4GWJA

His 62 mutant of the lectin binding domain of lectinolysin complexed with lewis b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
PVETENIARGKQASQSSTAHGGAATRAVDGNVDSDYGHHSVTHTNFEDNAWWQVDLGKTENVGKVKLYNRGDGNVANRLSNFDVVLLNEAKQEVARQHFDSLNGKAELEVFFTAKDARYVKVELKTKNTPLSLAEVEVFRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Platelet aggregation factor Sm-hPAF
publication title Manipulating the Lewis antigen specificity of the cholesterol-dependent cytolysin lectinolysin
pubmed doi rcsb
source organism Streptococcus mitis
total genus 38
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4gwjA00
3J7HA 4ZXEA 4ET7A 1XC6A 5JXHA 2W1SA 2J1AA 3MUY1 3SKJE 3WNLA 3C7HA 3DYPA 4LPLA 4QB6A 4CU9A 2XOMA 2VZRA 3MO4A 3IIIA 1BHGA 5CZKA 1L7RA 3HOBA 1K12A 3GDBA 3NRUA 5DQ0A 3OG2A 3C7OA 4L0PA 3K4DA 2VM9A 3K4AA 3C8XA 5DN2A 1US2A 3CMGA 5G05L 3MUZ1 4GWJA 4DXTA 1XNTA 1JYNA 3WNKA 2VTFA 3IDAA 5LCWL 2JDAA 4D0QA 4A6OA 5B4XA 3PUIA 1RYYA 3A7QA 3ABZA 2QQMA 2V72A 1K42A 2Y6LA 1DYOA 3WNPA 2WBKA 3E1F1 2VZQA 1HN1A 2JKXA 4XURA 1ULPA 3ACFA 3FL7A 3THDA 3ETPA 1OH4A 1EUTA 1UMIA 1NKGA 3EYPA 2C26A 3CZUA 4CVUA 5J1XA 4TTGA 4A44A 3T09A 4ARXA 3FHQA 4W50A 3SEPA 3K75B 3ACGA 2ORZA 2YB7A 5HPOA 2W87A 3T2QA 4PF1A 3THCA 1JYVA 2BGPA 3MV01 3CZJA 5EIYB 2VZ3A 4W8JA 3I3BA 2QQKA 1DP0A 2W3JA 1GOHA 5C71A 1OD3A 5JMOA 4XUQA 1JZ2A 1NUKA 2X10A 4LKSA 3SEEA 5A1AA 3T08A 2VZPA 2VR4A 5I0DA 3NJVA 2HYXA 2VQTA 2B4KA 5LA2A 4OUEA 2QQIA 3LPFA 3W5NA 1WCQA 3IB3A 2R7EB 4XVHA 2QQLA 3SKVA 3IAPA 1PMJX 3WF1A 3LQCA 4ZZ8A 2WN3A 3P1IA 2BGOA 4JKLA 5B4NA 2W9XA 3CQOA 2VZSA 1JZ8A 2W46A 4OMCA 5FUIA 2DDUA 3I2HA 3ACIA 2YC2A 1W9TA 2ZEZA 4MADA 1CZSA 3I2IA 2Y6GA 3NJXA 1UMHA 4D8MA 3CIHA 2BERA 2ORXA 5F7UA 2J1EA 3OB8A 2VMCA 2VCCA 3PUHA 5CYYA 3VDAA 2W1UA 1JZ4A 2XQXA 1IQDC 1CX1A 4OMDA 4UAPA 1JYXA 1UY0A 4PT6A 4MGSA 4OZOA 1UWWA 1F4AA 3D3AA 5JXGA 1JZ3A 3HNMA 5EJZB 1W99A 3NNGA 3HEIA 2VL4A 4DUWA 4QDQA 3AC0A 2Y8KA 1CIYA 4QX3A 1DLCA 4E8DA 3BN6A 3T2PA 1UY1A 2X09A 4BJ0A 1KGYA 4DEVA 3OBAA 1KEXA 3UESA 2W91A 5JUVA 2ZXQA 3VD3A 1PX3A 1UX7A 4CU7A 4P08A 1OF4A 2WABA 5DPNA 2OKXA 2W5FA 3I2FA 3VD7A 1O8SA 3I2GA 1H6XA 3WEZA 1UY4A 3DYMA 5DMYA 2ZEXA 4Z2AA 4DUVA 2VZTA 4P02B 3VD4A 3WF2A 4P00B 4MO3M 4A3ZA 5JXJA 3T2OA 4AAXA 2J1VA 2ZEYA 3VD5A 5JR2A 2KD7A 1UY3A 3VDBA 4BK4A 4CUBA 2Y6KA 2WO1A 4PQQA 2VMFA 1XNAA 4A45A 4JX0A 4FI9A 4ZZ5A 1W0NA 2XHNA 3OEAA 1W9SA 4DUXA 4XUPA 3CDZB 4KMQA 3LPGA 4UI9L 1O8PA 2W95A 3WNMA 2QQNA 3WF0A 3OEBA 3WSOA 4HG6B 2CDPA 2VQUA 2J22A 1ULOA 4ARYA 1SG3A 2J7MA 2WO2A 4JHZA 1GMMA 2EIBA 1WKYA 1H6YA 1NAEA 1J83A 3HNYM 1SHWB 3F2ZA 1OT5A 3HN3A 2QBXA 2Y6JA 2WAOA 3I3DA 1L7QA 3GXUA 2WAAA 2JE8A 3T0AA 3LEKA 1GOFA 5LA0A 2C9KA 2WUHA 4QX0A 2WQ8A 5C70A 4QPWA 2VZUA 1UXXX 2J1UA 5IFPA 2E32A 2VO5A 2C4XA 3WQBA 4BK5A 1CZVA 4KI5M 3I2KA 1K45A 3A22A 1JZ5A 2BZDA 3HNBM 3HJRA 1JHJA 1JU3A 3WF3A 4QX1A 2E33A 3C7FA 4XUNA 4LQRA 2W94A 3WNOA 5C7GA 4XZUG 3W5MA 1W8NA 3IAQA 3GM8A 1OF3A 2YFUA 1GU3A 1O59A 4A42A 2WZEA 2LS6A 2WN2A 3CKHA 2B9VA 2ZEWA 1NX9A 2CDOA 3JXSA 2L9LA 2EIDA 2XONA 1UXZA 4OYUA 2VZOA 4A41A 4RYDA 1I5PA 1K3IA 2WDBA 1F4HA 1UYYA 3A21A 3DECA 2PQSA 3VDCA 2J1RA 1R64A 3MBWA 5G04L 3K77A 2J1TA 2EICA 4IUGA 4QX2A 1J84A 2DCKA 3I2JA 3UNPA 2VZVA 1EUUA 2W1WA 1JZ7A 1YQ2A 1US3A 4KWUA 4BDVB 1P8JA 3OGRA 3WF4A 4M4PA 4DXSA 4JKMA 2BBAA 4ZY9A 4CU8A 2Z4FA 4BXSV 3WNNA 3EB7A 1JZ6A 4M4RA 4W4ZA 5IFTA 4GWIA 2V4VA 3ECQA 1JU4A 3LEIA 3GGLA 5EJ1B 3A23A 3U37A 3FN9A 4RN5A 5IJRA 3T0BA 4MGQA 4AG4A 3BGAA 2QQOA 1SDDB 3C7EA 2VCBA 2ID4A 1LNSA 3MV11 4QDSA 3ZM8A 2VMDA 2VCAA 3C7GA 4E8CA 1MPXA 3HPNA 5LA1A 2LW8A 1UY2A 2J1SA 1T2XA 1GNYA 4XUTA 3T0DA 1UZ0A 4MOAA 1CZTA 1TVGA 3K4ZA 5HXMA 1D7PM 2VZ1A 4QAWA 3I97A 3I3EA 3LEGA 4A4AA 2V5DA 2E26A 2HLEA 4CU6A 3UETA 2WZ8A 2YFZA 1PMHX 2EIEA 2WO3A 2W92A 4CUCA 5IYYA 3ACHA 4P5YA 1W8OA 2Y6HA 3DYOA 4QDRA 1UYXA 1TG7A 5JXIA 4GZ9A 2VC9A 1PX4A 1GQPA 4JKKA 2VMEA 4TXWA 4QB1A 3OGVA 3K46A 2WYSA 2RJ2A 1W9WA 2DCJA 1GUIA 3FHAA 3OGSA 2VJXA 2W1QA 4CUAA 1UYZA 1JI6A 2QQJA 1JYWA 2W47A 4QB2A 3VD9A 2VOTA 2YC4A 2YG0A 2E31A 4UOJA 2RVAA 2X05A 2Y64A 2RV9A 2JD9A 5IHRA 4DEQA 3P6BA 3NQHA 4DXRA 4LHSA 3LE0A 1GOGA 1XPWA 4XUOA 4YPJA
chains in the Genus database with same CATH superfamily
3J7HA 4ZXEA 4LTAA 3FFQA 3KWVA 3TRSB 5JXHA 1HV1A 1LOFA 4CDUB 2VULA 3PHMA 1LESA 1WD3A 2VOXA 3PNAA 4LPLA 3HT2A 4QB6A 4YGEA 4CU9A 3POJA 4L2NA 3NV4A 1FNYA 1SLLA 4XF4A 1AR82 1RUH1 2XKPA 1F2NA 1C1FA 5LY2A 4AFAA 1L7RA 5C8WA 1RUNA 3PVEA 4XDPA 4CXYA 1K12A 3RYRA 2JICA 3OG2A 2RS13 4L0PA 3J4UH 4XW3A 2H0BA 3VBOC 4AVBA 4JQTA 2CNAA 2OS2A 4AEJA 2XL9A 1LR5A 3MZHA 4K1YA 3A0NA 3S7IA 3IZOA 3WHUA 1OVPA 5HCHA 3IIAA 1W8HA 1WGPA 4JHTA 4OVEA 2B5HA 5IAVA 4CCNA 5DDJ1 1W6QA 1VBC1 4C1WA 4O65A 2LALA 4YLZA 5E1RA 4C0HA 5JSOA 1PGL2 3WQ0A 1OPOA 2AEZA 3IDBB 2DU0A 3MICA 4A6OA 2RJLA 3ILRA 5ANQA 5CU1A 3VZKA 4MG2A 1EAH1 2XUMA 5GLZA 4DY3A 1RYYA 2QQMA 1UMZA 1H30A 1E5HA 1NZIA 1AL23 2WNUB 2Y6LA 1XYNA 1S0IA 3KT4A 4GMP1 4PIZA 2Q8CA 2MEV2 1CAWB 1MACA 2VZQA 3USUB 4G4FA 1HJGA 1OH4A 3NAPB 1HX6A 1UMIA 3BUCA 4OZXA 3NNMA 4Q26A 5J1XA 2ARCA 3HQRA 1WW6A 4CCMA 4P9JA 5J37A 2F17A 3H7JA 3ZIWA 3SEPA 5E6HA 2UY9A 4FPHA 2ORZA 4Y1XA 5HPOA 5J7MA 4G3YC 5KXBA 3O1SA 5LASA 2W87A 2P3KA 3G6JB 1PVC3 4L99A 3UGGA 3RGBA 4WVWA 1JYVA 4FP3A 4QPGB 1MR5A 3O5SA 1NE6A 4HVQA 3ZPYA 3K2OA 3V56A 3WHTA 5BNPB 2WL1A 3MPBA 1SACA 1EPZA 5IK8A 3I3BA 4PLOA 1HB1A 1GOHA 4INDA 2HWE1 1AUYA 1ZRIA 2CGOA 3LA3A 5GLTA 5C71A 2ARBA 2ZHNA 4XUQA 1GZ9A 2GSYA 4BMBA 1LHWA 3ZOIA 2TBVA 3LCPA 1JH5A 1I6XA 1HRI3 1C8M3 2OZJA 2X10A 4JRAA 1QJZA 3OJBA 3SEEA 1C8NA 3OTFA 5I0DA 4UW6A 2PMWB 2HYXA 5DAXA 4B4PA 4WBBA 1PK6C 3OD4A 2PQQA 4AQ2A 3AXDA 1WCQA 4XVHA 4AQ6A 5C4WA 3SKVA 2VNRA 4S2FA 2BUKA 3U1XA 2K0GA 5JSPA 5GZGA 1FOD3 1Z7S1 2RMU2 1KDMA 2WNUC 2XJTA 4XDOA 2BGOA 1QJU3 3CQOA 5ACA1 2GH8A 3SCGA 1LAJA 3C2UA 1FPN1 3NAPC 1F15A 1VP6A 2R6QA 2UYBA 3AFGA 5L73A 3N9QA 4GULA 4L8QA 5APAA 5FO8B 4JGZB 3RRDA 2ZEZA 3I2IA 2Y6GA 3KCCA 4Y4RA 2QZ3A 1DZRA 3JQXA 3ZN4A 5C9AB 1AXYA 4MVTA 1OXCA 3O0VA 2ORXA 3P5BA 5F6LB 4RS5B 3RJRA 5F7UA 4XTMA 1B35A 4YGBA 1NY71 1W3VA 4KWJA 1D2SA 3OB8A 3Q8EA 2FQPA 2IXLA 2VMCA 5T5JA 2NM1A 4XFHA 2NN8A 1Q43A 4WM8C 4QPIA 2ZACA 4QPGC 2JDPA 4BYYA 1HQWA 1TME3 4NHMA 3I3MA 1YC61 1E57A 2X29A 4OMDA 2OUHA 5FWJA 2GC0A 4Y1UA 1BKZA 3CNAA 4FPCA 2RS11 1JZ3A 3HNMA 2X5IA 3J26N 4YM3A 1UYPA 1YFXA 2Z2SB 1NCQB 3NNGA 3HEIA 3R05A 2VL4A 1RUE2 4R9DA 3V65A 4DUWA 3E5XA 4QDQA 3VBSC 2XBO3 3AC0A 4ZHNA 1CIYA 3OBZA 2BDRA 3N9LA 3O1RA 4YVWA 1AJKA 2JECA 3T2PA 2MNGA 4LO7A 1MZFA 1A8DA 2X09A 2XVGA 4Z07A 2BGCA 2E9QA 2A6XA 3LSDA 3SH5A 3WX5A 2RS53 4Q0VA 1COV2 4HK8A 3OBRA 1RUI2 1N1VA 3UESA 2W91A 1V0AA 1UNBA 5SV8A 3WDTA 1UX7A 4XBLA 3JBG1 2EA7A 5IUQA 2CAUA 5EYYA 1V00A 2ZX4A 4X8NA 1HRV1 2OKXA 2JWPA 4LXLA 3JB4C 4EN0A 3VD7A 1O8SA 2VY0A 2RDSA 3I2GA 3WD5A 3ZFGA 4NAMA 3RWKX 5FR3A 4F3JA 1WLCA 1EP0A 4EWDA 2IVIB 1IPJA 3PJQA 1SBFA 3BKZA 1C5HA 3K3OA 1RUD2 3QH6A 2XB6C 4MO3M 1X36A 4UFKA 1BVP1 3S57A 4AAXA 1RITA 1OA2A 5FZFA 1UY3A 1KJRA 1ULGA 4TWTA 3N9MA 3BIWE 1JYTA 4M3CA 3PVNA 3B5LB 3K51A 3POIA 3ATGA 2D98A 4A45A 3HMYA 1R1ZA 2LTNA 4ZZ5A 1OLQA 5JOWA 5EV7A 5J09A 3EBRA 3POBA 2EAAA 1SDWA 2K2SA 4XUPA 1S2BA 4XAEA 5FZ9A 1IHMA 4CDWC 1O8PA 3HIFA 4MH0E 1HXS2 4MXWA 1YNAA 3OEBA 4S2DA 5BY5A 1GBGA 3VLBB 1LOAA 4AQTA 2VQUA 1PNFA 2J22A 1GNZA 4C0BA 5L9RA 1SG3A 4QQHA 4XCBA 2J7MA 3WDYA 1ENRA 2WO2A 5HCFA 5LEKA 1GMMA 1QXJA 2PAMA 1ONAA 4IEXA 4H3WA 4RQPB 3TBDA 5EHDA 3RI9A 5A32A 2WC2A 4NPLA 3I2OA 5M0TA 1NAEA 4C1XA 4IW3A 1ZZ9A 3BPZA 1OT5A 1S1AA 4TSVA 3ZXKA 1Z78A 1QJU1 5K7PA 5A7SA 4XYXA 1ZBE2 1D0GA 1J3QA 1J1TA 2VNOA 2ZMKA 3AMQA 3B7MA 1QH7A 1LB2A 4IEZA 4YVSA 2WAAA 3H1MA 3QD6A 2Q30A 3WDXA 4AVCA 3Q9OA 4I02A 4FPOB 4IGOA 3WG4A 2NP0A 3W58A 2V5YA 3NNJA 1RTVA 3J8F1 1DQ4A 4P14A 1X9PA 1CAUA 2WQZC 4LMFA 3B94A 1YWKA 3ZFFA 4QX0A 1G9AA 5JZGC 4B3NA 3TN93 1TMF2 1SLAA 4NHXA 1XE8A 2VZUA 2ZGUA 5LA9A 5C33A 3SH4A 3GALA 1NLQA 2VO5A 3AZZA 3O1UA 4GB32 3WLUA 4K9SA 1HV0A 1K45A 3A22A 1CR7A 4IEUA 4QXKA 4Q4V3 5DABA 1V6JA 2BZDA 5T5OA 1NA1A 1PMIA 5FY5A 5FKBA 3AKQA 4FQZA 2MHFA 3C7FA 5I93A 3N7JA 4BZ4A 1FMD2 2ZX3A 3VKNA 2W94A 2Q8OA 4Z2WA 4XF9A 2BVBA 1REFA 4XZUG 3RMYA 1W9FA 4Z8BA 1DHKB 3ZDVA 2XBO1 4NO4A 4IESA 1AYM3 1OF3A 1GU3A 4KNCA 4LBKA 4LBQD 2PHDA 2WZEA 1YI7A 1UU6A 4YM1A 3T2TA 5CAZA 1UZZA 3MI8A 4DMIA 2WN2A 2H6CA 3B01A 4K3UA 4JQRA 4RQPC 3V0BB 4LLOA 2EAKA 2ZEWA 1IPSA 2RS51 4XIOA 5C8CA 4LBJA 2BVVA 3VKLA 1EV11 4HL0A 4CP9A 5FLHA 2XONA 4XXAA 4MZUA 2WLQA 2PLV1 3OOXA 2K46A 5FZ6A 5F2SA 4IEWA 1Q8QA 5D21A 4NE9A 1NXD1 1RUC3 3E6DA 5JOZA 5KXCA 1I5PA 3LDKA 4IL7A 4COWA 4COYA 4LUKA 5E89A 4LEJA 5FMOS 1VRH3 2WDBA 4XHXA 2WIIB 1VE0A 2C6SA 4UFHA 4XJ8A 3UGFA 4FOVA 3ZYGA 4CDXA 4OCTA 4CCOA 1MVEA 2PQSA 4CEYB 3VDCA 2IXIA 3KCXA 4D7TA 1R64A 1YQ8A 1AJOA 1AYN2 3H1YA 1BK0A 3ME2A 2CV6A 2YMZA 3Q8BA 3CJIC 3K77A 3ZIXA 1UKGA 4GH4B 4Q0UA 2DV9A 2D93A 1QXRA 1UOGA 3VL9A 3I2JA 1ULFA 5ACA2 1WZXA 3M3EA 4IEPA 4HOOA 4BQ2A 1MQTC 5FZGA 3VZOA 4EN8B 5JSRA 3UNPA 1EUUA 1QOSA 1W0PA 2P3IA 2R042 5EP9A 3ZYPA 1OOPB 1US3A 1V6MA 4BXFA 5JI9A 3KV4A 3PUQA 4E9KA 4Y20A 5ABJC 1KITA 4SLIA 4JDOA 3WF4A 1Q8OA 3NMBA 4DXSA 1HB2A 3AYEA 4UYBA 2X8KA 2ZGMA 3E6BA 1R083 4OHXA 4PCRA 3WNNA 3QBQA 4V1PA 2VNGA 4GKXA 4W65A 2IXHA 5FBJA 4GWIA 1AXZA 2EVXA 3ECQA 4MGIE 4TZDA 3DXTA 4E2GA 2WZR3 3O0XA 4BQ4A 5CISA 3ACLA 2NPIA 1Z0HA 4YW5A 3H7YA 4RR3A 5HXVA 5DUUA 3MDPA 1ND3C 4RN5A 2VOWA 4CDQA 3T0BA 3VZNA 4GIQA 2P17A 1GQGA 2TUNA 5BV6A 1NCRB 4AGRA 1OD5A 1VRBA 1YRZA 4QDSA 1OUSA 2VPVA 1NQDA 4JTOA 2VMDA 3ES1A 5K0UC 2YBPA 1RINA 4XZPA 5FZ8A 2ZJCA 3MIFA 1RUF3 3KV5A 4Z92B 3D5OA 4UBHA 1V9U2 5T5PA 1K5MB 4EQVA 1UY2A 4Y4YA 1HKDA 1T2XA 1GNYA 1NLRA 2RDNA 4PDWA 3DUIA 3VBUB 1CAVB 4CEYC 5FMDA 3KGZA 2P6CA 3SLIA 1CGPA 1S0CA 1AL22 4GH4C 4YW6A 2UURA 4J25A 3M8LA 4OI2A 3N4MA 5FXZA 4FFIA 2HLEA 5I8YA 1OOPC 1XU1A 5IVEA 1BXHA 3AKRA 4Q4V1 4QX8A 2R073 3TEZA 2ENRA 1O4TA 1PMHX 3LA2A 5CFDB 1RB8G 5GLUA 2Y6FA 3TB0A 4BQ1A 3TAYA 5LEJA 2HWD3 3RZLA 4XHBA 4CUCA 4I0WB 3ACHA 4XACA 5FZMA 1PVC2 1MEC3 1VBD1 3WP6A 3EMRA 3HD8B 1W90A 1LOFC 2PXJA 2CAVA 1M4WA 4AHZA 5T5LA 2D97A 3E6CC 5JXIA 4KH9A 2HWF1 4IV1B 3WG3A 4CCKA 3DGTA 5FZBA 5HBAA 1LGCA 3ZFEB 1SZBA 1W6MB 3OGVA 3K46A 3KS7A 4XETA 5IT6A 1W03A 5IW0A 4AVSA 1GFF2 3FHAA 5KHHA 3I49A 2EALA 3M3CA 5FKCA 2VJXA 2AYHA 2FCVA 4K8FA 1HRI2 4K8RB 1C8M2 1LULA 1LODA 4LBQB 4Y1YA 4QGLA 1E5RA 1YCIA 2HEYF 4Y5Z0 5FP4A 2FDIA 3RFRA 1VRH1 2WLPA 1K5MC 2GU9A 3SMHA 3OUHA 3T1MA 1W06A 2YGLA 4NIDA 1QJY2 4CP0A 4FXGB 2O8OA 2WR9A 1VAMA 4BE3A 1FOD2 4FPGA 5FY4A 1IGOA 1DQ5A 4DEQA 5DZGA 5ISLA 5HI0A 4AI8A 