1R083 1YYNA 1EAH3 3KT4A 3WOGA 5LA2A 2QQUA 2A1XA 4M01A 5HCHA 4YM2A 2Y26A 3IDAA 5T55A 3CBNA 3ZSEA 3WEZA 1M06G 2RS53 1RUF3 3N9LA 1UY0A 1QKQA 1FV3A 1YO8A 2PHXA 2W52A 2D97A 3PJYA 4WV8A 4BK4A 3BIEA 3HJRA 1E5SA 2OUJA 1G9FA 2VTXA 2QFEA 3T0AA 3TN91 4IEWA 1FMD2 4XEZA 1KRIA 4Y20B 4JTNA 5FY0A 3NNMA 5FYHA 1DGWX 2D6OX 1BKZA 3AM2A 2RS12 3CLPA 1X50A 1AUYA 2EIEA 2JDPA 3VKNA 2XBO1 1VBA3 4IUGA 5A7PA 3RJRA 4ES9A 3SCGA 2J1EA 1SLTA 3HNBM 4Q1PA 2HBTA 2B9UA 1W8HA 3FJSA 5FO9B 1YJLA 4BB3A 3O1SA 1S0EA 2WYSA 3JQXA 3X29B 3NV3A 1H1IA 3M3EA 5BNQA 2VOVA 3FFQA 1CWPA 3GHNA 5FZOA 2WQ4A 5J3UA 1WCUA 1WMDA 5FYVA 3ZN4A 4AZZA 4H2AA 3O1MA 1XSRA 1GWKA 2DVFA 1QOTA 1UD1A 1VMFA 2P2KA 2WABA 2XKPA 5LB6A 4AGGA 2WFF2 1S1AA 4M3CF 4TWTA 2RMU3 3OGJA 4HOOA 2K46A 4YW7A 3P3PA 4JHTA 2BWAA 1PZ8A 2H6BA 1FI2A 5FYMA 3DEMA 1VBD3 1DZTA 5JOXA 2IFRA 1LECA 1QDOA 3RRDA 3B3QE 1NCQB 2J22A 5A3PA 2CGNA 2VNGA 2WS91 3ON7A 5GJ6A 2A3XA 1ZRDA 1SZBA 4MGQA 4QM8A 4XFFA 5C9AA 4ZHNA 1QJEA 1SLLA 2VXRA 2QQNA 2ZGKA 4FOVA 4JDMA 2JE9A 3ATGA 3ABZA 3GZEA 5LBCA 2RJ2A 1O4YA 1IPJA 4QQLA 1MS1A 1LOFA 4V2WA 3UKVA 4CUCA 2CGOA 2DUOA 4XYXA 3NMBA 2XL9A 2VBDA 1Q3EA 3RG0A 1YNAA 5JMCA 2ZGRA 4EWAA 3M1HA 1WD4A 1PIV1 2ZGOA 1HRI1 4RD7A 2D43A 3VLBB 1CGPA 2VQAA 4FAGA 4HKWA 1SBFA 1D4M2 1A8DA 1F9KA 2ID4A 2HWC3 2J42A 3BODA 4Q0VA 3I49A 1QJX2 1FPN1 1N1VA 3OBTA 1H8TA 2G4IA 5BNPA 1FATA 1V0AA 1IS5A 2BBAA 2WNUB 4M3CB 5C71A 5JWPA 2IWGB 1I6XA 3PMEA 2JXAA 3BUCA 2RJLA 3H7YA 1J58A 4XBLA 2PHUA 5FY7A 1MQTC 2QQWA 1KD7A 3ELNA 3N35A 2XDVA 5HXMA 3PNAA 5CISA 5M0TA 3OGRA 3N7JA 4DEQA 3WSOA 1QXJA 2NMNA 4FPKA 4ZU4A 1OH4A 2YXSA 5DABA 4JGYC 3ZFFC 3I2KA 1A3KA 1F2NA 2HWE3 4QB2A 1VRH2 1WZXA 2WZR1 4ET7A 2B9VA 2FMDA 1D2SA 1GNHA 3BKZA 3UJQA 2E63A 4Q4W2 1LKNA 2HYXA 1V6NA 1R1A2 1XB9A 3MBWA 3MIBA 4OZXA 3MYXA 3LEMA 4I02A 4EN7B 5FZ0A 3KWVA 4XOGA 4EZHA 5HI0A 3CHXA 2BYVE 5FWEA 4YNIA 2W47A 3AP7A 1SLAA 2PLV3 4RGAA 2ZJCA 1W8NA 4ASMB 1OFSA 3NW4A 2BFUL 1W3XA 5DDJ3 3VBUA 3BTAA 2IXIA 4AVCA 4RS5A 3O1TA 1QJY3 1ND3C 3B5LB 1ZBE1 5G05L 3OY8B 4A44A 4FOYA 1LOAA 2CWMA 1LOEA 2WNVA 3OSDA 4W65A 3U10A 4KNCA 4MZUA 4GB33 4Q4V3 1JU4A 2J1VA 2CDPA 1YFYA 1SLCA 2FCTA 3K4DA 4PF5A 4RYDA 5FZ1A 1CONA 4E4DX 4HETA 2W92A 3TYJA 3WNKA 1ENSA 1RUJ3 3E5UA 1XE7A 5FREA 5ACA2 2J1UA 3T2OA 4AFBA 2AH2A 5LA1A 1CQ9A 4LBQA 5DMYA 2WNEA 1MEC2 2OXBA 4IGOA 2R32A 4MXVA 3I3BA 4UFHA 1Y3TA 2DWRA 2D98A 2EIGA 2XLFA 1MZ5A 3M3IA 5JOZA 1IKPA 2XQRA 4YW1A 3AYEA 5J1XA 1DQ6A 4FPEA 3G6JB 4YFWA 1QMJA 1XE8A 1O3QA 2IVJA 3OUHA 1OUXA 3Q9OA 5FLJA 3MIFA 2ADDA 3ZSLA 3ES4A 4NAOA 2QNKA 1QQP3 2D5FA 3N7LA 4BIOA 3TBDA 4XIOA 2G1MA 3R05A 2A70A 