4GWJA

His 62 mutant of the lectin binding domain of lectinolysin complexed with lewis b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
PVETENIARGKQASQSSTAHGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the Lewis antigen specificity of the cholesterol-dependent cytolysin lectinolysin
pubmed doi rcsb
source organism Streptococcus mitis
molecule tags Sugar binding protein
molecule keywords Platelet aggregation factor Sm-hPAF
total genus 38
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4gwjA00
3W5NA 1EUUA 4QB1A 3WEZA 3DECA 1JYVA 2X05A 3SEPA 1T2XA 1UX7A 1WKYA 2YC2A 5IHRA 4A45A 4A42A 1JZ6A 3CZJA 1H6YA 3A7QA 5IFTA 2W47A 3HEIA 5DPNA 4LPLA 1JZ5A 3UESA 4ZXEA 1UXZA 1DP0A 4CVUA 3U37A 2VZ1A 3BN6A 3OGRA 1OT5A 2R7EB 2VZSA 3HNBM 3IIIA 4DUXA 3MV01 1JZ4A 1ULOA 3WNLA 1GMMA 1EUTA 2L9LA 3T2OA 3HNMA 2QQOA 1JU4A 3ABZA 2VMDA 4UAPA 3GM8A 4ARYA 2WABA 2VTFA 4RN5A 4MGQA 3FN9A 1XPWA 1BHGA 3CDZB 1GOGA 4XUPA 1UY1A 1K3IA 5LCWL 2BZDA 3T2PA 3WNOA 2V4VA 2YFUA 2JKXA 3C7OA 3UNPA 1GOFA 2J1UA 1UMIA 3C7FA 1OF3A 3EB7A 3K4DA 3ZM8A 4A44A 1I5PA 2VZUA 3C8XA 3WF2A 1K45A 3IDAA 2QBXA 5FUIA 3OGVA 4AAXA 4ARXA 3IB3A 3THCA 1US3A 1W8NA 1IQDC 4DXTA 3SKVA 2HYXA 2W94A 2QQMA 2BGOA 5JUVA 1UYZA 4CUCA 1DLCA 2WQ8A 3A21A 4XUQA 3OG2A 1JYWA 3LQCA 3P1IA 4MGSA 3K77A 2OKXA 1O59A 3ACFA 1W0NA 1W9SA 3I2KA 4XVHA 4D8MA 2LW8A 3K4ZA 3VD4A 2ZXQA 4D0QA 2VOTA 1XC6A 1LNSA 3LEIA 2C9KA 5LA1A 4MO3M 4Z2AA 2VR4A 2E26A 2QQNA 3SEEA 2X10A 2EICA 4QB2A 1O8SA 4JX0A 2VCAA 2WO2A 4BXSV 1UY0A 2Y6GA 4MOAA 2WN3A 1PMHX 1JU3A 5EJ1B 3PUHA 3VD3A 3ETPA 1H6XA 1OH4A 1P8JA 1UY4A 3FHAA 2VZOA 2Y6HA 4W50A 4AG4A 2V72A 5B4NA 2ZEWA 5IFPA 1PX3A 1JYXA 4OYUA 2J7MA 4OUEA 2PQSA 2EIBA 3W5MA 2W46A 4W8JA 4TTGA 4PF1A 4ZY9A 2Y6LA 4UOJA 3WNMA 2Z4FA 1TG7A 1UY3A 3EYPA 3A22A 5JXGA 2RVAA 3DYPA 3ACGA 4KMQA 3CMGA 3OGSA 2WUHA 2W95A 3DYMA 4ZZ8A 2B9VA 2VC9A 2W91A 4ET7A 5JMOA 1XNTA 4JKLA 2VZTA 3THDA 5JXIA 1YQ2A 2YB7A 3OBAA 3ECQA 4CU9A 1NUKA 3WF3A 1W99A 2WAAA 5J1XA 2RJ2A 2XQXA 3WF4A 1GOHA 2VCCA 3T0DA 3D3AA 2VCBA 3DYOA 3K46A 2XONA 4XZUG 3HPNA 3MBWA 3T0BA 4BK5A 2QQIA 5IYYA 3JXSA 2W5FA 4CUBA 3AC0A 4HG6B 5G05L 2VZ3A 5EIYB 5JXHA 2YFZA 1UYXA 5IJRA 2EIDA 4QX2A 4GWJA 1UWWA 1US2A 2WBKA 1L7RA 2VMEA 3NQHA 1J84A 1CIYA 2WN2A 3CKHA 4BK4A 2WO3A 2WZEA 4P00B 2Y8KA 3I2HA 4M4PA 1K12A 2B4KA 2VMFA 3C7EA 1W9WA 2BGPA 3WF0A 3T08A 2E33A 3MUY1 2JE8A 2VQTA 4JKKA 1JYNA 1GQPA 1PMJX 1JZ8A 1D7PM 2VQUA 5G04L 2W87A 3NRUA 4L0PA 2VM9A 1CZTA 1CZSA 4JKMA 5JR2A 4XURA 4PT6A 3NJVA 1JZ3A 3C7HA 3MO4A 2VO5A 4LKSA 4XUTA 4JHZA 2ZEYA 2BBAA 5C7GA 4PQQA 2C26A 2ZEZA 3HOBA 2ORXA 1J83A 4GZ9A 4CU6A 3OEAA 2BERA 2WYSA 2CDOA 2VZQA 1K42A 3A23A 5C70A 2YG0A 1WCQA 4FI9A 3WF1A 2KD7A 4GWIA 3MUZ1 4CUAA 2J1VA 4P08A 4LHSA 2WZ8A 4ZZ5A 3WNNA 5HPOA 3LEGA 2VJXA 1JZ2A 4RYDA 4XUOA 3VD9A 3T09A 2JD9A 1NX9A 4QAWA 4QX3A 2J1AA 2VMCA 3IAPA 4LQRA 4QX0A 2ORZA 3PUIA 2W3JA 1O8PA 4QDQA 1JHJA 4DEQA 3FL7A 3HJRA 5CYYA 1W8OA 3CIHA 4OZOA 2JDAA 5DMYA 5A1AA 3NJXA 3WNPA 1NAEA 5LA2A 4KWUA 1CZVA 3T0AA 3T2QA 3WSOA 4W4ZA 2XOMA 2W9XA 2E31A 1XNAA 1GNYA 2YC4A 1RYYA 4OMDA 1UY2A 2VZRA 2W1QA 4DEVA 1DYOA 1JZ7A 2HLEA 2W1UA 4E8CA 2E32A 2ZEXA 3HN3A 3I3BA 1KGYA 4DXSA 3SKJE 2VZPA 5LA0A 3ACIA 4DUWA 4DUVA 4KI5M 3GGLA 1UMHA 4M4RA 1F4AA 1GUIA 4IUGA 4UI9L 4TXWA 2DCKA 2RV9A 2Y64A 3P6BA 3I2JA 5CZKA 4E8DA 3VDCA 3ACHA 5F7UA 3WNKA 5C71A 2C4XA 5I0DA 1SG3A 1W9TA 3K4AA 3HNYM 2ID4A 2W1SA 4BJ0A 4BDVB 2WDBA 3I2IA 1TVGA 2V5DA 3I97A 1OF4A 2X09A 1HN1A 3GXUA 2Y6JA 3C7GA 4QDRA 4A3ZA 4CU7A 2QQKA 5DQ0A 3VDAA 4XUNA 4P5YA 1SDDB 1OD3A 1MPXA 1UXXX 1KEXA 3I2GA 3BGAA 2DDUA 4YPJA 2XHNA 3VDBA 2VL4A 5B4XA 3GDBA 4A41A 4CU8A 2EIEA 2J1TA 2WO1A 3K75B 2W1WA 1F4HA 2W92A 5DN2A 3LPFA 3J7HA 1R64A 2VZVA 3IAQA 5EJZB 3F2ZA 2LS6A 3NNGA 3WQBA 3OB8A 1UZ0A 4QB6A 3VD7A 4DXRA 2J1EA 4A6OA 3LE0A 1JI6A 3VD5A 3FHQA 1NKGA 1PX4A 5JXJA 3UETA 2DCJA 2CDPA 2J22A 4MADA 1L7QA 1UYYA 3CZUA 2QQLA 1GU3A 3CQOA 3I3DA 3I2FA 2QQJA 4QPWA 2J1SA 1SHWB 4QDSA 3OEBA 4QX1A 4OMCA 3MV11 2WAOA 4A4AA 4P02B 2Y6KA 2J1RA 5HXMA 3LEKA 3LPGA 1ULPA 3E1F1 1CX1A 3I3EA
chains in the Genus database with same CATH superfamily
4FFIA 5CIRA 3GNEA 4MLOA 2RS31 5KHIA 1EUUA 1XQNA 2RM23 4LBNA 1VAVA 1AL0G 4P9WA 5BNQA 5JZGA 1DCSA 1YO8A 3GZEA 4HK9A 3Q8AA 2DFCA 1WKYA 3GHNA 5IHRA 3KHBA 3CZJA 1H6YA 3GZTB 5IFTA 5FYHA 3AMHA 3AVSA 3UESA 3ZO0B 3AL5A 1PO13 3M1HA 5K0UB 3SXWA 3PU3A 2VZ1A 3AMPA 3LF7A 5FZDA 4AI9A 4N53B 3OGRA 2R7EB 1VB2A 1MQTA 1UX6A 5JSPA 1SLIA 3MV01 1ULOA 1W2TA 1YYNA 3MIEA 2YXSA 2R32A 2QQUA 4GMP0 4LITA 1EUTA 2AEYA 4C90A 2QQOA 3ABZA 5IAXA 3VBSB 2VOVA 4ARYA 4EN8B 2FHRA 3AKSA 2XWBB 3MPPG 2ZGSA 4OLLA 4RN5A 3FN9A 2A7AA 1XPWA 1VBE2 4WZFA 1LEMA 2PLV1 1MS5A 4H14A 1AXZA 1UY1A 4BM8A 5LCWL 3ZFGB 3U14A 1AX0A 3V65A 5LWBA 4QU1A 1UNBA 2BJSA 1ZVFA 3EHKA 3C7OA 4NIGA 3L2HA 5FYUA 2BQPA 1UMIA 4RFRB 4ES9A 2I45A 1LHVA 1XNBA 4CE8A 5JLVA 1OF3A 4AVVA 1I5PA 2VZUA 3URFA 2OQ6A 3ZN5A 3PVEA 1YQ6A 1UZVA 3NKGA 3AP9A 4JQTA 4JTNA 4LMFA 4UFIA 4XFGA 1W8NA 3EXUA 1RUF1 3ZSMA 4BLJA 3ALQA 4LK6A 3J7NA 1XXNA 1COV1 2YHJA 1WA6X 3VZOA 1K5MB 5B2GB 2OUJA 3FWEA 5JCTA 3RQ0A 1BEV1 4OFGA 3AKTA 4QX8A 3UGGA 1D0HA 3AMNA 5K9YA 2BGOA 5JUVA 4PBPA 1HJGA 3M3OA 4XJWA 2JG9A 2WQ8A 3A21A 3PDQA 4UW4A 1TME3 3KF5A 3OG2A 4UFLA 3H42B 5EWSA 3S6PA 1JYWA 1FI2A 5LEKA 3LQCA 3N9QA 1DGRA 2LM3A 1SLBA 1OLMA 3DEMA 1DQ2A 4MGKE 3KHCA 3K77A 4CCMA 2JWPA 3K48A 4XF1A 2JB4A 1Q8PA 4K9SA 3E97A 4AYUA 3UKTA 2XKOA 3NNLA 4ZU4A 4D8MA 3U75A 2Z69A 1HRV1 3IZOA 4XTPA 4YRDA 5J98B 1O3SA 3LA3A 4WM7A 4N7UA 5A7PA 3VD4A 3I2OA 1NCQA 3CBNA 1W6QB 3LEMA 3VDDA 1ASJ1 2IWGB 2VOTA 3FZ3A 5BNOC 2NYYA 4Q1RA 1VRH2 1MZEA 1W3VA 2RJLA 4BLIA 3LEIA 2FDIA 3R6SA 3T2TA 1WLWA 2C9KA 3ZYBA 3VZKA 4Q4V2 3FHIB 1G9DA 1UQXA 2JXAA 1GBGA 3R0RA 3BTZA 4Z2AA 2VR4A 4FP2A 4KNCA 2NM1A 1QQP1 2R063 3FBMA 4FFFA 4URTA 2A1XA 4LIUA 3PTRB 2A3WA 4QB2A 5CVRA 2I74A 4JX0A 5C3OA 2BFUS 4XFCA 5EPAA 1RTVA 1FYUA 1GWMA 1QJY1 4BXSV 1HB4A 3EJKA 3S5AA 1QHDA 3H8UA 4K1YA 2RR11 1UCXA 5JOWA 2NPIA 4IV1B 2XJQA 2HBUA 2ZZQA 1QJY2 1VLNA 3NAPB 1TME1 5FPZA 3VBSA 1R092 1UKRA 4D7YA 3M3EA 2Z5WA 1LB2A 1RVF3 1V6KA 3H8RA 3FHAA 2PMWB 4CDXC 1N1SA 4AG4A 4AQ2A 4K40A 3ZIWA 1ENRA 4AEMA 1GWKA 5FZFA 3AP6A 1YJKA 4Y1UA 5FZ1A 1Z7S1 1WMDA 1QQP3 2VVDA 2AR6A 3TN92 5IFPA 4DINB 2J7MA 4OUEA 2PQSA 3JBG3 4FQ4A 2FZ2A 1PZ7A 2EIGA 3LIGA 3TN93 1YUDA 2EIBA 4MX3A 1OVSA 2W46A 1I3HA 1CR7A 4RHV1 4V2WA 1SBDA 4QGLA 4PF1A 5DAQA 1BVP1 4AI3A 3MIDA 4AHYA 1ZZ8A 4HOOA 1G9CA 3LB9A 1DHKB 5FWJA 2OPKA 4D7TA 5CB7A 5BNNB 1AYM2 2CWMA 2AEZA 3KGLA 3B5LB 1IG0A 3DYPA 3DCQA 2XVLA 4GALA 4RFT0 4KMQA 4CDQA 1AR83 3LFIA 3LA2A 4YW6A 1IS6A 4QHBA 1YCIA 3NJZA 1ODNA 4Y5SA 5JMOA 5FPBA 4JRAA 1OQ1A 3JBG2 5DDJ3 3RSJA 3O1VA 1C1FA 3HWJA 3THDA 5JXIA 3KT7A 5CKNA 1YQ2A 4Q29A 3UKNA 3ASIA 3OBAA 1DQ4A 5BNPB 1Y9MA 3ZFEA 5FZLA 4W6XA 1D4VB 2P3YA 1ALYA 3WF3A 1H8VA 3AK0A 1S4CA 2VECA 1UZZA 1GQHA 5C4WC 4IL7A 1RHI1 1NLQA 4NRMA 2RJ2A 2XQXA 3MFAA 3QACA 3WF4A 4D94A 2GH8A 1L7LA 4Z07A 2VCBA 3OJBA 1DGWA 1FAYA 4Q8KA 2RDSA 4GB32 4I0WB 4IETA 1GANA 2QE3A 5I8TA 1GZWA 3B94A 4Q5OA 4MVTA 4HLTA 3MBWA 2XLAA 1H8TC 2WWUA 1GP6A 1C5HA 3F95A 3O0VA 4HT1T 5IYYA 2W5FA 4XFBA 1GLHA 1FOD1 2TEPA 1Y9GA 4HG6B 5ERLA 4CDUC 2VZ3A 2SBAA 4IV1C 4QKFA 5JXHA 4QXHA 2RS33 2HKXA 1KDMA 2LUWA 1AL23 4GWJA 5BNNA 4XQ4A 2NP0A 3RYPA 1UO9A 1ND2C 4CDXB 2A3XA 2Y38A 1GR3A 3TB0A 3J9SA 1HV0A 2XMLA 1STMA 1UZYA 4XBQA 5K0UA 2VW2A 4R4XA 5KHKA 1QDOA 4XZPA 4YNIA 4BK4A 5DDJ1 3HBZA 4AK3A 4CA9A 4ZS2A 2WT2A 3CJIC 4AVBA 1PHMA 4GMP1 2YPDA 1I6XA 1G6NA 1NE4A 3V0AB 3FBYA 4M4PA 4DQAA 4Y4YA 1YQCA 3SCGA 5A3UA 5DAPA 4LA2A 1DYKA 3LDRA 1VBB3 3M70A 1PZ9A 1NY72 5GJ6A 3ST7A 5T3NA 4RR3B 5EXOA 3QH6A 2RDRA 1PO22 2ZKLA 2BGPA 3AFKA 4XQDA 5FK8A 3T08A 4CYDA 3MZHA 5J48A 2R072 4NN0A 3KF3A 3AZZA 2D44A 4D69A 1NLRA 3SLIA 3ACLA 4LO5B 2HEVF 1ULGA 1HXS3 4L0PA 4LO7A 5L36A 3I59B 4F7ZA 4IEYA 2NZ9A 1JS9A 5FYIA 4Z1VA 4KG0A 1LESA 1UZWA 5JR2A 2VMIA 2DU0A 5FPXA 3NJVA 1GWLA 1JZ3A 3C7HA 4DRRA 5FYCA 3USUB 2B9UA 3VKLA 3BIEA 3UK9A 4LKSA 3ES4A 1NY71 2VBPA 4JHZA 2UWBA 4LTAA 3ZFFA 4Q8LA 2PHDA 2KXLA 2WZR3 1UIKA 2ZEZA 3WLUA 4WV8A 4JAAA 5KXCA 2I2SA 2D5FA 1C4RA 3POWA 1NXD1 2KM2A 2JE9A 2QKDA 3H3ZA 4QQOA 1A78A 2C9AA 1FXZA 1W2UA 4A3XA 5AC92 2WNVC 1K42A 3A23A 5FZKA 4HVOA 3JQXA 4LBKA 4X6QB 3WDUA 2P2KA 4R9DA 3ZX7A 1B09A 3NNJA 3WF1A 5C8CA 2KD7A 4GWIA 4Y5Z0 2HWB3 3JD71 2E51A 4GXLA 4D3WA 4P08A 1AX1A 4QX5A 1XSRA 5H9QA 3WP4A 5FRAA 3RFRA 1AJOA 3HN1A 4G4FA 4FPEA 1HRI1 3S30A 4CDXA 1FOD3 4XUOA 2CV6A 3D0JA 1FOD2 3PIJA 1RUD2 1FPN3 4TN7A 1NX9A 4C91A 2CGPA 2VMCA 4H55A 3SQOA 4LQRA 1Y3TA 3GJAA 4DS0A 3JZVA 4LHKA 2ZABA 1X7NA 3SNMA 5GLWA 2RJKA 3BALA 4X8PA 3LAGA 4MGIE 4DEQA 5FYSA 5A3PA 3GCWA 3KD4A 5CYYA 4EN6B 4E2GA 1W8OA 2XBO1 1UOGA 3KV6A 3CJXA 1PGL2 5A1AA 3CU7A 1IGOA 2UY8A 3JUUA 3NJXA 4RR3C 4XFIA 3S5QA 3ZPOA 4CP9A 1ZRFA 2WNUB 2DBNA 3WSOA 5LB6A 5IATA 2XOMA 3AB0A 2W9XA 1PO23 4NR1A 1XE0A 1K5MC 1UAIA 3DPRC 5IW0A 2UU8A 4UYBA 4PIYA 2FCUA 1BK1A 1PO21 1LECA 3BB6A 3I2DA 2CGNA 1AVBA 2AYHA 4IESA 4A2UA 1AR62 3MYXA 5C8CB 1VE0A 5C6CA 2E32A 4UFMA 3T3YA 5FZ4A 4AEDA 1MEC2 1CAWA 4AI8A 1PM4A 1N47A 2ARXA 4RL7A 2JG9C 2CAVA 4MV2A 4DUVA 4KI5M 3WX5A 1JW6A 1UKGA 3WP5A 4ZPIA 3ZFFB 1RUI2 2BU9A 1GUIA 2Y6FA 1Q8VA 1YFUA 2C0ZA 4ISQA 2DCKA 3E5XA 4PLMA 4U36A 5CAZA 1J1LA 2Q1FA 4E8DA 4P9YA 1PVC2 3ZYGA 5F7UA 2WFF1 1LHOA 5C71A 2C4XA 4JTOA 5I0DA 3O1MA 2EXIA 2ZX4A 3K4AA 2ARAA 3LCPA 3L9JT 2RM22 5FZGA 4BQ5A 4R8HA 1QXRA 4YW3A 4PJYA 1U12A 4NIAA 3PHMA 2VTXA 2FDFA 1CN1A 3I97A 1KRIA 3KCXA 3P3PA 4NJ4A 4KG8A 4Y22A 1QJEA 2D3RA 3N35A 4CCDA 1JTZX 1NCRB 2XL7A 5DQ0A 4CU7A 3RZMA 1ULEA 5FLHA 1VAMA 3IDEA 3ZPYA 1OFNA 1SPPA 2YU1A 3VBFC 5F5QA 2BOIA 5CU1A 5GLZA 2JENA 4DRVA 5JWPA 4R9BA 4YWAA 1UYPA 3BGAA 3POEA 1JYCA 2DDUA 2O8QA 2NN8A 2WZR1 2X5IA 2JD4A 3M4FA 4YPJA 5L7OB 1LGBA 2PELA 4NOTA 3U4SA 2DVFA 1KFUL 3AKPA 1XNDA 4UF0B 4ZU5A 5EZWA 3VBRB 4BQ3A 5JOXA 4CU8A 1H4HA 1IS3A 4CEYC 4EJRA 3PURA 2Z2SB 2EA7A 1LHUA 1F35A 2WSUA 3IAQA 5EJZB 2LS6A 1AYM3 4IEWA 4PLNA 3LSDA 3HMYA 1UZ0A 1W8UA 1WMXA 3POJA 3W58A 3VD7A 4EWAA 2RS52 5A1LA 4KWKA 2D93A 2D5HA 5J7MA 1MZ5A 3N36A 4E27A 1IPSA 4JGZA 1G7YA 2G4IA 1PX4A 5CBLA 4BIFA 5JXJA 5ANNA 1GQGA 1N1TA 4YGEA 3HR9A 3UETA 1CQ9A 2XLFA 1VBB1 4HONA 1OSGA 1W6PA 5BYNA 4LBLA 3RGBA 3I7DA 5LY2A 1OQEA 2BYVE 3O0XA 1ACCA 4FPLA 5I8YA 5BXXA 4GMP3 3ZMNA 1EYBA 4QPWA 3NJYA 5FPVA 3E6BA 5FUPA 5H9RA 1RUG2 1S2KA 1HB2A 2PHWA 4KWJA 4AL9A 5FZOB 4CXWA 4XF0A 3MV11 1AZDA 2ILMA 1LTEA 1PVC3 1A3KA 1WCUA 2ZGNA 3J7MA 4IV3B 4Y22B 5LBBA 5E16A 1LU2A 5FZ6A 5ABJA 3I3MA 2C5DA 3LPGA 3IPVA 1MZFA 2A70A 3RJ2X 2PAEA 