4GWJA

His 62 mutant of the lectin binding domain of lectinolysin complexed with lewis b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
PVETENIARGKQASQSSTAHGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet aggregation factor Sm-hPAF
publication title Manipulating the Lewis antigen specificity of the cholesterol-dependent cytolysin lectinolysin
pubmed doi rcsb
source organism Streptococcus mitis
molecule tags Sugar binding protein
total genus 38
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4gwjA00
2HLEA 2ZXQA 2ORXA 1UXXX 2ID4A 2J1EA 3K4AA 1JYVA 1F4HA 1P8JA 3I2GA 1SHWB 1W8NA 3SKVA 3U37A 2VMDA 1NKGA 2BGPA 5B4XA 4L0PA 3VD5A 3THCA 4A45A 5A1AA 1D7PM 3NJXA 5LCWL 4YPJA 1OH4A 3WSOA 4D8MA 4DXTA 3IIIA 5JXIA 3IAPA 4CU9A 3BGAA 2QQNA 2X09A 3I3BA 3OG2A 1ULPA 5IYYA 3HOBA 1EUUA 3UETA 4W50A 2L9LA 2VQUA 1XNTA 4BJ0A 3UESA 4LPLA 2Y8KA 2DDUA 2VCBA 5J1XA 2QQKA 3I97A 4XZUG 3T09A 1XNAA 2DCJA 5IHRA 3WF4A 2WO3A 1HN1A 3PUHA 2WN3A 3CIHA 1UY3A 4CUAA 3WNMA 4DEVA 4DUWA 1JZ7A 1W9SA 2HYXA 3FHAA 1JU4A 2VZQA 3P6BA 2E32A 4JKKA 3P1IA 3ZM8A 4CU7A 2B9VA 3J7HA 1UYZA 3UNPA 2Y6GA 1F4AA 4QX2A 2PQSA 2B4KA 1UY2A 4JKMA 5CZKA 3HNBM 4LKSA 1JZ3A 2W9XA 1UY4A 3DYOA 3VD7A 1NAEA 3IDAA 3OEBA 2RVAA 3LEGA 2VZOA 1UMHA 2JE8A 2VZSA 3OGRA 4QPWA 3A21A 2J1AA 4FI9A 4XUNA 1JYNA 3JXSA 3MO4A 2XONA 3AC0A 2VZ3A 1US3A 1SG3A 1IQDC 1PMJX 2VZ1A 4QDQA 3C8XA 1W9WA 5DPNA 1CIYA 3K4DA 1JYWA 1GUIA 1W9TA 4QB2A 2QQJA 2VCCA 1GOHA 4XVHA 2VL4A 1YQ2A 2YC4A 1UY0A 3NRUA 5DQ0A 1H6XA 1GU3A 5JUVA 3BN6A 4BXSV 3THDA 5F7UA 2JD9A 2QQOA 3K4ZA 3LPFA 4OUEA 4KMQA 4BK5A 5HXMA 4UI9L 1L7RA 1DYOA 3OB8A 4A42A 2ZEXA 3CQOA 4RYDA 5EJ1B 1US2A 2QQIA 4OYUA 4QAWA 2X05A 2W91A 3I2FA 3SEPA 2Z4FA 2E31A 1WCQA 1PX3A 2BERA 4OMCA 3WNPA 2W46A 4QB6A 3I2JA 1L7QA 4XUPA 1TVGA 3IAQA 3ACFA 3A7QA 3CKHA 3OGVA 3VD9A 3MUZ1 2W1QA 1K12A 3W5NA 3ACHA 1NUKA 3VDBA 5LA1A 2Y6KA 3WF2A 4CU8A 5JMOA 3SKJE 3HNMA 4QDSA 4QB1A 4UOJA 1GOFA 3W5MA 3C7FA 1UMIA 2VO5A 4GZ9A 2J1UA 2VM9A 2LS6A 4QX3A 4TXWA 4ET7A 2WAOA 1MPXA 2VQTA 3T2OA 1NX9A 3NQHA 4P00B 4Z2AA 5LA0A 3HEIA 4GWIA 3VD3A 1XC6A 3FN9A 1KEXA 1TG7A 3DYMA 3MUY1 4DEQA 4AAXA 1UWWA 1CZSA 2XQXA 3C7HA 3WNNA 2QBXA 1UXZA 2W87A 5FUIA 1O8SA 2C26A 3CMGA 2W1UA 3LQCA 3SEEA 3VDAA 3K75B 1K42A 4XURA 4P02B 2QQLA 2Y6HA 4DXRA 2VMEA 4QDRA 4BK4A 4D0QA 2WAAA 2VMFA 3T0BA 2J7MA 3OBAA 3HPNA 2YFZA 2WDBA 1O59A 2J1RA 3WF3A 3K46A 2W5FA 3LPGA 1ULOA 1H6YA 2Y6JA 3GDBA 4IUGA 2W95A 2OKXA 2J1VA 4E8DA 3T0DA 1W99A 5IFPA 3I2HA 1J84A 4JKLA 4KI5M 4XUQA 3A23A 3ETPA 1J83A 2X10A 3CZJA 4PT6A 3DECA 4ZXEA 2EIDA 4BDVB 4M4PA 3E1F1 3ACGA 1CX1A 3WNOA 1OT5A 1GNYA 2BGOA 3IB3A 5IFTA 5C70A 3NNGA 3WQBA 4W4ZA 4A6OA 4P08A 3T0AA 2YG0A 1JZ2A 1JZ5A 4JHZA 3CZUA 3MV11 2C4XA 3I2IA 5C71A 2EICA 4DUVA 2WABA 3HJRA 5I0DA 2BBAA 2J22A 2J1TA 3VDCA 5LA2A 5CYYA 5B4NA 5IJRA 4A3ZA 2VR4A 2VZTA 4W8JA 5DN2A 3LEIA 3MV01 1RYYA 3C7OA 4MGQA 4CUBA 5EIYB 2XHNA 3PUIA 2VJXA 1OF4A 2R7EB 2WN2A 3GGLA 1UYXA 2CDOA 3I3DA 2WBKA 2XOMA 2ZEZA 2V5DA 5JXGA 2WYSA 3C7GA 4ZZ5A 2ZEYA 2Y6LA 1DP0A 3GXUA 3WF0A 2VZPA 3CDZB 1CZVA 4LQRA 1O8PA 2VZRA 2YB7A 4QX1A 1PMHX 2JDAA 4M4RA 2C9KA 3T2PA 2RJ2A 3T08A 3DYPA 3WF1A 2WO2A 4UAPA 2WO1A 4HG6B 1K45A 2RV9A 2ZEWA 1I5PA 4MADA 4PQQA 3HN3A 5G05L 3C7EA 4MO3M 4RN5A 3WNLA 4QX0A 3EB7A 4CU6A 1JZ4A 3ABZA 2W1WA 4A4AA 4ZY9A 2VZVA 4JX0A 1JU3A 1CZTA 4MGSA 3ECQA 5G04L 4CUCA 1JZ8A 5C7GA 4OZOA 4LHSA 2CDPA 4A41A 2W47A 3I2KA 3MBWA 2W1SA 4ARXA 2VC9A 1EUTA 3I3EA 4ARYA 1WKYA 1BHGA 1LNSA 1W0NA 2WZEA 1XPWA 2QQMA 1JI6A 4GWJA 5HPOA 1PX4A 2W3JA 1KGYA 5DMYA 1GQPA 2EIEA 2VCAA 1W8OA 2E26A 3HNYM 2E33A 1OF3A 4TTGA 2KD7A 2W94A 3F2ZA 2WQ8A 4KWUA 2JKXA 2VOTA 3K77A 3LE0A 4XUTA 3WEZA 2BZDA 3ACIA 1DLCA 1JYXA 2WZ8A 4XUOA 3OGSA 1JHJA 1UZ0A 1GOGA 3OEAA 2VZUA 4DUXA 4A44A 3A22A 2VTFA 1T2XA 4CVUA 5JR2A 1UY1A 1UX7A 2YFUA 4PF1A 2V4VA 4OMDA 2EIBA 2WUHA 3D3AA 3T2QA 2V72A 2LW8A 3LEKA 1JZ6A 2DCKA 4P5YA 1SDDB 3GM8A 2VMCA 2W92A 1K3IA 1UYYA 2Y64A 4MOAA 5JXJA 3WNKA 4E8CA 3FL7A 2YC2A 3FHQA 3NJVA 2ORZA 4ZZ8A 5EJZB 4AG4A 3VD4A 3EYPA 1GMMA 2J1SA 1R64A 1OD3A 4DXSA 5JXHA
chains in the Genus database with same CATH superfamily
1RMU2 3BTXA 1CN1A 4COYA 1BK0A 1AL23 3TNPB 2YYOA 4GAZA 3VKLA 4PDWC 4JCKA 1F4HA 1P8JA 4M0NA 1OFNA 2BDRA 1OOPC 1W8NA 3U14A 1G9CA 3RZHA 4PQ9A 5FP8A 3SKVA 3WW4A 2VW0A 5CNAA 4XIKA 2YGLA 2JB4A 4N9IA 3NV3A 1XNCA 4N43C 3ALQA 2O8OA 2ZZJA 2OS2A 1FATA 3V0BB 1RVF2 2JWPA 1SLTA 4RHV3 4Y1YA 3SNMA 3VD5A 4A45A 4I3PA 2R16A 1W6MA 4QU2A 4XDPA 5LCWL 4FOVA 2HWB2 1OH4A 3WSOA 4DXTA 1K5MB 3MI8A 1HB4A 2R042 4PDWB 1Q8SA 3BGAA 4IETA 1OOPB 1VP6A 3B00A 5J37A 3LDRA 5JR7B 4ES8A 3S5AA 2MHFA 3RI8A 3OY8B 1V9U2 5GZEA 4OQ9A 2ZKNA 2FMDA 2WRAA 3HT1A 5SV8A 2I2SA 2XLGA 1W6NA 2DU0A 4MH0E 2VMHA 4TN7A 3ST7A 2XPJA 3PIJA 4XDQA 1ZZ6A 2BVBA 4QT6A 5DABA 4AGRA 4AK3A 3WDVA 4ASMB 4DQAA 3D0SA 1SBFA 3ZO0B 3WP6A 2JECA 3AX4A 3F95A 5BPXA 1O3TA 5J1XA 3ORJA 4XZUG 2W39A 4XVHA 2DCJA 3MW4A 5IHRA 1R082 4R4ZA 4LKFA 1RUE1 3MFCA 5FZ8A 5F5QA 4P9LA 2YUEA 4DUWA 5FYYA 4CA9A 2GH2A 4JGZC 1PGL2 3FHAA 3PTRB 4CRQA 3KLSA 1V6IA 2R1BA 4CEWC 1RINA 2G9GA 1A8MA 1B35A 1FNZA 5FZMA 3ZM8A 4CU7A 4PF5A 5LBFA 4NO4A 4WM8B 3T2TA 4JC1A 1S0DA 4QGNA 5CIRA 4IEVA 3CNAA 3JBG1 4FT8A 2PQSA 1COV1 1SPPB 5FBZA 3VBUC 3GZAA 5CZKA 5DZEA 5KXCA 1GP5A 3VD7A 1HJGA 2O8QA 4YZ2A 3IDAA 4AI3A 3W20A 4CEWB 3RZJA 4UFMA 3OEBA 1HQWA 4NRQA 1QF3A 2SLIA 2NQYA 1H9PA 1QJY3 4IEOA 4KG8A 3W9AA 2K0GA 1PVC3 4BH9A 3O1VA 3B5LB 1JYNA 1G86A 3MO4A 1VBE3 2IVJA 3AC0A 4CCMA 2D43A 3VBUB 5FXXA 3PUQA 5FY0A 1RUJ3 5JPNB 1XNKA 2Y0OA 2C5DA 1JUHA 1ZZ9A 1ND3A 2VE1A 3H50A 4OI4A 1RL3A 3GBFA 1I1EA 4UW4A 1CIYA 5LA9A 1JYWA 1GUIA 5F6KA 3ENRA 1Z7S2 2G1MA 1D4VB 2QE3A 2RS51 1TE1B 3AZYA 4QB2A 1AR61 5JOXA 2QQJA 2BBVA 5A3PA 1YQ2A 2X29A 3FMGA 1J1TA 1U12A 3V64A 5HCHA 4XJ9A 1AR73 4HFSA 1H6XA 1GU3A 1HN0A 3BN6A 3JCIA 5EQUA 1CQ9A 3LPFA 4OUEA 4KMQA 5FRAA 1NQDA 1N3QA 1XYOA 1SDWA 5HXMA 5J48A 4XABA 1L7RA 3VKNA 3WCSA 2ZGQA 1OVPA 1U0AA 2A6ZA 1PZ7A 1YXWA 2XQRA 1GZWA 2GDFA 3LSEA 2QZ3A 4RYDA 4YW1A 5EJ1B 3ZR6A 2XDVA 5FXZA 1BBT2 1O5LA 3GZEA 2D98A 1UU6A 1XE0A 2P6HA 1OFSA 2W91A 2Q8EA 1UZWA 5FCCA 4YGCA 2PYTA 3KZ4C 3FLTA 2Y26A 1UX6A 2WKKA 1ST8A 3NW4A 1C57A 1FNYA 2B42B 2W46A 4H7MA 1PO21 3K51A 4XF0A 5FZFA 2RS53 1L7QA 4RGKA 4XUPA 2R32A 1TVGA 4TWTA 3WDYA 4WVWA 4IEQA 4CDUB 3ZFFB 5JCTA 4Q26A 3OGVA 1QY4A 3D5OA 2DUPA 3AZXA 3KV4A 3MDPA 1K12A 5FMBA 1GKBA 2ZX4A 1FYUA 2DBNA 2A70A 5FZKA 3OCPA 1F8VA 5LBCA 4CU8A 3GJAA 4XFGA 2XWBB 3MLLA 3LZZA 4HKLA 2EAKA 4P9YA 4QB1A 5FXWA 3U10A 4XFHA 3I3MA 4FTSA 1GNZA 3WDXA 2K9ZA 2VO5A 1MZFA 4Y20A 1QQP1 2OUJA 4ZU4A 3BPSA 1JYTA 3PVOA 1E5SA 4NR1A 1T6BX 2RS33 2RDNA 2PAMA 1RJ7A 4P00B 2PLV3 4R9CA 1HW5A 3BTYA 3VBFA 3GJBA 1FOD1 1A8DA 3AVRA 3OD4A 4GWIA 2RMU1 4QPIC 3OPTA 4XFCA 4FOYA 3FN9A 5IVJA 1JTZX 4Q4W2 4OI2A 2VNRA 3BB6A 4P9IA 3S7IA 4QKFA 1WA4A 3DYMA 2HWD1 1W6OB 1DQ5A 1VAMA 2F4PA 5CU1A 4DEQA 1UIKA 5J7MA 1HDKA 5C4WA 2A6XA 3LFIA 3H1YA 3APBA 4HVQA 2YDEA 1TEIA 4DFSA 2ILMA 1SLAA 1YNAA 2VNOA 2WFPA 1UXZA 1JOPA 1VRH2 3FE5A 2ZACA 3JD71 1RIRA 4MVTA 3SEEA 1WBLA 2CWMA 4QPIB 3TRSB 2XH6A 1NCQA 2IXKA 3K75B 1RGSA 2VTXA 3OUJA 1AXZA 4B7EA 4LKDA 5IVVA 1QQP3 4DMIA 2Z79A 3HMYA 2JDKA 2VMEA 3UK9A 3QLQA 3UJQA 3PUAA 3AKQA 4K1YA 4KH9A 1IPJA 1LENA 1RHI1 3VBRA 2YROA 3WG2A 2WAAA 5A6YA 3LIGA 5IVBA 1DF0A 1EAH1 5FYTA 3I2OA 3T0BA 2J7MA 4JZRA 4EWAA 3VBOA 4DNYA 2RMU3 4LE3A 1E5RA 2W5FA 3IDBB 2XVKA 3CHXA 5I0SA 1D0GA 3I7DA 1JYIA 4IE7A 1W6PA 1XU1A 3K2OA 4AI2A 1X8EA 2WNVC 4UW3A 2W95A 4I0AA 4JGYA 5JMCA 1REFA 2XKPA 2HWF2 3LDBA 2ET7A 4GB31 5KHJA 3KQRA 3I2HA 1J84A 3CU7A 4QQPA 5IT6A 3ETPA 1J83A 1AR83 3AKPA 4QKBA 1V6JA 1POQA 4Q0QA 4B1LA 2VULA 2WNUB 2YZ4A 4LO5B 4FPOB 4NHKA 1NE6A 1CAVB 2WNVB 1OT5A 4EQVA 1DLLA 3RZZA 1J1LA 4E4SA 1QJZA 2BGOA 2HWB1 2OQ7A 4DOUA 1H8TA 1XE8A 1VBA2 2R041 1LHOA 2NM1A 3ZFGA 4CDXA 2EVXA 1RUD3 2K46A 2XMLA 1BZWA 2J42A 5IAVA 3M70A 1TME1 2VGDA 4NHYA 1C1LA 1ZX5A 2DF7A 2RDRA 2QFEA 4R8HA 1CONA 3VHPA 5DDJ2 2V4AA 3JB8A 4AI0A 2BWCA 4QQOA 3ES4A 3MV11 1ZBE2 3GBGA 3T30A 4EV0A 2JG8A 4LLOA 1Q5OA 1W8WA 2R0FA 4GB33 2ARBA 1IZ3A 4YW6A 2FDJA 3KCYA 1I3HA 3O0WA 5FZLA 2EICA 4AR2A 5LZ6A 3HJRA 4E27A 4H55A 1HRI1 3R4SA 5JZGC 4AFCA 2J22A 1OKQA 4EN7B 3C3VA 1OLME 3VDDC 1ENXA 1C8M2 5HI0A 3H8RA 2RS13 1APNA 1MS3A 1RUG1 1LOFA 5FJHA 1W06A 3R6SA 1CPNA 5KHHA 4ZONA 2BNMA 4QKNA 1LU1A 1YJKA 3Q8CA 4AGVA 4CE8A 2VR4A 5KXEA 3T1LA 1S2BA 4JHTA 4Y22A 5ANNA 2DWRA 4B1MA 2OIIA 3H1MA 4EWDA 1TME3 5JZGB 3DXUA 4INDA 4XQ4A 3ZSLA 1OF4A 4GXLA 1CJDA 3HQXA 4NIGA 5IUQA 3VDDB 2WN2A 1B35C 1L7LA 3POEA 2P5BA 3WQ1A 4FFFA 4N53A 4YNIA 4HK9A 5FDBA 1QMJA 2CDOA 1YI7A 4YZ3A 3VN4A 5CG8A 1AYM3 3AMPA 5D21A 2G4IA 4XFFA 2WBKA 1W3XA 3INAA 5JXGA 3PNAA 2WYSA 3VZMA 3KHCA 5K9YA 2ZEYA 4IGOA 3QH7A 4XQWA 4NOTA 1YQ6A 5KXBA 5KWRA 2A1XA 1RUG3 1MACA 1YWKA 2AR6A 3Q8FA 2VMIA 4KWJA 2Y60A 3J7MA 4LOTA 4RGGA 4LBNA 3POIA 5D8AC 4CCDA 5DAWA 3JU9A 5AC93 1CZVA 2DVAA 3EMRA 3GYDA 1O8PA 3HVDA 3U11A 2DCYA 4FPLA 4QXHA 3WNXA 4KG0A 1YI9A 5A1FA 5HCAA 2W52A 4Y1VA 2DCZA 3D0JA 4SBVA 2C9KA 4DY5A 5FO9B 2XJVA 3VKFC 3CJIA 4C0HA 5D2AA 1NLSA 4ISQA 4XF1A 4PI0A 1N1VA 1ND3C 3WY6A 3IPVA 1DHKB 1CAWB 1PGW1 5FZ1A 5D8AB 2WO1A 1RC6A 1AL22 3FX3A 2ZEWA 1W9YA 5FAXA 1V6LA 2I45A 1RUH2 3C7EA 4MO3M 1S2EA 1MEC1 4Z07A 3WNLA 4DZGA 3WT3A 3V0AA 4C1WA 1VIWB 3S30A 5FP9A 2P6CA 2VZVA 3L9JT 4ZY9A 1RJ8A 2IFWA 1JU3A 2JIGA 1LEDA 4HOOA 1CZTA 1SLCA 4LK6A 4ATEA 4CDWB 3BALA 1CX4A 4HMZA 1ND3B 4QXBA 5A7OA 1QNYA 2E63A 3UKNA 1ZZCA 2CWSA 4C91A 4AHYA 1JZ8A 3B3QE 3EO6A 1R1A3 2X5IC 4OZOA 2FZ1A 5EFUA 5I91A 3SQOA 2CGPA 1BBT1 1MZEA 2FCUA 3PTYA 3MBWA 4WM7B 2IUWA 3ZSJA 2AUYA 4L99A 4CCCA 4FAHA 4NHLA 5J98B 5FY5A 3H9AA 2ARCA 4X6QB 5HPOA 1PX4A 1W9FA 2W3JA 2JEMA 2X5IB 1OC1A 4ZPIA 4JAAA 5GZCA 1GQPA 1SEFA 2IXIA 2EIEA 4XMAA 4G4FA 5GM0A 3HNYM 3WINE 4CP0A 1L3JA 2XJTA 2EA7A 5TSWA 1OKOA 1OF3A 5I0UA 4AHXA 1GYKA 4BB3A 4I0WB 2VOTA 3L2HA 4ATFA 4YW4A 3IZOA 2VOWA 4D7SA 5CFDB 3P3PA 4PIYA 4XUTA 4NVPA 4AFAA 3TEWA 2VOKA 4OHZA 1JYXA 4QM9A 1R091 4HSLA 2WZ8A 4XUOA 3OGSA 4FBFA 3I59A 1UZ0A 4IESA 3ZDSA 3A22A 2NLRA 5ACA1 1AJKA 3G7DA 4KL1A 3POYA 3ZMNA 4CVUA 5JR2A 1TQ5A 3ON7A 5I8YA 2CV6A 1AX0A 2YFUA 4PF1A 5H9RA 1Q8VA 2EIBA 4EWEA 4IL7A 4QU1A 2YXSA 2ZGSA 3VBFC 5FQ0A 2C1FA 5KXDA 5IATA 1WMFA 1DQ2A 1HJFA 4JVAA 2RM23 3BI3A 2LW8A 4DINB 2WJSA 1AYN3 1E5IA 1PVC2 4QX8A 4UFHA 3R4DB 3SH3A 1RUE2 3UYJA 1SDDB 3GM8A 5FZAA 4ITCA 4C0BA 1BMV1 3ZVXA 2Y64A 1UYYA 1R093 4YM1A 5FZ4A 3NO8A 4NPRA 3DEMA 3RWNA 4BCUA 1VMJA 3ZIWA 5T5LA 1YIFA 3H8XA 1VBC1 2R071 2WLPA 1Q8OA 2WNOA 5LBEA 5LASA 4BM8A 3E5QA 5ACA3 4ZZ8A 3VBHA 4JQRA 