2JDPA

Mutant (s23a) of pseudomonas aeruginosa lectin ii (pa-iil) complexed with methyl-a-l-fucopyranoside
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSAGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Engineering of Pa-Iil Lectin from Pseudomonas Aeruginosa - Unravelling the Role of the Specificity Loop for Sugar Preference.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
total genus 21
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdpA00
1OUSA 2BV4A 1OVSA 5A6XA 1UZVA 2XR4A 3DCQA 1OXCA 2JDPA 2JDKA 1OVPA 1OUXA 2JDMA 4CE8A 3ZDVA 2WR9A 5A70A 1UQXA 2VNVA 2CHHA 2JDUA 1W8FA 2VUDA 5A6YA 5D2AA 2WRAA 2BP6A 2VUCA 1OURA 5A6ZA 5HCHA 4AOCA 4UT5A 1W8HA 5A6QA 5A3OA 2JDYA 1GZTA 2BOJA 2JDNA 2BOIA 2JDHA
chains in the Genus database with same CATH superfamily
1K42A 5FXWA 4D6SA 5GLUA 1JYWA 5A6XA 1J1TA 1AR82 1ND2C 3GNEA 3H50A 1HV1A 4X6QB 1XU1A 1TMF1 4JGYA 5CVRA 4MZUA 4W6YA 4Y1VA 1RINA 2H0BA 2JECA 1GZWA 4AEKA 1ACCA 2A3WA 4KG8A 5FOJB 1ASJ3 3MW4A 1FT9A 3WNLA 5FYIA 4LKDA 5J7MA 4HANA 2BNMA 5E1RA 3WP3A 1AYN1 1MEC2 1XJAA 1PIV3 2C9AA 2VCCA 1X82A 4KGQA 1GZCA 2VUCA 3ZKYA 2DUOA 1V6IA 2OZ6A 1O3SA 4AK3A 4ATEA 1DF0A 4PQ9A 4UXAA 2ZBJA 2VZOA 4AWDA 2BERA 2HH9A 2PA7A 1YCIA 3NSTA 3U10A 1JYIA 4BM8A 4CCKA 1DP0A 3NMBA 3ZIXA 3AL6A 4K3UA 5ABJA 1LOBA 5L7OB 2DYCA 4FTEA 5KC6A 1US2A 2WR9A 1JZ5A 4M0HA 3NJVA 4QX7A 4E4SA 2WNVB 5LZ6A 4LUKA 4EN0A 3T08A 3U11A 5DDJ3 4QKDA 3AK0A 5C4WC 4QXKA 2YV8A 2BP6A 4YSFA 4XUNA 4QM9A 3POFA 2A75A 5FZ0A 3W5NA 4FXKB 4COWA 3ES4A 4NRMA 4AI0A 2DBIA 4QAWA 2PHFA 3WHTA 4M3CE 4JDMA 1K3IA 1CIWA 2YPDA 3PURA 5CYYA 5FUPA 1LHOA 5L19A 4CEYC 3FLTA 5FKCA 3OPTA 3N7KA 1AXKA 2JG9B 2VOKA 1W6MB 3ZFFA 3T0AA 1WMDA 1MZFA 5FY9A 1PZ9A 1RUC3 1WWYA 3WNOA 1PVC3 4LBOA 3GZTB 4NHLA 3LA2A 4CP9B 5F37A 3SQOA 2VUAA 2G9FA 4AEDA 2R071 3FE5A 2W1WA 4Q0PA 5T5LA 3B3QE 1AL21 1IGOA 3MICA 2VNGA 2X29A 4AAXA 4AE2A 5JZGB 3LIGA 4E4DX 4ARYA 1W9TA 3LAGA 3WV6A 4I30A 4I3PA 4EJRA 3P5BA 4BCUA 1OF3A 4COUA 1RJ8A 3AZYA 3FWEA 3SEEA 2RVAA 4Q4W3 3RWNA 4CCLA 1WUVA 1DDLA 4ZY9A 3AVSA 5G05L 4YZ3A 4OUEA 5L9RA 1XB9A 5E88A 1XNKA 2BFUS 1PNGA 1QXRA 1O4ZA 2KD7A 5HXMA 5FUIA 2RJ2A 3UGFA 1WMFA 2VUDA 1K45A 1OQDA 4UF0A 5FFOC 5GZCA 4K8FA 2VU9A 4QQPA 3VBFA 1UIJA 1UW8A 1S0DA 3L9JT 3AMMA 1R092 2YBPA 1H8VA 1D0GA 5DUXA 2FDFA 1QEXA 5M0TA 3VDDA 2WSVA 2CWMA 2MEV3 2XUMA 4XACA 5C8WA 5L36A 2BGPA 4CDWA 3E5QA 1YNAA 5DG1A 2Y38A 3RNSA 2RS33 4IL7A 4QKNA 4IEPA 4EN6B 2YG0A 3J8F2 5ABJB 1RXGA 2QQUA 4TLGA 3O1OA 5A7SA 5FQ0B 5JIAA 3CNAA 2ZOEB 5IVVA 4CE8A 3A23A 1GMMA 3U78A 1YXWA 5LBFA 3ZKUA 1WCSA 2XQXA 2Q8OA 1QJZA 1CAVB 4QQ2A 1EPWA 2X8KA 2YXSA 3H8OA 1RUG1 1JH5A 1MS9A 2VZUA 1X36A 2X5IC 1EV12 3ITQA 4QX1A 3NJYA 4QQHA 3OB8A 4OMCA 4UWDA 1N1VA 4XFCA 5FPAA 1LOAA 3OD0A 3M3CA 4Q4Y3 5GKAC 4LJHA 1C28A 3IBMA 1SQ4A 3N9LA 3OTFA 5C5TA 5AC93 5IVJA 4IDZA 2XR4A 1I9RA 1QMJA 1TNFA 1YIFA 4JQTA 3R6SA 4B7KA 1UXZA 4XDOA 4XJAA 2TEPA 2JDKA 1OA3A 3WNPA 5JXGA 4FT8A 1UPSA 4AVCA 4BWOA 2VE1A 2ZEYA 2WABA 3N9PA 5T5JA 3ZFFB 1RHI3 3I59B 2B8MA 5F3EA 5DG2A 1PX3A 2HWE2 3OCPA 3B5LB 2AEYA 1OQEA 1AF9A 3HQXA 4XCBA 3AFGA 5FPLA 4AEDB 3T1MA 3PJYA 4EWEA 3POGA 5A6ZA 1H2LA 1RVF3 1H2MA 4AFCA 5EXOA 3KT7A 1W6QA 2MPFA 3HVDA 2YMZA 1BEV2 1GWMA 2YU1A 2XHNA 3ZIWA 3SEPA 5CG8A 4LEJA 1SEFA 3HQUA 4O61A 1FMD2 1POV1 5CFCA 1C3HA 5A32A 5C8CC 1ODNA 1AYM3 3MO4A 1LOGA 3I2GA 2WFF2 2VBBA 4K8RB 3ZN4A 3WR0A 4KNCA 3I3MA 1V9U1 2A73B 2ES3A 3VHRA 2ZGNA 4BQ5A 3MF6A 1U5YA 3SH4A 1CD3G 3ECQA 2IUWA 1ENSA 1RUI2 2ILMA 2VQ0A 2WAOA 4RYDA 3QD6A 3WSOA 2BUKA 3GHMA 4MXWA 4CUAA 5KC5A 1HXS3 1FV2A 3N7MA 4GB33 4KH9A 3VBFB 4AGVA 3SKVA 2ZGPA 3RQ0A 1VB2A 4YM3A 1UY2A 4MSVA 1REDA 3K75B 3LPFA 2VCBA 3TB0A 3VDDB 1D4M3 1UO9A 2EA7A 1OI6A 2I07B 1BVP1 1NZCA 2J1UA 5L7OC 1QDOA 1GFF2 2ET1A 5A3NA 2HWC1 4NRQA 1C1FA 1EUUA 2WKKA 2ZMLA 4FAGA 1UYZA 4PIZA 1DYKA 5ACA2 1RUE1 2WNVC 4YVSC 2H6BA 1VBE3 5LWBA 4BB3A 3UNPA 3RZJA 2WJSA 3LDKA 1HRI1 2E7QA 2WS91 4YW4A 2BRTA 1J3PA 2WYFA 3M7AA 4AI8A 4XVHA 4TZDA 3WG4A 1QNYA 2W0XA 1D0HA 3KCXA 4QGNA 3T0DA 3ETQA 4I0AA 4IEUA 4L11A 4NHKA 4AGRA 3T4HB 5JSOA 2W5FA 5FZOA 4IE0A 3VV1A 3URFA 3WT3A 2CDPA 1LECA 3HMYA 5FBZA 5C3OA 2QVSB 2GN7A 1COV3 2WNOA 4XDPA 5GZGA 2XVLA 3QLQA 2VVEA 4NIDA 3LWCA 4CDUC 2JG9C 4V1PA 1E5IA 4QHOA 4OQ8A 3E1F1 4P5HA 1G86A 3GBGA 2WDBA 3ACHA 2FMYA 4ZS3A 3GF6A 4Q2FA 1AR71 4EZHA 2WAAA 4K1YA 4QPIC 1NA1A 2WINB 2IXHA 3AL5A 2QQKA 1W9WA 2WZEA 4BXSV 2GNDA 1TE1B 2I2SA 4Q4X1 2XLGA 4XYXA 3SMHA 4N43A 4CUCA 5LK7B 3RZZA 1G9DA 4UFJA 2D43A 5FZGA 1RIRA 3W9AA 2XJUA 3VBSC 1NE6A 3NL1A 3GCWA 2ZEWA 4YZ4A 4A6OA 1UNBA 1YWKA 1VE0A 2E9QA 4GAZA 3BB6A 4H7LA 3ZXJA 2Y6LA 4AR2A 4D7SA 5FLIA 3WCRA 1GQHA 2JIGA 1ND3B 2JENA 1RUJ2 1VBD3 4A3XA 4DEQA 5E6HA 3I49A 2E33A 3A0NA 4UW5A 2JIJA 4P9WA 3VHPA 3VZNA 1JW6A 1A78A 1G7YA 2VPVA 5IYYA 1W9FA 1NXMA 5CB7A 1LRHA 5A3UA 2EIDA 4MXWB 4JC1A 2VMCA 1ZZBA 2BOJA 3LGRA 1NY72 2YGLA 3F2ZA 4IGOA 2IVJA 1D2QA 1DGWX 2XHKA 4AEMA 1G9CA 3C3VA 3DYMA 1VPHA 2OUJA 2I74A 4RSUA 3NJXA 4Y26A 4EROA 2B7YA 1KGYA 1W6PA 4YLZA 4ISQA 1VAMA 1NCQA 1RUF2 4EZ4A 1HRV2 2PQQA 1LJ7A 2W52A 3WNXA 1JBCA 4BLJA 1LTEA 1BQPA 3MIHA 1OKQA 3MLLA 2CSGA 2VR4A 3ROUA 1JOBA 4QX0A 2BVBA 2ARXA 2TUNA 2PAKA 5DAWA 3FHIB 4UFLA 1PO11 3IPVB 4OZXA 1F4AA 1RUNA 3AJYA 3OBTA 2RDNA 1V6OA 2W68A 3N4MA 3UESA 2V73A 2W1SA 3WW4A 2A6XA 1ZRRA 2FDGA 1PM7A 4JKKA 1Y9MA 3AZZA 4UFHA 3AKPA 1IPJA 5DAVA 2A1XA 3H8RA 1HKDA 1STMA 1HN0A 2EXJA 2XOMA 4HL0A 5F8PA 1GOHA 4H2AA 4NJ4A 3VB9A 1CVNA 1RUD1 1UIKA 5JXJA 5FP9A 1SLAA 4MADA 3ZPOA 4M3CB 4IEYA 5EJ3A 2VMGA 3N9NA 1F8VA 2A6YA 2B45X 4H55A 1W8HA 3SXWA 4HN1A 3RRDA 3KT1A 1LGBA 5DUVA 3UJOA 4N9HA 4N43B 1GQGA 5ANQA 5FO9B 4A3ZA 4EV0A 5CBLA 5IJRA 4LKFA 2ID4A 5GLVA 4YG3A 3ZLIA 3AKTA 2OYZA 1TVGA 4WM8B 2RM23 5D8AC 1TZOA 4I2OA 1A8MA 3VD9A 2V4AA 4HN0A 4IEVA 4Z1VA 1SZBA 5FP7A 4CEWC 2J1SA 1WCDJ 1M06G 1PGW2 2O0OA 4I3GA 1LHWA 1ZZ9A 4KU8A 4LO7A 3WY6A 2UYAA 2RR11 4YW5A 2QQJA 5CIRA 4GMP1 4K21A 1F9KA 2VZQA 5FMBA 2XBO3 2WZPP 3ZFGA 4AI9A 3GZAA 3INAA 4MV2A 5FZMA 1QJX1 1W8ZA 4LORA 3VZJA 3C8XA 1QOSA 2FDHA 1O5UA 1W0OA 3KGZA 2MHFA 2GMEA 4RHV1 3GM8A 1BZWA 1AZDA 1YQ8A 2O8QA 3LKJA 2GSYA 1BXHA 3VD4A 5F5AA 1KDKA 2HWF2 1JYCA 4B7EA 2FZ1A 1SFNA 4C8DA 1G9AA 1W6PB 3MPBA 1M4WA 2Y64A 4LA2A 4MX3A 4XBQA 4JTOA 2X09A 4AFMA 1AX1A 5EQUA 1AL0G 3AYDA 2R0HA 1I5ZA 1MQTA 4BQ4A 3AYEA 4A44A 1JZ7A 4K40A 1EAH1 1S1AA 2QZ3A 4GKYA 1OFSA 2NM1A 4XAAA 1S4CA 5JPMB 4XJZA 5A6QA 2W95A 4JVAA 1C8M1 2GMMA 3D0JA 4NWWA 5KHIA 2WNUA 4FFHA 5CA6A 3OGJA 4P9IA 2R061 2P17A 3U75A 4TYSA 2R0FA 5FMOL 1LOEA 2IFRA 3AMHA 2RG4A 3OOXA 3DCQA 4DIQA 1HV0A 4DXZA 2VM9A 1MPXA 3UGHA 2B9VA 1XYNA 4AZZA 1J59A 1W2AX 5EIYB 3D8CA 4M01A 3K4DA 3EJKA 2ARBA 3GALA 4CXXA 3T4VA 1HB1A 3VBRB 5JPNB 4LOSA 1ULOA 2BEOA 4JTNA 4A42A 5FYMA 1R1A3 1GANA 2F6BA 2WRAA 4B4RA 1LU2A 5JWPA 3M3OA 1GQPA 5J96B 3ALQA 3GBWA 1UY1A 1VBB3 1P8JA 2CNAA 2P3JA 2HYXA 3FHAA 3I2DA 5DABA 5A3OA 4BIFA 1VMJA 1VBA2 3TN91 3WEZA 1HDKA 3KM5A 4PLMA 1GYKA 2QQIA 2WWUA 1SLBA 1W90A 5JDBA 1XXNA 2JX9A 3JD72 5KWRA 4GWMA 2F17A 3WP5A 5J3UA 3WG1A 3K77A 3P6BA 3WQ1A 4MOAA 1AR93 3PIGA 4I0BA 4XUPA 2ZEXA 4XFAA 4LBLA 5EYYA 2DBNA 1K5MA 4FSJA 4V2WA 1ND3C 4QX5A 3VBOA 1ASJ1 2CHHA 2VL4A 1F31A 3DPRA 3POYA 4BJ0A 1XNTA 4DO0A 2ZAHA 3K3OA 1Q8OA 4Y22B 3ZFGB 4CUGA 1UF2C 3VUOA 2UYBA 4Q4V3 3WF0A 1DLLA 3CJIB 4XIKA 5D1IA 5BPXA 2HEWF 3ASIA 4UFKA 5FPBA 3ZYJB 3N9QA 1YQ5A 1BK0A 2VQUA 5K0UA 4DUXA 4ONUA 4LBNA 1ULDA 4LBMA 4ZXEA 4OFGA 1CZVA 5E8AA 3KS7A 1DZRA 3W21A 4RGGA 1UZWA 2RMU2 4CSWA 3UJQA 3IDCB 1JHJA 4GZ9A 4HLTA 4PJYA 2W91A 5A80A 3I3QA 4YVWA 2HJIA 4GH4C 2D97A 4NAOA 1ZBA2 2W1QA 3HJRA 1IS5A 2A6ZA 3ABZA 5FPZA 1YQ6A 3WOGA 4X8PA 4ES9A 3PVOA 3DUIA 5CKNA 3A4UA 1LEMA 5DDJ1 1MQTB 4RN5A 3PU3A 3J9SA 3HR9A 1YFWA 1UZZA 1UKGA 5JMOA 1NCRB 4GD4A 2FHRA 3H8XA 4XJ8A 2SBAA 1U12A 2CTVA 2JEMA 5A3MA 4OI1A 3HQRA 2UWAA 3M3EA 4EE2A 2JG8B 2WA4A 3BU0A 2PFWA 2WQ8A 4HKLA 2PHDA 4FPKA 4LK7A 4AI1A 2G4IA 1QQP2 4CVUA 1WA6X 4HSLA 1AX2A 3GJBA 3LOBA 3AYAA 2W08A 5J48A 1BBT2 4FQZA 3W20A 1OVPA 3B93A 3JZVA 4QB6A 4QXCA 3JQXA 2ZGKA 4FFGA 4PIYA 2EXIA 1SCSA 1RUC1 4Y20A 1PVC1 3KV5A 2W3JA 3O0XA 