1S0JA 1RUE2 2VTXJ 4EZHA 2BV4A 3CHXA 4UW6A 1NCQB 3VDDB 3ZFEC 2YDEA 4NPLA 4QXCA 3ME2A 2PLV2 3DECA 4XETA 5FYMA 1E5RA 3P3NA 2O1QA 4BQXA 1EV12 3M8LA 1JYVA 4S2FA 2VXRA 5IT6A 3ZSLA 1IS4A 1MEC3 1R1ZA 2BGCA 4M00A 2X05A 5DUXA 1XOYA 4N53C 1J3RA 5DAWA 3VHRA 3VBFB 4A42A 4HXCA 5KC5A 3A7QA 4UWDA 1RUOA 5DPNA 1D2SA 2VNOA 1G9FA 4AFBA 5F5CA 4BQ1A 5FIXA 1IKQA 1F8VA 4R9CA 1LHWA 3RG0A 1HRI2 4JV4A 1QIQA 4JGYB 4A7KA 1DGWX 3H8XA 3MIBA 3HNBM 4V2VA 1W6QA 3ZSKA 3WP6A 2VAUA 3GBGA 4XHBA 4YFZA 3PVNA 4ZHNA 1HJFA 3KZ4C 2CGOA 3E5QA 2J42A 5LBEA 4URAA 2CTVA 4H7LA 4L8QA 1YIPA 5A32A 5A3LA 1VBB2 4F83A 2GDFA 4XACA 1CWPA 2FD8A 1C1LA 1NE6A 1SACA 3NV1A 4UFJA 1FX5A 1C28A 2WC2A 4LE3A 1AHSA 4DFSA 5CFCB 4PHZA 3GM8A 1VR3A 2AC1A 1N3PA 4D7SA 4RGKA 4XF4A 1QXPA 5FY1A 1D0GA 1BHGA 1DGRN 1GOGA 1EAH3 2XGXA 1AYM1 1RUG1 1BEV2 4LBMA 4XABA 1PIV1 4KQ7A 3VZJA 4FPYA 2VE1A 3WNOA 5LK7B 2N7GA 1PK6A 1QXJA 2G19A 1XYOA 2JKXA 4R9AA 2GNDA 3AYEA 1VBD3 5A6YA 3UNPA 2J1UA 1TNFA 4FQZA 3U78A 2D6PA 3EB7A 3K4DA 2Y60A 3ZM8A 5FWEA 4MZUA 4A44A 4HSJA 3WINE 4CP2A 4RHV3 4BMBA 1CPNA 3WF2A 4QM9A 5T55A 1QJU3 4AAXA 2D3SA 2QBXA 1POV0 1DU3D 2W52A 5FUIA 4ARXA 2PHRA 1IQDC 2BW8A 4FT8A 4QKDA 1BBT3 5LY1A 4MGZE 1POV3 4QPYA 4A7YA 3USSA 1I5ZA 1IQAA 1BBT2 1IHMA 1RC6A 2JDYA 3M3CA 1QJX3 3NKTA 4HMZA 3B9CA 5T54A 4C0HA 2ZX1A 5AC93 4CUCA 1POV1 2YC0A 1RVF1 2BWCA 1Q8SA 2QQWA 4KU7A 2FMDA 3GHMA 3A4UA 1NCQC 3VDDC 1R1A1 2R062 1RUJ1 1SLTA 4YVSC 4LXLA 4FOWA 4CCOA 1MS4A 1O59A 5GKAC 4XYXA 4Z8BA 4OHXA 1WCSA 3I2KA 1KDKA 4OI4A 4XFAA 1YFXA 1K5MA 2ZMKA 1MQTB 1QH6A 2FDGA 4JGYA 4AHWA 2HWE1 1R091 4LK7A 4CXXA 3ON7A 3O0WA 4WVMA 1GZ9A 3WW3A 1JBCA 4FFGA 1PGSA 3Q9OA 2YBKA 2OVUA 5FY4A 4XMAA 1H1IA 5FZMA 1OD5A 2JG8A 3IDBB 2QQNA 2DVGA 3SEEA 1FV3A 2P3KA 3LSEA 4K7JA 3NWKA 5FZ0A 1O8SA 2DCTA 2VBDA 2XUMA 1POQA 2ZGKA 1F15A 4MH0E 1GFF2 1H2NA 5IVCA 3RZGA 5HV4A 2HWF1 2Y6GA 1RUNA 3TWIA 1OH3A 3B93A 2WN3A 1PMHX 1W28A 3SITA 1H9WA 4P9IA 5JIUA 3ETPA 3WCSA 1AR71 3KQRA 1Q8QA 4M3CB 3IN9A 1DDLA 2WNUC 2V72A 4WVMB 3WG3A 5A7WA 3VKMA 4CPBD 4BWOA 1BEV3 4MGYE 3LOBA 1CAWB 4OYUA 3N9NA 1MEC1 1X36A 5A7QA 2XBO3 2FBEA 3RNSA 4B4QA 5DZGA 2R49A 4NIDA 5C8CC 1YQ5A 1V6JA 5F3GA 4W8JA 2CHHA 4ZY9A 2UY9A 2DTYA 4MYEA 4CP1A 2A6XA 1W6MB 4OI1A 1JYIA 1BMV1 2OUHA 2Z4FA 4JRLA 4I2OA 3EYPA 3TOJA 1WD4A 1R082 3ETQA 3K2OA 4S2HA 4IEVA 3APBA 4LUKA 4XXAA 2FQPA 5D8AB 5GZFA 5A33B 5JXGA 3ZFFC 4S2DA 5JZGB 1RB8G 4I30A 2ZGLA 3ZYRA 5ACA3 3FFQA 3OGSA 1C8M1 1SPPB 1W8FA 1QOSA 4PBOA 3N7JA 2WT1A 4ZZ8A 1AYN1 2FCVA 2VC9A 1AR63 4K20A 3UKVA 3VL8A 1ZBE1 1W6NA 1HB1A 2BEOA 1DZQA 2VZTA 1AR93 3NV2A 2P3IA 1JOPA 3PMEA 3R4DB 1H2LA 5DDJ2 3ECQA 3LGRA 4D6QA 4CU9A 1W0OA 5I93A 2G9FA 1NUKA 3THPA 1LGCA 1HDKA 1XNKA 4AGGA 1GOHA 2B5HA 2ES3A 4AFAA 2E9QA 1O6UA 3AFGA 2DUQA 3MDPA 3QBQA 1NCRC 2XONA 5APAA 5GZCA 5CKMA 2X29A 3H1MA 3RYRA 5EHDA 4XZUG 3ENRA 3QD6A 5FKCA 4QT6A 2TBVA 2YU2A 3BPZA 5FMBA 4BK5A 1VMHA 4MG2A 1U5YA 4YZ5A 4QPIC 3VBUC 4YLZA 2Y0IA 5FO8B 4CUBA 4LORA 5EQUA 4YM3A 1SFPA 2A6VA 2YFZA 1UYXA 3ZDSA 2OS2A 4FAHA 5A3NA 4QX2A 2QJVA 5A33A 3NQHA 1TE1B 3H1WA 5F5AA 3MF9A 4J6GA 3AJZA 4NWVA 1SFNA 4RS5B 5FYYA 2ZHLA 4DIQA 3J8F3 1V9U3 1KXGA 1VBC2 4KL1A 4NMIA 2WZEA 5GM0A 1G9AA 1SFYA 2QNKA 2XLGA 4NAMA 3S57A 1ZRDA 5L9RA 5CISA 3BTYA 1ZX5A 4TLGA 2YBSA 1ZRRA 4Y1VA 3VKFC 4CEYA 4COVA 1QJU2 3PJYA 4NHMA 1IZ3A 1CESA 5AVPA 3WD5A 1QF3A 5J96B 4OQ8A 1MZ6A 2P6CA 5FPLA 1EY2A 4HVRA 1HQNA 3PTYA 2O8OA 2ZCWA 1XRUA 4FPKA 1VBA3 4AEJA 1R083 2H0BA 2VMFA 3JQWA 1OVPA 2HBTA 3K3NA 4ITCA 2JDPA 5D8AC 3WF0A 4AEKA 2IXJA 4JKKA 2VQTA 2JDKA 1VP6A 2RMU3 5DAXA 4MSVA 1GQPA 2IZWA 1JOBA 1RINA 3H7JA 5J3UA 3ZXJA 5F37A 4LA3A 1JZ8A 1D7PM 4M3CF 1MS8A 3V0AA 2W87A 2Q5TA 3D0SA 4UT5A 1GP4A 2H6BA 1DQ5A 2YZ4A 3A0NA 1LOEA 4UBGA 2PAMA 1XNCA 2PXJA 3LZZA 1PNGA 4XURA 2A75A 2BTVC 2BWAA 1OI6A 2DUPA 4YVWA 1PVXA 3MO4A 3LFMA 2VO5A 4FP3A 4UW5A 4J1WA 4XUTA 4CEWA 3TNPB 5F3EA 4FXKB 2CU5A 1YC61 5T5PA 3UJQA 4BYYA 5C3SA 5C9AB 3VHOA 2PN5A 4Q4V1 3VZLA 4BH9A 1RUC3 1VBA2 2R043 1UMZA 3RRDA 1O3RA 4B3NA 4CU6A 3UGHA 1V6OA 2Z42A 2WYSA 4QM8A 1OBNA 2VZQA 3L2YA 5FDBA 1DQ0A 2A6YA 2YG0A 3G6JB 2GAUA 3PUAA 3TYJA 1LOGA 3ZN6B 4BZ4A 4K3UA 2ZAHA 4YW4A 2YGMA 5LEJA 5LRRA 2OPWA 1DIWA 4H2AA 5FZEA 2R041 4AEDC 4OULA 2VULA 2FDHA 2AENA 2D40A 3WG4A 4C8DA 1REFA 4RQPA 2OW4A 4FVVA 4I3GA 2YGLA 2GC1A 3TAYA 1YFYA 3T09A 2VU9A 2CWSA 2PA7A 3WDTA 4QAWA 4FTBA 5CFCC 2BNNA 2YUEA 3IAPA 4M0NA 1OKQA 2ORZA 4AE2A 3D8CA 4Q0UA 1O8PA 1DF0A 4K21A 2WQ4A 3B69A 2EVXA 2XHKA 3NAPA 4K1ZA 1O5LA 1ULCA 4P14A 3TNQA 3POFA 4OZOA 3AXDA 3B7MA 3ELNA 5FXVA 3ZYHA 1Z7S3 1S0CA 1S2EA 3WNPA 5FLIA 3M7AA 5E88A 2ETEA 4IERA 4KWUA 1LEDA 1CZVA 4RQPB 1Q5OA 2VCMA 3OGGA 1C3HA 4LO8A 4WM8C 4IQPA 3AJYA 5I0RA 1XNAA 4LLOA 4OHZA 2FCTA 1X8EA 4LKDA 2YC4A 3DF0A 1RYYA 4XF9A 1ZYBA 1UY2A 4DEVA 2Y26A 1JZ7A 4EQVA 1PO11 1Y43B 2IC1A 3H9AA 2DV9A 2XQRA 3MLJA 3S7IA 3ZN6A 4JDOA 1UOBA 4J1XA 3HN3A 3I3BA 1D4M2 3SKJE 2A71A 1C8M2 1ND3C 3ZYPA 2VH9A 4LKEA 5E6HA 1FMD1 1H30A 3CEWA 5IK5A 3ATGA 2HJIA 3AP5A 4BCUA 1RIRA 1UPSA 1YEWA 5T5JA 4GB31 1Z0HA 3RS6A 1J59A 3TEXA 1ZBE2 1SZBA 4UI9L 1IKPA 1WA4A 5CFDB 3JBG1 2WFPA 3AKQA 3AZXA 4Q4X3 3I2JA 4Y24A 5IVJA 3N9OA 2W0XA 3V64A 4OUMA 3ACHA 5FUNA 1SMVA 3S0MA 2DVAA 4QWNA 1W9TA 3ZXDA 5FLJA 3KT1A 1GNHA 3ZXAC 2W1SA 3UGFA 4BJ0A 2W08A 2GN3A 2OX0A 4YVWC 4X6RB 2EXJA 1WUVA 3I2IA 3FMGA 1TVGA 4UFKA 4YW7A 5K4LA 4XCAA 4DPNA 1RMU2 3AMQA 2EXKA 3EBRA 3KVAA 4IDZA 1RUJ3 1OF4A 3B3QE 2X09A 2XJSA 2RS12 3I3QA 2GNBA 3WG1A 4U2AA 3WHTA 1AXYA 2K0GA 2H0VA 1QJY3 3DKWA 2Y6JA 4XJUA 2F4PA 4AFMA 4QDRA 3WUCA 5CG8A 1ZRCA 3LWCA 4FPFA 4Y33A 4ZKTB 3OD0A 4P5YA 4YARA 2ZX0A 2E7AA 1OD3A 3ZYIB 2Y34A 3AKRA 4JQRA 2ZHKA 3I2GA 2W68A 3PNAA 1COV2 2XXZA 2AZ5A 5D8AA 4FPJA 3KS7A 5FPUA 3WG2A 2ZGOA 3VDBA 1GSLA 2Z79A 5T5LA 1HB3A 3WY6A 4A6SA 4Z92B 4RHV2 4W6WA 2EIEA 2J1TA 3SH4A 5FP7A 3RWNA 5JOYA 2VMGA 2JG9B 4AVCA 1W05A 1F4HA 2EXHA 2PHTA 2WLPA 2W92A 2ZX3A 4KWLA 4NAOA 3HQUA 5HI0A 2VZVA 1PIV3 3P5BA 4UW3A 1PGW2 5I8SA 4NIIA 2OIIA 3OB8A 5FYTA 3GYDA 3VBHC 4AF9A 5K0UC 4DXRA 2J1EA 2HWD1 2R16A 1OLRA 1U0AA 4NHKA 5FP8A 4A6OA 1JI6A 4M0HA 3ZKYA 1CJDA 1FPN2 1PM7A 3JD72 3WV6A 1OXCA 2X53S 1ND2A 2OT7A 3E6DA 5C5TA 1WCDJ 5JZGC 3H7YA 2VUAA 1HV1A 1YHFA 4EZ4A 2UURA 1J3QA 3PU8A 3MGUA 2DCJA 4B4RA 3IBMA 5L9VA 4IV1A 4GH4C 3CL1A 1IPKA 1L7QA 4FPCA 5KWRA 1U5ZA 1RUF3 1GU3A 3AZVA 3VHNA 1BXHA 5ABJC 3I3DA 2IXKA 1RUC1 2RDQA 2XKPA 2XJPA 3FC0A 2QQJA 4LKFA 3WNXA 3WZ1A 3X29B 1SBFA 1WW5A 3LD8A 5IVBA 2BFUL 2LRPA 3W9AA 3WVJA 1NCRA 1RUH1 1EP0A 4OMCA 1LKNA 2PHLA 4A4AA 4P02B 4B1LA 1OUXA 2WSVA 2J1RA 3IWZA 4HL0A 2Q8EA 2QQPA 1ZZCA 4IEPA 5C4WA 5BPXA 2BUKA 3E1F1 4MXWA 2PLV3 2A3YA 3OYWB 5EYYA 5FAXA 1AJKA 2VOKA 4LO6B 5FZHA 4QB1A 2Q0AA 2WINB 4AQTA 1ULDA 4B4PA 2HWE3 3OF1A 2XL9A 1MS0A 1ENXA 1T2XA 1CGPA 4UFHA 2VOXA 3VZMA 3Q8FA 2YC2A 4QPIB 4A45A 5GZDA 1JZ6A 1L3JA 2D43A 2W47A 2B45X 3HEIA 4LJHA 1AR73 4LUMA 3PLQA 4CVUA 1APNA 4RGAA 3WW2A 4HKWA 4Q4Y1 5F8PA 1X82A 2VZSA 5HCFA 3IIIA 2JDHA 1JOJA 4KGGA 5FMCA 3N7LA 4BQ4A 1XJAA 3OYWA 3WNLA 1OPMA 4E4ZA 4OI0A 3BYWA 3OSDA 1AUYA 2ZMLA 3CNAA 1XU1A 2X5IC 5LRSA 1GMMA 3IIAA 5FMDA 3NL1A 2L9LA 1IS5A 4Y20A 3T2OA 1W04A 3HNMA 1RMU3 4IV3A 2RG4A 2VMDA 4UAPA 1B35A 2BVBA 4IGPA 2QUOA 2PHXA 4MGQA 1ZREA 4L92A 1I9RA 2PHUA 1W6OA 3CDZB 1MR5A 3OPZA 4I0AA 1MS3A 1R093 3LOIA 2RS53 1K3IA 4CP9B 3B01A 2WA4A 3JB8A 1WGPA 3T2PA 5DUWA 3BU0A 5T50A 3RZHA 4PIZA 3IMMA 3RJRA 1YNAA 2YFUA 2ZZJA 3FE5A 5T5OA 1J3PA 1GOFA 3KCCA 4L9BA 4E4SA 3BKZA 5BY5A 4FO9A 1F2NA 3MW3A 3BUCA 1RUE1 4CDWC 3C8XA 3RPQA 4QU2A 1W6NB 1K45A 4QXKA 3MPBA 5C5UA 3KQ4B 4BA6A 5EP9A 1EV11 4YW1A 4OQ9A 3ZDVA 1O5UA 2D6MA 2O0OA 4IE5A 2RE9A 4FFHA 2JEMA 3SKVA 2HYXA 4CUGA 2BRTA 1NQDA 5JDBA 1UL9A 4FTEA 1H8TB 2W94A 3MFCA 4PI0A 4K8FA 5I0UA 2XR4A 3VB9A 5A1FA 1UYZA 1ZBA3 1K5JA 1QKQA 2MHFA 4Q0VA 1NXMA 2WRAA 2WS91 1HW5A 3GZUC 4TWTA 4FAGA 1ZBA2 1ZZBA 4XUQA 4UXAA 1AR61 4I0BA 3UV9A 3M3IA 4JC1A 1OA4A 1UN1A 2MEV3 1XYNA 1RUI1 4CCEA 4MGSA 2IFWA 2OKXA 3DXTA 4Y20B 2BNOA 2RS13 1MVEA 2P17A 1W9SA 3KLSA 4IGOA 5F1RA 4XVHA 3AYAA 2XJUA 3MIGA 3VBRC 1REDA 4AEDB 3WQ7A 1LOFA 1GZCA 4NIHA 1RUC2 3DPRA 1W9YA 5FXWA 1BZWA 1RUD3 5LASA 3T4HB 2A5ZA 4MXWB 2H6CA 1UU6A 2VMHA 2ZGRA 3LA7A 3T1LA 1V0AA 1VMJA 3NMBA 4EN7B 5FZAA 5FCCA 4Q4X2 4YSFA 4RD7A 1UPIA 1MS1A 3OBRA 4UF0A 2E26A 5J36A 3ZN4A 5FZ9A 2F17A 1WZXA 2UYAA 4GA9A 5IK4A 1YRZA 4BMEA 2ZBJA 2VCAA 1V6MA 2ZJCA 3MEPA 2WO2A 2ARBA 1N3OA 1RUH3 2VNGA 4FOYA 1WMEA 5KXEA 3QCWA 4DOUA 4OHYA 2HYKA 3I8TA 4DXZA 4WBBA 4MOAA 1RUJ2 1HQWA 4AFCA 3SISA 5FBJA 1E5HA 1JU3A 5A3WA 3PUHA 5FQ0B 4AGRA 3ILRA 3SC7X 1O91A 1TEIA 3VD3A 3H0OA 1OH4A 4PLOA 4RQPC 1UY4A 5IVYA 1AR82 2Y6HA 4XJ9A 4W50A 2P5BA 2K9ZA 2V73A 1PO12 3GZAA 2ZMNA 4B1MA 1B35C 4COZA 2Q1MA 1PX3A 2AUYA 3H1YA 1OOPA 2R1DA 4IV3C 4DZGA 5CEHA 2HWD2 4XFFA 3RYKA 3V0BB 4TSVA 1GV9A 3MI8A 5FYZA 5JOZA 1W8WA 2RM21 1S0GA 2GC2A 3AP4A 2CY6A 1O4TA 2D6NA 4FOQA 3ORJA 4OI2A 4UOJA 1MQTC 3WNMA 2WNVB 3B00A 5JSOA 4N9HA 1UY3A 1SLCA 1UW8A 2DFBA 1H2MA 1W2AX 3O1RA 1J58A 1LODA 3A22A 2P3JA 2RS51 3ZOIA 4MUVA 3ACGA 4KGQA 1ZZ6A 2Q8DA 2V4AA 2E7TA 2ET1A 3CMGA 2MEV1 2WUHA 2W95A 4Q0PA 2B42B 2DU1A 3CJIB 5BV6A 2G9GA 1XE7A 3LIHA 5LA9A 2B9VA 5ACA2 3GBWA 2QVSB 2YYOA 2W91A 4FPHA 1RMU1 1DZTA 2WS93 2EAKA 1XNTA 3ZYJB 3RI9A 1V70A 4QPGA 4P9XA 5FYVA 2DF7A 2YB7A 1VBC1 5FMOS 2ATFA 4J25A 1RUF2 2C6SA 5DXDA 2PQQA 4I02A 2ZTNA 3VKOA 3ZLIA 4NRPA 1BCXA 3POIA 2VVEA 2O14A 3FLRA 4M01A 3ZFGA 3KWVA 2VCCA 5DABA 3WW4A 5KXBA 4BIOA 1V9U2 2GZWA 4W6YA 3TRSB 1DFQA 3DYOA 3K46A 4BQYA 4AW7A 4Y1XA 2ZGTA 1QJFA 1PMIA 4QMAA 1VBD1 4JHTA 1W2NA 4BHPA 3ROUA 4QX7A 1ZZ7A 2QQIA 5JI7A 5A32B 2VNRA 1UIJA 3WR0A 1RGSA 4QKBA 3N9MA 1WD3A 4Q27A 2HWC1 5IAVA 1HXS1 2CSGA 3AC0A 3M3QA 5G05L 5EIYB 4E4DX 5IJRA 1A6CA 2EIDA 1WLTA 2R1BA 3CO2A 1US2A 1TMF2 2VMEA 2W2IA 1V6NA 1C8NA 1CIYA 3GALA 3FLPA 5BNNC 3CKHA 1TMF1 3ZXKA 4CXYA 1S0FA 1UD1A 3D82A 2DVDA 1OA3A 5GZEA 2DTWA 2V5YA 2K2SA 5FY8A 4AQ6A 4XFHA 4DO0A 2DYCA 5HXVA 4PDWC 5F32A 1VBD2 2WO3A 3VLBB 4HANA 5EV7A 5C33A 3WQ0A 3V0BA 3NO8A 5A7SA 4QPIA 1X33A 4E2SA 5A80A 1VAKA 2JDNA 3ZSJA 4P00B 2CYFA 3RWKX 2IFRA 3ZKUA 4NVPA 1XYPA 2R0HA 1C8M3 1WBLA 1YFWA 4IXLA 4XXPA 2DCZA 5FZIA 1AF9A 3AZWA 1ASJ2 1U5IA 4INDA 3BI3A 1K12A 2B4KA 2ENRA 1ST8A 5GLTA 2ZPXA 3OUHA 4NHYA 4XJZA 2QFEA 3WDYA 5FY7A 3C7EA 3ZR5A 1QNYA 1XB9A 1YWKA 4JCKA 4ZS3A 5IVVA 3FX3A 2E33A 4GAZA 3MUY1 5C4WB 3MLKA 5L9BA 3M2MA 4E9KA 4F8AA 1E5SA 3JB4C 4EV0A 3W20A 3UL2A 2MNGA 4Z2WA 3POBA 1KITA 4ONUA 4ATEA 1OLQA 1XU2A 2VQUA 5H9PA 5G04L 2OXBA 3IT8A 2D97A 4XEZA 4BQWA 1QMJA 3QH7A 3HQXA 3MIFA 2PTMA 3ES1A 4O9EA 4OHWA 2VM9A 3C2UA 2JECA 1DQ6A 3FUOA 4JKMA 