4AG4A 3O1SA 1COV2 3VD4A 1DG6A 1H4GA 4IE4A 4XETA 1RITA 4YRDA 2WR9A 3BPZA 4BE3A 2GC0A 1ZRCA 1BK1A 3KV5A 3MFAA 4YM3A 2C24A 2OXBA 4IGPA 1JYCA 2ZJCA 2GMPA 2ZXQA 1V70A 5E8AA 1AR72 1QJX3 3IKWA 5FYBA 3WP4A 5ABJA 1G9BA 1AR91 1WW7A 2J1EA 1JYVA 4XTMA 1YCIA 3H3ZA 1N3PA 2PHUA 3TB0A 1K5JA 4QGLA 1LECA 3I2GA 1SHWB 4OUMA 2E6VA 1W39A 3AYAA 2TUNA 5BNNC 1IKPA 1LGCA 3MPPG 5A6XA 4RS5B 2IZWA 5FMOS 2VMDA 1PGSA 1NKGA 5B4XA 3ZN5A 4L0PA 2VBDA 2JG9A 2Q1ZB 5A1AA 3THCA 3B02A 2G9FA 2VOXA 1OQ1A 4W6YA 3VZJA 1RUC1 3BTZA 5JI9A 1D7PM 1UIJA 3NAPA 3J8F1 4CCEA 2BPA2 4YPJA 4D8MA 3J26N 5KHGA 5JXIA 2UYBA 2JJ6A 4CU9A 1ALYA 1FMD3 2B45X 3HWJA 3WQ0A 3LOBA 1CAXB 1ULDA 2TBVA 2RS52 3OG2A 3USUB 3HBZA 1AR62 1QXPA 3DKWA 1EUUA 2RR11 2ES3A 1WW4A 4W50A 3UETA 1H9WA 3ZFGC 4CDXC 1QEXA 3AKRA 4K7JA 2WZR3 5GLZA 4N9HA 4QQLA 5KC6A 5FYVA 3D82A 3WP5A 2VQAA 4ISRA 5FZBA 1YC61 3UESA 1DQ4A 4MLOA 1GICA 5GALA 4NN0A 3ILFA 5GJ6A 5GLVA 2JG8C 3GHNA 3ILNA 4GJZA 5C3OA 4BIOA 4WZCA 4AI8A 3WDUA 2ZMNA 2VCBA 1TZOA 2IXLA 2YU2A 4QM8A 5CFCA 3J4UH 1U5XA 5FMCA 4KGQA 1VJ2A 3CJXA 5A33B 3I97A 3KF5A 4GALA 4YW2A 1YYNA 2E7AA 1O4YA 2WO3A 4N8MA 1SFYA 1VBB3 1RUC3 5FZ7A 2WN3A 3CIHA 4CUAA 4DEVA 3J8F3 2AENA 3WNMA 1UQXA 5ABJB 1OSGA 4FFIA 1W9SA 4RQPA 2HYXA 4MG2A 1JU4A 4UFJA 2VZQA 4UXAA 1PO22 2RS32 3H7JA 3NSTA 4P14A 4V2WA 3BU7A 2HWC1 4XMIA 4EROA 1W05A 4Q4V1 4Q4Y3 2RR13 4XEZA 2VXJA 1OH3A 1YFXA 4COWA 2A3YA 1S4CA 2A6YA 1UYZA 1QDOA 3UNPA 4HZFA 2Y6GA 4XIOA 4R9AA 4O65A 4RR3A 1OLRA 3KB5A 5BNNB 3HQRA 4Q1RA 3VUOA 4AI1A 2H0VA 3N9NA 4IV3C 4L11A 4JQTA 4WV8A 1NAEA 2H6CA 2ZKLA 1PIV1 5A7PA 5FZEA 4Q8KA 2EIGA 5FXVA 3MZHA 4YLZA 3H42B 4AAPA 4DRRA 3LEGA 2G19A 3OGRA 2JE8A 2O1QA 3HAGA 4FP3A 3AL6A 5FZOA 3TEXA 1URXA 3A21A 2BRTA 2J1AA 4L9BA 2BU9A 4LXLA 2ATFA 4HPKA 5J09A 5KBFA 1QQP2 4JDOA 1OUXA 2WQZC 2VZ3A 5F32A 3B9IA 1IQDC 3B7MA 5FFOC 4IV3B 4I0BA 4FTBA 2JDNA 1W04A 1Y9MA 4CEYA 1QH7A 3J9SA 2RJLA 2FDGA 1FOD2 1UNBA 1W6QA 2Y33A 2RMU2 1HXS1 1W9WA 1CR7A 4BLIA 1FPN3 4DIQA 1EV11 2DU1A 3PVNA 4Y1XA 1O3SA 4NIDA 4BQYA 4PCRA 2GN7A 2ZGTA 1LB2A 3ZXEA 2JD4A 5BNPA 1PNFA 5JSPA 2XUEA 4UW6A 3LOIA 4JDNA 5FPBA 4Y24A 1UY0A 5CKMA 4P9XA 2ARXA 5JUVA 3IWZA 1H2LA 1DQ0A 3JD72 3THDA 2Y6FA 2WYFA 1AR82 4YSFA 1UKRA 2Z69A 4U36A 5FYUA 5AVPA 4C1XA 3UGFA 2JDMA 4RHV1 5F7UA 2VUJA 2QQUA 4NHMA 1PM4A 2ZEXA 5K4LA 2JX9A 1ODNA 1YO8A 1Y9QA 4MV2A 1EAH2 1WD4A 1SBEA 4OYUA 4Q0UA 4E4ZA 1W0OA 4QD2A 1RUD2 3I2FA 4G3YC 4LHLA 1HXS3 3OYWA 3POFA 1ULCA 4MGIE 4MXWA 4YVWA 3ZFEB 5B2GB 4OMCA 1PX3A 5K0UB 3WNPA 3FBMA 1KS5A 1NA1A 1UO9A 4LITA 1MR5A 2MEV3 3LA3A 3MF6A 4O9EA 4WVMA 4Q5OA 5C3RA 1CIWA 3V0AB 4GB32 2N7GA 3UJOA 4XXAA 1QU0A 3RRDA 4JRLA 1OI6A 3VD9A 2VNVA 2GSYA 4IW3A 4M3CA 2BTVC 3PL0A 3MUZ1 2W1QA 1KQRA 5F3CA 3QCWA 3BIEA 4JDMA 4BWOA 5DAQA 3AP9A 2BQPA 5FZ3A 5LA1A 2Y6KA 2QTWB 3SLIA 4AHZA 4OHVA 1IHMA 3HNMA 2JB8A 1WLTA 1O3QA 2OPWA 2AZ5A 2IVIB 3C7FA 1H8VA 3RYKA 4FPEA 4EN0A 1O5UA 1WW6A 4D7TA 1W8ZA 4XBQA 1TME2 4EN9B 4AEDA 2BP6A 3TNQA 1GZCA 1QOOA 2VM9A 4N43B 2XBO1 4QX3A 1FI2A 1MQTA 2P1BA 5DUXA 4TXWA 4ET7A 1AVBA 3TEYA 3M1HA 4IE0A 2CGOA 5LA0A 1Z78A 1D4M1 3HEIA 4OHYA 1VBD3 1WCKA 2R49A 3ITQA 3GNEA 1GZ9A 2CAVA 2PHTA 3RZGA 4E2SA 3TEZA 1AX2A 1HRI2 1RUI1 5E16A 1AZDA 1W90A 1NY71 2HBUA 2A3WA 1QJY1 3KVBA 1SCRA 2QQWA 4GIQA 5JIUA 5T5PA 1PVC1 1NOVA 1RUG2 1CZSA 2XQXA 1C5IA 2LTNA 1NCRA 3MEPA 3OPZA 3VBSC 3WNNA 3UV9A 1VBE1 2UYAA 1OPOA 2XGXA 5JSRA 1G7YA 3AMQA 1RUJ1 4M3CF 4HKWA 4MGTA 4AVSA 4GULA 1X7NA 5KHKA 2CNAA 4XBNA 2QQLA 3GALA 2Y6HA 1N1SA 1UZYA 2ZGRA 5F37A 4QDRA 3CEWA 3PU8A 2XBO3 1GWMA 3ZPYA 1H1AA 4NUBA 4XTPA 2KR2A 5C3PA 2NMOA 3KM5A 3Q8AA 1D4M3 1QGLA 4YVSA 3VBSB 3VHOA 4CXYA 2WDBA 5A6QA 2J1RA 3V56A 3ZN6A 3ME2A 3WF3A 4JGZB 5JIAA 2BYVE 2VW2A 3LPGA 1ULOA 1VALA 4IEZA 1H6YA 2Y6JA 1RUI3 5D1IA 1AR71 1KXGA 2OKXA 2YBPA 5FR3A 2PXJA 2D3SA 2WA3A 3OD0A 4UF0A 5DG2A 1RTVA 1VMHA 3VZNA 3T0DA 4AEKA 1DZQA 5IFPA 3N9MA 1XE7A 3N9PA 3DXTA 1SMVA 4WZFA 4KBZA 5A7SA 3A23A 1S2KA 5FYCA 1XOYA 5FIXA 2HH9A 2XWJB 3CZJA 5FMOL 3DECA 2A7AA 2EIDA 1YEWA 4UBGA 4ZXEA 4LBQA 4M4PA 3E1F1 2DV9A 2IFRA 3VB9A 2FQPA 1KD7A 4MSVA 2JG9C 4NROA 2P17A 3MW2A 1UMZA 4LMFA 4QX7A 1ODMA 4XCBA 1PGW2 1JS9A 1G9DA 1CAUB 5H9PA 5JOYA 3CO2A 5FZCA 1W8FA 3U4SA 1JZ5A 1HKDA 3IT8A 1OBNA 2ZHMA 1MEC2 5IW0A 4XE9A 3I2IA 1ND2C 1FV3A 1UD1A 4QXCA 5BNOA 5C71A 1PO13 5L7OC 3THTA 4FTEA 3VGIA 3H8UA 1QJFA 1IQAA 1C1FA 1UZVA 2J1TA 1X36A 5JWPA 5IVEA 3U0ZA 1IKQA 3JQXA 5A3WA 4AE2A 4Z2WA 4L92A 1W2AX 2V09A 1KDKA 5B4NA 5FY8A 1ND2B 1Y4WA 5IJRA 5HXVA 1TNRA 5C5UA 1BEV3 1Q8PA 2RS31 4L97A 5L7OB 3LEIA 3MV01 1HB3A 1RYYA 4GWMA 4BISA 3C7OA 4AL9A 4MGQA 4N7IA 2PLV1 5EIYB 3M2MA 2VJXA 4XJZA 3AP4A 2ZCWA 1H2KA 1OLQA 2R7EB 3VZOA 2FCVA 1O6UA 1YRZA 5A7NA 1PHMA 1UYXA 1YHFA 2FDIA 1X9PA 2GNTA 2ARAA 4Q29A 4QPGA 1MS0A 1XRUA 4HSJA 5DG1A 3WUCA 1LODA 3I8TA 4HKOA 4F8AA 5IVFA 2RM22 2ZEZA 3E5UA 3U78A 1F31A 3LFMA 3OPWA 3AKTA 1AYN2 1WLDA 3NV2A 2Q1FA 1HQNA 4ZZ5A 4W6WA 1DP0A 1ULGA 2VPVA 3WXPA 4AEMA 4F3JA 4MXVA 1DDLA 1R092 4LBQD 4XJ8A 5BNQA 1HRV3 2D6LX 1QDCA 1CESA 4E2QA 2VZPA 1BXHA 4YARA 3WLUA 1RXGA 3MIEA 4IGQA 1IPSA 4B3NA 5LK5A 5FZGA 2VZRA 2YB7A 4QX1A 5ACA2 2Q0AA 5F3EA 4IV1A 4M00A 2XB6C 4AYUA 4XW3A 4QQ2A 4XAEA 3BVCA 2QJVA 4CEYC 3T2PA 4KU8A 4J1XA 4RFT0 5APAA 4DY3A 4BMBA 4CCNA 3ASIA 2P3JA 4QGMA 4UAPA 4FAGA 5LBBA 3UT0A 3OSDA 3LIHA 4LULA 2RV9A 3TAYA 5G05L 3BOWA 5BNPC 2AREA 5LW9A 3KVAA 4OULA 1JZ4A 3D8CA 3EB7A 4BPZA 1AR81 2JDZA 2AYHA 1DZTA 2PHFA 5F3IA 1BMV2 4E4HA 3IM0A 4JX0A 3NL1A 3SC7X 1R1ZA 4CEYB 5DUVA 2Q5TA 3MF9A 1DCSA 4YG6A 5G04L 4A2UA 5C8CA 5EWSA 1ASJ3 1LU2A 5FLJA 5E89A 1VRBA 1VBC2 2R072 3J7NA 3IMMA 3LKJA 3DCQA 1SFNA 2VG9A 5FUPA 3ZSEA 3I2KA 2HWE1 2LALA 4ARXA 2W08A 1IOAA 1RUD1 1HV0A 1QXRA 2VC9A 4GH4C 1LRHA 2JIJA 1S0CA 2RG4A 2ZHNA 3ETQA 2RHPA 4IEYA 3T4HB 2VVEA 1BHGA 2GNDA 1LNSA 4L2NA 1W0NA 5BUVA 2QQMA 1JI6A 2ZHKA 5DAXA 4COUA 5C9AA 3OUHA 4FPGA 4GWJA 4YVWC 1XU2A 4CP2A 2O0OA 4XC9A 1AR92 5FZHA 1I9RA 4XQDA 1QWRA 3RDIA 3VZKA 2WNEA 2B39A 2WO7A 1W8OA 4GH4B 2R0HA 3VZLA 4LUMA 4D7YA 4AFDA 4BXFA 3EHKA 4UW5A 3N9OA 1DGRN 3DKQA 2W94A 3F2ZA 5CKNA 1S0BA 4BZ4A 1JXNA 2RS11 3LE0A 5FREA 1RUC2 1V6OA 2BZDA 4LO7A 4RGAA 3SCFA 3J8F2 2I74A 2HWE3 4COZA 4ES9A 2P3YA 3ACIA 3PU3A 4O7XA 2FZ2A 2BFUS 3IN9A 2LROA 4PJYA 4Q4Y2 1MS8A 2JICA 2RR12 3WW1A 3OEAA 2VW1A 1YQCA 4J1WA 4CDQA 4YZ4A 4BQWA 1VB4A 4SLIA 4LBKA 3FUOA 1Q3EA 4AEDC 5GZFA 4S2FA 4XFAA 5FPAA 4F7ZA 1AYM1 1MQTC 4XF4A 1ZRRA 1ENSA 1UYPA 4OMDA 4AWDA 4MZUA 1G9FA 1DU3D 4FXGB 1W6MB 3WX5A 3D3AA 2HYKA 1OA3A 5T52A 1Y9GA 3O14A 4P9WA 4CP1A 1NT0A 3E6DA 4HN0A 5A32A 1XJAA 1S55A 4AEDB 5C6CA 2K2SA 2W92A 5AC91 4XILA 2VXRA 3FUQA 1W6NB 1XSRA 4KNCA 3BIWE 2HWC2 3BODA 4QPYA 4ZKTB 2WC2A 1O7FA 4K6BA 4Q4V2 3FHQA 3ZXAC 3NJVA 4I01A 4NIIA 1CD3G 4BHPA 2OW4A 1TMF3 5CG9A 2E7QA 4IDZA 5EV7A 4Z92B 3HIFA 2Z2SB 4LK7A 1E5HA 5EZWA 1RVF3 2NMNA 4H2AA 1LHWA 2ZGUA 2ZA9A 5BXXA 3SH4A 4YG0A 3QACA 2PMWB 4EZHA 2WT0A 3SH5A 2D44A 5LK7B 1PIV2 1ZRIA 5LY2A 4DXSA 1YQ5A 2HLEA 5JXHA 2ORXA 2XVLA 3M3IA 1T6GC 3WZ1A 1I6XA 1UXXX 2ID4A 3E97A 3K4AA 2VTXJ 4UYBA 1HIXA 1B35B 1V9U3 3E5XA 2UY9A 5F39A 1NXMA 3RGBA 1ULFA 1X82A 3T3YA 1PK6A 1R1A1 1F5FA 3AJZA 1SBDA 3Q8EA 4AVVA 2DTWA 2I07B 3U75A 2MNGA 3SXWA 1YFYA 2WWJA 2Y0IA 1YQ8A 4LE4A 1HXS2 4BOWA 2NZ9A 4K40A 5A1LA 1EV12 4LBOA 3AZZA 4V1PA 1W0PA 3IIIA 2D6MA 5FUNA 2XUMA 1R083 3I3BA 2QQNA 2X09A 4UF0B 2MEV2 3WOGA 3ZPOA 1O91A 1W03A 2OX0A 2BW8A 3A0KA 4FPFA 4YGBA 1ULPA 3HOBA 3M3QA 1MS5A 4FXKB 3HD8B 2CY6A 4AVBA 3DL3A 4MGYE 3ZYFA 1QXJA 1MVEA 3AMNA 4BJ0A 3IDEA 3N4MA 2VU9A 2WT2A 5FO7B 4FSJA 3N7LA 1ZZBA 2DDUA 2AEZA 4AQ2A 5FWJA 4RHV2 5BNOC 3BU0A 3KCXA 5C5TA 3ZYHA 2TEPA 4Y5TA 2QQKA 3BOPA 3PMSA 2PHXA 2WT1A 3ES1A 2RE9A 3M8LA 5A7WA 5I0RA 4IEXA 5EPAA 3I3QA 1XSQA 1GNHA 2D40A 1UY3A 5T50A 4WVVA 1LOEA 4GKYA 1C8NA 4XPVA 2YC0A 3POBA 5LRRA 4Z82A 3P6BA 1GANA 3AYEA 1LOBA 2ET1A 4JKKA 4K20A 3U1XA 3P1IA 1W2UA 1WLWA 1S0GA 4BIFA 2B9VA 2B46X 3M3EA 2JKBA 5FK7A 1GFF2 4AGGA 4ZS3A 1GZWB 3Q9OA 1F4AA 3M3OA 4ZU7A 4QX2A 2B4KA 4JKMA 3I4IA 3V0BA 2RM21 4LKSA 1LCLA 2BV4A 2VD7A 3KV6A 2W9XA 1UY4A 3DYOA 2QDNA 3M4FA 1AYN1 1NQJA 3MIDA 1GV9A 5FYMA 2A6WA 5F6LB 1K5MA 4PDWA 2ZZQA 2VZOA 1OOPA 4MGKE 1DBNA 3B94A 5C3QA 4FI9A 4XUNA 4YW3A 3OY8A 1GR3A 1VB2A 2SBAA 3JXSA 5A7QA 2XONA 4B4PA 5SV5A 1XXNA 3WW2A 2VUCA 1SG3A 2XBO2 3GCXA 2RJKA 4B8EA 1JN2P 1GQHA 1PMJX 1XYNA 4NMIA 4EZ4A 5L19A 3C8XA 1D4M2 4HETA 3MGUA 2NYYA 4H3WA 1GZTA 4XFIA 2Q8OA 5IK7A 5DPNA 5CADA 3DPRA 3AP5A 3NMBA 3FWEA 4AEJA 2XJRA 3ZXGA 1RUI2 1W28A 1QJX1 5IAXA 1W9TA 1NY72 3DN7A 5ERLA 1QJY2 2NN8A 1QJU3 1S0FA 3MW3A 2WQ4A 4IQPA 4Y20B 2FDKA 5FP4A 2QKDA 4S2GA 2AACA 3W21A 1ENRA 2VY0A 5FKCA 4E2GA 1VBE2 4GJYA 5C4WC 2E9QA 2ZAHA 2P3IA 1JHNA 4LEJA 4XHXA 1RUJ2 2ZOEB 2ADEA 2JENA 3K4ZA 5A3OA 4BK5A 5KHIA 4UI9L 4KBBA 1REDA 4D69A 3VBFB 3KGLA 4NWWA 3TBDA 1DYOA 3R05A 3VLBB 4LHKA 4WM8A 4YGDA 1NCQC 4AXOA 4FOWA 3WUDA 1BKZA 3CQOA 1JOBA 4IERA 1SPPA 1SLIA 2QQIA 4QAWA 1KJRA 5C8CC 2X05A 3POWA 3S0MA 1FMD1 1ZREA 3VBRC 5C4WB 1N1TA 2Y34A 1AJOA 3NNMA 2Z4FA 4FP2A 3RJRA 3SEPA 1POV3 4CEWA 2BERA 3LGRA 3VBOC 2ZX0A 4FO9A 2GC1A 4BQXA 4CTEA 1X8MA 2WZR1 4QB6A 1DFQA 3FC0A 1NCQB 1UU4A 3I54A 3I2JA 3KWVA 1DQ6A 4DPNA 4JGYC 3ZXDA 3IAQA 5BV6A 4YYOA 1OA2A 3VBUA 2GH8A 3A7QA 3CKHA 1AHSA 3VBRB 3I49A 4TZDA 3WR0A 3ACHA 1LOAA 2GN3A 1NUKA 4LIVA 5EHDA 2XHKA 3L2YA 3VBOB 1J58A 3ZKYA 4FFGA 1DGLA 4Q4W3 1KDMA 1VBB1 4QDSA 4UOJA 1XQNA 3WD5A 1GOFA 3W5MA 1JODA 1OLMA 1W6PB 2ZGNA 4J6GA 4TLGA 4JGYB 3ZXJA 1GLHA 1PZ8A 2BFUL 3ZYPA 4AZZA 3X29B 1MZ5A 1U5ZA 1H8TC 2DVFA 1HX6A 2J1UA 2HBTA 1H1IA 3HQUA 4Q4Y1 4XDOA 1VRH3 3FBYA 4OQ8A 5DAVA 4GMP3 2JDUA 5E6HA 5FPVA 4O9GA 1JBCA 5FY9A 2VECA 3RVHA 3ZKUA 2WAOA 1MPXA 2VQTA 3GZTB 3FFZA 3AVSA 1NX9A 1S0IA 3NQHA 2WS93 4FQ4A 3T1MA 3WQ7A 4A6SA 3O5SA 3VD3A 4OUSA 4LTAA 1VMFA 1XC6A 4NE9A 4O61A 3WG3A 5A3MA 2ZHLA 4HK8A 1GP6A 2LM3A 2DFBA 4XJWA 3RS6A 1FXZA 1H8TB 4W65A 1WBFA 5F5IA 3ZFGB 2D3RA 4IXLA 4CDXB 3RZLA 1LAJA 3SCGA 5JSOA 5LATA 1UWWA 4HVRA 3C7HA 3ZYBA 2ZGLA 2DVDA 2EXJA 4Y1UA 2QBXA 1WUVA 2W87A 2R30A 1O8SA 2XLFA 3CMGA 2HWF3 3LQCA 3PIGA 5FUIA 3VHNA 3VDAA 4CXWA 1LOFC 5KR7A 2JG8B 4XURA 4MX3A 1AXYA 4LO4B 4P02B 3TN93 4IE6A 2PLV2 4CDUA 4PBOA 1C3HA 3ZFFA 3NNLA 4AF9A 1ZA7A 2VUDA 3AP6A 4Q1PA 1D0HA 1OD5A 1FPN1 2MPFA 4HANA 5FLHA 1NE4A 3FLPA 2XR4A 1KRIA 2C6SA 1PM7A 1IS4A 5I93A 1UOGA 3O1OA 3OBAA 2YFZA 3MIBA 5GLTA 3NKGA 4YFZA 4N53C 1ZBA1 1RUOA 4NAOA 2A71A 1Y43B 4IUGA 3EJKA 4Y22B 4GKXA 2GMMA 5H9QA 3NKTA 1UPIA 4Q27A 4CCJA 4E8DA 1W99A 5J3UA 1CWPA 1KFXL 1SCSA 4KI5M 5JAXA 2GNMA 4B4RA 1CPMA 3OOXA 1UL9A 2XJQA 3S6PA 3VL9A 4NIHA 4Q8LA 2QVSB 3RJ2X 3RZKA 5FPLA 