1H1AA 4FOVA 5GZEA 4B8EA 2VTXA 2FDKA 1UMHA 4XQWA 5LY2A 3KWVA 4FOQA 4P14A 5DZFA 1B09A 4YW3A 1N3QA 4A45A 3WG3A 4XTPA 1ZRCA 2NMNA 1GZTA 4GWNA 5KHHA 4IXLA 3T2PA 1FYUA 2PMWB 2D98A 2VOVA 1WLTA 1N1TA 2QNKA 3MFCA 5LB6A 4AI3A 4WM8C 4Q4W1 1B35B 2QTWB 4AQ6A 3AMPA 3N3HA 1H9PA 4FTBA 3DGTA 4META 4IUGA 2PLV3 4HVOA 5F3IA 2QDRA 1PO21 3WDTA 1ENXA 2D3PA 3VZMA 1X9TA 3VBOB 4PHZA 1YQCA 2LUWA 1JZ3A 1CAUA 2GP5A 5L73A 1AR63 2R30A 1RYYA 2ZGTA 3DPRB 1YRZA 4IW3A 4LQRA 1JYNA 4KBZA 1QOTA 3ZSEA 1NAEA 2Y26A 5JXIA 3KMHA 4XF1A 3GDBA 4Z07A 4Z2AA 1CGPA 5K0UB 4UW4A 3B9IA 3USSA 4RGAA 3H8UA 2GC1A 1PO12 2Q1FA 2MEV1 4WBBA 2ZA9A 3LEKA 3N7JA 3WF1A 2RS31 1SCRA 3KCYA 4QPGA 1U5ZA 3LFMA 2DVDA 4J1WA 4Y1UA 5FZKA 4W65A 4GWJA 4U36A 1R1ZA 5FJHA 1JUIA 3GBFA 1C5IA 4L9BA 4ASLA 1AXYA 1G8WA 2NLRA 4C1WA 5C9AA 2KXLA 1ZBE3 4JDNA 3O1SA 4XF3A 3WNMA 5FYBA 4Q0VA 5KBFA 4KBBA 1YFXA 5A7WA 1AR83 2R043 1S2BA 3UYJA 4MO3M 2PLV2 5DAPA 1QWRA 1S0EA 5EZWA 1DG6A 1W2OA 4OUSA 5AVAA 5DMYA 4LLOA 4XXPA 5FZ9A 5APAA 5F9TA 1JI6A 2KR2A 4Y5TA 1W06A 4Q1RA 4MUVA 4Z2WA 5AC91 4OI4A 4A6SA 1MEC3 3I97A 3TEXA 2GAUA 2JDPA 1JODA 3ZYBA 4LT5A 1KITA 2VY0A 5CKQA 5CFDB 3I2OA 4FPCA 1H8TC 2ZMKA 3CLPA 1BMV1 3VBRC 1QOOA 1IKQA 2A3XA 3VBUB 3SC7X 4I01A 2PHUA 2O8OA 4B29A 5EJ1B 5T3NA 3O7OA 5KHKA 1E5SA 1TME2 1A6CA 2RR12 5FZEA 5HCHA 2LS6A 3N35A 1RVF1 3WW3A 2E6VA 4AXOA 4BOWA 2EVXA 4ZS2A 4JCKA 3WW2A 2XDVA 4O9GA 4D3WA 4G9SB 3WP4A 1DBNA 3EQEA 3O14A 3RJ2X 4CPBD 1XYOA 2DU0A 3AC0A 3VLBB 2BWAA 3A0KA 1OVSA 3O1VA 4UW3A 1DYOA 5FDBA 1W6NA 3EXUA 1LR5A 2R042 3MLKA 2K2SA 2QKDA 2DCYA 3I2JA 2ZX1A 3V65A 3VZKA 2XWJB 4AQSA 2B39A 4XILA 4BXFA 1S0FA 3RI8A 2QQLA 4J25A 1ZRIA 3UKVA 3S0MA 2BGCA 2JE8A 2WNEA 1BJQA 3O0WA 3BI3A 2EIGA 4P9YA 4QKFA 3PMSA 5HV0A 1W39A 5FZ7A 2KM2A 4QHZA 4Y1ZA 1OHFA 2R1DA 2I45A 3CJIC 3RMYA 4DY5A 4HZFA 5EHDA 4BDVB 3AMQA 2AH2A 5C33A 5IFPA 1HXS1 2R6QA 1F2NA 4GB31 2BQPA 1PZ7A 1KFUL 4IV3A 4N90A 1EAH2 5GLZA 4DY3A 1W0NA 5FZ8A 1MS8A 5IVEA 4FI9A 5FP3A 1D4M1 5FO8B 4Y4RA 1H30A 1GOGA 1OLQA 5BYNA 3VKMA 3ZO0B 4NAMA 3ZSJA 2HWB1 2HLEA 3AM2A 5DAQA 4XPVA 4QDQA 4BMEA 2RDSA 3S5AA 1IKPA 5LA2A 3T2OA 1PVXA 4R52A 1RB8G 2VTFA 4CUBA 3GZEA 1VBE1 2VULA 3CU7A 1CX4A 1OPOA 1UMIA 2E51A 4OI2A 5C9AB 2CL2A 2DDUA 1W2UA 2AZ5A 1A8DA 2XVKA 4AG4A 5T52A 2VOTA 2UWBA 1NCRC 3X29B 1EY2A 2HKXA 2B46X 1J3RA 2XB6C 5FY8A 3ZR6A 4NO4A 5GZDA 5B4XA 1RUH1 1X9PA 2JG8C 1E5HA 1VBC2 4LO4B 1KJLA 4P08A 3UK9A 2WWSA 4IV1A 4YZ1A 1NQJA 1VR3A 5LASA 2DV9A 5BNPA 5KXDA 5A33B 2D3SA 2OQ6A 4LHLA 2FBEA 5FPVA 2WN2A 3TN92 1COV1 5IK5A 1MS0A 4PF1A 2CAUA 4FTSA 1XQNA 1ZZ8A 1R093 5FY5A 3BUCA 4ZZ8A 5FZ6A 3BTYA 4XHXA 4ZONA 3H42B 3NJZA 1AJKA 3AX4A 3TOJA 2V5YA 2PELA 5F3CA 3LEGA 4LBQA 5EYXA 3J8F3 5T5OA 4K1ZA 4ES8A 3M70A 1SFPA 2RS51 1GUIA 3DKWA 1GU3A 4Q0QA 4HPKA 4NPLA 1QJU2 3FL7A 1C4RA 4LHSA 2WZR1 3CIHA 1YFYA 1B35C 1DLCA 3HWJA 3ME2A 1W6NB 3C2UA 3ZFEA 2BZDA 4JGYB 5CG9A 3ZR5A 1EV13 2ZGSA 3S7EA 1DYPA 4OZOA 2Q1ZB 1SG3A 4P9GA 3SCFA 3NNGA 1GZWB 4F8AA 4IE7A 5FXVA 3VBOC 2O14A 3I54A 4URAA 3PTRB 4RS5C 3DN7A 4DNYA 2DCKA 4BZ4A 1OURA 3T0BA 4FPHA 4PLNA 1Q56A 2RDQA 4QQLA 4C91A 2Y60A 4QXHA 1TQ5A 2HWD2 4FVVA 5CEHA 2HYKA 4IV3B 3WQBA 4KWLA 2FCUA 4YG6A 1RTVA 4NROA 5F6LB 3WZ1A 5BNNC 3AP5A 4FPLA 4BQXA 3VBHA 1Z7S2 1HX6A 2HWE3 5F5QA 3J7MA 3OGGA 5FCCA 1ULFA 3VKOA 5KR7A 1IS6A 1LNSA 2HBUA 3AP6A 1RC6A 4GMP0 1PK6C 4B4QA 5F5IA 4AFDA 2A6VA 2AENA 3WW1A 2W9XA 2GALA 5K4LA 1BEV3 1W04A 3ZXKA 4WV8A 3L2YA 3MIFA 4KU7A 1JS9A 1VAKA 5EPAA 1FMD3 4IEXA 4K20A 3NAPC 5FYSA 4LO8A 5T50A 3THPA 1MR5A 2VCMA 3PUHA 4D6RA 4IEWA 2WFF3 4LLFA 4XBLA 2BTVC 1S2EA 2XLAA 5F7UA 5FZHA 4ZU4A 4S2FA 2JKXA 1D4VB 2PXJA 2VTXJ 3IDAA 3JQWA 3PIJA 2JDZA 1IS3A 5BNPB 2FCTA 1RUI3 2VW1A 3MHZA 5FYZA 1RMU2 1XRUA 4S2GA 1DGLA 4NMIA 3WX5A 1C57A 5CFDC 3PJQA 4RD7A 3T09A 3WLUA 2G1MA 3RYRA 2B42B 1VRH2 3VBUC 2VW2A 3TYJA 2FMDA 4CXYA 5FIXA 3WDYA 3RI9A 4LPLA 4GKXA 4FP2A 4INDA 2TNFA 1UX6A 1DZQA 2Y6HA 2PHWA 5SV8A 3C7GA 1L7LA 3ZM8A 2JDYA 2XH6A 2C5DA 4P9JA 2D6PA 4XAEA 1C8NA 4E2GA 3D5OA 1R081 1CPNA 4LK6A 4COZA 4PDWA 5ACA3 1C1LA 2XJSA 1FATA 2WYSA 2RM21 2VZTA 4R9CA 4RGKA 1MZEA 5FZ3A 1IQDC 4EWAA 3ZFEB 1I5PA 2UY8A 4CYDA 1W8TA 2XXZA 3VD5A 2VNVA 3MYXA 2FCVA 5HV4A 4B4PA 1HJFA 2OW4A 1AX0A 1C5HA 2XBO1 2VZPA 3NNLA 4D7YA 4UF0B 4XFHA 1O5LA 4NIIA 2JE9A 3PUIA 4XC9A 1FNYA 1JTZX 2BBAA 1W8NA 1LOFC 2GH2A 1IPKA 4FP3A 1J58A 5AFBA 1O4TA 5CZKA 2R1BA 2UY9A 1GV9A 2WA3A 4L92A 4HVRA 4QX2A 4BK5A 2QCSB 4CDWB 1ONAA 1WW4A 2P34A 5C3PA 2ORZA 4NRPA 4CU6A 1OXCA 5F3GA 1QY4A 3ZXDA 4JGZA 1NLSA 1GKBA 3LPGA 4XMIA 3VGIA 1PGL2 4E4ZA 4A2UA 2Q5TA 4CP1A 2VD7A 5IWFA 4AI2A 3OBRA 1MACA 2NQYA 2XJQA 3MFAA 2J7MA 3PUSA 2RE9A 1DGWA 1DU3D 1WCKA 2VG9A 1QH6A 3AXDA 1OBNA 3KD4A 5T54A 1W8UA 4YW2A 4XJ9A 3ILNA 5A7PA 2XJTA 3AFKA 2OIIA 3GZUC 1CONA 3LDBA 3POEA 4CCOA 4CDQA 1SDWA 1ZZ6A 2KA3A 4L8QA 4XFGA 1DQ2A 2RS12 2D6KA 3J26N 1LCLA 1RUJ3 2WN3A 4LTAA 2DF7A 2VVDA 4WVWA 3HEIA 2VOXA 3OSDA 4J6GA 4Y1XA 3WDVA 5JUVA 3OBZA 5JMCA 4QB1A 4Y3OA 4XQ4A 1GR3A 1JXNA 4OHZA 4CU7A 3WF3A 1FOD1 2ENRA 1LULA 4NHYA 3O1UA 1KJRA 3AZWA 3IIAA 1QJY1 1TMF2 5BV6A 1ZRFA 2Q8DA 1DCSA 4D6QA 3MI8A 3E5XA 1UOJA 4L99A 2WIIB 5K8SA 2H0VA 1JHNA 1ULCA 4MGYE 3CKHA 4ASMB 2Y33A 5CU1A 4QPWA 2WLQA 3AJZA 4CDXA 5JZGC 1VBB1 4MVTA 4AW7A 1RUF3 4F7ZA 5HPOA 1HRV3 1AYN2 5FWJA 3ZSLA 3M8LA 2FD8A 1W6QB 4AHZA 2OA2A 3F95A 4PDWB 4WM7A 1MVQA 5CFCB 4UI9L 3HD8B 5FK7A 5I0SA 5A32B 4JGYC 4S2HA 5BXXA 1UN1A 2JDMA 5TSWA 3SH5A 4P5YA 1AR91 2X10A 4ATFA 3M3QA 4U2AA 4AVBA 1WGPA 4DRRA 5LBBA 4A41A 4RR3A 2YYOA 4PCRA 2HWB2 5A6YA 3ZSMA 2UURA 1H6XA 1VLNA 1HW5A 2PHLA 2P4EA 2E7TA 3LEIA 3KT4A 1Y3TA 4AYUA 2OS2A 1K12A 3IMMA 5CISA 2WBKA 2E31A 3LSDA 1KEXA 4IEZA 1F5FA 2NMOA 3NVCA 3O1RA 4CCNA 3S57A 4BQ1A 2DVBA 3ELNA 3BGAA 4P02B 3NO8A 2XMLA 2K0GA 3B9CA 1PZ8A 1OQ1A 3E5UA 1ZNPA 1RUH2 2J42A 3B01A 5ABJC 4FO9A 1I6XA 1UD1A 2JKBA 2Q4SA 4JGZB 5K9YA 4WZCA 4HSJA 5FY7A 1HB3A 2XL9A 5IVYA 4QM8A 5E16A 1KRIA 3WCSA 2GC3A 3LQCA 4XURA 1SPPA 1UZ0A 1VIWB 1SMVA 3HAGA 4Y5SA 3RS6A 4NPRA 2CYFA 4N53A 2C1FA 2P3IA 3CL1A 4RQPA 1LENA 2R072 4BYYA 1N3PA 1BLZA 2YU2A 3FC0A 1AL22 4LULA 2B4KA 3OUJA 3PVEA 4PF5A 2IXKA 4CRQA 5FZOB 5B2GB 1Q43A 1T6BX 2BNNA 4OHVA 4LKEA 1WMXA 2D44A 3JBG1 3RZLA 2WSUA 3CQOA 4BU2A 1YLLA 5KHGA 1G6NA 3VKFC 1O8PA 1UQXA 1ULGA 1FI2A 3A21A 2NP0A 2Y34A 3VD7A 3ZFFC 1XSRA 4QHBA 4FOWA 4QU2A 3THCA 2AEZA 3V0AA 3KLSA 5F2SA 1OOPA 3JB4C 1H1IA 4F3JA 4KL1A 1CJPA 4AFBA 2IXJA 1NA1B 4KMQA 4AEDC 3PMEA 3NQHA 1W05A 2ORXA 1XSQA 3PVNA 5A3WA 1IG0A 1YC61 2HWF3 2QDNA 4HMZA 4LUMA 3ZXAC 3OUHA 2ZZJA 4Y4YA 3ENRA 4CDXB 1UU5A 3OYWA 5FLHA 5A1AA 4R4XA 4XF0A 4RFRB 1CESA 2C0ZA 4CCMA 1UZVA 4YW6A 4WM7B 1US3A 1J3QA 3H7YA 2WUHA 3P1IA 4YW7A 5H9QA 5GLWA 5DAXA 4IE6A 1QGLA 1OD5A 3G6JB 2JD9A 4XF4A 4DMIA 4RR3B 1V70A 1AR61 2XWBB 2Z4FA 4O65A 4Z8BA 5BNOA 5A3LA 1DQ5A 2UWCA 4FPGA 1POQA 4GALA 4QU1A 1Y9GA 3VBFC 1JZ6A 1N1SA 1ND2A 1POV3 1DFQA 1RUG2 3CJXA 3PUQA 1NE4A 4RL7A 4XETA 5I0RA 2D40A 1PMHX 1FPN1 1S0JA 2BW8A 2DU1A 2EIEA 4H3WA 3VDDC 1LAJA 4CCDA 3DECA 1J84A 4CDWC 4JX0A 2YC0A 4EQVA 1EUTA 2P3KA 4D7TA 4G3YC 5J98B 4YARA 4NIAA 4XOGA 3BODA 3MBWA 4QMAA 4HK8A 3C7EA 3B00A 3SKJE 3ZMNA 1WCUA 1NCQB 4IERA 4WVMA 1W28A 5LY1A 1UU6A 3MPPG 3IAQA 4HKOA 2JDUA 4DB5A 1YO8A 4JDOA 1VBA3 4FXGB 3WQ7A 4DXSA 5FPXA 1ZBE1 1LGCA 2ET7A 2XKPA 1G9FA 3JD73 1AR81 3ETPA 1IZ3A 1JU4A 4W8JA 2DUQA 5FZLA 3ACFA 2VO5A 3MLJA 3H1YA 5HBAA 3LD8A 1UXXX 2YUEA 3SISA 2VC9A 4CTEA 3FZ3A 4XEZA 5FY0A 4IGQA 3ATGA 2YFZA 2NN8A 1SHWB 2IFWA 4MGTA 5H9SA 1R082 5KXCA 2Y6FA 3ACGA 3M4FA 3THDA 1O59A 1OH4A 1SBDA 1OA4A 4XHBA 5FY4A 3MV11 1HRI3 2NZ9A 3OD4A 5C4WA 3BTXA 4YNIA 4E27A 1H6YA 3V0AB 4AL9A 3LSEA 2D3RA 4IE4A 5FYHA 3RMXA 3FBYA 4QGMA 2ZGQA 1V9U2 1O4YA 2P6CA 2RMU3 2DWRA 2CGOA 5FMDA 4DZGA 1U0AA 3TBDA 2J22A 1RITA 3H1MA 3K4AA 5EP9A 4UT5A 1BVVA 4A7YA 4CEYA 5JI7A 1UY3A 1ZBA3 2JWPA 5AFEA 1V6KA 2ZX4A 3VL8A 1WBLA 5SV5A 4NR1A 5CFCC 2BVVA 3CBNA 3CHXA 3I3EA 2IVIB 4ZHNA 3AZXA 3WQ0A 1TEIA 2AGSA 2QZ2A 4LHNA 3NV2A 2HWC2 3IB3A 4URTA 3GXUA 3PLQA 1Y7BA 4M3CF 4C90A 1PIV1 1QQP3 2W46A 1O3QA 5IFTA 1RUE2 1N1YA 1BBT3 2MNGA 3EO6A 4YRDA 4FOYA 4C0BA 4V2VA 1HRI2 2WS92 4XZPA 