4XDQA 5EFUA 4BB3A 3SH5A 5K8SA 2WZPP 1VIWB 5FZ8A 5LZ6A 2GH2A 4QPGB 1W6PB 3ILNA 2RS11 4PQ9A 1E57A 2BBAA 2E53A 4XIOA 5C7GA 1XSQA 2C26A 2ORXA 4RS5C 1PGL1 4GZ9A 3OEAA 1HLCA 1OMIA 2BERA 4QGNA 5JVVA 2CDOA 2HH9A 5DUUA 1LOBA 4GQ7A 4HVQA 2B8MA 4O65A 4AWDA 3WCRA 1ND3A 1UU5A 2E6VA 2GMPA 2HWE2 1SLAA 1OOPC 4CPBA 4W65A 4Z82A 4LHSA 5I0TA 2WZ8A 1JYTA 4ZZ5A 4L97A 3DXUA 3FJSA 5BUVA 2ZS6B 3U4XA 5IVFA 1SBEA 4IEQA 1AR92 3WNNA 5HPOA 1NG0A 4GKXA 2A6ZA 4LHLA 5FZCA 5A6QA 2ADEA 1JZ2A 2HWC3 4B29A 3VZNA 1RVF2 2HWC2 3BTAA 3JCIA 3EMRA 4JZRA 4Q4W1 5H9SA 4QX3A 3MICA 1LJ7A 2J1AA 4PDWB 5FYBA 5A7WB 1W8TA 5BNPC 5IVEA 4QX0A 1YI7A 3PUIA 4QDQA 1W2OA 2PHFA 5FMOL 1VJ2A 1QH7A 3NV4A 5A6ZA 5SV8A 3VV1A 1KJRA 3JU9A 4LBOA 1FV2A 3U10A 1ODMA 1R1A3 2JG8C 2JDAA 2OQ7A 2ZACA 4N43B 5DMYA 1RHI2 1E5IA 5F39A 4AR2A 1ONAA 4EN9B 4LIVA 3GJBA 4YG3A 2B46X 5AC91 5LA2A 3E5UA 4B8EA 2VBBA 5D1IA 3T0AA 3T2QA 3TEYA 4ORFA 3BTXA 1LCLA 4OZXA 3WXPA 1IG3A 1BBT1 2BDRA 1W3XA 2E31A 4LHNA 5BNPA 5F3IA 5CFCA 2XVKA 4R4ZA 1OC1A 1GNYA 1YXWA 1LOFC 1F5JA 5HV0A 3HBKA 2RMU2 4OMDA 3K51A 1RUE3 2VZRA 1DYOA 1YIFA 2DUOA 1ND3B 2XJRA 3TBDA 2HLEA 4KU8A 2JKBA 3AYCA 3SCHA 4E8CA 2JIGA 1LR5A 5FJHA 2ZEXA 5F2WA 2D6LX 3U07A 1KGYA 4DXSA 3QOPA 4EWEA 1LU1A 3O1UA 2IUWA 2VZPA 2I07B 5LA0A 1HRV2 1RUG3 4DUWA 4IE6A 2WZR2 2VQ0A 2R042 3GGLA 1H0BA 1AR72 1YQ8A 4MHUA 4XCBA 4Y1ZA 2HEYF 2WNVA 1ULFA 1JN2P 2R071 1UMHA 4QD2A 1RL3A 1F4AA 1ZM1A 5A7OA 3U11A 4TXWA 2KR2A 4ZU7A 4Q0QA 2RV9A 2Y64A 4BE3A 5CZKA 3VDCA 1S0BA 4RS5A 5FPAA 5AFBA 1D2QA 4IW3A 4XBLA 2QZ2A 2VW0A 1OOPB 3O1TA 4MXVA 3GCXA 4MHRA 1HXS2 1UF2C 2WR9A 1WLCA 3KCYA 4X8NA 1OPOA 4ZONA 2DVBA 3MHZA 4AXOA 2V5DA 4PI2A 5HBAA 3WHUA 2YPJA 5FZBA 5FOJB 1S0EA 2XVGA 4CCLA 3N9LA 2GC0A 2GN7A 3W59A 2RR12 3GXUA 3C7GA 2BNMA 1BLZA 3H3UA 2IXIA 2XPJA 4WVVA 2QQKA 4HBNA 2AACA 5F2SA 5KC6A 5A3MA 5T52A 3HIFA 5FV3A 1COV3 4D6RA 3WQ1A 1A8DA 1ZBE3 5HCBA 3ZMOA 5A3OA 4AI1A 4IE7A 4AZZA 2LALA 2UWCA 1W6OB 1H1AA 2GNTA 2ARCA 2HWD3 3BIWE 5D2AA 3ZSEA 2P4EA 2XHNA 2VL4A 5TSWA 1VMFA 4YYOA 1T6GC 1B35B 1SQ4A 4DNYA 5IK8A 1CAVA 3OOXA 1W8HA 4A41A 1Y7BA 1WBFA 5FBZA 1AYN2 3AL6A 1FNYA 2WL1A 2W1WA 4JGZB 1TNRA 3NSTA 4Q2FA 1CD3G 2WFF2 3VBOB 5HCAA 4TLFA 5DN2A 1PVC1 1NA1B 4XJ8A 1EPZA 3RZZA 2WWJA 4P5HA 3WDWA 4XMIA 3RZKA 1VBE3 3F2ZA 3VGIA 4P9LA 4HZFA 3NNGA 3WQBA 1X9PA 1KFXL 4GJYA 4XOGA 5CFDC 4FBFA 4AVAA 1A8MA 2EAAA 3LE0A 4N53A 2IXHA 3VD5A 2F6BA 4N90A 1ZRIA 3OY8A 3R4SA 5FK7A 4YW2A 1RXFA 5JMCA 4YZ1A 4NUBA 1ZBA1 2VNVA 4YG0A 3R05A 5A3TA 4K8RB 5C9AA 1D4M3 1O4ZA 2VGDA 1JODA 2CDPA 4KBBA 4KH9A 4HETA 4MADA 4CDUA 4NWWA 4XAAA 3RI8A 1M06G 2QQLA 4Y4RA 4BISA 3KV9A 5GLVA 2PYTA 1H8TA 3BU7A 1UOJA 3U0ZA 1NZCA 1LULA 2E7QA 3BCWA 3HD8B 3MLLA 1OHFA 2J1SA 2VVFA 4XIKA 3OEBA 1T6BX 4QX1A 2JIJA 4SLIA 3TEWA 3OBTA 1O7FA 3TEZA 3PVBB 2WAOA 3RDIA 4GJZA 3IPVB 3LEKA 1O3QA 1W8ZA 3KMHA 4Y5TA 1A34A 1ULPA 1BYHA 5F3CA 1DBNA 2C24A 4QQHA 5FY0A 4P9GA 3POGA 3I3EA 3U1XA 1F31A 2VUJA 3W5NA 1OA2A 4GH4A 4HPKA 3DPRB 3WEZA 4TYSA 5A70A 4Q26A 3PMSA 1ZA4A 3Q8CA 2IXLA 2VXJA 3TN91 5FXZA 4YGBA 5E8AA 1G86A 3SEPA 1OLME 1UX7A 1HRV3 3NVCA 2K46A 5C3PA 2W39A 1V6IA 2VQAA 1CAUA 3BOWA 1OQDA 3MIHA 4CDQC 3HVDA 4LPLA 4BXFA 2P34A 4PF5A 4RA0A 4ZXEA 1JZ5A 1UXZA 2Q8OA 1DP0A 4CSWA 4ES8A 1JH5A 3BPSA 5JAXA 4FPOB 3U37A 2QCSB 4LOTA 1H1MA 3BN6A 4IEXA 1OT5A 5A7NA 1N1VA 1S1AA 1JHNA 4YVSB 4Q4Y3 1AX2A 4DUXA 3S7EA 1QOOA 4XDPA 2YROA 4Q4Y2 1JZ4A 4O61A 2NMOA 3RVHA 4FOVA 4ATFA 1NA1A 2VPVA 1Q8OA 4LO4B 3VBOA 1ZZ9A 2WFF3 3DV8A 3Q8BA 4G3YC 1R1A2 1AL22 2R061 2WWSA 3MW2A 3J26N 1JU4A 4CCKA 2E63A 1DYPA 4V1PA 3D6EA 3O12A 1S2BA 1GZWB 1S55A 1MACA 2ZKNA 1AL21 2OZJA 2ZA9A 1QWRA 4L2NA 2WABA 2VTFA 3VBFA 3WW1A 5C8WA 2A73B 2WNUA 1PK6B 1EPWA 3KSCA 4NROA 4XUPA 5DZEA 4S2GA 1OFSA 3AZYA 2BZDA 3O14A 3POYA 3VBSC 1VRBA 1VPHA 4N43A 3RMXA 1W06A 2V4VA 2MEV2 2QTWB 4Q4W3 4CDUB 2WS92 3N9PA 1KS4A 4AHXA 2GP5A 2P6HA 4AI2A 2XUEA 3C7FA 1F9KA 2XBO2 3LDBA 5LATA 4XE9A 2GMEA 4YZ3A 2YMZA 4EWDA 3HAGA 3IDAA 2Q8CA 3OGVA 1RHI3 3IB3A 1V6LA 3THCA 1US3A 2F4LA 4DXTA 2Q4SA 1YI9A 2VW1A 4WM7B 4AI0A 1CONA 1D4M1 3SHRA 2QQMA 3WOGA 1DG6A 2RHPA 3LKJA 2G9ZA 1DLCA 1EAH2 4EN0A 4YFWA 5E89A 5I0SA 4BU2A 3WUDA 2LTNA 5JR7B 1DGLA 3NNFA 2OA2A 4XDOA 2HWB2 3N3HA 4XC9A 2G1MA 3IM0A 4N9IA 4Q0SA 3VBRA 2D6OX 4A7ZA 3P1IA 2XH6A 4Q1PA 1AR81 2ZHNA 4NHXA 5HCHA 2CL2A 5FZ7A 2X5IB 1HIXA 1N3QA 1VBE1 3ACFA 1W0NA 4YGDA 3KV4A 5GZGA 4CZSA 2LW8A 3K4ZA 3DL3A 3N4MA 1V00A 4CP0A 4TZDA 2R6QA 3DKQA 1FPN1 1JXNA 1RJ7A 2UYBA 3FLTA 2ZXQA 2JE7A 3KV5A 3OCPA 2ZGPA 3OUJA 4B7KA 4D0QA 1I1EA 1BQPA 1LRHA 1XC6A 1LNSA 2AH2A 3IDCB 3OUIA 4YG6A 1IPJA 2ERFA 1HRI3 4NE9A 2C1FA 5CA6A 4M3CA 3E6CC 2ADDA 5LA1A 1QQP2 2GSYA 3USUA 3AYDA 2XB6C 5DG1A 3T30A 4OHVA 4MO3M 3VHPA 3VKNA 4BQ2A 1ZA7A 4K6BA 5BNOB 3BVCA 1S0DA 3R4UA 3ILFA 3T4VA 2P1BA 2X10A 2FMYA 2EICA 1R081 3GF6A 5FP3A 4COYA 1PZ8A 2D98A 2GALA 2WNEA 4CDWB 1PGW1 3V56A 2WKKA 2QDNA 3OPWA 1UY0A 4LLFA 4XILA 1FNZA 3I4IA 4LR4A 3DN7A 4NO4A 1ENQA 4BPZA 3O5SA 1PK6C 4C1XA 1Y4WA 1VALA 2JG8B 1HKDA 2RR13 4N43C 2EALA 5EJ1B 1LAJA 4XJAA 1H6XA 1P8JA 2KA3A 2ZGQA 4HN1A 2VZOA 5B4NA 1WW6A 3EO6A 2ZEWA 2JICA 3KGZA 4AFDA 5DUVA 2AGSA 1RJ8A 1LENA 2WO7A 1JYXA 4OVEA 4ASKA 3FUQA 5LK5A 4HK8A 3PL0A 5L19A 3W5MA 4TTGA 1NT0A 1JUHA 5FZ3A 3MF6A 1W03A 2XJVA 5JPNB 1TQ5A 4KBZA 1QNWA 5L73A 2Y6LA 5FFOC 1ASJ3 1N1YA 2RMU1 2VD7A 2NLRA 1TG7A 2GP3A 4FPGA 2WNOA 4CRQA 1KS5A 1KJLA 3B9IA 1VBA1 3DUIA 4I01A 2RVAA 4G9SB 5LBCA 1G9BA 5KHGA 1CAXA 4CEWC 2YBPA 1C57A 3OPTA 4YM2A 4DY3A 4LEJA 3RMYA 3DYMA 4Y1YA 5IK7A 4AHZA 1S0IA 4ET7A 2WJSA 4O7XA 4JKLA 4WZCA 5C3RA 2B7YA 1CPMA 2VY0A 5F6KA 3J8F1 4COWA 4HKLA 1QJX1 1BVVA 1FT9A 5FTTC 1CAVB 1J1TA 1AR91 2IVJA 4WVZA 3CLPA 4FSJA 1WCKA 2PAKA 1MVQA 1W99A 3ZXFA 3J4UH 2WAAA 5M0TA 5J1XA 4L99A 5FY5A 3CF6E 4IEOA 1QJU1 1CVNA 1Y9QA 2ET7A 2NQYA 4D6SA 4JDMA 3T0DA 1URXA 3D3AA 4XQWA 4NHLA 1QGLA 2ZGMA 4EE2A 2FZ1A 2JDMA 4GKYA 4R52A 2P37A 4QQLA 2JJ6A 4YM1A 3HPNA 4GWNA 1HN0A 1OKOA 3T0BA 4ZXKA 3ZXEA 1AXKA 2WT0A 3AXEA 3OY8B 3CJIA 4IGQA 1LOAA 1RXGA 1SEFA 1SCSA 2NMNA 3JXSA 4WM8B 2RS32 2ZAAA 4PDWA 1IOAA 4PIXA 5C9AC 5EJ3A 1UWWA 2WBKA 4EROA 1L7RA 1CJPA 1J84A 4JGZC 1VRH1 4LBJA 3SH3A 2WN2A 3HT1A 3PUSA 4M3CE 3ZXGA 2FDJA 5FP9A 5CFDA 3VBHA 1UU4A 1W9FA 4Y26A 1CIWA 3OD4A 2Y0OA 1CAUB 1QU0A 4JDNA 2UWAA 3VBUA 3FFZA 3VN4A 5L7OA 2Y8KA 3A0KA 1AYN3 1DLLA 3AM2A 5EYXA 5DAVA 3I2HA 2DURA 5KHHA 3ZXLA 3I49A 2VOWA 1QDCA 1LGNA 5CKQA 5ACA1 1LOCA 3AMMA 1X9TA 1FATA 3KVBA 4N7IA 2X8KA 3UYJA 1BJQA 3NW4A 3C3VA 2OZ6A 4HPKB 1WMFA 3WT3A 4OCTA 3QLQA 4IE4A 1W90A 3ZFGC 2ZOEB 1BKZA 1QJX2 1W9WA 5JI9A 4XPVA 1CX4A 2JE8A 1YJLA 4XF3A 3KM5A 1JUIA 1Q56A 3ZVXA 4GIQA 4CEWB 5DZFA 4YVWB 4CTEA 1JYNA 1PMJX 2R073 3BOPA 4LBQB 2DBIA 4CEYB 3LDKA 2XG3A 4QPGC 3NRUA 4AVTA 3RZLA 3I59A 1NYWA 4B7EA 4F3JA 5CG9A 1RUD1 1HQLA 1U5XA 4E4HA 1CZTA 1CZSA 4COUA 2PFWA 4PT6A 4AAPA 2EF6A 5KR7A 5AVAA 3T1MA 3N7MA 1BMV2 2WYFA 2ZEYA 2FDKA 1RUI3 2DWRA 4PQQA 3SCFA 4CCJA 3J7LA 4LE4A 3HOBA 2V09A 4QKNA 3AX4A 1J83A 4QQ2A 2VUCA 2XJTA 3OTFA 1YLLA 2HWF3 4O9GA 4CDQB 5JPMB 2Q1ZB 1O4YA 3AP7A 1SDWA 1X8MA 4GD4A 4DB5A 3G7DA 3WDVA 4AGVA 5GALA 5ISLA 5C70A 4P9JA 1QEXA 1WCQA 2BPA2 4FI9A 4YW5A 4LT5A 3MUZ1 4CUAA 1EV13 2J1VA 2ZX2A 1TZOA 4QGMA 3OGJA 4HN0A 4HKOA 1MS9A 3VBHB 3GBFA 2B39A 2D7FA 4PCRA 3VL9A 1H2KA 5JSRA 4XTMA 1XE8A 1GICA 2R0FA 3LEGA 2VJXA 4LBQD 2SLIA 3NV3A 4RYDA 5J09A 1GKBA 3VD9A 3O1OA 1SLLA 4N8MA 1ENSA 1KQRA 5IWFA 2JD9A 5FO9B 4LBQA 4YZ2A 1OURA 5FJKA 2OYZA 4WM8A 2W3JA 4GB33 1GNZA 3KT4A 1JHJA 2WLQA 2BVVA 3H50A 5FQ0A 1DZRA 5FOBB 3VUOA 4H3WA 2IVIB 4ASLA 4QHOA 3FL7A 4RR3A 1FMD3 3HJRA 3Q8EA 2JB8A 4C1WA 5A6XA 2ZGUA 1REEA 2VG9A 1WLDA 3CIHA 1GYKA 5F9TA 4YZ4A 2Q30A 1NAEA 1NZIA 3IMNA 4CCNA 3NAPC 3RZJA 5SV5A 4YGCA 3N7KA 4IE0A 5BNOA 4W4ZA 4JGYC 3VBUB 4META 2QZ3A 2QQVA 2IXCA 2CAUA 1W39A 2R30A 4WM7C 5FKBA 2JDZA 1XBFA 4NPRA 4IEUA 5C3QA 3KB5A 1BK0A 1HX6A 1NQJA 2W1QA 3DGTA 4QXBA 4WVWA 5F6LB 1H4GA 2WA3A 2WIIB 4XBNA 2VUDA 4GULA 4DY5A 3J8F2 2W1UA 4ISRA 1M4WA 4Q4W2 1Z78A 4H7MA 4BOWA 4YVSA 4EYUA 1G8WA 2ZHMA 3ACIA 2GU9A 5CNAA 1Q43A 5FP4A 1EAH1 5FREA 4QQPA 4AQSA 1GZTA 4IEZA 3ITQA 1W0PA 4YM0A 4GWMA 4MGTA 4M4RA 4IUGA 5LBFA 1ZNPA 2D3PA 3O7OA 5F5IA 5D21A 1NOVA 3ZIXA 3P6BA 3UJOA 3POSA 4RGGA 4I09A 3WNKA 4CDWA 1SG3A 4FTSA 3D4KA 3HNYM 1H9PA 2ID4A 4GH4B 3PIGA 3PJQA 3AVRA 4BDVB 2WDBA 3HQRA 5CADA 3O1PA 3MW4A 4LOSA 3OBZA 4C0BA 2WQZC 5ABJB 2BP6A 4E2QA 3O1SA 1HN1A 3I54A 3PVOA 1KD7A 1F5FA 1LHNA 2YY1A 4QHZA 1OUSA 1X50A 2XDVA 4A3ZA 5FZOA 3VDAA 4L11A 1WWYA 4XUNA 1QY4A 1SDDB 1TMF3 2JX9A 4JVAA 5AFEA 5KBFA 3H3LA 4XW3A 1MPXA 4UBHA 1UXXX 1CAXB 1KEXA 1VRH3 2DCYA 2XWJB 1Q3EA 5I91A 1JMUB 4XHXA 1NLSA 2HWF2 4FXGB 3THTA 2LROA 4Q4V3 3VBOC 1FMD2 5E1RA 1NA1C 4Y3OA 5B4XA 5JIAA 4AVSA 3ZFEB 3GDBA 1RUH2 1WW4A 5LW9A 2QDRA 4ASMB 2WO1A 3K75B 5FO7B 1ND2B 3WP3A 5GLUA 2A6WA 2AREA 3H8OA 4FCAA 4SBVA 5L7OC 3LPFA 3J7HA 3WDXA 1R64A 1UOFA 1Z7S2 2HEWF 4NRQA 5KXDA 4LULA 4QB6A 4OUSA 2TNFA 3ZR6A 3K3OA 5IUQA 1TME2 1QJZA 3FHQA 5DG2A 5K7PA 1NKGA 3D5OA 2HWB1 3JD73 4LNVA 5FR3A 3B02A 4AOCA 3UT0A 2GNMA 4HFSA 1DQ1A 1PNFA 1VBC3 3IKWA 1W6MA 1QOTA 2J22A 2YV8A 3SMHA 1UYYA 3CZUA 2BBVA 5FXXA 5ANQA 4RSUA 3HT2A 2D6KA 3EQEA 3CQOA 4NPMA 3INAA 1O3TA 2CNAA 3I2FA 2GC3A 2RDNA 4DMIA 1SHWB 4QDSA 5KHJA 2Y33A 5J37A 1PIV2 2JDUA 3NNMA 5FY9A 1V9U1 3W21A 3ZYFA 2TUNA 2MPFA 2GMMA 3BODA 3PUQA 4XAEA 2Y6KA 1WW7A 2BOJA 5HXMA 1C5IA 4HSLA 4I3PA 4Q4X1 4CCCA 1SCRA 1CX1A 1GP5A 1VB4A 1RITA
chains in the Genus database with same CATH topology