3GHNA 3DN7A 1QKQA 3UL2A 3B02A 2DCYA 1N1TA 2GP5A 2RM22 1ASJ1 4LHSA 5LBEA 2P5BA 1GOGA 2JG8B 1XNDA 4XUOA 2RS33 2YYOA 5K9YA 3VHOA 1UW8A 5KXDA 1S2KA 4N43B 1LHUA 1LOEA 3AFKA 4ET7A 1R081 3T4HB 3BTAA 4A42A 1Y9QA 4Y33A 2W1SA 3OYWB 5FLIA 1GWKA 1ULCA 1VBB3 4M01A 3WNLA 4CCLA 4FTEA 5A3WA 2OVUA 3WP3A 4PLMA 3T3YA 2ZGOA 1IS4A 2UWBA 1Y9MA 5CG9A 1TME2 3ZN6B 1U5ZA 4QKBA 1Q56A 4OHYA 4Y22A 3TEWA 3BYWA 3NRUA 5LK7B 2D6NA 4JGYB 4HBNA 1Y7BA 1NQJA 1C5IA 3B00A 3WVJA 5GALA 4CCEA 2YHJA 4K21A 5G05L 4EE2A 2OUJA 2VECA 4DIQA 1EPWA 2X5IB 4Y26A 4EWEA 1O4YA 2UU8A 2PELA 2DTYA 1KFUL 2XBO2 4QXCA 1W8UA 4R4XA 1XNTA 5DAWA 5J98B 5IVVA 1JYNA 2YZ4A 3MLJA 4WZCA 2VTFA 5LCWL 1HQNA 4IQPA 2YXSA 3ZYJB 2ARAA 4UW4A 4EV0A 1N3QA 5J96B 5A7WB 4BB3A 5B4XA 2BRTA 2A5ZA 3PUIA 5D8AB 2HBUA 2WT0A 3ABZA 3WG2A 2XLFA 2V72A 1H1MA 2FDJA 5C4WC 5C6CA 1TEIA 2VTXJ 5FIXA 5H9RA 4HPKB 5F5IA 1XYOA 5F39A 2JKXA 5H9PA 4B1MA 4N53A 4Q0QA 1QNWA 1R1A3 1ULPA 5HCAA 3ETPA 1FAYA 1W6OB 3BU7A 1EUTA 3T30A 3WG1A 4CVUA 5FPBA 4D7SA 2R071 3T09A 3WP4A 1SLTA 1UAIA 2D6MA 2ZMLA 3FHQA 1CJPA 4DPNA 3ACGA 1MZEA 2YB7A 1OURA 1ZA4A 2BEOA 4FQ4A 2E7TA 4JCKA 2HWD1 1OA4A 1LJ7A 4GMP3 2ZBJA 3JB8A 4PF1A 2P1BA 3APBA 5FXVA 1W04A 3MLLA 5A33B 5FOJB 3AYDA 2BGPA 3MV01 2BJSA 2WNVA 5GLVA 4CP2A 4LLFA 2QQVA 1LOBA 1O5UA 2ZS6B 4UBGA 3I3QA 3NO8A 1BEV2 1PM4A 4W8JA 3VBHA 4PI0A 1DP0A 2A73B 5FY8A 1DQ0A 4XBQA 1OKOA 1QQP1 4JGYC 2OQ7A 4IEOA 5F5QA 4LO6B 3NKTA 5FMCA 3FMGA 5L9VA 4D7YA 1PM7A 2JX9A 3ZR6A 3MF9A 1JZ2A 2C9AA 4EWAA 2W08A 4LKSA 2DFCA 2X5IC 3NWKA 5A1AA 1H1AA 2VZPA 2VR4A 2WSUA 3NJVA 5CFCA 5FPZA 3R0RA 1OUXA 4EN7B 2B4KA 3PMEA 2R1DA 3LPFA 4P5HA 3IB3A 4Q1PA 3VGIA 3I54A 1KRIA 2QQLA 4CE8A 3RJ2X 3B9CA 3MPPG 2WFF3 4ATEA 3VBOB 3OF1A 1OHFA 1XSRA 3LQCA 5EFUA 2BW8A 5F3GA 2JDYA 2OXBA 3P1IA 4JKLA 3VBFB 1WUVA 3FUQA 4A3XA 4CRQA 3OSDA 5B4NA 1W6NA 5FJHA 3HWJA 2ZGRA 3NV1A 5FK7A 4OMCA 2IXJA 1GP5A 2XQRA 5KHIA 2JEMA 1TNRA 2ZX0A 3I2HA 3MIGA 4FVVA 4QX7A 2YC2A 4ES8A 2PHRA 1YJLA 4CPBA 1LU2A 3VHNA 2J42A 3V0AB 4MADA 2E51A 4NOTA 5BPXA 1GP6A 4QQOA 4TLGA 1JOBA 3WV6A 1UMHA 1J3RA 4E2SA 5F2WA 1H2MA 3X29B 1CN1A 2VMHA 3KLSA 3POSA 2Y38A 4XJ9A 3ZFGC 2J1EA 4UFLA 4EJRA 3ST7A 3TN92 1VBB1 1O5LA 3IDCB 1RHI3 5I0SA 4HVRA 5FO9B 4CCDA 2W1UA 1VMFA 2G4IA 2XQXA 5FP7A 2D43A 1WD4A 1WMDA 2KR2A 2D3PA 1JYXA 3BTZA 3NKGA 1R092 1LENA 2WWSA 3DL3A 4XQWA 4OZOA 2WS92 4IXLA 4LBOA 4AI9A 3WCRA 4AHYA 1IKPA 3HBKA 4Q4X1 1W99A 3LF7A 5EXOA 1UIKA 1X33A 2JKBA 3PIGA 3HVDA 4GWNA 4BCUA 5BNOA 3KGLA 1HLCA 3WDUA 4Z1VA 1BCXA 4WZFA 4NIGA 4A7ZA 2Y8KA 2O8QA 2VH9A 3DKWA 2R062 4L92A 3T4VA 2ADDA 5FXWA 4AHWA 4X6RB 1AYM2 4A7YA 1V6IA 4CZSA 3BN6A 1BJQA 2QE3A 2JG9B 4FPYA 3BALA 2Y34A 1GZWB 3B9IA 3BODA 3V64A 1Q5OA 2FCTA 1STMA 3DPRA 1KGYA 2DVGA 2ZAAA 3M70A 3OBAA 4PJYA 4Y5TA 4YZ3A 3UK9A 2WNEA 4IE6A 3RI8A 1RVF3 4LITA 3VD3A 3VBFC 5E16A 4AYUA 3MF6A 3DXUA 4P08A 2C0ZA 4AAPA 1W2AX 1ND2A 2ETEA 1M06G 1OF4A 5DPNA 1R1A1 2I45A 2IXKA 2W5FA 4AE2A 5AC92 1RUC2 4FPLA 1C4RA 1PK6B 2TEPA 5FZOB 1T6BX 2Q5TA 1JXNA 5A6ZA 1H6XA 4YW3A 3WEZA 5FYYA 3ITQA 1H1IA 1IPKA 2PFWA 4YVSC 5FZCA 2VZTA 3W59A 2P6HA 3VD4A 1H2KA 1UN1A 3CHXA 4P00B 2P3JA 1AZDA 2VTXA 4A3ZA 1YFWA 2VOKA 3M7AA 3JBG3 4W6YA 5ERLA 2J1VA 5JR2A 3GBGA 5EZWA 2KD7A 1HRV3 2ZGPA 3M2MA 3ZFFC 1QJEA 5LATA 2VW2A 1W6PB 4LE4A 3M1HA 4CUBA 3MFCA 1V70A 4QHZA 1X8MA 4P9WA 1XJAA 3GJBA 4PQQA 2QDRA 3RPQA 1XNAA 1LHOA 3ELNA 3H1WA 1J58A 3N35A 4QHBA 2XHNA 3OEAA 2D6KA 1TE1B 5JDBA 3FJSA 2GNBA 1WLWA 2IWGB 2GNDA 4KMQA 1NA1C 3LPGA 4UI9L 2W95A 1DQ1A 3OPTA 2A6VA 2QFEA 4WM8B 3WF0A 4CXXA 4XQ4A 2CDPA 3POGA 5FJKA 2OPKA 4CCCA 3WCSA 1O4ZA 3N7LA 3WW3A 3KVBA 1W05A 2YPDA 2WZR2 5KR7A 1BMV1 4ARYA 1QHDA 1V6NA 2VW1A 2JG9C 1LEDA 3FLPA 4HFSA 4JHZA 4Q0PA 5I0TA 5LB6A 3VHRA 2CTVA 2RE9A 2WFF1 3CU7A 1WKYA 3SCFA 5FQ0A 4XXPA 1FX5A 5D1IA 3F2ZA 2HKXA 3MIBA 4JVAA 1XNCA 2BFUL 4HSJA 1LTEA 4OI1A 2QBXA 2Y6JA 3VBSB 1AR93 3I3DA 4URTA 1SPPB 1L7QA 2CU5A 1TNFA 3FFZA 4LO5B 4D6SA 3T0AA 1RUF2 1XE0A 3ZSMA 1OLME 4QGMA 4AGGA 3D6EA 1PIV2 1AX2A 4CDXC 2R1BA 3N9NA 2CY6A 4QPWA 1FYUA 1RHI1 2J1UA 2BNMA 2QQUA 4XOGA 5A3NA 4QWNA 2ZCWA 3WQBA 4RHV1 1W3XA 1CZVA 2ZABA 4XTPA 3W20A 1JZ5A 1LOGA 4BA6A 4BPZA 3HNBM 3HJRA 3J8F3 5FYHA 1JHJA 3LIGA 5GZDA 1O7FA 3H8OA 4QX1A 1DGWA 1H8TA 2DFBA 4GKYA 5FY1A 4YZ2A 3WDWA 3IDEA 4XIKA 4XFGA 2YY1A 4HKWA 3LD8A 5T3NA 3NV2A 2BNOA 4H55A 1MEC2 1MS9A 3WDVA 3O1MA 2YROA 5FPUA 3GM8A 1FT9A 4IETA 1O59A 1ODMA 4DQAA 1UPSA 3AVSA 4FPKA 2ZHKA 1VLNA 2Q1FA 4L11A 4H7MA 3CKHA 1VPHA 2B9VA 2NZ9A 3UKNA 4WM7B 3AMMA 2CDOA 4I2OA 4KBZA 1H4HA 3EXUA 4RR3C 4CDQC 3BVCA 2L9LA 1YLLA 4CDWB 1RVF1 2GALA 4LOSA 3ZMNA 1ST8A 1HQLA 1XRUA 1VBE2 2GNTA 3U10A 3HN1A 4HVOA 4Q8LA 3J7MA 1WMEA 4ZS3A 4NIHA 2VZOA 4IV3A 4RYDA 4NPMA 5BYNA 5CKNA 1UYYA 3I59B 3ZR5A 1VAVA 3MIHA 2J1RA 3M3IA 1PNGA 1EV13 1RUJ3 2VOVA 2RR11 3KV6A 3TOJA 4COVA 3OY8B 1VBA3 2J1TA 5FY7A 4PDWC 2PLV3 2DCTA 4CEWB 3FC0A 4N90A 2Q1ZB 2ILMA 2VVEA 1ENSA 2DVBA 1JZ7A 3P3NA 1YQ2A 1RGSA 3W9AA 4BDVB 4LHLA 5A1LA 1RMU1 3KB5A 2RS32 1MZ5A 1W28A 2VD7A 1MS1A 4BM8A 5IATA 1GV9A 3LGRA 3UV9A 4CU8A 3ROUA 3JD72 1W0OA 1H9WA 2Z4FA 3SHRA 5JZGB 1AR71 2WA4A 3EB7A 1JZ6A 4IE7A 2XJRA 3VUOA 4ITCA 3VHPA 5A6QA 4AI0A 3HQXA 4M0NA 2XJUA 4P9XA 3LOBA 4DRVA 1RXFA 2XUEA 1JBCA 3BB6A 3LDRA 3LEIA 1ACCA 3GGLA 4HN0A 2DVAA 1DZQA 3U37A 3KQRA 4AW7A 1YIFA 1RUG1 5FWEA 5IJRA 3CL1A 4WM7C 4HKLA 4MGQA 2YBKA 3ZKYA 4I0AA 2GC2A 2ZZJA 1SDDB 3ASIA 5L7OA 1WLTA 2VCBA 5FYUA 1UZYA 3IPVB 4RGGA 4XC9A 1I3HA 2D40A 4COUA 2DWRA 4OHWA 3ZM8A 4D6QA 4YGCA 5FYVA 1AR91 1W2TA 3C7GA 4WVMB 3ETQA 1J59A 5CA6A 2A3XA 1RUH2 4AEDA 2PHFA 5LA1A 4ZU7A 2Q1MA 1RXGA 3S6PA 2R16A 1DGWX 3MYXA 2F4LA 2I07B 4AF9A 3T0DA 1G7YA 3IM0A 4MOAA 1YFUA 1CZTA 4ASLA 4QU2A 3S5AA 3U78A 3D0JA 1LHVA 3K4ZA 5JCTA 4CEWC 1NYWA 1X7NA 2A3YA 3PLQA 3I3EA 5T54A 5DDJ2 3FWEA 4A4AA 2V5DA 4FTSA 1VBC2 2E26A 1DLLA 3FBYA 2WZ8A 4AFBA 1D4VB 4HXCA 2GMEA 4XFBA 2WZPP 5FRAA 2EIEA 1EAH2 3RSJA 4K40A 1F5JA 4AI2A 1OQEA 2AUYA 2EXHA 3WW1A 5I0UA 1QOOA 2WO3A 4D6RA 5LK5A 3CJIB 1XQNA 4M3CF 4P5YA 4XFAA 4XAAA 3O14A 2HWC1 5FY0A 1MQTB 1ZRFA 3FUOA 1UYXA 3HQUA 2VCMA 3AL6A 1GP4A 2OQ6A 4N9HA 3Q8AA 1JYIA 1QWRA 4FPJA 4V2WA 2ZGSA 2FHRA 1WLDA 1G86A 1H2LA 4JKKA 1QY4A 3UT0A 5ABJB 2ZGNA 3Q8CA 5FZ7A 2NMOA 1DBNA 2EXJA 4KGQA 3AYAA 4LA2A 1LKNA 1OQDA 1YQ6A 2GMMA 4O7XA 3VDDA 3AP4A 4PQ9A 1VBD3 2AACA 3O1OA 1BBT3 2ZGLA 1NOVA 4OLLA 5A7OA 2B8MA 2GMPA 2IVJA 4XFFA 4YFZA 4UF0A 1Q8SA 3SCHA 5A1FA 2HWF3 2W47A 3K3NA 4FXKB 4QB2A 4ZONA 1ND3B 4N7IA 1LHNA 5IK7A 2ZKNA 2HWE2 4HLTA 4CDUA 2VOTA 2YC4A 3OPZA 2E31A 3AX4A 1IG0A 4KG8A 2JDUA 2NYYA 4H2AA 1RUJ1 5BNNB 3N3HA 2ZX2A 3CBNA 1MS4A 4DINB 5IHRA 4AWDA 1GWMA 1O91A 1QXPA 1VBA1 4BLIA 1XE7A 4KGGA 3GJAA 5K0UB 3LFMA 2WWUA 2Z42A 4COZA 2BWAA 5FUPA 5IWFA 1S0DA 4N53C 1XPWA 3KMHA 1DQ6A 2QQWA 3S0MA 1CX4A 4YG0A 2ZMNA 5A7NA 1PGW1 1UCXA 1Z7S2 2A6WA 3ORJA 3VBRB 4AFMA 5DAVA 3SKJE 3C7HA 3POWA 3KHBA 1D4M1 1RHI2 1Y3TA 3PTRB 1OC1A 2P2KA 2XOMA 2VZRA 2AENA 1FPN2 2CWMA 4YM0A 1ASJ3 3FLTA 3I2DA 4F8AA 3IIIA 4QPYA 1BHGA 4NWVA 4U2AA 3CEWA 2WNVC 1CAXB 5FTTC 1LCLA 2WNUA 2XJSA 5FY9A 3GDBA 2DYCA 3C7OA 1POQA 1CAWA 2VM9A 3K4AA 3USUA 3AXEA 1YUDA 4U36A 3VBHC 1IQAA 2BOJA 2K9ZA 1NY72 4P9LA 4OHZA 4CCJA 5DG2A 3KHCA 5DN2A 1US2A 2D6OX 3NAPA 1DF0A 3MUZ1 4GWJA 3ZLIA 1JUHA 4PHZA 4I09A 4PBPA 2ZGQA 4NN0A 1OLMA 4DXTA 3O7OA 3WNKA 2WWJA 3IDAA 4IERA 2VQ0A 4R4ZA 5FZHA 4R9AA 4D0QA 3U4SA 1C1LA 3GHMA 3UKVA 1O3QA 1A34A 2NLRA 3FBMA 1IS5A 2RS12 3VKOA 4AL9A 1OQ1A 5HCBA 1ZBA3 3A7QA 3THTA 3JU9A 4ES9A 2FZ2A 5BNNC 1AX0A 1K42A 3VKFC 1SCRA 4QPGA 3MIEA 5FFOC 4A6SA 4XPVA 4FOYA 4PIYA 5GZEA 3LFIA 3DPRB 2QQPA 3E1F1 5BNPA 1HN1A 4FTBA 2HWB1 3KF5A 4XURA 3O1VA 4MGTA 2JDKA 4ATFA 3EYPA 3U0ZA 3LSEA 3CZUA 4TTGA 1DGRN 2ZGTA 4GXLA 1OKQA 2D44A 1ZZCA 2TNFA 5JVVA 1W6QB 2Y0IA 1QIQA 4W50A 2A75A 4CYDA 2C24A 4OQ9A 2DBNA 3K75B 2P37A 2VUJA 3AZYA 5I91A 4XJWA 3VBRC 1IZ3A 1CPNA 4RA0A 4LO4B 3B93A 3THCA 3JBG2 4QD2A 4ZXKA 4O9EA 3RYPA 2AR6A 1W9YA 1HRV2 2YC0A 3CZJA 2YV8A 5CEHA 4KL1A 2JIJA 4K6BA 1U5XA 5FV3A 3ZYIB 2VZ3A 1SLIA 2GAUA 3ZSLA 1YI9A 4QGNA 1OA3A 4GWMA 2QQKA 4LJHA 5FAXA 4BQYA 2OA2A 1OD3A 5BXXA 1OFNA 5FXXA 1UIJA 2EF6A 2RMU3 1VJ2A 1AR61 1VB4A 2BTVC 3WQ1A 1BBT1 1XXNA 4YW4A 3T08A 4JGZA 4BOWA 1W39A 2VW0A 2PN5A 2VXRA 5JIAA 5BNOC 2XMLA 5C9AA 1X8EA 1PGSA 2JDNA 5LBCA 1QJX1 1QQP3 2VVFA 4RS5A 3WUCA 3WP5A 1OBNA 5C3SA 3H8XA 3BI3A 5JR7B 1Q8PA 2R32A 3SITA 4YPJA 4ZZ8A 2WN3A 1VALA 3BIEA 3DPRC 2VZSA 5FZ0A 3WW2A 2IC1A 2W46A 2OPWA 2DDUA 2G9ZA 3ZMOA 1RC6A 3IWZA 1AR81 2ZAHA 2QKDA 3NW4A 1ND2C 2D3RA 4IE4A 1W9TA 4XJZA 1NCQA 3NSTA 4YWAA 1CZSA 3OUJA 2ES3A 3B3QE 4LBLA 3NJXA 2DCZA 3GZUC 4WVVA 4D8MA 1SLBA 2QZ2A 2GN7A 3CIHA 5EPAA 2BERA 3E5UA 5C4WB 4LKFA 3JUUA 2W0XA 1APNA 1RUE3 2VUCA 1QJU2 4NHKA 3RDIA 4YZ5A 5LY1A 3PL0A 5T52A 4FAGA 2VNVA 3PUHA 5GZFA 3RYKA 3VDAA 3WXPA 2Z79A 3LDBA 1WBFA 1IQDC 1C57A 1D0HA 1ZRRA 4S2GA 3BTXA 1PGL1 1H4GA 4O9GA 1UY0A 3RNSA 3OGGA 4MGSA 2DF7A 1F31A 3J8F2 5T50A 4RSUA 1W2UA 3RZHA 1F4AA 3D3AA 1COV3 1YIPA 1JHNA 2XLAA 1RUI3 5EJZB 4YZ4A 4B29A 5JXGA 3RZZA 4FOWA 2A7AA 2IUWA 3BTYA 3R4SA 2HEWF 2O14A 3ZXGA 1SEFA 4LK7A 1ZA7A 2MEV1 3CLPA 4FSJA 1UOJA 2HBTA 4ZKTB 1B35B 2EXKA 4QX3A 4E8DA 1LGBA 4URAA 5J36A 4O61A 1UU4A 4QPIB 1ZRDA 5FMOL 1UY1A 4B4RA 3OCPA 4R9CA 3J7LA 3W21A 4BJ0A 4D69A 1URXA 3FLRA 4Q4X3 2BNNA 1ZBA1 4XF1A 1KEXA 4IEYA 4KQ7A 4HSLA 3UJOA 1RUD3 1N3PA 1UU5A 4CU7A 4DO0A 2D7FA 4NRPA 5L19A 5GKAC 5JPNB 2JJ6A 4Q2FA 3AMPA 4MV2A 3OPWA 1F9KA 4AR2A 4XILA 3DYMA 2KM2A 2XLGA 4R8HA 5DMYA 1PO13 2ZEXA 4YVWB 1WW4A 1EY2A 1A78A 2RS52 2VGDA 4DUVA 4TN7A 1XNKA 3NVCA 5L9BA 2VBBA 5FBZA 1EV12 1BVVA 1ENXA 4X8PA 5JXJA 1RUOA 1HXS3 3H42B 2ZEYA 2PLV2 1AF9A 4FT8A 1S0BA 4AGVA 2Q8EA 4GJZA 3L2HA 4RQPA 2ERFA 2WO1A 2D3SA 2WRAA 4JX0A 1REDA 1W0NA 2CL2A 1NXMA 4KWKA 3KV9A 3PVOA 4QHOA 1Y4WA 1S0JA 3ZFGB 3CDZB 3HAGA 3HR9A 2D6PA 2RMU1 1LEMA 2SBAA 4AI1A 5A70A 1TZOA 4P9IA 3WNMA 1QH6A 2DVFA 2QQNA 3ZO0B 2PHWA 1H8TC 3ZKUA 2RHPA 1ZBE3 3WSOA 4D94A 1B35C 3MW2A 5I8TA 2N7GA 4E4SA 4QPIC 1HDKA 4GAZA 1HB4A 4UWDA 3ZSEA 5CG8A 2EIBA 1V6OA 4M3CB 1RJ7A 2C5DA 4OHVA 4CTEA 4UW5A 3P3PA 1J83A 3HNYM 5FDBA 1SHWB 4JTNA 1ULEA 1ZM1A 1S4CA 4B8EA 1X82A 3OGJA 5F8PA 3BU0A 2BFUS 3N7KA 2GP3A 4GALA 4XABA 2B9UA 3HN3A 2I74A 3TEYA 1MZ6A 3AB0A 4IGQA 4QM8A 2WAOA 4PIXA 3EJKA 1GSLA 1ZNPA 2WNOA 3GXUA 4GB33 4HMZA 4JRLA 3NL1A 4MXWB 5IAXA 3I7DA 5LBBA 5EQUA 4XDQA 2VUDA 4RGAA 1Q8VA 4M00A 3LEKA 4E4ZA 3N9OA 4IV3C 4YVWC 2VUAA 2C9KA 2HJIA 1SBEA 4ZPIA 1WCSA 1FMD3 4C91A 1GNHA 3OUIA 4LR4A 4YW7A 1QEXA 3VN4A 5A32B 4BQXA 4CUGA 4IE5A 3DV8A 1RUE1 1UXXX 1UZVA 2FDFA 4HK9A 3KM5A 1QNYA 4LNVA 5IFPA 3LWCA 3QH7A 3TEXA 1W8FA 2C4XA 