2C9KA 3R05A 5A7OA 3S30A 2ETEA 2NPIA 2OZJA 4H14A 1NXD1 1XE8A 3KV4A 3P3NA 4DXRA 2AC1A 2Z69A 5FXZA 3WVJA 4BQWA 5FZBA 2VZRA 4DOUA 4JKLA 3D6EA 3I7DA 4B1MA 2ZGLA 4WVMB 2PHRA 1W6OA 3HNMA 4E8DA 1QKQA 4NOTA 1CAXA 1W9SA 3NV1A 1X7NA 3CF6E 3AB0A 3TWIA 3Q9OA 2OPWA 3ZN6A 1YHFA 1QJY2 1QNWA 1AR72 3UGGA 3GHNA 5GLTA 2ZHMA 2XQRA 3CEWA 1HQLA 1IG3A 1VALA 4OYUA 3WNNA 1NG0A 1X50A 4JRAA 3HN1A 2WNUB 2WT0A 4Q4X2 3ZYIB 4YGCA 5BNQA 4MGSA 4PBPA 1DZTA 1NKGA 3AP4A 4FPFA 4JAAA 3U37A 4COVA 4LOTA 2EXKA 1HJGA 3O1TA 2D93A 4AVTA 1IPSA 2ZGRA 4FPJA 2BFUL 5LRRA 1O3TA 1R091 2YB7A 3CZUA 5L9BA 3V64A 1GP6A 2QJVA 3ZOIA 2X5IA 1PO13 3OY8A 2DTYA 2ZMNA 2XJPA 2VW0A 1NA1C 4Q8LA 2AREA 4YM0A 1NLRA 4NIHA 1KS4A 2VJXA 2OT7A 1V6JA 3J8F1 3RWKX 2BJSA 3PNAA 3C7OA 4N43C 3O1PA 5IAVA 3LB9A 3ZMOA 5I8TA 4ARXA 4BE3A 3EBRA 1KQRA 3ZSKA 1L3JA 2ZX3A 4R8HA 2DVGA 5FZ1A 1DQ4A 4QDSA 3AKSA 2P5BA 4E8CA 1F4HA 3OEAA 1EV11 3O1MA 4Y33A 5FR3A 3NRUA 1K5MB 5DUUA 4IGPA 4EN8B 1W99A 1WW5A 4XFBA 1OSGA 3KV9A 5D2AA 3ZYPA 4QQOA 4CP0A 2D5FA 5LA0A 2ZKLA 3WP6A 2ZZQA 2VZ1A 4N9IA 4ORFA 1O6UA 1S2KA 3ZVXA 4KWKA 1FAYA 1UYXA 3BKZA 2LROA 1HLCA 1GP4A 2O1QA 5LRSA 5C8CA 3DF0A 4DUWA 3RDIA 1J1LA 2WO1A 1ALYA 4UBGA 2HWE1 3ZXGA 1W2NA 2BDRA 1TME3 1WLCA 4UBHA 2RR13 5JVVA 3E97A 4MGKE 4ASKA 2EAAA 1NCQC 3LDRA 3R4SA 3E6BA 2DCJA 3LA7A 4YVWB 3WD5A 2CGPA 2K9ZA 1UPIA 3JBG2 4F83A 1APNA 1BEV1 2ZX2A 3MIBA 1FMD1 4AVAA 2IXLA 1RUD2 4QD2A 2YZ4A 3ZN6B 2WFF1 3M3IA 1H4HA 1JYVA 2PQSA 5IK8A 4LKSA 3KHBA 5FP4A 1OUSA 4Q4Y1 1ZREA 3QH6A 4FCAA 2PAMA 5HCBA 1PX4A 1OF4A 2QUOA 4KWJA 1RUI1 4HKWA 3C7FA 2WNVA 4YVSA 3IIIA 4CU9A 4MGQA 1EP0A 2UU8A 4YM2A 3ZPYA 4YFZA 3B7MA 1Z78A 1EAH3 2OPKA 1RHI1 2WWJA 2ZGOA 3GJAA 3DYPA 4HG6B 4LR4A 1O8SA 4FPYA 4Y20B 2X5IB 5GZFA 5FPUA 3OY8B 4MXVA 1S0GA 1XOYA 4TLFA 5F5CA 4NIGA 5IUQA 1AVBA 4NE9A 2XGXA 3OG2A 3GCXA 3WINE 4OI0A 2D6MA 1LGNA 4QKBA 4XBNA 3U4XA 1QJX2 1VAVA 2V4VA 3KCCA 5A3PA 1IOAA 4HVQA 1NLQA 3DXUA 3N9OA 3MV01 4N7IA 2C6SA 3GGLA 1HIXA 4CDUA 2PTMA 2JG9A 1OT5A 1W6MA 3K51A 5JSRA 1HQNA 1ZM1A 2BWCA 1HB2A 4RHV2 4BLIA 4M4PA 2A71A 1AYM1 3ACIA 5JR2A 4KQ7A 3UL2A 4PI2A 3FX3A 3RZGA 1FPN2 3RZHA 1XYPA 1WCQA 4CP9A 4QPIA 4M0NA 1Y9QA 1XU2A 1SDDB 2DCZA 4IEOA 4PT6A 3T1LA 1V0AA 1VBC3 5C5UA 3J4UH 3U07A 4XIOA 3DV8A 4UAPA 2G19A 2J1TA 3ZFGC 3RZMA 1CAUB 3BVCA 2D7FA 4AOCA 2WC2A 4Q29A 5DZGA 4WVZA 4BISA 2ZS6B 3TN93 5K7PA 4W6XA 4GIQA 3FUQA 4MLOA 2GMPA 2IXIA 3HOBA 2ZXQA 2ATFA 3DXTA 3VBSA 2BV4A 3SHRA 5CAZA 1IS4A 3WDXA 1GP5A 5C8CB 2Z79A 5DQ0A 5FMOS 3MW2A 5T5PA 3W58A 5C6CA 2BBVA 1C8M2 1REFA 2R7EB 3EB7A 4FFIA 3HNYM 1V6LA 1CJDA 2B9UA 3ZXFA 2R062 3LA3A 2ZGUA 4QPGB 5JSPA 5I8YA 1RL3A 4BHPA 2C26A 1YFUA 3I2FA 3B94A 2EICA 2P6HA 4IETA 1QJU3 5HXVA 2VAUA 4L2NA 3Q8FA 1MQTC 2G9GA 4IE5A 5FZDA 2Z5WA 5A7WB 5FP8A 3U1XA 1CN1A 2XLFA 4C1XA 2BOIA 1O7FA 2JDAA 4YPJA 5FYTA 2WNUC 2D6LX 3MUY1 5ERLA 1RUJ1 5FQ0A 1LU1A 3EMRA 1OFNA 5I8SA 3AVRA 4LHKA 2E26A 2XL7A 4FBFA 3HNBM 1CAVA 1VRBA 4YVSB 3K48A 1UY4A 2HWD3 3MF9A 3OJBA 1NY71 4XUQA 2OKXA 4BMBA 4XF9A 3QH7A 1LKNA 1OLMA 1FX5A 1Z7S3 4LE4A 4AF9A 1EPZA 2Q8CA 4PQQA 1ASJ2 4G4FA 2GU9A 1W0PA 1NX9A 3ACLA 1KS5A 1RUF1 1HRV1 1YJKA 3T3YA 3WUDA 1PIV2 1ULPA 1YJLA 2IWGB 3I8TA 3OGRA 4XFFA 5JLVA 1R64A 5DZEA 5FWEA 3HBZA 3CZJA 4CDUB 3KQRA 1D7PM 4GWIA 4AVSA 3BOPA 5CKMA 3GYDA 3I59A 3AKQA 3UT0A 2P2KA 4RFT0 3RG0A 2AACA 2B5HA 5I93A 3LCPA 4JZRA 4XABA 4JRLA 4QPIB 1O3RA 2GN3A 3AP7A 1K5MC 1VBD1 3UKNA 2HEYF 5FZFA 2YBSA 2P37A 3T2QA 5AVPA 4NVPA 3DPRC 1YIPA 2EAKA 3KQ4B 3TNQA 2VBPA 1H2KA 4YW1A 1RMU3 5FYCA 2WQ4A 5LATA 3I2HA 3FLRA 2W1UA 2E63A 2XG3A 5K0UC 4TXWA 2JDHA 5D8AA 2RDRA 4I09A 5DDJ2 4ZU7A 3VBSB 3WF4A 1UKRA 3UV9A 3IWZA 5IT6A 4MG2A 4HOOA 1VRH3 1ZA7A 2YC2A 1BKZA 2VZSA 3BPSA 4CEWA 1A34A 4JQRA 3ZYRA 1RXFA 2VZVA 4XW3A 3S6PA 1IHMA 1PO23 1LB2A 4TWTA 2PHXA 1J83A 3MIEA 1UCXA 4DRVA 1H9WA 3IZOA 4YVWC 4NHXA 2VMHA 1PHMA 3H3ZA 1DQ0A 3NV4A 4FPOB 1U5IA 1XE0A 1UOGA 1VJ2A 1BMV2 3AP9A 1Q8VA 5IVBA 2VMDA 4YYOA 1NQDA 2OX0A 1WMEA 1RUC2 3BIWE 4YGBA 5C3QA 1PVC2 4D94A 1PMJX 1QH7A 1SBFA 2YPJA 5FY1A 5H9RA 4YFWA 1CPMA 1PGW1 4HETA 3NNMA 3OUIA 3U0ZA 3NKGA 2QQNA 1ZX5A 4RA0A 2WZ8A 4IV1B 1UX7A 1UY0A 4XQDA 3K2OA 4QB2A 2ZKNA 4DQAA 2CY6A 3A22A 3VHNA 4TSVA 3LOIA 4Z92B 1GLHA 3POBA 4QX8A 3W5MA 1GNYA 4Q4W2 3ST7A 3MIGA 4BH9A 1WKYA 3KB5A 1REEA 2D6OX 2JB4A 2P3YA 4SLIA 3POJA 1HB4A 3SCGA 1UU4A 3RFRA 2W47A 5D21A 3RYPA 2AYHA 1JYXA 2HBTA 1PO22 2QFEA 5DPNA 1NZIA 3KGLA 4B3NA 4COYA 2HWF1 4QXBA 2PHTA 4LBQB 4AHXA 2WT1A 2OUHA 4DXTA 4CP2A 3K3NA 4WVVA 5FUNA 3LEMA 5JI9A 2CAVA 4HPKB 1D2SA 2V5DA 2ERFA 2XKOA 4FFFA 1GNHA 1O91A 2VMFA 4P00B 3WNKA 1Q5OA 1YUDA 4NUBA 1GBGA 3DL3A 2MEV2 2ZX0A 3THTA 5A70A 5FYVA 2J1AA 1KDMA 1F15A 1W3XA 1WBFA 2PYTA 2YROA 3HT2A 3I3DA 4P9XA 3I3BA 5E89A 3WUCA 3WG2A 2RS32 3O5SA 4Q1PA 2RS13 1DQ1A 3FMGA 3P3PA 3BIEA 3PUAA 5LBCA 5FXXA 2QQVA 5FAXA 5A1LA 4W4ZA 2GP3A 2Z42A 1WLWA 3DEMA 2Y8KA 4OUMA 2JDNA 4EYUA 1CZTA 3FJSA 1MS1A 2ZGMA 1V6NA 5D8AB 1TMF3 1SFYA 4Q26A 1YQ2A 4JHZA 5I91A 2DTWA 4CEWB 1FNZA 3VBHB 4OVEA 1ND3A 1OUXA 1XE7A 4HK9A 5J09A 1Q3EA 1TNRA 3G7DA 3JU9A 3H9AA 2EALA 3H3UA 1YEWA 4LIUA 4Q4Y2 4QPGC 3OPWA 3SLIA 4NN0A 5AC92 5F1RA 1AYN3 1X8EA 2JD4A 1VBA1 2JXAA 4ISRA 3K46A 3R4DB 4UYBA 3LF7A 5C9AC 2H6CA 4ZPIA 1GZ9A 3ZYGA 5A3TA 1JZ8A 3JD71 1LESA 4K9SA 4W50A 3VDAA 1ENRA 4JHTA 4QDRA 4D69A 1RHI2 1YI9A 4DFSA 5LCWL 1DGRA 1XPWA 4TN7A 4AHYA 5GM0A 1TG7A 1IQAA 1WLDA 3N36A 3OGSA 2EIBA 4LMFA 4O9EA 5JOYA 4I0WB 2VECA 3VHOA 3V56A 1RVF2 2HWB3 3KV6A 4GH4A 5IVCA 2L9LA 2TBVA 4HT1T 2QQOA 2X05A 1EYBA 3IDEA 4JV4A 4CPBA 4D8MA 2JB8A 4EN7B 3ZXLA 1AYM2 2IZWA 3FBMA 3IPVA 3QBQA 5FYYA 4UOJA 2R16A 1R1A1 2RMU1 4XFIA 3DYOA 1SLLA 2A5ZA 4MGIE 1E57A 1RUH3 3PDQA 2VCAA 2DURA 3FUOA 3VZLA 3ILFA 4D0QA 3CDZB 5FRAA 4XCAA 1UL9A 3AKRA 5IW0A 1ZBA1 1BK1A 1JZ4A 1T6GC 3NV3A 1HXS2 4GB32 3J7HA 2F4PA 3MW3A 1CWPA 2N7GA 5I0TA 1W2TA 1WW7A 1XC6A 1UYPA 1D4M2 3LIHA 2VBDA 2BNOA 2R073 2VNRA 4M3CA 3EYPA 3TEYA 1AUYA 3H0OA 2RV9A 4X8NA 1AL23 4CCCA 2VQAA 3J7NA 4Y5Z0 1NUKA 1QQP1 4K7JA 2RS53 3H1WA 4Q4V1 5A7QA 5ACA1 4EN9B 4YZ2A 5JOZA 4AQTA 3VKLA 1BBT1 1VBE2 2PAEA 2WZR3 4OLLA 1QXPA 3C7HA 1A3KA 4WM8A 2WLPA 3RJRA 4IV3C 1Q8PA 2Q0AA 2VZ3A 2VQTA 3VDBA 2IXCA 3PL0A 4LBJA 3USUA 4UW6A 3ES1A 3AYCA 3TEZA 4AGGA 5DXDA 2YBKA 1AHSA 3HN3A 3VL9A 5FYUA 4KI5M 4Q27A 2FDJA 2CU5A 5JOXA 4R9DA 4BQ2A 4OHYA 5BY5A 1COV2 1LHVA 4LE3A 2NYYA 1DIWA 2R32A 4PLOA 2ARAA 4YGEA 3UETA 5EJZB 3TRSB 4MH0E 1JZ2A 1JN2P 3L2HA 3LZZA 3BCWA 4XDQA 4GULA 3B69A 1H1MA 4A7ZA 2W39A 2ZTNA 4CDQB 1W8WA 2F4LA 2LTNA 4Q8KA 2BU9A 2YFUA 4IV1C 4J1XA 5BNPC 3T30A 4GQ7A 1ZZCA 2A70A 3RGBA 2RS52 1UMZA 3D3AA 2V09A 3OF1A 3BALA 4DPNA 4GH4B 4TTGA 3WDWA 1OD3A 1ZYBA 3BPZA 4CCEA 3BU7A 1VMHA 2QQWA 4FQ4A 2WZR2 3QCWA 1N3OA 1XNBA 4K6BA 4YM1A 3Q8CA 4M4RA 1FXZA 1LEDA 4XXAA 1AJOA 1RUG3 3M1HA 3FLPA 4LA3A 2OVUA 3NNFA 5FJKA 1JMUB 2W2IA 4AQ2A 3E6DA 5LW9A 2J1EA 4NWVA 1VBD2 1ODMA 2FQPA 1OC1A 2DUPA 2Z2SB 1OKOA 2WT2A 4LIVA 1ZZ7A 4BQYA 3Q8EA 5ANNA 4ET7A 2XPJA 3VDCA 2QQPA 3POWA 1HQWA 1H8TA 1F35A 4XJWA 2Q30A 3VBRA 2RJLA 1SLTA 3QACA 4FPEA 3ZFEC 5IHRA 1OA2A 3N9MA 4KWUA 1RJ7A 1JOPA 2PLV1 2D6NA 4Q0UA 2OQ7A 5FZ4A 2YGMA 3I4IA 4ZU5A 2GNBA 3JCIA 5FZAA 3KZ4C 1WD4A 4XJUA 4ZZ5A 1ZA4A 3PVBB 4ITCA 3SITA 1UYYA 2QBXA 2X53S 1F5JA 4L97A 1WW6A 2ZJCA 1R083 2J1VA 5IK7A 5IAXA 5FZCA 2DFCA 4ZXKA 5FKBA 1UOFA 2JE7A 3K4ZA 1BCXA 2WQZC 4IESA 1I1EA 2VXRA 3NKTA 2D5HA 2C24A 3USUB 1Q8SA 3VBHC 1KFXL 1V9U3 3J7LA 1OMIA 3CMGA 1KXGA 3A7QA 2BYVE 2VH9A 5FK8A 1TME1 3ZDVA 1S55A 2W94A 5FREA 1CZSA 4LXLA 1W8OA 1H2NA 4JKMA 2E32A 4Y22A 3PTYA 2WO7A 1UAIA 2GH8A 4QWNA 1MS5A 3CJIA 4NPMA 3ZYFA 3HPNA 1K5JA 1MS3A 1S0BA 2DVFA 4YWAA 4M00A 1QF3A 2GC2A 4MHRA 5GJ6A 2GC0A 1T2XA 2R041 2YDEA 4H7MA 5FBJA 1SPPB 1Y43B 4AFAA 2CGNA 3OGVA 4OHWA 3UKTA 4DS0A 3I2KA 4LBKA 2ZHLA 4N53B 2LM3A 5EWSA 1JYTA 1GSLA 3APBA 4RQPB 3HIFA 2XJRA 4AEJA 5FV3A 5DUWA 3S5QA 4YGDA 1OLRA 5C70A 1XNAA 2HWC3 4Q5OA 1LODA 2CWSA 1FV3A 1ZRDA 4DEVA 2Y6KA 1MEC1 2XVGA 3POIA 3VD3A 3FHQA 5F32A 3H7JA 2DFBA 5F39A 3WXPA 1L7QA 1RUE3 3Q8BA 3PHMA 4MGZE 5KHJA 1W3VA 1W8FA 1W9YA 2RM22 3ON7A 5CNAA 4AHWA 5B4NA 2WS93 3POSA 2AR6A 5HI0A 