4K1ZA 3H42B 3SH3A 3T0BA 5FZMA 4YLZA 1HB3A 4XHXA 1PM4A 1UKGA 2J1RA 2VOWA 4OHXA 5FP9A 1F4HA 4NMIA 4D8MA 3WQBA 2B39A 2Z5WA 3FZ3A 2QDRA 1H9PA 1UL9A 1WW4A 1W9WA 4XJZA 2BUKA 3ASIA 1E5HA 3AKTA 2KXLA 4OUSA 2JECA 5DUUA 2B4KA 2E6VA 2ZGMA 1S55A 2HWF1 5KXEA 4GALA 1G9BA 2ZMKA 2XGXA 1RVF1 1Y9MA 2XL7A 2WLQA 2Y64A 5F9TA 1GLHA 4RGKA 2JDZA 3EYPA 1ZRFA 5FZOB 4FPFA 1O3RA 4XUPA 2JDKA 3WDXA 3JBG2 4QXKA 1W28A 3VBFC 5AC91 4MO3M 5BV6A 2YBSA 1FX5A 1NA1A 2XB6C 3P5BA 4P5HA 5FMOS 3UL2A 1K5JA 2ZEXA 5FK8A 2RDRA 4AW7A 2YBPA 3FLPA 2CHHA 3GBWA 1JI6A 3VHPA 4ZU7A 4FPHA 2PQSA 3GDBA 2PAEA 3FN9A 4N8MA 3USSA 5DAXA 4E2GA 1ZA7A 1PX3A 2ZX0A 1DGRN 3A21A 3K3OA 4FPOB 1YUDA 4LITA 1COV3 2VZTA 2ZX2A 4Y5TA 2X10A 3VZOA 3N36A 1REFA 5JXIA 5FY9A 4FI9A 3VBHA 1UZZA 4DZGA 5C9AB 4QGLA 3PLQA 3JCIA 1WUVA 4YFZA 5FUPA 3ZXDA 1PZ7A 4OHVA 2DFBA 2A73B 2PTMA 2WT2A 1RUNA 2ZMNA 3VDDA 1ZVFA 5I0UA 3RYKA 3J7NA 4BU2A 4CXXA 1Z7S1 1GFF2 4F7ZA 1G6NA 4CXYA 4HKOA 2O0OA 1ZYBA 3O0XA 2QQVA 3DV8A 4OI1A 3TRSB 4ARXA 4EYUA 3AP4A 3RDIA 3LZZA 4YGDA 1LESA 4IV1A 1ZBA2 5LA9A 3ACGA 5CKQA 1QU0A 2P1BA 2BVVA 4E8CA 3HQRA 2XJUA 4C90A 1U5XA 2ZGPA 1OXCA 1IS3A 1FXZA 1TG7A 2GNBA 2WL1A 1ZZBA 1VAMA 3CJIA 2VMCA 3DPRC 3BN6A 5A80A 4W8JA 1H8TB 2NYYA 2VQ0A 4LTAA 5BNPB 1QF3A 4XETA 4GWIA 2W46A 1UU5A 2AZ5A 3AKQA 3K75B 4FFHA 2R30A 4QHBA 5KXBA 4AFDA 4XPVA 1ENQA 2CAUA 1WA6X 3DN7A 5T5LA 4HVQA 4EWEA 5I93A 2DU1A 1FNZA 1H9WA 1J3RA 2DCKA 4Q5OA 1XNBA 2HWD3 2QDNA 4Q1RA 3AKPA 1SMVA 2FD8A 4GMP3 4NPMA 5FBZA 4J25A 5FR3A 4QPGC 2CU5A 4MHUA 1N3OA 4CDWA 3PIGA 2Q1MA 1XYNA 3QCWA 4QB6A 3KCYA 3D8CA 1NLSA 3VBRC 5DZFA 3OGSA 3KD4A 3N9PA 4Q8LA 1PGL1 2LW8A 3MFCA 4UBGA 2O1QA 2NZ9A 2OZJA 5BNNA 3HMYA 3PUHA 3POFA 5EYXA 2WNOA 5FY8A 3A0KA 1R082 3AL5A 1IPSA 3P3NA 4WVMA 4XJ8A 3WUDA 3J7LA 2PHWA 2OIIA 5FMBA 5JOYA 1VAVA 4LE4A 2QTWB 1O5LA 2QE3A 4H3WA 5IFTA 3VBUB 1S2EA 5JI9A 3ROUA 4RS5B 4QX7A 2VCBA 1NCRA 2A6XA 1MR5A 2RS52 1RUF2 3BOWA 3J4UH 1KITA 3RYRA 2DV9A 3VZJA 3WNMA 4AI2A 3W5NA 1SDWA 4LKFA 1RUG1 2VVDA 2QZ2A 5GZCA 1NE6A 3OCPA 2R49A 5LW9A 3FUOA 4MGYE 4FTEA 2QZ3A 1MS4A 2JKBA 5CBLA 3K46A 4DXRA 1V00A 1NLRA 2JB4A 1V9U1 2JIJA 1XSQA 1SACA 4DUWA 3IPVA 3EMRA 1S0FA 3NAPC 4LBQB 2X05A 1VRBA 4HPKA 4Y4RA 3SKVA 1BXHA 3PDQA 1VBA2 3LDRA 4CU9A 3O0WA 3R4DB 4I3PA 2Z69A 1BEV3 3Q8BA 3VB9A 4GQ7A 4QWNA 1PVC2 3A7QA 2H0VA 2Y6JA 3ILRA 2VCMA 4COZA 1CPMA 5KC5A 2WFF3 4XC9A 2VTXJ 2JDAA 4P9WA 4AYUA 3K2OA 1YIPA 3J7HA 1IGOA 4DNYA 1E57A 3ZXKA 1T2XA 2DTWA 1F15A 2ZX4A 4C0BA 1QJU1 4KG0A 4NRMA 4HN1A 4XBNA 4DEVA 4LORA 3IZOA 1X36A 2BZDA 2DCZA 2VU9A 1CD3G 2RR11 5FKCA 1NY72 1R092 4LOSA 2R041 1SQ4A 1U5IA 4Z2WA 4Y1UA 