4YFWA 4EN8B 4N53B 2EALA 3U4XA 4MGZE 2YPJA 3S57A 1OMIA 3ACGA 2PN5A 3D6EA 3WNOA 4Q0SA 1S0JA 3AL5A 5FKBA 3WG4A 3ILRA 2FDFA 3IB3A 5IFTA 1W6OA 1ACCA 2WWSA 5C70A 1C8M3 2D97A 3NNJA 3NNGA 5FP3A 2MEV1 2VMGA 2Y38A 2IC1A 2ZGPA 3CJIC 4W4ZA 1CGPA 4A6OA 4H14A 1S0EA 1H0BA 1ZBA3 1JZ2A 1C5HA 5HCBA 2LRPA 4KU7A 3BUCA 2O14A 3CZUA 4QPIA 3IBMA 1IPKA 4G9SB 4Y5SA 5HCFA 5T3NA 4OI0A 1D2QA 2V73A 5CKQA 3RMYA 2QNKA 2UWCA 5DZGA 4DUVA 1LHUA 1ZNPA 3N7MA 2WABA 3P3NA 5F5AA 2JXAA 2AC1A 2GALA 2NP0A 3CJIB 4J25A 5I0DA 5GLWA 5A3LA 2FBEA 1G6NA 3VDCA 5CVRA 2HWE2 3IPVB 4IEWA 5FYIA 3RQ0A 3AFGA 5LA2A 1H2MA 5FBJA 3M3CA 3RYPA 4URAA 2ZPXA 3AM2A 3MIHA 2WFF3 2VZTA 4JTOA 2AH2A 4K8FA 4XYXA 4AVAA 2IXCA 1W2TA 4UBHA 1WCDJ 3CL1A 3DUIA 3ROUA 5FPXA 4FFHA 5HV4A 4CUBA 3AXEA 1JMUB 2XHNA 3BYWA 3OGJA 2Q8DA 4LJHA 1VBD1 4OI1A 3PLQA 3KV9A 5FYSA 3GGLA 3HN1A 2BEOA 4EN6B 2WNUA 3SISA 4ZU5A 2Q30A 2ZGOA 1SQ4A 4Y26A 1CAVA 2WNVA 3EQEA 2XOMA 3I3DA 4GQ7A 2V5DA 4UWDA 2RS12 1OVSA 2ZMKA 5FJKA 4I2OA 1REEA 4AFMA 3AMHA 2FMYA 1ULEA 3WV6A 4YZ1A 1JW6A 1K5MC 3WF0A 1DGRA 1RUH3 3J7LA 4KWLA 5LY1A 2HEWF 2ENRA 2WSVA 4FVVA 1J59A 4LQRA 1TMF2 3RYRA 4EYUA 3KT7A 2JDAA 3S5QA 1AYM2 2WL1A 4I09A 1YJLA 5GZDA 1SLBA 3I2DA 1QOSA 4MYEA 5A70A 1A34A 4QQHA 2WWUA 3JUUA 2RJ2A 4HL0A 4A7ZA 3DYPA 5FOJB 3WF1A 1BYHA 1QHDA 3O0XA 3OBRA 5K7PA 3DPRC 2ZMLA 2GC3A 1PVXA 4HG6B 1OA4A 4Q0VA 4AI9A 1I5PA 1I5ZA 4MADA 4Q4X3 4PQQA 3I59B 3A4UA 4A7KA 3MLJA 2B9UA 2VAUA 4QX0A 1F9KA 5A6ZA 5AC92 1GP4A 2XJPA 3QH6A 4A4AA 5JZGA 2ZX3A 4MGSA 3ECQA 1E57A 2FCTA 2PELA 3O0VA 4K1ZA 4K8RB 4CUCA 3VDDA 5I8TA 1LR5A 5L73A 3DPRB 3MPBA 1NZCA 2CDPA 1DGWX 3DV8A 5FQ0B 1V6NA 4C8DA 4WM8C 2BJSA 2GZWA 1QOTA 4S2HA 4ASKA 3I3EA 3UKVA 4ARYA 2B5HA 3VBHC 1LEMA 4QXKA 2CTVA 3BCWA 5T5JA 4Z8BA 5DUUA 1J3RA 1KFUL 4BQ4A 4NPLA 2Z42A 2B7YA 1PO11 3GHMA 1KGYA 2P37A 1BJQA 1EPWA 2TNFA 3UKTA 2KXLA 4KGGA 4AQTA 1EY2A 4C90A 3LD8A 2VCAA 2E26A 3AKSA 3EXUA 2DFCA 5C33A 3LCPA 4FPYA 5IK8A 1R1A2 2DTYA 5JOWA 3W59A 4TTGA 3VBHB 2KD7A 4MUVA 1W2NA 3EBRA 1GBGA 1UOJA 1GSLA 4DRVA 2A75A 4LO6B 4MHRA 1NXD1 4X6RB 3D4KA 1CAWA 2ZAAA 3PJYA 3LB9A 1BEV1 4AVCA 5D8AA 2P4EA 3NVCA 5C7GA 3NAPC 1RUE3 4M01A 3KD4A 3H0OA 2WINB 1FT9A 1BLZA 1GOGA 1XNBA 2VZUA 4ORFA 5FLIA 5JVVA 4DUXA 5JOZA 1RB8G 2BOJA 4XJUA 5FZ9A 1T2XA 4CP9A 1AUYA 4CDWA 1UY1A 3IDCB 3ZYRA 5EJ3A 1EP0A 4OZXA 1UX7A 2IXHA 2JG9B 2JE7A 4XF3A 3WVJA 4B4QA 4OHXA 1Q56A 5FP7A 3JBG3 3NAPB 3PJQA 4XOGA 1COV3 5FZ6A 4WM7A 2F17A 3T2QA 1LHNA 2V72A 2VBBA 2PFWA 3B93A 3R0RA 2VVFA 3LEKA 4AW7A 5CFCC 5E1RA 4EE2A 4XBLA 1OQDA 1HB2A 1HRV1 2ZTNA 1POV0 2D6OX 3OF1A 5IVYA 1RUF1 3OUIA 2VMCA 2PA7A 4NRPA 3N7JA 1IG0A 1SLLA 3DF0A 5DAPA 4TSVA 2XLAA 2X5IA 3S7EA 4RQPC 3FL7A 4PIZA 4YZ5A 1XB9A 4PLNA 3TWIA 3R4UA 1U5YA 1N1YA 2PQQA 3URFA 2RDQA 4CDUC 3ZFFC 5CFCB 3B69A 5EJZB 3THPA 3ZIXA 1X50A 1X9TA 1AXKA 2E7TA 4PBPA 3EYPA 5FY4A 1QJU2 2J1SA 3O12A 1R64A 4RR3C 5CFDA 1IS6A 3ZYIB 1MS9A 2YGMA 4HLTA 2OPKA 4D6SA 2VNGA 4YM0A 3H7YA 5I8SA 4RQPB 1JH5A 2QQPA 2EF6A 4QHOA 2XL9A 4YW5A 1DYKA 1AR63 3JQWA 2B8MA 2R6QA 1ENQA 2D5FA 1RUF3 5GZGA 4GMP0 5IWFA 1ASJ1 5EXOA 3WP3A 3U37A 4ASLA 4RR3B 1YFWA 4PIXA 2BGPA 2DUOA 4FPKA 1CJPA 2A3XA 3ZMOA 1NG0A 4AQSA 2G9ZA 3NJXA 4XJAA 1STMA 1ZRFA 1LHVA 2R061 3A0NA 3IAPA 2GC2A 2UY8A 1QJX2 4LBMA 2CL2A 3AZVA 5FZOB 4Z1VA 2R1DA 5IYYA 4HPKB 3LSDA 2YU1A 4HONA 2L9LA 3WCRA 2VQUA 1PO23 1XNTA 2GAUA 2WLQA 4ZXKA 2P34A 3GF6A 2P3KA 1IS5A 5E88A 4LPLA 3JB4C 2V5YA 1PMIA 2Y8KA 1U5IA 1W6QB 1NLRA 5A80A 2CYFA 1O3RA 1WGPA 5K8SA 2YMZA 4RA0A 1WD3A 2PTMA 1BQPA 4KWKA 1N3OA 4OVEA 2X8KA 1QIQA 1UPSA 4BYYA 1A78A 4LA3A 3T09A 3RZMA 1XNAA 2D5HA 5BNPB 1FMD2 4IE5A 4LBLA 3WF4A 1HN1A 3U07A 1LULA 3PUHA 4E9KA 1FV2A 3ZN4A 1Z0HA 3RSJA 4HVOA 2R063 1JZ7A 5IK5A 4GD4A 2WZR2 4IEPA 2ZGMA 4LUKA 3H3LA 3ZXLA 3C2UA 4FPHA 1UOFA 2YHJA 2E32A 2WS92 4N90A 4IEUA 5FYZA 2ERFA 3AK0A 2XXZA 1NA1C 3AJYA 3WHUA 3J7HA 3KSCA 1W8HA 3UGHA 5BY5A 5LRSA 4RS5A 3OJBA 4YG3A 2FHRA 2UURA 4PLOA 1FOD3 1UY2A 1DQ1A 3FLRA 3HNBM 3HBKA 1V00A 1EPZA 3AZWA 1JZ3A 1QNWA 2WNUC 3OYWB 4MXWB 4YVWB 1QKQA 1J3PA 3PUSA 1J3QA 3OGGA 1RMU1 1VBB2 2Q4SA 1BVVA 2HWD3 3ACLA 2RVAA 4QPWA 1NA1B 1UMHA 2GP3A 2VZSA 1CAXA 4NAMA 4WVMB 3PURA 5LEJA 4CCOA 3USUA 2RDSA 4D6QA 2YBKA 3TN92 1Q43A 2QQVA 2JDPA 3KT1A 3RFRA 3UGGA 3JD73 3LF7A 4ONUA 1US3A 1W8UA 1MVQA 3K3OA 3N7KA 4LA2A 4M3CB 1TMF1 2DBIA 4XZPA 2OUHA 3AXDA 2VBPA 5CBLA 2UWBA 2VZ1A 2CGNA 2DURA 4QDQA 1RVF1 4QHBA 4NPMA 4CZSA 3M7AA 1BCXA 3AP7A 1RXFA 4HBNA 1W8TA 1UCXA 2F6BA 2PHDA 1RHI3 2H0BA 3O7OA 4NRMA 4WVZA 4DB5A 4D6RA 4Y1ZA 1EAH3 3K4DA 5A33A 1VLNA 4LLFA 5L9RA 3H1WA 4AVTA 1C28A 3SCHA 3AYDA 5GKAC 1ONAA 3VL8A 2VCCA 5DZFA 1GOHA 2DVBA 2XJSA 1BVP1 1SZBA 1Y7BA 1V9U1 2DYCA 2VL4A 2YC4A 2BGCA 2XVGA 3MHZA 3NRUA 1RMU3 1ZA4A 4K9SA 5DQ0A 5F9TA 2QZ2A 1SACA 2BVVA 2HEVF 2VOVA 5ISLA 1MQTB 4HT1T 4TLFA 5ANQA 3WDTA 4BXSV 2JD9A 1LOGA 2QQOA 4FQZA 1NCRC 1FX5A 2LUWA 4BQ5A 4LKEA 2ZS6B 3MIGA 3O1UA 2F4LA 2YBSA 3OB8A 1MS4A 3WHTA 4A42A 1IG3A 1FPN2 2YY1A 3LEMA 3QOPA 1MZ6A 5BNNA 5FTTC 1US2A 1VE0A 3CF6E 5EP9A 1R081 4LBJA 3WG1A 3VV1A 4P9GA 4QMAA 4Q0PA 4RL7A 3FZ3A 4K21A 2E31A 1WCQA 2HWB3 4Y4RA 1UZZA 1ZBA2 4ZS2A 4YVSC 1NCRB 1PGL1 1WZXA 1F35A 2R043 4XHBA 3POGA 2D3PA 4ZHNA 2PHLA 4LO8A 4HXCA 1DYPA 2GNBA 5AFBA 5FV3A 4AQ6A 2YV8A 2OA2A 4YWAA 2Q8CA 4DO0A 3ACFA 1G8WA 5F5CA 1FAYA 1OXCA 2GU9A 4IV3A 2ETEA 4L8QA 2A6VA 5L36A 1OUSA 3W5NA 4OHWA 2PHWA 2PAEA 4D94A 4YVSB 5A3TA 1X33A 2D6NA 3VDBA 2ZBJA 4YM2A 3WF2A 4U2AA 3ZN6B 1HRI3 5JMOA 4BA6A 3SKJE 2XL7A 4UFLA 2BUKA 1HLCA 4Q2FA 3BKZA 1MS1A 3N35A 3POSA 2WFF2 3RG0A 4RFRB 1UU5A 1AF9A 1UMIA 1F5JA 1HV1A 4GZ9A 4URTA 4D3WA 2A5ZA 2OVUA 2OYZA 2LS6A 3VHRA 1A3KA 2D7FA 1WCUA 3T2OA 2BNNA 2FDHA 5FY7A 4Z2AA 2XG3A 1TNFA 4X8PA 3ZSMA 1ZVFA 5HBAA 4LBQB 2BWAA 2CHHA 1M4WA 3FJSA 1KEXA 4META 3SMHA 2QDRA 1TG7A 4CDWC 3DGTA 1OPMA 5JLVA 2JDHA 1RUNA 3GCWA 3MUY1 1Z7S1 4PI2A 4S2DA 4AAXA 3KGZA 2DUQA 3ZFEA 3B01A 5K0UA 1DGWA 4WM7C 3ZLIA 4H7LA 2C26A 2W1UA 4Y33A 2D93A 1K42A 1H4HA 5T55A 4EJRA 5BNOB 2D6KA 4DXRA 4DS0A 1VBD2 4FOQA 4I30A 2W0XA 3USSA 4BK4A 3LA7A 4NJ4A 2HJIA 2H6BA 4D0QA 2QCSB 5FOBB 3CLPA 3KT4A 4RD7A 2VMFA 3HPNA 2QUOA 3IIAA 3NWKA 1O59A 4LR4A 1QJU1 1UOBA 3K46A 3MYXA 1AX1A 1F15A 5I0TA 3O1MA 4QPGC 4Q4X2 5IVCA 4M0HA 3GDBA 2X53S 5C8WA 3ZXFA 1Z7S3 2OT7A 1WCSA 4LNVA 5LEKA 3P5BA 5CFDC 5IK4A 2J1VA 1UKGA 4XFBA 2GP5A 3GZUC 4JRAA 1WLCA 3NJZA 4JKLA 5FPUA 4PHZA 4N43A 4XUQA 1KJLA 4BQ2A 1MEC3 1VAKA 3ATGA 5DXDA 1B09A 1DZRA 2X10A 4COVA 1JUIA 4PT6A 3ZX7A 3BTAA 4BDVB 2UU8A 3ZYGA 4P9JA 5F3GA 4QPGB 4UFIA 5FZDA 4B7KA 1WA6X 1CX1A 2D6PA 4X8NA 1PZ9A 4QKDA 4UFKA 1GNYA 1POV1 2BOIA 4IV1C 1BBT3 3POJA 4YW7A 1V6MA 3NJYA 4CCKA 2DCTA 1CVNA 5CB7A 5EYYA 1O4ZA 4P08A 3T0AA 2YG0A 2WA4A 3ZR5A 4JHZA 1DIWA 4LORA 4R52A 5F2WA 5FY1A 3GBWA 2C4XA 4M3CE 1VR3A 2HKXA 2JE9A 1WW5A 3Q8BA 4IV1B 4K3UA 3PVBB 1LTEA 3QD6A 5M0TA 3QBQA 4Q4W1 4LOSA 4GWNA 3JZVA 3LAGA 2BBAA 3UL2A 2C9AA 1KS4A 4OFGA 1A6CA 2WZPP 4F83A 3VBSA 2W68A 3PHMA 3OTFA 4JGZA 5CEHA 4I3GA 3KMHA 4Y4YA 5CYYA 1LKNA 1VRH1 5HV0A 4A3ZA 3RPQA 2C0ZA 2OQ6A 4GMP1 4W8JA 5DN2A 4CP9B 5FPZA 4E4DX 1GWKA 3KHBA 5J96B 4Y3OA 2WS91 4N7UA 3N36A 3T4VA 4CCLA 3ZOIA 3PUIA 2DVGA 5C9AC 1PO12 5DUWA 5F8PA 2VH9A 3TOJA 4DXZA 3KS7A 5C8CB 3PVEA 2AGSA 2XJUA 3JBG2 3K3NA 1HB1A 5L9BA 2CAUA 5A3UA 4OCTA 1F2NA 4NHXA 5CAZA 1H30A 3RI9A 4RS5C 4LT5A 3C7GA 2Q1MA 1C4RA 3RNSA 4JTNA 5FYHA 5JDBA 2HWF1 2Y6LA 3PDQA 3GXUA 1N47A 5C9AB 2ZX1A 1BEV2 1CAUA 3VKOA 3LA2A 5LWBA 1NZIA 3TN91 3KCCA 5C3SA 2EAAA 1WMEA 2PAKA 1O4TA 3OBZA 2E51A 3SHRA 4KQ7A 3CDZB 1IS3A 5CISA 4BMEA 1S1AA 3E6BA 1PMHX 5L9VA 2WIIB 1ZZ7A 1YUDA 2KM2A 4M4RA 4CDQC 1G9AA 3IMNA 1VBC3 1W2OA 2R073 2JDYA 1VBA1 4BQ1A 3WDWA 1XBFA 2E53A 3KF3A 3T08A 3PMEA 1OQEA 4MHUA 2WO2A 3NV1A 1LESA 1Q8QA 1Y3TA 5J36A 4FPJA 2CSGA 1GQGA 2OZJA 1K45A 4QX5A 5DDJ1 1ND2A 1JOJA 1NLQA 1WWYA 3HN3A 2EXKA 1YLLA 1HRV2 5FMDA 5LB6A 1ZBE1 4RN5A 1KITA 3HR9A 1RUF2 5L7OA 1HQLA 4XAAA 3MICA 4CDQB 4CU6A 1AR93 2BNOA 3ABZA 2W1WA 5ABJC 1XYPA 3N9QA 1GWLA 2NPIA 2FD8A 5FZ0A 5AFEA 3TYJA 1WMXA 2HEYF 3KQ4B 1ZRDA 2ZX2A 4WBBA 5T5OA 2AEYA 1WMDA 3AFKA 5JI7A 4LHSA 4CPBA 4A41A 2W47A 3WW3A 2P2KA 5T54A 1LGNA 2W1SA 1C8M1 3H3UA 5KC5A 3ZDVA 3O1RA 1EUTA 1W3VA 3AMMA 1H1MA 1WKYA 5A32B 1VBA3 5FZIA 2WZEA 1XPWA 1NYWA 2PHRA 3B9CA 1OURA 3NNFA 2A73B 4UT5A 3RMXA 3MLKA 5DDJ3 2OZ6A 1ZZ8A 2YPDA 2EXHA 4BQ3A 4Y5Z0 3SITA 5DMYA 1ZBE3 4W6XA 4XACA 5GLUA 1ASJ2 1V6KA 3AB0A 1EYBA 3FFQA 3ZXKA 2E33A 4BLJA 2VUAA 2WQ8A 4KWUA 3G6JB 2JKXA 1OHFA 1PK6C 3FHIB 3K77A 4RSUA 4FCAA 3HT2A 4TYSA 4XF9A 3O1PA 3E6CC 3ZYJB 3WEZA 1XNDA 1AL0G 2XKOA 4XCAA 2WFF1 3V65A 3WQBA 2R062 2W2IA 5A3NA 5CA6A 1DLCA 3ELNA 4GA9A 1ZM1A 3N3HA 1JHJA 3RWKX 2Z5WA 3LDKA 2GMEA 4FPCA 5F2SA 4A3XA 1M06G 3N9LA 2ZABA 4A44A 3K48A 2VTFA 4PLMA 1QJEA 4AFBA 5F1RA 1PK6B 2HWC3 1UAIA 5BYNA 2IWGB 4QHZA 4CUGA 4Q4V3 1ZYBA 3LWCA 1YFUA 2V4VA 5FK8A 4HN1A 5FWEA 1SFPA 3H8OA 4R9BA 2WUHA 2KA3A 3NV4A 1H2NA 2HWD2 4YGEA 4LHNA 4QWNA 3OBTA 1UN1A 1AL21 2EXIA 4BU2A 1LOCA 4R4XA 1UW8A 1JZ6A 1PIV3 4AHWA 1RUH1 2VVDA 2DCKA 4P5YA 1UF2C 4V2VA 3VKMA 1QH6A 2ADDA 1LGBA 3ZFEC 3AYCA 4CSWA 4CYDA 4B29A 4I02A 1VPHA 4CPBD 1K3IA 5K0UC 1D2SA 4MOAA 5JXJA 3WNKA 2VCMA 2UWAA 3MIFA 4R9DA 1YIPA 4JV4A 4E8CA 1IGOA 4P5HA 1LJ7A 4LIUA 5JPMB 2YC2A 5H9SA 2ZGKA 2CU5A 4NIAA 4GH4A 3O1TA 1RHI2 2ORZA 3CBNA 1PNGA 2IXJA 2VQ0A 4CXXA 5FO8B 1V0AA 5AVAA 4AOCA 4OLLA 3W58A 5EYXA 5A7WB 4XXPA 3ZSKA 1GMMA 4NWVA 4A7YA 1EV13 4Q4X1 1OD3A 2WSUA 1VAVA
chains in the Genus database with same CATH topology