1ZVFA 1NCRA 4XZUG 5FO7B 1GWLA 1OOPB 5FMCA 3RVHA 2VGDA 5JCTA 2ZACA 1Z0HA 2JG8A 3AXEA 3HT1A 1CQ9A 2VMIA 2XBO2 2WFPA 1VB4A 4GA9A 3SNMA 3RSJA 2QE3A 1JU3A 3H3LA 1GOFA 3OYWB 3HBKA 4L0PA 5LEJA 1CX1A 1NOVA 4PDWC 2OXBA 1GWKA 1FOD3 2YHJA 5KXEA 1H8TB 1QJY3 3U4SA 4R9AA 3AZVA 4OCTA 4PBOA 3S7IA 1AR73 1XNDA 2LW8A 5C3SA 1UOBA 5BUVA 2RJKA 2XJVA 3SCHA 1VBC1 2ZABA 4Q4X3 1OPMA 1N47A 3B02A 1S0IA 2HEVF 4A7KA 4E2SA 4QT6A 1QJFA 2ADEA 3ZX7A 3CO2A 2DCTA 5BNOB 2V72A 4O7XA 4DINB 1UWWA 1Q8QA 1SLCA 1ENQA 1B35A 1W03A 2LALA 2VXJA 4XUOA 1KD7A 3BYWA 1ND2B 3BTAA 2W87A 4UFMA 2J1RA 4CCJA 4WZFA 1XBFA 3MZHA 2ZPXA 3MGUA 4LBQD 3TEWA 4JGZC 5FOBB 3IMNA 3MIDA 4MHUA 1Y4WA 2A6WA 4OHXA 4RS5A 2C4XA 2GNTA 2XONA 1QU0A 2Q1MA 4B1LA 4YG0A 1QJU1 4FAHA 3VZOA 1FOD2 2ZCWA 4XUTA 4OMDA 4LO5B 4C0HA 2BGOA 1XNCA 4LNVA 1QJEA 4DUVA 4CU8A 4E2QA 5BNNA 1CAWA 1PM4A 2ADDA 4CDQC 1R1A2 3KSCA 1OH3A 4W6WA 1S0CA 1OLME 3O0VA 1VBB2 4QGLA 3ZYHA 1DGRN 1PGSA 2PN5A 3WF2A 1GNZA 5HCFA 1PK6A 3KF5A 4A4AA 4E9KA 2FZ2A 2P1BA 2W92A 4GXLA 3RYKA 5JXHA 1URXA 3DKQA 2SLIA 5FLJA 1UZYA 2E7AA 1JOJA 1VMFA 1VP6A 4UFIA 5G04L 3D4KA 3NAPA 1CR7A 2HWD1 3NWKA 4BPZA 2VVFA 3JUUA 5A1FA 1QDCA 5JR7B 5C4WB 5LA1A 3D0SA 4NHMA 2FDIA 4AVVA 1E5RA 5JOWA 1AR92 3VN4A 3FFQA 1Z7S1 5EFUA 2GDFA 1X33A 4PIXA 3M2MA 2Y6GA 3IKWA 4X6RB 4CDXC 3ZDSA 2JJ6A 2CV6A 2RHPA 2A7AA 2BPA2 4XMAA 3R0RA 4Q4V2 4CEYB 1L7RA 3BN6A 3JBG3 2LRPA 5JAXA 5CFDA 4WM7C 3W59A 4OQ9A 4CXWA 2XUEA 3U14A 1CIYA 1ULEA 4R9BA 5LA9A 3VBUA 5KXBA 1RUD3 1DQ6A 5LK5A 2VNOA 3LE0A 2Y0OA 5J1XA 3V0BA 4CZSA 5JIUA 1WD3A 1PNFA 4N8MA 3OPZA 4RR3C 5C7GA 1H4GA 3I2IA 1MZ6A 4EWDA 2Q8EA 3TAYA 4IQPA 2VMEA 4E4HA 5L9VA 2WO2A 2YC4A 3O12A 4XE9A 4SBVA 1RMU1 2K46A 1RUOA 5ISLA 3JXSA 1BHGA 3FN9A 3IM0A 4BA6A 4MYEA 4HXCA 1I3HA 1VRH1 2ARCA 2VOWA 4R4ZA 5I0UA 5J36A 1WA4A 1X8MA 2CDOA 5F2WA 2R49A 3IAPA 1V6MA 3IN9A 3WDUA 3EHKA 2G9ZA 5EV7A 4HONA 1JUHA 1YYNA 4IEQA 4GMP3 4N7UA 5IVFA 1V00A 5HCAA 5T55A 4P9LA 2ZHNA 5IK4A 2WL1A 1MS4A 1QJX3 4RS5B 5C71A 1W6OB 2Y0IA 3IDBB 3QOPA 3KF3A 4GJZA 1CAXB 1DHKB 1LOCA 3BOWA 4RHV3 1LHUA 3OEBA 4BIOA 4BQ3A 1LOFA 2VUJA 3MUZ1 1POV0 3JB8A 4HFSA 1QHDA 4XTMA 4N53C 2EXHA 3ZXEA 1SBEA 1FPN3 1MVEA 3T2TA 5IATA 4RQPC 1NT0A 3VKNA 3E6CC 2IC1A 5DN2A 5BNNB 1CAWB 2ZEZA 3RPQA 5L7OA 1SLIA 3KVAA 4S2DA 5GALA 1WZXA 4KGGA 5F6KA 3D82A 2A3YA 3IT8A 3ZN5A 1BYHA 4Y24A 1H0BA 2QQMA 1QXJA 1PK6B 4BK4A 4YZ5A 3NW4A 3WHUA 1ST8A 4Y1YA 1HN1A 1RGSA 3KHCA 4AAPA 3NAPB 1QIQA 4OULA 1MZ5A 1OOPC 5FZIA 3TNPB 2ZAAA 1C8M3 5FTTC 4LITA 2JICA 4Q0SA 2Y6JA 3ORJA 1U5XA 4KG0A 3ILRA 3Q8AA 5J37A 5A33A 2R063 4QX3A 1PGL1 3AMNA 3MEPA 4GJYA 1AR62 3LFIA 2GNMA 5I0DA 1AXZA 2DVAA 3MDPA 3OBAA 1G9BA 3FFZA 2AUYA 5H9PA 4ZKTB 2EF6A 4Z82A 2ZHKA 2YY1A 5CADA 2GZWA 1GICA 1PMIA 3RZKA 3NNJA 5A7NA 4QPYA 3PU8A 1YI7A 4CA9A 3V0BB 2WO3A 2RS11 1NYWA 1SACA 4I02A 3R4UA 5LBEA 3SH3A 5JZGA 2E53A 3KVBA 5LEKA 5C3RA 4HBNA 5BNOC 3BTZA 3N7LA 1LHNA 4PI0A 4LO6B 1ZBE2
chains in the Genus database with same CATH topology
1OUSA 2BV4A 1OVSA 5A6XA 1UZVA 2XR4A 3DCQA 1OXCA 2JDPA 2JDKA 1OVPA 1OUXA 2JDMA 4CE8A 3ZDVA 2WR9A 5A70A 1UQXA 2VNVA 2CHHA 2JDUA 1W8FA 2VUDA 5A6YA 5D2AA 2WRAA 2BP6A 2VUCA 1OURA 5A6ZA 5HCHA 4AOCA 4UT5A 1W8HA 5A6QA 5A3OA 2JDYA 1GZTA 2BOJA 2JDNA 2BOIA 2JDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUS A;  2BV4 A;  1OVS A;  5A6X A;  1UZV A;  2XR4 A;  3DCQ A;  1OXC A;  2JDP A;  2JDK A;  1OVP A;  1OUX A;  2JDM A;  4CE8 A;  3ZDV A;  2WR9 A;  5A70 A;  1UQX A;  2VNV A;  2CHH A;  2JDU A;  1W8F A;  2VUD A;  5A6Y A;  5D2A A;  2WRA A;  2BP6 A;  2VUC A;  1OUR A;  5A6Z A;  5HCH A;  4AOC A;  4UT5 A;  1W8H A;  5A6Q A;  5A3O A;  2JDY A;  1GZT A;  2BOJ A;  2JDN A;  2BOI A;  2JDH A; 
#chains in the Genus database with same CATH topology
 1K42 A;  5FXW A;  4D6S A;  5GLU A;  1JYW A;  5A6X A;  1J1T A;  1AR8 2;  1ND2 C;  3GNE A;  3H50 A;  1HV1 A;  4X6Q B;  1XU1 A;  1TMF 1;  4JGY A;  5CVR A;  4MZU A;  4W6Y A;  4Y1V A;  1RIN A;  2H0B A;  2JEC A;  1GZW A;  4AEK A;  1ACC A;  2A3W A;  4KG8 A;  5FOJ B;  1ASJ 3;  3MW4 A;  1FT9 A;  3WNL A;  5FYI A;  4LKD A;  5J7M A;  4HAN A;  2BNM A;  5E1R A;  3WP3 A;  1AYN 1;  1MEC 2;  1XJA A;  1PIV 3;  2C9A A;  2VCC A;  1X82 A;  4KGQ A;  1GZC A;  2VUC A;  3ZKY A;  2DUO A;  1V6I A;  2OZ6 A;  1O3S A;  4AK3 A;  4ATE A;  1DF0 A;  4PQ9 A;  4UXA A;  2ZBJ A;  2VZO A;  4AWD A;  2BER A;  2HH9 A;  2PA7 A;  1YCI A;  3NST A;  3U10 A;  1JYI A;  4BM8 A;  4CCK A;  1DP0 A;  3NMB A;  3ZIX A;  3AL6 A;  4K3U A;  5ABJ A;  1LOB A;  5L7O B;  2DYC A;  4FTE A;  5KC6 A;  1US2 A;  2WR9 A;  1JZ5 A;  4M0H A;  3NJV A;  4QX7 A;  4E4S A;  2WNV B;  5LZ6 A;  4LUK A;  4EN0 A;  3T08 A;  3U11 A;  5DDJ 3;  4QKD A;  3AK0 A;  5C4W C;  4QXK A;  2YV8 A;  2BP6 A;  4YSF A;  4XUN A;  4QM9 A;  3POF A;  2A75 A;  5FZ0 A;  3W5N A;  4FXK B;  4COW A;  3ES4 A;  4NRM A;  4AI0 A;  2DBI A;  4QAW A;  2PHF A;  3WHT A;  4M3C E;  4JDM A;  1K3I A;  1CIW A;  2YPD A;  3PUR A;  5CYY A;  5FUP A;  1LHO A;  5L19 A;  4CEY C;  3FLT A;  5FKC A;  3OPT A;  3N7K A;  1AXK A;  2JG9 B;  2VOK A;  1W6M B;  3ZFF A;  3T0A A;  1WMD A;  1MZF A;  5FY9 A;  1PZ9 A;  1RUC 3;  1WWY A;  3WNO A;  1PVC 3;  4LBO A;  3GZT B;  4NHL A;  3LA2 A;  4CP9 B;  5F37 A;  3SQO A;  2VUA A;  2G9F A;  4AED A;  2R07 1;  3FE5 A;  2W1W A;  4Q0P A;  5T5L A;  3B3Q E;  1AL2 1;  1IGO A;  3MIC A;  2VNG A;  2X29 A;  4AAX A;  4AE2 A;  5JZG B;  3LIG A;  4E4D X;  4ARY A;  1W9T A;  3LAG A;  3WV6 A;  4I30 A;  4I3P A;  4EJR A;  3P5B A;  4BCU A;  1OF3 A;  4COU A;  1RJ8 A;  3AZY A;  3FWE A;  3SEE A;  2RVA A;  4Q4W 3;  3RWN A;  4CCL A;  1WUV A;  1DDL A;  4ZY9 A;  3AVS A;  5G05 L;  4YZ3 A;  4OUE A;  5L9R A;  1XB9 A;  5E88 A;  1XNK A;  2BFU S;  1PNG A;  1QXR A;  1O4Z A;  2KD7 A;  5HXM A;  5FUI A;  2RJ2 A;  3UGF A;  1WMF A;  2VUD A;  1K45 A;  1OQD A;  4UF0 A;  5FFO C;  5GZC A;  4K8F A;  2VU9 A;  4QQP A;  3VBF A;  1UIJ A;  1UW8 A;  1S0D A;  3L9J T;  3AMM A;  1R09 2;  2YBP A;  1H8V A;  1D0G A;  5DUX A;  2FDF A;  1QEX A;  5M0T A;  3VDD A;  2WSV A;  2CWM A;  2MEV 3;  2XUM A;  4XAC A;  5C8W A;  5L36 A;  2BGP A;  4CDW A;  3E5Q A;  1YNA A;  5DG1 A;  2Y38 A;  3RNS A;  2RS3 3;  4IL7 A;  4QKN A;  4IEP A;  4EN6 B;  2YG0 A;  3J8F 2;  5ABJ B;  1RXG A;  2QQU A;  4TLG A;  3O1O A;  5A7S A;  5FQ0 B;  5JIA A;  3CNA A;  2ZOE B;  5IVV A;  4CE8 A;  3A23 A;  1GMM A;  3U78 A;  1YXW A;  5LBF A;  3ZKU A;  1WCS A;  2XQX A;  2Q8O A;  1QJZ A;  1CAV B;  4QQ2 A;  1EPW A;  2X8K A;  2YXS A;  3H8O A;  1RUG 1;  1JH5 A;  1MS9 A;  2VZU A;  1X36 A;  2X5I C;  1EV1 2;  3ITQ A;  4QX1 A;  3NJY A;  4QQH A;  3OB8 A;  4OMC A;  4UWD A;  1N1V A;  4XFC A;  5FPA A;  1LOA A;  3OD0 A;  3M3C A;  4Q4Y 3;  5GKA C;  4LJH A;  1C28 A;  3IBM A;  1SQ4 A;  3N9L A;  3OTF A;  5C5T A;  5AC9 3;  5IVJ A;  4IDZ A;  2XR4 A;  1I9R A;  1QMJ A;  1TNF A;  1YIF A;  4JQT A;  3R6S A;  4B7K A;  1UXZ A;  4XDO A;  4XJA A;  2TEP A;  2JDK A;  1OA3 A;  3WNP A;  5JXG A;  4FT8 A;  1UPS A;  4AVC A;  4BWO A;  2VE1 A;  2ZEY A;  2WAB A;  3N9P A;  5T5J A;  3ZFF B;  1RHI 3;  3I59 B;  2B8M A;  5F3E A;  5DG2 A;  1PX3 A;  2HWE 2;  3OCP A;  3B5L B;  2AEY A;  1OQE A;  1AF9 A;  3HQX A;  4XCB A;  3AFG A;  5FPL A;  4AED B;  3T1M A;  3PJY A;  4EWE A;  3POG A;  5A6Z A;  1H2L A;  1RVF 3;  1H2M A;  4AFC A;  5EXO A;  3KT7 A;  1W6Q A;  2MPF A;  3HVD A;  2YMZ A;  1BEV 2;  1GWM A;  2YU1 A;  2XHN A;  3ZIW A;  3SEP A;  5CG8 A;  4LEJ A;  1SEF A;  3HQU A;  4O61 A;  1FMD 2;  1POV 1;  5CFC A;  1C3H A;  5A32 A;  5C8C C;  1ODN A;  1AYM 3;  3MO4 A;  1LOG A;  3I2G A;  2WFF 2;  2VBB A;  4K8R B;  3ZN4 A;  3WR0 A;  4KNC A;  3I3M A;  1V9U 1;  2A73 B;  2ES3 A;  3VHR A;  2ZGN A;  4BQ5 A;  3MF6 A;  1U5Y A;  3SH4 A;  1CD3 G;  3ECQ A;  2IUW A;  1ENS A;  1RUI 2;  2ILM A;  2VQ0 A;  2WAO A;  4RYD A;  3QD6 A;  3WSO A;  2BUK A;  3GHM A;  4MXW A;  4CUA A;  5KC5 A;  1HXS 3;  1FV2 A;  3N7M A;  4GB3 3;  4KH9 A;  3VBF B;  4AGV A;  3SKV A;  2ZGP A;  3RQ0 A;  1VB2 A;  4YM3 A;  1UY2 A;  4MSV A;  1RED A;  3K75 B;  3LPF A;  2VCB A;  3TB0 A;  3VDD B;  1D4M 3;  1UO9 