3W5NA 1EUUA 4QB1A 3WEZA 3DECA 1JYVA 2X05A 3SEPA 1T2XA 1UX7A 1WKYA 2YC2A 5IHRA 4A45A 4A42A 1JZ6A 3CZJA 1H6YA 3A7QA 5IFTA 2W47A 3HEIA 5DPNA 4LPLA 1JZ5A 3UESA 4ZXEA 1UXZA 1DP0A 4CVUA 3U37A 2VZ1A 3BN6A 3OGRA 1OT5A 2R7EB 2VZSA 3HNBM 3IIIA 4DUXA 3MV01 1JZ4A 1ULOA 3WNLA 1GMMA 1EUTA 2L9LA 3T2OA 3HNMA 2QQOA 1JU4A 3ABZA 2VMDA 4UAPA 3GM8A 4ARYA 2WABA 2VTFA 4RN5A 4MGQA 3FN9A 1XPWA 1BHGA 3CDZB 1GOGA 4XUPA 1UY1A 1K3IA 5LCWL 2BZDA 3T2PA 3WNOA 2V4VA 2YFUA 2JKXA 3C7OA 3UNPA 1GOFA 2J1UA 1UMIA 3C7FA 1OF3A 3EB7A 3K4DA 3ZM8A 4A44A 1I5PA 2VZUA 3C8XA 3WF2A 1K45A 3IDAA 2QBXA 5FUIA 3OGVA 4AAXA 4ARXA 3IB3A 3THCA 1US3A 1W8NA 1IQDC 4DXTA 3SKVA 2HYXA 2W94A 2QQMA 2BGOA 5JUVA 1UYZA 4CUCA 1DLCA 2WQ8A 3A21A 4XUQA 3OG2A 1JYWA 3LQCA 3P1IA 4MGSA 3K77A 2OKXA 1O59A 3ACFA 1W0NA 1W9SA 3I2KA 4XVHA 4D8MA 2LW8A 3K4ZA 3VD4A 2ZXQA 4D0QA 2VOTA 1XC6A 1LNSA 3LEIA 2C9KA 5LA1A 4MO3M 4Z2AA 2VR4A 2E26A 2QQNA 3SEEA 2X10A 2EICA 4QB2A 1O8SA 4JX0A 2VCAA 2WO2A 4BXSV 1UY0A 2Y6GA 4MOAA 2WN3A 1PMHX 1JU3A 5EJ1B 3PUHA 3VD3A 3ETPA 1H6XA 1OH4A 1P8JA 1UY4A 3FHAA 2VZOA 2Y6HA 4W50A 4AG4A 2V72A 5B4NA 2ZEWA 5IFPA 1PX3A 1JYXA 4OYUA 2J7MA 4OUEA 2PQSA 2EIBA 3W5MA 2W46A 4W8JA 4TTGA 4PF1A 4ZY9A 2Y6LA 4UOJA 3WNMA 2Z4FA 1TG7A 1UY3A 3EYPA 3A22A 5JXGA 2RVAA 3DYPA 3ACGA 4KMQA 3CMGA 3OGSA 2WUHA 2W95A 3DYMA 4ZZ8A 2B9VA 2VC9A 2W91A 4ET7A 5JMOA 1XNTA 4JKLA 2VZTA 3THDA 5JXIA 1YQ2A 2YB7A 3OBAA 3ECQA 4CU9A 1NUKA 3WF3A 1W99A 2WAAA 5J1XA 2RJ2A 2XQXA 3WF4A 1GOHA 2VCCA 3T0DA 3D3AA 2VCBA 3DYOA 3K46A 2XONA 4XZUG 3HPNA 3MBWA 3T0BA 4BK5A 2QQIA 5IYYA 3JXSA 2W5FA 4CUBA 3AC0A 4HG6B 5G05L 2VZ3A 5EIYB 5JXHA 2YFZA 1UYXA 5IJRA 2EIDA 4QX2A 4GWJA 1UWWA 1US2A 2WBKA 1L7RA 2VMEA 3NQHA 1J84A 1CIYA 2WN2A 3CKHA 4BK4A 2WO3A 2WZEA 4P00B 2Y8KA 3I2HA 4M4PA 1K12A 2B4KA 2VMFA 3C7EA 1W9WA 2BGPA 3WF0A 3T08A 2E33A 3MUY1 2JE8A 2VQTA 4JKKA 1JYNA 1GQPA 1PMJX 1JZ8A 1D7PM 2VQUA 5G04L 2W87A 3NRUA 4L0PA 2VM9A 1CZTA 1CZSA 4JKMA 5JR2A 4XURA 4PT6A 3NJVA 1JZ3A 3C7HA 3MO4A 2VO5A 4LKSA 4XUTA 4JHZA 2ZEYA 2BBAA 5C7GA 4PQQA 2C26A 2ZEZA 3HOBA 2ORXA 1J83A 4GZ9A 4CU6A 3OEAA 2BERA 2WYSA 2CDOA 2VZQA 1K42A 3A23A 5C70A 2YG0A 1WCQA 4FI9A 3WF1A 2KD7A 4GWIA 3MUZ1 4CUAA 2J1VA 4P08A 4LHSA 2WZ8A 4ZZ5A 3WNNA 5HPOA 3LEGA 2VJXA 1JZ2A 4RYDA 4XUOA 3VD9A 3T09A 2JD9A 1NX9A 4QAWA 4QX3A 2J1AA 2VMCA 3IAPA 4LQRA 4QX0A 2ORZA 3PUIA 2W3JA 1O8PA 4QDQA 1JHJA 4DEQA 3FL7A 3HJRA 5CYYA 1W8OA 3CIHA 4OZOA 2JDAA 5DMYA 5A1AA 3NJXA 3WNPA 1NAEA 5LA2A 4KWUA 1CZVA 3T0AA 3T2QA 3WSOA 4W4ZA 2XOMA 2W9XA 2E31A 1XNAA 1GNYA 2YC4A 1RYYA 4OMDA 1UY2A 2VZRA 2W1QA 4DEVA 1DYOA 1JZ7A 2HLEA 2W1UA 4E8CA 2E32A 2ZEXA 3HN3A 3I3BA 1KGYA 4DXSA 3SKJE 2VZPA 5LA0A 3ACIA 4DUWA 4DUVA 4KI5M 3GGLA 1UMHA 4M4RA 1F4AA 1GUIA 4IUGA 4UI9L 4TXWA 2DCKA 2RV9A 2Y64A 3P6BA 3I2JA 5CZKA 4E8DA 3VDCA 3ACHA 5F7UA 3WNKA 5C71A 2C4XA 5I0DA 1SG3A 1W9TA 3K4AA 3HNYM 2ID4A 2W1SA 4BJ0A 4BDVB 2WDBA 3I2IA 1TVGA 2V5DA 3I97A 1OF4A 2X09A 1HN1A 3GXUA 2Y6JA 3C7GA 4QDRA 4A3ZA 4CU7A 2QQKA 5DQ0A 3VDAA 4XUNA 4P5YA 1SDDB 1OD3A 1MPXA 1UXXX 1KEXA 3I2GA 3BGAA 2DDUA 4YPJA 2XHNA 3VDBA 2VL4A 5B4XA 3GDBA 4A41A 4CU8A 2EIEA 2J1TA 2WO1A 3K75B 2W1WA 1F4HA 2W92A 5DN2A 3LPFA 3J7HA 1R64A 2VZVA 3IAQA 5EJZB 3F2ZA 2LS6A 3NNGA 3WQBA 3OB8A 1UZ0A 4QB6A 3VD7A 4DXRA 2J1EA 4A6OA 3LE0A 1JI6A 3VD5A 3FHQA 1NKGA 1PX4A 5JXJA 3UETA 2DCJA 2CDPA 2J22A 4MADA 1L7QA 1UYYA 3CZUA 2QQLA 1GU3A 3CQOA 3I3DA 3I2FA 2QQJA 4QPWA 2J1SA 1SHWB 4QDSA 3OEBA 4QX1A 4OMCA 3MV11 2WAOA 4A4AA 4P02B 2Y6KA 2J1RA 5HXMA 3LEKA 3LPGA 1ULPA 3E1F1 1CX1A 3I3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5N A;  1EUU A;  4QB1 A;  3WEZ A;  3DEC A;  1JYV A;  2X05 A;  3SEP A;  1T2X A;  1UX7 A;  1WKY A;  2YC2 A;  5IHR A;  4A45 A;  4A42 A;  1JZ6 A;  3CZJ A;  1H6Y A;  3A7Q A;  5IFT A;  2W47 A;  3HEI A;  5DPN A;  4LPL A;  1JZ5 A;  3UES A;  4ZXE A;  1UXZ A;  1DP0 A;  4CVU A;  3U37 A;  2VZ1 A;  3BN6 A;  3OGR A;  1OT5 A;  2R7E B;  2VZS A;  3HNB M;  3III A;  4DUX A;  3MV0 1;  1JZ4 A;  1ULO A;  3WNL A;  1GMM A;  1EUT A;  2L9L A;  3T2O A;  3HNM A;  2QQO A;  1JU4 A;  3ABZ A;  2VMD A;  4UAP A;  3GM8 A;  4ARY A;  2WAB A;  2VTF A;  4RN5 A;  4MGQ A;  3FN9 A;  1XPW A;  1BHG A;  3CDZ B;  1GOG A;  4XUP A;  1UY1 A;  1K3I A;  5LCW L;  2BZD A;  3T2P A;  3WNO A;  2V4V A;  2YFU A;  2JKX A;  3C7O A;  3UNP A;  1GOF A;  2J1U A;  1UMI A;  3C7F A;  1OF3 A;  3EB7 A;  3K4D A;  3ZM8 A;  4A44 A;  1I5P A;  2VZU A;  3C8X A;  3WF2 A;  1K45 A;  3IDA A;  2QBX A;  5FUI A;  3OGV A;  4AAX A;  4ARX A;  3IB3 A;  3THC A;  1US3 A;  1W8N A;  1IQD C;  4DXT A;  3SKV A;  2HYX A;  2W94 A;  2QQM A;  2BGO A;  5JUV A;  1UYZ A;  4CUC A;  1DLC A;  2WQ8 A;  3A21 A;  4XUQ A;  3OG2 A;  1JYW A;  3LQC A;  3P1I A;  4MGS A;  3K77 A;  2OKX A;  1O59 A;  3ACF A;  1W0N A;  1W9S A;  3I2K A;  4XVH A;  4D8M A;  2LW8 A;  3K4Z A;  3VD4 A;  2ZXQ A;  4D0Q A;  2VOT A;  1XC6 A;  1LNS A;  3LEI A;  2C9K A;  5LA1 A;  4MO3 M;  4Z2A A;  2VR4 A;  2E26 A;  2QQN A;  3SEE A;  2X10 A;  2EIC A;  4QB2 A;  1O8S A;  4JX0 A;  2VCA A;  2WO2 A;  4BXS V;  1UY0 A;  2Y6G A;  4MOA A;  2WN3 A;  1PMH X;  1JU3 A;  5EJ1 B;  3PUH A;  3VD3 A;  3ETP A;  1H6X A;  1OH4 A;  1P8J A;  1UY4 A;  3FHA A;  2VZO A;  2Y6H A;  4W50 A;  4AG4 A;  2V72 A;  5B4N A;  2ZEW A;  5IFP A;  1PX3 A;  1JYX A;  4OYU A;  2J7M A;  4OUE A;  2PQS A;  2EIB A;  3W5M A;  2W46 A;  4W8J A;  4TTG A;  4PF1 A;  4ZY9 A;  2Y6L A;  4UOJ A;  3WNM A;  2Z4F A;  1TG7 A;  1UY3 A;  3EYP A;  3A22 A;  5JXG A;  2RVA A;  3DYP A;  3ACG A;  4KMQ A;  3CMG A;  3OGS A;  2WUH A;  2W95 A;  3DYM A;  4ZZ8 A;  2B9V A;  2VC9 A;  2W91 A;  4ET7 A;  5JMO A;  1XNT A;  4JKL A;  2VZT A;  3THD A;  5JXI A;  1YQ2 A;  2YB7 A;  3OBA A;  3ECQ A;  4CU9 A;  1NUK A;  3WF3 A;  1W99 A;  2WAA A;  5J1X A;  2RJ2 A;  2XQX A;  3WF4 A;  1GOH A;  2VCC A;  3T0D A;  3D3A A;  2VCB A;  3DYO A;  3K46 A;  2XON A;  4XZU G;  3HPN A;  3MBW A;  3T0B A;  4BK5 A;  2QQI A;  5IYY A;  3JXS A;  2W5F A;  4CUB A;  3AC0 A;  4HG6 B;  5G05 L;  2VZ3 A;  5EIY B;  5JXH A;  2YFZ A;  1UYX A;  5IJR A;  2EID A;  4QX2 A;  4GWJ A;  1UWW A;  1US2 A;  2WBK A;  1L7R A;  2VME A;  3NQH A;  1J84 A;  1CIY A;  2WN2 A;  3CKH A;  4BK4 A;  2WO3 A;  2WZE A;  4P00 B;  2Y8K A;  3I2H A;  4M4P A;  1K12 A;  2B4K A;  2VMF A;  3C7E A;  1W9W A;  2BGP A;  3WF0 A;  3T08 A;  2E33 A;  3MUY 1;  2JE8 A;  2VQT A;  4JKK A;  1JYN A;  1GQP A;  1PMJ X;  1JZ8 A;  1D7P M;  2VQU A;  5G04 L;  2W87 A;  3NRU A;  4L0P A;  2VM9 A;  1CZT A;  1CZS A;  4JKM A;  5JR2 A;  4XUR A;  4PT6 A;  3NJV A;  1JZ3 A;  3C7H A;  3MO4 A;  2VO5 A;  4LKS A;  4XUT A;  4JHZ A;  2ZEY A;  2BBA A;  5C7G A;  4PQQ A;  2C26 A;  2ZEZ A;  3HOB A;  2ORX A;  1J83 A;  4GZ9 A;  4CU6 A;  3OEA A;  2BER A;  2WYS A;  2CDO A;  2VZQ A;  1K42 A;  3A23 A;  5C70 A;  2YG0 A;  1WCQ A;  4FI9 A;  3WF1 A;  2KD7 A;  4GWI A;  3MUZ 1;  4CUA A;  2J1V A;  4P08 A;  4LHS A;  2WZ8 A;  4ZZ5 A;  3WNN A;  5HPO A;  3LEG A;  2VJX A;  1JZ2 A;  4RYD A;  4XUO A;  3VD9 A;  3T09 A;  2JD9 A;  1NX9 A;  4QAW A;  4QX3 A;  2J1A A;  2VMC A;  3IAP A;  4LQR A;  4QX0 A;  2ORZ A;  3PUI A;  2W3J A;  1O8P A;  4QDQ A;  1JHJ A;  4DEQ A;  3FL7 A;  3HJR A;  5CYY A;  1W8O A;  3CIH A;  4OZO A;  2JDA A;  5DMY A;  5A1A A;  3NJX A;  3WNP A;  1NAE A;  5LA2 A;  4KWU A;  1CZV A;  3T0A A;  3T2Q A;  3WSO A;  4W4Z A;  2XOM A;  2W9X A;  2E31 A;  1XNA A;  1GNY A;  2YC4 A;  1RYY A;  4OMD A;  1UY2 A;  2VZR A;  2W1Q A;  4DEV A;  1DYO A;  1JZ7 A;  2HLE A;  2W1U A;  4E8C A;  2E32 A;  2ZEX A;  3HN3 A;  3I3B A;  1KGY A;  4DXS A;  3SKJ E;  2VZP A;  5LA0 A;  3ACI A;  4DUW A;  4DUV A;  4KI5 M;  3GGL A;  1UMH A;  4M4R A;  1F4A A;  1GUI A;  4IUG A;  4UI9 L;  4TXW A;  2DCK A;  2RV9 A;  2Y64 A;  3P6B A;  3I2J A;  5CZK A;  4E8D A;  3VDC A;  3ACH A;  5F7U A;  3WNK A;  5C71 A;  2C4X A;  5I0D A;  1SG3 A;  1W9T A;  3K4A A;  3HNY M;  2ID4 A;  2W1S A;  4BJ0 A;  4BDV B;  2WDB A;  3I2I A;  1TVG A;  2V5D A;  3I97 A;  1OF4 A;  2X09 A;  1HN1 A;  3GXU A;  2Y6J A;  3C7G A;  4QDR A;  4A3Z A;  4CU7 A;  2QQK A;  5DQ0 A;  3VDA A;  4XUN A;  4P5Y A;  1SDD B;  1OD3 A;  1MPX A;  1UXX X;  1KEX A;  3I2G A;  3BGA A;  2DDU A;  4YPJ A;  2XHN A;  3VDB A;  2VL4 A;  5B4X A;  3GDB A;  4A41 A;  4CU8 A;  2EIE A;  2J1T A;  2WO1 A;  3K75 B;  2W1W A;  1F4H A;  2W92 A;  5DN2 A;  3LPF A;  3J7H A;  1R64 A;  2VZV A;  3IAQ A;  5EJZ B;  3F2Z A;  2LS6 A;  3NNG A;  3WQB A;  3OB8 A;  1UZ0 A;  4QB6 A;  3VD7 A;  4DXR A;  2J1E A;  4A6O A;  3LE0 A;  1JI6 A;  3VD5 A;  3FHQ A;  1NKG A;  1PX4 A;  5JXJ A;  3UET A;  2DCJ A;  2CDP A;  2J22 A;  4MAD A;  1L7Q A;  1UYY A;  3CZU A;  2QQL A;  1GU3 A;  3CQO A;  3I3D A;  3I2F A;  2QQJ A;  4QPW A;  2J1S A;  1SHW B;  4QDS A;  3OEB A;  4QX1 A;  4OMC A;  3MV1 1;  2WAO A;  4A4A A;  4P02 B;  2Y6K A;  2J1R A;  5HXM A;  3LEK A;  3LPG A;  1ULP A;  3E1F 1;  1CX1 A;  3I3E A; 
#chains in the Genus database with same CATH topology
 4FFI A;  5CIR A;  3GNE A;  4MLO A;  2RS3 1;  5KHI A;  1EUU A;  1XQN A;  2RM2 3;  4LBN A;  1VAV A;  1AL0 G;  4P9W A;  5BNQ A;  5JZG A;  1DCS A;  1YO8 A;  3GZE A;  4HK9 A;  3Q8A A;  2DFC A;  1WKY A;  3GHN A;  5IHR A;  3KHB A;  3CZJ A;  1H6Y A;  3GZT B;  5IFT A;  5FYH A;  3AMH A;  3AVS A;  3UES A;  3ZO0 B;  3AL5 A;  1PO1 3;  3M1H A;  5K0U B;  3SXW A;  3PU3 A;  2VZ1 A;  3AMP A;  3LF7 A;  5FZD A;  4AI9 A;  4N53 B;  3OGR A;  2R7E B;  1VB2 A;  1MQT A;  1UX6 A;  5JSP A;  1SLI A;  3MV0 1;  1ULO A;  1W2T A;  1YYN A;  3MIE A;  2YXS A;  2R32 A;  2QQU A;  4GMP 0;  4LIT A;  1EUT A;  2AEY A;  4C90 A;  2QQO A;  3ABZ A;  5IAX A;  3VBS B;  2VOV A;  4ARY A;  4EN8 B;  2FHR A;  3AKS A;  2XWB B;  3MPP G;  2ZGS A;  4OLL A;  4RN5 A;  3FN9 A;  2A7A A;  1XPW A;  1VBE 2;  4WZF A;  1LEM A;  2PLV 1;  1MS5 A;  4H14 A;  1AXZ A;  1UY1 A;  4BM8 A;  5LCW L;  3ZFG B;  3U14 A;  1AX0 A;  3V65 A;  5LWB A;  4QU1 A;  1UNB A;  2BJS A;  1ZVF A;  3EHK A;  3C7O A;  4NIG A;  3L2H A;  5FYU A;  2BQP A;  1UMI A;  4RFR B;  4ES9 A;  2I45 A;  1LHV A;  1XNB A;  4CE8 A;  5JLV A;  1OF3 A;  4AVV A;  1I5P A;  2VZU A;  3URF A;  2OQ6 A;  3ZN5 A;  3PVE A;  1YQ6 A;  1UZV A;  3NKG A;  3AP9 A;  4JQT A;  4JTN A;  4LMF A;  4UFI A;  4XFG A;  1W8N A;  3EXU A;  1RUF 1;  3ZSM A;  4BLJ A;  3ALQ A;  4LK6 A;  3J7N A;  1XXN A;  1COV 1;  2YHJ A;  1WA6 X;  3VZO A;  1K5M B;  5B2G B;  2OUJ A;  3FWE A;  5JCT A;  3RQ0 A;  1BEV 1;  4OFG A;  3AKT A;  4QX8 A;  3UGG A;  1D0H A;  3AMN A;  5K9Y A;  2BGO A;  5JUV A;  4PBP A;  1HJG A;  3M3O A;  4XJW A;  2JG9 A;  2WQ8 A;  3A21 A;  3PDQ A;  4UW4 A;  1TME 3;  3KF5 A;  3OG2 A;  4UFL A;  3H42 B;  5EWS A;  3S6P A;  1JYW A;  1FI2 A;  5LEK A;  3LQC A;  3N9Q A;  1DGR A;  2LM3 A;  1SLB A;  1OLM A;  3DEM A;  1DQ2 A;  4MGK E;  3KHC A;  3K77 A;  4CCM A;  2JWP A;  3K48 A;  4XF1 A;  2JB4 A;  1Q8P A;  4K9S A;  3E97 A;  4AYU A;  3UKT A;  2XKO A;  3NNL A;  4ZU4 A;  4D8M A;  3U75 A;  2Z69 A;  1HRV 1;  3IZO A;  4XTP A;  4YRD A;  5J98 B;  1O3S A;  3LA3 A;  4WM7 A;  4N7U A;  5A7P A;  3VD4 A;  3I2O A;  1NCQ A;  3CBN A;  1W6Q B;  3LEM A;  3VDD A;  1ASJ 1;  2IWG B;  2VOT A;  3FZ3 A;  5BNO C;  2NYY A;  4Q1R A;  1VRH 2;  1MZE A;  1W3V A;  2RJL A;  4BLI A;  3LEI A;  2FDI A;  3R6S A;  3T2T A;  1WLW A;  2C9K A;  3ZYB A;  3VZK A;  4Q4V 2;  3FHI B;  1G9D A;  1UQX A;  2JXA A;  1GBG A;  3R0R A;  3BTZ A;  4Z2A A;  2VR4 A;  4FP2 A;  4KNC A;  2NM1 A;  1QQP 1;  2R06 3;  3FBM A;  4FFF A;  4URT A;  2A1X A;  4LIU A;  3PTR B;  2A3W A;  4QB2 A;  5CVR A;  2I74 A;  4JX0 A;  5C3O A;  2BFU S;  4XFC A;  5EPA A;  1RTV A;  1FYU A;  1GWM A;  1QJY 1;  4BXS V;  1HB4 A;  3EJK A;  3S5A A;  1QHD A;  3H8U A;  