2DYCA 2D6NA 4NIGA 4OHWA 2EICA 1FMD1 1ST8A 4Q4X1 2VUCA 1OF3A 3WQ7A 2PQQA 3I97A 2HEWF 3VD7A 5KR7A 1FT9A 4QQ2A 3WINE 1UZYA 1NXD1 2RS11 3I3DA 3THCA 3N9QA 3VD5A 2BDRA 1DU3D 1GUIA 2WAOA 5IK8A 4CPBA 5I0TA 1K5MC 3T2TA 1GQPA 3KV4A 1RGSA 2FDHA 1OBNA 5FY1A 1NA1B 3B7MA 4F8AA 2OUHA 3HNMA 4OFGA 4CDUA 1Q8VA 5A3UA 3S0MA 4N53A 4JV4A 1POV3 5D1IA 2YDEA 5EWSA 1G9CA 3RZHA 1WCKA 4DQAA 1QH7A 5GLZA 1JBCA 3LPFA 5I0DA 1W2AX 3VZKA 2XVLA 4ZKTB 1MVEA 5FWJA 5LBBA 2VUJA 4R9CA 4BDVB 5J48A 4URTA 4OHYA 2YY1A 4JX0A 1J84A 1R64A 4JGZA 4X6RB 2ZKNA 4EN6B 3T4VA 4KGQA 5DG1A 4YPJA 3VBHB 2FBEA 2D44A 1L7RA 3MIEA 3MLLA 2VNVA 1JMUB 1VBB3 2WKKA 3OB8A 4FOWA 4XF3A 3WP4A 2QQJA 3VDDB 4C91A 1FNYA 5LRSA 1LCLA 5FOJB 3N3HA 1VRH3 3SH5A 3E6DA 3DECA 4L97A 2A5ZA 1SDDB 4CYDA 4E27A 1ZRRA 1H1AA 2BNNA 3N4MA 3BU0A 1R1A3 5I8TA 2WLPA 1VB2A 4GKXA 1QY4A 1PVXA 4HG6B 3LE0A 4HLTA 4BQYA 4IV1B 4IEYA 2P3IA 3ETPA 1W2TA 2VY0A 3K4AA 5FZ7A 2NN8A 5F5AA 1CR7A 1DBNA 2D3RA 2C9KA 2WJSA 3CJIB 3LA2A 2ZMLA 3WW1A 5GZDA 2JG9C 3MUZ1 4P9XA 1JYTA 3GCXA 2PLV2 4Y4YA 1LGCA 1IG0A 1EPZA 2R1DA 3VBOA 4BWOA 4CA9A 1HB4A 2Y0OA 5IT6A 3J26N 1DIWA 5DDJ2 4XBQA 4GH4C 5T5PA 1D4M1 4HZFA 3J8F2 4W4ZA 3I3MA 1UY2A 4IQPA 4JVAA 1QJX1 1N3PA 4WM8A 1WBLA 1YWKA 2BU9A 4N7IA 5FOBB 3AZVA 3KGZA 3TEWA 1ND2C 1POQA 5ACA3 3RZJA 3SEPA 4CDWB 3H1WA 5IVEA 2JENA 1WBFA 3AVRA 3KLSA 4COVA 4LXLA 1MEC3 4ZPIA 5JOWA 4ZXKA 4OZOA 5JXHA 4BQ4A 1RITA 3ZSJA 3POJA 2X29A 2IXLA 3PTYA 4GWMA 3O5SA 5DG2A 1A34A 1GZCA 5C5TA 2VW1A 1N47A 5EJ3A 3POYA 2W95A 3THTA 4AR2A 3PIJA 5F37A 2A75A 1LHNA 5HCFA 5J98B 3AMNA 5BNNB 1K42A 1DYKA 4L11A 1Q56A 4Q4W1 4QDSA 4WVMB 4FOQA 4A41A 3GHMA 2MEV3 5LATA 1QOOA 2HYKA 2WN2A 1QQP2 3ZR5A 1H0BA 3NL1A 3NWKA 5ABJC 5EXOA 4BIFA 4LA2A 4D6RA 3TEZA 1OVPA 1CAXA 1NCRB 5C6CA 2DVGA 2W9XA 4L9BA 2E7AA 4QPWA 1YQ8A 2ZGSA 1J59A 1AXYA
chains in the Genus database with same CATH topology
3WDYA 4XF9A 3V65A 4AWDA 1Q8PA 5JI7A 1VJ2A 2D6LX 4CDXC 2UURA 2WA3A 1C28A 2E9QA 4OHZA 2VULA 1C8M2 2K0GA 3IPVB 2PHLA 4HPKB 1PK6C 1RHI3 1VBE2 4FXKB 4H14A 1N1TA 5CFDC 1KXGA 1W39A 4Z1VA 1KDKA 2AYHA 1EV13 4H7LA 4XXAA 4DRVA 3EXUA 4PDWC 1QGLA 1LU2A 5JCTA 1RMU3 3ZXAC 5JIUA 2D6MA 4K6BA 3RWNA 4XQ4A 4XFHA 5DUWA 3PJQA 5DZGA 4Q0SA 4B3NA 5AVAA 2FHRA 5EV7A 2Y38A 3AKSA 1LHOA 1T6GC 4XE9A 1DGRA 3DL3A 2BEOA 4MGIE 1R1ZA 4I0BA 1COV2 4Q0QA 5FLIA 3TAYA 4M0HA 3VUOA 2B5HA 2ZGNA 1BMV1 3AB0A 1RB8G 4FSJA 1ZZ7A 3B93A 4CEYC 1W6PA 3MF9A 4N90A 2VW0A 3WW4A 1ZM1A 2PAKA 2WT1A 1ZBA3 2GMMA 4YM0A 1O3TA 1BJQA 1HQWA 4MXWA 3SITA 5J96B 1ULCA 3ALQA 4CDUB 1SLIA 4N53B 3WG1A 5J7MA 2X53S 2ZBJA 3JBG1 2EA7A 1ZREA 4P9GA 1HRV3 1EP0A 