A;  2EA7 A;  1OI6 A;  2I07 B;  1BVP 1;  1NZC A;  2J1U A;  5L7O C;  1QDO A;  1GFF 2;  2ET1 A;  5A3N A;  2HWC 1;  4NRQ A;  1C1F A;  1EUU A;  2WKK A;  2ZML A;  4FAG A;  1UYZ A;  4PIZ A;  1DYK A;  5ACA 2;  1RUE 1;  2WNV C;  4YVS C;  2H6B A;  1VBE 3;  5LWB A;  4BB3 A;  3UNP A;  3RZJ A;  2WJS A;  3LDK A;  1HRI 1;  2E7Q A;  2WS9 1;  4YW4 A;  2BRT A;  1J3P A;  2WYF A;  3M7A A;  4AI8 A;  4XVH A;  4TZD A;  3WG4 A;  1QNY A;  2W0X A;  1D0H A;  3KCX A;  4QGN A;  3T0D A;  3ETQ A;  4I0A A;  4IEU A;  4L11 A;  4NHK A;  4AGR A;  3T4H B;  5JSO A;  2W5F A;  5FZO A;  4IE0 A;  3VV1 A;  3URF A;  3WT3 A;  2CDP A;  1LEC A;  3HMY A;  5FBZ A;  5C3O A;  2QVS B;  2GN7 A;  1COV 3;  2WNO A;  4XDP A;  5GZG A;  2XVL A;  3QLQ A;  2VVE A;  4NID A;  3LWC A;  4CDU C;  2JG9 C;  4V1P A;  1E5I A;  4QHO A;  4OQ8 A;  3E1F 1;  4P5H A;  1G86 A;  3GBG A;  2WDB A;  3ACH A;  2FMY A;  4ZS3 A;  3GF6 A;  4Q2F A;  1AR7 1;  4EZH A;  2WAA A;  4K1Y A;  4QPI C;  1NA1 A;  2WIN B;  2IXH A;  3AL5 A;  2QQK A;  1W9W A;  2WZE A;  4BXS V;  2GND A;  1TE1 B;  2I2S A;  4Q4X 1;  2XLG A;  4XYX A;  3SMH A;  4N43 A;  4CUC A;  5LK7 B;  3RZZ A;  1G9D A;  4UFJ A;  2D43 A;  5FZG A;  1RIR A;  3W9A A;  2XJU A;  3VBS C;  1NE6 A;  3NL1 A;  3GCW A;  2ZEW A;  4YZ4 A;  4A6O A;  1UNB A;  1YWK A;  1VE0 A;  2E9Q A;  4GAZ A;  3BB6 A;  4H7L A;  3ZXJ A;  2Y6L A;  4AR2 A;  4D7S A;  5FLI A;  3WCR A;  1GQH A;  2JIG A;  1ND3 B;  2JEN A;  1RUJ 2;  1VBD 3;  4A3X A;  4DEQ A;  5E6H A;  3I49 A;  2E33 A;  3A0N A;  4UW5 A;  2JIJ A;  4P9W A;  3VHP A;  3VZN A;  1JW6 A;  1A78 A;  1G7Y A;  2VPV A;  5IYY A;  1W9F A;  1NXM A;  5CB7 A;  1LRH A;  5A3U A;  2EID A;  4MXW B;  4JC1 A;  2VMC A;  1ZZB A;  2BOJ A;  3LGR A;  1NY7 2;  2YGL A;  3F2Z A;  4IGO A;  2IVJ A;  1D2Q A;  1DGW X;  2XHK A;  4AEM A;  1G9C A;  3C3V A;  3DYM A;  1VPH A;  2OUJ A;  2I74 A;  4RSU A;  3NJX A;  4Y26 A;  4ERO A;  2B7Y A;  1KGY A;  1W6P A;  4YLZ A;  4ISQ A;  1VAM A;  1NCQ A;  1RUF 2;  4EZ4 A;  1HRV 2;  2PQQ A;  1LJ7 A;  2W52 A;  3WNX A;  1JBC A;  4BLJ A;  1LTE A;  1BQP A;  3MIH A;  1OKQ A;  3MLL A;  2CSG A;  2VR4 A;  3ROU A;  1JOB A;  4QX0 A;  2BVB A;  2ARX A;  2TUN A;  2PAK A;  5DAW A;  3FHI B;  4UFL A;  1PO1 1;  3IPV B;  4OZX A;  1F4A A;  1RUN A;  3AJY A;  3OBT A;  2RDN A;  1V6O A;  2W68 A;  3N4M A;  3UES A;  2V73 A;  2W1S A;  3WW4 A;  2A6X A;  1ZRR A;  2FDG A;  1PM7 A;  4JKK A;  1Y9M A;  3AZZ A;  4UFH A;  3AKP A;  1IPJ A;  5DAV A;  2A1X A;  3H8R A;  1HKD A;  1STM A;  1HN0 A;  2EXJ A;  2XOM A;  4HL0 A;  5F8P A;  1GOH A;  4H2A A;  4NJ4 A;  3VB9 A;  1CVN A;  1RUD 1;  1UIK A;  5JXJ A;  5FP9 A;  1SLA A;  4MAD A;  3ZPO A;  4M3C B;  4IEY A;  5EJ3 A;  2VMG A;  3N9N A;  1F8V A;  2A6Y A;  2B45 X;  4H55 A;  1W8H A;  3SXW A;  4HN1 A;  3RRD A;  3KT1 A;  1LGB A;  5DUV A;  3UJO A;  4N9H A;  4N43 B;  1GQG A;  5ANQ A;  5FO9 B;  4A3Z A;  4EV0 A;  5CBL A;  5IJR A;  4LKF A;  2ID4 A;  5GLV A;  4YG3 A;  3ZLI A;  3AKT A;  2OYZ A;  1TVG A;  4WM8 B;  2RM2 3;  5D8A C;  1TZO A;  4I2O A;  1A8M A;  3VD9 A;  2V4A A;  4HN0 A;  4IEV A;  4Z1V A;  1SZB A;  5FP7 A;  4CEW C;  2J1S A;  1WCD J;  1M06 G;  1PGW 2;  2O0O A;  4I3G A;  1LHW A;  1ZZ9 A;  4KU8 A;  4LO7 A;  3WY6 A;  2UYA A;  2RR1 1;  4YW5 A;  2QQJ A;  5CIR A;  4GMP 1;  4K21 A;  1F9K A;  2VZQ A;  5FMB A;  2XBO 3;  2WZP P;  3ZFG A;  4AI9 A;  3GZA A;  3INA A;  4MV2 A;  5FZM A;  1QJX 1;  1W8Z A;  4LOR A;  3VZJ A;  3C8X A;  1QOS A;  2FDH A;  1O5U A;  1W0O A;  3KGZ A;  2MHF A;  2GME A;  4RHV 1;  3GM8 A;  1BZW A;  1AZD A;  1YQ8 A;  2O8Q A;  3LKJ A;  2GSY A;  1BXH A;  3VD4 A;  5F5A A;  1KDK A;  2HWF 2;  1JYC A;  4B7E A;  2FZ1 A;  1SFN A;  4C8D A;  1G9A A;  1W6P B;  3MPB A;  1M4W A;  2Y64 A;  4LA2 A;  4MX3 A;  4XBQ A;  4JTO A;  2X09 A;  4AFM A;  1AX1 A;  5EQU A;  1AL0 G;  3AYD A;  2R0H A;  1I5Z A;  1MQT A;  4BQ4 A;  3AYE A;  4A44 A;  1JZ7 A;  4K40 A;  1EAH 1;  1S1A A;  2QZ3 A;  4GKY A;  1OFS A;  2NM1 A;  4XAA A;  1S4C A;  5JPM B;  4XJZ A;  5A6Q A;  2W95 A;  4JVA A;  1C8M 1;  2GMM A;  3D0J A;  4NWW A;  5KHI A;  2WNU A;  4FFH A;  5CA6 A;  3OGJ A;  4P9I A;  2R06 1;  2P17 A;  3U75 A;  4TYS A;  2R0F A;  5FMO L;  1LOE A;  2IFR A;  3AMH A;  2RG4 A;  3OOX A;  3DCQ A;  4DIQ A;  1HV0 A;  4DXZ A;  2VM9 A;  1MPX A;  3UGH A;  2B9V A;  1XYN A;  4AZZ A;  1J59 A;  1W2A X;  5EIY B;  3D8C A;  4M01 A;  3K4D A;  3EJK A;  2ARB A;  3GAL A;  4CXX A;  3T4V A;  1HB1 A;  3VBR B;  5JPN B;  4LOS A;  1ULO A;  2BEO A;  4JTN A;  4A42 A;  5FYM A;  1R1A 3;  1GAN A;  2F6B A;  2WRA A;  4B4R A;  1LU2 A;  5JWP A;  3M3O A;  1GQP A;  5J96 B;  3ALQ A;  3GBW A;  1UY1 A;  1VBB 3;  1P8J A;  2CNA A;  2P3J A;  2HYX A;  3FHA A;  3I2D A;  5DAB A;  5A3O A;  4BIF A;  1VMJ A;  1VBA 2;  3TN9 1;  3WEZ A;  1HDK A;  3KM5 A;  4PLM A;  1GYK A;  2QQI A;  2WWU A;  1SLB A;  1W90 A;  5JDB A;  1XXN A;  2JX9 A;  3JD7 2;  5KWR A;  4GWM A;  2F17 A;  3WP5 A;  5J3U A;  3WG1 A;  3K77 A;  3P6B A;  3WQ1 A;  4MOA A;  1AR9 3;  3PIG A;  4I0B A;  4XUP A;  2ZEX A;  4XFA A;  4LBL A;  5EYY A;  2DBN A;  1K5M A;  4FSJ A;  4V2W A;  1ND3 C;  4QX5 A;  3VBO A;  1ASJ 1;  2CHH A;  2VL4 A;  1F31 A;  3DPR A;  3POY A;  4BJ0 A;  1XNT A;  4DO0 A;  2ZAH A;  3K3O A;  1Q8O A;  4Y22 B;  3ZFG B;  4CUG A;  1UF2 C;  3VUO A;  2UYB A;  4Q4V 3;  3WF0 A;  1DLL A;  3CJI B;  4XIK A;  5D1I A;  5BPX A;  2HEW F;  3ASI A;  4UFK A;  5FPB A;  3ZYJ B;  3N9Q A;  1YQ5 A;  1BK0 A;  2VQU A;  5K0U A;  4DUX A;  4ONU A;  4LBN A;  1ULD A;  4LBM A;  4ZXE A;  4OFG A;  1CZV A;  5E8A A;  3KS7 A;  1DZR A;  3W21 A;  4RGG A;  1UZW A;  2RMU 2;  4CSW A;  3UJQ A;  3IDC B;  1JHJ A;  4GZ9 A;  4HLT A;  4PJY A;  2W91 A;  5A80 A;  3I3Q A;  4YVW A;  2HJI A;  4GH4 C;  2D97 A;  4NAO A;  1ZBA 2;  2W1Q A;  3HJR A;  1IS5 A;  2A6Z A;  3ABZ A;  5FPZ A;  1YQ6 A;  3WOG A;  4X8P A;  4ES9 A;  3PVO A;  3DUI A;  5CKN A;  3A4U A;  1LEM A;  5DDJ 1;  1MQT B;  4RN5 A;  3PU3 A;  3J9S A;  3HR9 A;  1YFW A;  1UZZ A;  1UKG A;  5JMO A;  1NCR B;  4GD4 A;  2FHR A;  3H8X A;  4XJ8 A;  2SBA A;  1U12 A;  2CTV A;  2JEM A;  5A3M A;  4OI1 A;  3HQR A;  2UWA A;  3M3E A;  4EE2 A;  2JG8 B;  2WA4 A;  3BU0 A;  2PFW A;  2WQ8 A;  4HKL A;  2PHD A;  4FPK A;  4LK7 A;  4AI1 A;  2G4I A;  1QQP 2;  4CVU A;  1WA6 X;  4HSL A;  1AX2 A;  3GJB A;  3LOB A;  3AYA A;  2W08 A;  5J48 A;  1BBT 2;  4FQZ A;  3W20 A;  1OVP A;  3B93 A;  3JZV A;  4QB6 A;  4QXC A;  3JQX A;  2ZGK A;  4FFG A;  4PIY A;  2EXI A;  1SCS A;  1RUC 1;  4Y20 A;  1PVC 1;  3KV5 A;  2W3J A;  3O0X A;  1H1A A;  4FOV A;  5GZE A;  4B8E A;  2VTX A;  2FDK A;  1UMH A;  4XQW A;  5LY2 A;  3KWV A;  4FOQ A;  4P14 A;  5DZF A;  1B09 A;  4YW3 A;  1N3Q A;  4A45 A;  3WG3 A;  4XTP A;  1ZRC A;  2NMN A;  1GZT A;  4GWN A;  5KHH A;  4IXL A;  3T2P A;  1FYU A;  2PMW B;  2D98 A;  2VOV A;  1WLT A;  1N1T A;  2QNK A;  3MFC A;  5LB6 A;  4AI3 A;  4WM8 C;  4Q4W 1;  1B35 B;  2QTW B;  4AQ6 A;  3AMP A;  3N3H A;  1H9P A;  4FTB A;  3DGT A;  4MET A;  4IUG A;  2PLV 3;  4HVO A;  5F3I A;  2QDR A;  1PO2 1;  3WDT A;  1ENX A;  2D3P A;  3VZM A;  1X9T A;  3VBO B;  4PHZ A;  1YQC A;  2LUW A;  1JZ3 A;  1CAU A;  2GP5 A;  5L73 A;  1AR6 3;  2R30 A;  1RYY A;  2ZGT A;  3DPR B;  1YRZ A;  4IW3 A;  4LQR A;  1JYN A;  4KBZ A;  1QOT A;  3ZSE A;  1NAE A;  2Y26 A;  5JXI A;  3KMH A;  4XF1 A;  3GDB A;  4Z07 A;  4Z2A A;  1CGP A;  5K0U B;  4UW4 A;  3B9I A;  3USS A;  4RGA A;  3H8U A;  2GC1 A;  1PO1 2;  2Q1F A;  2MEV 1;  4WBB A;  2ZA9 A;  3LEK A;  3N7J A;  3WF1 A;  2RS3 1;  1SCR A;  3KCY A;  4QPG A;  1U5Z A;  3LFM A;  2DVD A;  4J1W A;  4Y1U A;  5FZK A;  4W65 A;  4GWJ A;  4U36 A;  1R1Z A;  5FJH A;  1JUI A;  3GBF A;  1C5I A;  4L9B A;  4ASL A;  1AXY A;  1G8W A;  2NLR A;  4C1W A;  5C9A A;  2KXL A;  1ZBE 3;  4JDN A;  3O1S A;  4XF3 A;  3WNM A;  5FYB A;  4Q0V A;  5KBF A;  4KBB A;  1YFX A;  5A7W A;  1AR8 3;  2R04 3;  1S2B A;  3UYJ A;  4MO3 M;  2PLV 2;  5DAP A;  1QWR A;  1S0E A;  5EZW A;  1DG6 A;  1W2O A;  4OUS A;  5AVA A;  5DMY A;  4LLO A;  4XXP A;  5FZ9 A;  5APA A;  5F9T A;  1JI6 