2HLEA 2ZXQA 2ORXA 1UXXX 2ID4A 2J1EA 3K4AA 1JYVA 1F4HA 1P8JA 3I2GA 1SHWB 1W8NA 3SKVA 3U37A 2VMDA 1NKGA 2BGPA 5B4XA 4L0PA 3VD5A 3THCA 4A45A 5A1AA 1D7PM 3NJXA 5LCWL 4YPJA 1OH4A 3WSOA 4D8MA 4DXTA 3IIIA 5JXIA 3IAPA 4CU9A 3BGAA 2QQNA 2X09A 3I3BA 3OG2A 1ULPA 5IYYA 3HOBA 1EUUA 3UETA 4W50A 2L9LA 2VQUA 1XNTA 4BJ0A 3UESA 4LPLA 2Y8KA 2DDUA 2VCBA 5J1XA 2QQKA 3I97A 4XZUG 3T09A 1XNAA 2DCJA 5IHRA 3WF4A 2WO3A 1HN1A 3PUHA 2WN3A 3CIHA 1UY3A 4CUAA 3WNMA 4DEVA 4DUWA 1JZ7A 1W9SA 2HYXA 3FHAA 1JU4A 2VZQA 3P6BA 2E32A 4JKKA 3P1IA 3ZM8A 4CU7A 2B9VA 3J7HA 1UYZA 3UNPA 2Y6GA 1F4AA 4QX2A 2PQSA 2B4KA 1UY2A 4JKMA 5CZKA 3HNBM 4LKSA 1JZ3A 2W9XA 1UY4A 3DYOA 3VD7A 1NAEA 3IDAA 3OEBA 2RVAA 3LEGA 2VZOA 1UMHA 2JE8A 2VZSA 3OGRA 4QPWA 3A21A 2J1AA 4FI9A 4XUNA 1JYNA 3JXSA 3MO4A 2XONA 3AC0A 2VZ3A 1US3A 1SG3A 1IQDC 1PMJX 2VZ1A 4QDQA 3C8XA 1W9WA 5DPNA 1CIYA 3K4DA 1JYWA 1GUIA 1W9TA 4QB2A 2QQJA 2VCCA 1GOHA 4XVHA 2VL4A 1YQ2A 2YC4A 1UY0A 3NRUA 5DQ0A 1H6XA 1GU3A 5JUVA 3BN6A 4BXSV 3THDA 5F7UA 2JD9A 2QQOA 3K4ZA 3LPFA 4OUEA 4KMQA 4BK5A 5HXMA 4UI9L 1L7RA 1DYOA 3OB8A 4A42A 2ZEXA 3CQOA 4RYDA 5EJ1B 1US2A 2QQIA 4OYUA 4QAWA 2X05A 2W91A 3I2FA 3SEPA 2Z4FA 2E31A 1WCQA 1PX3A 2BERA 4OMCA 3WNPA 2W46A 4QB6A 3I2JA 1L7QA 4XUPA 1TVGA 3IAQA 3ACFA 3A7QA 3CKHA 3OGVA 3VD9A 3MUZ1 2W1QA 1K12A 3W5NA 3ACHA 1NUKA 3VDBA 5LA1A 2Y6KA 3WF2A 4CU8A 5JMOA 3SKJE 3HNMA 4QDSA 4QB1A 4UOJA 1GOFA 3W5MA 3C7FA 1UMIA 2VO5A 4GZ9A 2J1UA 2VM9A 2LS6A 4QX3A 4TXWA 4ET7A 2WAOA 1MPXA 2VQTA 3T2OA 1NX9A 3NQHA 4P00B 4Z2AA 5LA0A 3HEIA 4GWIA 3VD3A 1XC6A 3FN9A 1KEXA 1TG7A 3DYMA 3MUY1 4DEQA 4AAXA 1UWWA 1CZSA 2XQXA 3C7HA 3WNNA 2QBXA 1UXZA 2W87A 5FUIA 1O8SA 2C26A 3CMGA 2W1UA 3LQCA 3SEEA 3VDAA 3K75B 1K42A 4XURA 4P02B 2QQLA 2Y6HA 4DXRA 2VMEA 4QDRA 4BK4A 4D0QA 2WAAA 2VMFA 3T0BA 2J7MA 3OBAA 3HPNA 2YFZA 2WDBA 1O59A 2J1RA 3WF3A 3K46A 2W5FA 3LPGA 1ULOA 1H6YA 2Y6JA 3GDBA 4IUGA 2W95A 2OKXA 2J1VA 4E8DA 3T0DA 1W99A 5IFPA 3I2HA 1J84A 4JKLA 4KI5M 4XUQA 3A23A 3ETPA 1J83A 2X10A 3CZJA 4PT6A 3DECA 4ZXEA 2EIDA 4BDVB 4M4PA 3E1F1 3ACGA 1CX1A 3WNOA 1OT5A 1GNYA 2BGOA 3IB3A 5IFTA 5C70A 3NNGA 3WQBA 4W4ZA 4A6OA 4P08A 3T0AA 2YG0A 1JZ2A 1JZ5A 4JHZA 3CZUA 3MV11 2C4XA 3I2IA 5C71A 2EICA 4DUVA 2WABA 3HJRA 5I0DA 2BBAA 2J22A 2J1TA 3VDCA 5LA2A 5CYYA 5B4NA 5IJRA 4A3ZA 2VR4A 2VZTA 4W8JA 5DN2A 3LEIA 3MV01 1RYYA 3C7OA 4MGQA 4CUBA 5EIYB 2XHNA 3PUIA 2VJXA 1OF4A 2R7EB 2WN2A 3GGLA 1UYXA 2CDOA 3I3DA 2WBKA 2XOMA 2ZEZA 2V5DA 5JXGA 2WYSA 3C7GA 4ZZ5A 2ZEYA 2Y6LA 1DP0A 3GXUA 3WF0A 2VZPA 3CDZB 1CZVA 4LQRA 1O8PA 2VZRA 2YB7A 4QX1A 1PMHX 2JDAA 4M4RA 2C9KA 3T2PA 2RJ2A 3T08A 3DYPA 3WF1A 2WO2A 4UAPA 2WO1A 4HG6B 1K45A 2RV9A 2ZEWA 1I5PA 4MADA 4PQQA 3HN3A 5G05L 3C7EA 4MO3M 4RN5A 3WNLA 4QX0A 3EB7A 4CU6A 1JZ4A 3ABZA 2W1WA 4A4AA 4ZY9A 2VZVA 4JX0A 1JU3A 1CZTA 4MGSA 3ECQA 5G04L 4CUCA 1JZ8A 5C7GA 4OZOA 4LHSA 2CDPA 4A41A 2W47A 3I2KA 3MBWA 2W1SA 4ARXA 2VC9A 1EUTA 3I3EA 4ARYA 1WKYA 1BHGA 1LNSA 1W0NA 2WZEA 1XPWA 2QQMA 1JI6A 4GWJA 5HPOA 1PX4A 2W3JA 1KGYA 5DMYA 1GQPA 2EIEA 2VCAA 1W8OA 2E26A 3HNYM 2E33A 1OF3A 4TTGA 2KD7A 2W94A 3F2ZA 2WQ8A 4KWUA 2JKXA 2VOTA 3K77A 3LE0A 4XUTA 3WEZA 2BZDA 3ACIA 1DLCA 1JYXA 2WZ8A 4XUOA 3OGSA 1JHJA 1UZ0A 1GOGA 3OEAA 2VZUA 4DUXA 4A44A 3A22A 2VTFA 1T2XA 4CVUA 5JR2A 1UY1A 1UX7A 2YFUA 4PF1A 2V4VA 4OMDA 2EIBA 2WUHA 3D3AA 3T2QA 2V72A 2LW8A 3LEKA 1JZ6A 2DCKA 4P5YA 1SDDB 3GM8A 2VMCA 2W92A 1K3IA 1UYYA 2Y64A 4MOAA 5JXJA 3WNKA 4E8CA 3FL7A 2YC2A 3FHQA 3NJVA 2ORZA 4ZZ8A 5EJZB 4AG4A 3VD4A 3EYPA 1GMMA 2J1SA 1R64A 1OD3A 4DXSA 5JXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLE A;  2ZXQ A;  2ORX A;  1UXX X;  2ID4 A;  2J1E A;  3K4A A;  1JYV A;  1F4H A;  1P8J A;  3I2G A;  1SHW B;  1W8N A;  3SKV A;  3U37 A;  2VMD A;  1NKG A;  2BGP A;  5B4X A;  4L0P A;  3VD5 A;  3THC A;  4A45 A;  5A1A A;  1D7P M;  3NJX A;  5LCW L;  4YPJ A;  1OH4 A;  3WSO A;  4D8M A;  4DXT A;  3III A;  5JXI A;  3IAP A;  4CU9 A;  3BGA A;  2QQN A;  2X09 A;  3I3B A;  3OG2 A;  1ULP A;  5IYY A;  3HOB A;  1EUU A;  3UET A;  4W50 A;  2L9L A;  2VQU A;  1XNT A;  4BJ0 A;  3UES A;  4LPL A;  2Y8K A;  2DDU A;  2VCB A;  5J1X A;  2QQK A;  3I97 A;  4XZU G;  3T09 A;  1XNA A;  2DCJ A;  5IHR A;  3WF4 A;  2WO3 A;  1HN1 A;  3PUH A;  2WN3 A;  3CIH A;  1UY3 A;  4CUA A;  3WNM A;  4DEV A;  4DUW A;  1JZ7 A;  1W9S A;  2HYX A;  3FHA A;  1JU4 A;  2VZQ A;  3P6B A;  2E32 A;  4JKK A;  3P1I A;  3ZM8 A;  4CU7 A;  2B9V A;  3J7H A;  1UYZ A;  3UNP A;  2Y6G A;  1F4A A;  4QX2 A;  2PQS A;  2B4K A;  1UY2 A;  4JKM A;  5CZK A;  3HNB M;  4LKS A;  1JZ3 A;  2W9X A;  1UY4 A;  3DYO A;  3VD7 A;  1NAE A;  3IDA A;  3OEB A;  2RVA A;  3LEG A;  2VZO A;  1UMH A;  2JE8 A;  2VZS A;  3OGR A;  4QPW A;  3A21 A;  2J1A A;  4FI9 A;  4XUN A;  1JYN A;  3JXS A;  3MO4 A;  2XON A;  3AC0 A;  2VZ3 A;  1US3 A;  1SG3 A;  1IQD C;  1PMJ X;  2VZ1 A;  4QDQ A;  3C8X A;  1W9W A;  5DPN A;  1CIY A;  3K4D A;  1JYW A;  1GUI A;  1W9T A;  4QB2 A;  2QQJ A;  2VCC A;  1GOH A;  4XVH A;  2VL4 A;  1YQ2 A;  2YC4 A;  1UY0 A;  3NRU A;  5DQ0 A;  1H6X A;  1GU3 A;  5JUV A;  3BN6 A;  4BXS V;  3THD A;  5F7U A;  2JD9 A;  2QQO A;  3K4Z A;  3LPF A;  4OUE A;  4KMQ A;  4BK5 A;  5HXM A;  4UI9 L;  1L7R A;  1DYO A;  3OB8 A;  4A42 A;  2ZEX A;  3CQO A;  4RYD A;  5EJ1 B;  1US2 A;  2QQI A;  4OYU A;  4QAW A;  2X05 A;  2W91 A;  3I2F A;  3SEP A;  2Z4F A;  2E31 A;  1WCQ A;  1PX3 A;  2BER A;  4OMC A;  3WNP A;  2W46 A;  4QB6 A;  3I2J A;  1L7Q A;  4XUP A;  1TVG A;  3IAQ A;  3ACF A;  3A7Q A;  3CKH A;  3OGV A;  3VD9 A;  3MUZ 1;  2W1Q A;  1K12 A;  3W5N A;  3ACH A;  1NUK A;  3VDB A;  5LA1 A;  2Y6K A;  3WF2 A;  4CU8 A;  5JMO A;  3SKJ E;  3HNM A;  4QDS A;  4QB1 A;  4UOJ A;  1GOF A;  3W5M A;  3C7F A;  1UMI A;  2VO5 A;  4GZ9 A;  2J1U A;  2VM9 A;  2LS6 A;  4QX3 A;  4TXW A;  4ET7 A;  2WAO A;  1MPX A;  2VQT A;  3T2O A;  1NX9 A;  3NQH A;  4P00 B;  4Z2A A;  5LA0 A;  3HEI A;  4GWI A;  3VD3 A;  1XC6 A;  3FN9 A;  1KEX A;  1TG7 A;  3DYM A;  3MUY 1;  4DEQ A;  4AAX A;  1UWW A;  1CZS A;  2XQX A;  3C7H A;  3WNN A;  2QBX A;  1UXZ A;  2W87 A;  5FUI A;  1O8S A;  2C26 A;  3CMG A;  2W1U A;  3LQC A;  3SEE A;  3VDA A;  3K75 B;  1K42 A;  4XUR A;  4P02 B;  2QQL A;  2Y6H A;  4DXR A;  2VME A;  4QDR A;  4BK4 A;  4D0Q A;  2WAA A;  2VMF A;  3T0B A;  2J7M A;  3OBA A;  3HPN A;  2YFZ A;  2WDB A;  1O59 A;  2J1R A;  3WF3 A;  3K46 A;  2W5F A;  3LPG A;  1ULO A;  1H6Y A;  2Y6J A;  3GDB A;  4IUG A;  2W95 A;  2OKX A;  2J1V A;  4E8D A;  3T0D A;  1W99 A;  5IFP A;  3I2H A;  1J84 A;  4JKL A;  4KI5 M;  4XUQ A;  3A23 A;  3ETP A;  1J83 A;  2X10 A;  3CZJ A;  4PT6 A;  3DEC A;  4ZXE A;  2EID A;  4BDV B;  4M4P A;  3E1F 1;  3ACG A;  1CX1 A;  3WNO A;  1OT5 A;  1GNY A;  2BGO A;  3IB3 A;  5IFT A;  5C70 A;  3NNG A;  3WQB A;  4W4Z A;  4A6O A;  4P08 A;  3T0A A;  2YG0 A;  1JZ2 A;  1JZ5 A;  4JHZ A;  3CZU A;  3MV1 1;  2C4X A;  3I2I A;  5C71 A;  2EIC A;  4DUV A;  2WAB A;  3HJR A;  5I0D A;  2BBA A;  2J22 A;  2J1T A;  3VDC A;  5LA2 A;  5CYY A;  5B4N A;  5IJR A;  4A3Z A;  2VR4 A;  2VZT A;  4W8J A;  5DN2 A;  3LEI A;  3MV0 1;  1RYY A;  3C7O A;  4MGQ A;  4CUB A;  5EIY B;  2XHN A;  3PUI A;  2VJX A;  1OF4 A;  2R7E B;  2WN2 A;  3GGL A;  1UYX A;  2CDO A;  3I3D A;  2WBK A;  2XOM A;  2ZEZ A;  2V5D A;  5JXG A;  2WYS A;  3C7G A;  4ZZ5 A;  2ZEY A;  2Y6L A;  1DP0 A;  3GXU A;  3WF0 A;  2VZP A;  3CDZ B;  1CZV A;  4LQR A;  1O8P A;  2VZR A;  2YB7 A;  4QX1 A;  1PMH X;  2JDA A;  4M4R A;  2C9K A;  3T2P A;  2RJ2 A;  3T08 A;  3DYP A;  3WF1 A;  2WO2 A;  4UAP A;  2WO1 A;  4HG6 B;  1K45 A;  2RV9 A;  2ZEW A;  1I5P A;  4MAD A;  4PQQ A;  3HN3 A;  5G05 L;  3C7E A;  4MO3 M;  4RN5 A;  3WNL A;  4QX0 A;  3EB7 A;  4CU6 A;  1JZ4 A;  3ABZ A;  2W1W A;  4A4A A;  4ZY9 A;  2VZV A;  4JX0 A;  1JU3 A;  1CZT A;  4MGS A;  3ECQ A;  5G04 L;  4CUC A;  1JZ8 A;  5C7G A;  4OZO A;  4LHS A;  2CDP A;  4A41 A;  2W47 A;  3I2K A;  3MBW A;  2W1S A;  4ARX A;  2VC9 A;  1EUT A;  3I3E A;  4ARY A;  1WKY A;  1BHG A;  1LNS A;  1W0N A;  2WZE A;  1XPW A;  2QQM A;  1JI6 A;  4GWJ A;  5HPO A;  1PX4 A;  2W3J A;  1KGY A;  5DMY A;  1GQP A;  2EIE A;  2VCA A;  1W8O A;  2E26 A;  3HNY M;  2E33 A;  1OF3 A;  4TTG A;  2KD7 A;  2W94 A;  3F2Z A;  2WQ8 A;  4KWU A;  2JKX A;  2VOT A;  3K77 A;  3LE0 A;  4XUT A;  3WEZ A;  2BZD A;  3ACI A;  1DLC A;  1JYX A;  2WZ8 A;  4XUO A;  3OGS A;  1JHJ A;  1UZ0 A;  1GOG A;  3OEA A;  2VZU A;  4DUX A;  4A44 A;  3A22 A;  2VTF A;  1T2X A;  4CVU A;  5JR2 A;  1UY1 A;  1UX7 A;  2YFU A;  4PF1 A;  2V4V A;  4OMD A;  2EIB A;  2WUH A;  3D3A A;  3T2Q A;  2V72 A;  2LW8 A;  3LEK A;  1JZ6 A;  2DCK A;  4P5Y A;  1SDD B;  3GM8 A;  2VMC A;  2W92 A;  1K3I A;  1UYY A;  2Y64 A;  4MOA A;  5JXJ A;  3WNK A;  4E8C A;  3FL7 A;  2YC2 A;  3FHQ A;  3NJV A;  2ORZ A;  4ZZ8 A;  5EJZ B;  4AG4 A;  3VD4 A;  3EYP A;  1GMM A;  2J1S A;  1R64 A;  1OD3 A;  4DXS A;  5JXH A; 
#chains in the Genus database with same CATH topology
 1RMU 2;  3BTX A;  1CN1 A;  4COY A;  1BK0 A;  1AL2 3;  3TNP B;  2YYO A;  4GAZ A;  3VKL A;  4PDW C;  4JCK A;  1F4H A;  1P8J A;  4M0N A;  1OFN A;  2BDR A;  1OOP C;  1W8N A;  3U14 A;  1G9C A;  3RZH A;  4PQ9 A;  5FP8 A;  3SKV A;  3WW4 A;  2VW0 A;  5CNA A;  4XIK A;  2YGL A;  2JB4 A;  4N9I A;  3NV3 A;  1XNC A;  4N43 C;  3ALQ A;  2O8O A;  2ZZJ A;  2OS2 A;  1FAT A;  3V0B B;  1RVF 2;  2JWP A;  1SLT A;  4RHV 3;  4Y1Y A;  3SNM A;  3VD5 A;  4A45 A;  4I3P A;  2R16 A;  1W6M A;  4QU2 A;  4XDP A;  5LCW L;  4FOV A;  2HWB 2;  1OH4 A;  3WSO A;  4DXT A;  1K5M B;  3MI8 A;  1HB4 A;  2R04 2;  4PDW B;  1Q8S A;  3BGA A;  4IET A;  1OOP B;  1VP6 A;  3B00 A;  5J37 A;  3LDR A;  5JR7 B;  4ES8 A;  3S5A A;  2MHF A;  3RI8 A;  3OY8 B;  1V9U 2;  5GZE A;  4OQ9 A;  2ZKN A;  2FMD A;  2WRA A;  3HT1 A;  5SV8 A;  2I2S A;  2XLG A;  1W6N A;  2DU0 A;  4MH0 E;  2VMH A;  4TN7 A;  3ST7 A;  2XPJ A;  3PIJ A;  4XDQ A;  1ZZ6 A;  2BVB A;  4QT6 A;  5DAB A;  4AGR A;  4AK3 A;  3WDV A;  4ASM B;  4DQA A;  3D0S A;  1SBF A;  3ZO0 B;  3WP6 A;  2JEC A;  3AX4 A;  3F95 A;  5BPX A;  1O3T A;  5J1X A;  3ORJ A;  4XZU G;  2W39 A;  4XVH A;  2DCJ A;  3MW4 A;  5IHR A;  1R08 2;  4R4Z A;  4LKF A;  1RUE 1;  3MFC A;  5FZ8 A;  5F5Q A;  4P9L A;  2YUE A;  4DUW A;  5FYY A;  4CA9 A;  2GH2 A;  4JGZ C;  1PGL 2;  3FHA A;  3PTR B;  4CRQ A;  3KLS A;  1V6I A;  2R1B A;  4CEW C;  1RIN A;  2G9G A;  1A8M A;  1B35 A;  1FNZ A;  5FZM A;  3ZM8 A;  4CU7 A;  4PF5 A;  5LBF A;  4NO4 A;  4WM8 B;  3T2T A;  4JC1 A;  1S0D A;  4QGN A;  5CIR A;  4IEV A;  3CNA A;  3JBG 1;  4FT8 A;  2PQS A;  1COV 1;  1SPP B;  5FBZ A;  3VBU C;  3GZA A;  5CZK A;  5DZE A;  5KXC A;  1GP5 A;  3VD7 A;  1HJG A;  2O8Q A;  4YZ2 A;  3IDA A;  4AI3 A;  3W20 A;  4CEW B;  3RZJ A;  4UFM A;  3OEB A;  1HQW A;  4NRQ A;  1QF3 A;  2SLI A;  2NQY A;  1H9P A;  1QJY 3;  4IEO A;  4KG8 A;  3W9A A;  2K0G A;  1PVC 3;  4BH9 A;  3O1V A;  3B5L B;  1JYN A;  1G86 A;  3MO4 A;  1VBE 3;  2IVJ A;  3AC0 A;  4CCM A;  2D43 A;  3VBU B;  5FXX A;  3PUQ A;  5FY0 A;  1RUJ 3;  5JPN B;  1XNK A;  2Y0O A;  2C5D A;  1JUH A;  1ZZ9 A;  1ND3 A;  2VE1 A;  3H50 A;  4OI4 A;  1RL3 A;  3GBF A;  1I1E A;  4UW4 A;  1CIY A;  5LA9 A;  1JYW A;  1GUI A;  5F6K A;  3ENR A;  1Z7S 2;  2G1M A;  1D4V B;  2QE3 A;  2RS5 1;  1TE1 B;  3AZY A;  4QB2 A;  1AR6 1;  5JOX A;  2QQJ A;  2BBV A;  5A3P A;  1YQ2 A;  2X29 A;  3FMG A;  1J1T A;  1U12 A;  3V64 A;  5HCH A;  4XJ9 A;  1AR7 3;  4HFS A;  1H6X A;  1GU3 A;  1HN0 A;  3BN6 A;  3JCI A;  5EQU A;  1CQ9 A;  3LPF A;  4OUE A;  4KMQ A;  5FRA A;  1NQD A;  1N3Q A;  1XYO A;  1SDW A;  5HXM A;  5J48 A;  4XAB A;  1L7R A;  3VKN A;  3WCS A;  2ZGQ A;  1OVP A;  1U0A A;  2A6Z A;  1PZ7 A;  