4QQPA 2GNDA 3HIFA 4JGZB 4FBFA 1LGNA 5C8CA 3PHMA 1AR92 4B8EA 4KWKA 1BBT1 4UBHA 4W6XA 3GYDA 1RUD1 1RJ7A 1TNFA 2UWBA 3IDBB 3QOPA 3O7OA 4CEWA 2Q8OA 4AI8A 5FO8B 2HJIA 2X5IA 1AYN2 3I59A 3NV4A 4K21A 3JQWA 1ZZ8A 5I91A 1XYOA 3AP6A 1AR61 4B7KA 1CX4A 4EJRA 1QOSA 3JD72 3VBOB 2P17A 4I3GA 4YW4A 3HBZA 3L9JT 4ASLA 1F5JA 4KU7A 3UKTA 4R9AA 1MVQA 3SMHA 2MHFA 5H9PA 2JE7A 4DPNA 4YZ4A 4WM8B 3WW2A 2VGDA 4L92A 3B94A 3CL1A 2UYAA 1MS3A 4YVSC 4N43C 1OA4A 4XFBA 5HBAA 5GKAC 4LBLA 2XJRA 4RHV3 3ZFGC 1G8WA 4RR3C 2OVUA 2QQPA 4LE3A 1VAKA 2DUQA 5JZGA 2WQZC 1UPIA 4GULA 4BA6A 5CVRA 1PVC3 4PLNA 1BEV2 2VVEA 1F31A 4IV3C 1QNWA 1M4WA 2SLIA 4HBNA 5I8YA 4RA0A 2ZCWA 3KS7A 4RQPA 4MH0E 2PAMA 2ZZQA 3H0OA 1HXS3 1YRZA 2IZWA 3SH4A 1CAXB 1UIKA 3FHIB 4XIKA 1V6LA 2HWB1 5F1RA 1AL22 3VL9A 4DFSA 3IKWA 1R081 1EAH1 4FTSA 1X82A 2FZ1A 1PZ9A 4FVVA 5JSPA 4JQRA 3ZFEC 1RIRA 3B01A 1R093 2ATFA 2JEMA 2RS51 1RUF1 2DVBA 4FPLA 1SBDA 4NO4A 4RSUA 3O14A 3MPPG 3WG2A 4A7YA 4DRRA 4D7TA 1B35A 4AFMA 1DQ4A 4AVVA 4KL1A 3MDPA 4G9SB 3IN9A 4JDNA 1AHSA 1VBA1 1XXNA 4HL0A 4AQSA 5K7PA 4YVWA 3VZMA 3JUUA 2BBVA 2Q30A 3E6BA 4P9LA 1ZRCA 5F6LB 4MGZE 4BQ1A 3V0BA 2VOKA 3PVBB 2RS32 5JPMB 1UIJA 3GZTB 3MI8A 2UWAA 4LHKA 1PGW1 2JG8C 5D8AA 4YZ5A 2VH9A 1OMIA 2RMU1 1AL0G 1TME2 3V64A 2CGPA 4ISRA 4RFT0 1WA4A 1VBB2 2AGSA 4UXAA 1VBD1 4COYA 1O4TA 4AQ6A 4DY5A 4DB5A 5K8SA 5BY5A 3SCHA 1W6PB 1RUH3 4FQZA 4Y26A 3H9AA 3WP6A 4QQOA 3VKMA 1H30A 4OI0A 5FFOC 2GDFA 2A3YA 4MXWB 1YI7A 1PO13 3SXWA 2Z42A 4BMEA 4Y22A 4WM7A 2TNFA 1RJ8A 5EFUA 2LUWA 2YC0A 1NQJA 4MUVA 4Q29A 1C1FA 3J8F3 1PO23 1W6MA 4YG3A 4AEDA 5C8CB 2HWC1 3MIHA 3KCXA 3UV9A 3POWA 5H9QA 2BFUS 3M7AA 3MW2A 2BWCA 2EF6A 4YZ3A 4NHMA 2R6QA 3R4SA 5JIAA 3A0NA 2ARBA 2VNOA 5A32A 2R063 4CEWB 2GNTA 1OOPA 5C4WA 1JW6A 2X5IB 1NCQC 3I59B 4R8HA 4CDQA 5GZGA 2A6VA 2N7GA 1XU1A 2XHKA 2ZGTA 1XNDA 5FPZA 1PHMA 4AVSA 5K0UA 3TB0A 2HWE1 3USUA 4CP1A 4LNVA 2ZHMA 2MEV2 3T1LA 1KFXL 5HCAA 1DLLA 4AI3A 3NV1A 1L3JA 3AP5A 1IPKA 1H2NA 1RUE2 3IWZA 4LT5A 2I2SA 3GZAA 3AMHA 2PLV1 3DKWA 2E51A 4P9JA 4Q26A 1X8EA 2IXJA 2LALA 1PGSA 1MZ6A 3AYAA 5DDJ1 4LBQD 5LK7B 4QGMA 1C8M3 1QJY1 4BZ4A 5GZFA 5GZEA 4Y5Z0 4WVVA 2WNUC 1VBE3 4GB31 3ILFA 4Q4V1 4LULA 4FXGB 5JZGB 1RHI2 4GXLA 3W58A 2B46X 4Z92B 1RUJ1 3DF0A 4HKLA 4RQPB 4LUMA 1EV12 2CL2A 3E97A 2PELA 2JD4A 1VLNA 4M0NA 4H55A 4XFCA 3WW3A 2Y0IA 1RMU2 1B09A 1GSLA 1LHUA 4ATEA 4AF9A 5FQ0A 3ZVXA 1ASJ3 3NSTA 1Y7BA 4YM1A 5HXVA 2H6CA 1ENRA 4PLMA 3V0AA 3VZLA 1AR72 2B8MA 1QQP1 3FBYA 4QD2A 3HWJA 3THPA 2D5HA 4FP2A 4OI2A 5KHGA 4P9YA 2EAAA 1CJDA 1UW8A 1OPOA 3APBA 5FLHA 3RMYA 1GZWA 3VHRA 1B35B 1Q43A 1W6NA 1RUC3 