3V0BA 1VMJA 5CVRA 3PMSA 4KI5M 3KVAA 4OI0A 1JU3A 3ENRA 2NQYA 4META 1PZ7A 1GZTA 4YVSB 4LUMA 1COV1 4NAOA 1CPMA 1RUI1 1A3KA 4BQWA 4LQRA 3GBFA 2ZOEB 3WNOA 2Y60A 3SXWA 1CAUB 3EQEA 4NUBA 3W5MA 3AL5A 1ODNA 3NV3A 5GM0A 3ZFFB 2NMNA 3HT1A 1KDKA 4OI4A 4RHV3 4PLNA 1XYPA 2GN3A 4QU1A 5AFBA 4D3WA 3A4UA 1PZ8A 2PHUA 4YSFA 2LRPA 4ONUA 4CEYA 1HB3A 4Q4V2 5T55A 1U5YA 1WWYA 2LS6A 5FK8A 2LM3A 2V4AA 5SV5A 4GH4A 1NX9A 3H3ZA 5K4LA 1AYN3 1POV0 3JXSA 1RUD1 4NPRA 2EIDA 1NA1B 4CA9A 2QDNA 2QVSB 4EZ4A 1I1EA 3LIHA 1WA6X 2B46X 5IK5A 1D2QA 1OOPA 4YGDA 1VBD2 4B7EA 1LOCA 2ZGKA 4DB5A 5L7OC 2XJPA 5EWSA 1O3SA 2X53S 4OYUA 4Y1VA 3FX3A 2HWF2 2DUOA 4V2VA 4QKNA 2CHHA 5FZIA 2R0HA 1PO11 1TQ5A 2PTMA 4HKOA 4Q5OA 4AEDC 1G9CA 3RZMA 4Q29A 2WT1A 1QU0A 3BOWA 1CIWA 5JI7A 2W52A 3MBWA 3AK0A 4HONA 4XJAA 3KSCA 4QX2A 1HXS1 3GBWA 1J84A 4W6WA 1G8WA 4BHPA 4WVZA 5C8CB 3Q8FA 4CP9B 1KS4A 4R9BA 5K8SA 4JZRA 4LK6A 5LWBA 3OBTA 4FO9A 4Q4W3 1KQRA 2WA3A 3IMMA 1UL9A 4UXAA 1VRH2 5GLWA 4MGKE 1HJFA 1NCRA 4K20A 4OQ8A 3OGRA 4M4PA 1PZ9A 2BWCA 2BBAA 4ZY9A 2RR13 5KHKA 4BQ3A 4PI2A 4P9GA 4CDXB 2A3WA 4ZU4A 3O1TA 2XWBB 3M4FA 2AC1A 4N9IA 4N8MA 2PHTA 2YPJA 4W4ZA 1FATA 3U75A 4EZHA 3RS6A 5IFTA 1ZBE1 2IFWA 2E53A 4AVAA 1K5MA 3LB9A 5GJ6A 4YARA 1ZZ6A 5EJ1B 1ASJ2 3VBUA 4YZ1A 1CAVA 1H8VA 1RMU3 1UF2C 2A1XA 1BZWA 1V9U3 3PVBB 4QX5A 3LEMA 4LKEA 4YG6A 4AVVA 4AG4A 2JENA 3QLQA 5DZFA 2XG3A 5CKQA 3NNFA 3BGAA 2QQOA 3WNXA 3C7EA 1R082 4XFIA 3TNQA 2ZKLA 1AR73 4Y20B 2P34A 2E63A 2JE7A 2Y26A 2H6BA 2O1QA 1A6CA 2ID4A 3WY6A 3MV11 1TMF1 2PYTA 3R4DB 4DY5A 4JV4A 3WR0A 1F8VA 1UO9A 5FPAA 2VCAA 4YYOA 3VDDC 4JC1A 1MVQA 1MPXA 3HPNA 4GB31 4RGKA 5CFDA 1K5JA 2ARXA 1RUG3 2LUWA 1NT0A 2AGSA 1S0EA 4GMP0 5H9SA 3PIJA 3SISA 5C3RA 4XUTA 5EYXA 2XVLA 3ZVXA 4RR3B 1ZBA2 1UZ0A 1WW7A 4CDQB 2QJVA 3H0OA 1FMD1 1UX6A 1TVGA 4CDUC 1H9PA 5C8CC 4UFMA 2FZ1A 5I0RA 2XGXA 5HXMA 1D7PM 2P4EA 2VBPA 4IV1A 3FE5A 4QAWA 3PDQA 4AZZA 1AL0G 1W8TA 3LEGA 1G9BA 1ZYBA 3ZFEA 3WINE 1YO8A 1W6MA 3I8TA 4CU6A 5F32A 4NJ4A 2G9GA 3UETA 1OMIA 3CO2A 1GQHA 4GJYA 4XE9A 3VL8A 3U11A 1EYBA 3H3UA 1LGNA 2W2IA 3QOPA 1UQXA 4LBQA 2QTWB 5JOXA 1XBFA 4PDWB 1S2EA 1W8OA 1LU1A 4LT5A 3RWNA 2BU9A 4QMAA 1TG7A 3ZYHA 4GZ9A 2B39A 1GQPA 3LZZA 2R072 5FZ1A 1UPIA 2WT2A 2FMDA 1GZCA 1QJY3 1ZX5A 3RG0A 1N1SA 3O0WA 2RJ2A 3AP5A 4MHRA 1IG3A 5KC6A 2HWD2 1AYN1 1GUIA 1C3HA 3OGSA 1OI6A 1N47A 1RIRA 2XHKA 4PF5A 1SBDA 3GCXA 2W1QA 2HWC3 3ON7A 1UYZA 4CUAA 1FNZA 4MYEA 4XMIA 3AKPA 2JG8A 2MPFA 2QQJA 3NJYA 4ISQA 3TWIA 1WMXA 1QF3A 3DCQA 2JIGA 3WZ1A 5KHJA 2R041 2RM23 4XFCA 4MX3A 4N43A 5FZKA 3VV1A 3AVRA 2RDQA 4TYSA 5FPVA 1QGLA 2XJQA 3VD9A 5C3OA 1CWPA 1QQP2 3OYWA 1SLCA 2BBVA 1G9FA 2ZA9A 2RVAA 3D0SA 4FPFA 2X05A 2VAUA 2RV9A 4NROA 2JD9A 4Q1RA 4FFGA 5E8AA 1CD3G 3VB9A 1QOTA 3H9AA 3ZDSA 3ZN6A 4LIUA 4QKFA 4J1XA 2JB8A 4SBVA 1KFXL 4Q0SA 5CIRA 4JGYA 1PO23 4Q4W1 5FYSA 2GC3A 4NRMA 1KD7A 5BNPC 4NVPA 1CJDA 2YGMA 5F3IA 2GC1A 1DG6A 2DURA 5FYBA 4MLOA 1XC6A 4OFGA 2XJVA 4C90A 2J1AA 3MUY1 1VR3A 5JPMB 1WA4A 3NNLA 3DYPA 4CPBD 1DDLA 3CJXA 2A70A 5F5AA 4UFJA 5A7WA 5J48A 2BPA2 1F5FA 3MO4A 5D8AA 2ZZQA 4MUVA 4YG3A 2F4PA 5CZKA 2UY8A 3ZXJA 5HV4A 1V9U1 4HANA 1KS5A 4Z82A 1GANA 3HOBA 5DQ0A 1KXGA 2SLIA 3T1LA 1JN2P 1Y43B 2HYKA 4HPKA 1AVBA 1VB2A 3K4DA 5ANNA 3C8XA 2QCSB 1UOBA 3RZJA 2W68A 3WUDA 3ZYFA 4J1WA 1AL21 1JUIA 1VBB2 1W6OA 1X9TA 3CMGA 4IGPA 1D4M3 5DUWA 3ZSJA 5C5TA 4BISA 1ZZ7A 1BQPA 4DS0A 2DUPA 2E7QA 1DCSA 2JDAA 1KJLA 3R6SA 3UGHA 4FP2A 5FZDA 4JGZC 4XJUA 1CONA 3LOIA 3KZ4C 4FCAA 1OPMA 3AJYA 2FDHA 4Q4X2 5C9AC 5A33A 1E5SA 2E7AA 4NHLA 4Y22B 4RS5C 1DYOA 3RQ0A 2GNMA 4Q4Y3 3WNPA 2WBKA 3JCIA 1PVC1 3QCWA 2GH2A 3FL7A 3ACFA 5F3EA 4ASMB 3THDA 3O1PA 2E6VA 3C3VA 1NKGA 2C26A 4LO8A 1FI2A 3TNPB 5FYCA 1BEV3 5A6YA 3GYDA 2OX0A 4A44A 3GNEA 3KT7A 4ARXA 4XMAA 1PO12 4FBFA 1AXKA 4JDMA 1T6GC 2PA7A 1NCQC 2CGNA 3T2QA 3ALQA 3KF3A 1HRI1 4G9SB 1C8M1 2HWB3 2VXJA 4ZS2A 3U14A 2ADEA 2AEYA 1R1A2 2VBDA 1O3TA 5EIYB 1CVNA 4KG0A 1OVSA 5EJ3A 3AYCA 4BH9A 1O3RA 3VBOA 3AP9A 4N53B 3PJYA 4Y5SA 2YDEA 2W3JA 1JW6A 4P9YA 1QJY1 3VBFA 2ATFA 1DZTA 5JMOA 3E5QA 1CQ9A 5FYTA 5HV0A 1FOD1 1YQCA 2WINB 4TLFA 4UFIA 4B7KA 4CSWA 3H8RA 1NUKA 2YBSA 1VIWB 5AVPA 5A7PA 4IDZA 1W2OA 3WT3A 4XBNA 3V0AA 2G19A 2ZHLA 4YRDA 2VQTA 5LA2A 1AHSA 4OUEA 2QQIA 2HEVF 2RM21 4B1LA 4E4DX 3W5NA 4R52A 2WNVB 2R7EB 5FYZA 5FLJA 3B69A 2VMIA 5KC5A 1IKQA 3IAPA 4K1ZA 1PMJX 3N9PA 3SH3A 3WF1A 5FP9A 1AR63 4I01A 1XOYA 3VBHB 2RDRA 4DNYA 1LRHA 2DU1A 3D8CA 4QQ2A 2W9XA 1REEA 2XR4A 2Q0AA 1JZ8A 1JODA 1YQ5A 5FUIA 1BMV2 3KD4A 4BLJA 1TME1 4FPEA 1PO21 4RD7A 3ACIA 5FYIA 3AZVA 1QJX3 4X6QB 4Y1ZA 1R093 3ES4A 1RL3A 2VU9A 5CFCB 2WS93 1WCKA 4OULA 4Y3OA 5J3UA 2WFF2 5JIUA 3UJQA 5A3LA 1JTZX 4AHXA 5I8SA 2QUOA 4MGZE 1FXZA 5FZLA 5F1RA 1MS5A 3FZ3A 2VCCA 4QXBA 2R063 1UZWA 2JG9A 2WSVA 2JB4A 4LBNA 1AR83 1GZWA 5CYYA 3AP7A 5FZ4A 1JZ4A 4L9BA 1W6NB 1FV2A 3VZJA 1NG0A 1CX1A 2D5FA 4UAPA 1BYHA 4PT6A 1V6KA 4F83A 4EN9B 1HN0A 1UWWA 2JDHA 3D82A 3PUSA 4NRQA 3OD0A 5F3CA 2EIGA 2VE1A 5KWRA 3BOPA 3H50A 1O6UA 3GF6A 3WW4A 2R0FA 2B42B 1IS3A 1PK6A 4LA3A 4M0HA 1YFYA 4LOTA 1G6NA 2EXIA 5FZOA 3SC7X 3MLKA 4CP1A 5AC93 5CNAA 1DLCA 4RHV2 1XB9A 2Q4SA 3G7DA 5FREA 5TSWA 2G1MA 4DXZA 4UT5A 5FCCA 1S0FA 4DEVA 2CYFA 4LKDA 3KQ4B 1F35A 1WCDJ 1S0GA 5JUVA 4KU8A 2ZXQA 1NLSA 4LE3A 4AI3A 5A3OA 2O0OA 1PX3A 1W6PA 1L7LA 1XNBA 2MEV3 2PHXA 4Q4Y1 2ZHMA 4AK3A 2YU2A 4KBBA 2WABA 5FZ3A 2WJSA 5IVJA 2A6YA 4IEQA 2WFPA 3I2FA 3JQWA 2A71A 3NJZA 5BNOB 4RFT0 4GA9A 2WYFA 1BEV1 5A3TA 5CFCC 3VZMA 1UY4A 4FOQA 1UKRA 4Z2AA 3KCYA 3IKWA 4P02B 3FHIB 1YHFA 4WM8A 4E2QA 4YM2A 1WW5A 3WF2A 1RVF2 3DKQA 1DYKA 3T2OA 2PAEA 3VD5A 3U07A 2V09A 1AX1A 5DUXA 5CADA 4BK4A 3VDBA 1H0BA 1HIXA 1OSGA 2Y6KA 4FFHA 1ND2B 4KU7A 3K48A 4Q4W2 2VMFA 4QXHA 2DVDA 2FDGA 1ENQA 1JOJA 4FI9A 5H9QA 3DEMA 1UOFA 2BQPA 4KWLA 1OFSA 3THPA 4EROA 1W9SA 4RFRB 4F7ZA 4L97A 1S55A 4AVTA 4I3PA 4DUXA 3VBSA 2RR12 1N3OA 3PU3A 3MHZA 1SPPA 3MFAA 5F37A 2OYZA 5DAQA 4GQ7A 2CGPA 1PHMA 4Q8KA 4HG6B 2BV4A 3SNMA 2Z5WA 4W6XA 5A3PA 4BU2A 5BUVA 1ULOA 3ZXEA 4NWWA 3PUAA 5KHGA 1RMU2 4XQDA 2VQAA 5CKMA 1DGLA 3S30A 5LBFA 3AM2A 4YNIA 4AEMA 4BIFA 5FMBA 2XL7A 3POEA 1H6YA 2LROA 3ZYRA 1PIV3 1AR72 1NE4A 5JOYA 5KXEA 3TN91 4XF0A 3DF0A 4B4QA 2FDKA 4WV8A 3VZLA 3L9JT 5FPXA 3ZXFA 1BLZA 3A0KA 3MIDA 2A6ZA 2JE8A 1YJKA 3VKMA 2XPJA 1RUG2 1R091 2XVKA 4MXVA 1GOFA 2R30A 1G9DA 3PTYA 2WS91 2JD4A 5LA0A 1WMFA 1GWLA 2WUHA 4XF3A 4AFDA 4OUMA 2WQ8A 5BNQA 5CB7A 1XSQA 1MS8A 5DG1A 5C70A 2FBEA 5DXDA 3GZTB 5FQ0B 2FD8A 3GZEA 1VMHA 2D5HA 4QQLA 3ZXDA 2DUQA 1AR92 1JMUB 1QDOA 2OW4A 2R061 2E32A 3ZPOA 3J7NA 1L3JA 4WM7A 5FPLA 4BK5A 1AYM1 3I2KA 3JZVA 1SFNA 1SMVA 4AFCA 3AKSA 1W8WA 2PAKA 1JOPA 4ZU5A 4CDWA 4QQPA 3WF3A 4MGYE 5FO7B 4OUSA 3M3OA 2E33A 4XUNA 1NZCA 3ZXLA 1IOAA 1NCRC 1ZVFA 2ZPXA 1SQ4A 1CESA 5C7GA 4QKDA 5A7QA 1VBE3 3S5QA 5CBLA 3H3LA 5FP8A 1W8NA 5L36A 2HH9A 1N1YA 3IAQA 3AMHA 3WQ7A 4IEVA 3I59A 1H2NA 5AC91 2YFUA 1J1LA 1RUC1 3POYA 3UKTA 3URFA 3QACA 5FP3A 3R4UA 3EHKA 3N36A 5FOBB 5JWPA 3OY8A 5IVYA 4A2UA 3PURA 4LORA 3VBUC 1B09A 4CEWA 3SQOA 3POFA 1DU3D 4I0BA 4LIVA 2ET7A 2AREA 4ISRA 4DRRA 4IE0A 4A7KA 1Q3EA 2AZ5A 4C8DA 1H8TB 3CF6E 3AMNA 2HWC2 2I2SA 2DTWA 3L2YA 3D4KA 1UXZA 4A41A 2ZX1A 1POV3 4YW1A 3LA7A 4BMEA 2Z69A 4BIOA 4EYUA 3USSA 1K3IA 2AH2A 1F4HA 2OIIA 2XH6A 4AOCA 5JZGA 3A21A 3DECA 2OT7A 5FYMA 5AFEA 5CFDC 5FUNA 1WBLA 3BPSA 4JDNA 3JD73 4K7JA 3S7EA 4N7UA 5G04L 3AP6A 2EICA 3AKTA 4H7LA 4IUGA 3GCWA 2DCKA 3INAA 1W2NA 4I30A 3RZKA 1OLRA 4DFSA 2GZWA 2VZVA 1MS3A 2W1WA 2JXAA 2WZR1 3J9SA 4LHNA 1ZREA 1PO22 2ZTNA 4IV1C 4KWUA 2XWJB 1LECA 2BP6A 1A8MA 2W39A 1SFPA 4IV3B 1P8JA 3EO6A 5A80A 3ZFEC 1U0AA 3AZWA 3IPVA 4I3GA 4MHUA 4JKMA 1DFQA 1ZRCA 1RUJ2 1UD1A 2XXZA 1VAKA 4J6GA 4BXSV 4WVMA 4NIAA 1VBA2 1BK1A 2VMGA 2FMYA 4M4RA 2CWSA 4YW2A 2CSGA 3M3QA 2UWAA 2V4VA 3IT8A 3AJZA 2D6LX 5AVAA 5IVFA 1U12A 2VVDA 2BOIA 1JU4A 1RUH3 2V73A 5JLVA 2RG4A 3A23A 4AQSA 1RUF1 3FN9A 3E97A 4ASKA 4AXOA 1V6LA 1ZZBA 2PHLA 1ALYA 3ILFA 5F6KA 1W8ZA 1Y9GA 4AEKA 1PGW2 1GYKA 1PIV1 2BYVE 1LNSA 1QJFA 2ET1A 1XU2A 1D4M2 2B7YA 3MW4A 2P3YA 2WO7A 3IN9A 4XCAA 4E8CA 5DDJ3 5LZ6A 1DIWA 1VBC3 2F6BA 2IZWA 2VG9A 3H8UA 1J3PA 4FFFA 4GD4A 1DYPA 2QNKA 3LAGA 4XEZA 4E4HA 3MEPA 2LW8A 1PVXA 2JG8C 4DOUA 4YFWA 3CJIA 1EAH3 2J1SA 1GKBA 2IXCA 3ZXAC 1QDCA 4MSVA 4N43C 1ULDA 4HZFA 3UYJA 3BCWA 3TYJA 1OH3A 1MQTA 2YUEA 1TMF3 4FAHA 2WKKA 2JDZA 4HN1A 3O12A 4S2HA 1WCUA 4Q4Y2 4BWOA 5JMCA 5L7OB 2UWCA 2VZ1A 3IMNA 1YEWA 3I97A 3KT1A 1MEC1 5DAPA 5LRRA 5C5UA 5ABJA 1GR3A 5DUVA 4HT1T 1JS9A 1HW5A 2Y0OA 2FCUA 3ILNA 2YFZA 1IS6A 4EN6B 4AEDB 5F9TA 2GDFA 2JE9A 5LW9A 2KXLA 2W92A 2RJKA 3ZX7A 5IYYA 4QT6A 4UW3A 4CXWA 2Y33A 5IVCA 2Y6HA 4ORFA 4NHYA 5IVBA 1VBE1 3DYOA 2WQ4A 1GLHA 1RJ8A 2HWB2 1I9RA 1DGRA 1ND3A 4QDRA 1E5IA 4HETA 4LULA 2IFRA 5A6XA 5IK4A 5FZEA 2VC9A 1PX4A 1SCSA 5BNNA 2VMEA 2Q8DA 2HWE3 4TXWA 4QB1A 3WOGA 3GZAA 5LRSA 2KA3A 4M3CE 5D8AC 2XDVA 5F5CA 4E27A 2WYSA 3LKJA 1ZZ8A 5K0UA 4DZGA 1W9WA 2DCJA 3MGUA 5D2AA 4Q27A 3ZSKA 3N7MA 2R49A 3F95A 3RVHA 5C3PA 1GICA 4NIIA 5GZCA 2YU1A 1U5IA 4BQ5A 1X50A 1JI6A 1C28A 3PU8A 2DBIA 3HBZA 2JDMA 3I4IA 1JYWA 1POV1 1I5ZA 4NR1A 5A3UA 3U4XA 1JYCA 5B2GB 1DQ2A 5FZAA 1YXWA 3VBRA 1YYNA 5E88A 1FV3A 2RS31 2C1FA 2YG0A 4UOJA 3IBMA 5DZEA 2Y64A 3MW3A 5A3MA 4H14A 3RZGA 1Z7S3 3JD71 1AR62 4LHKA 3RMXA 3AZXA 4RL7A 1MS0A 5ACA3 3P6BA 4QM9A 1BBT2 3NQHA 4PBOA 1SFYA 4JAAA 3ZN5A 2UYAA 4LBMA 5KBFA 1QMJA 3VDDB 1CAXA 1FPN3 4NMIA 2R043 3ZYBA 4DXRA 5C3QA 5JAXA 3LE0A 2XKOA 2H0VA 2OZ6A 2B45X 1QJX2 2G9FA 4Y24A 4UF0B
chains in the Genus database with same CATH topology