1YXW A;  2XQR A;  1GZW A;  2GDF A;  3LSE A;  2QZ3 A;  4RYD A;  4YW1 A;  5EJ1 B;  3ZR6 A;  2XDV A;  5FXZ A;  1BBT 2;  1O5L A;  3GZE A;  2D98 A;  1UU6 A;  1XE0 A;  2P6H A;  1OFS A;  2W91 A;  2Q8E A;  1UZW A;  5FCC A;  4YGC A;  2PYT A;  3KZ4 C;  3FLT A;  2Y26 A;  1UX6 A;  2WKK A;  1ST8 A;  3NW4 A;  1C57 A;  1FNY A;  2B42 B;  2W46 A;  4H7M A;  1PO2 1;  3K51 A;  4XF0 A;  5FZF A;  2RS5 3;  1L7Q A;  4RGK A;  4XUP A;  2R32 A;  1TVG A;  4TWT A;  3WDY A;  4WVW A;  4IEQ A;  4CDU B;  3ZFF B;  5JCT A;  4Q26 A;  3OGV A;  1QY4 A;  3D5O A;  2DUP A;  3AZX A;  3KV4 A;  3MDP A;  1K12 A;  5FMB A;  1GKB A;  2ZX4 A;  1FYU A;  2DBN A;  2A70 A;  5FZK A;  3OCP A;  1F8V A;  5LBC A;  4CU8 A;  3GJA A;  4XFG A;  2XWB B;  3MLL A;  3LZZ A;  4HKL A;  2EAK A;  4P9Y A;  4QB1 A;  5FXW A;  3U10 A;  4XFH A;  3I3M A;  4FTS A;  1GNZ A;  3WDX A;  2K9Z A;  2VO5 A;  1MZF A;  4Y20 A;  1QQP 1;  2OUJ A;  4ZU4 A;  3BPS A;  1JYT A;  3PVO A;  1E5S A;  4NR1 A;  1T6B X;  2RS3 3;  2RDN A;  2PAM A;  1RJ7 A;  4P00 B;  2PLV 3;  4R9C A;  1HW5 A;  3BTY A;  3VBF A;  3GJB A;  1FOD 1;  1A8D A;  3AVR A;  3OD4 A;  4GWI A;  2RMU 1;  4QPI C;  3OPT A;  4XFC A;  4FOY A;  3FN9 A;  5IVJ A;  1JTZ X;  4Q4W 2;  4OI2 A;  2VNR A;  3BB6 A;  4P9I A;  3S7I A;  4QKF A;  1WA4 A;  3DYM A;  2HWD 1;  1W6O B;  1DQ5 A;  1VAM A;  2F4P A;  5CU1 A;  4DEQ A;  1UIK A;  5J7M A;  1HDK A;  5C4W A;  2A6X A;  3LFI A;  3H1Y A;  3APB A;  4HVQ A;  2YDE A;  1TEI A;  4DFS A;  2ILM A;  1SLA A;  1YNA A;  2VNO A;  2WFP A;  1UXZ A;  1JOP A;  1VRH 2;  3FE5 A;  2ZAC A;  3JD7 1;  1RIR A;  4MVT A;  3SEE A;  1WBL A;  2CWM A;  4QPI B;  3TRS B;  2XH6 A;  1NCQ A;  2IXK A;  3K75 B;  1RGS A;  2VTX A;  3OUJ A;  1AXZ A;  4B7E A;  4LKD A;  5IVV A;  1QQP 3;  4DMI A;  2Z79 A;  3HMY A;  2JDK A;  2VME A;  3UK9 A;  3QLQ A;  3UJQ A;  3PUA A;  3AKQ A;  4K1Y A;  4KH9 A;  1IPJ A;  1LEN A;  1RHI 1;  3VBR A;  2YRO A;  3WG2 A;  2WAA A;  5A6Y A;  3LIG A;  5IVB A;  1DF0 A;  1EAH 1;  5FYT A;  3I2O A;  3T0B A;  2J7M A;  4JZR A;  4EWA A;  3VBO A;  4DNY A;  2RMU 3;  4LE3 A;  1E5R A;  2W5F A;  3IDB B;  2XVK A;  3CHX A;  5I0S A;  1D0G A;  3I7D A;  1JYI A;  4IE7 A;  1W6P A;  1XU1 A;  3K2O A;  4AI2 A;  1X8E A;  2WNV C;  4UW3 A;  2W95 A;  4I0A A;  4JGY A;  5JMC A;  1REF A;  2XKP A;  2HWF 2;  3LDB A;  2ET7 A;  4GB3 1;  5KHJ A;  3KQR A;  3I2H A;  1J84 A;  3CU7 A;  4QQP A;  5IT6 A;  3ETP A;  1J83 A;  1AR8 3;  3AKP A;  4QKB A;  1V6J A;  1POQ A;  4Q0Q A;  4B1L A;  2VUL A;  2WNU B;  2YZ4 A;  4LO5 B;  4FPO B;  4NHK A;  1NE6 A;  1CAV B;  2WNV B;  1OT5 A;  4EQV A;  1DLL A;  3RZZ A;  1J1L A;  4E4S A;  1QJZ A;  2BGO A;  2HWB 1;  2OQ7 A;  4DOU A;  1H8T A;  1XE8 A;  1VBA 2;  2R04 1;  1LHO A;  2NM1 A;  3ZFG A;  4CDX A;  2EVX A;  1RUD 3;  2K46 A;  2XML A;  1BZW A;  2J42 A;  5IAV A;  3M70 A;  1TME 1;  2VGD A;  4NHY A;  1C1L A;  1ZX5 A;  2DF7 A;  2RDR A;  2QFE A;  4R8H A;  1CON A;  3VHP A;  5DDJ 2;  2V4A A;  3JB8 A;  4AI0 A;  2BWC A;  4QQO A;  3ES4 A;  3MV1 1;  1ZBE 2;  3GBG A;  3T30 A;  4EV0 A;  2JG8 A;  4LLO A;  1Q5O A;  1W8W A;  2R0F A;  4GB3 3;  2ARB A;  1IZ3 A;  4YW6 A;  2FDJ A;  3KCY A;  1I3H A;  3O0W A;  5FZL A;  2EIC A;  4AR2 A;  5LZ6 A;  3HJR A;  4E27 A;  4H55 A;  1HRI 1;  3R4S A;  5JZG C;  4AFC A;  2J22 A;  1OKQ A;  4EN7 B;  3C3V A;  1OLM E;  3VDD C;  1ENX A;  1C8M 2;  5HI0 A;  3H8R A;  2RS1 3;  1APN A;  1MS3 A;  1RUG 1;  1LOF A;  5FJH A;  1W06 A;  3R6S A;  1CPN A;  5KHH A;  4ZON A;  2BNM A;  4QKN A;  1LU1 A;  1YJK A;  3Q8C A;  4AGV A;  4CE8 A;  2VR4 A;  5KXE A;  3T1L A;  1S2B A;  4JHT A;  4Y22 A;  5ANN A;  2DWR A;  4B1M A;  2OII A;  3H1M A;  4EWD A;  1TME 3;  5JZG B;  3DXU A;  4IND A;  4XQ4 A;  3ZSL A;  1OF4 A;  4GXL A;  1CJD A;  3HQX A;  4NIG A;  5IUQ A;  3VDD B;  2WN2 A;  1B35 C;  1L7L A;  3POE A;  2P5B A;  3WQ1 A;  4FFF A;  4N53 A;  4YNI A;  4HK9 A;  5FDB A;  1QMJ A;  2CDO A;  1YI7 A;  4YZ3 A;  3VN4 A;  5CG8 A;  1AYM 3;  3AMP A;  5D21 A;  2G4I A;  4XFF A;  2WBK A;  1W3X A;  3INA A;  5JXG A;  3PNA A;  2WYS A;  3VZM A;  3KHC A;  5K9Y A;  2ZEY A;  4IGO A;  3QH7 A;  4XQW A;  4NOT A;  1YQ6 A;  5KXB A;  5KWR A;  2A1X A;  1RUG 3;  1MAC A;  1YWK A;  2AR6 A;  3Q8F A;  2VMI A;  4KWJ A;  2Y60 A;  3J7M A;  4LOT A;  4RGG A;  4LBN A;  3POI A;  5D8A C;  4CCD A;  5DAW A;  3JU9 A;  5AC9 3;  1CZV A;  2DVA A;  3EMR A;  3GYD A;  1O8P A;  3HVD A;  3U11 A;  2DCY A;  4FPL A;  4QXH A;  3WNX A;  4KG0 A;  1YI9 A;  5A1F A;  5HCA A;  2W52 A;  4Y1V A;  2DCZ A;  3D0J A;  4SBV A;  2C9K A;  4DY5 A;  5FO9 B;  2XJV A;  3VKF C;  3CJI A;  4C0H A;  5D2A A;  1NLS A;  4ISQ A;  4XF1 A;  4PI0 A;  1N1V A;  1ND3 C;  3WY6 A;  3IPV A;  1DHK B;  1CAW B;  1PGW 1;  5FZ1 A;  5D8A B;  2WO1 A;  1RC6 A;  1AL2 2;  3FX3 A;  2ZEW A;  1W9Y A;  5FAX A;  1V6L A;  2I45 A;  1RUH 2;  3C7E A;  4MO3 M;  1S2E A;  1MEC 1;  4Z07 A;  3WNL A;  4DZG A;  3WT3 A;  3V0A A;  4C1W A;  1VIW B;  3S30 A;  5FP9 A;  2P6C A;  2VZV A;  3L9J T;  4ZY9 A;  1RJ8 A;  2IFW A;  1JU3 A;  2JIG A;  1LED A;  4HOO A;  1CZT A;  1SLC A;  4LK6 A;  4ATE A;  4CDW B;  3BAL A;  1CX4 A;  4HMZ A;  1ND3 B;  4QXB A;  5A7O A;  1QNY A;  2E63 A;  3UKN A;  1ZZC A;  2CWS A;  4C91 A;  4AHY A;  1JZ8 A;  3B3Q E;  3EO6 A;  1R1A 3;  2X5I C;  4OZO A;  2FZ1 A;  5EFU A;  5I91 A;  3SQO A;  2CGP A;  1BBT 1;  1MZE A;  2FCU A;  3PTY A;  3MBW A;  4WM7 B;  2IUW A;  3ZSJ A;  2AUY A;  4L99 A;  4CCC A;  4FAH A;  4NHL A;  5J98 B;  5FY5 A;  3H9A A;  2ARC A;  4X6Q B;  5HPO A;  1PX4 A;  1W9F A;  2W3J A;  2JEM A;  2X5I B;  1OC1 A;  4ZPI A;  4JAA A;  5GZC A;  1GQP A;  1SEF A;  2IXI A;  2EIE A;  4XMA A;  4G4F A;  5GM0 A;  3HNY M;  3WIN E;  4CP0 A;  1L3J A;  2XJT A;  2EA7 A;  5TSW A;  1OKO A;  1OF3 A;  5I0U A;  4AHX A;  1GYK A;  4BB3 A;  4I0W B;  2VOT A;  3L2H A;  4ATF A;  4YW4 A;  3IZO A;  2VOW A;  4D7S A;  5CFD B;  3P3P A;  4PIY A;  4XUT A;  4NVP A;  4AFA A;  3TEW A;  2VOK A;  4OHZ A;  1JYX A;  4QM9 A;  1R09 1;  4HSL A;  2WZ8 A;  4XUO A;  3OGS A;  4FBF A;  3I59 A;  1UZ0 A;  4IES A;  3ZDS A;  3A22 A;  2NLR A;  5ACA 1;  1AJK A;  3G7D A;  4KL1 A;  3POY A;  3ZMN A;  4CVU A;  5JR2 A;  1TQ5 A;  3ON7 A;  5I8Y A;  2CV6 A;  1AX0 A;  2YFU A;  4PF1 A;  5H9R A;  1Q8V A;  2EIB A;  4EWE A;  4IL7 A;  4QU1 A;  2YXS A;  2ZGS A;  3VBF C;  5FQ0 A;  2C1F A;  5KXD A;  5IAT A;  1WMF A;  1DQ2 A;  1HJF A;  4JVA A;  2RM2 3;  3BI3 A;  2LW8 A;  4DIN B;  2WJS A;  1AYN 3;  1E5I A;  1PVC 2;  4QX8 A;  4UFH A;  3R4D B;  3SH3 A;  1RUE 2;  3UYJ A;  1SDD B;  3GM8 A;  5FZA A;  4ITC A;  4C0B A;  1BMV 1;  3ZVX A;  2Y64 A;  1UYY A;  1R09 3;  4YM1 A;  5FZ4 A;  3NO8 A;  4NPR A;  3DEM A;  3RWN A;  4BCU A;  1VMJ A;  3ZIW A;  5T5L A;  1YIF A;  3H8X A;  1VBC 1;  2R07 1;  2WLP A;  1Q8O A;  2WNO A;  5LBE A;  5LAS A;  4BM8 A;  3E5Q A;  5ACA 3;  4ZZ8 A;  3VBH A;  4JQR A;  4AG4 A;  3O1S A;  1COV 2;  3VD4 A;  1DG6 A;  1H4G A;  4IE4 A;  4XET A;  1RIT A;  4YRD A;  2WR9 A;  3BPZ A;  4BE3 A;  2GC0 A;  1ZRC A;  1BK1 A;  3KV5 A;  3MFA A;  4YM3 A;  2C24 A;  2OXB A;  4IGP A;  1JYC A;  2ZJC A;  2GMP A;  2ZXQ A;  1V70 A;  5E8A A;  1AR7 2;  1QJX 3;  3IKW A;  5FYB A;  3WP4 A;  5ABJ A;  1G9B A;  1AR9 1;  1WW7 A;  2J1E A;  1JYV A;  4XTM A;  1YCI A;  3H3Z A;  1N3P A;  2PHU A;  3TB0 A;  1K5J A;  4QGL A;  1LEC A;  3I2G A;  1SHW B;  4OUM A;  2E6V A;  1W39 A;  3AYA A;  2TUN A;  5BNN C;  1IKP A;  1LGC A;  3MPP G;  5A6X A;  4RS5 B;  2IZW A;  5FMO S;  2VMD A;  1PGS A;  1NKG A;  5B4X A;  3ZN5 A;  4L0P A;  2VBD A;  2JG9 A;  2Q1Z B;  5A1A A;  3THC A;  3B02 A;  2G9F A;  2VOX A;  1OQ1 A;  4W6Y A;  3VZJ A;  1RUC 1;  3BTZ A;  5JI9 A;  1D7P M;  1UIJ A;  3NAP A;  3J8F 1;  4CCE A;  2BPA 2;  4YPJ A;  4D8M A;  3J26 N;  5KHG A;  5JXI A;  2UYB A;  2JJ6 A;  4CU9 A;  1ALY A;  1FMD 3;  2B45 X;  3HWJ A;  3WQ0 A;  3LOB A;  1CAX B;  1ULD A;  2TBV A;  2RS5 2;  3OG2 A;  3USU B;  3HBZ A;  1AR6 2;  1QXP A;  3DKW A;  1EUU A;  2RR1 1;  2ES3 A;  1WW4 A;  4W50 A;  3UET A;  1H9W A;  3ZFG C;  4CDX C;  1QEX A;  3AKR A;  4K7J A;  2WZR 3;  5GLZ A;  4N9H A;  4QQL A;  5KC6 A;  5FYV A;  3D82 A;  3WP5 A;  2VQA A;  4ISR A;  5FZB A;  1YC6 1;  3UES A;  1DQ4 A;  4MLO A;  1GIC A;  5GAL A;  4NN0 A;  3ILF A;  5GJ6 A;  5GLV A;  2JG8 C;  3GHN A;  3ILN A;  4GJZ A;  5C3O A;  4BIO A;  4WZC A;  4AI8 A;  3WDU A;  2ZMN A;  2VCB A;  1TZO A;  2IXL A;  2YU2 A;  4QM8 A;  5CFC A;  3J4U H;  1U5X A;  5FMC A;  4KGQ A;  1VJ2 A;  3CJX A;  5A33 B;  3I97 A;  3KF5 A;  4GAL A;  4YW2 A;  1YYN A;  2E7A A;  1O4Y A;  2WO3 A;  4N8M A;  1SFY A;  1VBB 3;  1RUC 3;  5FZ7 A;  2WN3 A;  3CIH A;  4CUA A;  4DEV A;  3J8F 3;  2AEN A;  3WNM A;  1UQX A;  5ABJ B;  1OSG A;  4FFI A;  1W9S A;  4RQP A;  2HYX A;  4MG2 A;  1JU4 A;  4UFJ A;  2VZQ A;  4UXA A;  1PO2 2;  2RS3 2;  3H7J A;  3NST A;  4P14 A;  4V2W A;  3BU7 A;  2HWC 1;  4XMI A;  4ERO A;  1W05 A;  4Q4V 1;  4Q4Y 3;  2RR1 3;  4XEZ A;  2VXJ A;  1OH3 A;  1YFX A;  4COW A;  2A3Y A;  1S4C A;  2A6Y A;  1UYZ A;  1QDO A;  3UNP A;  4HZF A;  2Y6G A;  4XIO A;  4R9A A;  4O65 A;  4RR3 A;  1OLR A;  3KB5 A;  5BNN B;  3HQR A;  4Q1R A;  3VUO A;  4AI1 A;  2H0V A;  3N9N A;  4IV3 C;  4L11 A;  4JQT A;  4WV8 A;  1NAE A;  2H6C A;  2ZKL A;  1PIV 1;  5A7P A;  5FZE A;  4Q8K A;  2EIG A;  5FXV A;  3MZH A;  4YLZ A;  3H42 B;  4AAP A;  4DRR A;  3LEG A;  2G19 A;  3OGR A;  2JE8 A;  2O1Q A;  3HAG A;  4FP3 A;  3AL6 A;  5FZO A;  3TEX A;  1URX A;  3A21 A;  2BRT A;  2J1A A;  4L9B A;  2BU9 A;  4LXL A;  2ATF A;  4HPK A;  5J09 A;  5KBF A;  1QQP 2;  4JDO A;  1OUX A;  2WQZ C;  2VZ3 A;  5F32 A;  3B9I A;  1IQD C;  3B7M A;  5FFO C;  4IV3 B;  4I0B A;  4FTB A;  2JDN A;  1W04 A;  1Y9M A;  4CEY A;  1QH7 A;  3J9S A;  2RJL A;  2FDG A;  1FOD 2;  1UNB A;  1W6Q A;  2Y33 A;  2RMU 2;  1HXS 1;  1W9W A;  1CR7 A;  4BLI A;  1FPN 3;  4DIQ A;  1EV1 1;  2DU1 A;  3PVN A;  4Y1X A;  1O3S A;  4NID A;  4BQY A;  4PCR A;  2GN7 A;  2ZGT A;  1LB2 A;  3ZXE A;  2JD4 A;  5BNP A;  1PNF A;  5JSP A;  2XUE A;  4UW6 A;  3LOI A;  4JDN A;  5FPB A;  4Y24 A;  1UY0 A;  5CKM A;  4P9X A;  2ARX A;  5JUV A;  3IWZ A;  1H2L A;  1DQ0 A;  3JD7 2;  3THD A;  2Y6F A;  2WYF A;  1AR8 2;  4YSF A;  1UKR A;  2Z69 A;  4U36 A;  5FYU A;  5AVP A;  4C1X A;  3UGF A;  2JDM A;  4RHV 1;  5F7U A;  2VUJ A;  2QQU A;  4NHM A;  1PM4 A;  2ZEX A;  5K4L A;  2JX9 A;  1ODN A;  1YO8 A;  1Y9Q A;  4MV2 A;  1EAH 2;  1WD4 A;  1SBE A;  4OYU A;  4Q0U A;  4E4Z A;  1W0O A;  4QD2 A;  1RUD 2;  3I2F A;  4G3Y C;  4LHL A;  1HXS 3;  3OYW A;  3POF A;  