A;  2KR2 A;  4Y5T A;  1W06 A;  4Q1R A;  4MUV A;  4Z2W A;  5AC9 1;  4OI4 A;  4A6S A;  1MEC 3;  3I97 A;  3TEX A;  2GAU A;  2JDP A;  1JOD A;  3ZYB A;  4LT5 A;  1KIT A;  2VY0 A;  5CKQ A;  5CFD B;  3I2O A;  4FPC A;  1H8T C;  2ZMK A;  3CLP A;  1BMV 1;  3VBR C;  1QOO A;  1IKQ A;  2A3X A;  3VBU B;  3SC7 X;  4I01 A;  2PHU A;  2O8O A;  4B29 A;  5EJ1 B;  5T3N A;  3O7O A;  5KHK A;  1E5S A;  1TME 2;  1A6C A;  2RR1 2;  5FZE A;  5HCH A;  2LS6 A;  3N35 A;  1RVF 1;  3WW3 A;  2E6V A;  4AXO A;  4BOW A;  2EVX A;  4ZS2 A;  4JCK A;  3WW2 A;  2XDV A;  4O9G A;  4D3W A;  4G9S B;  3WP4 A;  1DBN A;  3EQE A;  3O14 A;  3RJ2 X;  4CPB D;  1XYO A;  2DU0 A;  3AC0 A;  3VLB B;  2BWA A;  3A0K A;  1OVS A;  3O1V A;  4UW3 A;  1DYO A;  5FDB A;  1W6N A;  3EXU A;  1LR5 A;  2R04 2;  3MLK A;  2K2S A;  2QKD A;  2DCY A;  3I2J A;  2ZX1 A;  3V65 A;  3VZK A;  2XWJ B;  4AQS A;  2B39 A;  4XIL A;  4BXF A;  1S0F A;  3RI8 A;  2QQL A;  4J25 A;  1ZRI A;  3UKV A;  3S0M A;  2BGC A;  2JE8 A;  2WNE A;  1BJQ A;  3O0W A;  3BI3 A;  2EIG A;  4P9Y A;  4QKF A;  3PMS A;  5HV0 A;  1W39 A;  5FZ7 A;  2KM2 A;  4QHZ A;  4Y1Z A;  1OHF A;  2R1D A;  2I45 A;  3CJI C;  3RMY A;  4DY5 A;  4HZF A;  5EHD A;  4BDV B;  3AMQ A;  2AH2 A;  5C33 A;  5IFP A;  1HXS 1;  2R6Q A;  1F2N A;  4GB3 1;  2BQP A;  1PZ7 A;  1KFU L;  4IV3 A;  4N90 A;  1EAH 2;  5GLZ A;  4DY3 A;  1W0N A;  5FZ8 A;  1MS8 A;  5IVE A;  4FI9 A;  5FP3 A;  1D4M 1;  5FO8 B;  4Y4R A;  1H30 A;  1GOG A;  1OLQ A;  5BYN A;  3VKM A;  3ZO0 B;  4NAM A;  3ZSJ A;  2HWB 1;  2HLE A;  3AM2 A;  5DAQ A;  4XPV A;  4QDQ A;  4BME A;  2RDS A;  3S5A A;  1IKP A;  5LA2 A;  3T2O A;  1PVX A;  4R52 A;  1RB8 G;  2VTF A;  4CUB A;  3GZE A;  1VBE 1;  2VUL A;  3CU7 A;  1CX4 A;  1OPO A;  1UMI A;  2E51 A;  4OI2 A;  5C9A B;  2CL2 A;  2DDU A;  1W2U A;  2AZ5 A;  1A8D A;  2XVK A;  4AG4 A;  5T52 A;  2VOT A;  2UWB A;  1NCR C;  3X29 B;  1EY2 A;  2HKX A;  2B46 X;  1J3R A;  2XB6 C;  5FY8 A;  3ZR6 A;  4NO4 A;  5GZD A;  5B4X A;  1RUH 1;  1X9P A;  2JG8 C;  1E5H A;  1VBC 2;  4LO4 B;  1KJL A;  4P08 A;  3UK9 A;  2WWS A;  4IV1 A;  4YZ1 A;  1NQJ A;  1VR3 A;  5LAS A;  2DV9 A;  5BNP A;  5KXD A;  5A33 B;  2D3S A;  2OQ6 A;  4LHL A;  2FBE A;  5FPV A;  2WN2 A;  3TN9 2;  1COV 1;  5IK5 A;  1MS0 A;  4PF1 A;  2CAU A;  4FTS A;  1XQN A;  1ZZ8 A;  1R09 3;  5FY5 A;  3BUC A;  4ZZ8 A;  5FZ6 A;  3BTY A;  4XHX A;  4ZON A;  3H42 B;  3NJZ A;  1AJK A;  3AX4 A;  3TOJ A;  2V5Y A;  2PEL A;  5F3C A;  3LEG A;  4LBQ A;  5EYX A;  3J8F 3;  5T5O A;  4K1Z A;  4ES8 A;  3M70 A;  1SFP A;  2RS5 1;  1GUI A;  3DKW A;  1GU3 A;  4Q0Q A;  4HPK A;  4NPL A;  1QJU 2;  3FL7 A;  1C4R A;  4LHS A;  2WZR 1;  3CIH A;  1YFY A;  1B35 C;  1DLC A;  3HWJ A;  3ME2 A;  1W6N B;  3C2U A;  3ZFE A;  2BZD A;  4JGY B;  5CG9 A;  3ZR5 A;  1EV1 3;  2ZGS A;  3S7E A;  1DYP A;  4OZO A;  2Q1Z B;  1SG3 A;  4P9G A;  3SCF A;  3NNG A;  1GZW B;  4F8A A;  4IE7 A;  5FXV A;  3VBO C;  2O14 A;  3I54 A;  4URA A;  3PTR B;  4RS5 C;  3DN7 A;  4DNY A;  2DCK A;  4BZ4 A;  1OUR A;  3T0B A;  4FPH A;  4PLN A;  1Q56 A;  2RDQ A;  4QQL A;  4C91 A;  2Y60 A;  4QXH A;  1TQ5 A;  2HWD 2;  4FVV A;  5CEH A;  2HYK A;  4IV3 B;  3WQB A;  4KWL A;  2FCU A;  4YG6 A;  1RTV A;  4NRO A;  5F6L B;  3WZ1 A;  5BNN C;  3AP5 A;  4FPL A;  4BQX A;  3VBH A;  1Z7S 2;  1HX6 A;  2HWE 3;  5F5Q A;  3J7M A;  3OGG A;  5FCC A;  1ULF A;  3VKO A;  5KR7 A;  1IS6 A;  1LNS A;  2HBU A;  3AP6 A;  1RC6 A;  4GMP 0;  1PK6 C;  4B4Q A;  5F5I A;  4AFD A;  2A6V A;  2AEN A;  3WW1 A;  2W9X A;  2GAL A;  5K4L A;  1BEV 3;  1W04 A;  3ZXK A;  4WV8 A;  3L2Y A;  3MIF A;  4KU7 A;  1JS9 A;  1VAK A;  5EPA A;  1FMD 3;  4IEX A;  4K20 A;  3NAP C;  5FYS A;  4LO8 A;  5T50 A;  3THP A;  1MR5 A;  2VCM A;  3PUH A;  4D6R A;  4IEW A;  2WFF 3;  4LLF A;  4XBL A;  2BTV C;  1S2E A;  2XLA A;  5F7U A;  5FZH A;  4ZU4 A;  4S2F A;  2JKX A;  1D4V B;  2PXJ A;  2VTX J;  3IDA A;  3JQW A;  3PIJ A;  2JDZ A;  1IS3 A;  5BNP B;  2FCT A;  1RUI 3;  2VW1 A;  3MHZ A;  5FYZ A;  1RMU 2;  1XRU A;  4S2G A;  1DGL A;  4NMI A;  3WX5 A;  1C57 A;  5CFD C;  3PJQ A;  4RD7 A;  3T09 A;  3WLU A;  2G1M A;  3RYR A;  2B42 B;  1VRH 2;  3VBU C;  2VW2 A;  3TYJ A;  2FMD A;  4CXY A;  5FIX A;  3WDY A;  3RI9 A;  4LPL A;  4GKX A;  4FP2 A;  4IND A;  2TNF A;  1UX6 A;  1DZQ A;  2Y6H A;  2PHW A;  5SV8 A;  3C7G A;  1L7L A;  3ZM8 A;  2JDY A;  2XH6 A;  2C5D A;  4P9J A;  2D6P A;  4XAE A;  1C8N A;  4E2G A;  3D5O A;  1R08 1;  1CPN A;  4LK6 A;  4COZ A;  4PDW A;  5ACA 3;  1C1L A;  2XJS A;  1FAT A;  2WYS A;  2RM2 1;  2VZT A;  4R9C A;  4RGK A;  1MZE A;  5FZ3 A;  1IQD C;  4EWA A;  3ZFE B;  1I5P A;  2UY8 A;  4CYD A;  1W8T A;  2XXZ A;  3VD5 A;  2VNV A;  3MYX A;  2FCV A;  5HV4 A;  4B4P A;  1HJF A;  2OW4 A;  1AX0 A;  1C5H A;  2XBO 1;  2VZP A;  3NNL A;  4D7Y A;  4UF0 B;  4XFH A;  1O5L A;  4NII A;  2JE9 A;  3PUI A;  4XC9 A;  1FNY A;  1JTZ X;  2BBA A;  1W8N A;  1LOF C;  2GH2 A;  1IPK A;  4FP3 A;  1J58 A;  5AFB A;  1O4T A;  5CZK A;  2R1B A;  2UY9 A;  1GV9 A;  2WA3 A;  4L92 A;  4HVR A;  4QX2 A;  4BK5 A;  2QCS B;  4CDW B;  1ONA A;  1WW4 A;  2P34 A;  5C3P A;  2ORZ A;  4NRP A;  4CU6 A;  1OXC A;  5F3G A;  1QY4 A;  3ZXD A;  4JGZ A;  1NLS A;  1GKB A;  3LPG A;  4XMI A;  3VGI A;  1PGL 2;  4E4Z A;  4A2U A;  2Q5T A;  4CP1 A;  2VD7 A;  5IWF A;  4AI2 A;  3OBR A;  1MAC A;  2NQY A;  2XJQ A;  3MFA A;  2J7M A;  3PUS A;  2RE9 A;  1DGW A;  1DU3 D;  1WCK A;  2VG9 A;  1QH6 A;  3AXD A;  1OBN A;  3KD4 A;  5T54 A;  1W8U A;  4YW2 A;  4XJ9 A;  3ILN A;  5A7P A;  2XJT A;  3AFK A;  2OII A;  3GZU C;  1CON A;  3LDB A;  3POE A;  4CCO A;  4CDQ A;  1SDW A;  1ZZ6 A;  2KA3 A;  4L8Q A;  4XFG A;  1DQ2 A;  2RS1 2;  2D6K A;  3J26 N;  1LCL A;  1RUJ 3;  2WN3 A;  4LTA A;  2DF7 A;  2VVD A;  4WVW A;  3HEI A;  2VOX A;  3OSD A;  4J6G A;  4Y1X A;  3WDV A;  5JUV A;  3OBZ A;  5JMC A;  4QB1 A;  4Y3O A;  4XQ4 A;  1GR3 A;  1JXN A;  4OHZ A;  4CU7 A;  3WF3 A;  1FOD 1;  2ENR A;  1LUL A;  4NHY A;  3O1U A;  1KJR A;  3AZW A;  3IIA A;  1QJY 1;  1TMF 2;  5BV6 A;  1ZRF A;  2Q8D A;  1DCS A;  4D6Q A;  3MI8 A;  3E5X A;  1UOJ A;  4L99 A;  2WII B;  5K8S A;  2H0V A;  1JHN A;  1ULC A;  4MGY E;  3CKH A;  4ASM B;  2Y33 A;  5CU1 A;  4QPW A;  2WLQ A;  3AJZ A;  4CDX A;  5JZG C;  1VBB 1;  4MVT A;  4AW7 A;  1RUF 3;  4F7Z A;  5HPO A;  1HRV 3;  1AYN 2;  5FWJ A;  3ZSL A;  3M8L A;  2FD8 A;  1W6Q B;  4AHZ A;  2OA2 A;  3F95 A;  4PDW B;  4WM7 A;  1MVQ A;  5CFC B;  4UI9 L;  3HD8 B;  5FK7 A;  5I0S A;  5A32 B;  4JGY C;  4S2H A;  5BXX A;  1UN1 A;  2JDM A;  5TSW A;  3SH5 A;  4P5Y A;  1AR9 1;  2X10 A;  4ATF A;  3M3Q A;  4U2A A;  4AVB A;  1WGP A;  4DRR A;  5LBB A;  4A41 A;  4RR3 A;  2YYO A;  4PCR A;  2HWB 2;  5A6Y A;  3ZSM A;  2UUR A;  1H6X A;  1VLN A;  1HW5 A;  2PHL A;  2P4E A;  2E7T A;  3LEI A;  3KT4 A;  1Y3T A;  4AYU A;  2OS2 A;  1K12 A;  3IMM A;  5CIS A;  2WBK A;  2E31 A;  3LSD A;  1KEX A;  4IEZ A;  1F5F A;  2NMO A;  3NVC A;  3O1R A;  4CCN A;  3S57 A;  4BQ1 A;  2DVB A;  3ELN A;  3BGA A;  4P02 B;  3NO8 A;  2XML A;  2K0G A;  3B9C A;  1PZ8 A;  1OQ1 A;  3E5U A;  1ZNP A;  1RUH 2;  2J42 A;  3B01 A;  5ABJ C;  4FO9 A;  1I6X A;  1UD1 A;  2JKB A;  2Q4S A;  4JGZ B;  5K9Y A;  4WZC A;  4HSJ A;  5FY7 A;  1HB3 A;  2XL9 A;  5IVY A;  4QM8 A;  5E16 A;  1KRI A;  3WCS A;  2GC3 A;  3LQC A;  4XUR A;  1SPP A;  1UZ0 A;  1VIW B;  1SMV A;  3HAG A;  4Y5S A;  3RS6 A;  4NPR A;  2CYF A;  4N53 A;  2C1F A;  2P3I A;  3CL1 A;  4RQP A;  1LEN A;  2R07 2;  4BYY A;  1N3P A;  1BLZ A;  2YU2 A;  3FC0 A;  1AL2 2;  4LUL A;  2B4K A;  3OUJ A;  3PVE A;  4PF5 A;  2IXK A;  4CRQ A;  5FZO B;  5B2G B;  1Q43 A;  1T6B X;  2BNN A;  4OHV A;  4LKE A;  1WMX A;  2D44 A;  3JBG 1;  3RZL A;  2WSU A;  3CQO A;  4BU2 A;  1YLL A;  5KHG A;  1G6N A;  3VKF C;  1O8P A;  1UQX A;  1ULG A;  1FI2 A;  3A21 A;  2NP0 A;  2Y34 A;  3VD7 A;  3ZFF C;  1XSR A;  4QHB A;  4FOW A;  4QU2 A;  3THC A;  2AEZ A;  3V0A A;  3KLS A;  5F2S A;  1OOP A;  3JB4 C;  1H1I A;  4F3J A;  4KL1 A;  1CJP A;  4AFB A;  2IXJ A;  1NA1 B;  4KMQ A;  4AED C;  