3J7HA 4ZXEA 4ET7A 1XC6A 5JXHA 2W1SA 2J1AA 3MUY1 3SKJE 3WNLA 3C7HA 3DYPA 4LPLA 4QB6A 4CU9A 2XOMA 2VZRA 3MO4A 3IIIA 1BHGA 5CZKA 1L7RA 3HOBA 1K12A 3GDBA 3NRUA 5DQ0A 3OG2A 3C7OA 4L0PA 3K4DA 2VM9A 3K4AA 3C8XA 5DN2A 1US2A 3CMGA 5G05L 3MUZ1 4GWJA 4DXTA 1XNTA 1JYNA 3WNKA 2VTFA 3IDAA 5LCWL 2JDAA 4D0QA 4A6OA 5B4XA 3PUIA 1RYYA 3A7QA 3ABZA 2QQMA 2V72A 1K42A 2Y6LA 1DYOA 3WNPA 2WBKA 3E1F1 2VZQA 1HN1A 2JKXA 4XURA 1ULPA 3ACFA 3FL7A 3THDA 3ETPA 1OH4A 1EUTA 1UMIA 1NKGA 3EYPA 2C26A 3CZUA 4CVUA 5J1XA 4TTGA 4A44A 3T09A 4ARXA 3FHQA 4W50A 3SEPA 3K75B 3ACGA 2ORZA 2YB7A 5HPOA 2W87A 3T2QA 4PF1A 3THCA 1JYVA 2BGPA 3MV01 3CZJA 5EIYB 2VZ3A 4W8JA 3I3BA 2QQKA 1DP0A 2W3JA 1GOHA 5C71A 1OD3A 5JMOA 4XUQA 1JZ2A 1NUKA 2X10A 4LKSA 3SEEA 5A1AA 3T08A 2VZPA 2VR4A 5I0DA 3NJVA 2HYXA 2VQTA 2B4KA 5LA2A 4OUEA 2QQIA 3LPFA 3W5NA 1WCQA 3IB3A 2R7EB 4XVHA 2QQLA 3SKVA 3IAPA 1PMJX 3WF1A 3LQCA 4ZZ8A 2WN3A 3P1IA 2BGOA 4JKLA 5B4NA 2W9XA 3CQOA 2VZSA 1JZ8A 2W46A 4OMCA 5FUIA 2DDUA 3I2HA 3ACIA 2YC2A 1W9TA 2ZEZA 4MADA 1CZSA 3I2IA 2Y6GA 3NJXA 1UMHA 4D8MA 3CIHA 2BERA 2ORXA 5F7UA 2J1EA 3OB8A 2VMCA 2VCCA 3PUHA 5CYYA 3VDAA 2W1UA 1JZ4A 2XQXA 1IQDC 1CX1A 4OMDA 4UAPA 1JYXA 1UY0A 4PT6A 4MGSA 4OZOA 1UWWA 1F4AA 3D3AA 5JXGA 1JZ3A 3HNMA 5EJZB 1W99A 3NNGA 3HEIA 2VL4A 4DUWA 4QDQA 3AC0A 2Y8KA 1CIYA 4QX3A 1DLCA 4E8DA 3BN6A 3T2PA 1UY1A 2X09A 4BJ0A 1KGYA 4DEVA 3OBAA 1KEXA 3UESA 2W91A 5JUVA 2ZXQA 3VD3A 1PX3A 1UX7A 4CU7A 4P08A 1OF4A 2WABA 5DPNA 2OKXA 2W5FA 3I2FA 3VD7A 1O8SA 3I2GA 1H6XA 3WEZA 1UY4A 3DYMA 5DMYA 2ZEXA 4Z2AA 4DUVA 2VZTA 4P02B 3VD4A 3WF2A 4P00B 4MO3M 4A3ZA 5JXJA 3T2OA 4AAXA 2J1VA 2ZEYA 3VD5A 5JR2A 2KD7A 1UY3A 3VDBA 4BK4A 4CUBA 2Y6KA 2WO1A 4PQQA 2VMFA 1XNAA 4A45A 4JX0A 4FI9A 4ZZ5A 1W0NA 2XHNA 3OEAA 1W9SA 4DUXA 4XUPA 3CDZB 4KMQA 3LPGA 4UI9L 1O8PA 2W95A 3WNMA 2QQNA 3WF0A 3OEBA 3WSOA 4HG6B 2CDPA 2VQUA 2J22A 1ULOA 4ARYA 1SG3A 2J7MA 2WO2A 4JHZA 1GMMA 2EIBA 1WKYA 1H6YA 1NAEA 1J83A 3HNYM 1SHWB 3F2ZA 1OT5A 3HN3A 2QBXA 2Y6JA 2WAOA 3I3DA 1L7QA 3GXUA 2WAAA 2JE8A 3T0AA 3LEKA 1GOFA 5LA0A 2C9KA 2WUHA 4QX0A 2WQ8A 5C70A 4QPWA 2VZUA 1UXXX 2J1UA 5IFPA 2E32A 2VO5A 2C4XA 3WQBA 4BK5A 1CZVA 4KI5M 3I2KA 1K45A 3A22A 1JZ5A 2BZDA 3HNBM 3HJRA 1JHJA 1JU3A 3WF3A 4QX1A 2E33A 3C7FA 4XUNA 4LQRA 2W94A 3WNOA 5C7GA 4XZUG 3W5MA 1W8NA 3IAQA 3GM8A 1OF3A 2YFUA 1GU3A 1O59A 4A42A 2WZEA 2LS6A 2WN2A 3CKHA 2B9VA 2ZEWA 1NX9A 2CDOA 3JXSA 2L9LA 2EIDA 2XONA 1UXZA 4OYUA 2VZOA 4A41A 4RYDA 1I5PA 1K3IA 2WDBA 1F4HA 1UYYA 3A21A 3DECA 2PQSA 3VDCA 2J1RA 1R64A 3MBWA 5G04L 3K77A 2J1TA 2EICA 4IUGA 4QX2A 1J84A 2DCKA 3I2JA 3UNPA 2VZVA 1EUUA 2W1WA 1JZ7A 1YQ2A 1US3A 4KWUA 4BDVB 1P8JA 3OGRA 3WF4A 4M4PA 4DXSA 4JKMA 2BBAA 4ZY9A 4CU8A 2Z4FA 4BXSV 3WNNA 3EB7A 1JZ6A 4M4RA 4W4ZA 5IFTA 4GWIA 2V4VA 3ECQA 1JU4A 3LEIA 3GGLA 5EJ1B 3A23A 3U37A 3FN9A 4RN5A 5IJRA 3T0BA 4MGQA 4AG4A 3BGAA 2QQOA 1SDDB 3C7EA 2VCBA 2ID4A 1LNSA 3MV11 4QDSA 3ZM8A 2VMDA 2VCAA 3C7GA 4E8CA 1MPXA 3HPNA 5LA1A 2LW8A 1UY2A 2J1SA 1T2XA 1GNYA 4XUTA 3T0DA 1UZ0A 4MOAA 1CZTA 1TVGA 3K4ZA 5HXMA 1D7PM 2VZ1A 4QAWA 3I97A 3I3EA 3LEGA 4A4AA 2V5DA 2E26A 2HLEA 4CU6A 3UETA 2WZ8A 2YFZA 1PMHX 2EIEA 2WO3A 2W92A 4CUCA 5IYYA 3ACHA 4P5YA 1W8OA 2Y6HA 3DYOA 4QDRA 1UYXA 1TG7A 5JXIA 4GZ9A 2VC9A 1PX4A 1GQPA 4JKKA 2VMEA 4TXWA 4QB1A 3OGVA 3K46A 2WYSA 2RJ2A 1W9WA 2DCJA 1GUIA 3FHAA 3OGSA 2VJXA 2W1QA 4CUAA 1UYZA 1JI6A 2QQJA 1JYWA 2W47A 4QB2A 3VD9A 2VOTA 2YC4A 2YG0A 2E31A 4UOJA 2RVAA 2X05A 2Y64A 2RV9A 2JD9A 5IHRA 4DEQA 3P6BA 3NQHA 4DXRA 4LHSA 3LE0A 1GOGA 1XPWA 4XUOA 4YPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7H A;  4ZXE A;  4ET7 A;  1XC6 A;  5JXH A;  2W1S A;  2J1A A;  3MUY 1;  3SKJ E;  3WNL A;  3C7H A;  3DYP A;  4LPL A;  4QB6 A;  4CU9 A;  2XOM A;  2VZR A;  3MO4 A;  3III A;  1BHG A;  5CZK A;  1L7R A;  3HOB A;  1K12 A;  3GDB A;  3NRU A;  5DQ0 A;  3OG2 A;  3C7O A;  4L0P A;  3K4D A;  2VM9 A;  3K4A A;  3C8X A;  5DN2 A;  1US2 A;  3CMG A;  5G05 L;  3MUZ 1;  4GWJ A;  4DXT A;  1XNT A;  1JYN A;  3WNK A;  2VTF A;  3IDA A;  5LCW L;  2JDA A;  4D0Q A;  4A6O A;  5B4X A;  3PUI A;  1RYY A;  3A7Q A;  3ABZ A;  2QQM A;  2V72 A;  1K42 A;  2Y6L A;  1DYO A;  3WNP A;  2WBK A;  3E1F 1;  2VZQ A;  1HN1 A;  2JKX A;  4XUR A;  1ULP A;  3ACF A;  3FL7 A;  3THD A;  3ETP A;  1OH4 A;  1EUT A;  1UMI A;  1NKG A;  3EYP A;  2C26 A;  3CZU A;  4CVU A;  5J1X A;  4TTG A;  4A44 A;  3T09 A;  4ARX A;  3FHQ A;  4W50 A;  3SEP A;  3K75 B;  3ACG A;  2ORZ A;  2YB7 A;  5HPO A;  2W87 A;  3T2Q A;  4PF1 A;  3THC A;  1JYV A;  2BGP A;  3MV0 1;  3CZJ A;  5EIY B;  2VZ3 A;  4W8J A;  3I3B A;  2QQK A;  1DP0 A;  2W3J A;  1GOH A;  5C71 A;  1OD3 A;  5JMO A;  4XUQ A;  1JZ2 A;  1NUK A;  2X10 A;  4LKS A;  3SEE A;  5A1A A;  3T08 A;  2VZP A;  2VR4 A;  5I0D A;  3NJV A;  2HYX A;  2VQT A;  2B4K A;  5LA2 A;  4OUE A;  2QQI A;  3LPF A;  3W5N A;  1WCQ A;  3IB3 A;  2R7E B;  4XVH A;  2QQL A;  3SKV A;  3IAP A;  1PMJ X;  3WF1 A;  3LQC A;  4ZZ8 A;  2WN3 A;  3P1I A;  2BGO A;  4JKL A;  5B4N A;  2W9X A;  3CQO A;  2VZS A;  1JZ8 A;  2W46 A;  4OMC A;  5FUI A;  2DDU A;  3I2H A;  3ACI A;  2YC2 A;  1W9T A;  2ZEZ A;  4MAD A;  1CZS A;  3I2I A;  2Y6G A;  3NJX A;  1UMH A;  4D8M A;  3CIH A;  2BER A;  2ORX A;  5F7U A;  2J1E A;  3OB8 A;  2VMC A;  2VCC A;  3PUH A;  5CYY A;  3VDA A;  2W1U A;  1JZ4 A;  2XQX A;  1IQD C;  1CX1 A;  4OMD A;  4UAP A;  1JYX A;  1UY0 A;  4PT6 A;  4MGS A;  4OZO A;  1UWW A;  1F4A A;  3D3A A;  5JXG A;  1JZ3 A;  3HNM A;  5EJZ B;  1W99 A;  3NNG A;  3HEI A;  2VL4 A;  4DUW A;  4QDQ A;  3AC0 A;  2Y8K A;  1CIY A;  4QX3 A;  1DLC A;  4E8D A;  3BN6 A;  3T2P A;  1UY1 A;  2X09 A;  4BJ0 A;  1KGY A;  4DEV A;  3OBA A;  1KEX A;  3UES A;  2W91 A;  5JUV A;  2ZXQ A;  3VD3 A;  1PX3 A;  1UX7 A;  4CU7 A;  4P08 A;  1OF4 A;  2WAB A;  5DPN A;  2OKX A;  2W5F A;  3I2F A;  3VD7 A;  1O8S A;  3I2G A;  1H6X A;  3WEZ A;  1UY4 A;  3DYM A;  5DMY A;  2ZEX A;  4Z2A A;  4DUV A;  2VZT A;  4P02 B;  3VD4 A;  3WF2 A;  4P00 B;  4MO3 M;  4A3Z A;  5JXJ A;  3T2O A;  4AAX A;  2J1V A;  2ZEY A;  3VD5 A;  5JR2 A;  2KD7 A;  1UY3 A;  3VDB A;  4BK4 A;  4CUB A;  2Y6K A;  2WO1 A;  4PQQ A;  2VMF A;  1XNA A;  4A45 A;  4JX0 A;  4FI9 A;  4ZZ5 A;  1W0N A;  2XHN A;  3OEA A;  1W9S A;  4DUX A;  4XUP A;  3CDZ B;  4KMQ A;  3LPG A;  4UI9 L;  1O8P A;  2W95 A;  3WNM A;  2QQN A;  3WF0 A;  3OEB A;  3WSO A;  4HG6 B;  2CDP A;  2VQU A;  2J22 A;  1ULO A;  4ARY A;  1SG3 A;  2J7M A;  2WO2 A;  4JHZ A;  1GMM A;  2EIB A;  1WKY A;  1H6Y A;  1NAE A;  1J83 A;  3HNY M;  1SHW B;  3F2Z A;  1OT5 A;  3HN3 A;  2QBX A;  2Y6J A;  2WAO A;  3I3D A;  1L7Q A;  3GXU A;  2WAA A;  2JE8 A;  3T0A A;  3LEK A;  1GOF A;  5LA0 A;  2C9K A;  2WUH A;  4QX0 A;  2WQ8 A;  5C70 A;  4QPW A;  2VZU A;  1UXX X;  2J1U A;  5IFP A;  2E32 A;  2VO5 A;  2C4X A;  3WQB A;  4BK5 A;  1CZV A;  4KI5 M;  3I2K A;  1K45 A;  3A22 A;  1JZ5 A;  2BZD A;  3HNB M;  3HJR A;  1JHJ A;  1JU3 A;  3WF3 A;  4QX1 A;  2E33 A;  3C7F A;  4XUN A;  4LQR A;  2W94 A;  3WNO A;  5C7G A;  4XZU G;  3W5M A;  1W8N A;  3IAQ A;  3GM8 A;  1OF3 A;  2YFU A;  1GU3 A;  1O59 A;  4A42 A;  2WZE A;  2LS6 A;  2WN2 A;  3CKH A;  2B9V A;  2ZEW A;  1NX9 A;  2CDO A;  3JXS A;  2L9L A;  2EID A;  2XON A;  1UXZ A;  4OYU A;  2VZO A;  4A41 A;  4RYD A;  1I5P A;  1K3I A;  2WDB A;  1F4H A;  1UYY A;  3A21 A;  3DEC A;  2PQS A;  3VDC A;  2J1R A;  1R64 A;  3MBW A;  5G04 L;  3K77 A;  2J1T A;  2EIC A;  4IUG A;  4QX2 A;  1J84 A;  2DCK A;  3I2J A;  3UNP A;  2VZV A;  1EUU A;  2W1W A;  1JZ7 A;  1YQ2 A;  1US3 A;  4KWU A;  4BDV B;  1P8J A;  3OGR A;  3WF4 A;  4M4P A;  4DXS A;  4JKM A;  2BBA A;  4ZY9 A;  4CU8 A;  2Z4F A;  4BXS V;  3WNN A;  3EB7 A;  1JZ6 A;  4M4R A;  4W4Z A;  5IFT A;  4GWI A;  2V4V A;  3ECQ A;  1JU4 A;  3LEI A;  3GGL A;  5EJ1 B;  3A23 A;  3U37 A;  3FN9 A;  4RN5 A;  5IJR A;  3T0B A;  4MGQ A;  4AG4 A;  3BGA A;  2QQO A;  1SDD B;  3C7E A;  2VCB A;  2ID4 A;  1LNS A;  3MV1 1;  4QDS A;  3ZM8 A;  2VMD A;  2VCA A;  3C7G A;  4E8C A;  1MPX A;  3HPN A;  5LA1 A;  2LW8 A;  1UY2 A;  2J1S A;  1T2X A;  1GNY A;  4XUT A;  3T0D A;  1UZ0 A;  4MOA A;  1CZT A;  1TVG A;  3K4Z A;  5HXM A;  1D7P M;  2VZ1 A;  4QAW A;  3I97 A;  3I3E A;  3LEG A;  4A4A A;  2V5D A;  2E26 A;  2HLE A;  4CU6 A;  3UET A;  2WZ8 A;  2YFZ A;  1PMH X;  2EIE A;  2WO3 A;  2W92 A;  4CUC A;  5IYY A;  3ACH A;  4P5Y A;  1W8O A;  2Y6H A;  3DYO A;  4QDR A;  1UYX A;  1TG7 A;  5JXI A;  4GZ9 A;  2VC9 A;  1PX4 A;  1GQP A;  4JKK A;  2VME A;  4TXW A;  4QB1 A;  3OGV A;  3K46 A;  2WYS A;  2RJ2 A;  1W9W A;  2DCJ A;  1GUI A;  3FHA A;  3OGS A;  2VJX A;  2W1Q A;  4CUA A;  1UYZ A;  1JI6 A;  2QQJ A;  1JYW A;  2W47 A;  4QB2 A;  3VD9 A;  2VOT A;  2YC4 A;  2YG0 A;  2E31 A;  4UOJ A;  2RVA A;  2X05 A;  2Y64 A;  2RV9 A;  2JD9 A;  5IHR A;  4DEQ A;  3P6B A;  3NQH A;  4DXR A;  4LHS A;  3LE0 A;  1GOG A;  1XPW A;  4XUO A;  4YPJ A; 
#chains in the Genus database with same CATH topology
 3J7H A;  4ZXE A;  4LTA A;  3FFQ A;  3KWV A;  3TRS B;  5JXH A;  1HV1 A;  1LOF A;  4CDU B;  2VUL A;  3PHM A;  1LES A;  1WD3 A;  2VOX A;  3PNA A;  4LPL A;  3HT2 A;  4QB6 A;  4YGE A;  4CU9 A;  3POJ A;  4L2N A;  3NV4 A;  1FNY A;  1SLL A;  4XF4 A;  1AR8 2;  1RUH 1;  2XKP A;  1F2N A;  1C1F A;  5LY2 A;  4AFA A;  1L7R A;  5C8W A;  1RUN A;  3PVE A;  4XDP A;  4CXY A;  1K12 A;  3RYR A;  2JIC A;  3OG2 A;  2RS1 3;  4L0P A;  3J4U H;  4XW3 A;  2H0B A;  3VBO C;  4AVB A;  4JQT A;  2CNA A;  2OS2 A;  4AEJ A;  2XL9 A;  1LR5 A;  3MZH A;  4K1Y A;  3A0N A;  3S7I A;  3IZO A;  3WHU A;  1OVP A;  5HCH A;  3IIA A;  1W8H A;  1WGP A;  4JHT A;  4OVE A;  2B5H A;  5IAV A;  4CCN A;  5DDJ 1;  1W6Q A;  1VBC 1;  4C1W A;  4O65 A;  2LAL A;  4YLZ A;  5E1R A;  4C0H A;  5JSO A;  1PGL 2;  3WQ0 A;  1OPO A;  2AEZ A;  3IDB B;  2DU0 A;  3MIC A;  4A6O A;  2RJL A;  3ILR A;  5ANQ A;  5CU1 A;  3VZK A;  4MG2 A;  1EAH 1;  2XUM A;  5GLZ A;  4DY3 A;  1RYY A;  2QQM A;  1UMZ A;  1H30 A;  1E5H A;  1NZI A;  1AL2 3;  2WNU B;  2Y6L A;  1XYN A;  1S0I A;  3KT4 A;  4GMP 1;  4PIZ A;  2Q8C A;  2MEV 2;  1CAW B;  1MAC A;  2VZQ A;  3USU B;  4G4F A;  1HJG A;  1OH4 A;  3NAP B;  1HX6 A;  1UMI A;  3BUC A;  4OZX A;  3NNM A;  4Q26 A;  5J1X A;  2ARC A;  3HQR A;  1WW6 A;  4CCM A;  4P9J A;  5J37 A;  2F17 A;  3H7J A;  3ZIW A;  3SEP A;  5E6H A;  2UY9 A;  4FPH A;  2ORZ A;  4Y1X A;  5HPO A;  5J7M A;  4G3Y C;  5KXB A;  3O1S A;  5LAS A;  2W87 A;  2P3K A;  3G6J B;  1PVC 3;  4L99 A;  3UGG A;  3RGB A;  4WVW A;  1JYV A;  4FP3 A;  4QPG B;  1MR5 A;  3O5S A;  1NE6 A;  4HVQ A;  3ZPY A;  3K2O A;  3V56 A;  3WHT A;  5BNP B;  2WL1 A;  3MPB A;  1SAC A;  1EPZ A;  5IK8 A;  3I3B A;  4PLO A;  1HB1 A;  1GOH A;  4IND A;  2HWE 1;  1AUY A;  1ZRI A;  2CGO A;  3LA3 A;  5GLT A;  5C71 A;  2ARB A;  2ZHN A;  4XUQ A;  1GZ9 A;  2GSY A;  4BMB A;  1LHW A;  3ZOI A;  2TBV A;  3LCP A;  1JH5 A;  1I6X A;  1HRI 3;  1C8M 3;  2OZJ A;  2X10 A;  4JRA A;  1QJZ A;  3OJB A;  3SEE A;  1C8N A;  3OTF A;  5I0D A;  4UW6 A;  2PMW B;  2HYX A;  5DAX A;  4B4P A;  4WBB A;  1PK6 C;  3OD4 A;  2PQQ A;  4AQ2 A;  3AXD A;  1WCQ A;  4XVH A;  4AQ6 A;  5C4W A;  3SKV A;  2VNR A;  4S2F A;  2BUK A;  3U1X A;  2K0G A;  5JSP A;  5GZG A;  1FOD 3;  1Z7S 1;  2RMU 2;  1KDM A;  2WNU C;  2XJT A;  4XDO A;  2BGO A;  1QJU 3;  3CQO A;  5ACA 1;  2GH8 A;  3SCG A;  1LAJ A;  3C2U A;  1FPN 1;  3NAP C;  1F15 A;  1VP6 A;  2R6Q A;  2UYB A;  3AFG A;  5L73 A;  3N9Q A;  4GUL A;  4L8Q A;  5APA A;  5FO8 B;  4JGZ B;  3RRD A;  2ZEZ A;  3I2I A;  2Y6G A;  3KCC A;  4Y4R A;  2QZ3 A;  1DZR A;  3JQX A;  3ZN4 A;  5C9A B;  1AXY A;  4MVT A;  1OXC A;  3O0V A;  