1ULC A;  4MGI E;  4MXW A;  4YVW A;  3ZFE B;  5B2G B;  4OMC A;  1PX3 A;  5K0U B;  3WNP A;  3FBM A;  1KS5 A;  1NA1 A;  1UO9 A;  4LIT A;  1MR5 A;  2MEV 3;  3LA3 A;  3MF6 A;  4O9E A;  4WVM A;  4Q5O A;  5C3R A;  1CIW A;  3V0A B;  4GB3 2;  2N7G A;  3UJO A;  4XXA A;  1QU0 A;  3RRD A;  4JRL A;  1OI6 A;  3VD9 A;  2VNV A;  2GSY A;  4IW3 A;  4M3C A;  2BTV C;  3PL0 A;  3MUZ 1;  2W1Q A;  1KQR A;  5F3C A;  3QCW A;  3BIE A;  4JDM A;  4BWO A;  5DAQ A;  3AP9 A;  2BQP A;  5FZ3 A;  5LA1 A;  2Y6K A;  2QTW B;  3SLI A;  4AHZ A;  4OHV A;  1IHM A;  3HNM A;  2JB8 A;  1WLT A;  1O3Q A;  2OPW A;  2AZ5 A;  2IVI B;  3C7F A;  1H8V A;  3RYK A;  4FPE A;  4EN0 A;  1O5U A;  1WW6 A;  4D7T A;  1W8Z A;  4XBQ A;  1TME 2;  4EN9 B;  4AED A;  2BP6 A;  3TNQ A;  1GZC A;  1QOO A;  2VM9 A;  4N43 B;  2XBO 1;  4QX3 A;  1FI2 A;  1MQT A;  2P1B A;  5DUX A;  4TXW A;  4ET7 A;  1AVB A;  3TEY A;  3M1H A;  4IE0 A;  2CGO A;  5LA0 A;  1Z78 A;  1D4M 1;  3HEI A;  4OHY A;  1VBD 3;  1WCK A;  2R49 A;  3ITQ A;  3GNE A;  1GZ9 A;  2CAV A;  2PHT A;  3RZG A;  4E2S A;  3TEZ A;  1AX2 A;  1HRI 2;  1RUI 1;  5E16 A;  1AZD A;  1W90 A;  1NY7 1;  2HBU A;  2A3W A;  1QJY 1;  3KVB A;  1SCR A;  2QQW A;  4GIQ A;  5JIU A;  5T5P A;  1PVC 1;  1NOV A;  1RUG 2;  1CZS A;  2XQX A;  1C5I A;  2LTN A;  1NCR A;  3MEP A;  3OPZ A;  3VBS C;  3WNN A;  3UV9 A;  1VBE 1;  2UYA A;  1OPO A;  2XGX A;  5JSR A;  1G7Y A;  3AMQ A;  1RUJ 1;  4M3C F;  4HKW A;  4MGT A;  4AVS A;  4GUL A;  1X7N A;  5KHK A;  2CNA A;  4XBN A;  2QQL A;  3GAL A;  2Y6H A;  1N1S A;  1UZY A;  2ZGR A;  5F37 A;  4QDR A;  3CEW A;  3PU8 A;  2XBO 3;  1GWM A;  3ZPY A;  1H1A A;  4NUB A;  4XTP A;  2KR2 A;  5C3P A;  2NMO A;  3KM5 A;  3Q8A A;  1D4M 3;  1QGL A;  4YVS A;  3VBS B;  3VHO A;  4CXY A;  2WDB A;  5A6Q A;  2J1R A;  3V56 A;  3ZN6 A;  3ME2 A;  3WF3 A;  4JGZ B;  5JIA A;  2BYV E;  2VW2 A;  3LPG A;  1ULO A;  1VAL A;  4IEZ A;  1H6Y A;  2Y6J A;  1RUI 3;  5D1I A;  1AR7 1;  1KXG A;  2OKX A;  2YBP A;  5FR3 A;  2PXJ A;  2D3S A;  2WA3 A;  3OD0 A;  4UF0 A;  5DG2 A;  1RTV A;  1VMH A;  3VZN A;  3T0D A;  4AEK A;  1DZQ A;  5IFP A;  3N9M A;  1XE7 A;  3N9P A;  3DXT A;  1SMV A;  4WZF A;  4KBZ A;  5A7S A;  3A23 A;  1S2K A;  5FYC A;  1XOY A;  5FIX A;  2HH9 A;  2XWJ B;  3CZJ A;  5FMO L;  3DEC A;  2A7A A;  2EID A;  1YEW A;  4UBG A;  4ZXE A;  4LBQ A;  4M4P A;  3E1F 1;  2DV9 A;  2IFR A;  3VB9 A;  2FQP A;  1KD7 A;  4MSV A;  2JG9 C;  4NRO A;  2P17 A;  3MW2 A;  1UMZ A;  4LMF A;  4QX7 A;  1ODM A;  4XCB A;  1PGW 2;  1JS9 A;  1G9D A;  1CAU B;  5H9P A;  5JOY A;  3CO2 A;  5FZC A;  1W8F A;  3U4S A;  1JZ5 A;  1HKD A;  3IT8 A;  1OBN A;  2ZHM A;  1MEC 2;  5IW0 A;  4XE9 A;  3I2I A;  1ND2 C;  1FV3 A;  1UD1 A;  4QXC A;  5BNO A;  5C71 A;  1PO1 3;  5L7O C;  3THT A;  4FTE A;  3VGI A;  3H8U A;  1QJF A;  1IQA A;  1C1F A;  1UZV A;  2J1T A;  1X36 A;  5JWP A;  5IVE A;  3U0Z A;  1IKQ A;  3JQX A;  5A3W A;  4AE2 A;  4Z2W A;  4L92 A;  1W2A X;  2V09 A;  1KDK A;  5B4N A;  5FY8 A;  1ND2 B;  1Y4W A;  5IJR A;  5HXV A;  1TNR A;  5C5U A;  1BEV 3;  1Q8P A;  2RS3 1;  4L97 A;  5L7O B;  3LEI A;  3MV0 1;  1HB3 A;  1RYY A;  4GWM A;  4BIS A;  3C7O A;  4AL9 A;  4MGQ A;  4N7I A;  2PLV 1;  5EIY B;  3M2M A;  2VJX A;  4XJZ A;  3AP4 A;  2ZCW A;  1H2K A;  1OLQ A;  2R7E B;  3VZO A;  2FCV A;  1O6U A;  1YRZ A;  5A7N A;  1PHM A;  1UYX A;  1YHF A;  2FDI A;  1X9P A;  2GNT A;  2ARA A;  4Q29 A;  4QPG A;  1MS0 A;  1XRU A;  4HSJ A;  5DG1 A;  3WUC A;  1LOD A;  3I8T A;  4HKO A;  4F8A A;  5IVF A;  2RM2 2;  2ZEZ A;  3E5U A;  3U78 A;  1F31 A;  3LFM A;  3OPW A;  3AKT A;  1AYN 2;  1WLD A;  3NV2 A;  2Q1F A;  1HQN A;  4ZZ5 A;  4W6W A;  1DP0 A;  1ULG A;  2VPV A;  3WXP A;  4AEM A;  4F3J A;  4MXV A;  1DDL A;  1R09 2;  4LBQ D;  4XJ8 A;  5BNQ A;  1HRV 3;  2D6L X;  1QDC A;  1CES A;  4E2Q A;  2VZP A;  1BXH A;  4YAR A;  3WLU A;  1RXG A;  3MIE A;  4IGQ A;  1IPS A;  4B3N A;  5LK5 A;  5FZG A;  2VZR A;  2YB7 A;  4QX1 A;  5ACA 2;  2Q0A A;  5F3E A;  4IV1 A;  4M00 A;  2XB6 C;  4AYU A;  4XW3 A;  4QQ2 A;  4XAE A;  3BVC A;  2QJV A;  4CEY C;  3T2P A;  4KU8 A;  4J1X A;  4RFT 0;  5APA A;  4DY3 A;  4BMB A;  4CCN A;  3ASI A;  2P3J A;  4QGM A;  4UAP A;  4FAG A;  5LBB A;  3UT0 A;  3OSD A;  3LIH A;  4LUL A;  2RV9 A;  3TAY A;  5G05 L;  3BOW A;  5BNP C;  2ARE A;  5LW9 A;  3KVA A;  4OUL A;  1JZ4 A;  3D8C A;  3EB7 A;  4BPZ A;  1AR8 1;  2JDZ A;  2AYH A;  1DZT A;  2PHF A;  5F3I A;  1BMV 2;  4E4H A;  3IM0 A;  4JX0 A;  3NL1 A;  3SC7 X;  1R1Z A;  4CEY B;  5DUV A;  2Q5T A;  3MF9 A;  1DCS A;  4YG6 A;  5G04 L;  4A2U A;  5C8C A;  5EWS A;  1ASJ 3;  1LU2 A;  5FLJ A;  5E89 A;  1VRB A;  1VBC 2;  2R07 2;  3J7N A;  3IMM A;  3LKJ A;  3DCQ A;  1SFN A;  2VG9 A;  5FUP A;  3ZSE A;  3I2K A;  2HWE 1;  2LAL A;  4ARX A;  2W08 A;  1IOA A;  1RUD 1;  1HV0 A;  1QXR A;  2VC9 A;  4GH4 C;  1LRH A;  2JIJ A;  1S0C A;  2RG4 A;  2ZHN A;  3ETQ A;  2RHP A;  4IEY A;  3T4H B;  2VVE A;  1BHG A;  2GND A;  1LNS A;  4L2N A;  1W0N A;  5BUV A;  2QQM A;  1JI6 A;  2ZHK A;  5DAX A;  4COU A;  5C9A A;  3OUH A;  4FPG A;  4GWJ A;  4YVW C;  1XU2 A;  4CP2 A;  2O0O A;  4XC9 A;  1AR9 2;  5FZH A;  1I9R A;  4XQD A;  1QWR A;  3RDI A;  3VZK A;  2WNE A;  2B39 A;  2WO7 A;  1W8O A;  4GH4 B;  2R0H A;  3VZL A;  4LUM A;  4D7Y A;  4AFD A;  4BXF A;  3EHK A;  4UW5 A;  3N9O A;  1DGR N;  3DKQ A;  2W94 A;  3F2Z A;  5CKN A;  1S0B A;  4BZ4 A;  1JXN A;  2RS1 1;  3LE0 A;  5FRE A;  1RUC 2;  1V6O A;  2BZD A;  4LO7 A;  4RGA A;  3SCF A;  3J8F 2;  2I74 A;  2HWE 3;  4COZ A;  4ES9 A;  2P3Y A;  3ACI A;  3PU3 A;  4O7X A;  2FZ2 A;  2BFU S;  3IN9 A;  2LRO A;  4PJY A;  4Q4Y 2;  1MS8 A;  2JIC A;  2RR1 2;  3WW1 A;  3OEA A;  2VW1 A;  1YQC A;  4J1W A;  4CDQ A;  4YZ4 A;  4BQW A;  1VB4 A;  4SLI A;  4LBK A;  3FUO A;  1Q3E A;  4AED C;  5GZF A;  4S2F A;  4XFA A;  5FPA A;  4F7Z A;  1AYM 1;  1MQT C;  4XF4 A;  1ZRR A;  1ENS A;  1UYP A;  4OMD A;  4AWD A;  4MZU A;  1G9F A;  1DU3 D;  4FXG B;  1W6M B;  3WX5 A;  3D3A A;  2HYK A;  1OA3 A;  5T52 A;  1Y9G A;  3O14 A;  4P9W A;  4CP1 A;  1NT0 A;  3E6D A;  4HN0 A;  5A32 A;  1XJA A;  1S55 A;  4AED B;  5C6C A;  2K2S A;  2W92 A;  5AC9 1;  4XIL A;  2VXR A;  3FUQ A;  1W6N B;  1XSR A;  4KNC A;  3BIW E;  2HWC 2;  3BOD A;  4QPY A;  4ZKT B;  2WC2 A;  1O7F A;  4K6B A;  4Q4V 2;  3FHQ A;  3ZXA C;  3NJV A;  4I01 A;  4NII A;  1CD3 G;  4BHP A;  2OW4 A;  1TMF 3;  5CG9 A;  2E7Q A;  4IDZ A;  5EV7 A;  4Z92 B;  3HIF A;  2Z2S B;  4LK7 A;  1E5H A;  5EZW A;  1RVF 3;  2NMN A;  4H2A A;  1LHW A;  2ZGU A;  2ZA9 A;  5BXX A;  3SH4 A;  4YG0 A;  3QAC A;  2PMW B;  4EZH A;  2WT0 A;  3SH5 A;  2D44 A;  5LK7 B;  1PIV 2;  1ZRI A;  5LY2 A;  4DXS A;  1YQ5 A;  2HLE A;  5JXH A;  2ORX A;  2XVL A;  3M3I A;  1T6G C;  3WZ1 A;  1I6X A;  1UXX X;  2ID4 A;  3E97 A;  3K4A A;  2VTX J;  4UYB A;  1HIX A;  1B35 B;  1V9U 3;  3E5X A;  2UY9 A;  5F39 A;  1NXM A;  3RGB A;  1ULF A;  1X82 A;  3T3Y A;  1PK6 A;  1R1A 1;  1F5F A;  3AJZ A;  1SBD A;  3Q8E A;  4AVV A;  2DTW A;  2I07 B;  3U75 A;  2MNG A;  3SXW A;  1YFY A;  2WWJ A;  2Y0I A;  1YQ8 A;  4LE4 A;  1HXS 2;  4BOW A;  2NZ9 A;  4K40 A;  5A1L A;  1EV1 2;  4LBO A;  3AZZ A;  4V1P A;  1W0P A;  3III A;  2D6M A;  5FUN A;  2XUM A;  1R08 3;  3I3B A;  2QQN A;  2X09 A;  4UF0 B;  2MEV 2;  3WOG A;  3ZPO A;  1O91 A;  1W03 A;  2OX0 A;  2BW8 A;  3A0K A;  4FPF A;  4YGB A;  1ULP A;  3HOB A;  3M3Q A;  1MS5 A;  4FXK B;  3HD8 B;  2CY6 A;  4AVB A;  3DL3 A;  4MGY E;  3ZYF A;  1QXJ A;  1MVE A;  3AMN A;  4BJ0 A;  3IDE A;  3N4M A;  2VU9 A;  2WT2 A;  5FO7 B;  4FSJ A;  3N7L A;  1ZZB A;  2DDU A;  2AEZ A;  4AQ2 A;  5FWJ A;  4RHV 2;  5BNO C;  3BU0 A;  3KCX A;  5C5T A;  3ZYH A;  2TEP A;  4Y5T A;  2QQK A;  3BOP A;  3PMS A;  2PHX A;  2WT1 A;  3ES1 A;  2RE9 A;  3M8L A;  5A7W A;  5I0R A;  4IEX A;  5EPA A;  3I3Q A;  1XSQ A;  1GNH A;  2D40 A;  1UY3 A;  5T50 A;  4WVV A;  1LOE A;  4GKY A;  1C8N A;  4XPV A;  2YC0 A;  3POB A;  5LRR A;  4Z82 A;  3P6B A;  1GAN A;  3AYE A;  1LOB A;  2ET1 A;  4JKK A;  4K20 A;  3U1X A;  3P1I A;  1W2U A;  1WLW A;  1S0G A;  4BIF A;  2B9V A;  2B46 X;  3M3E A;  2JKB A;  5FK7 A;  1GFF 2;  4AGG A;  4ZS3 A;  1GZW B;  3Q9O A;  1F4A A;  3M3O A;  4ZU7 A;  4QX2 A;  2B4K A;  4JKM A;  3I4I A;  3V0B A;  2RM2 1;  4LKS A;  1LCL A;  2BV4 A;  2VD7 A;  3KV6 A;  2W9X A;  1UY4 A;  3DYO A;  2QDN A;  3M4F A;  1AYN 1;  1NQJ A;  3MID A;  1GV9 A;  5FYM A;  2A6W A;  5F6L B;  1K5M A;  4PDW A;  2ZZQ A;  2VZO A;  1OOP A;  4MGK E;  1DBN A;  3B94 A;  5C3Q A;  4FI9 A;  4XUN A;  4YW3 A;  3OY8 A;  1GR3 A;  1VB2 A;  2SBA A;  3JXS A;  5A7Q A;  2XON A;  4B4P A;  5SV5 A;  1XXN A;  3WW2 A;  2VUC A;  1SG3 A;  2XBO 2;  3GCX A;  2RJK A;  4B8E A;  1JN2 P;  1GQH A;  1PMJ X;  1XYN A;  4NMI A;  4EZ4 A;  5L19 A;  3C8X A;  1D4M 2;  4HET A;  3MGU A;  2NYY A;  4H3W A;  1GZT A;  4XFI A;  2Q8O A;  5IK7 A;  5DPN A;  5CAD A;  3DPR A;  3AP5 A;  3NMB A;  3FWE A;  4AEJ A;  2XJR A;  3ZXG A;  1RUI 2;  1W28 A;  1QJX 1;  5IAX A;  1W9T A;  1NY7 2;  3DN7 A;  5ERL A;  1QJY 2;  2NN8 A;  1QJU 3;  1S0F A;  3MW3 A;  2WQ4 A;  4IQP A;  4Y20 B;  2FDK A;  5FP4 A;  2QKD A;  4S2G A;  2AAC A;  3W21 A;  1ENR A;  2VY0 A;  5FKC A;  4E2G A;  1VBE 2;  4GJY A;  5C4W C;  2E9Q A;  2ZAH A;  2P3I A;  1JHN A;  4LEJ A;  4XHX A;  1RUJ 2;  2ZOE B;  2ADE A;  2JEN A;  3K4Z A;  5A3O A;  4BK5 A;  5KHI A;  4UI9 L;  4KBB A;  1RED A;  4D69 A;  3VBF B;  3KGL A;  4NWW A;  3TBD A;  1DYO A;  3R05 A;  3VLB B;  4LHK A;  4WM8 A;  4YGD A;  1NCQ C;  4AXO A;  4FOW A;  3WUD A;  1BKZ A;  3CQO A;  1JOB A;  4IER A;  1SPP A;  1SLI A;  2QQI A;  4QAW A;  1KJR A;  5C8C C;  2X05 A;  3POW A;  3S0M A;  1FMD 1;  1ZRE A;  3VBR C;  5C4W B;  1N1T A;  2Y34 A;  1AJO A;  3NNM A;  2Z4F A;  4FP2 A;  3RJR A;  3SEP A;  1POV 3;  4CEW A;  2BER A;  3LGR A;  3VBO C;  2ZX0 A;  4FO9 A;  2GC1 A;  4BQX A;  4CTE A;  1X8M A;  2WZR 1;  4QB6 A;  1DFQ A;  3FC0 A;  1NCQ B;  1UU4 A;  3I54 A;  3I2J A;  3KWV A;  1DQ6 A;  4DPN A;  4JGY C;  3ZXD A;  3IAQ A;  5BV6 A;  4YYO A;  1OA2 A;  3VBU A;  2GH8 A;  3A7Q A;  3CKH A;  1AHS A;  3VBR B;  3I49 A;  4TZD A;  3WR0 A;  3ACH A;  1LOA A;  2GN3 A;  1NUK A;  4LIV A;  5EHD A;  2XHK A;  3L2Y A;  3VBO B;  1J58 A;  3ZKY A;  4FFG A;  1DGL A;  4Q4W 3;  1KDM A;  1VBB 1;  4QDS A;  4UOJ A;  1XQN A;  3WD5 A;  1GOF A;  3W5M A;  1JOD A;  1OLM A;  1W6P B;  2ZGN A;  4J6G A;  4TLG A;  4JGY B;  3ZXJ A;  1GLH A;  1PZ8 A;  2BFU L;  3ZYP A;  4AZZ A;  3X29 B;  1MZ5 A;  1U5Z A;  1H8T C;  2DVF A;  1HX6 