4K1Y A;  2RR1 1;  1UCX A;  5JOW A;  2NPI A;  4IV1 B;  2XJQ A;  2HBU A;  2ZZQ A;  1QJY 2;  1VLN A;  3NAP B;  1TME 1;  5FPZ A;  3VBS A;  1R09 2;  1UKR A;  4D7Y A;  3M3E A;  2Z5W A;  1LB2 A;  1RVF 3;  1V6K A;  3H8R A;  3FHA A;  2PMW B;  4CDX C;  1N1S A;  4AG4 A;  4AQ2 A;  4K40 A;  3ZIW A;  1ENR A;  4AEM A;  1GWK A;  5FZF A;  3AP6 A;  1YJK A;  4Y1U A;  5FZ1 A;  1Z7S 1;  1WMD A;  1QQP 3;  2VVD A;  2AR6 A;  3TN9 2;  5IFP A;  4DIN B;  2J7M A;  4OUE A;  2PQS A;  3JBG 3;  4FQ4 A;  2FZ2 A;  1PZ7 A;  2EIG A;  3LIG A;  3TN9 3;  1YUD A;  2EIB A;  4MX3 A;  1OVS A;  2W46 A;  1I3H A;  1CR7 A;  4RHV 1;  4V2W A;  1SBD A;  4QGL A;  4PF1 A;  5DAQ A;  1BVP 1;  4AI3 A;  3MID A;  4AHY A;  1ZZ8 A;  4HOO A;  1G9C A;  3LB9 A;  1DHK B;  5FWJ A;  2OPK A;  4D7T A;  5CB7 A;  5BNN B;  1AYM 2;  2CWM A;  2AEZ A;  3KGL A;  3B5L B;  1IG0 A;  3DYP A;  3DCQ A;  2XVL A;  4GAL A;  4RFT 0;  4KMQ A;  4CDQ A;  1AR8 3;  3LFI A;  3LA2 A;  4YW6 A;  1IS6 A;  4QHB A;  1YCI A;  3NJZ A;  1ODN A;  4Y5S A;  5JMO A;  5FPB A;  4JRA A;  1OQ1 A;  3JBG 2;  5DDJ 3;  3RSJ A;  3O1V A;  1C1F A;  3HWJ A;  3THD A;  5JXI A;  3KT7 A;  5CKN A;  1YQ2 A;  4Q29 A;  3UKN A;  3ASI A;  3OBA A;  1DQ4 A;  5BNP B;  1Y9M A;  3ZFE A;  5FZL A;  4W6X A;  1D4V B;  2P3Y A;  1ALY A;  3WF3 A;  1H8V A;  3AK0 A;  1S4C A;  2VEC A;  1UZZ A;  1GQH A;  5C4W C;  4IL7 A;  1RHI 1;  1NLQ A;  4NRM A;  2RJ2 A;  2XQX A;  3MFA A;  3QAC A;  3WF4 A;  4D94 A;  2GH8 A;  1L7L A;  4Z07 A;  2VCB A;  3OJB A;  1DGW A;  1FAY A;  4Q8K A;  2RDS A;  4GB3 2;  4I0W B;  4IET A;  1GAN A;  2QE3 A;  5I8T A;  1GZW A;  3B94 A;  4Q5O A;  4MVT A;  4HLT A;  3MBW A;  2XLA A;  1H8T C;  2WWU A;  1GP6 A;  1C5H A;  3F95 A;  3O0V A;  4HT1 T;  5IYY A;  2W5F A;  4XFB A;  1GLH A;  1FOD 1;  2TEP A;  1Y9G A;  4HG6 B;  5ERL A;  4CDU C;  2VZ3 A;  2SBA A;  4IV1 C;  4QKF A;  5JXH A;  4QXH A;  2RS3 3;  2HKX A;  1KDM A;  2LUW A;  1AL2 3;  4GWJ A;  5BNN A;  4XQ4 A;  2NP0 A;  3RYP A;  1UO9 A;  1ND2 C;  4CDX B;  2A3X A;  2Y38 A;  1GR3 A;  3TB0 A;  3J9S A;  1HV0 A;  2XML A;  1STM A;  1UZY A;  4XBQ A;  5K0U A;  2VW2 A;  4R4X A;  5KHK A;  1QDO A;  4XZP A;  4YNI A;  4BK4 A;  5DDJ 1;  3HBZ A;  4AK3 A;  4CA9 A;  4ZS2 A;  2WT2 A;  3CJI C;  4AVB A;  1PHM A;  4GMP 1;  2YPD A;  1I6X A;  1G6N A;  1NE4 A;  3V0A B;  3FBY A;  4M4P A;  4DQA A;  4Y4Y A;  1YQC A;  3SCG A;  5A3U A;  5DAP A;  4LA2 A;  1DYK A;  3LDR A;  1VBB 3;  3M70 A;  1PZ9 A;  1NY7 2;  5GJ6 A;  3ST7 A;  5T3N A;  4RR3 B;  5EXO A;  3QH6 A;  2RDR A;  1PO2 2;  2ZKL A;  2BGP A;  3AFK A;  4XQD A;  5FK8 A;  3T08 A;  4CYD A;  3MZH A;  5J48 A;  2R07 2;  4NN0 A;  3KF3 A;  3AZZ A;  2D44 A;  4D69 A;  1NLR A;  3SLI A;  3ACL A;  4LO5 B;  2HEV F;  1ULG A;  1HXS 3;  4L0P A;  4LO7 A;  5L36 A;  3I59 B;  4F7Z A;  4IEY A;  2NZ9 A;  1JS9 A;  5FYI A;  4Z1V A;  4KG0 A;  1LES A;  1UZW A;  5JR2 A;  2VMI A;  2DU0 A;  5FPX A;  3NJV A;  1GWL A;  1JZ3 A;  3C7H A;  4DRR A;  5FYC A;  3USU B;  2B9U A;  3VKL A;  3BIE A;  3UK9 A;  4LKS A;  3ES4 A;  1NY7 1;  2VBP A;  4JHZ A;  2UWB A;  4LTA A;  3ZFF A;  4Q8L A;  2PHD A;  2KXL A;  2WZR 3;  1UIK A;  2ZEZ A;  3WLU A;  4WV8 A;  4JAA A;  5KXC A;  2I2S A;  2D5F A;  1C4R A;  3POW A;  1NXD 1;  2KM2 A;  2JE9 A;  2QKD A;  3H3Z A;  4QQO A;  1A78 A;  2C9A A;  1FXZ A;  1W2U A;  4A3X A;  5AC9 2;  2WNV C;  1K42 A;  3A23 A;  5FZK A;  4HVO A;  3JQX A;  4LBK A;  4X6Q B;  3WDU A;  2P2K A;  4R9D A;  3ZX7 A;  1B09 A;  3NNJ A;  3WF1 A;  5C8C A;  2KD7 A;  4GWI A;  4Y5Z 0;  2HWB 3;  3JD7 1;  2E51 A;  4GXL A;  4D3W A;  4P08 A;  1AX1 A;  4QX5 A;  1XSR A;  5H9Q A;  3WP4 A;  5FRA A;  3RFR A;  1AJO A;  3HN1 A;  4G4F A;  4FPE A;  1HRI 1;  3S30 A;  4CDX A;  1FOD 3;  4XUO A;  2CV6 A;  3D0J A;  1FOD 2;  3PIJ A;  1RUD 2;  1FPN 3;  4TN7 A;  1NX9 A;  4C91 A;  2CGP A;  2VMC A;  4H55 A;  3SQO A;  4LQR A;  1Y3T A;  3GJA A;  4DS0 A;  3JZV A;  4LHK A;  2ZAB A;  1X7N A;  3SNM A;  5GLW A;  2RJK A;  3BAL A;  4X8P A;  3LAG A;  4MGI E;  4DEQ A;  5FYS A;  5A3P A;  3GCW A;  3KD4 A;  5CYY A;  4EN6 B;  4E2G A;  1W8O A;  2XBO 1;  1UOG A;  3KV6 A;  3CJX A;  1PGL 2;  5A1A A;  3CU7 A;  1IGO A;  2UY8 A;  3JUU A;  3NJX A;  4RR3 C;  4XFI A;  3S5Q A;  3ZPO A;  4CP9 A;  1ZRF A;  2WNU B;  2DBN A;  3WSO A;  5LB6 A;  5IAT A;  2XOM A;  3AB0 A;  2W9X A;  1PO2 3;  4NR1 A;  1XE0 A;  1K5M C;  1UAI A;  3DPR C;  5IW0 A;  2UU8 A;  4UYB A;  4PIY A;  2FCU A;  1BK1 A;  1PO2 1;  1LEC A;  3BB6 A;  3I2D A;  2CGN A;  1AVB A;  2AYH A;  4IES A;  4A2U A;  1AR6 2;  3MYX A;  5C8C B;  1VE0 A;  5C6C A;  2E32 A;  4UFM A;  3T3Y A;  5FZ4 A;  4AED A;  1MEC 2;  1CAW A;  4AI8 A;  1PM4 A;  1N47 A;  2ARX A;  4RL7 A;  2JG9 C;  2CAV A;  4MV2 A;  4DUV A;  4KI5 M;  3WX5 A;  1JW6 A;  1UKG A;  3WP5 A;  4ZPI A;  3ZFF B;  1RUI 2;  2BU9 A;  1GUI A;  2Y6F A;  1Q8V A;  1YFU A;  2C0Z A;  4ISQ A;  2DCK A;  3E5X A;  4PLM A;  4U36 A;  5CAZ A;  1J1L A;  2Q1F A;  4E8D A;  4P9Y A;  1PVC 2;  3ZYG A;  5F7U A;  2WFF 1;  1LHO A;  5C71 A;  2C4X A;  4JTO A;  5I0D A;  3O1M A;  2EXI A;  2ZX4 A;  3K4A A;  2ARA A;  3LCP A;  3L9J T;  2RM2 2;  5FZG A;  4BQ5 A;  4R8H A;  1QXR A;  4YW3 A;  4PJY A;  1U12 A;  4NIA A;  3PHM A;  2VTX A;  2FDF A;  1CN1 A;  3I97 A;  1KRI A;  3KCX A;  3P3P A;  4NJ4 A;  4KG8 A;  4Y22 A;  1QJE A;  2D3R A;  3N35 A;  4CCD A;  1JTZ X;  1NCR B;  2XL7 A;  5DQ0 A;  4CU7 A;  3RZM A;  1ULE A;  5FLH A;  1VAM A;  3IDE A;  3ZPY A;  1OFN A;  1SPP A;  2YU1 A;  3VBF C;  5F5Q A;  2BOI A;  5CU1 A;  5GLZ A;  2JEN A;  4DRV A;  5JWP A;  4R9B A;  4YWA A;  1UYP A;  3BGA A;  3POE A;  1JYC A;  2DDU A;  2O8Q A;  2NN8 A;  2WZR 1;  2X5I A;  2JD4 A;  3M4F A;  4YPJ A;  5L7O B;  1LGB A;  2PEL A;  4NOT A;  3U4S A;  2DVF A;  1KFU L;  3AKP A;  1XND A;  4UF0 B;  4ZU5 A;  5EZW A;  3VBR B;  4BQ3 A;  5JOX A;  4CU8 A;  1H4H A;  1IS3 A;  4CEY C;  4EJR A;  3PUR A;  2Z2S B;  2EA7 A;  1LHU A;  1F35 A;  2WSU A;  3IAQ A;  5EJZ B;  2LS6 A;  1AYM 3;  4IEW A;  4PLN A;  3LSD A;  3HMY A;  1UZ0 A;  1W8U A;  1WMX A;  3POJ A;  3W58 A;  3VD7 A;  4EWA A;  2RS5 2;  5A1L A;  4KWK A;  2D93 A;  2D5H A;  5J7M A;  1MZ5 A;  3N36 A;  4E27 A;  1IPS A;  4JGZ A;  1G7Y A;  2G4I A;  1PX4 A;  5CBL A;  4BIF A;  5JXJ A;  5ANN A;  1GQG A;  1N1T A;  4YGE A;  3HR9 A;  3UET A;  1CQ9 A;  2XLF A;  1VBB 1;  4HON A;  1OSG A;  1W6P A;  5BYN A;  4LBL A;  3RGB A;  3I7D A;  5LY2 A;  1OQE A;  2BYV E;  3O0X A;  1ACC A;  4FPL A;  5I8Y A;  5BXX A;  4GMP 3;  3ZMN A;  1EYB A;  4QPW A;  3NJY A;  5FPV A;  3E6B A;  5FUP A;  5H9R A;  1RUG 2;  1S2K A;  1HB2 A;  2PHW A;  4KWJ A;  4AL9 A;  5FZO B;  4CXW A;  4XF0 A;  3MV1 1;  1AZD A;  2ILM A;  1LTE A;  1PVC 3;  1A3K A;  1WCU A;  2ZGN A;  3J7M A;  4IV3 B;  4Y22 B;  5LBB A;  5E16 A;  1LU2 A;  5FZ6 A;  5ABJ A;  3I3M A;  2C5D A;  3LPG A;  3IPV A;  1MZF A;  2A70 A;  3RJ2 X;  2PAE A;  1S0J A;  1RUE 2;  2VTX J;  4EZH A;  2BV4 A;  3CHX A;  4UW6 A;  1NCQ B;  3VDD B;  3ZFE C;  2YDE A;  4NPL A;  4QXC A;  3ME2 A;  2PLV 2;  3DEC A;  4XET A;  5FYM A;  1E5R A;  3P3N A;  2O1Q A;  4BQX A;  1EV1 2;  3M8L A;  1JYV A;  4S2F A;  2VXR A;  5IT6 A;  3ZSL A;  1IS4 A;  1MEC 3;  1R1Z A;  2BGC A;  4M00 A;  2X05 A;  5DUX A;  1XOY A;  4N53 C;  1J3R A;  5DAW A;  3VHR A;  3VBF B;  4A42 A;  4HXC A;  5KC5 A;  3A7Q A;  4UWD A;  1RUO A;  5DPN A;  1D2S A;  2VNO A;  1G9F A;  4AFB A;  5F5C A;  4BQ1 A;  5FIX A;  1IKQ A;  1F8V A;  4R9C A;  1LHW A;  3RG0 A;  1HRI 2;  4JV4 A;  1QIQ A;  4JGY B;  4A7K A;  1DGW X;  3H8X A;  3MIB A;  3HNB M;  4V2V A;  1W6Q A;  3ZSK A;  3WP6 A;  2VAU A;  3GBG A;  4XHB A;  4YFZ A;  3PVN A;  4ZHN A;  1HJF A;  3KZ4 C;  2CGO A;  3E5Q A;  2J42 A;  5LBE A;  4URA A;  2CTV A;  4H7L A;  4L8Q A;  1YIP A;  5A32 A;  5A3L A;  1VBB 2;  4F83 A;  2GDF A;  4XAC A;  1CWP A;  2FD8 A;  1C1L A;  1NE6 A;  1SAC A;  3NV1 A;  4UFJ A;  1FX5 A;  1C28 A;  2WC2 A;  4LE3 A;  1AHS A;  4DFS A;  5CFC B;  4PHZ A;  3GM8 A;  1VR3 A;  2AC1 A;  1N3P A;  4D7S A;  4RGK A;  4XF4 A;  1QXP A;  5FY1 A;  1D0G A;  1BHG A;  1DGR N;  1GOG A;  1EAH 3;  2XGX A;  1AYM 1;  1RUG 1;  1BEV 2;  4LBM A;  4XAB A;  1PIV 1;  4KQ7 A;  3VZJ A;  4FPY A;  2VE1 A;  3WNO A;  5LK7 B;  2N7G A;  1PK6 A;  1QXJ A;  2G19 A;  1XYO A;  2JKX A;  4R9A A;  2GND A;  3AYE A;  1VBD 3;  5A6Y A;  3UNP A;  2J1U A;  1TNF A;  4FQZ A;  3U78 A;  2D6P A;  3EB7 A;  3K4D A;  2Y60 A;  3ZM8 A;  5FWE A;  4MZU A;  4A44 A;  4HSJ A;  3WIN E;  4CP2 A;  4RHV 3;  4BMB A;  1CPN A;  3WF2 A;  4QM9 A;  5T55 A;  1QJU 3;  4AAX A;  2D3S A;  2QBX A;  1POV 0;  1DU3 D;  2W52 A;  5FUI A;  4ARX A;  2PHR A;  1IQD C;  2BW8 A;  4FT8 A;  4QKD A;  1BBT 3;  5LY1 A;  4MGZ E;  1POV 3;  4QPY A;  4A7Y A;  3USS A;  1I5Z A;  1IQA A;  1BBT 2;  1IHM A;  1RC6 A;  2JDY A;  3M3C A;  1QJX 3;  3NKT A;  4HMZ A;  3B9C A;  5T54 A;  4C0H A;  2ZX1 A;  5AC9 3;  4CUC A;  1POV 1;  2YC0 A;  1RVF 1;  2BWC A;  1Q8S A;  2QQW A;  4KU7 A;  2FMD A;  3GHM A;  3A4U A;  1NCQ C;  3VDD C;  1R1A 1;  2R06 2;  1RUJ 1;  1SLT A;  4YVS C;  4LXL A;  4FOW A;  4CCO A;  1MS4 A;  1O59 A;  5GKA C;  4XYX A;  4Z8B A;  4OHX A;  1WCS A;  3I2K A;  1KDK A;  4OI4 A;  4XFA A;  1YFX A;  1K5M A;  2ZMK A;  1MQT B;  1QH6 A;  2FDG A;  4JGY A;  4AHW A;  2HWE 1;  1R09 1;  4LK7 A;  4CXX A;  3ON7 A;  3O0W A;  4WVM A;  1GZ9 A;  3WW3 A;  1JBC A;  4FFG A;  1PGS A;  3Q9O A;  2YBK A;  2OVU A;  5FY4 A;  4XMA A;  1H1I A;  5FZM A;  1OD5 A;  2JG8 A;  3IDB B;  2QQN A;  2DVG A;  3SEE A;  1FV3 A;  2P3K A;  3LSE A;  4K7J A;  3NWK A;  5FZ0 A;  1O8S A;  2DCT A;  2VBD A;  2XUM A;  1POQ A;  2ZGK A;  1F15 A;  4MH0 E;  1GFF 2;  1H2N A;  5IVC A;  3RZG A;  5HV4 A;  2HWF 1;  2Y6G A;  1RUN A;  3TWI A;  1OH3 A;  3B93 A;  2WN3 A;  1PMH X;  1W28 A;  3SIT A;  1H9W A;  4P9I A;  5JIU A;  3ETP A;  3WCS A;  1AR7 1;  3KQR A;  1Q8Q A;  4M3C B;  3IN9 A;  1DDL A;  2WNU C;  2V72 A;  4WVM B;  3WG3 A;  5A7W A;  3VKM A;  4CPB D;  4BWO A;  1BEV 3;  4MGY E;  3LOB A;  1CAW B;  4OYU A;  3N9N A;  1MEC 1;  1X36 A;  5A7Q A;  2XBO 3;  2FBE A;  3RNS A;  4B4Q A;  5DZG A;  2R49 A;  4NID A;  5C8C C;  1YQ5 A;  1V6J A;  5F3G A;  4W8J A;  2CHH A;  4ZY9 A;  2UY9 A;  2DTY A;  4MYE A;  4CP1 A;  2A6X A;  1W6M B;  4OI1 A;  1JYI A;  1BMV 1;  2OUH A;  2Z4F A;  4JRL A;  4I2O A;  3EYP A;  3TOJ A;  1WD4 A;  1R08 2;  3ETQ A;  3K2O A;  4S2H A;  4IEV A;  3APB A;  4LUK A;  4XXA A;  2FQP A;  5D8A B;  5GZF A;  5A33 B;  5JXG A;  3ZFF C;  4S2D A;  5JZG B;  1RB8 G;  4I30 A;  2ZGL A;  3ZYR A;  5ACA 3;  3FFQ A;  3OGS A;  