3PME A;  3NQH A;  1W05 A;  2ORX A;  1XSQ A;  3PVN A;  5A3W A;  1IG0 A;  1YC6 1;  2HWF 3;  2QDN A;  4HMZ A;  4LUM A;  3ZXA C;  3OUH A;  2ZZJ A;  4Y4Y A;  3ENR A;  4CDX B;  1UU5 A;  3OYW A;  5FLH A;  5A1A A;  4R4X A;  4XF0 A;  4RFR B;  1CES A;  2C0Z A;  4CCM A;  1UZV A;  4YW6 A;  4WM7 B;  1US3 A;  1J3Q A;  3H7Y A;  2WUH A;  3P1I A;  4YW7 A;  5H9Q A;  5GLW A;  5DAX A;  4IE6 A;  1QGL A;  1OD5 A;  3G6J B;  2JD9 A;  4XF4 A;  4DMI A;  4RR3 B;  1V70 A;  1AR6 1;  2XWB B;  2Z4F A;  4O65 A;  4Z8B A;  5BNO A;  5A3L A;  1DQ5 A;  2UWC A;  4FPG A;  1POQ A;  4GAL A;  4QU1 A;  1Y9G A;  3VBF C;  1JZ6 A;  1N1S A;  1ND2 A;  1POV 3;  1DFQ A;  1RUG 2;  3CJX A;  3PUQ A;  1NE4 A;  4RL7 A;  4XET A;  5I0R A;  2D40 A;  1PMH X;  1FPN 1;  1S0J A;  2BW8 A;  2DU1 A;  2EIE A;  4H3W A;  3VDD C;  1LAJ A;  4CCD A;  3DEC A;  1J84 A;  4CDW C;  4JX0 A;  2YC0 A;  4EQV A;  1EUT A;  2P3K A;  4D7T A;  4G3Y C;  5J98 B;  4YAR A;  4NIA A;  4XOG A;  3BOD A;  3MBW A;  4QMA A;  4HK8 A;  3C7E A;  3B00 A;  3SKJ E;  3ZMN A;  1WCU A;  1NCQ B;  4IER A;  4WVM A;  1W28 A;  5LY1 A;  1UU6 A;  3MPP G;  3IAQ A;  4HKO A;  2JDU A;  4DB5 A;  1YO8 A;  4JDO A;  1VBA 3;  4FXG B;  3WQ7 A;  4DXS A;  5FPX A;  1ZBE 1;  1LGC A;  2ET7 A;  2XKP A;  1G9F A;  3JD7 3;  1AR8 1;  3ETP A;  1IZ3 A;  1JU4 A;  4W8J A;  2DUQ A;  5FZL A;  3ACF A;  2VO5 A;  3MLJ A;  3H1Y A;  5HBA A;  3LD8 A;  1UXX X;  2YUE A;  3SIS A;  2VC9 A;  4CTE A;  3FZ3 A;  4XEZ A;  5FY0 A;  4IGQ A;  3ATG A;  2YFZ A;  2NN8 A;  1SHW B;  2IFW A;  4MGT A;  5H9S A;  1R08 2;  5KXC A;  2Y6F A;  3ACG A;  3M4F A;  3THD A;  1O59 A;  1OH4 A;  1SBD A;  1OA4 A;  4XHB A;  5FY4 A;  3MV1 1;  1HRI 3;  2NZ9 A;  3OD4 A;  5C4W A;  3BTX A;  4YNI A;  4E27 A;  1H6Y A;  3V0A B;  4AL9 A;  3LSE A;  2D3R A;  4IE4 A;  5FYH A;  3RMX A;  3FBY A;  4QGM A;  2ZGQ A;  1V9U 2;  1O4Y A;  2P6C A;  2RMU 3;  2DWR A;  2CGO A;  5FMD A;  4DZG A;  1U0A A;  3TBD A;  2J22 A;  1RIT A;  3H1M A;  3K4A A;  5EP9 A;  4UT5 A;  1BVV A;  4A7Y A;  4CEY A;  5JI7 A;  1UY3 A;  1ZBA 3;  2JWP A;  5AFE A;  1V6K A;  2ZX4 A;  3VL8 A;  1WBL A;  5SV5 A;  4NR1 A;  5CFC C;  2BVV A;  3CBN A;  3CHX A;  3I3E A;  2IVI B;  4ZHN A;  3AZX A;  3WQ0 A;  1TEI A;  2AGS A;  2QZ2 A;  4LHN A;  3NV2 A;  2HWC 2;  3IB3 A;  4URT A;  3GXU A;  3PLQ A;  1Y7B A;  4M3C F;  4C90 A;  1PIV 1;  1QQP 3;  2W46 A;  1O3Q A;  5IFT A;  1RUE 2;  1N1Y A;  1BBT 3;  2MNG A;  3EO6 A;  4YRD A;  4FOY A;  4C0B A;  4V2V A;  1HRI 2;  2WS9 2;  4XZP A;  2C9K A;  3R05 A;  5A7O A;  3S30 A;  2ETE A;  2NPI A;  2OZJ A;  4H14 A;  1NXD 1;  1XE8 A;  3KV4 A;  3P3N A;  4DXR A;  2AC1 A;  2Z69 A;  5FXZ A;  3WVJ A;  4BQW A;  5FZB A;  2VZR A;  4DOU A;  4JKL A;  3D6E A;  3I7D A;  4B1M A;  2ZGL A;  4WVM B;  2PHR A;  1W6O A;  3HNM A;  4E8D A;  1QKQ A;  4NOT A;  1CAX A;  1W9S A;  3NV1 A;  1X7N A;  3CF6 E;  3AB0 A;  3TWI A;  3Q9O A;  2OPW A;  3ZN6 A;  1YHF A;  1QJY 2;  1QNW A;  1AR7 2;  3UGG A;  3GHN A;  5GLT A;  2ZHM A;  2XQR A;  3CEW A;  1HQL A;  1IG3 A;  1VAL A;  4OYU A;  3WNN A;  1NG0 A;  1X50 A;  4JRA A;  3HN1 A;  2WNU B;  2WT0 A;  4Q4X 2;  3ZYI B;  4YGC A;  5BNQ A;  4MGS A;  4PBP A;  1DZT A;  1NKG A;  3AP4 A;  4FPF A;  4JAA A;  3U37 A;  4COV A;  4LOT A;  2EXK A;  1HJG A;  3O1T A;  2D93 A;  4AVT A;  1IPS A;  2ZGR A;  4FPJ A;  2BFU L;  5LRR A;  1O3T A;  1R09 1;  2YB7 A;  3CZU A;  5L9B A;  3V64 A;  1GP6 A;  2QJV A;  3ZOI A;  2X5I A;  1PO1 3;  3OY8 A;  2DTY A;  2ZMN A;  2XJP A;  2VW0 A;  1NA1 C;  4Q8L A;  2ARE A;  4YM0 A;  1NLR A;  4NIH A;  1KS4 A;  2VJX A;  2OT7 A;  1V6J A;  3J8F 1;  3RWK X;  2BJS A;  3PNA A;  3C7O A;  4N43 C;  3O1P A;  5IAV A;  3LB9 A;  3ZMO A;  5I8T A;  4ARX A;  4BE3 A;  3EBR A;  1KQR A;  3ZSK A;  1L3J A;  2ZX3 A;  4R8H A;  2DVG A;  5FZ1 A;  1DQ4 A;  4QDS A;  3AKS A;  2P5B A;  4E8C A;  1F4H A;  3OEA A;  1EV1 1;  3O1M A;  4Y33 A;  5FR3 A;  3NRU A;  1K5M B;  5DUU A;  4IGP A;  4EN8 B;  1W99 A;  1WW5 A;  4XFB A;  1OSG A;  3KV9 A;  5D2A A;  3ZYP A;  4QQO A;  4CP0 A;  2D5F A;  5LA0 A;  2ZKL A;  3WP6 A;  2ZZQ A;  2VZ1 A;  4N9I A;  4ORF A;  1O6U A;  1S2K A;  3ZVX A;  4KWK A;  1FAY A;  1UYX A;  3BKZ A;  2LRO A;  1HLC A;  1GP4 A;  2O1Q A;  5LRS A;  5C8C A;  3DF0 A;  4DUW A;  3RDI A;  1J1L A;  2WO1 A;  1ALY A;  4UBG A;  2HWE 1;  3ZXG A;  1W2N A;  2BDR A;  1TME 3;  1WLC A;  4UBH A;  2RR1 3;  5JVV A;  3E97 A;  4MGK E;  4ASK A;  2EAA A;  1NCQ C;  3LDR A;  3R4S A;  3E6B A;  2DCJ A;  3LA7 A;  4YVW B;  3WD5 A;  2CGP A;  2K9Z A;  1UPI A;  3JBG 2;  4F83 A;  1APN A;  1BEV 1;  2ZX2 A;  3MIB A;  1FMD 1;  4AVA A;  2IXL A;  1RUD 2;  4QD2 A;  2YZ4 A;  3ZN6 B;  2WFF 1;  3M3I A;  1H4H A;  1JYV A;  2PQS A;  5IK8 A;  4LKS A;  3KHB A;  5FP4 A;  1OUS A;  4Q4Y 1;  1ZRE A;  3QH6 A;  4FCA A;  2PAM A;  5HCB A;  1PX4 A;  1OF4 A;  2QUO A;  4KWJ A;  1RUI 1;  4HKW A;  3C7F A;  2WNV A;  4YVS A;  3III A;  4CU9 A;  4MGQ A;  1EP0 A;  2UU8 A;  4YM2 A;  3ZPY A;  4YFZ A;  3B7M A;  1Z78 A;  1EAH 3;  2OPK A;  1RHI 1;  2WWJ A;  2ZGO A;  3GJA A;  3DYP A;  4HG6 B;  4LR4 A;  1O8S A;  4FPY A;  4Y20 B;  2X5I B;  5GZF A;  5FPU A;  3OY8 B;  4MXV A;  1S0G A;  1XOY A;  4TLF A;  5F5C A;  4NIG A;  5IUQ A;  1AVB A;  4NE9 A;  2XGX A;  3OG2 A;  3GCX A;  3WIN E;  4OI0 A;  2D6M A;  1LGN A;  4QKB A;  4XBN A;  3U4X A;  1QJX 2;  1VAV A;  2V4V A;  3KCC A;  5A3P A;  1IOA A;  4HVQ A;  1NLQ A;  3DXU A;  3N9O A;  3MV0 1;  4N7I A;  2C6S A;  3GGL A;  1HIX A;  4CDU A;  2PTM A;  2JG9 A;  1OT5 A;  1W6M A;  3K51 A;  5JSR A;  1HQN A;  1ZM1 A;  2BWC A;  1HB2 A;  4RHV 2;  4BLI A;  4M4P A;  2A71 A;  1AYM 1;  3ACI A;  5JR2 A;  4KQ7 A;  3UL2 A;  4PI2 A;  3FX3 A;  3RZG A;  1FPN 2;  3RZH A;  1XYP A;  1WCQ A;  4CP9 A;  4QPI A;  4M0N A;  1Y9Q A;  1XU2 A;  1SDD B;  2DCZ A;  4IEO A;  4PT6 A;  3T1L A;  1V0A A;  1VBC 3;  5C5U A;  3J4U H;  3U07 A;  4XIO A;  3DV8 A;  4UAP A;  2G19 A;  2J1T A;  3ZFG C;  3RZM A;  1CAU B;  3BVC A;  2D7F A;  4AOC A;  2WC2 A;  4Q29 A;  5DZG A;  4WVZ A;  4BIS A;  2ZS6 B;  3TN9 3;  5K7P A;  4W6X A;  4GIQ A;  3FUQ A;  4MLO A;  2GMP A;  2IXI A;  3HOB A;  2ZXQ A;  2ATF A;  3DXT A;  3VBS A;  2BV4 A;  3SHR A;  5CAZ A;  1IS4 A;  3WDX A;  1GP5 A;  5C8C B;  2Z79 A;  5DQ0 A;  5FMO S;  3MW2 A;  5T5P A;  3W58 A;  5C6C A;  2BBV A;  1C8M 2;  1REF A;  2R7E B;  3EB7 A;  4FFI A;  3HNY M;  1V6L A;  1CJD A;  2B9U A;  3ZXF A;  2R06 2;  3LA3 A;  2ZGU A;  4QPG B;  5JSP A;  5I8Y A;  1RL3 A;  4BHP A;  2C26 A;  1YFU A;  3I2F A;  3B94 A;  2EIC A;  2P6H A;  4IET A;  1QJU 3;  5HXV A;  2VAU A;  4L2N A;  3Q8F A;  1MQT C;  2G9G A;  4IE5 A;  5FZD A;  2Z5W A;  5A7W B;  5FP8 A;  3U1X A;  1CN1 A;  2XLF A;  4C1X A;  2BOI A;  1O7F A;  2JDA A;  4YPJ A;  5FYT A;  2WNU C;  2D6L X;  3MUY 1;  5ERL A;  1RUJ 1;  5FQ0 A;  1LU1 A;  3EMR A;  1OFN A;  5I8S A;  3AVR A;  4LHK A;  2E26 A;  2XL7 A;  4FBF A;  3HNB M;  1CAV A;  1VRB A;  4YVS B;  3K48 A;  1UY4 A;  2HWD 3;  3MF9 A;  3OJB A;  1NY7 1;  4XUQ A;  2OKX A;  4BMB A;  4XF9 A;  3QH7 A;  1LKN A;  1OLM A;  1FX5 A;  1Z7S 3;  4LE4 A;  4AF9 A;  1EPZ A;  2Q8C A;  4PQQ A;  1ASJ 2;  4G4F A;  2GU9 A;  1W0P A;  1NX9 A;  3ACL A;  1KS5 A;  1RUF 1;  1HRV 1;  1YJK A;  3T3Y A;  3WUD A;  1PIV 2;  1ULP A;  1YJL A;  2IWG B;  3I8T A;  3OGR A;  4XFF A;  5JLV A;  1R64 A;  5DZE A;  5FWE A;  3HBZ A;  3CZJ A;  4CDU B;  3KQR A;  1D7P M;  4GWI A;  4AVS A;  3BOP A;  5CKM A;  3GYD A;  3I59 A;  3AKQ A;  3UT0 A;  2P2K A;  4RFT 0;  3RG0 A;  2AAC A;  2B5H A;  5I93 A;  3LCP A;  4JZR A;  4XAB A;  4JRL A;  4QPI B;  1O3R A;  2GN3 A;  3AP7 A;  1K5M C;  1VBD 1;  3UKN A;  2HEY F;  5FZF A;  2YBS A;  2P37 A;  3T2Q A;  5AVP A;  4NVP A;  3DPR C;  1YIP A;  2EAK A;  3KQ4 B;  3TNQ A;  2VBP A;  1H2K A;  4YW1 A;  1RMU 3;  5FYC A;  2WQ4 A;  5LAT A;  3I2H A;  3FLR A;  2W1U A;  2E63 A;  2XG3 A;  5K0U C;  4TXW A;  2JDH A;  5D8A A;  2RDR A;  4I09 A;  5DDJ 2;  4ZU7 A;  3VBS B;  3WF4 A;  1UKR A;  3UV9 A;  3IWZ A;  5IT6 A;  4MG2 A;  4HOO A;  1VRH 3;  1ZA7 A;  2YC2 A;  1BKZ A;  2VZS A;  3BPS A;  4CEW A;  