4XF0A 1QHDA 3PMSA 5FCCA 2OA2A 3CO2A 4QM9A 3WV6A 4L8QA 3LA3A 1OI6A 2BPA2 3BB6A 1RINA 4XTMA 1AR83 1IZ3A 4YVWB 4H7MA 3NKTA 1G7YA 4AVBA 1FV2A 5E89A 2R1BA 5JSRA 3AXEA 3V0BB 5DUVA 3S30A 1S2BA 4Q4Y2 2MPFA 5D8AB 5C33A 5BNOA 1HRV2 2UU8A 3ZN6A 4YG6A 4Y1VA 1OQDA 1AR93 3UJOA 3U0ZA 3EQEA 3RI8A 2VECA 2ZGUA 1GR3A 4S2DA 1COV1 3KCCA 2XWJB 3TN92 5BUVA 3AMPA 3POSA 4KWLA 1AYN3 1OKQA 4QPIA 4LO8A 2ETEA 5T50A 3W9AA 1OLRA 1WCSA 1EPWA 3C3VA 2XBO2 3WG4A 2ZABA 4JRAA 3LAGA 5K9YA 3N7KA 5T5JA 3JD73 4Y22B 4WM7B 3WUCA 1TMF3 3WHUA 2GMPA 1W0PA 3ZX7A 2GC1A 2RM23 5GLUA 1ENXA 2WNVB 1W6MB 4LBOA 4AEDB 1ZZ9A 2GH2A 2VPVA 3D0JA 3VBSA 2SBAA 1VBC3 5KBFA 5BXXA 3I7DA 1S2KA 1HV0A 5E88A 4U36A 1S0JA 4RHV2 4Q0PA 3FWEA 1KS5A 4PBOA 4S2GA 1BYHA 1QNYA 5A32B 3IDEA 4B4RA 1LEDA 2RR13 4FPGA 4FQ4A 3VKOA 1OOPB 5C4WB 2HWD1 4CDQB 1LENA 2NPIA 3B02A 5CFCA 4BOWA 4GMP1 5L19A 3J9SA 5E16A 1F8VA 4FPJA 4D3WA 5K0UB 5C9AC 1CPNA 3H7JA 3USUB 4EN0A 2P34A 3B00A 2GMEA 5FPXA 2TEPA 1HXS2 5DXDA 1LOFC 1AL23 1PIV2 5FTTC 3VKFC 2VNRA 2GC2A 4JRLA 3ZYRA 4A7KA 1PM7A 1JN2P 3RSJA 1LODA 2WA4A 4G4FA 3R4UA 1FPN2 3AZYA 1RUI3 2ZS6B 3R0RA 2IXCA 4YVSA 4DS0A 3MW3A 4JDOA 1AJKA 1H8TC 5BNPC 1IS6A 3VHNA 1S0BA 4WVWA 4LBKA 1NXMA 4IEOA 4C0HA 5L73A 3WY6A 1SCSA 5I0SA 1A6CA 1H8VA 1J1TA 3V56A 5KHKA 1X33A 4CP2A 1AYM3 1SCRA 5DUXA 4YGBA 1BEV1 5FQ0B 3HQXA 3ACLA 2ZTNA 1YI9A 2RS33 2W39A 1LB2A 5SV5A 3V0AB 1GKBA 1Z0HA 2WFF1 4XDQA 1TME3 4S2HA 5F5QA 2UY8A 3O12A 3KM5A 2DFCA 5T54A 1DG6A 1AF9A 4XXPA 3MLKA 1A8MA 4YZ1A 5EZWA 5EYYA 1J3QA 4YW3A 5A33A 1IQAA 3FUQA 2GZWA 3OPZA 1C5IA 3G7DA 4HN0A 3VBUC 4QU2A 3AYCA 3OD0A 4RS5C 1GZWB 1D0GA 1TQ5A 1MZFA 5I0RA 1ZZ6A 2R073 3BOPA 1W6NB 2AR6A 1RUH2 1QWRA 1ULGA 3M3OA 3BALA 3EO6A 3LB9A 2WZPP 2B45X 2ENRA 4AHZA 1DZQA 2YROA 1PO12 1AX0A 4XTPA 1ULDA 3C2UA 1NYWA 1C5HA 2VOXA 1ZX5A 3MIDA 1BVVA 3ZDSA 4LBNA 3ZXFA 5BNOB 1PO22 3ZN6B 1YHFA 2V5YA 4Z07A 3WP3A 4XF1A 1CN1A 4XF4A 1POV1 1O3SA 1MQTA 4NOTA 2JICA 1GZ9A 2D3PA 3H1YA 4JAAA 4OLLA 3AXDA 3N7MA 4Z8BA 4COUA 3NO8A 1CJPA 1LOBA 4YGEA 1OD5A 3SISA 4JGYA 3ZFFA 1ZRDA 4QPIB 4DMIA 2W68A 3WXPA 5H9RA 3HT2A 4YM3A 2R062 4QX5A 1RL3A 2VMHA 1VBB1 3K51A 5JDBA 5T5OA 4BPZA 3BU7A 4NHKA 4OI4A 3WQ1A 4D94A 1VRH1 3ETQA 4IEVA 2UY9A 1WLCA 1WLWA 4KQ7A 3RI9A 4BLIA 1GV9A 2QCSB 4KG8A 2Z2SB 1R1A1 4I2OA 4NWWA 1RUE3 2Q0AA 5AC92 2JX9A 3JU9A 3RYPA 2ARXA 1ND3A 2C0ZA 4EWDA 1JUIA 1UPSA 4XQWA 4FCAA 1FOD3 3VBSB 3FLTA 1A78A 1O91A 1XYPA 2C5DA 2IC1A 4PCRA 1WCDJ 2XKOA 3NV2A 1NA1C 1POV0 4YW2A 2CV6A 1H1MA 2A6ZA 1V6JA 3SNMA 4LEJA 4XFIA 1YJKA 2D6PA 4PIXA 3D5OA 1MZEA 4B7EA 5CFCB 2P37A 2IXHA 1O7FA 5ACA1 4U2AA 4NN0A 2XUMA 3B9CA 