2ORX A;  3P5B A;  5F6L B;  4RS5 B;  3RJR A;  5F7U A;  4XTM A;  1B35 A;  4YGB A;  1NY7 1;  1W3V A;  4KWJ A;  1D2S A;  3OB8 A;  3Q8E A;  2FQP A;  2IXL A;  2VMC A;  5T5J A;  2NM1 A;  4XFH A;  2NN8 A;  1Q43 A;  4WM8 C;  4QPI A;  2ZAC A;  4QPG C;  2JDP A;  4BYY A;  1HQW A;  1TME 3;  4NHM A;  3I3M A;  1YC6 1;  1E57 A;  2X29 A;  4OMD A;  2OUH A;  5FWJ A;  2GC0 A;  4Y1U A;  1BKZ A;  3CNA A;  4FPC A;  2RS1 1;  1JZ3 A;  3HNM A;  2X5I A;  3J26 N;  4YM3 A;  1UYP A;  1YFX A;  2Z2S B;  1NCQ B;  3NNG A;  3HEI A;  3R05 A;  2VL4 A;  1RUE 2;  4R9D A;  3V65 A;  4DUW A;  3E5X A;  4QDQ A;  3VBS C;  2XBO 3;  3AC0 A;  4ZHN A;  1CIY A;  3OBZ A;  2BDR A;  3N9L A;  3O1R A;  4YVW A;  1AJK A;  2JEC A;  3T2P A;  2MNG A;  4LO7 A;  1MZF A;  1A8D A;  2X09 A;  2XVG A;  4Z07 A;  2BGC A;  2E9Q A;  2A6X A;  3LSD A;  3SH5 A;  3WX5 A;  2RS5 3;  4Q0V A;  1COV 2;  4HK8 A;  3OBR A;  1RUI 2;  1N1V A;  3UES A;  2W91 A;  1V0A A;  1UNB A;  5SV8 A;  3WDT A;  1UX7 A;  4XBL A;  3JBG 1;  2EA7 A;  5IUQ A;  2CAU A;  5EYY A;  1V00 A;  2ZX4 A;  4X8N A;  1HRV 1;  2OKX A;  2JWP A;  4LXL A;  3JB4 C;  4EN0 A;  3VD7 A;  1O8S A;  2VY0 A;  2RDS A;  3I2G A;  3WD5 A;  3ZFG A;  4NAM A;  3RWK X;  5FR3 A;  4F3J A;  1WLC A;  1EP0 A;  4EWD A;  2IVI B;  1IPJ A;  3PJQ A;  1SBF A;  3BKZ A;  1C5H A;  3K3O A;  1RUD 2;  3QH6 A;  2XB6 C;  4MO3 M;  1X36 A;  4UFK A;  1BVP 1;  3S57 A;  4AAX A;  1RIT A;  1OA2 A;  5FZF A;  1UY3 A;  1KJR A;  1ULG A;  4TWT A;  3N9M A;  3BIW E;  1JYT A;  4M3C A;  3PVN A;  3B5L B;  3K51 A;  3POI A;  3ATG A;  2D98 A;  4A45 A;  3HMY A;  1R1Z A;  2LTN A;  4ZZ5 A;  1OLQ A;  5JOW A;  5EV7 A;  5J09 A;  3EBR A;  3POB A;  2EAA A;  1SDW A;  2K2S A;  4XUP A;  1S2B A;  4XAE A;  5FZ9 A;  1IHM A;  4CDW C;  1O8P A;  3HIF A;  4MH0 E;  1HXS 2;  4MXW A;  1YNA A;  3OEB A;  4S2D A;  5BY5 A;  1GBG A;  3VLB B;  1LOA A;  4AQT A;  2VQU A;  1PNF A;  2J22 A;  1GNZ A;  4C0B A;  5L9R A;  1SG3 A;  4QQH A;  4XCB A;  2J7M A;  3WDY A;  1ENR A;  2WO2 A;  5HCF A;  5LEK A;  1GMM A;  1QXJ A;  2PAM A;  1ONA A;  4IEX A;  4H3W A;  4RQP B;  3TBD A;  5EHD A;  3RI9 A;  5A32 A;  2WC2 A;  4NPL A;  3I2O A;  5M0T A;  1NAE A;  4C1X A;  4IW3 A;  1ZZ9 A;  3BPZ A;  1OT5 A;  1S1A A;  4TSV A;  3ZXK A;  1Z78 A;  1QJU 1;  5K7P A;  5A7S A;  4XYX A;  1ZBE 2;  1D0G A;  1J3Q A;  1J1T A;  2VNO A;  2ZMK A;  3AMQ A;  3B7M A;  1QH7 A;  1LB2 A;  4IEZ A;  4YVS A;  2WAA A;  3H1M A;  3QD6 A;  2Q30 A;  3WDX A;  4AVC A;  3Q9O A;  4I02 A;  4FPO B;  4IGO A;  3WG4 A;  2NP0 A;  3W58 A;  2V5Y A;  3NNJ A;  1RTV A;  3J8F 1;  1DQ4 A;  4P14 A;  1X9P A;  1CAU A;  2WQZ C;  4LMF A;  3B94 A;  1YWK A;  3ZFF A;  4QX0 A;  1G9A A;  5JZG C;  4B3N A;  3TN9 3;  1TMF 2;  1SLA A;  4NHX A;  1XE8 A;  2VZU A;  2ZGU A;  5LA9 A;  5C33 A;  3SH4 A;  3GAL A;  1NLQ A;  2VO5 A;  3AZZ A;  3O1U A;  4GB3 2;  3WLU A;  4K9S A;  1HV0 A;  1K45 A;  3A22 A;  1CR7 A;  4IEU A;  4QXK A;  4Q4V 3;  5DAB A;  1V6J A;  2BZD A;  5T5O A;  1NA1 A;  1PMI A;  5FY5 A;  5FKB A;  3AKQ A;  4FQZ A;  2MHF A;  3C7F A;  5I93 A;  3N7J A;  4BZ4 A;  1FMD 2;  2ZX3 A;  3VKN A;  2W94 A;  2Q8O A;  4Z2W A;  4XF9 A;  2BVB A;  1REF A;  4XZU G;  3RMY A;  1W9F A;  4Z8B A;  1DHK B;  3ZDV A;  2XBO 1;  4NO4 A;  4IES A;  1AYM 3;  1OF3 A;  1GU3 A;  4KNC A;  4LBK A;  4LBQ D;  2PHD A;  2WZE A;  1YI7 A;  1UU6 A;  4YM1 A;  3T2T A;  5CAZ A;  1UZZ A;  3MI8 A;  4DMI A;  2WN2 A;  2H6C A;  3B01 A;  4K3U A;  4JQR A;  4RQP C;  3V0B B;  4LLO A;  2EAK A;  2ZEW A;  1IPS A;  2RS5 1;  4XIO A;  5C8C A;  4LBJ A;  2BVV A;  3VKL A;  1EV1 1;  4HL0 A;  4CP9 A;  5FLH A;  2XON A;  4XXA A;  4MZU A;  2WLQ A;  2PLV 1;  3OOX A;  2K46 A;  5FZ6 A;  5F2S A;  4IEW A;  1Q8Q A;  5D21 A;  4NE9 A;  1NXD 1;  1RUC 3;  3E6D A;  5JOZ A;  5KXC A;  1I5P A;  3LDK A;  4IL7 A;  4COW A;  4COY A;  4LUK A;  5E89 A;  4LEJ A;  5FMO S;  1VRH 3;  2WDB A;  4XHX A;  2WII B;  1VE0 A;  2C6S A;  4UFH A;  4XJ8 A;  3UGF A;  4FOV A;  3ZYG A;  4CDX A;  4OCT A;  4CCO A;  1MVE A;  2PQS A;  4CEY B;  3VDC A;  2IXI A;  3KCX A;  4D7T A;  1R64 A;  1YQ8 A;  1AJO A;  1AYN 2;  3H1Y A;  1BK0 A;  3ME2 A;  2CV6 A;  2YMZ A;  3Q8B A;  3CJI C;  3K77 A;  3ZIX A;  1UKG A;  4GH4 B;  4Q0U A;  2DV9 A;  2D93 A;  1QXR A;  1UOG A;  3VL9 A;  3I2J A;  1ULF A;  5ACA 2;  1WZX A;  3M3E A;  4IEP A;  4HOO A;  4BQ2 A;  1MQT C;  5FZG A;  3VZO A;  4EN8 B;  5JSR A;  3UNP A;  1EUU A;  1QOS A;  1W0P A;  2P3I A;  2R04 2;  5EP9 A;  3ZYP A;  1OOP B;  1US3 A;  1V6M A;  4BXF A;  5JI9 A;  3KV4 A;  3PUQ A;  4E9K A;  4Y20 A;  5ABJ C;  1KIT A;  4SLI A;  4JDO A;  3WF4 A;  1Q8O A;  3NMB A;  4DXS A;  1HB2 A;  3AYE A;  4UYB A;  2X8K A;  2ZGM A;  3E6B A;  1R08 3;  4OHX A;  4PCR A;  3WNN A;  3QBQ A;  4V1P A;  2VNG A;  4GKX A;  4W65 A;  2IXH A;  5FBJ A;  4GWI A;  1AXZ A;  2EVX A;  3ECQ A;  4MGI E;  4TZD A;  3DXT A;  4E2G A;  2WZR 3;  3O0X A;  4BQ4 A;  5CIS A;  3ACL A;  2NPI A;  1Z0H A;  4YW5 A;  3H7Y A;  4RR3 A;  5HXV A;  5DUU A;  3MDP A;  1ND3 C;  4RN5 A;  2VOW A;  4CDQ A;  3T0B A;  3VZN A;  4GIQ A;  2P17 A;  1GQG A;  2TUN A;  5BV6 A;  1NCR B;  4AGR A;  1OD5 A;  1VRB A;  1YRZ A;  4QDS A;  1OUS A;  2VPV A;  1NQD A;  4JTO A;  2VMD A;  3ES1 A;  5K0U C;  2YBP A;  1RIN A;  4XZP A;  5FZ8 A;  2ZJC A;  3MIF A;  1RUF 3;  3KV5 A;  4Z92 B;  3D5O A;  4UBH A;  1V9U 2;  5T5P A;  1K5M B;  4EQV A;  1UY2 A;  4Y4Y A;  1HKD A;  1T2X A;  1GNY A;  1NLR A;  2RDN A;  4PDW A;  3DUI A;  3VBU B;  1CAV B;  4CEY C;  5FMD A;  3KGZ A;  2P6C A;  3SLI A;  1CGP A;  1S0C A;  1AL2 2;  4GH4 C;  4YW6 A;  2UUR A;  4J25 A;  3M8L A;  4OI2 A;  3N4M A;  5FXZ A;  4FFI A;  2HLE A;  5I8Y A;  1OOP C;  1XU1 A;  5IVE A;  1BXH A;  3AKR A;  4Q4V 1;  4QX8 A;  2R07 3;  3TEZ A;  2ENR A;  1O4T A;  1PMH X;  3LA2 A;  5CFD B;  1RB8 G;  5GLU A;  2Y6F A;  3TB0 A;  4BQ1 A;  3TAY A;  5LEJ A;  2HWD 3;  3RZL A;  4XHB A;  4CUC A;  4I0W B;  3ACH A;  4XAC A;  5FZM A;  1PVC 2;  1MEC 3;  1VBD 1;  3WP6 A;  3EMR A;  3HD8 B;  1W90 A;  1LOF C;  2PXJ A;  2CAV A;  1M4W A;  4AHZ A;  5T5L A;  2D97 A;  3E6C C;  5JXI A;  4KH9 A;  2HWF 1;  4IV1 B;  3WG3 A;  4CCK A;  3DGT A;  5FZB A;  5HBA A;  1LGC A;  3ZFE B;  1SZB A;  1W6M B;  3OGV A;  3K46 A;  3KS7 A;  4XET A;  5IT6 A;  1W03 A;  5IW0 A;  4AVS A;  1GFF 2;  3FHA A;  5KHH A;  3I49 A;  2EAL A;  3M3C A;  5FKC A;  2VJX A;  2AYH A;  2FCV A;  4K8F A;  1HRI 2;  4K8R B;  1C8M 2;  1LUL A;  1LOD A;  4LBQ B;  4Y1Y A;  4QGL A;  1E5R A;  1YCI A;  2HEY F;  4Y5Z 0;  5FP4 A;  2FDI A;  3RFR A;  1VRH 1;  2WLP A;  1K5M C;  2GU9 A;  3SMH A;  3OUH A;  3T1M A;  1W06 A;  2YGL A;  4NID A;  1QJY 2;  4CP0 A;  4FXG B;  2O8O A;  2WR9 A;  1VAM A;  4BE3 A;  1FOD 2;  4FPG A;  5FY4 A;  1IGO A;  1DQ5 A;  4DEQ A;  5DZG A;  5ISL A;  5HI0 A;  4AI8 A;  3GHN A;  3DN7 A;  1QKQ A;  3UL2 A;  3B02 A;  2DCY A;  1N1T A;  2GP5 A;  2RM2 2;  1ASJ 1;  4LHS A;  5LBE A;  2P5B A;  1GOG A;  2JG8 B;  1XND A;  4XUO A;  2RS3 3;  2YYO A;  5K9Y A;  3VHO A;  1UW8 A;  5KXD A;  1S2K A;  4N43 B;  1LHU A;  1LOE A;  3AFK A;  4ET7 A;  1R08 1;  3T4H B;  3BTA A;  4A42 A;  1Y9Q A;  4Y33 A;  2W1S A;  3OYW B;  5FLI A;  1GWK A;  1ULC A;  1VBB 3;  4M01 A;  3WNL A;  4CCL A;  4FTE A;  5A3W A;  2OVU A;  3WP3 A;  4PLM A;  3T3Y A;  2ZGO A;  1IS4 A;  2UWB A;  1Y9M A;  5CG9 A;  1TME 2;  3ZN6 B;  1U5Z A;  4QKB A;  1Q56 A;  4OHY A;  4Y22 A;  3TEW A;  3BYW A;  3NRU A;  5LK7 B;  2D6N A;  4JGY B;  4HBN A;  1Y7B A;  1NQJ A;  1C5I A;  3B00 A;  3WVJ A;  5GAL A;  4CCE A;  2YHJ A;  4K21 A;  5G05 L;  4EE2 A;  2OUJ A;  2VEC A;  4DIQ A;  1EPW A;  2X5I B;  4Y26 A;  4EWE A;  1O4Y A;  2UU8 A;  2PEL A;  2DTY A;  1KFU L;  2XBO 2;  4QXC A;  1W8U A;  4R4X A;  1XNT A;  5DAW A;  5J98 B;  5IVV A;  1JYN A;  2YZ4 A;  3MLJ A;  4WZC A;  2VTF A;  5LCW L;  1HQN A;  4IQP A;  2YXS A;  3ZYJ B;  2ARA A;  4UW4 A;  4EV0 A;  1N3Q A;  5J96 B;  5A7W B;  4BB3 A;  5B4X A;  2BRT A;  2A5Z A;  3PUI A;  5D8A B;  2HBU A;  2WT0 A;  3ABZ A;  3WG2 A;  2XLF A;  2V72 A;  1H1M A;  2FDJ A;  5C4W C;  5C6C A;  1TEI A;  2VTX J;  5FIX A;  5H9R A;  4HPK B;  5F5I A;  1XYO A;  5F39 A;  2JKX A;  5H9P A;  4B1M A;  4N53 A;  4Q0Q A;  1QNW A;  1R1A 3;  1ULP A;  5HCA A;  3ETP A;  1FAY A;  1W6O B;  3BU7 A;  1EUT A;  3T30 A;  3WG1 A;  4CVU A;  5FPB A;  4D7S A;  2R07 1;  3T09 A;  3WP4 A;  1SLT A;  1UAI A;  2D6M A;  2ZML A;  3FHQ A;  1CJP A;  4DPN A;  3ACG A;  1MZE A;  2YB7 A;  1OUR A;  1ZA4 A;  2BEO A;  4FQ4 A;  2E7T A;  4JCK A;  2HWD 1;  1OA4 A;  1LJ7 A;  4GMP 3;  2ZBJ A;  3JB8 A;  4PF1 A;  2P1B A;  3APB A;  5FXV A;  1W04 A;  3MLL A;  5A33 B;  5FOJ B;  3AYD A;  2BGP A;  3MV0 1;  2BJS A;  2WNV A;  5GLV A;  4CP2 A;  4LLF A;  2QQV A;  1LOB A;  1O5U A;  2ZS6 B;  4UBG A;  3I3Q A;  3NO8 A;  1BEV 2;  1PM4 A;  4W8J A;  3VBH A;  4PI0 A;  1DP0 A;  2A73 B;  5FY8 A;  1DQ0 A;  4XBQ A;  1OKO A;  1QQP 1;  4JGY C;  2OQ7 A;  4IEO A;  5F5Q A;  4LO6 B;  3NKT A;  5FMC A;  3FMG A;  5L9V A;  4D7Y A;  1PM7 A;  2JX9 A;  3ZR6 A;  3MF9 A;  1JZ2 A;  2C9A A;  4EWA A;  2W08 A;  4LKS A;  2DFC A;  2X5I C;  3NWK A;  5A1A A;  1H1A A;  2VZP A;  2VR4 A;  2WSU A;  3NJV A;  5CFC A;  5FPZ A;  3R0R A;  1OUX A;  4EN7 B;  2B4K A;  3PME A;  2R1D A;  3LPF A;  4P5H A;  3IB3 A;  4Q1P A;  3VGI A;  3I54 A;  1KRI A;  2QQL A;  4CE8 A;  3RJ2 X;  3B9C A;  3MPP G;  2WFF 3;  4ATE A;  3VBO B;  3OF1 A;  1OHF A;  1XSR A;  3LQC A;  5EFU A;  2BW8 A;  5F3G A;  2JDY A;  2OXB A;  3P1I A;  4JKL A;  3VBF B;  1WUV A;  3FUQ A;  4A3X A;  4CRQ A;  3OSD A;  5B4N A;  1W6N A;  5FJH A;  3HWJ A;  2ZGR A;  3NV1 A;  5FK7 A;  4OMC A;  2IXJ A;  1GP5 A;  2XQR A;  5KHI A;  2JEM A;  1TNR A;  2ZX0 A;  3I2H A;  3MIG A;  4FVV A;  4QX7 A;  2YC2 A;  4ES8 A;  2PHR A;  1YJL A;  4CPB A;  1LU2 A;  3VHN A;  2J42 A;  3V0A B;  4MAD A;  2E51 A;  4NOT A;  5BPX A;  1GP6 A;  4QQO A;  4TLG A;  1JOB A;  3WV6 A;  1UMH A;  1J3R A;  4E2S A;  5F2W A;  1H2M A;  3X29 B;  1CN1 A;  2VMH A;  3KLS A;  3POS A;  2Y38 A;  4XJ9 A;  3ZFG C;  2J1E A;  4UFL A;  4EJR A;  3ST7 A;  3TN9 2;  1VBB 1;  1O5L A;  3IDC B;  1RHI 3;  5I0S A;  4HVR A;  5FO9 B;  4CCD A;  2W1U A;  1VMF A;  2G4I A;  2XQX A;  5FP7 A;  2D43 A;  1WD4 A;  1WMD A;  2KR2 A;  2D3P A;  1JYX A;  3BTZ A;  3NKG A;  1R09 2;  1LEN A;  2WWS A;  3DL3 A;  4XQW A;  4OZO A;  2WS9 2;  4IXL A;  4LBO A;  4AI9 A;  3WCR A;  4AHY A;  1IKP A;  3HBK A;  4Q4X 1;  1W99 A;  3LF7 A;  5EXO A;  1UIK A;  1X33 A;  2JKB A;  3PIG A;  3HVD A;  4GWN A;  4BCU A;  5BNO A;  3KGL A;  1HLC A;  3WDU A;  4Z1V A;  