1C8M 1;  1SPP B;  1W8F A;  1QOS A;  4PBO A;  3N7J A;  2WT1 A;  4ZZ8 A;  1AYN 1;  2FCV A;  2VC9 A;  1AR6 3;  4K20 A;  3UKV A;  3VL8 A;  1ZBE 1;  1W6N A;  1HB1 A;  2BEO A;  1DZQ A;  2VZT A;  1AR9 3;  3NV2 A;  2P3I A;  1JOP A;  3PME A;  3R4D B;  1H2L A;  5DDJ 2;  3ECQ A;  3LGR A;  4D6Q A;  4CU9 A;  1W0O A;  5I93 A;  2G9F A;  1NUK A;  3THP A;  1LGC A;  1HDK A;  1XNK A;  4AGG A;  1GOH A;  2B5H A;  2ES3 A;  4AFA A;  2E9Q A;  1O6U A;  3AFG A;  2DUQ A;  3MDP A;  3QBQ A;  1NCR C;  2XON A;  5APA A;  5GZC A;  5CKM A;  2X29 A;  3H1M A;  3RYR A;  5EHD A;  4XZU G;  3ENR A;  3QD6 A;  5FKC A;  4QT6 A;  2TBV A;  2YU2 A;  3BPZ A;  5FMB A;  4BK5 A;  1VMH A;  4MG2 A;  1U5Y A;  4YZ5 A;  4QPI C;  3VBU C;  4YLZ A;  2Y0I A;  5FO8 B;  4CUB A;  4LOR A;  5EQU A;  4YM3 A;  1SFP A;  2A6V A;  2YFZ A;  1UYX A;  3ZDS A;  2OS2 A;  4FAH A;  5A3N A;  4QX2 A;  2QJV A;  5A33 A;  3NQH A;  1TE1 B;  3H1W A;  5F5A A;  3MF9 A;  4J6G A;  3AJZ A;  4NWV A;  1SFN A;  4RS5 B;  5FYY A;  2ZHL A;  4DIQ A;  3J8F 3;  1V9U 3;  1KXG A;  1VBC 2;  4KL1 A;  4NMI A;  2WZE A;  5GM0 A;  1G9A A;  1SFY A;  2QNK A;  2XLG A;  4NAM A;  3S57 A;  1ZRD A;  5L9R A;  5CIS A;  3BTY A;  1ZX5 A;  4TLG A;  2YBS A;  1ZRR A;  4Y1V A;  3VKF C;  4CEY A;  4COV A;  1QJU 2;  3PJY A;  4NHM A;  1IZ3 A;  1CES A;  5AVP A;  3WD5 A;  1QF3 A;  5J96 B;  4OQ8 A;  1MZ6 A;  2P6C A;  5FPL A;  1EY2 A;  4HVR A;  1HQN A;  3PTY A;  2O8O A;  2ZCW A;  1XRU A;  4FPK A;  1VBA 3;  4AEJ A;  1R08 3;  2H0B A;  2VMF A;  3JQW A;  1OVP A;  2HBT A;  3K3N A;  4ITC A;  2JDP A;  5D8A C;  3WF0 A;  4AEK A;  2IXJ A;  4JKK A;  2VQT A;  2JDK A;  1VP6 A;  2RMU 3;  5DAX A;  4MSV A;  1GQP A;  2IZW A;  1JOB A;  1RIN A;  3H7J A;  5J3U A;  3ZXJ A;  5F37 A;  4LA3 A;  1JZ8 A;  1D7P M;  4M3C F;  1MS8 A;  3V0A A;  2W87 A;  2Q5T A;  3D0S A;  4UT5 A;  1GP4 A;  2H6B A;  1DQ5 A;  2YZ4 A;  3A0N A;  1LOE A;  4UBG A;  2PAM A;  1XNC A;  2PXJ A;  3LZZ A;  1PNG A;  4XUR A;  2A75 A;  2BTV C;  2BWA A;  1OI6 A;  2DUP A;  4YVW A;  1PVX A;  3MO4 A;  3LFM A;  2VO5 A;  4FP3 A;  4UW5 A;  4J1W A;  4XUT A;  4CEW A;  3TNP B;  5F3E A;  4FXK B;  2CU5 A;  1YC6 1;  5T5P A;  3UJQ A;  4BYY A;  5C3S A;  5C9A B;  3VHO A;  2PN5 A;  4Q4V 1;  3VZL A;  4BH9 A;  1RUC 3;  1VBA 2;  2R04 3;  1UMZ A;  3RRD A;  1O3R A;  4B3N A;  4CU6 A;  3UGH A;  1V6O A;  2Z42 A;  2WYS A;  4QM8 A;  1OBN A;  2VZQ A;  3L2Y A;  5FDB A;  1DQ0 A;  2A6Y A;  2YG0 A;  3G6J B;  2GAU A;  3PUA A;  3TYJ A;  1LOG A;  3ZN6 B;  4BZ4 A;  4K3U A;  2ZAH A;  4YW4 A;  2YGM A;  5LEJ A;  5LRR A;  2OPW A;  1DIW A;  4H2A A;  5FZE A;  2R04 1;  4AED C;  4OUL A;  2VUL A;  2FDH A;  2AEN A;  2D40 A;  3WG4 A;  4C8D A;  1REF A;  4RQP A;  2OW4 A;  4FVV A;  4I3G A;  2YGL A;  2GC1 A;  3TAY A;  1YFY A;  3T09 A;  2VU9 A;  2CWS A;  2PA7 A;  3WDT A;  4QAW A;  4FTB A;  5CFC C;  2BNN A;  2YUE A;  3IAP A;  4M0N A;  1OKQ A;  2ORZ A;  4AE2 A;  3D8C A;  4Q0U A;  1O8P A;  1DF0 A;  4K21 A;  2WQ4 A;  3B69 A;  2EVX A;  2XHK A;  3NAP A;  4K1Z A;  1O5L A;  1ULC A;  4P14 A;  3TNQ A;  3POF A;  4OZO A;  3AXD A;  3B7M A;  3ELN A;  5FXV A;  3ZYH A;  1Z7S 3;  1S0C A;  1S2E A;  3WNP A;  5FLI A;  3M7A A;  5E88 A;  2ETE A;  4IER A;  4KWU A;  1LED A;  1CZV A;  4RQP B;  1Q5O A;  2VCM A;  3OGG A;  1C3H A;  4LO8 A;  4WM8 C;  4IQP A;  3AJY A;  5I0R A;  1XNA A;  4LLO A;  4OHZ A;  2FCT A;  1X8E A;  4LKD A;  2YC4 A;  3DF0 A;  1RYY A;  4XF9 A;  1ZYB A;  1UY2 A;  4DEV A;  2Y26 A;  1JZ7 A;  4EQV A;  1PO1 1;  1Y43 B;  2IC1 A;  3H9A A;  2DV9 A;  2XQR A;  3MLJ A;  3S7I A;  3ZN6 A;  4JDO A;  1UOB A;  4J1X A;  3HN3 A;  3I3B A;  1D4M 2;  3SKJ E;  2A71 A;  1C8M 2;  1ND3 C;  3ZYP A;  2VH9 A;  4LKE A;  5E6H A;  1FMD 1;  1H30 A;  3CEW A;  5IK5 A;  3ATG A;  2HJI A;  3AP5 A;  4BCU A;  1RIR A;  1UPS A;  1YEW A;  5T5J A;  4GB3 1;  1Z0H A;  3RS6 A;  1J59 A;  3TEX A;  1ZBE 2;  1SZB A;  4UI9 L;  1IKP A;  1WA4 A;  5CFD B;  3JBG 1;  2WFP A;  3AKQ A;  3AZX A;  4Q4X 3;  3I2J A;  4Y24 A;  5IVJ A;  3N9O A;  2W0X A;  3V64 A;  4OUM A;  3ACH A;  5FUN A;  1SMV A;  3S0M A;  2DVA A;  4QWN A;  1W9T A;  3ZXD A;  5FLJ A;  3KT1 A;  1GNH A;  3ZXA C;  2W1S A;  3UGF A;  4BJ0 A;  2W08 A;  2GN3 A;  2OX0 A;  4YVW C;  4X6R B;  2EXJ A;  1WUV A;  3I2I A;  3FMG A;  1TVG A;  4UFK A;  4YW7 A;  5K4L A;  4XCA A;  4DPN A;  1RMU 2;  3AMQ A;  2EXK A;  3EBR A;  3KVA A;  4IDZ A;  1RUJ 3;  1OF4 A;  3B3Q E;  2X09 A;  2XJS A;  2RS1 2;  3I3Q A;  2GNB A;  3WG1 A;  4U2A A;  3WHT A;  1AXY A;  2K0G A;  2H0V A;  1QJY 3;  3DKW A;  2Y6J A;  4XJU A;  2F4P A;  4AFM A;  4QDR A;  3WUC A;  5CG8 A;  1ZRC A;  3LWC A;  4FPF A;  4Y33 A;  4ZKT B;  3OD0 A;  4P5Y A;  4YAR A;  2ZX0 A;  2E7A A;  1OD3 A;  3ZYI B;  2Y34 A;  3AKR A;  4JQR A;  2ZHK A;  3I2G A;  2W68 A;  3PNA A;  1COV 2;  2XXZ A;  2AZ5 A;  5D8A A;  4FPJ A;  3KS7 A;  5FPU A;  3WG2 A;  2ZGO A;  3VDB A;  1GSL A;  2Z79 A;  5T5L A;  1HB3 A;  3WY6 A;  4A6S A;  4Z92 B;  4RHV 2;  4W6W A;  2EIE A;  2J1T A;  3SH4 A;  5FP7 A;  3RWN A;  5JOY A;  2VMG A;  2JG9 B;  4AVC A;  1W05 A;  1F4H A;  2EXH A;  2PHT A;  2WLP A;  2W92 A;  2ZX3 A;  4KWL A;  4NAO A;  3HQU A;  5HI0 A;  2VZV A;  1PIV 3;  3P5B A;  4UW3 A;  1PGW 2;  5I8S A;  4NII A;  2OII A;  3OB8 A;  5FYT A;  3GYD A;  3VBH C;  4AF9 A;  5K0U C;  4DXR A;  2J1E A;  2HWD 1;  2R16 A;  1OLR A;  1U0A A;  4NHK A;  5FP8 A;  4A6O A;  1JI6 A;  4M0H A;  3ZKY A;  1CJD A;  1FPN 2;  1PM7 A;  3JD7 2;  3WV6 A;  1OXC A;  2X53 S;  1ND2 A;  2OT7 A;  3E6D A;  5C5T A;  1WCD J;  5JZG C;  3H7Y A;  2VUA A;  1HV1 A;  1YHF A;  4EZ4 A;  2UUR A;  1J3Q A;  3PU8 A;  3MGU A;  2DCJ A;  4B4R A;  3IBM A;  5L9V A;  4IV1 A;  4GH4 C;  3CL1 A;  1IPK A;  1L7Q A;  4FPC A;  5KWR A;  1U5Z A;  1RUF 3;  1GU3 A;  3AZV A;  3VHN A;  1BXH A;  5ABJ C;  3I3D A;  2IXK A;  1RUC 1;  2RDQ A;  2XKP A;  2XJP A;  3FC0 A;  2QQJ A;  4LKF A;  3WNX A;  3WZ1 A;  3X29 B;  1SBF A;  1WW5 A;  3LD8 A;  5IVB A;  2BFU L;  2LRP A;  3W9A A;  3WVJ A;  1NCR A;  1RUH 1;  1EP0 A;  4OMC A;  1LKN A;  2PHL A;  4A4A A;  4P02 B;  4B1L A;  1OUX A;  2WSV A;  2J1R A;  3IWZ A;  4HL0 A;  2Q8E A;  2QQP A;  1ZZC A;  4IEP A;  5C4W A;  5BPX A;  2BUK A;  3E1F 1;  4MXW A;  2PLV 3;  2A3Y A;  3OYW B;  5EYY A;  5FAX A;  1AJK A;  2VOK A;  4LO6 B;  5FZH A;  4QB1 A;  2Q0A A;  2WIN B;  4AQT A;  1ULD A;  4B4P A;  2HWE 3;  3OF1 A;  2XL9 A;  1MS0 A;  1ENX A;  1T2X A;  1CGP A;  4UFH A;  2VOX A;  3VZM A;  3Q8F A;  2YC2 A;  4QPI B;  4A45 A;  5GZD A;  1JZ6 A;  1L3J A;  2D43 A;  2W47 A;  2B45 X;  3HEI A;  4LJH A;  1AR7 3;  4LUM A;  3PLQ A;  4CVU A;  1APN A;  4RGA A;  3WW2 A;  4HKW A;  4Q4Y 1;  5F8P A;  1X82 A;  2VZS A;  5HCF A;  3III A;  2JDH A;  1JOJ A;  4KGG A;  5FMC A;  3N7L A;  4BQ4 A;  1XJA A;  3OYW A;  3WNL A;  1OPM A;  4E4Z A;  4OI0 A;  3BYW A;  3OSD A;  1AUY A;  2ZML A;  3CNA A;  1XU1 A;  2X5I C;  5LRS A;  1GMM A;  3IIA A;  5FMD A;  3NL1 A;  2L9L A;  1IS5 A;  4Y20 A;  3T2O A;  1W04 A;  3HNM A;  1RMU 3;  4IV3 A;  2RG4 A;  2VMD A;  4UAP A;  1B35 A;  2BVB A;  4IGP A;  2QUO A;  2PHX A;  4MGQ A;  1ZRE A;  4L92 A;  1I9R A;  2PHU A;  1W6O A;  3CDZ B;  1MR5 A;  3OPZ A;  4I0A A;  1MS3 A;  1R09 3;  3LOI A;  2RS5 3;  1K3I A;  4CP9 B;  3B01 A;  2WA4 A;  3JB8 A;  1WGP A;  3T2P A;  5DUW A;  3BU0 A;  5T50 A;  3RZH A;  4PIZ A;  3IMM A;  3RJR A;  1YNA A;  2YFU A;  2ZZJ A;  3FE5 A;  5T5O A;  1J3P A;  1GOF A;  3KCC A;  4L9B A;  4E4S A;  3BKZ A;  5BY5 A;  4FO9 A;  1F2N A;  3MW3 A;  3BUC A;  1RUE 1;  4CDW C;  3C8X A;  3RPQ A;  4QU2 A;  1W6N B;  1K45 A;  4QXK A;  3MPB A;  5C5U A;  3KQ4 B;  4BA6 A;  5EP9 A;  1EV1 1;  4YW1 A;  4OQ9 A;  3ZDV A;  1O5U A;  2D6M A;  2O0O A;  4IE5 A;  2RE9 A;  4FFH A;  2JEM A;  3SKV A;  2HYX A;  4CUG A;  2BRT A;  1NQD A;  5JDB A;  1UL9 A;  4FTE A;  1H8T B;  2W94 A;  3MFC A;  4PI0 A;  4K8F A;  5I0U A;  2XR4 A;  3VB9 A;  5A1F A;  1UYZ A;  1ZBA 3;  1K5J A;  1QKQ A;  2MHF A;  4Q0V A;  1NXM A;  2WRA A;  2WS9 1;  1HW5 A;  3GZU C;  4TWT A;  4FAG A;  1ZBA 2;  1ZZB A;  4XUQ A;  4UXA A;  1AR6 1;  4I0B A;  3UV9 A;  3M3I A;  4JC1 A;  1OA4 A;  1UN1 A;  2MEV 3;  1XYN A;  1RUI 1;  4CCE A;  4MGS A;  2IFW A;  2OKX A;  3DXT A;  4Y20 B;  2BNO A;  2RS1 3;  1MVE A;  2P17 A;  1W9S A;  3KLS A;  4IGO A;  5F1R A;  4XVH A;  3AYA A;  2XJU A;  3MIG A;  3VBR C;  1RED A;  4AED B;  3WQ7 A;  1LOF A;  1GZC A;  4NIH A;  1RUC 2;  3DPR A;  1W9Y A;  5FXW A;  1BZW A;  1RUD 3;  5LAS A;  3T4H B;  2A5Z A;  4MXW B;  2H6C A;  1UU6 A;  2VMH A;  2ZGR A;  3LA7 A;  3T1L A;  1V0A A;  1VMJ A;  3NMB A;  4EN7 B;  5FZA A;  5FCC A;  4Q4X 2;  4YSF A;  4RD7 A;  1UPI A;  1MS1 A;  3OBR A;  4UF0 A;  2E26 A;  5J36 A;  3ZN4 A;  5FZ9 A;  2F17 A;  1WZX A;  2UYA A;  4GA9 A;  5IK4 A;  1YRZ A;  4BME A;  2ZBJ A;  2VCA A;  1V6M A;  2ZJC A;  3MEP A;  2WO2 A;  2ARB A;  1N3O A;  1RUH 3;  2VNG A;  4FOY A;  1WME A;  5KXE A;  3QCW A;  4DOU A;  4OHY A;  2HYK A;  3I8T A;  4DXZ A;  4WBB A;  4MOA A;  1RUJ 2;  1HQW A;  4AFC A;  3SIS A;  5FBJ A;  1E5H A;  1JU3 A;  5A3W A;  3PUH A;  5FQ0 B;  4AGR A;  3ILR A;  3SC7 X;  1O91 A;  1TEI A;  3VD3 A;  3H0O A;  1OH4 A;  4PLO A;  4RQP C;  1UY4 A;  5IVY A;  1AR8 2;  2Y6H A;  4XJ9 A;  4W50 A;  2P5B A;  2K9Z A;  2V73 A;  1PO1 2;  3GZA A;  2ZMN A;  4B1M A;  1B35 C;  4COZ A;  2Q1M A;  1PX3 A;  2AUY A;  3H1Y A;  1OOP A;  2R1D A;  4IV3 C;  4DZG A;  5CEH A;  2HWD 2;  4XFF A;  3RYK A;  3V0B B;  4TSV A;  1GV9 A;  3MI8 A;  5FYZ A;  5JOZ A;  1W8W A;  2RM2 1;  1S0G A;  2GC2 A;  3AP4 A;  2CY6 A;  1O4T A;  2D6N A;  4FOQ A;  3ORJ A;  4OI2 A;  4UOJ A;  1MQT C;  3WNM A;  2WNV B;  3B00 A;  5JSO A;  4N9H A;  1UY3 A;  1SLC A;  1UW8 A;  2DFB A;  1H2M A;  1W2A X;  3O1R A;  1J58 A;  1LOD A;  3A22 A;  2P3J A;  2RS5 1;  3ZOI A;  4MUV A;  3ACG A;  4KGQ A;  1ZZ6 A;  2Q8D A;  2V4A A;  2E7T A;  2ET1 A;  3CMG A;  2MEV 1;  2WUH A;  2W95 A;  4Q0P A;  2B42 B;  2DU1 A;  3CJI B;  5BV6 A;  2G9G A;  1XE7 A;  3LIH A;  5LA9 A;  2B9V A;  5ACA 2;  3GBW A;  2QVS B;  2YYO A;  2W91 A;  4FPH A;  1RMU 1;  1DZT A;  2WS9 3;  2EAK A;  1XNT A;  3ZYJ B;  3RI9 A;  1V70 A;  4QPG A;  4P9X A;  5FYV A;  2DF7 A;  2YB7 A;  1VBC 1;  5FMO S;  2ATF A;  4J25 A;  1RUF 2;  2C6S A;  5DXD A;  2PQQ A;  4I02 A;  2ZTN A;  3VKO A;  3ZLI A;  4NRP A;  1BCX A;  3POI A;  2VVE A;  2O14 A;  3FLR A;  4M01 A;  3ZFG A;  3KWV A;  2VCC A;  5DAB A;  3WW4 A;  5KXB A;  4BIO A;  1V9U 2;  2GZW A;  4W6Y A;  3TRS B;  1DFQ A;  3DYO A;  3K46 A;  4BQY A;  4AW7 A;  4Y1X A;  2ZGT A;  1QJF A;  