3H1MA 3VBHC 5CG8A 1WGPA 2NP0A 1MEC1 2A7AA 5HCBA 2CY6A 3VDDC 2EAKA 4XFGA 1HQLA 4I30A 5KHHA 4IERA 5L7OC 2LM3A 3I54A 3ZYGA 1ASJ2 1JH5A 1DGWA 1AR73 2IXKA 3WD5A 4IV1C 2H0BA 1TEIA 2MEV1 5CAZA 1ZNPA 4NR1A 3CJIC 4YVSB 3SCFA 3ZXLA 1DQ5A 1X8MA 2NLRA 1V6IA 1Y43B 4XJWA 4XFAA 4EV0A 5L36A 3WHTA 2O8OA 4O9EA 1JOJA 1O4ZA 4FAHA 4AE2A 5CA6A 2C9AA 1RUC2 5GLWA 1LTEA 1BVP1 1XRUA 1WW6A 1V6KA 1U5YA 1RHI1 2ZAHA 3VL8A 1AR82 4CDWC 3S7EA 3VBFA 4TYSA 3WDWA 3AMQA 4NWVA 3ECQA 4YGCA 1YLLA 1EV11 4Q4Y3 3WG3A 4R9BA 4WZCA 4UW5A 4INDA 1RMU1 2GC3A 5BNNC 4TLFA 4Q2FA 2DF7A 5A33B 1OSGA 1QJZA 3IMNA 4FPCA 1ULEA 3VZNA 3TN93 2FQPA 1HQNA 1NCRC 3HD8B 1I5ZA 4D7SA 2DVAA 1BCXA 1UMZA 1LOGA 1NQDA 1GNZA 3ZSKA 5FDBA 2XBO3 1V9U2 2WINB 4CRQA 4IL7A 1JXNA 2ZX3A 4K7JA 2YV8A 3I2DA 4R4ZA 2XJPA 1OFNA 4YSFA 1CAVA 1XNKA 1WLTA 3B69A 4X8PA 4Y24A 3FLRA 3A4UA 4ATFA 1CAUA 1TMF2 2BW8A 3DPRA 1UCXA 1ZBA1 1OQ1A 3ZXGA 3GALA 2RM22 1HLCA 5CNAA 1WMFA 4LR4A 1C1LA 4P14A 2TUNA 4BHPA 3FX3A 1MQTB 4DY3A 3BCWA 1VBC2 4MV2A 4P9IA 4BMBA 4K20A 4PIYA 5TSWA 1BZWA 1HRV1 3MIGA 4QPGA 4RGGA 3WX5A 2RHPA 2WS93 2DURA 1OQEA 4JGYB 3ZFFB 3IT8A 5IUQA 2RR12 2ZAAA 3SHRA 2R042 1RTVA 1OLQA 2YHJA 2DCJA 5CIRA 2A3WA 3VBRA 3JB8A 2DTYA 4NHLA 4DINB 1MACA 3FBMA 1I1EA 1NOVA 2R0FA 1Q8QA 4Q4X2 4NVPA 3MLJA 4W6WA 1PIV3 1HRI3 3LKJA 4MGKE 3PVOA 4AG4A 2DUPA 4XJ9A 4A2UA 1ND3B 2GN7A 1KS4A 1FPN3 2AENA 4B29A 1HW5A 1LJ7A 2HEVF 3UKNA 1RUI2 1AZDA 1Q8OA 4CDUC 4FT8A 4PIZA 4N53C 3PVNA 2W08A 2XLAA 2VMIA 2XPJA 4JTOA 2YUEA 3NJZA 4G3YC 4PJYA 2EXHA 3AFGA 3MW4A 3NAPA 5GLVA 3ZYIB 4PQ9A 4K40A 1X7NA 4GWNA 4JGZC 4RHV1 5J36A 3WNXA 2WZR3 2ZGQA 1LHWA 3EJKA 3LGRA 2Q5TA 1JYIA 2I74A 2TBVA 1BQPA 3LSEA 1AYM2 3EBRA 5JVVA 1SLBA 1PVC1 1AJOA 3L2YA 1GBGA 4HSLA 4KH9A 3WT3A 1NE4A 4MX3A 3CJXA 2ZACA 4AVTA 4AHXA 1LU1A 1D2QA 2QKDA 4AHYA 1HXS1 1OA2A 4S2FA 5LK5A 1W6QA 2ERFA 1ZBE3 4J6GA 2XJVA 3MF6A 3W59A 3TWIA 1YFWA 2CYFA 3WDUA 3VBOC 1AXKA 4K8FA 4A7ZA 1KJRA 1QH6A 5KHJA 1LEMA 2EVXA 3WDTA 1NY71 1HV1A 1R091 1YFXA 3HN1A 2P3JA 2R072 3K48A 4WM8C 4LBJA 3S6PA 3ZXEA 2AREA 3ENRA 1J3PA 1H2MA 3ZPYA 1K5MA 1Q5OA 3VBFB 2GC0A 3WDVA 2V09A 2ZZJA 4LO5B 3GBFA 2ZHKA 4WVZA 3AP9A 3JB4C 1UX6A 2YYOA 2XJQA 2YMZA 1UKRA 4L2NA 3DGTA 4Y1XA 3M4FA 1KQRA 4CP0A 3I4IA 2UYBA 3ZIXA 3HR9A 4A3XA 3ZMOA 4E4SA 4GIQA 2K2SA 2WC2A 1CAWA 4LO4B 4M00A 4CZSA 1PNGA 2G9GA 2RE9A 4E2QA 2HWF3 3LA7A 3EHKA 1CAVB 1RVF3 3B9IA 2YGLA 4AK3A 1N3QA 1RUH1 4QQHA 1CAUB 3DPRB 2JG9A 3QH7A 3AKRA 2IFWA 1OA3A 3M3CA 5AC93 2XJSA 3OF1A 1AX2A 2I45A 2GN3A 2FMYA 1PO11 2E7TA 2JJ6A 3MPBA 1EYBA 1IS4A 4GH4A 1G9AA 3U4XA 1FOD2 2BQPA 4BYYA 3R6SA 1SFYA 3J8F1 1PO21 