1BCX A;  4WZF A;  4NIG A;  4A7Z A;  2Y8K A;  2O8Q A;  2VH9 A;  3DKW A;  2R06 2;  4L92 A;  3T4V A;  2ADD A;  5FXW A;  4AHW A;  4X6R B;  1AYM 2;  4A7Y A;  1V6I A;  4CZS A;  3BN6 A;  1BJQ A;  2QE3 A;  2JG9 B;  4FPY A;  3BAL A;  2Y34 A;  1GZW B;  3B9I A;  3BOD A;  3V64 A;  1Q5O A;  2FCT A;  1STM A;  3DPR A;  1KGY A;  2DVG A;  2ZAA A;  3M70 A;  3OBA A;  4PJY A;  4Y5T A;  4YZ3 A;  3UK9 A;  2WNE A;  4IE6 A;  3RI8 A;  1RVF 3;  4LIT A;  3VD3 A;  3VBF C;  5E16 A;  4AYU A;  3MF6 A;  3DXU A;  4P08 A;  2C0Z A;  4AAP A;  1W2A X;  1ND2 A;  2ETE A;  1M06 G;  1OF4 A;  5DPN A;  1R1A 1;  2I45 A;  2IXK A;  2W5F A;  4AE2 A;  5AC9 2;  1RUC 2;  4FPL A;  1C4R A;  1PK6 B;  2TEP A;  5FZO B;  1T6B X;  2Q5T A;  1JXN A;  5A6Z A;  1H6X A;  4YW3 A;  3WEZ A;  5FYY A;  3ITQ A;  1H1I A;  1IPK A;  2PFW A;  4YVS C;  5FZC A;  2VZT A;  3W59 A;  2P6H A;  3VD4 A;  1H2K A;  1UN1 A;  3CHX A;  4P00 B;  2P3J A;  1AZD A;  2VTX A;  4A3Z A;  1YFW A;  2VOK A;  3M7A A;  3JBG 3;  4W6Y A;  5ERL A;  2J1V A;  5JR2 A;  3GBG A;  5EZW A;  2KD7 A;  1HRV 3;  2ZGP A;  3M2M A;  3ZFF C;  1QJE A;  5LAT A;  2VW2 A;  1W6P B;  4LE4 A;  3M1H A;  4CUB A;  3MFC A;  1V70 A;  4QHZ A;  1X8M A;  4P9W A;  1XJA A;  3GJB A;  4PQQ A;  2QDR A;  3RPQ A;  1XNA A;  1LHO A;  3ELN A;  3H1W A;  1J58 A;  3N35 A;  4QHB A;  2XHN A;  3OEA A;  2D6K A;  1TE1 B;  5JDB A;  3FJS A;  2GNB A;  1WLW A;  2IWG B;  2GND A;  4KMQ A;  1NA1 C;  3LPG A;  4UI9 L;  2W95 A;  1DQ1 A;  3OPT A;  2A6V A;  2QFE A;  4WM8 B;  3WF0 A;  4CXX A;  4XQ4 A;  2CDP A;  3POG A;  5FJK A;  2OPK A;  4CCC A;  3WCS A;  1O4Z A;  3N7L A;  3WW3 A;  3KVB A;  1W05 A;  2YPD A;  2WZR 2;  5KR7 A;  1BMV 1;  4ARY A;  1QHD A;  1V6N A;  2VW1 A;  2JG9 C;  1LED A;  3FLP A;  4HFS A;  4JHZ A;  4Q0P A;  5I0T A;  5LB6 A;  3VHR A;  2CTV A;  2RE9 A;  2WFF 1;  3CU7 A;  1WKY A;  3SCF A;  5FQ0 A;  4XXP A;  1FX5 A;  5D1I A;  3F2Z A;  2HKX A;  3MIB A;  4JVA A;  1XNC A;  2BFU L;  4HSJ A;  1LTE A;  4OI1 A;  2QBX A;  2Y6J A;  3VBS B;  1AR9 3;  3I3D A;  4URT A;  1SPP B;  1L7Q A;  2CU5 A;  1TNF A;  3FFZ A;  4LO5 B;  4D6S A;  3T0A A;  1RUF 2;  1XE0 A;  3ZSM A;  1OLM E;  4QGM A;  4AGG A;  3D6E A;  1PIV 2;  1AX2 A;  4CDX C;  2R1B A;  3N9N A;  2CY6 A;  4QPW A;  1FYU A;  1RHI 1;  2J1U A;  2BNM A;  2QQU A;  4XOG A;  5A3N A;  4QWN A;  2ZCW A;  3WQB A;  4RHV 1;  1W3X A;  1CZV A;  2ZAB A;  4XTP A;  3W20 A;  1JZ5 A;  1LOG A;  4BA6 A;  4BPZ A;  3HNB M;  3HJR A;  3J8F 3;  5FYH A;  1JHJ A;  3LIG A;  5GZD A;  1O7F A;  3H8O A;  4QX1 A;  1DGW A;  1H8T A;  2DFB A;  4GKY A;  5FY1 A;  4YZ2 A;  3WDW A;  3IDE A;  4XIK A;  4XFG A;  2YY1 A;  4HKW A;  3LD8 A;  5T3N A;  3NV2 A;  2BNO A;  4H55 A;  1MEC 2;  1MS9 A;  3WDV A;  3O1M A;  2YRO A;  5FPU A;  3GM8 A;  1FT9 A;  4IET A;  1O59 A;  1ODM A;  4DQA A;  1UPS A;  3AVS A;  4FPK A;  2ZHK A;  1VLN A;  2Q1F A;  4L11 A;  4H7M A;  3CKH A;  1VPH A;  2B9V A;  2NZ9 A;  3UKN A;  4WM7 B;  3AMM A;  2CDO A;  4I2O A;  4KBZ A;  1H4H A;  3EXU A;  4RR3 C;  4CDQ C;  3BVC A;  2L9L A;  1YLL A;  4CDW B;  1RVF 1;  2GAL A;  4LOS A;  3ZMN A;  1ST8 A;  1HQL A;  1XRU A;  1VBE 2;  2GNT A;  3U10 A;  3HN1 A;  4HVO A;  4Q8L A;  3J7M A;  1WME A;  4ZS3 A;  4NIH A;  2VZO A;  4IV3 A;  4RYD A;  4NPM A;  5BYN A;  5CKN A;  1UYY A;  3I59 B;  3ZR5 A;  1VAV A;  3MIH A;  2J1R A;  3M3I A;  1PNG A;  1EV1 3;  1RUJ 3;  2VOV A;  2RR1 1;  3KV6 A;  3TOJ A;  4COV A;  3OY8 B;  1VBA 3;  2J1T A;  5FY7 A;  4PDW C;  2PLV 3;  2DCT A;  4CEW B;  3FC0 A;  4N90 A;  2Q1Z B;  2ILM A;  2VVE A;  1ENS A;  2DVB A;  1JZ7 A;  3P3N A;  1YQ2 A;  1RGS A;  3W9A A;  4BDV B;  4LHL A;  5A1L A;  1RMU 1;  3KB5 A;  2RS3 2;  1MZ5 A;  1W28 A;  2VD7 A;  1MS1 A;  4BM8 A;  5IAT A;  1GV9 A;  3LGR A;  3UV9 A;  4CU8 A;  3ROU A;  3JD7 2;  1W0O A;  1H9W A;  2Z4F A;  3SHR A;  5JZG B;  1AR7 1;  2WA4 A;  3EB7 A;  1JZ6 A;  4IE7 A;  2XJR A;  3VUO A;  4ITC A;  3VHP A;  5A6Q A;  4AI0 A;  3HQX A;  4M0N A;  2XJU A;  4P9X A;  3LOB A;  4DRV A;  1RXF A;  2XUE A;  1JBC A;  3BB6 A;  3LDR A;  3LEI A;  1ACC A;  3GGL A;  4HN0 A;  2DVA A;  1DZQ A;  3U37 A;  3KQR A;  4AW7 A;  1YIF A;  1RUG 1;  5FWE A;  5IJR A;  3CL1 A;  4WM7 C;  4HKL A;  4MGQ A;  2YBK A;  3ZKY A;  4I0A A;  2GC2 A;  2ZZJ A;  1SDD B;  3ASI A;  5L7O A;  1WLT A;  2VCB A;  5FYU A;  1UZY A;  3IPV B;  4RGG A;  4XC9 A;  1I3H A;  2D40 A;  4COU A;  2DWR A;  4OHW A;  3ZM8 A;  4D6Q A;  4YGC A;  5FYV A;  1AR9 1;  1W2T A;  3C7G A;  4WVM B;  3ETQ A;  1J59 A;  5CA6 A;  2A3X A;  1RUH 2;  4AED A;  2PHF A;  5LA1 A;  4ZU7 A;  2Q1M A;  1RXG A;  3S6P A;  2R16 A;  1DGW X;  3MYX A;  2F4L A;  2I07 B;  4AF9 A;  3T0D A;  1G7Y A;  3IM0 A;  4MOA A;  1YFU A;  1CZT A;  4ASL A;  4QU2 A;  3S5A A;  3U78 A;  3D0J A;  1LHV A;  3K4Z A;  5JCT A;  4CEW C;  1NYW A;  1X7N A;  2A3Y A;  3PLQ A;  3I3E A;  5T54 A;  5DDJ 2;  3FWE A;  4A4A A;  2V5D A;  4FTS A;  1VBC 2;  2E26 A;  1DLL A;  3FBY A;  2WZ8 A;  4AFB A;  1D4V B;  4HXC A;  2GME A;  4XFB A;  2WZP P;  5FRA A;  2EIE A;  1EAH 2;  3RSJ A;  4K40 A;  1F5J A;  4AI2 A;  1OQE A;  2AUY A;  2EXH A;  3WW1 A;  5I0U A;  1QOO A;  2WO3 A;  4D6R A;  5LK5 A;  3CJI B;  1XQN A;  4M3C F;  4P5Y A;  4XFA A;  4XAA A;  3O14 A;  2HWC 1;  5FY0 A;  1MQT B;  1ZRF A;  3FUO A;  1UYX A;  3HQU A;  2VCM A;  3AL6 A;  1GP4 A;  2OQ6 A;  4N9H A;  3Q8A A;  1JYI A;  1QWR A;  4FPJ A;  4V2W A;  2ZGS A;  2FHR A;  1WLD A;  1G86 A;  1H2L A;  4JKK A;  1QY4 A;  3UT0 A;  5ABJ B;  2ZGN A;  3Q8C A;  5FZ7 A;  2NMO A;  1DBN A;  2EXJ A;  4KGQ A;  3AYA A;  4LA2 A;  1LKN A;  1OQD A;  1YQ6 A;  2GMM A;  4O7X A;  3VDD A;  3AP4 A;  4PQ9 A;  1VBD 3;  2AAC A;  3O1O A;  1BBT 3;  2ZGL A;  1NOV A;  4OLL A;  5A7O A;  2B8M A;  2GMP A;  2IVJ A;  4XFF A;  4YFZ A;  4UF0 A;  1Q8S A;  3SCH A;  5A1F A;  2HWF 3;  2W47 A;  3K3N A;  4FXK B;  4QB2 A;  4ZON A;  1ND3 B;  4N7I A;  1LHN A;  5IK7 A;  2ZKN A;  2HWE 2;  4HLT A;  4CDU A;  2VOT A;  2YC4 A;  3OPZ A;  2E31 A;  3AX4 A;  1IG0 A;  4KG8 A;  2JDU A;  2NYY A;  4H2A A;  1RUJ 1;  5BNN B;  3N3H A;  2ZX2 A;  3CBN A;  1MS4 A;  4DIN B;  5IHR A;  4AWD A;  1GWM A;  1O91 A;  1QXP A;  1VBA 1;  4BLI A;  1XE7 A;  4KGG A;  3GJA A;  5K0U B;  3LFM A;  2WWU A;  2Z42 A;  4COZ A;  2BWA A;  5FUP A;  5IWF A;  1S0D A;  4N53 C;  1XPW A;  3KMH A;  1DQ6 A;  2QQW A;  3S0M A;  1CX4 A;  4YG0 A;  2ZMN A;  5A7N A;  1PGW 1;  1UCX A;  1Z7S 2;  2A6W A;  3ORJ A;  3VBR B;  4AFM A;  5DAV A;  3SKJ E;  3C7H A;  3POW A;  3KHB A;  1D4M 1;  1RHI 2;  1Y3T A;  3PTR B;  1OC1 A;  2P2K A;  2XOM A;  2VZR A;  2AEN A;  1FPN 2;  2CWM A;  4YM0 A;  1ASJ 3;  3FLT A;  3I2D A;  4F8A A;  3III A;  4QPY A;  1BHG A;  4NWV A;  4U2A A;  3CEW A;  2WNV C;  1CAX B;  5FTT C;  1LCL A;  2WNU A;  2XJS A;  5FY9 A;  3GDB A;  2DYC A;  3C7O A;  1POQ A;  1CAW A;  2VM9 A;  3K4A A;  3USU A;  3AXE A;  1YUD A;  4U36 A;  3VBH C;  1IQA A;  2BOJ A;  2K9Z A;  1NY7 2;  4P9L A;  4OHZ A;  4CCJ A;  5DG2 A;  3KHC A;  5DN2 A;  1US2 A;  2D6O X;  3NAP A;  1DF0 A;  3MUZ 1;  4GWJ A;  3ZLI A;  1JUH A;  4PHZ A;  4I09 A;  4PBP A;  2ZGQ A;  4NN0 A;  1OLM A;  4DXT A;  3O7O A;  3WNK A;  2WWJ A;  3IDA A;  4IER A;  2VQ0 A;  4R4Z A;  5FZH A;  4R9A A;  4D0Q A;  3U4S A;  1C1L A;  3GHM A;  3UKV A;  1O3Q A;  1A34 A;  2NLR A;  3FBM A;  1IS5 A;  2RS1 2;  3VKO A;  4AL9 A;  1OQ1 A;  5HCB A;  1ZBA 3;  3A7Q A;  3THT A;  3JU9 A;  4ES9 A;  2FZ2 A;  5BNN C;  1AX0 A;  1K42 A;  3VKF C;  1SCR A;  4QPG A;  3MIE A;  5FFO C;  4A6S A;  4XPV A;  4FOY A;  4PIY A;  5GZE A;  3LFI A;  3DPR B;  2QQP A;  3E1F 1;  5BNP A;  1HN1 A;  4FTB A;  2HWB 1;  3KF5 A;  4XUR A;  3O1V A;  4MGT A;  2JDK A;  4ATF A;  3EYP A;  3U0Z A;  3LSE A;  3CZU A;  4TTG A;  1DGR N;  2ZGT A;  4GXL A;  1OKQ A;  2D44 A;  1ZZC A;  2TNF A;  5JVV A;  1W6Q B;  2Y0I A;  1QIQ A;  4W50 A;  2A75 A;  4CYD A;  2C24 A;  4OQ9 A;  2DBN A;  3K75 B;  2P37 A;  2VUJ A;  3AZY A;  5I91 A;  4XJW A;  3VBR C;  1IZ3 A;  1CPN A;  4RA0 A;  4LO4 B;  3B93 A;  3THC A;  3JBG 2;  4QD2 A;  4ZXK A;  4O9E A;  3RYP A;  2AR6 A;  1W9Y A;  1HRV 2;  2YC0 A;  3CZJ A;  2YV8 A;  5CEH A;  4KL1 A;  2JIJ A;  4K6B A;  1U5X A;  5FV3 A;  3ZYI B;  2VZ3 A;  1SLI A;  2GAU A;  3ZSL A;  1YI9 A;  4QGN A;  1OA3 A;  4GWM A;  2QQK A;  4LJH A;  5FAX A;  4BQY A;  2OA2 A;  1OD3 A;  5BXX A;  1OFN A;  5FXX A;  1UIJ A;  2EF6 A;  2RMU 3;  1VJ2 A;  1AR6 1;  1VB4 A;  2BTV C;  3WQ1 A;  1BBT 1;  1XXN A;  4YW4 A;  3T08 A;  4JGZ A;  4BOW A;  1W39 A;  2VW0 A;  2PN5 A;  2VXR A;  5JIA A;  5BNO C;  2XML A;  5C9A A;  1X8E A;  1PGS A;  2JDN A;  5LBC A;  1QJX 1;  1QQP 3;  2VVF A;  4RS5 A;  3WUC A;  3WP5 A;  1OBN A;  5C3S A;  3H8X A;  3BI3 A;  5JR7 B;  1Q8P A;  2R32 A;  3SIT A;  4YPJ A;  4ZZ8 A;  2WN3 A;  1VAL A;  3BIE A;  3DPR C;  2VZS A;  5FZ0 A;  3WW2 A;  2IC1 A;  2W46 A;  2OPW A;  2DDU A;  2G9Z A;  3ZMO A;  1RC6 A;  3IWZ A;  1AR8 1;  2ZAH A;  2QKD A;  3NW4 A;  1ND2 C;  2D3R A;  4IE4 A;  1W9T A;  4XJZ A;  1NCQ A;  3NST A;  4YWA A;  1CZS A;  3OUJ A;  2ES3 A;  3B3Q E;  4LBL A;  3NJX A;  2DCZ A;  3GZU C;  4WVV A;  4D8M A;  1SLB A;  2QZ2 A;  2GN7 A;  3CIH A;  5EPA A;  2BER A;  3E5U A;  5C4W B;  4LKF A;  3JUU A;  2W0X A;  1APN A;  1RUE 3;  2VUC A;  1QJU 2;  4NHK A;  3RDI A;  4YZ5 A;  5LY1 A;  3PL0 A;  5T52 A;  4FAG A;  2VNV A;  3PUH A;  5GZF A;  3RYK A;  3VDA A;  3WXP A;  2Z79 A;  3LDB A;  1WBF A;  1IQD C;  1C57 A;  1D0H A;  1ZRR A;  4S2G A;  3BTX A;  1PGL 1;  1H4G A;  4O9G A;  1UY0 A;  3RNS A;  3OGG A;  4MGS A;  2DF7 A;  1F31 A;  3J8F 2;  5T50 A;  4RSU A;  1W2U A;  3RZH A;  1F4A A;  3D3A A;  1COV 3;  1YIP A;  1JHN A;  2XLA A;  1RUI 3;  5EJZ B;  4YZ4 A;  4B29 A;  5JXG A;  3RZZ A;  4FOW A;  2A7A A;  2IUW A;  3BTY A;  3R4S A;  2HEW F;  2O14 A;  3ZXG A;  1SEF A;  4LK7 A;  1ZA7 A;  2MEV 1;  3CLP A;  4FSJ A;  1UOJ A;  2HBT A;  4ZKT B;  1B35 B;  2EXK A;  4QX3 A;  4E8D A;  1LGB A;  4URA A;  5J36 A;  4O61 A;  1UU4 A;  4QPI B;  1ZRD A;  5FMO L;  1UY1 A;  4B4R A;  3OCP A;  4R9C A;  3J7L A;  3W21 A;  4BJ0 A;  4D69 A;  1URX A;  3FLR A;  4Q4X 3;  2BNN A;  1ZBA 1;  4XF1 A;  1KEX A;  4IEY A;  4KQ7 A;  4HSL A;  3UJO A;  1RUD 3;  1N3P A;  1UU5 A;  4CU7 A;  4DO0 A;  2D7F A;  4NRP A;  5L19 A;  5GKA C;  5JPN B;  2JJ6 A;  4Q2F A;  3AMP A;  4MV2 A;  3OPW A;  1F9K A;  4AR2 A;  4XIL A;  3DYM A;  2KM2 A;  2XLG A;  4R8H A;  5DMY A;  1PO1 3;  2ZEX A;  4YVW B;  1WW4 A;  1EY2 A;  1A78 A;  2RS5 2;  2VGD A;  4DUV A;  4TN7 A;  1XNK A;  3NVC A;  5L9B A;  2VBB A;  5FBZ A;  1EV1 2;  1BVV A;  1ENX A;  