A;  2J1U A;  2HBT A;  1H1I A;  3HQU A;  4Q4Y 1;  4XDO A;  1VRH 3;  3FBY A;  4OQ8 A;  5DAV A;  4GMP 3;  2JDU A;  5E6H A;  5FPV A;  4O9G A;  1JBC A;  5FY9 A;  2VEC A;  3RVH A;  3ZKU A;  2WAO A;  1MPX A;  2VQT A;  3GZT B;  3FFZ A;  3AVS A;  1NX9 A;  1S0I A;  3NQH A;  2WS9 3;  4FQ4 A;  3T1M A;  3WQ7 A;  4A6S A;  3O5S A;  3VD3 A;  4OUS A;  4LTA A;  1VMF A;  1XC6 A;  4NE9 A;  4O61 A;  3WG3 A;  5A3M A;  2ZHL A;  4HK8 A;  1GP6 A;  2LM3 A;  2DFB A;  4XJW A;  3RS6 A;  1FXZ A;  1H8T B;  4W65 A;  1WBF A;  5F5I A;  3ZFG B;  2D3R A;  4IXL A;  4CDX B;  3RZL A;  1LAJ A;  3SCG A;  5JSO A;  5LAT A;  1UWW A;  4HVR A;  3C7H A;  3ZYB A;  2ZGL A;  2DVD A;  2EXJ A;  4Y1U A;  2QBX A;  1WUV A;  2W87 A;  2R30 A;  1O8S A;  2XLF A;  3CMG A;  2HWF 3;  3LQC A;  3PIG A;  5FUI A;  3VHN A;  3VDA A;  4CXW A;  1LOF C;  5KR7 A;  2JG8 B;  4XUR A;  4MX3 A;  1AXY A;  4LO4 B;  4P02 B;  3TN9 3;  4IE6 A;  2PLV 2;  4CDU A;  4PBO A;  1C3H A;  3ZFF A;  3NNL A;  4AF9 A;  1ZA7 A;  2VUD A;  3AP6 A;  4Q1P A;  1D0H A;  1OD5 A;  1FPN 1;  2MPF A;  4HAN A;  5FLH A;  1NE4 A;  3FLP A;  2XR4 A;  1KRI A;  2C6S A;  1PM7 A;  1IS4 A;  5I93 A;  1UOG A;  3O1O A;  3OBA A;  2YFZ A;  3MIB A;  5GLT A;  3NKG A;  4YFZ A;  4N53 C;  1ZBA 1;  1RUO A;  4NAO A;  2A71 A;  1Y43 B;  4IUG A;  3EJK A;  4Y22 B;  4GKX A;  2GMM A;  5H9Q A;  3NKT A;  1UPI A;  4Q27 A;  4CCJ A;  4E8D A;  1W99 A;  5J3U A;  1CWP A;  1KFX L;  1SCS A;  4KI5 M;  5JAX A;  2GNM A;  4B4R A;  1CPM A;  3OOX A;  1UL9 A;  2XJQ A;  3S6P A;  3VL9 A;  4NIH A;  4Q8L A;  2QVS B;  3RJ2 X;  3RZK A;  5FPL A;  4YFW A;  4EN8 B;  4N53 B;  2EAL A;  3U4X A;  4MGZ E;  2YPJ A;  3S57 A;  1OMI A;  3ACG A;  2PN5 A;  3D6E A;  3WNO A;  4Q0S A;  1S0J A;  3AL5 A;  5FKB A;  3WG4 A;  3ILR A;  2FDF A;  3IB3 A;  5IFT A;  1W6O A;  1ACC A;  2WWS A;  5C70 A;  1C8M 3;  2D97 A;  3NNJ A;  3NNG A;  5FP3 A;  2MEV 1;  2VMG A;  2Y38 A;  2IC1 A;  2ZGP A;  3CJI C;  4W4Z A;  1CGP A;  4A6O A;  4H14 A;  1S0E A;  1H0B A;  1ZBA 3;  1JZ2 A;  1C5H A;  5HCB A;  2LRP A;  4KU7 A;  3BUC A;  2O14 A;  3CZU A;  4QPI A;  3IBM A;  1IPK A;  4G9S B;  4Y5S A;  5HCF A;  5T3N A;  4OI0 A;  1D2Q A;  2V73 A;  5CKQ A;  3RMY A;  2QNK A;  2UWC A;  5DZG A;  4DUV A;  1LHU A;  1ZNP A;  3N7M A;  2WAB A;  3P3N A;  5F5A A;  2JXA A;  2AC1 A;  2GAL A;  2NP0 A;  3CJI B;  4J25 A;  5I0D A;  5GLW A;  5A3L A;  2FBE A;  1G6N A;  3VDC A;  5CVR A;  2HWE 2;  3IPV B;  4IEW A;  5FYI A;  3RQ0 A;  3AFG A;  5LA2 A;  1H2M A;  5FBJ A;  3M3C A;  3RYP A;  4URA A;  2ZPX A;  3AM2 A;  3MIH A;  2WFF 3;  2VZT A;  4JTO A;  2AH2 A;  4K8F A;  4XYX A;  4AVA A;  2IXC A;  1W2T A;  4UBH A;  1WCD J;  3CL1 A;  3DUI A;  3ROU A;  5FPX A;  4FFH A;  5HV4 A;  4CUB A;  3AXE A;  1JMU B;  2XHN A;  3BYW A;  3OGJ A;  2Q8D A;  4LJH A;  1VBD 1;  4OI1 A;  3PLQ A;  3KV9 A;  5FYS A;  3GGL A;  3HN1 A;  2BEO A;  4EN6 B;  2WNU A;  3SIS A;  4ZU5 A;  2Q30 A;  2ZGO A;  1SQ4 A;  4Y26 A;  1CAV A;  2WNV A;  3EQE A;  2XOM A;  3I3D A;  4GQ7 A;  2V5D A;  4UWD A;  2RS1 2;  1OVS A;  2ZMK A;  5FJK A;  4I2O A;  1REE A;  4AFM A;  3AMH A;  2FMY A;  1ULE A;  3WV6 A;  4YZ1 A;  1JW6 A;  1K5M C;  3WF0 A;  1DGR A;  1RUH 3;  3J7L A;  4KWL A;  5LY1 A;  2HEW F;  2ENR A;  2WSV A;  4FVV A;  1J59 A;  4LQR A;  1TMF 2;  3RYR A;  4EYU A;  3KT7 A;  2JDA A;  3S5Q A;  1AYM 2;  2WL1 A;  4I09 A;  1YJL A;  5GZD A;  1SLB A;  3I2D A;  1QOS A;  4MYE A;  5A70 A;  1A34 A;  4QQH A;  2WWU A;  3JUU A;  2RJ2 A;  4HL0 A;  4A7Z A;  3DYP A;  5FOJ B;  3WF1 A;  1BYH A;  1QHD A;  3O0X A;  3OBR A;  5K7P A;  3DPR C;  2ZML A;  2GC3 A;  1PVX A;  4HG6 B;  1OA4 A;  4Q0V A;  4AI9 A;  1I5P A;  1I5Z A;  4MAD A;  4Q4X 3;  4PQQ A;  3I59 B;  3A4U A;  4A7K A;  3MLJ A;  2B9U A;  2VAU A;  4QX0 A;  1F9K A;  5A6Z A;  5AC9 2;  1GP4 A;  2XJP A;  3QH6 A;  4A4A A;  5JZG A;  2ZX3 A;  4MGS A;  3ECQ A;  1E57 A;  2FCT A;  2PEL A;  3O0V A;  4K1Z A;  4K8R B;  4CUC A;  3VDD A;  5I8T A;  1LR5 A;  5L73 A;  3DPR B;  3MPB A;  1NZC A;  2CDP A;  1DGW X;  3DV8 A;  5FQ0 B;  1V6N A;  4C8D A;  4WM8 C;  2BJS A;  2GZW A;  1QOT A;  4S2H A;  4ASK A;  3I3E A;  3UKV A;  4ARY A;  2B5H A;  3VBH C;  1LEM A;  4QXK A;  2CTV A;  3BCW A;  5T5J A;  4Z8B A;  5DUU A;  1J3R A;  1KFU L;  4BQ4 A;  4NPL A;  2Z42 A;  2B7Y A;  1PO1 1;  3GHM A;  1KGY A;  2P37 A;  1BJQ A;  1EPW A;  2TNF A;  3UKT A;  2KXL A;  4KGG A;  4AQT A;  1EY2 A;  4C90 A;  3LD8 A;  2VCA A;  2E26 A;  3AKS A;  3EXU A;  2DFC A;  5C33 A;  3LCP A;  4FPY A;  5IK8 A;  1R1A 2;  2DTY A;  5JOW A;  3W59 A;  4TTG A;  3VBH B;  2KD7 A;  4MUV A;  1W2N A;  3EBR A;  1GBG A;  1UOJ A;  1GSL A;  4DRV A;  2A75 A;  4LO6 B;  4MHR A;  1NXD 1;  4X6R B;  3D4K A;  1CAW A;  2ZAA A;  3PJY A;  3LB9 A;  1BEV 1;  4AVC A;  5D8A A;  2P4E A;  3NVC A;  5C7G A;  3NAP C;  1RUE 3;  4M01 A;  3KD4 A;  3H0O A;  2WIN B;  1FT9 A;  1BLZ A;  1GOG A;  1XNB A;  2VZU A;  4ORF A;  5FLI A;  5JVV A;  4DUX A;  5JOZ A;  1RB8 G;  2BOJ A;  4XJU A;  5FZ9 A;  1T2X A;  4CP9 A;  1AUY A;  4CDW A;  1UY1 A;  3IDC B;  3ZYR A;  5EJ3 A;  1EP0 A;  4OZX A;  1UX7 A;  2IXH A;  2JG9 B;  2JE7 A;  4XF3 A;  3WVJ A;  4B4Q A;  4OHX A;  1Q56 A;  5FP7 A;  3JBG 3;  3NAP B;  3PJQ A;  4XOG A;  1COV 3;  5FZ6 A;  4WM7 A;  2F17 A;  3T2Q A;  1LHN A;  2V72 A;  2VBB A;  2PFW A;  3B93 A;  3R0R A;  2VVF A;  3LEK A;  4AW7 A;  5CFC C;  5E1R A;  4EE2 A;  4XBL A;  1OQD A;  1HB2 A;  1HRV 1;  2ZTN A;  1POV 0;  2D6O X;  3OF1 A;  5IVY A;  1RUF 1;  3OUI A;  2VMC A;  2PA7 A;  4NRP A;  3N7J A;  1IG0 A;  1SLL A;  3DF0 A;  5DAP A;  4TSV A;  2XLA A;  2X5I A;  3S7E A;  4RQP C;  3FL7 A;  4PIZ A;  4YZ5 A;  1XB9 A;  4PLN A;  3TWI A;  3R4U A;  1U5Y A;  1N1Y A;  2PQQ A;  3URF A;  2RDQ A;  4CDU C;  3ZFF C;  5CFC B;  3B69 A;  5EJZ B;  3THP A;  3ZIX A;  1X50 A;  1X9T A;  1AXK A;  2E7T A;  4PBP A;  3EYP A;  5FY4 A;  1QJU 2;  2J1S A;  3O12 A;  1R64 A;  4RR3 C;  5CFD A;  1IS6 A;  3ZYI B;  1MS9 A;  2YGM A;  4HLT A;  2OPK A;  4D6S A;  2VNG A;  4YM0 A;  3H7Y A;  5I8S A;  4RQP B;  1JH5 A;  2QQP A;  2EF6 A;  4QHO A;  2XL9 A;  4YW5 A;  1DYK A;  1AR6 3;  3JQW A;  2B8M A;  2R6Q A;  1ENQ A;  2D5F A;  1RUF 3;  5GZG A;  4GMP 0;  5IWF A;  1ASJ 1;  5EXO A;  3WP3 A;  3U37 A;  4ASL A;  4RR3 B;  1YFW A;  4PIX A;  2BGP A;  2DUO A;  4FPK A;  1CJP A;  2A3X A;  3ZMO A;  1NG0 A;  4AQS A;  2G9Z A;  3NJX A;  4XJA A;  1STM A;  1ZRF A;  1LHV A;  2R06 1;  3A0N A;  3IAP A;  2GC2 A;  2UY8 A;  1QJX 2;  4LBM A;  2CL2 A;  3AZV A;  5FZO B;  4Z1V A;  2R1D A;  5IYY A;  4HPK B;  3LSD A;  2YU1 A;  4HON A;  2L9L A;  3WCR A;  2VQU A;  1PO2 3;  1XNT A;  2GAU A;  2WLQ A;  4ZXK A;  2P34 A;  3GF6 A;  2P3K A;  1IS5 A;  5E88 A;  4LPL A;  3JB4 C;  2V5Y A;  1PMI A;  2Y8K A;  1U5I A;  1W6Q B;  1NLR A;  5A80 A;  2CYF A;  1O3R A;  1WGP A;  5K8S A;  2YMZ A;  4RA0 A;  1WD3 A;  2PTM A;  1BQP A;  4KWK A;  1N3O A;  4OVE A;  2X8K A;  1QIQ A;  1UPS A;  4BYY A;  1A78 A;  4LA3 A;  3T09 A;  3RZM A;  1XNA A;  2D5H A;  5BNP B;  1FMD 2;  4IE5 A;  4LBL A;  3WF4 A;  1HN1 A;  3U07 A;  1LUL A;  3PUH A;  4E9K A;  1FV2 A;  3ZN4 A;  1Z0H A;  3RSJ A;  4HVO A;  2R06 3;  1JZ7 A;  5IK5 A;  4GD4 A;  2WZR 2;  4IEP A;  2ZGM A;  4LUK A;  3H3L A;  3ZXL A;  3C2U A;  4FPH A;  1UOF A;  2YHJ A;  2E32 A;  2WS9 2;  4N90 A;  4IEU A;  5FYZ A;  2ERF A;  3AK0 A;  2XXZ A;  1NA1 C;  3AJY A;  3WHU A;  3J7H A;  3KSC A;  1W8H A;  3UGH A;  5BY5 A;  5LRS A;  4RS5 A;  3OJB A;  4YG3 A;  2FHR A;  2UUR A;  4PLO A;  1FOD 3;  1UY2 A;  1DQ1 A;  3FLR A;  3HNB M;  3HBK A;  1V00 A;  1EPZ A;  3AZW A;  1JZ3 A;  1QNW A;  2WNU C;  3OYW B;  4MXW B;  4YVW B;  1QKQ A;  1J3P A;  3PUS A;  1J3Q A;  3OGG A;  1RMU 1;  1VBB 2;  2Q4S A;  1BVV A;  2HWD 3;  3ACL A;  2RVA A;  4QPW A;  1NA1 B;  1UMH A;  2GP3 A;  2VZS A;  1CAX A;  4NAM A;  4WVM B;  3PUR A;  5LEJ A;  4CCO A;  3USU A;  2RDS A;  4D6Q A;  2YBK A;  3TN9 2;  1Q43 A;  2QQV A;  2JDP A;  3KT1 A;  3RFR A;  3UGG A;  3JD7 3;  3LF7 A;  4ONU A;  1US3 A;  1W8U A;  1MVQ A;  3K3O A;  3N7K A;  4LA2 A;  4M3C B;  1TMF 1;  2DBI A;  4XZP A;  2OUH A;  3AXD A;  2VBP A;  5CBL A;  2UWB A;  2VZ1 A;  2CGN A;  2DUR A;  4QDQ A;  1RVF 1;  4QHB A;  4NPM A;  4CZS A;  3M7A A;  1BCX A;  3AP7 A;  1RXF A;  4HBN A;  1W8T A;  1UCX A;  2F6B A;  2PHD A;  1RHI 3;  2H0B A;  3O7O A;  4NRM A;  4WVZ A;  4DB5 A;  4D6R A;  4Y1Z A;  1EAH 3;  3K4D A;  5A33 A;  1VLN A;  4LLF A;  5L9R A;  3H1W A;  4AVT A;  1C28 A;  3SCH A;  3AYD A;  5GKA C;  1ONA A;  3VL8 A;  2VCC A;  5DZF A;  1GOH A;  2DVB A;  2XJS A;  1BVP 1;  1SZB A;  1Y7B A;  1V9U 1;  2DYC A;  2VL4 A;  2YC4 A;  2BGC A;  2XVG A;  3MHZ A;  3NRU A;  1RMU 3;  1ZA4 A;  4K9S A;  5DQ0 A;  5F9T A;  2QZ2 A;  1SAC A;  2BVV A;  2HEV F;  2VOV A;  5ISL A;  1MQT B;  4HT1 T;  4TLF A;  5ANQ A;  3WDT A;  4BXS V;  2JD9 A;  1LOG A;  2QQO A;  4FQZ A;  1NCR C;  1FX5 A;  2LUW A;  4BQ5 A;  4LKE A;  2ZS6 B;  3MIG A;  3O1U A;  2F4L A;  2YBS A;  3OB8 A;  1MS4 A;  3WHT A;  4A42 A;  1IG3 A;  1FPN 2;  2YY1 A;  3LEM A;  3QOP A;  1MZ6 A;  5BNN A;  5FTT C;  1US2 A;  1VE0 A;  3CF6 E;  5EP9 A;  1R08 1;  4LBJ A;  3WG1 A;  3VV1 A;  4P9G A;  4QMA A;  4Q0P A;  4RL7 A;  3FZ3 A;  4K21 A;  2E31 A;  1WCQ A;  2HWB 3;  4Y4R A;  1UZZ A;  1ZBA 2;  4ZS2 A;  4YVS C;  1NCR B;  1PGL 1;  1WZX A;  1F35 A;  2R04 3;  4XHB A;  3POG A;  2D3P A;  4ZHN A;  2PHL A;  4LO8 A;  4HXC A;  1DYP A;  2GNB A;  5AFB A;  5FV3 A;  4AQ6 A;  2YV8 A;  2OA2 A;  4YWA A;  2Q8C A;  4DO0 A;  3ACF A;  1G8W A;  5F5C A;  1FAY A;  1OXC A;  2GU9 A;  4IV3 A;  2ETE A;  4L8Q A;  2A6V A;  5L36 A;  1OUS A;  3W5N A;  4OHW A;  2PHW A;  2PAE A;  4D94 A;  4YVS B;  5A3T A;  1X33 A;  2D6N A;  3VDB A;  2ZBJ A;  4YM2 A;  3WF2 A;  4U2A A;  3ZN6 B;  1HRI 3;  5JMO A;  4BA6 A;  3SKJ E;  2XL7 A;  4UFL A;  2BUK A;  1HLC A;  4Q2F A;  3BKZ A;  1MS1 A;  3N35 A;  3POS A;  2WFF 2;  3RG0 A;  4RFR B;  1UU5 A;  1AF9 A;  1UMI A;  1F5J A;  1HV1 A;  4GZ9 A;  4URT A;  4D3W A;  2A5Z A;  2OVU A;  2OYZ A;  2LS6 A;  3VHR A;  1A3K A;  2D7F A;  1WCU A;  3T2O A;  2BNN A;  2FDH A;  5FY7 A;  4Z2A A;  2XG3 A;  1TNF A;  4X8P A;  3ZSM A;  1ZVF A;  5HBA A;  4LBQ B;  2BWA A;  2CHH A;  1M4W A;  3FJS A;  1KEX A;  4MET A;  3SMH A;  2QDR A;  1TG7 A;  4CDW C;  3DGT A;  1OPM A;  5JLV A;  2JDH A;  1RUN A;  3GCW A;  3MUY 1;  1Z7S 1;  4PI2 A;  4S2D A;  4AAX A;  3KGZ A;  2DUQ A;  3ZFE A;  3B01 A;  5K0U A;  1DGW A;  4WM7 C;  3ZLI A;  4H7L A;  2C26 A;  2W1U A;  4Y33 A;  2D93 A;  1K42 A;  1H4H A;  5T55 A;  4EJR A;  5BNO