4OUMA 5T52A 4QPGB 2B42B 1ND2A 3ZMNA 1IKQA 3LCPA 3WQ0A 1HX6A 2NQYA 3VBRB 2FZ2A 1BMV2 4E9KA 3WVJA 1Q8SA 1Z7S3 1H4GA 4OVEA 4LO6B 4DXZA 1UAIA 4JC1A 1CIWA 1F5FA 4IEXA 2R061 5CB7A 4I09A 5JSOA 4BE3A 1WMEA 1DQ1A 2F4PA 3URFA 5ABJA 3KT7A 5JPNB 5FMOL 3TNQA 1DHKB 2NM1A 3NKGA 2CWSA 4F83A 2OW4A 4AXOA 2BNOA 3H8UA 2ZHLA 2UWCA 2GALA 1OPMA 4CDXA 1BK1A 3AZWA 4LLFA 3U11A 3NAPB 1Z78A 3MGUA 1PK6A 2OYZA 5J37A 4Q0UA 1BBT2 5C8CC 3JZVA 1I3HA 1C8M1 1AVBA 4LBMA 5CFDA 1UN1A 3H3UA 1RUD2 2B7YA 3RNSA 3BIWE 2GSYA 2G9FA 4HK9A 1VBE1 5T3NA 4PDWA 4SBVA 5E1RA 4F3JA 2PYTA 4N9HA 2E7QA 2PA7A 3MICA 2XJTA 3KB5A 1MS5A 4FTBA 1AR62 2ZOEB 4XHBA 3TOJA 1UF2C 4CEWC 1ZZCA 5L7OA 2X5IC 1RC6A 3IM0A 1S0DA 2PFWA 4XMIA 5BYNA 2VMGA 4O9GA 5CG9A 1W6QB 1LR5A 2GU9A 4IEPA 5BPXA 1CVNA 1ASJ1 2ZKLA 3QD6A 3OYWA 1KFUL 1D4VB 4D69A 1RUG3 1U5ZA 3HT1A 1C3HA 4IETA 4I01A 4QPYA 5DZEA 3UK9A 3M70A 4IEZA 4CEYA 3M8LA 4R9DA 4Y1ZA 2ZPXA 4ONUA 4Y1YA 1V9U3 3FMGA 3ME2A 1QDCA 3CU7A 3KZ4C 3QBQA 4AVAA 1ONAA 3D4KA 3ZIWA 1K5MB 4BM8A 5I8SA 1QXRA 3GZUC 4J1XA 1HIXA 4ES8A 2WT0A 3T1MA 1REEA 1RUC1 1UU4A 5JZGC 1CESA 1ALYA 1S0IA 3FC0A 1YIFA 1AR81 4BCUA 4HT1T 2DCYA 2VUAA 1GANA 2VG9A 3FE5A 4Q27A 4RQPC 1QJU3 1YCIA 3MFAA 3LOIA 4WBBA 2HWB2 5C8WA 5CADA 3AX4A 1S0CA 1EAH2 2PN5A 4JCKA 1CAWB 3VKLA 2WS92 4LLOA 1JYCA 1PNFA 2I07B 2R043 1AR91 3WCSA 3ZXJA 4C1WA 1LULA 4E2SA 4F8AA 4IESA 5GLTA 5CU1A 3BPZA 4X8NA 4EN9B 1PMIA 5SV8A 3RQ0A 1IOAA 3U07A 4EN8B 1VR3A 1FMD3 2PHFA 3RMXA 4Q4X3 4I0AA 4AGRA 4AQTA 4N9IA 3ST7A 2VW2A 5A3MA 1W6OA 2DCTA 2RS13 2Q4SA 2D6KA 1AYN1 2JG9B 2ZX1A 1DZRA 1EY2A 4QT6A 1V6OA 3S7IA 2GAUA 1H2KA 2Z79A 3VN4A 3GF6A 1HRI2 4HVRA 1B35C 2CTVA 2PHTA 5LEKA 3JD71 4GH4B 3ZYJB 1WW7A 4KBBA 3M2MA 4EROA 3L2HA 4LUKA 2X8KA 1TMF1 4YW5A 5AFEA 1TNRA 1LGBA 2OZ6A 1Y9QA 4YVWC 3HAGA 5AFBA 4IXLA 3OD4A 4N43A 2RM21 5KHIA 2XVGA 1ND2B 1PGW2 1KDMA 1KJLA 4X6QB 4XZPA 2RMU2 3ZFGA 4RR3A 1WLDA 3QACA 1VBC1 1NZCA 5D8AC 2A6WA 4HANA 1LOCA 1C57A 1VBD2 4GMP0 1MS9A 3O0VA 4IV3A 2WZR2 3FFZA 4R4XA 4HMZA 4BH9A 1V70A 4QGNA 5IK4A 1W2UA 3E6CC 4AFAA 2KM2A 1XNCA 2HEYF 4Z82A 4BLJA 4V1PA 4AI0A 2R0HA 5ABJB 1VP6A 3WZ1A 3AJZA 2WFPA 1APNA 1NG0A 4MVTA 4CTEA 2A6YA 1DDLA 1S0GA 2DU0A 4XMAA 1H2LA 4KWJA 3RJ2X 1I9RA 5J09A 5FO7B 1AL21 1D4M3 2DVDA 1ZBE2 5F6KA 3ZFEA 2CNAA 4WM7C 2D40A 3VGIA 4CDXB 5B2GB 5IK7A 1QJX3 3D0SA 3MEPA 2ET7A 2HWC2 3AJYA 1PK6B 1VIWB 4TSVA 1RUI1 2WNVC 1ULFA 4AEDC 1SEFA 3WP5A 4KGGA 1J1LA 4AEKA 3OGGA 1GQHA 5CFDB 4L99A 1U0AA 5LRRA 1MS0A 5AVPA 1DQ2A 4AI1A 4PDWB 4B4QA 4IEQA 2ZA9A 4IEUA 5KC6A 3CF6E 3DUIA 4DOUA 3QLQA 5C4WC 1OOPC 4HSJA 1N1SA 5GM0A 5H9SA 5L7OB 1DYPA 3QH6A 