4X8P A;  5JXJ A;  1RUO A;  1HXS 3;  3H42 B;  2ZEY A;  2PLV 2;  1AF9 A;  4FT8 A;  1S0B A;  4AGV A;  2Q8E A;  4GJZ A;  3L2H A;  4RQP A;  2ERF A;  2WO1 A;  2D3S A;  2WRA A;  4JX0 A;  1RED A;  1W0N A;  2CL2 A;  1NXM A;  4KWK A;  3KV9 A;  3PVO A;  4QHO A;  1Y4W A;  1S0J A;  3ZFG B;  3CDZ B;  3HAG A;  3HR9 A;  2D6P A;  2RMU 1;  1LEM A;  2SBA A;  4AI1 A;  5A70 A;  1TZO A;  4P9I A;  3WNM A;  1QH6 A;  2DVF A;  2QQN A;  3ZO0 B;  2PHW A;  1H8T C;  3ZKU A;  2RHP A;  1ZBE 3;  3WSO A;  4D94 A;  1B35 C;  3MW2 A;  5I8T A;  2N7G A;  4E4S A;  4QPI C;  1HDK A;  4GAZ A;  1HB4 A;  4UWD A;  3ZSE A;  5CG8 A;  2EIB A;  1V6O A;  4M3C B;  1RJ7 A;  2C5D A;  4OHV A;  4CTE A;  4UW5 A;  3P3P A;  1J83 A;  3HNY M;  5FDB A;  1SHW B;  4JTN A;  1ULE A;  1ZM1 A;  1S4C A;  4B8E A;  1X82 A;  3OGJ A;  5F8P A;  3BU0 A;  2BFU S;  3N7K A;  2GP3 A;  4GAL A;  4XAB A;  2B9U A;  3HN3 A;  2I74 A;  3TEY A;  1MZ6 A;  3AB0 A;  4IGQ A;  4QM8 A;  2WAO A;  4PIX A;  3EJK A;  1GSL A;  1ZNP A;  2WNO A;  3GXU A;  4GB3 3;  4HMZ A;  4JRL A;  3NL1 A;  4MXW B;  5IAX A;  3I7D A;  5LBB A;  5EQU A;  4XDQ A;  2VUD A;  4RGA A;  1Q8V A;  4M00 A;  3LEK A;  4E4Z A;  3N9O A;  4IV3 C;  4YVW C;  2VUA A;  2C9K A;  2HJI A;  1SBE A;  4ZPI A;  1WCS A;  1FMD 3;  4C91 A;  1GNH A;  3OUI A;  4LR4 A;  4YW7 A;  1QEX A;  3VN4 A;  5A32 B;  4BQX A;  4CUG A;  4IE5 A;  3DV8 A;  1RUE 1;  1UXX X;  1UZV A;  2FDF A;  4HK9 A;  3KM5 A;  1QNY A;  4LNV A;  5IFP A;  3LWC A;  3QH7 A;  3TEX A;  1W8F A;  2C4X A;  3V0B A;  1VMJ A;  5CVR A;  3PMS A;  4KI5 M;  3KVA A;  4OI0 A;  1JU3 A;  3ENR A;  2NQY A;  4MET A;  1PZ7 A;  1GZT A;  4YVS B;  4LUM A;  1COV 1;  4NAO A;  1CPM A;  1RUI 1;  1A3K A;  4BQW A;  4LQR A;  3GBF A;  2ZOE B;  3WNO A;  2Y60 A;  3SXW A;  1CAU B;  3EQE A;  4NUB A;  3W5M A;  3AL5 A;  1ODN A;  3NV3 A;  5GM0 A;  3ZFF B;  2NMN A;  3HT1 A;  1KDK A;  4OI4 A;  4RHV 3;  4PLN A;  1XYP A;  2GN3 A;  4QU1 A;  5AFB A;  4D3W A;  3A4U A;  1PZ8 A;  2PHU A;  4YSF A;  2LRP A;  4ONU A;  4CEY A;  1HB3 A;  4Q4V 2;  5T55 A;  1U5Y A;  1WWY A;  2LS6 A;  5FK8 A;  2LM3 A;  2V4A A;  5SV5 A;  4GH4 A;  1NX9 A;  3H3Z A;  5K4L A;  1AYN 3;  1POV 0;  3JXS A;  1RUD 1;  4NPR A;  2EID A;  1NA1 B;  4CA9 A;  2QDN A;  2QVS B;  4EZ4 A;  1I1E A;  3LIH A;  1WA6 X;  2B46 X;  5IK5 A;  1D2Q A;  1OOP A;  4YGD A;  1VBD 2;  4B7E A;  1LOC A;  2ZGK A;  4DB5 A;  5L7O C;  2XJP A;  5EWS A;  1O3S A;  2X53 S;  4OYU A;  4Y1V A;  3FX3 A;  2HWF 2;  2DUO A;  4V2V A;  4QKN A;  2CHH A;  5FZI A;  2R0H A;  1PO1 1;  1TQ5 A;  2PTM A;  4HKO A;  4Q5O A;  4AED C;  1G9C A;  3RZM A;  4Q29 A;  2WT1 A;  1QU0 A;  3BOW A;  1CIW A;  5JI7 A;  2W52 A;  3MBW A;  3AK0 A;  4HON A;  4XJA A;  3KSC A;  4QX2 A;  1HXS 1;  3GBW A;  1J84 A;  4W6W A;  1G8W A;  4BHP A;  4WVZ A;  5C8C B;  3Q8F A;  4CP9 B;  1KS4 A;  4R9B A;  5K8S A;  4JZR A;  4LK6 A;  5LWB A;  3OBT A;  4FO9 A;  4Q4W 3;  1KQR A;  2WA3 A;  3IMM A;  1UL9 A;  4UXA A;  1VRH 2;  5GLW A;  4MGK E;  1HJF A;  1NCR A;  4K20 A;  4OQ8 A;  3OGR A;  4M4P A;  1PZ9 A;  2BWC A;  2BBA A;  4ZY9 A;  2RR1 3;  5KHK A;  4BQ3 A;  4PI2 A;  4P9G A;  4CDX B;  2A3W A;  4ZU4 A;  3O1T A;  2XWB B;  3M4F A;  2AC1 A;  4N9I A;  4N8M A;  2PHT A;  2YPJ A;  4W4Z A;  1FAT A;  3U75 A;  4EZH A;  3RS6 A;  5IFT A;  1ZBE 1;  2IFW A;  2E53 A;  4AVA A;  1K5M A;  3LB9 A;  5GJ6 A;  4YAR A;  1ZZ6 A;  5EJ1 B;  1ASJ 2;  3VBU A;  4YZ1 A;  1CAV A;  1H8V A;  1RMU 3;  1UF2 C;  2A1X A;  1BZW A;  1V9U 3;  3PVB B;  4QX5 A;  3LEM A;  4LKE A;  4YG6 A;  4AVV A;  4AG4 A;  2JEN A;  3QLQ A;  5DZF A;  2XG3 A;  5CKQ A;  3NNF A;  3BGA A;  2QQO A;  3WNX A;  3C7E A;  1R08 2;  4XFI A;  3TNQ A;  2ZKL A;  1AR7 3;  4Y20 B;  2P34 A;  2E63 A;  2JE7 A;  2Y26 A;  2H6B A;  2O1Q A;  1A6C A;  2ID4 A;  3WY6 A;  3MV1 1;  1TMF 1;  2PYT A;  3R4D B;  4DY5 A;  4JV4 A;  3WR0 A;  1F8V A;  1UO9 A;  5FPA A;  2VCA A;  4YYO A;  3VDD C;  4JC1 A;  1MVQ A;  1MPX A;  3HPN A;  4GB3 1;  4RGK A;  5CFD A;  1K5J A;  2ARX A;  1RUG 3;  2LUW A;  1NT0 A;  2AGS A;  1S0E A;  4GMP 0;  5H9S A;  3PIJ A;  3SIS A;  5C3R A;  4XUT A;  5EYX A;  2XVL A;  3ZVX A;  4RR3 B;  1ZBA 2;  1UZ0 A;  1WW7 A;  4CDQ B;  2QJV A;  3H0O A;  1FMD 1;  1UX6 A;  1TVG A;  4CDU C;  1H9P A;  5C8C C;  4UFM A;  2FZ1 A;  5I0R A;  2XGX A;  5HXM A;  1D7P M;  2P4E A;  2VBP A;  4IV1 A;  3FE5 A;  4QAW A;  3PDQ A;  4AZZ A;  1AL0 G;  1W8T A;  3LEG A;  1G9B A;  1ZYB A;  3ZFE A;  3WIN E;  1YO8 A;  1W6M A;  3I8T A;  4CU6 A;  5F32 A;  4NJ4 A;  2G9G A;  3UET A;  1OMI A;  3CO2 A;  1GQH A;  4GJY A;  4XE9 A;  3VL8 A;  3U11 A;  1EYB A;  3H3U A;  1LGN A;  2W2I A;  3QOP A;  1UQX A;  4LBQ A;  2QTW B;  5JOX A;  1XBF A;  4PDW B;  1S2E A;  1W8O A;  1LU1 A;  4LT5 A;  3RWN A;  2BU9 A;  4QMA A;  1TG7 A;  3ZYH A;  4GZ9 A;  2B39 A;  1GQP A;  3LZZ A;  2R07 2;  5FZ1 A;  1UPI A;  2WT2 A;  2FMD A;  1GZC A;  1QJY 3;  1ZX5 A;  3RG0 A;  1N1S A;  3O0W A;  2RJ2 A;  3AP5 A;  4MHR A;  1IG3 A;  5KC6 A;  2HWD 2;  1AYN 1;  1GUI A;  1C3H A;  3OGS A;  1OI6 A;  1N47 A;  1RIR A;  2XHK A;  4PF5 A;  1SBD A;  3GCX A;  2W1Q A;  2HWC 3;  3ON7 A;  1UYZ A;  4CUA A;  1FNZ A;  4MYE A;  4XMI A;  3AKP A;  2JG8 A;  2MPF A;  2QQJ A;  3NJY A;  4ISQ A;  3TWI A;  1WMX A;  1QF3 A;  3DCQ A;  2JIG A;  3WZ1 A;  5KHJ A;  2R04 1;  2RM2 3;  4XFC A;  4MX3 A;  4N43 A;  5FZK A;  3VV1 A;  3AVR A;  2RDQ A;  4TYS A;  5FPV A;  1QGL A;  2XJQ A;  3VD9 A;  5C3O A;  1CWP A;  1QQP 2;  3OYW A;  1SLC A;  2BBV A;  1G9F A;  2ZA9 A;  2RVA A;  3D0S A;  4FPF A;  2X05 A;  2VAU A;  2RV9 A;  4NRO A;  2JD9 A;  4Q1R A;  4FFG A;  5E8A A;  1CD3 G;  3VB9 A;  1QOT A;  3H9A A;  3ZDS A;  3ZN6 A;  4LIU A;  4QKF A;  4J1X A;  2JB8 A;  4SBV A;  1KFX L;  4Q0S A;  5CIR A;  4JGY A;  1PO2 3;  4Q4W 1;  5FYS A;  2GC3 A;  4NRM A;  1KD7 A;  5BNP C;  4NVP A;  1CJD A;  2YGM A;  5F3I A;  2GC1 A;  1DG6 A;  2DUR A;  5FYB A;  4MLO A;  1XC6 A;  4OFG A;  2XJV A;  4C90 A;  2J1A A;  3MUY 1;  1VR3 A;  5JPM B;  1WA4 A;  3NNL A;  3DYP A;  4CPB D;  1DDL A;  3CJX A;  2A70 A;  5F5A A;  4UFJ A;  5A7W A;  5J48 A;  2BPA 2;  1F5F A;  3MO4 A;  5D8A A;  2ZZQ A;  4MUV A;  4YG3 A;  2F4P A;  5CZK A;  2UY8 A;  3ZXJ A;  5HV4 A;  1V9U 1;  4HAN A;  1KS5 A;  4Z82 A;  1GAN A;  3HOB A;  5DQ0 A;  1KXG A;  2SLI A;  3T1L A;  1JN2 P;  1Y43 B;  2HYK A;  4HPK A;  1AVB A;  1VB2 A;  3K4D A;  5ANN A;  3C8X A;  2QCS B;  1UOB A;  3RZJ A;  2W68 A;  3WUD A;  3ZYF A;  4J1W A;  1AL2 1;  1JUI A;  1VBB 2;  1W6O A;  1X9T A;  3CMG A;  4IGP A;  1D4M 3;  5DUW A;  3ZSJ A;  5C5T A;  4BIS A;  1ZZ7 A;  1BQP A;  4DS0 A;  2DUP A;  2E7Q A;  1DCS A;  2JDA A;  1KJL A;  3R6S A;  3UGH A;  4FP2 A;  5FZD A;  4JGZ C;  4XJU A;  1CON A;  3LOI A;  3KZ4 C;  4FCA A;  1OPM A;  3AJY A;  2FDH A;  4Q4X 2;  5C9A C;  5A33 A;  1E5S A;  2E7A A;  4NHL A;  4Y22 B;  4RS5 C;  1DYO A;  3RQ0 A;  2GNM A;  4Q4Y 3;  3WNP A;  2WBK A;  3JCI A;  1PVC 1;  3QCW A;  2GH2 A;  3FL7 A;  3ACF A;  5F3E A;  4ASM B;  3THD A;  3O1P A;  2E6V A;  3C3V A;  1NKG A;  2C26 A;  4LO8 A;  1FI2 A;  3TNP B;  5FYC A;  1BEV 3;  5A6Y A;  3GYD A;  2OX0 A;  4A44 A;  3GNE A;  3KT7 A;  4ARX A;  4XMA A;  1PO1 2;  4FBF A;  1AXK A;  4JDM A;  1T6G C;  2PA7 A;  1NCQ C;  2CGN A;  3T2Q A;  3ALQ A;  3KF3 A;  1HRI 1;  4G9S B;  1C8M 1;  2HWB 3;  2VXJ A;  4ZS2 A;  3U14 A;  2ADE A;  2AEY A;  1R1A 2;  2VBD A;  1O3T A;  5EIY B;  1CVN A;  4KG0 A;  1OVS A;  5EJ3 A;  3AYC A;  4BH9 A;  1O3R A;  3VBO A;  3AP9 A;  4N53 B;  3PJY A;  4Y5S A;  2YDE A;  2W3J A;  1JW6 A;  4P9Y A;  1QJY 1;  3VBF A;  2ATF A;  1DZT A;  5JMO A;  3E5Q A;  1CQ9 A;  5FYT A;  5HV0 A;  1FOD 1;  1YQC A;  2WIN B;  4TLF A;  4UFI A;  4B7K A;  4CSW A;  3H8R A;  1NUK A;  2YBS A;  1VIW B;  5AVP A;  5A7P A;  4IDZ A;  1W2O A;  3WT3 A;  4XBN A;  3V0A A;  2G19 A;  2ZHL A;  4YRD A;  2VQT A;  5LA2 A;  1AHS A;  4OUE A;  2QQI A;  2HEV F;  2RM2 1;  4B1L A;  4E4D X;  3W5N A;  4R52 A;  2WNV B;  2R7E B;  5FYZ A;  5FLJ A;  3B69 A;  2VMI A;  5KC5 A;  1IKQ A;  3IAP A;  4K1Z A;  1PMJ X;  3N9P A;  3SH3 A;  3WF1 A;  5FP9 A;  1AR6 3;  4I01 A;  1XOY A;  3VBH B;  2RDR A;  4DNY A;  1LRH A;  2DU1 A;  3D8C A;  4QQ2 A;  2W9X A;  1REE A;  2XR4 A;  2Q0A A;  1JZ8 A;  1JOD A;  1YQ5 A;  5FUI A;  1BMV 2;  3KD4 A;  4BLJ A;  1TME 1;  4FPE A;  1PO2 1;  4RD7 A;  3ACI A;  5FYI A;  3AZV A;  1QJX 3;  4X6Q B;  4Y1Z A;  1R09 3;  3ES4 A;  1RL3 A;  2VU9 A;  5CFC B;  2WS9 3;  1WCK A;  4OUL A;  4Y3O A;  5J3U A;  2WFF 2;  5JIU A;  3UJQ A;  5A3L A;  1JTZ X;  4AHX A;  5I8S A;  2QUO A;  4MGZ E;  1FXZ A;  5FZL A;  5F1R A;  1MS5 A;  3FZ3 A;  2VCC A;  4QXB A;  2R06 3;  1UZW A;  2JG9 A;  2WSV A;  2JB4 A;  4LBN A;  1AR8 3;  1GZW A;  5CYY A;  3AP7 A;  5FZ4 A;  1JZ4 A;  4L9B A;  1W6N B;  1FV2 A;  3VZJ A;  1NG0 A;  1CX1 A;  2D5F A;  4UAP A;  1BYH A;  4PT6 A;  1V6K A;  4F83 A;  4EN9 B;  1HN0 A;  1UWW A;  2JDH A;  3D82 A;  3PUS A;  4NRQ A;  3OD0 A;  5F3C A;  2EIG A;  2VE1 A;  5KWR A;  3BOP A;  3H50 A;  1O6U A;  3GF6 A;  3WW4 A;  2R0F A;  2B42 B;  1IS3 A;  1PK6 A;  4LA3 A;  4M0H A;  1YFY A;  4LOT A;  1G6N A;  2EXI A;  5FZO A;  3SC7 X;  3MLK A;  4CP1 A;  5AC9 3;  5CNA A;  1DLC A;  4RHV 2;  1XB9 A;  2Q4S A;  3G7D A;  5FRE A;  5TSW A;  2G1M A;  4DXZ A;  4UT5 A;  5FCC A;  1S0F A;  4DEV A;  2CYF A;  4LKD A;  3KQ4 B;  1F35 A;  1WCD J;  1S0G A;  5JUV A;  4KU8 A;  2ZXQ A;  1NLS A;  4LE3 A;  4AI3 A;  5A3O A;  2O0O A;  1PX3 A;  1W6P A;  1L7L A;  1XNB A;  2MEV 3;  2PHX A;  4Q4Y 1;  2ZHM A;  4AK3 A;  2YU2 A;  4KBB A;  2WAB A;  5FZ3 A;  2WJS A;  5IVJ A;  2A6Y A;  4IEQ A;  2WFP A;  3I2F A;  3JQW A;  2A71 A;  3NJZ A;  5BNO B;  4RFT 0;  4GA9 A;  2WYF A;  1BEV 1;  5A3T A;  5CFC C;  3VZM A;  1UY4 A;  4FOQ A;  1UKR A;  4Z2A A;  3KCY A;  3IKW A;  4P02 B;  3FHI B;  1YHF A;  4WM8 A;  4E2Q A;  4YM2 A;  1WW5 A;  3WF2 A;  1RVF 2;  3DKQ A;  1DYK A;  3T2O A;  2PAE A;  3VD5 A;  3U07 A;  2V09 A;  1AX1 A;  5DUX A;  5CAD A;  4BK4 A;  3VDB A;  1H0B A;  1HIX A;  1OSG A;  2Y6K A;  4FFH A;  1ND2 B;  4KU7 A;  3K48 A;  4Q4W 2;  2VMF A;  4QXH A;  2DVD A;  2FDG A;  1ENQ A;  1JOJ A;  4FI9 A;  5H9Q A;  3DEM A;  1UOF A;  2BQP A;  4KWL A;  1OFS A;  3THP A;  4ERO A;  1W9S A;  4RFR B;  4F7Z A;  4L97 A;  1S55 A;  4AVT A;  4I3P A;  4DUX A;  3VBS A;  2RR1 2;  1N3O A;  3PU3 A;  3MHZ A;  1SPP A;  3MFA A;  5F37 A;  2OYZ A;  5DAQ A;  4GQ7 A;  2CGP A;  1PHM A;  4Q8K A;  4HG6 B;  2BV4 A;  3SNM A;  2Z5W A;  4W6X A;  5A3P A;  4BU2 A;  5BUV A;  1ULO A;  3ZXE A;  4NWW A;  3PUA A;  5KHG A;  1RMU 2;  4XQD