B;  2D6K A;  4DXR A;  4DS0 A;  1VBD 2;  4FOQ A;  4I30 A;  2W0X A;  3USS A;  4BK4 A;  3LA7 A;  4NJ4 A;  2HJI A;  2H6B A;  4D0Q A;  2QCS B;  5FOB B;  3CLP A;  3KT4 A;  4RD7 A;  2VMF A;  3HPN A;  2QUO A;  3IIA A;  3NWK A;  1O59 A;  4LR4 A;  1QJU 1;  1UOB A;  3K46 A;  3MYX A;  1AX1 A;  1F15 A;  5I0T A;  3O1M A;  4QPG C;  4Q4X 2;  5IVC A;  4M0H A;  3GDB A;  2X53 S;  5C8W A;  3ZXF A;  1Z7S 3;  2OT7 A;  1WCS A;  4LNV A;  5LEK A;  3P5B A;  5CFD C;  5IK4 A;  2J1V A;  1UKG A;  4XFB A;  2GP5 A;  3GZU C;  4JRA A;  1WLC A;  3NJZ A;  4JKL A;  5FPU A;  4PHZ A;  4N43 A;  4XUQ A;  1KJL A;  4BQ2 A;  1MEC 3;  1VAK A;  3ATG A;  5DXD A;  1B09 A;  1DZR A;  2X10 A;  4COV A;  1JUI A;  4PT6 A;  3ZX7 A;  3BTA A;  4BDV B;  2UU8 A;  3ZYG A;  4P9J A;  5F3G A;  4QPG B;  4UFI A;  5FZD A;  4B7K A;  1WA6 X;  1CX1 A;  2D6P A;  4X8N A;  1PZ9 A;  4QKD A;  4UFK A;  1GNY A;  1POV 1;  2BOI A;  4IV1 C;  1BBT 3;  3POJ A;  4YW7 A;  1V6M A;  3NJY A;  4CCK A;  2DCT A;  1CVN A;  5CB7 A;  5EYY A;  1O4Z A;  4P08 A;  3T0A A;  2YG0 A;  2WA4 A;  3ZR5 A;  4JHZ A;  1DIW A;  4LOR A;  4R52 A;  5F2W A;  5FY1 A;  3GBW A;  2C4X A;  4M3C E;  1VR3 A;  2HKX A;  2JE9 A;  1WW5 A;  3Q8B A;  4IV1 B;  4K3U A;  3PVB B;  1LTE A;  3QD6 A;  5M0T A;  3QBQ A;  4Q4W 1;  4LOS A;  4GWN A;  3JZV A;  3LAG A;  2BBA A;  3UL2 A;  2C9A A;  1KS4 A;  4OFG A;  1A6C A;  2WZP P;  4F83 A;  3VBS A;  2W68 A;  3PHM A;  3OTF A;  4JGZ A;  5CEH A;  4I3G A;  3KMH A;  4Y4Y A;  5CYY A;  1LKN A;  1VRH 1;  5HV0 A;  4A3Z A;  3RPQ A;  2C0Z A;  2OQ6 A;  4GMP 1;  4W8J A;  5DN2 A;  4CP9 B;  5FPZ A;  4E4D X;  1GWK A;  3KHB A;  5J96 B;  4Y3O A;  2WS9 1;  4N7U A;  3N36 A;  3T4V A;  4CCL A;  3ZOI A;  3PUI A;  2DVG A;  5C9A C;  1PO1 2;  5DUW A;  5F8P A;  2VH9 A;  3TOJ A;  4DXZ A;  3KS7 A;  5C8C B;  3PVE A;  2AGS A;  2XJU A;  3JBG 2;  3K3N A;  1HB1 A;  5L9B A;  2CAU A;  5A3U A;  4OCT A;  1F2N A;  4NHX A;  5CAZ A;  1H30 A;  3RI9 A;  4RS5 C;  4LT5 A;  3C7G A;  2Q1M A;  1C4R A;  3RNS A;  4JTN A;  5FYH A;  5JDB A;  2HWF 1;  2Y6L A;  3PDQ A;  3GXU A;  1N47 A;  5C9A B;  2ZX1 A;  1BEV 2;  1CAU A;  3VKO A;  3LA2 A;  5LWB A;  1NZI A;  3TN9 1;  3KCC A;  5C3S A;  2EAA A;  1WME A;  2PAK A;  1O4T A;  3OBZ A;  2E51 A;  3SHR A;  4KQ7 A;  3CDZ B;  1IS3 A;  5CIS A;  4BME A;  1S1A A;  3E6B A;  1PMH X;  5L9V A;  2WII B;  1ZZ7 A;  1YUD A;  2KM2 A;  4M4R A;  4CDQ C;  1G9A A;  3IMN A;  1VBC 3;  1W2O A;  2R07 3;  2JDY A;  1VBA 1;  4BQ1 A;  3WDW A;  1XBF A;  2E53 A;  3KF3 A;  3T08 A;  3PME A;  1OQE A;  4MHU A;  2WO2 A;  3NV1 A;  1LES A;  1Q8Q A;  1Y3T A;  5J36 A;  4FPJ A;  2CSG A;  1GQG A;  2OZJ A;  1K45 A;  4QX5 A;  5DDJ 1;  1ND2 A;  1JOJ A;  1NLQ A;  1WWY A;  3HN3 A;  2EXK A;  1YLL A;  1HRV 2;  5FMD A;  5LB6 A;  1ZBE 1;  4RN5 A;  1KIT A;  3HR9 A;  1RUF 2;  5L7O A;  1HQL A;  4XAA A;  3MIC A;  4CDQ B;  4CU6 A;  1AR9 3;  2BNO A;  3ABZ A;  2W1W A;  5ABJ C;  1XYP A;  3N9Q A;  1GWL A;  2NPI A;  2FD8 A;  5FZ0 A;  5AFE A;  3TYJ A;  1WMX A;  2HEY F;  3KQ4 B;  1ZRD A;  2ZX2 A;  4WBB A;  5T5O A;  2AEY A;  1WMD A;  3AFK A;  5JI7 A;  4LHS A;  4CPB A;  4A41 A;  2W47 A;  3WW3 A;  2P2K A;  5T54 A;  1LGN A;  2W1S A;  1C8M 1;  3H3U A;  5KC5 A;  3ZDV A;  3O1R A;  1EUT A;  1W3V A;  3AMM A;  1H1M A;  1WKY A;  5A32 B;  1VBA 3;  5FZI A;  2WZE A;  1XPW A;  1NYW A;  2PHR A;  3B9C A;  1OUR A;  3NNF A;  2A73 B;  4UT5 A;  3RMX A;  3MLK A;  5DDJ 3;  2OZ6 A;  1ZZ8 A;  2YPD A;  2EXH A;  4BQ3 A;  4Y5Z 0;  3SIT A;  5DMY A;  1ZBE 3;  4W6X A;  4XAC A;  5GLU A;  1ASJ 2;  1V6K A;  3AB0 A;  1EYB A;  3FFQ A;  3ZXK A;  2E33 A;  4BLJ A;  2VUA A;  2WQ8 A;  4KWU A;  3G6J B;  2JKX A;  1OHF A;  1PK6 C;  3FHI B;  3K77 A;  4RSU A;  4FCA A;  3HT2 A;  4TYS A;  4XF9 A;  3O1P A;  3E6C C;  3ZYJ B;  3WEZ A;  1XND A;  1AL0 G;  2XKO A;  4XCA A;  2WFF 1;  3V65 A;  3WQB A;  2R06 2;  2W2I A;  5A3N A;  5CA6 A;  1DLC A;  3ELN A;  4GA9 A;  1ZM1 A;  3N3H A;  1JHJ A;  3RWK X;  2Z5W A;  3LDK A;  2GME A;  4FPC A;  5F2S A;  4A3X A;  1M06 G;  3N9L A;  2ZAB A;  4A44 A;  3K48 A;  2VTF A;  4PLM A;  1QJE A;  4AFB A;  5F1R A;  1PK6 B;  2HWC 3;  1UAI A;  5BYN A;  2IWG B;  4QHZ A;  4CUG A;  4Q4V 3;  1ZYB A;  3LWC A;  1YFU A;  2V4V A;  5FK8 A;  4HN1 A;  5FWE A;  1SFP A;  3H8O A;  4R9B A;  2WUH A;  2KA3 A;  3NV4 A;  1H2N A;  2HWD 2;  4YGE A;  4LHN A;  4QWN A;  3OBT A;  1UN1 A;  1AL2 1;  2EXI A;  4BU2 A;  1LOC A;  4R4X A;  1UW8 A;  1JZ6 A;  1PIV 3;  4AHW A;  1RUH 1;  2VVD A;  2DCK A;  4P5Y A;  1UF2 C;  4V2V A;  3VKM A;  1QH6 A;  2ADD A;  1LGB A;  3ZFE C;  3AYC A;  4CSW A;  4CYD A;  4B29 A;  4I02 A;  1VPH A;  4CPB D;  1K3I A;  5K0U C;  1D2S A;  4MOA A;  5JXJ A;  3WNK A;  2VCM A;  2UWA A;  3MIF A;  4R9D A;  1YIP A;  4JV4 A;  4E8C A;  1IGO A;  4P5H A;  1LJ7 A;  4LIU A;  5JPM B;  2YC2 A;  5H9S A;  2ZGK A;  2CU5 A;  4NIA A;  4GH4 A;  3O1T A;  1RHI 2;  2ORZ A;  3CBN A;  1PNG A;  2IXJ A;  2VQ0 A;  4CXX A;  5FO8 B;  1V0A A;  5AVA A;  4AOC A;  4OLL A;  3W58 A;  5EYX A;  5A7W B;  4XXP A;  3ZSK A;  1GMM A;  4NWV A;  4A7Y A;  1EV1 3;  4Q4X 1;  1OD3 A;  2WSU A;  1VAV A; 
#chains in the Genus database with same CATH homology
 2HLE A;  2ZXQ A;  2ORX A;  1UXX X;  2ID4 A;  2J1E A;  3K4A A;  1JYV A;  1F4H A;  1P8J A;  3I2G A;  1SHW B;  1W8N A;  3SKV A;  3U37 A;  2VMD A;  1NKG A;  2BGP A;  5B4X A;  4L0P A;  3VD5 A;  3THC A;  4A45 A;  5A1A A;  1D7P M;  3NJX A;  5LCW L;  4YPJ A;  1OH4 A;  3WSO A;  4D8M A;  4DXT A;  3III A;  5JXI A;  3IAP A;  4CU9 A;  3BGA A;  2QQN A;  2X09 A;  3I3B A;  3OG2 A;  1ULP A;  5IYY A;  3HOB A;  1EUU A;  3UET A;  4W50 A;  2L9L A;  2VQU A;  1XNT A;  4BJ0 A;  3UES A;  4LPL A;  2Y8K A;  2DDU A;  2VCB A;  5J1X A;  2QQK A;  3I97 A;  4XZU G;  3T09 A;  1XNA A;  2DCJ A;  5IHR A;  3WF4 A;  2WO3 A;  1HN1 A;  3PUH A;  2WN3 A;  3CIH A;  1UY3 A;  4CUA A;  3WNM A;  4DEV A;  4DUW A;  1JZ7 A;  1W9S A;  2HYX A;  3FHA A;  1JU4 A;  2VZQ A;  3P6B A;  2E32 A;  4JKK A;  3P1I A;  3ZM8 A;  4CU7 A;  2B9V A;  3J7H A;  1UYZ A;  3UNP A;  2Y6G A;  1F4A A;  4QX2 A;  2PQS A;  2B4K A;  1UY2 A;  4JKM A;  5CZK A;  3HNB M;  4LKS A;  1JZ3 A;  2W9X A;  1UY4 A;  3DYO A;  3VD7 A;  1NAE A;  3IDA A;  3OEB A;  2RVA A;  3LEG A;  2VZO A;  1UMH A;  2JE8 A;  2VZS A;  3OGR A;  4QPW A;  3A21 A;  2J1A A;  4FI9 A;  4XUN A;  1JYN A;  3JXS A;  3MO4 A;  2XON A;  3AC0 A;  2VZ3 A;  1US3 A;  1SG3 A;  1IQD C;  1PMJ X;  2VZ1 A;  4QDQ A;  3C8X A;  1W9W A;  5DPN A;  1CIY A;  3K4D A;  1JYW A;  1GUI A;  1W9T A;  4QB2 A;  2QQJ A;  2VCC A;  1GOH A;  4XVH A;  2VL4 A;  1YQ2 A;  2YC4 A;  1UY0 A;  3NRU A;  5DQ0 A;  1H6X A;  1GU3 A;  5JUV A;  3BN6 A;  4BXS V;  3THD A;  5F7U A;  2JD9 A;  2QQO A;  3K4Z A;  3LPF A;  4OUE A;  4KMQ A;  4BK5 A;  5HXM A;  4UI9 L;  1L7R A;  1DYO A;  3OB8 A;  4A42 A;  2ZEX A;  3CQO A;  4RYD A;  5EJ1 B;  1US2 A;  2QQI A;  4OYU A;  4QAW A;  2X05 A;  2W91 A;  3I2F A;  3SEP A;  2Z4F A;  2E31 A;  1WCQ A;  1PX3 A;  2BER A;  4OMC A;  3WNP A;  2W46 A;  4QB6 A;  3I2J A;  1L7Q A;  4XUP A;  1TVG A;  3IAQ A;  3ACF A;  3A7Q A;  3CKH A;  3OGV A;  3VD9 A;  3MUZ 1;  2W1Q A;  1K12 A;  3W5N A;  3ACH A;  1NUK A;  3VDB A;  5LA1 A;  2Y6K A;  3WF2 A;  4CU8 A;  5JMO A;  3SKJ E;  3HNM A;  4QDS A;  4QB1 A;  4UOJ A;  1GOF A;  3W5M A;  3C7F A;  1UMI A;  2VO5 A;  4GZ9 A;  2J1U A;  2VM9 A;  2LS6 A;  4QX3 A;  4TXW A;  4ET7 A;  2WAO A;  1MPX A;  2VQT A;  3T2O A;  1NX9 A;  3NQH A;  4P00 B;  4Z2A A;  5LA0 A;  3HEI A;  4GWI A;  3VD3 A;  1XC6 A;  3FN9 A;  1KEX A;  1TG7 A;  3DYM A;  3MUY 1;  4DEQ A;  4AAX A;  1UWW A;  1CZS A;  2XQX A;  3C7H A;  3WNN A;  2QBX A;  1UXZ A;  2W87 A;  5FUI A;  1O8S A;  2C26 A;  3CMG A;  2W1U A;  3LQC A;  3SEE A;  3VDA A;  3K75 B;  1K42 A;  4XUR A;  4P02 B;  2QQL A;  2Y6H A;  4DXR A;  2VME A;  4QDR A;  4BK4 A;  4D0Q A;  2WAA A;  2VMF A;  3T0B A;  2J7M A;  3OBA A;  3HPN A;  2YFZ A;  2WDB A;  1O59 A;  2J1R A;  3WF3 A;  3K46 A;  2W5F A;  3LPG A;  1ULO A;  1H6Y A;  2Y6J A;  3GDB A;  4IUG A;  2W95 A;  2OKX A;  2J1V A;  4E8D A;  3T0D A;  1W99 A;  5IFP A;  3I2H A;  1J84 A;  4JKL A;  4KI5 M;  4XUQ A;  3A23 A;  3ETP A;  1J83 A;  2X10 A;  3CZJ A;  4PT6 A;  3DEC A;  4ZXE A;  2EID A;  4BDV B;  4M4P A;  3E1F 1;  3ACG A;  1CX1 A;  3WNO A;  1OT5 A;  1GNY A;  2BGO A;  3IB3 A;  5IFT A;  5C70 A;  3NNG A;  3WQB A;  4W4Z A;  4A6O A;  4P08 A;  3T0A A;  2YG0 A;  1JZ2 A;  1JZ5 A;  4JHZ A;  3CZU A;  3MV1 1;  2C4X A;  3I2I A;  5C71 A;  2EIC A;  4DUV A;  2WAB A;  3HJR A;  5I0D A;  2BBA A;  2J22 A;  2J1T A;  3VDC A;  5LA2 A;  5CYY A;  5B4N A;  5IJR A;  4A3Z A;  2VR4 A;  2VZT A;  4W8J A;  5DN2 A;  3LEI A;  3MV0 1;  1RYY A;  3C7O A;  4MGQ A;  4CUB A;  5EIY B;  2XHN A;  3PUI A;  2VJX A;  1OF4 A;  2R7E B;  2WN2 A;  3GGL A;  1UYX A;  2CDO A;  3I3D A;  2WBK A;  2XOM A;  2ZEZ A;  2V5D A;  5JXG A;  2WYS A;  3C7G A;  4ZZ5 A;  2ZEY A;  2Y6L A;  1DP0 A;  3GXU A;  3WF0 A;  2VZP A;  3CDZ B;  1CZV A;  4LQR A;  1O8P A;  2VZR A;  2YB7 A;  4QX1 A;  1PMH X;  2JDA A;  4M4R A;  2C9K A;  3T2P A;  2RJ2 A;  3T08 A;  3DYP A;  3WF1 A;  2WO2 A;  4UAP A;  2WO1 A;  4HG6 B;  1K45 A;  2RV9 A;  2ZEW A;  1I5P A;  4MAD A;  4PQQ A;  3HN3 A;  5G05 L;  3C7E A;  4MO3 M;  4RN5 A;  3WNL A;  4QX0 A;  3EB7 A;  4CU6 A;  1JZ4 A;  3ABZ A;  2W1W A;  4A4A A;  4ZY9 A;  2VZV A;  4JX0 A;  1JU3 A;  1CZT A;  4MGS A;  3ECQ A;  5G04 L;  4CUC A;  1JZ8 A;  5C7G A;  4OZO A;  4LHS A;  2CDP A;  4A41 A;  2W47 A;  3I2K A;  3MBW A;  2W1S A;  4ARX A;  2VC9 A;  1EUT A;  3I3E A;  4ARY A;  1WKY A;  1BHG A;  1LNS A;  1W0N A;  2WZE A;  1XPW A;  2QQM A;  1JI6 A;  4GWJ A;  5HPO A;  1PX4 A;  2W3J A;  1KGY A;  5DMY A;  1GQP A;  2EIE A;  2VCA A;  1W8O A;  2E26 A;  3HNY M;  2E33 A;  1OF3 A;  4TTG A;  2KD7 A;  2W94 A;  3F2Z A;  2WQ8 A;  4KWU A;  2JKX A;  2VOT A;  3K77 A;  3LE0 A;  4XUT A;  3WEZ A;  2BZD A;  3ACI A;  1DLC A;  1JYX A;  2WZ8 A;  4XUO A;  3OGS A;  1JHJ A;  1UZ0 A;  1GOG A;  3OEA A;  2VZU A;  4DUX A;  4A44 A;  3A22 A;  2VTF A;  1T2X A;  4CVU A;  5JR2 A;  1UY1 A;  1UX7 A;  2YFU A;  4PF1 A;  2V4V A;  4OMD A;  2EIB A;  2WUH A;  3D3A A;  3T2Q A;  2V72 A;  2LW8 A;  3LEK A;  1JZ6 A;  2DCK A;  4P5Y A;  1SDD B;  3GM8 A;  2VMC A;  2W92 A;  1K3I A;  1UYY A;  2Y64 A;  4MOA A;  5JXJ A;  3WNK A;  4E8C A;  3FL7 A;  2YC2 A;  3FHQ A;  3NJV A;  2ORZ A;  4ZZ8 A;  5EJZ B;  4AG4 A;  3VD4 A;  3EYP A;  1GMM A;  2J1S A;  1R64 A;  1OD3 A;  4DXS A;  5JXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...