2HWE2 4Q4W3 4CDQC 1URXA 3VHOA 3INAA 1SBEA 1DF0A 1AYM1 2BNMA 3MZHA 4K1YA 5K0UC 2JG8A 1N1YA 2EXJA 1FYUA 3ES1A 2W0XA 4XILA 3OYWB 2QUOA 2RS31 4AEMA 1JUHA 4ITCA 3PVEA 5E8AA 3I8TA 4R52A 2C1FA 1TME1 4CEYB 2PHDA 4KU8A 3D6EA 2WSUA 1C8NA 3H3ZA 4E4ZA 3IBMA 5JAXA 3LOBA 1QJY2 4XQDA 1XU2A 3RS6A 1DQ0A 2ET1A 2E53A 3KT1A 4GB32 2HWF2 2AUYA 4Q4V2 4OULA 4UW3A 4Y20A 2F6BA 1RVF2 4WZFA 5KWRA 2R071 1LRHA 1RUJ2 1SFNA 1JHNA 2ZGLA 2WIIB 4META 2RJKA 4I0WB 4UW4A 1FAYA 4YG0A 4AQ2A 2GNMA 4QMAA 2XG3A 3E5QA 4AGVA 1XQNA 4SLIA 1VB4A 3E5XA 1LHVA 3RZZA 1U12A 5KXDA 4D7YA 2A71A 3AK0A 1YXWA 4MLOA 1OHFA 3AYDA 4HFSA 2XWBB 2D93A 4Q8KA 4ISQA 4AHWA 2GH8A 2ES3A 3OJBA 4LHNA 2XLGA 1NCQA 3GNEA 4FP3A 4MYEA 2XH6A 3CNAA 4NPRA 1Z7S2 1W6OB 2ZHNA 3AZXA 4ORFA 2YZ4A 3ZYPA 4TZDA 2EXIA 5FRAA 4YYOA 3CEWA 2PHRA 2Q1ZB 4PBPA 3WLUA 3AFKA 3IIAA 2YGMA 4ZU5A 2BGCA 3LSDA 4LA3A 3KGLA 4PLOA 2ILMA 3IDCB 1WD3A 4M3CE 1C4RA 2WWSA 3JBG3 3H50A 4N43B 4YRDA 1RUE1 2D7FA 3AZZA 1WW5A 3TNPB 3ILNA 1QXPA 2VVFA 3ZFGB 4RR3B 1YFUA 1RUOA 4FPYA 4UW6A 3RPQA 1FOD1 5KXCA 2XVKA 2R16A 2WNUA 1BBT3 4M3CA 5BNOC 4MSVA 1TE1B 1ZA4A 3AMMA 1GICA 2CAVA 3VV1A 3LWCA 1RUD3 3KSCA 4HK8A 1D0HA 2QJVA 4IV3B 1O5UA 3KQRA 1UU6A 1REDA 5FAXA 3ZN5A 4XW3A 1DFQA 1JTZX 1AR63 1PGL2 3NVCA 1MS8A 4GKYA 2QVSB 4QPIC 1G9DA 5LEJA 3WR0A 1GQGA 4B4PA 2WSVA 1HKDA 2KA3A 3ZFEB 5A3LA 2D3SA 3M3QA 1W0OA 4K3UA 3ZSMA 2MNGA 1AR71 1RUG2 4K9SA 1G86A 4LHLA 5JR7B 4XJAA 3D82A 4AFCA 2OPKA 4HVOA 2NMOA 3OY8A 2V73A 3VBSC 4XJUA 4COWA 2EXKA 4J1WA 3SLIA 3WCRA 1GYKA 2K9ZA 4RL7A 3KMHA 4LO7A 2HKXA 1H4HA 1AXZA 2HWD2 1V6MA 2P3KA 2EALA 2YPJA 4N7UA 3OTFA 2BVBA 5IK5A 4AEJA 4GA9A 2O8QA 2BTVC 5GALA 4W6YA 1HDKA 4YARA 1DGLA 4C1XA 1IHMA 4YZ2A 5CFCC 5JLVA 2LTNA 2JG8B 3ZO0B 3GBGA 2HWB3 4FO9A 1QJU2 3OBRA 1VALA 4Q4Y1 1AX1A 1R083 1YYNA 1EAH3 3KT4A 3WOGA 4M01A 4YM2A 2Y26A 5T55A 3ZSEA 1M06G 2RS53 1RUF3 1QKQA 1FV3A 1YO8A 2PHXA 2W52A 2D97A 3PJYA 4WV8A 2OUJA 1G9FA 2QFEA 3TN91 4IEWA 1FMD2 4XEZA 1KRIA 4Y20B 4JTNA 1DGWX 2D6OX 1BKZA 3AM2A 2RS12 3CLPA 1X50A 1AUYA 3VKNA 2XBO1 1VBA3 3RJRA 4ES9A 3SCGA 1SLTA 4Q1PA 2B9UA 3FJSA 5FO9B 1YJLA 1S0EA 3JQXA 3X29B 5BNQA 3NV3A 1H1IA 3M3EA 2VOVA 3FFQA 3GHNA 5J3UA 2WQ4A 1WMDA 3ZN4A 2DVFA 2XKPA 1QOTA 1UD1A 2P2KA 4AGGA 2WFF2 1S1AA 4M3CF 4TWTA 2RMU3 3OGJA 3P3PA 2BWAA 1PZ8A 2H6BA 1FI2A 5JOXA 1VBD3 1DZTA 2IFRA 1LECA 1QDOA 3RRDA 3B3QE 1NCQB 2CGNA 2VNGA 2WS91 5GJ6A 2A3XA 4QM8A 4XFFA 5C9AA 1SLLA 2VXRA 2ZGKA 4FOVA 4JDMA 2JE9A 3ATGA 1O4YA 1IPJA 4QQLA 1MS1A 1LOFA 3UKVA 2CGOA 2DUOA 4XYXA 2XL9A 1Q3EA 3RG0A 1YNAA 5JMCA 2ZGRA 4EWAA 3M1HA 1WD4A 1PIV1 2ZGOA 1HRI1 4RD7A 2D43A 3VLBB 1CGPA