A;  2VQA A;  5CKM A;  1DGL A;  3S30 A;  5LBF A;  3AM2 A;  4YNI A;  4AEM A;  4BIF A;  5FMB A;  2XL7 A;  3POE A;  1H6Y A;  2LRO A;  3ZYR A;  1PIV 3;  1AR7 2;  1NE4 A;  5JOY A;  5KXE A;  3TN9 1;  4XF0 A;  3DF0 A;  4B4Q A;  2FDK A;  4WV8 A;  3VZL A;  3L9J T;  5FPX A;  3ZXF A;  1BLZ A;  3A0K A;  3MID A;  2A6Z A;  2JE8 A;  1YJK A;  3VKM A;  2XPJ A;  1RUG 2;  1R09 1;  2XVK A;  4MXV A;  1GOF A;  2R30 A;  1G9D A;  3PTY A;  2WS9 1;  2JD4 A;  5LA0 A;  1WMF A;  1GWL A;  2WUH A;  4XF3 A;  4AFD A;  4OUM A;  2WQ8 A;  5BNQ A;  5CB7 A;  1XSQ A;  1MS8 A;  5DG1 A;  5C70 A;  2FBE A;  5DXD A;  3GZT B;  5FQ0 B;  2FD8 A;  3GZE A;  1VMH A;  2D5H A;  4QQL A;  3ZXD A;  2DUQ A;  1AR9 2;  1JMU B;  1QDO A;  2OW4 A;  2R06 1;  2E32 A;  3ZPO A;  3J7N A;  1L3J A;  4WM7 A;  5FPL A;  4BK5 A;  1AYM 1;  3I2K A;  3JZV A;  1SFN A;  1SMV A;  4AFC A;  3AKS A;  1W8W A;  2PAK A;  1JOP A;  4ZU5 A;  4CDW A;  4QQP A;  3WF3 A;  4MGY E;  5FO7 B;  4OUS A;  3M3O A;  2E33 A;  4XUN A;  1NZC A;  3ZXL A;  1IOA A;  1NCR C;  1ZVF A;  2ZPX A;  1SQ4 A;  1CES A;  5C7G A;  4QKD A;  5A7Q A;  1VBE 3;  3S5Q A;  5CBL A;  3H3L A;  5FP8 A;  1W8N A;  5L36 A;  2HH9 A;  1N1Y A;  3IAQ A;  3AMH A;  3WQ7 A;  4IEV A;  3I59 A;  1H2N A;  5AC9 1;  2YFU A;  1J1L A;  1RUC 1;  3POY A;  3UKT A;  3URF A;  3QAC A;  5FP3 A;  3R4U A;  3EHK A;  3N36 A;  5FOB B;  5JWP A;  3OY8 A;  5IVY A;  4A2U A;  3PUR A;  4LOR A;  3VBU C;  1B09 A;  4CEW A;  3SQO A;  3POF A;  1DU3 D;  4I0B A;  4LIV A;  2ET7 A;  2ARE A;  4ISR A;  4DRR A;  4IE0 A;  4A7K A;  1Q3E A;  2AZ5 A;  4C8D A;  1H8T B;  3CF6 E;  3AMN A;  2HWC 2;  2I2S A;  2DTW A;  3L2Y A;  3D4K A;  1UXZ A;  4A41 A;  2ZX1 A;  1POV 3;  4YW1 A;  3LA7 A;  4BME A;  2Z69 A;  4BIO A;  4EYU A;  3USS A;  1K3I A;  2AH2 A;  1F4H A;  2OII A;  2XH6 A;  4AOC A;  5JZG A;  3A21 A;  3DEC A;  2OT7 A;  5FYM A;  5AFE A;  5CFD C;  5FUN A;  1WBL A;  3BPS A;  4JDN A;  3JD7 3;  4K7J A;  3S7E A;  4N7U A;  5G04 L;  3AP6 A;  2EIC A;  3AKT A;  4H7L A;  4IUG A;  3GCW A;  2DCK A;  3INA A;  1W2N A;  4I30 A;  3RZK A;  1OLR A;  4DFS A;  2GZW A;  2VZV A;  1MS3 A;  2W1W A;  2JXA A;  2WZR 1;  3J9S A;  4LHN A;  1ZRE A;  1PO2 2;  2ZTN A;  4IV1 C;  4KWU A;  2XWJ B;  1LEC A;  2BP6 A;  1A8M A;  2W39 A;  1SFP A;  4IV3 B;  1P8J A;  3EO6 A;  5A80 A;  3ZFE C;  1U0A A;  3AZW A;  3IPV A;  4I3G A;  4MHU A;  4JKM A;  1DFQ A;  1ZRC A;  1RUJ 2;  1UD1 A;  2XXZ A;  1VAK A;  4J6G A;  4BXS V;  4WVM A;  4NIA A;  1VBA 2;  1BK1 A;  2VMG A;  2FMY A;  4M4R A;  2CWS A;  4YW2 A;  2CSG A;  3M3Q A;  2UWA A;  2V4V A;  3IT8 A;  3AJZ A;  2D6L X;  5AVA A;  5IVF A;  1U12 A;  2VVD A;  2BOI A;  1JU4 A;  1RUH 3;  2V73 A;  5JLV A;  2RG4 A;  3A23 A;  4AQS A;  1RUF 1;  3FN9 A;  3E97 A;  4ASK A;  4AXO A;  1V6L A;  1ZZB A;  2PHL A;  1ALY A;  3ILF A;  5F6K A;  1W8Z A;  1Y9G A;  4AEK A;  1PGW 2;  1GYK A;  1PIV 1;  2BYV E;  1LNS A;  1QJF A;  2ET1 A;  1XU2 A;  1D4M 2;  2B7Y A;  3MW4 A;  2P3Y A;  2WO7 A;  3IN9 A;  4XCA A;  4E8C A;  5DDJ 3;  5LZ6 A;  1DIW A;  1VBC 3;  2F6B A;  2IZW A;  2VG9 A;  3H8U A;  1J3P A;  4FFF A;  4GD4 A;  1DYP A;  2QNK A;  3LAG A;  4XEZ A;  4E4H A;  3MEP A;  2LW8 A;  1PVX A;  2JG8 C;  4DOU A;  4YFW A;  3CJI A;  1EAH 3;  2J1S A;  1GKB A;  2IXC A;  3ZXA C;  1QDC A;  4MSV A;  4N43 C;  1ULD A;  4HZF A;  3UYJ A;  3BCW A;  3TYJ A;  1OH3 A;  1MQT A;  2YUE A;  1TMF 3;  4FAH A;  2WKK A;  2JDZ A;  4HN1 A;  3O12 A;  4S2H A;  1WCU A;  4Q4Y 2;  4BWO A;  5JMC A;  5L7O B;  2UWC A;  2VZ1 A;  3IMN A;  1YEW A;  3I97 A;  3KT1 A;  1MEC 1;  5DAP A;  5LRR A;  5C5U A;  5ABJ A;  1GR3 A;  5DUV A;  4HT1 T;  1JS9 A;  1HW5 A;  2Y0O A;  2FCU A;  3ILN A;  2YFZ A;  1IS6 A;  4EN6 B;  4AED B;  5F9T A;  2GDF A;  2JE9 A;  5LW9 A;  2KXL A;  2W92 A;  2RJK A;  3ZX7 A;  5IYY A;  4QT6 A;  4UW3 A;  4CXW A;  2Y33 A;  5IVC A;  2Y6H A;  4ORF A;  4NHY A;  5IVB A;  1VBE 1;  3DYO A;  2WQ4 A;  1GLH A;  1RJ8 A;  2HWB 2;  1I9R A;  1DGR A;  1ND3 A;  4QDR A;  1E5I A;  4HET A;  4LUL A;  2IFR A;  5A6X A;  5IK4 A;  5FZE A;  2VC9 A;  1PX4 A;  1SCS A;  5BNN A;  2VME A;  2Q8D A;  2HWE 3;  4TXW A;  4QB1 A;  3WOG A;  3GZA A;  5LRS A;  2KA3 A;  4M3C E;  5D8A C;  2XDV A;  5F5C A;  4E27 A;  2WYS A;  3LKJ A;  1ZZ8 A;  5K0U A;  4DZG A;  1W9W A;  2DCJ A;  3MGU A;  5D2A A;  4Q27 A;  3ZSK A;  3N7M A;  2R49 A;  3F95 A;  3RVH A;  5C3P A;  1GIC A;  4NII A;  5GZC A;  2YU1 A;  1U5I A;  4BQ5 A;  1X50 A;  1JI6 A;  1C28 A;  3PU8 A;  2DBI A;  3HBZ A;  2JDM A;  3I4I A;  1JYW A;  1POV 1;  1I5Z A;  4NR1 A;  5A3U A;  3U4X A;  1JYC A;  5B2G B;  1DQ2 A;  5FZA A;  1YXW A;  3VBR A;  1YYN A;  5E88 A;  1FV3 A;  2RS3 1;  2C1F A;  2YG0 A;  4UOJ A;  3IBM A;  5DZE A;  2Y64 A;  3MW3 A;  5A3M A;  4H14 A;  3RZG A;  1Z7S 3;  3JD7 1;  1AR6 2;  4LHK A;  3RMX A;  3AZX A;  4RL7 A;  1MS0 A;  5ACA 3;  3P6B A;  4QM9 A;  1BBT 2;  3NQH A;  4PBO A;  1SFY A;  4JAA A;  3ZN5 A;  2UYA A;  4LBM A;  5KBF A;  1QMJ A;  3VDD B;  1CAX A;  1FPN 3;  4NMI A;  2R04 3;  3ZYB A;  4DXR A;  5C3Q A;  5JAX A;  3LE0 A;  2XKO A;  2H0V A;  2OZ6 A;  2B45 X;  1QJX 2;  2G9F A;  4Y24 A;  4UF0 B; 
#chains in the Genus database with same CATH homology
 3J7H A;  4ZXE A;  4ET7 A;  1XC6 A;  5JXH A;  2W1S A;  2J1A A;  3MUY 1;  3SKJ E;  3WNL A;  3C7H A;  3DYP A;  4LPL A;  4QB6 A;  4CU9 A;  2XOM A;  2VZR A;  3MO4 A;  3III A;  1BHG A;  5CZK A;  1L7R A;  3HOB A;  1K12 A;  3GDB A;  3NRU A;  5DQ0 A;  3OG2 A;  3C7O A;  4L0P A;  3K4D A;  2VM9 A;  3K4A A;  3C8X A;  5DN2 A;  1US2 A;  3CMG A;  5G05 L;  3MUZ 1;  4GWJ A;  4DXT A;  1XNT A;  1JYN A;  3WNK A;  2VTF A;  3IDA A;  5LCW L;  2JDA A;  4D0Q A;  4A6O A;  5B4X A;  3PUI A;  1RYY A;  3A7Q A;  3ABZ A;  2QQM A;  2V72 A;  1K42 A;  2Y6L A;  1DYO A;  3WNP A;  2WBK A;  3E1F 1;  2VZQ A;  1HN1 A;  2JKX A;  4XUR A;  1ULP A;  3ACF A;  3FL7 A;  3THD A;  3ETP A;  1OH4 A;  1EUT A;  1UMI A;  1NKG A;  3EYP A;  2C26 A;  3CZU A;  4CVU A;  5J1X A;  4TTG A;  4A44 A;  3T09 A;  4ARX A;  3FHQ A;  4W50 A;  3SEP A;  3K75 B;  3ACG A;  2ORZ A;  2YB7 A;  5HPO A;  2W87 A;  3T2Q A;  4PF1 A;  3THC A;  1JYV A;  2BGP A;  3MV0 1;  3CZJ A;  5EIY B;  2VZ3 A;  4W8J A;  3I3B A;  2QQK A;  1DP0 A;  2W3J A;  1GOH A;  5C71 A;  1OD3 A;  5JMO A;  4XUQ A;  1JZ2 A;  1NUK A;  2X10 A;  4LKS A;  3SEE A;  5A1A A;  3T08 A;  2VZP A;  2VR4 A;  5I0D A;  3NJV A;  2HYX A;  2VQT A;  2B4K A;  5LA2 A;  4OUE A;  2QQI A;  3LPF A;  3W5N A;  1WCQ A;  3IB3 A;  2R7E B;  4XVH A;  2QQL A;  3SKV A;  3IAP A;  1PMJ X;  3WF1 A;  3LQC A;  4ZZ8 A;  2WN3 A;  3P1I A;  2BGO A;  4JKL A;  5B4N A;  2W9X A;  3CQO A;  2VZS A;  1JZ8 A;  2W46 A;  4OMC A;  5FUI A;  2DDU A;  3I2H A;  3ACI A;  2YC2 A;  1W9T A;  2ZEZ A;  4MAD A;  1CZS A;  3I2I A;  2Y6G A;  3NJX A;  1UMH A;  4D8M A;  3CIH A;  2BER A;  2ORX A;  5F7U A;  2J1E A;  3OB8 A;  2VMC A;  2VCC A;  3PUH A;  5CYY A;  3VDA A;  2W1U A;  1JZ4 A;  2XQX A;  1IQD C;  1CX1 A;  4OMD A;  4UAP A;  1JYX A;  1UY0 A;  4PT6 A;  4MGS A;  4OZO A;  1UWW A;  1F4A A;  3D3A A;  5JXG A;  1JZ3 A;  3HNM A;  5EJZ B;  1W99 A;  3NNG A;  3HEI A;  2VL4 A;  4DUW A;  4QDQ A;  3AC0 A;  2Y8K A;  1CIY A;  4QX3 A;  1DLC A;  4E8D A;  3BN6 A;  3T2P A;  1UY1 A;  2X09 A;  4BJ0 A;  1KGY A;  4DEV A;  3OBA A;  1KEX A;  3UES A;  2W91 A;  5JUV A;  2ZXQ A;  3VD3 A;  1PX3 A;  1UX7 A;  4CU7 A;  4P08 A;  1OF4 A;  2WAB A;  5DPN A;  2OKX A;  2W5F A;  3I2F A;  3VD7 A;  1O8S A;  3I2G A;  1H6X A;  3WEZ A;  1UY4 A;  3DYM A;  5DMY A;  2ZEX A;  4Z2A A;  4DUV A;  2VZT A;  4P02 B;  3VD4 A;  3WF2 A;  4P00 B;  4MO3 M;  4A3Z A;  5JXJ A;  3T2O A;  4AAX A;  2J1V A;  2ZEY A;  3VD5 A;  5JR2 A;  2KD7 A;  1UY3 A;  3VDB A;  4BK4 A;  4CUB A;  2Y6K A;  2WO1 A;  4PQQ A;  2VMF A;  1XNA A;  4A45 A;  4JX0 A;  4FI9 A;  4ZZ5 A;  1W0N A;  2XHN A;  3OEA A;  1W9S A;  4DUX A;  4XUP A;  3CDZ B;  4KMQ A;  3LPG A;  4UI9 L;  1O8P A;  2W95 A;  3WNM A;  2QQN A;  3WF0 A;  3OEB A;  3WSO A;  4HG6 B;  2CDP A;  2VQU A;  2J22 A;  1ULO A;  4ARY A;  1SG3 A;  2J7M A;  2WO2 A;  4JHZ A;  1GMM A;  2EIB A;  1WKY A;  1H6Y A;  1NAE A;  1J83 A;  3HNY M;  1SHW B;  3F2Z A;  1OT5 A;  3HN3 A;  2QBX A;  2Y6J A;  2WAO A;  3I3D A;  1L7Q A;  3GXU A;  2WAA A;  2JE8 A;  3T0A A;  3LEK A;  1GOF A;  5LA0 A;  2C9K A;  2WUH A;  4QX0 A;  2WQ8 A;  5C70 A;  4QPW A;  2VZU A;  1UXX X;  2J1U A;  5IFP A;  2E32 A;  2VO5 A;  2C4X A;  3WQB A;  4BK5 A;  1CZV A;  4KI5 M;  3I2K A;  1K45 A;  3A22 A;  1JZ5 A;  2BZD A;  3HNB M;  3HJR A;  1JHJ A;  1JU3 A;  3WF3 A;  4QX1 A;  2E33 A;  3C7F A;  4XUN A;  4LQR A;  2W94 A;  3WNO A;  5C7G A;  4XZU G;  3W5M A;  1W8N A;  3IAQ A;  3GM8 A;  1OF3 A;  2YFU A;  1GU3 A;  1O59 A;  4A42 A;  2WZE A;  2LS6 A;  2WN2 A;  3CKH A;  2B9V A;  2ZEW A;  1NX9 A;  2CDO A;  3JXS A;  2L9L A;  2EID A;  2XON A;  1UXZ A;  4OYU A;  2VZO A;  4A41 A;  4RYD A;  1I5P A;  1K3I A;  2WDB A;  1F4H A;  1UYY A;  3A21 A;  3DEC A;  2PQS A;  3VDC A;  2J1R A;  1R64 A;  3MBW A;  5G04 L;  3K77 A;  2J1T A;  2EIC A;  4IUG A;  4QX2 A;  1J84 A;  2DCK A;  3I2J A;  3UNP A;  2VZV A;  1EUU A;  2W1W A;  1JZ7 A;  1YQ2 A;  1US3 A;  4KWU A;  4BDV B;  1P8J A;  3OGR A;  3WF4 A;  4M4P A;  4DXS A;  4JKM A;  2BBA A;  4ZY9 A;  4CU8 A;  2Z4F A;  4BXS V;  3WNN A;  3EB7 A;  1JZ6 A;  4M4R A;  4W4Z A;  5IFT A;  4GWI A;  2V4V A;  3ECQ A;  1JU4 A;  3LEI A;  3GGL A;  5EJ1 B;  3A23 A;  3U37 A;  3FN9 A;  4RN5 A;  5IJR A;  3T0B A;  4MGQ A;  4AG4 A;  3BGA A;  2QQO A;  1SDD B;  3C7E A;  2VCB A;  2ID4 A;  1LNS A;  3MV1 1;  4QDS A;  3ZM8 A;  2VMD A;  2VCA A;  3C7G A;  4E8C A;  1MPX A;  3HPN A;  5LA1 A;  2LW8 A;  1UY2 A;  2J1S A;  1T2X A;  1GNY A;  4XUT A;  3T0D A;  1UZ0 A;  4MOA A;  1CZT A;  1TVG A;  3K4Z A;  5HXM A;  1D7P M;  2VZ1 A;  4QAW A;  3I97 A;  3I3E A;  3LEG A;  4A4A A;  2V5D A;  2E26 A;  2HLE A;  4CU6 A;  3UET A;  2WZ8 A;  2YFZ A;  1PMH X;  2EIE A;  2WO3 A;  2W92 A;  4CUC A;  5IYY A;  3ACH A;  4P5Y A;  1W8O A;  2Y6H A;  3DYO A;  4QDR A;  1UYX A;  1TG7 A;  5JXI A;  4GZ9 A;  2VC9 A;  1PX4 A;  1GQP A;  4JKK A;  2VME A;  4TXW A;  4QB1 A;  3OGV A;  3K46 A;  2WYS A;  2RJ2 A;  1W9W A;  2DCJ A;  1GUI A;  3FHA A;  3OGS A;  2VJX A;  2W1Q A;  4CUA A;  1UYZ A;  1JI6 A;  2QQJ A;  1JYW A;  2W47 A;  4QB2 A;  3VD9 A;  2VOT A;  2YC4 A;  2YG0 A;  2E31 A;  4UOJ A;  2RVA A;  2X05 A;  2Y64 A;  2RV9 A;  2JD9 A;  5IHR A;  4DEQ A;  3P6B A;  3NQH A;  4DXR A;  4LHS A;  3LE0 A;  1GOG A;  1XPW A;  4XUO A;  4YPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...