1PMI A;  4QMA A;  1VBD 1;  4JHT A;  1W2N A;  4BHP A;  3ROU A;  4QX7 A;  1ZZ7 A;  2QQI A;  5JI7 A;  5A32 B;  2VNR A;  1UIJ A;  3WR0 A;  1RGS A;  4QKB A;  3N9M A;  1WD3 A;  4Q27 A;  2HWC 1;  5IAV A;  1HXS 1;  2CSG A;  3AC0 A;  3M3Q A;  5G05 L;  5EIY B;  4E4D X;  5IJR A;  1A6C A;  2EID A;  1WLT A;  2R1B A;  3CO2 A;  1US2 A;  1TMF 2;  2VME A;  2W2I A;  1V6N A;  1C8N A;  1CIY A;  3GAL A;  3FLP A;  5BNN C;  3CKH A;  1TMF 1;  3ZXK A;  4CXY A;  1S0F A;  1UD1 A;  3D82 A;  2DVD A;  1OA3 A;  5GZE A;  2DTW A;  2V5Y A;  2K2S A;  5FY8 A;  4AQ6 A;  4XFH A;  4DO0 A;  2DYC A;  5HXV A;  4PDW C;  5F32 A;  1VBD 2;  2WO3 A;  3VLB B;  4HAN A;  5EV7 A;  5C33 A;  3WQ0 A;  3V0B A;  3NO8 A;  5A7S A;  4QPI A;  1X33 A;  4E2S A;  5A80 A;  1VAK A;  2JDN A;  3ZSJ A;  4P00 B;  2CYF A;  3RWK X;  2IFR A;  3ZKU A;  4NVP A;  1XYP A;  2R0H A;  1C8M 3;  1WBL A;  1YFW A;  4IXL A;  4XXP A;  2DCZ A;  5FZI A;  1AF9 A;  3AZW A;  1ASJ 2;  1U5I A;  4IND A;  3BI3 A;  1K12 A;  2B4K A;  2ENR A;  1ST8 A;  5GLT A;  2ZPX A;  3OUH A;  4NHY A;  4XJZ A;  2QFE A;  3WDY A;  5FY7 A;  3C7E A;  3ZR5 A;  1QNY A;  1XB9 A;  1YWK A;  4JCK A;  4ZS3 A;  5IVV A;  3FX3 A;  2E33 A;  4GAZ A;  3MUY 1;  5C4W B;  3MLK A;  5L9B A;  3M2M A;  4E9K A;  4F8A A;  1E5S A;  3JB4 C;  4EV0 A;  3W20 A;  3UL2 A;  2MNG A;  4Z2W A;  3POB A;  1KIT A;  4ONU A;  4ATE A;  1OLQ A;  1XU2 A;  2VQU A;  5H9P A;  5G04 L;  2OXB A;  3IT8 A;  2D97 A;  4XEZ A;  4BQW A;  1QMJ A;  3QH7 A;  3HQX A;  3MIF A;  2PTM A;  3ES1 A;  4O9E A;  4OHW A;  2VM9 A;  3C2U A;  2JEC A;  1DQ6 A;  3FUO A;  4JKM A;  4XDQ A;  5EFU A;  4BB3 A;  3SH5 A;  5K8S A;  2WZP P;  1VIW B;  5FZ8 A;  5LZ6 A;  2GH2 A;  4QPG B;  1W6P B;  3ILN A;  2RS1 1;  4PQ9 A;  1E57 A;  2BBA A;  2E53 A;  4XIO A;  5C7G A;  1XSQ A;  2C26 A;  2ORX A;  4RS5 C;  1PGL 1;  4GZ9 A;  3OEA A;  1HLC A;  1OMI A;  2BER A;  4QGN A;  5JVV A;  2CDO A;  2HH9 A;  5DUU A;  1LOB A;  4GQ7 A;  4HVQ A;  2B8M A;  4O65 A;  4AWD A;  3WCR A;  1ND3 A;  1UU5 A;  2E6V A;  2GMP A;  2HWE 2;  1SLA A;  1OOP C;  4CPB A;  4W65 A;  4Z82 A;  4LHS A;  5I0T A;  2WZ8 A;  1JYT A;  4ZZ5 A;  4L97 A;  3DXU A;  3FJS A;  5BUV A;  2ZS6 B;  3U4X A;  5IVF A;  1SBE A;  4IEQ A;  1AR9 2;  3WNN A;  5HPO A;  1NG0 A;  4GKX A;  2A6Z A;  4LHL A;  5FZC A;  5A6Q A;  2ADE A;  1JZ2 A;  2HWC 3;  4B29 A;  3VZN A;  1RVF 2;  2HWC 2;  3BTA A;  3JCI A;  3EMR A;  4JZR A;  4Q4W 1;  5H9S A;  4QX3 A;  3MIC A;  1LJ7 A;  2J1A A;  4PDW B;  5FYB A;  5A7W B;  1W8T A;  5BNP C;  5IVE A;  4QX0 A;  1YI7 A;  3PUI A;  4QDQ A;  1W2O A;  2PHF A;  5FMO L;  1VJ2 A;  1QH7 A;  3NV4 A;  5A6Z A;  5SV8 A;  3VV1 A;  1KJR A;  3JU9 A;  4LBO A;  1FV2 A;  3U10 A;  1ODM A;  1R1A 3;  2JG8 C;  2JDA A;  2OQ7 A;  2ZAC A;  4N43 B;  5DMY A;  1RHI 2;  1E5I A;  5F39 A;  4AR2 A;  1ONA A;  4EN9 B;  4LIV A;  3GJB A;  4YG3 A;  2B46 X;  5AC9 1;  5LA2 A;  3E5U A;  4B8E A;  2VBB A;  5D1I A;  3T0A A;  3T2Q A;  3TEY A;  4ORF A;  3BTX A;  1LCL A;  4OZX A;  3WXP A;  1IG3 A;  1BBT 1;  2BDR A;  1W3X A;  2E31 A;  4LHN A;  5BNP A;  5F3I A;  5CFC A;  2XVK A;  4R4Z A;  1OC1 A;  1GNY A;  1YXW A;  1LOF C;  1F5J A;  5HV0 A;  3HBK A;  2RMU 2;  4OMD A;  3K51 A;  1RUE 3;  2VZR A;  1DYO A;  1YIF A;  2DUO A;  1ND3 B;  2XJR A;  3TBD A;  2HLE A;  4KU8 A;  2JKB A;  3AYC A;  3SCH A;  4E8C A;  2JIG A;  1LR5 A;  5FJH A;  2ZEX A;  5F2W A;  2D6L X;  3U07 A;  1KGY A;  4DXS A;  3QOP A;  4EWE A;  1LU1 A;  3O1U A;  2IUW A;  2VZP A;  2I07 B;  5LA0 A;  1HRV 2;  1RUG 3;  4DUW A;  4IE6 A;  2WZR 2;  2VQ0 A;  2R04 2;  3GGL A;  1H0B A;  1AR7 2;  1YQ8 A;  4MHU A;  4XCB A;  4Y1Z A;  2HEY F;  2WNV A;  1ULF A;  1JN2 P;  2R07 1;  1UMH A;  4QD2 A;  1RL3 A;  1F4A A;  1ZM1 A;  5A7O A;  3U11 A;  4TXW A;  2KR2 A;  4ZU7 A;  4Q0Q A;  2RV9 A;  2Y64 A;  4BE3 A;  5CZK A;  3VDC A;  1S0B A;  4RS5 A;  5FPA A;  5AFB A;  1D2Q A;  4IW3 A;  4XBL A;  2QZ2 A;  2VW0 A;  1OOP B;  3O1T A;  4MXV A;  3GCX A;  4MHR A;  1HXS 2;  1UF2 C;  2WR9 A;  1WLC A;  3KCY A;  4X8N A;  1OPO A;  4ZON A;  2DVB A;  3MHZ A;  4AXO A;  2V5D A;  4PI2 A;  5HBA A;  3WHU A;  2YPJ A;  5FZB A;  5FOJ B;  1S0E A;  2XVG A;  4CCL A;  3N9L A;  2GC0 A;  2GN7 A;  3W59 A;  2RR1 2;  3GXU A;  3C7G A;  2BNM A;  1BLZ A;  3H3U A;  2IXI A;  2XPJ A;  4WVV A;  2QQK A;  4HBN A;  2AAC A;  5F2S A;  5KC6 A;  5A3M A;  5T52 A;  3HIF A;  5FV3 A;  1COV 3;  4D6R A;  3WQ1 A;  1A8D A;  1ZBE 3;  5HCB A;  3ZMO A;  5A3O A;  4AI1 A;  4IE7 A;  4AZZ A;  2LAL A;  2UWC A;  1W6O B;  1H1A A;  2GNT A;  2ARC A;  2HWD 3;  3BIW E;  5D2A A;  3ZSE A;  2P4E A;  2XHN A;  2VL4 A;  5TSW A;  1VMF A;  4YYO A;  1T6G C;  1B35 B;  1SQ4 A;  4DNY A;  5IK8 A;  1CAV A;  3OOX A;  1W8H A;  4A41 A;  1Y7B A;  1WBF A;  5FBZ A;  1AYN 2;  3AL6 A;  1FNY A;  2WL1 A;  2W1W A;  4JGZ B;  1TNR A;  3NST A;  4Q2F A;  1CD3 G;  2WFF 2;  3VBO B;  5HCA A;  4TLF A;  5DN2 A;  1PVC 1;  1NA1 B;  4XJ8 A;  1EPZ A;  3RZZ A;  2WWJ A;  4P5H A;  3WDW A;  4XMI A;  3RZK A;  1VBE 3;  3F2Z A;  3VGI A;  4P9L A;  4HZF A;  3NNG A;  3WQB A;  1X9P A;  1KFX L;  4GJY A;  4XOG A;  5CFD C;  4FBF A;  4AVA A;  1A8M A;  2EAA A;  3LE0 A;  4N53 A;  2IXH A;  3VD5 A;  2F6B A;  4N90 A;  1ZRI A;  3OY8 A;  3R4S A;  5FK7 A;  4YW2 A;  1RXF A;  5JMC A;  4YZ1 A;  4NUB A;  1ZBA 1;  2VNV A;  4YG0 A;  3R05 A;  5A3T A;  4K8R B;  5C9A A;  1D4M 3;  1O4Z A;  2VGD A;  1JOD A;  2CDP A;  4KBB A;  4KH9 A;  4HET A;  4MAD A;  4CDU A;  4NWW A;  4XAA A;  3RI8 A;  1M06 G;  2QQL A;  4Y4R A;  4BIS A;  3KV9 A;  5GLV A;  2PYT A;  1H8T A;  3BU7 A;  1UOJ A;  3U0Z A;  1NZC A;  1LUL A;  2E7Q A;  3BCW A;  3HD8 B;  3MLL A;  1OHF A;  2J1S A;  2VVF A;  4XIK A;  3OEB A;  1T6B X;  4QX1 A;  2JIJ A;  4SLI A;  3TEW A;  3OBT A;  1O7F A;  3TEZ A;  3PVB B;  2WAO A;  3RDI A;  4GJZ A;  3IPV B;  3LEK A;  1O3Q A;  1W8Z A;  3KMH A;  4Y5T A;  1A34 A;  1ULP A;  1BYH A;  5F3C A;  1DBN A;  2C24 A;  4QQH A;  5FY0 A;  4P9G A;  3POG A;  3I3E A;  3U1X A;  1F31 A;  2VUJ A;  3W5N A;  1OA2 A;  4GH4 A;  4HPK A;  3DPR B;  3WEZ A;  4TYS A;  5A70 A;  4Q26 A;  3PMS A;  1ZA4 A;  3Q8C A;  2IXL A;  2VXJ A;  3TN9 1;  5FXZ A;  4YGB A;  5E8A A;  1G86 A;  3SEP A;  1OLM E;  1UX7 A;  1HRV 3;  3NVC A;  2K46 A;  5C3P A;  2W39 A;  1V6I A;  2VQA A;  1CAU A;  3BOW A;  1OQD A;  3MIH A;  4CDQ C;  3HVD A;  4LPL A;  4BXF A;  2P34 A;  4PF5 A;  4RA0 A;  4ZXE A;  1JZ5 A;  1UXZ A;  2Q8O A;  1DP0 A;  4CSW A;  4ES8 A;  1JH5 A;  3BPS A;  5JAX A;  4FPO B;  3U37 A;  2QCS B;  4LOT A;  1H1M A;  3BN6 A;  4IEX A;  1OT5 A;  5A7N A;  1N1V A;  1S1A A;  1JHN A;  4YVS B;  4Q4Y 3;  1AX2 A;  4DUX A;  3S7E A;  1QOO A;  4XDP A;  2YRO A;  4Q4Y 2;  1JZ4 A;  4O61 A;  2NMO A;  3RVH A;  4FOV A;  4ATF A;  1NA1 A;  2VPV A;  1Q8O A;  4LO4 B;  3VBO A;  1ZZ9 A;  2WFF 3;  3DV8 A;  3Q8B A;  4G3Y C;  1R1A 2;  1AL2 2;  2R06 1;  2WWS A;  3MW2 A;  3J26 N;  1JU4 A;  4CCK A;  2E63 A;  1DYP A;  4V1P A;  3D6E A;  3O12 A;  1S2B A;  1GZW B;  1S55 A;  1MAC A;  2ZKN A;  1AL2 1;  2OZJ A;  2ZA9 A;  1QWR A;  4L2N A;  2WAB A;  2VTF A;  3VBF A;  3WW1 A;  5C8W A;  2A73 B;  2WNU A;  1PK6 B;  1EPW A;  3KSC A;  4NRO A;  4XUP A;  5DZE A;  4S2G A;  1OFS A;  3AZY A;  2BZD A;  3O14 A;  3POY A;  3VBS C;  1VRB A;  1VPH A;  4N43 A;  3RMX A;  1W06 A;  2V4V A;  2MEV 2;  2QTW B;  4Q4W 3;  4CDU B;  2WS9 2;  3N9P A;  1KS4 A;  4AHX A;  2GP5 A;  2P6H A;  4AI2 A;  2XUE A;  3C7F A;  1F9K A;  2XBO 2;  3LDB A;  5LAT A;  4XE9 A;  2GME A;  4YZ3 A;  2YMZ A;  4EWD A;  3HAG A;  3IDA A;  2Q8C A;  3OGV A;  1RHI 3;  3IB3 A;  1V6L A;  3THC A;  1US3 A;  2F4L A;  4DXT A;  2Q4S A;  1YI9 A;  2VW1 A;  4WM7 B;  4AI0 A;  1CON A;  1D4M 1;  3SHR A;  2QQM A;  3WOG A;  1DG6 A;  2RHP A;  3LKJ A;  2G9Z A;  1DLC A;  1EAH 2;  4EN0 A;  4YFW A;  5E89 A;  5I0S A;  4BU2 A;  3WUD A;  2LTN A;  5JR7 B;  1DGL A;  3NNF A;  2OA2 A;  4XDO A;  2HWB 2;  3N3H A;  4XC9 A;  2G1M A;  3IM0 A;  4N9I A;  4Q0S A;  3VBR A;  2D6O X;  4A7Z A;  3P1I A;  2XH6 A;  4Q1P A;  1AR8 1;  2ZHN A;  4NHX A;  5HCH A;  2CL2 A;  5FZ7 A;  2X5I B;  1HIX A;  1N3Q A;  1VBE 1;  3ACF A;  1W0N A;  4YGD A;  3KV4 A;  5GZG A;  4CZS A;  2LW8 A;  3K4Z A;  3DL3 A;  3N4M A;  1V00 A;  4CP0 A;  4TZD A;  2R6Q A;  3DKQ A;  1FPN 1;  1JXN A;  1RJ7 A;  2UYB A;  3FLT A;  2ZXQ A;  2JE7 A;  3KV5 A;  3OCP A;  2ZGP A;  3OUJ A;  4B7K A;  4D0Q A;  1I1E A;  1BQP A;  1LRH A;  1XC6 A;  1LNS A;  2AH2 A;  3IDC B;  3OUI A;  4YG6 A;  1IPJ A;  2ERF A;  1HRI 3;  4NE9 A;  2C1F A;  5CA6 A;  4M3C A;  3E6C C;  2ADD A;  5LA1 A;  1QQP 2;  2GSY A;  3USU A;  3AYD A;  2XB6 C;  5DG1 A;  3T30 A;  4OHV A;  4MO3 M;  3VHP A;  3VKN A;  4BQ2 A;  1ZA7 A;  4K6B A;  5BNO B;  3BVC A;  1S0D A;  3R4U A;  3ILF A;  3T4V A;  2P1B A;  2X10 A;  2FMY A;  2EIC A;  1R08 1;  3GF6 A;  5FP3 A;  4COY A;  1PZ8 A;  2D98 A;  2GAL A;  2WNE A;  4CDW B;  1PGW 1;  3V56 A;  2WKK A;  2QDN A;  3OPW A;  1UY0 A;  4LLF A;  4XIL A;  1FNZ A;  3I4I A;  4LR4 A;  3DN7 A;  4NO4 A;  1ENQ A;  4BPZ A;  3O5S A;  1PK6 C;  4C1X A;  1Y4W A;  1VAL A;  2JG8 B;  1HKD A;  2RR1 3;  4N43 C;  2EAL A;  5EJ1 B;  1LAJ A;  4XJA A;  1H6X A;  1P8J A;  2KA3 A;  2ZGQ A;  4HN1 A;  2VZO A;  5B4N A;  1WW6 A;  3EO6 A;  2ZEW A;  2JIC A;  3KGZ A;  4AFD A;  5DUV A;  2AGS A;  1RJ8 A;  1LEN A;  2WO7 A;  1JYX A;  4OVE A;  4ASK A;  3FUQ A;  5LK5 A;  4HK8 A;  3PL0 A;  5L19 A;  3W5M A;  4TTG A;  1NT0 A;  1JUH A;  5FZ3 A;  3MF6 A;  1W03 A;  2XJV A;  5JPN B;  1TQ5 A;  4KBZ A;  1QNW A;  5L73 A;  2Y6L A;  5FFO C;  1ASJ 3;  1N1Y A;  2RMU 1;  2VD7 A;  2NLR A;  1TG7 A;  2GP3 A;  4FPG A;  2WNO A;  4CRQ A;  1KS5 A;  1KJL A;  3B9I A;  1VBA 1;  3DUI A;  4I01 A;  2RVA A;  4G9S B;  5LBC A;  1G9B A;  5KHG A;  1CAX A;  4CEW C;  2YBP A;  1C57 A;  3OPT A;  4YM2 A;  4DY3 A;  4LEJ A;  3RMY A;  3DYM A;  4Y1Y A;  5IK7 A;  4AHZ A;  1S0I A;  4ET7 A;  2WJS A;  4O7X A;  4JKL A;  4WZC A;  5C3R A;  2B7Y A;  1CPM A;  2VY0 A;  5F6K A;  3J8F 1;  4COW A;  4HKL A;  1QJX 1;  1BVV A;  1FT9 A;  5FTT C;  1CAV B;  1J1T A;  1AR9 1;  2IVJ A;  4WVZ A;  3CLP A;  4FSJ A;  1WCK A;  2PAK A;  1MVQ A;  1W99 A;  3ZXF A;  3J4U H;  2WAA A;  5M0T A;  5J1X A;  4L99 A;  5FY5 A;  3CF6 E;  4IEO A;  1QJU 1;  1CVN A;  1Y9Q A;  2ET7 A;  2NQY A;  4D6S A;  4JDM A;  3T0D A;  1URX A;  3D3A A;  4XQW A;  4NHL A;  1QGL A;  2ZGM A;  4EE2 A;  2FZ1 A;  2JDM A;  4GKY A;  4R52 A;  2P37 A;  4QQL A;  2JJ6 A;  4YM1 A;  3HPN A;  4GWN A;  1HN0 A;  1OKO A;  3T0B A;  4ZXK A;  3ZXE A;  1AXK A;  2WT0 A;  3AXE A;  3OY8 B;  3CJI A;  4IGQ A;  1LOA A;  1RXG A;  1SEF A;  1SCS A;  2NMN A;  3JXS A;  4WM8 B;  2RS3 2;  2ZAA A;  4PDW A;  1IOA A;  4PIX A;  5C9A C;  5EJ3 A;  1UWW A;  2WBK A;  4ERO A;  1L7R A;  1CJP A;  1J84 A;  4JGZ C;  1VRH 1;  4LBJ A;  3SH3 A;  2WN2 A;  3HT1 A;  3PUS A;  4M3C E;  3ZXG A;  2FDJ A;  5FP9 A;  5CFD A;  3VBH A;  1UU4 A;  1W9F A;  4Y26 A;  1CIW A;  3OD4 A;  2Y0O A;  1CAU B;  1QU0 A;  4JDN A;  2UWA A;  3VBU A;  3FFZ A;  3VN4 A;  5L7O A;  2Y8K A;  3A0K A;  1AYN 3;  1DLL A;  3AM2 A;  5EYX A;  5DAV A;  3I2H A;  2DUR A;  5KHH A;  3ZXL A;  3I49 A;  2VOW A;  1QDC A;  1LGN A;  5CKQ A;  5ACA 1;  1LOC A;  3AMM A;  1X9T A;  1FAT A;  3KVB A;  4N7I A;  2X8K A;  3UYJ A;  1BJQ A;  3NW4 A;  3C3V A;  2OZ6 A;  4HPK B;  1WMF A;  3WT3 A;  4OCT A;  3QLQ A;  4IE4 A;  1W90 A;  3ZFG C;  2ZOE B;  1BKZ A;  1QJX 2;  1W9W A;  5JI9 A;  4XPV A;  1CX4 A;  2JE8 A;  1YJL A;  4XF3 A;  3KM5 A;  1JUI A;  1Q56 A;  3ZVX A;  4GIQ A;  4CEW B;  5DZF A;  4YVW B;  4CTE A;  1JYN A;  1PMJ X;  2R07 3;  3BOP A;  4LBQ B;  2DBI A;  4CEY B;  3LDK A;  2XG3 A;  4QPG C;  3NRU A;  4AVT A;  3RZL A;  3I59 A;  1NYW A;  4B7E A;  4F3J A;  5CG9 A;  1RUD 1;  1HQL A;  1U5X A;  4E4H A;  1CZT A;  1CZS A;  4COU A;  2PFW A;  4PT6 A;  4AAP A;  2EF6 A;  5KR7 A;  5AVA A;  3T1M A;  3N7M A;  1BMV 2;  2WYF A;  2ZEY A;  2FDK A;  1RUI 3;  2DWR A;  4PQQ A;  3SCF A;  4CCJ A;  3J7L A;  4LE4 A;  3HOB A;  2V09 A;  4QKN A;  3AX4 A;  1J83 A;  4QQ2 A;  2VUC A;  2XJT A;  3OTF A;  1YLL A;  2HWF 3;  4O9G A;  4CDQ B;  5JPM B;  2Q1Z B;  1O4Y A;  3AP7 A;  1SDW A;  1X8M A;  4GD4 A;  4DB5 A;  3G7D A;  3WDV A;  4AGV A;  5GAL A;  5ISL A;  5C70 A;  4P9J A;  1QEX A;  1WCQ A;  2BPA 2;  4FI9 A;  4YW5 A;  4LT5 A;  3MUZ 1;  4CUA A;  1EV1 3;  2J1V A;  2ZX2 A;  1TZO A;  4QGM A;  3OGJ A;  4HN0 A;  4HKO A;  1MS9 A;  3VBH B;  3GBF A;  2B39 A;  2D7F A;  4PCR A;  3VL9 A;  1H2K A;  5JSR A;  4XTM A;  1XE8 A;  1GIC A;  2R0F A;  3LEG A;  2VJX A;  4LBQ D;  2SLI A;  3NV3 A;  4RYD A;  5J09 A;  1GKB A;  3VD9 A;  3O1O A;  1SLL A;  4N8M A;  1ENS A;  1KQR A;  5IWF A;  2JD9 A;  5FO9 B;  4LBQ A;  4YZ2 A;  1OUR A;  5FJK A;  2OYZ A;  4WM8 A;  2W3J A;  4GB3 3;  1GNZ A;  3KT4 A;  1JHJ A;  2WLQ A;  2BVV A;  3H50 A;  5FQ0 A;  1DZR A;  5FOB B;  3VUO A;  4H3W A;  2IVI B;  4ASL A;  4QHO A;  3FL7 A;  4RR3 A;  1FMD 3;  3HJR A;  3Q8E A;  2JB8 A;  4C1W A;  5A6X A;  2ZGU A;  1REE A;  2VG9 A;  1WLD A;  3CIH A;  1GYK A;  5F9T A;  4YZ4 A;  2Q30 A;  1NAE A;  1NZI A;  3IMN A;  4CCN A;  3NAP C;  3RZJ A;  5SV5 A;  4YGC A;  3N7K A;  4IE0 A;  5BNO A;  4W4Z A;  4JGY C;  3VBU B;  4MET A;  2QZ3 A;  2QQV A;  2IXC A;  2CAU A;  1W39 A;  2R30 A;  4WM7 C;  5FKB A;  2JDZ A;  1XBF A;  4NPR A;  4IEU A;  5C3Q A;  3KB5 A;  1BK0 A;  1HX6 A;  1NQJ A;  2W1Q A;  3DGT A;  4QXB A;  4WVW A;  5F6L B;  1H4G A;  2WA3 A;  2WII B;  4XBN A;  2VUD A;  4GUL A;  4DY5 A;  3J8F 2;  2W1U A;  4ISR A;  1M4W A;  4Q4W 2;  1Z78 A;  4H7M A;  4BOW A;  4YVS A;  4EYU A;  1G8W A;  2ZHM A;  3ACI A;  2GU9 A;  5CNA A;  1Q43 A;  5FP4 A;  1EAH 1;  5FRE A;  4QQP A;  4AQS A;  1GZT A;  4IEZ A;  3ITQ A;  1W0P A;  4YM0 A;  4GWM A;  4MGT A;  4M4R A;  4IUG A;  5LBF A;  1ZNP A;  2D3P A;  3O7O A;  5F5I A;  5D21 A;  1NOV A;  3ZIX A;  3P6B A;  3UJO A;  3POS A;  4RGG A;  4I09 A;  3WNK A;  4CDW A;  1SG3 A;  4FTS A;  3D4K A;  3HNY M;  1H9P A;  2ID4 A;  4GH4 B;  3PIG A;  3PJQ A;  3AVR A;  4BDV B;  2WDB A;  3HQR A;  5CAD A;  3O1P A;  3MW4 A;  4LOS A;  3OBZ A;  4C0B A;  2WQZ C;  5ABJ B;  2BP6 A;  4E2Q A;  3O1S A;  1HN1 A;  3I54 A;  3PVO A;  1KD7 A;  1F5F A;  1LHN A;  2YY1 A;  4QHZ A;  1OUS A;  1X50 A;  2XDV A;  4A3Z A;  5FZO A;  3VDA A;  4L11 A;  1WWY A;  4XUN A;  1QY4 A;  1SDD B;  1TMF 3;  2JX9 A;  4JVA A;  5AFE A;  5KBF A;  3H3L A;  4XW3 A;  1MPX A;  4UBH A;  1UXX X;  1CAX B;  1KEX A;  1VRH 3;  2DCY A;  2XWJ B;  1Q3E A;  5I91 A;  1JMU B;  4XHX A;  1NLS A;  2HWF 2;  4FXG B;  3THT A;  2LRO A;  4Q4V 3;  3VBO C;  1FMD 2;  5E1R A;  1NA1 C;  4Y3O A;  5B4X A;  5JIA A;  4AVS A;  3ZFE B;  3GDB A;  1RUH 2;  1WW4 A;  5LW9 A;  2QDR A;  4ASM B;  2WO1 A;  3K75 B;  5FO7 B;  1ND2 B;  3WP3 A;  5GLU A;  2A6W A;  2ARE A;  3H8O A;  4FCA A;  4SBV A;  5L7O C;  3LPF A;  3J7H A;  3WDX A;  1R64 A;  1UOF A;  1Z7S 2;  2HEW F;  4NRQ A;  5KXD A;  4LUL A;  4QB6 A;  4OUS A;  2TNF A;  3ZR6 A;  3K3O A;  5IUQ A;  1TME 2;  1QJZ A;  3FHQ A;  5DG2 A;  5K7P A;  1NKG A;  3D5O A;  2HWB 1;  3JD7 3;  4LNV A;  5FR3 A;  3B02 A;  4AOC A;  3UT0 A;  2GNM A;  4HFS A;  1DQ1 A;  1PNF A;  1VBC 3;  3IKW A;  1W6M A;  1QOT A;  2J22 A;  2YV8 A;  3SMH A;  1UYY A;  3CZU A;  2BBV A;  5FXX A;  5ANQ A;  4RSU A;  3HT2 A;  2D6K A;  3EQE A;  3CQO A;  4NPM A;  3INA A;  1O3T A;  2CNA A;  3I2F A;  2GC3 A;  2RDN A;  4DMI A;  1SHW B;  4QDS A;  5KHJ A;  2Y33 A;  5J37 A;  1PIV 2;  2JDU A;  3NNM A;  5FY9 A;  1V9U 1;  3W21 A;  3ZYF A;  2TUN A;  2MPF A;  2GMM A;  3BOD A;  3PUQ A;  4XAE A;  2Y6K A;  1WW7 A;  2BOJ A;  5HXM A;  1C5I A;  4HSL A;  4I3P A;  4Q4X 1;  4CCC A;  1SCR A;  1CX1 A;  1GP5 A;  1VB4 A;  1RIT A; 
#chains in the Genus database with same CATH homology
 3W5N A;  1EUU A;  4QB1 A;  3WEZ A;  3DEC A;  1JYV A;  2X05 A;  3SEP A;  1T2X A;  1UX7 A;  1WKY A;  2YC2 A;  5IHR A;  4A45 A;  4A42 A;  1JZ6 A;  3CZJ A;  1H6Y A;  3A7Q A;  5IFT A;  2W47 A;  3HEI A;  5DPN A;  4LPL A;  1JZ5 A;  3UES A;  4ZXE A;  1UXZ A;  1DP0 A;  4CVU A;  3U37 A;  2VZ1 A;  3BN6 A;  3OGR A;  1OT5 A;  2R7E B;  2VZS A;  3HNB M;  3III A;  4DUX A;  3MV0 1;  1JZ4 A;  1ULO A;  3WNL A;  1GMM A;  1EUT A;  2L9L A;  3T2O A;  3HNM A;  2QQO A;  1JU4 A;  3ABZ A;  2VMD A;  4UAP A;  3GM8 A;  4ARY A;  2WAB A;  2VTF A;  4RN5 A;  4MGQ A;  3FN9 A;  1XPW A;  1BHG A;  3CDZ B;  1GOG A;  4XUP A;  1UY1 A;  1K3I A;  5LCW L;  2BZD A;  3T2P A;  3WNO A;  2V4V A;  2YFU A;  2JKX A;  3C7O A;  3UNP A;  1GOF A;  2J1U A;  1UMI A;  3C7F A;  1OF3 A;  3EB7 A;  3K4D A;  3ZM8 A;  4A44 A;  1I5P A;  2VZU A;  3C8X A;  3WF2 A;  1K45 A;  3IDA A;  2QBX A;  5FUI A;  3OGV A;  4AAX A;  4ARX A;  3IB3 A;  3THC A;  1US3 A;  1W8N A;  1IQD C;  4DXT A;  3SKV A;  2HYX A;  2W94 A;  2QQM A;  2BGO A;  5JUV A;  1UYZ A;  4CUC A;  1DLC A;  2WQ8 A;  3A21 A;  4XUQ A;  3OG2 A;  1JYW A;  3LQC A;  3P1I A;  4MGS A;  3K77 A;  2OKX A;  1O59 A;  3ACF A;  1W0N A;  1W9S A;  3I2K A;  4XVH A;  4D8M A;  2LW8 A;  3K4Z A;  3VD4 A;  2ZXQ A;  4D0Q A;  2VOT A;  1XC6 A;  1LNS A;  3LEI A;  2C9K A;  5LA1 A;  4MO3 M;  4Z2A A;  2VR4 A;  2E26 A;  2QQN A;  3SEE A;  2X10 A;  2EIC A;  4QB2 A;  1O8S A;  4JX0 A;  2VCA A;  2WO2 A;  4BXS V;  1UY0 A;  2Y6G A;  4MOA A;  2WN3 A;  1PMH X;  1JU3 A;  5EJ1 B;  3PUH A;  3VD3 A;  3ETP A;  1H6X A;  1OH4 A;  1P8J A;  1UY4 A;  3FHA A;  2VZO A;  2Y6H A;  4W50 A;  4AG4 A;  2V72 A;  5B4N A;  2ZEW A;  5IFP A;  1PX3 A;  1JYX A;  4OYU A;  2J7M A;  4OUE A;  2PQS A;  2EIB A;  3W5M A;  2W46 A;  4W8J A;  4TTG A;  4PF1 A;  4ZY9 A;  2Y6L A;  4UOJ A;  3WNM A;  2Z4F A;  1TG7 A;  1UY3 A;  3EYP A;  3A22 A;  5JXG A;  2RVA A;  3DYP A;  3ACG A;  4KMQ A;  3CMG A;  3OGS A;  2WUH A;  2W95 A;  3DYM A;  4ZZ8 A;  2B9V A;  2VC9 A;  2W91 A;  4ET7 A;  5JMO A;  1XNT A;  4JKL A;  2VZT A;  3THD A;  5JXI A;  1YQ2 A;  2YB7 A;  3OBA A;  3ECQ A;  4CU9 A;  1NUK A;  3WF3 A;  1W99 A;  2WAA A;  5J1X A;  2RJ2 A;  2XQX A;  3WF4 A;  1GOH A;  2VCC A;  3T0D A;  3D3A A;  2VCB A;  3DYO A;  3K46 A;  2XON A;  4XZU G;  3HPN A;  3MBW A;  3T0B A;  4BK5 A;  2QQI A;  5IYY A;  3JXS A;  2W5F A;  4CUB A;  3AC0 A;  4HG6 B;  5G05 L;  2VZ3 A;  5EIY B;  5JXH A;  2YFZ A;  1UYX A;  5IJR A;  2EID A;  4QX2 A;  4GWJ A;  1UWW A;  1US2 A;  2WBK A;  1L7R A;  2VME A;  3NQH A;  1J84 A;  1CIY A;  2WN2 A;  3CKH A;  4BK4 A;  2WO3 A;  2WZE A;  4P00 B;  2Y8K A;  3I2H A;  4M4P A;  1K12 A;  2B4K A;  2VMF A;  3C7E A;  1W9W A;  2BGP A;  3WF0 A;  3T08 A;  2E33 A;  3MUY 1;  2JE8 A;  2VQT A;  4JKK A;  1JYN A;  1GQP A;  1PMJ X;  1JZ8 A;  1D7P M;  2VQU A;  5G04 L;  2W87 A;  3NRU A;  4L0P A;  2VM9 A;  1CZT A;  1CZS A;  4JKM A;  5JR2 A;  4XUR A;  4PT6 A;  3NJV A;  1JZ3 A;  3C7H A;  3MO4 A;  2VO5 A;  4LKS A;  4XUT A;  4JHZ A;  2ZEY A;  2BBA A;  5C7G A;  4PQQ A;  2C26 A;  2ZEZ A;  3HOB A;  2ORX A;  1J83 A;  4GZ9 A;  4CU6 A;  3OEA A;  2BER A;  2WYS A;  2CDO A;  2VZQ A;  1K42 A;  3A23 A;  5C70 A;  2YG0 A;  1WCQ A;  4FI9 A;  3WF1 A;  2KD7 A;  4GWI A;  3MUZ 1;  4CUA A;  2J1V A;  4P08 A;  4LHS A;  2WZ8 A;  4ZZ5 A;  3WNN A;  5HPO A;  3LEG A;  2VJX A;  1JZ2 A;  4RYD A;  4XUO A;  3VD9 A;  3T09 A;  2JD9 A;  1NX9 A;  4QAW A;  4QX3 A;  2J1A A;  2VMC A;  3IAP A;  4LQR A;  4QX0 A;  2ORZ A;  3PUI A;  2W3J A;  1O8P A;  4QDQ A;  1JHJ A;  4DEQ A;  3FL7 A;  3HJR A;  5CYY A;  1W8O A;  3CIH A;  4OZO A;  2JDA A;  5DMY A;  5A1A A;  3NJX A;  3WNP A;  1NAE A;  5LA2 A;  4KWU A;  1CZV A;  3T0A A;  3T2Q A;  3WSO A;  4W4Z A;  2XOM A;  2W9X A;  2E31 A;  1XNA A;  1GNY A;  2YC4 A;  1RYY A;  4OMD A;  1UY2 A;  2VZR A;  2W1Q A;  4DEV A;  1DYO A;  1JZ7 A;  2HLE A;  2W1U A;  4E8C A;  2E32 A;  2ZEX A;  3HN3 A;  3I3B A;  1KGY A;  4DXS A;  3SKJ E;  2VZP A;  5LA0 A;  3ACI A;  4DUW A;  4DUV A;  4KI5 M;  3GGL A;  1UMH A;  4M4R A;  1F4A A;  1GUI A;  4IUG A;  4UI9 L;  4TXW A;  2DCK A;  2RV9 A;  2Y64 A;  3P6B A;  3I2J A;  5CZK A;  4E8D A;  3VDC A;  3ACH A;  5F7U A;  3WNK A;  5C71 A;  2C4X A;  5I0D A;  1SG3 A;  1W9T A;  3K4A A;  3HNY M;  2ID4 A;  2W1S A;  4BJ0 A;  4BDV B;  2WDB A;  3I2I A;  1TVG A;  2V5D A;  3I97 A;  1OF4 A;  2X09 A;  1HN1 A;  3GXU A;  2Y6J A;  3C7G A;  4QDR A;  4A3Z A;  4CU7 A;  2QQK A;  5DQ0 A;  3VDA A;  4XUN A;  4P5Y A;  1SDD B;  1OD3 A;  1MPX A;  1UXX X;  1KEX A;  3I2G A;  3BGA A;  2DDU A;  4YPJ A;  2XHN A;  3VDB A;  2VL4 A;  5B4X A;  3GDB A;  4A41 A;  4CU8 A;  2EIE A;  2J1T A;  2WO1 A;  3K75 B;  2W1W A;  1F4H A;  2W92 A;  5DN2 A;  3LPF A;  3J7H A;  1R64 A;  2VZV A;  3IAQ A;  5EJZ B;  3F2Z A;  2LS6 A;  3NNG A;  3WQB A;  3OB8 A;  1UZ0 A;  4QB6 A;  3VD7 A;  4DXR A;  2J1E A;  4A6O A;  3LE0 A;  1JI6 A;  3VD5 A;  3FHQ A;  1NKG A;  1PX4 A;  5JXJ A;  3UET A;  2DCJ A;  2CDP A;  2J22 A;  4MAD A;  1L7Q A;  1UYY A;  3CZU A;  2QQL A;  1GU3 A;  3CQO A;  3I3D A;  3I2F A;  2QQJ A;  4QPW A;  2J1S A;  1SHW B;  4QDS A;  3OEB A;  4QX1 A;  4OMC A;  3MV1 1;  2WAO A;  4A4A A;  4P02 B;  2Y6K A;  2J1R A;  5HXM A;  3LEK A;  3LPG A;  1ULP A;  3E1F 1;  1CX1 A;  3I3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...