1A34 A;  4JQR A;  3ZYR A;  1RXF A;  2VZV A;  4XW3 A;  3S6P A;  1IHM A;  1PO2 3;  1LB2 A;  4TWT A;  2PHX A;  1J83 A;  3MIE A;  1UCX A;  4DRV A;  1H9W A;  3IZO A;  4YVW C;  4NHX A;  2VMH A;  1PHM A;  3H3Z A;  1DQ0 A;  3NV4 A;  4FPO B;  1U5I A;  1XE0 A;  1UOG A;  1VJ2 A;  1BMV 2;  3AP9 A;  1Q8V A;  5IVB A;  2VMD A;  4YYO A;  1NQD A;  2OX0 A;  1WME A;  1RUC 2;  3BIW E;  4YGB A;  5C3Q A;  1PVC 2;  4D94 A;  1PMJ X;  1QH7 A;  1SBF A;  2YPJ A;  5FY1 A;  5H9R A;  4YFW A;  1CPM A;  1PGW 1;  4HET A;  3NNM A;  3OUI A;  3U0Z A;  3NKG A;  2QQN A;  1ZX5 A;  4RA0 A;  2WZ8 A;  4IV1 B;  1UX7 A;  1UY0 A;  4XQD A;  3K2O A;  4QB2 A;  2ZKN A;  4DQA A;  2CY6 A;  3A22 A;  3VHN A;  4TSV A;  3LOI A;  4Z92 B;  1GLH A;  3POB A;  4QX8 A;  3W5M A;  1GNY A;  4Q4W 2;  3ST7 A;  3MIG A;  4BH9 A;  1WKY A;  3KB5 A;  1REE A;  2D6O X;  2JB4 A;  2P3Y A;  4SLI A;  3POJ A;  1HB4 A;  3SCG A;  1UU4 A;  3RFR A;  2W47 A;  5D21 A;  3RYP A;  2AYH A;  1JYX A;  2HBT A;  1PO2 2;  2QFE A;  5DPN A;  1NZI A;  3KGL A;  4B3N A;  4COY A;  2HWF 1;  4QXB A;  2PHT A;  4LBQ B;  4AHX A;  2WT1 A;  2OUH A;  4DXT A;  4CP2 A;  3K3N A;  4WVV A;  5FUN A;  3LEM A;  5JI9 A;  2CAV A;  4HPK B;  1D2S A;  2V5D A;  2ERF A;  2XKO A;  4FFF A;  1GNH A;  1O91 A;  2VMF A;  4P00 B;  3WNK A;  1Q5O A;  1YUD A;  4NUB A;  1GBG A;  3DL3 A;  2MEV 2;  2ZX0 A;  3THT A;  5A70 A;  5FYV A;  2J1A A;  1KDM A;  1F15 A;  1W3X A;  1WBF A;  2PYT A;  2YRO A;  3HT2 A;  3I3D A;  4P9X A;  3I3B A;  5E89 A;  3WUC A;  3WG2 A;  2RS3 2;  3O5S A;  4Q1P A;  2RS1 3;  1DQ1 A;  3FMG A;  3P3P A;  3BIE A;  3PUA A;  5LBC A;  5FXX A;  2QQV A;  5FAX A;  5A1L A;  4W4Z A;  2GP3 A;  2Z42 A;  1WLW A;  3DEM A;  2Y8K A;  4OUM A;  2JDN A;  4EYU A;  1CZT A;  3FJS A;  1MS1 A;  2ZGM A;  1V6N A;  5D8A B;  1TMF 3;  1SFY A;  4Q26 A;  1YQ2 A;  4JHZ A;  5I91 A;  2DTW A;  4CEW B;  1FNZ A;  3VBH B;  4OVE A;  1ND3 A;  1OUX A;  1XE7 A;  4HK9 A;  5J09 A;  1Q3E A;  1TNR A;  3G7D A;  3JU9 A;  3H9A A;  2EAL A;  3H3U A;  1YEW A;  4LIU A;  4Q4Y 2;  4QPG C;  3OPW A;  3SLI A;  4NN0 A;  5AC9 2;  5F1R A;  1AYN 3;  1X8E A;  2JD4 A;  1VBA 1;  2JXA A;  4ISR A;  3K46 A;  3R4D B;  4UYB A;  3LF7 A;  5C9A C;  2H6C A;  4ZPI A;  1GZ9 A;  3ZYG A;  5A3T A;  1JZ8 A;  3JD7 1;  1LES A;  4K9S A;  4W50 A;  3VDA A;  1ENR A;  4JHT A;  4QDR A;  4D69 A;  1RHI 2;  1YI9 A;  4DFS A;  5LCW L;  1DGR A;  1XPW A;  4TN7 A;  4AHY A;  5GM0 A;  1TG7 A;  1IQA A;  1WLD A;  3N36 A;  3OGS A;  2EIB A;  4LMF A;  4O9E A;  5JOY A;  4I0W B;  2VEC A;  3VHO A;  3V56 A;  1RVF 2;  2HWB 3;  3KV6 A;  4GH4 A;  5IVC A;  2L9L A;  2TBV A;  4HT1 T;  2QQO A;  2X05 A;  1EYB A;  3IDE A;  4JV4 A;  4CPB A;  4D8M A;  2JB8 A;  4EN7 B;  3ZXL A;  1AYM 2;  2IZW A;  3FBM A;  3IPV A;  3QBQ A;  5FYY A;  4UOJ A;  2R16 A;  1R1A 1;  2RMU 1;  4XFI A;  3DYO A;  1SLL A;  2A5Z A;  4MGI E;  1E57 A;  1RUH 3;  3PDQ A;  2VCA A;  2DUR A;  3FUO A;  3VZL A;  3ILF A;  4D0Q A;  3CDZ B;  5FRA A;  4XCA A;  1UL9 A;  3AKR A;  5IW0 A;  1ZBA 1;  1BK1 A;  1JZ4 A;  1T6G C;  3NV3 A;  1HXS 2;  4GB3 2;  3J7H A;  2F4P A;  3MW3 A;  1CWP A;  2N7G A;  5I0T A;  1W2T A;  1WW7 A;  1XC6 A;  1UYP A;  1D4M 2;  3LIH A;  2VBD A;  2BNO A;  2R07 3;  2VNR A;  4M3C A;  3EYP A;  3TEY A;  1AUY A;  3H0O A;  2RV9 A;  4X8N A;  1AL2 3;  4CCC A;  2VQA A;  3J7N A;  4Y5Z 0;  1NUK A;  1QQP 1;  4K7J A;  2RS5 3;  3H1W A;  4Q4V 1;  5A7Q A;  5ACA 1;  4EN9 B;  4YZ2 A;  5JOZ A;  4AQT A;  3VKL A;  1BBT 1;  1VBE 2;  2PAE A;  2WZR 3;  4OLL A;  1QXP A;  3C7H A;  1A3K A;  4WM8 A;  2WLP A;  3RJR A;  4IV3 C;  1Q8P A;  2Q0A A;  2VZ3 A;  2VQT A;  3VDB A;  2IXC A;  3PL0 A;  4LBJ A;  3USU A;  4UW6 A;  3ES1 A;  3AYC A;  3TEZ A;  4AGG A;  5DXD A;  2YBK A;  1AHS A;  3HN3 A;  3VL9 A;  5FYU A;  4KI5 M;  4Q27 A;  2FDJ A;  2CU5 A;  5JOX A;  4R9D A;  4BQ2 A;  4OHY A;  5BY5 A;  1COV 2;  1LHV A;  4LE3 A;  2NYY A;  1DIW A;  2R32 A;  4PLO A;  2ARA A;  4YGE A;  3UET A;  5EJZ B;  3TRS B;  4MH0 E;  1JZ2 A;  1JN2 P;  3L2H A;  3LZZ A;  3BCW A;  4XDQ A;  4GUL A;  3B69 A;  1H1M A;  4A7Z A;  2W39 A;  2ZTN A;  4CDQ B;  1W8W A;  2F4L A;  2LTN A;  4Q8K A;  2BU9 A;  2YFU A;  4IV1 C;  4J1X A;  5BNP C;  3T30 A;  4GQ7 A;  1ZZC A;  2A70 A;  3RGB A;  2RS5 2;  1UMZ A;  3D3A A;  2V09 A;  3OF1 A;  3BAL A;  4DPN A;  4GH4 B;  4TTG A;  3WDW A;  1OD3 A;  1ZYB A;  3BPZ A;  4CCE A;  3BU7 A;  1VMH A;  2QQW A;  4FQ4 A;  2WZR 2;  3QCW A;  1N3O A;  1XNB A;  4K6B A;  4YM1 A;  3Q8C A;  4M4R A;  1FXZ A;  1LED A;  4XXA A;  1AJO A;  1RUG 3;  3M1H A;  3FLP A;  4LA3 A;  2OVU A;  3NNF A;  5FJK A;  1JMU B;  2W2I A;  4AQ2 A;  3E6D A;  5LW9 A;  2J1E A;  4NWV A;  1VBD 2;  1ODM A;  2FQP A;  1OC1 A;  2DUP A;  2Z2S B;  1OKO A;  2WT2 A;  4LIV A;  1ZZ7 A;  4BQY A;  3Q8E A;  5ANN A;  4ET7 A;  2XPJ A;  3VDC A;  2QQP A;  3POW A;  1HQW A;  1H8T A;  1F35 A;  4XJW A;  2Q30 A;  3VBR A;  2RJL A;  1SLT A;  3QAC A;  4FPE A;  3ZFE C;  5IHR A;  1OA2 A;  3N9M A;  4KWU A;  1RJ7 A;  1JOP A;  2PLV 1;  2D6N A;  4Q0U A;  2OQ7 A;  5FZ4 A;  2YGM A;  3I4I A;  4ZU5 A;  2GNB A;  3JCI A;  5FZA A;  3KZ4 C;  1WD4 A;  4XJU A;  4ZZ5 A;  1ZA4 A;  3PVB B;  4ITC A;  3SIT A;  1UYY A;  2QBX A;  2X53 S;  1F5J A;  4L97 A;  1WW6 A;  2ZJC A;  1R08 3;  2J1V A;  5IK7 A;  5IAX A;  5FZC A;  2DFC A;  4ZXK A;  5FKB A;  1UOF A;  2JE7 A;  3K4Z A;  1BCX A;  2WQZ C;  4IES A;  1I1E A;  2VXR A;  3NKT A;  2D5H A;  2C24 A;  3USU B;  1Q8S A;  3VBH C;  1KFX L;  1V9U 3;  3J7L A;  1OMI A;  3CMG A;  1KXG A;  3A7Q A;  2BYV E;  2VH9 A;  5FK8 A;  1TME 1;  3ZDV A;  1S55 A;  2W94 A;  5FRE A;  1CZS A;  4LXL A;  1W8O A;  1H2N A;  4JKM A;  2E32 A;  4Y22 A;  3PTY A;  2WO7 A;  1UAI A;  2GH8 A;  4QWN A;  1MS5 A;  3CJI A;  4NPM A;  3ZYF A;  3HPN A;  1K5J A;  1MS3 A;  1S0B A;  2DVF A;  4YWA A;  4M00 A;  1QF3 A;  2GC2 A;  4MHR A;  5GJ6 A;  2GC0 A;  1T2X A;  2R04 1;  2YDE A;  4H7M A;  5FBJ A;  1SPP B;  1Y43 B;  4AFA A;  2CGN A;  3OGV A;  4OHW A;  3UKT A;  4DS0 A;  3I2K A;  4LBK A;  2ZHL A;  4N53 B;  2LM3 A;  5EWS A;  1JYT A;  1GSL A;  3APB A;  4RQP B;  3HIF A;  2XJR A;  4AEJ A;  5FV3 A;  5DUW A;  3S5Q A;  4YGD A;  1OLR A;  5C70 A;  1XNA A;  2HWC 3;  4Q5O A;  1LOD A;  2CWS A;  1FV3 A;  1ZRD A;  4DEV A;  2Y6K A;  1MEC 1;  2XVG A;  3POI A;  3VD3 A;  3FHQ A;  5F32 A;  3H7J A;  2DFB A;  5F39 A;  3WXP A;  1L7Q A;  1RUE 3;  3Q8B A;  3PHM A;  4MGZ E;  5KHJ A;  1W3V A;  1W8F A;  1W9Y A;  2RM2 2;  3ON7 A;  5CNA A;  4AHW A;  5B4N A;  2WS9 3;  3POS A;  2AR6 A;  5HI0 A;  1ZVF A;  1NCR A;  4XZU G;  5FO7 B;  1GWL A;  1OOP B;  5FMC A;  3RVH A;  2VGD A;  5JCT A;  2ZAC A;  1Z0H A;  2JG8 A;  3AXE A;  3HT1 A;  1CQ9 A;  2VMI A;  2XBO 2;  2WFP A;  1VB4 A;  4GA9 A;  3SNM A;  3RSJ A;  2QE3 A;  1JU3 A;  3H3L A;  1GOF A;  3OYW B;  3HBK A;  4L0P A;  5LEJ A;  1CX1 A;  1NOV A;  4PDW C;  2OXB A;  1GWK A;  1FOD 3;  2YHJ A;  5KXE A;  1H8T B;  1QJY 3;  3U4S A;  4R9A A;  3AZV A;  4OCT A;  4PBO A;  3S7I A;  1AR7 3;  1XND A;  2LW8 A;  5C3S A;  1UOB A;  5BUV A;  2RJK A;  2XJV A;  3SCH A;  1VBC 1;  2ZAB A;  4Q4X 3;  1OPM A;  1N47 A;  3B02 A;  1S0I A;  2HEV F;  4A7K A;  4E2S A;  4QT6 A;  1QJF A;  2ADE A;  3ZX7 A;  3CO2 A;  2DCT A;  5BNO B;  2V72 A;  4O7X A;  4DIN B;  1UWW A;  1Q8Q A;  1SLC A;  1ENQ A;  1B35 A;  1W03 A;  2LAL A;  2VXJ A;  4XUO A;  1KD7 A;  3BYW A;  1ND2 B;  3BTA A;  2W87 A;  4UFM A;  2J1R A;  4CCJ A;  4WZF A;  1XBF A;  3MZH A;  2ZPX A;  3MGU A;  4LBQ D;  3TEW A;  4JGZ C;  5FOB B;  3IMN A;  3MID A;  4MHU A;  1Y4W A;  2A6W A;  4OHX A;  4RS5 A;  2C4X A;  2GNT A;  2XON A;  1QU0 A;  2Q1M A;  4B1L A;  4YG0 A;  1QJU 1;  4FAH A;  3VZO A;  1FOD 2;  2ZCW A;  4XUT A;  4OMD A;  4LO5 B;  4C0H A;  2BGO A;  1XNC A;  4LNV A;  1QJE A;  4DUV A;  4CU8 A;  4E2Q A;  5BNN A;  1CAW A;  1PM4 A;  2ADD A;  4CDQ C;  1R1A 2;  3KSC A;  1OH3 A;  4W6W A;  1S0C A;  1OLM E;  3O0V A;  1VBB 2;  4QGL A;  3ZYH A;  1DGR N;  1PGS A;  2PN5 A;  3WF2 A;  1GNZ A;  5HCF A;  1PK6 A;  3KF5 A;  4A4A A;  4E9K A;  2FZ2 A;  2P1B A;  2W92 A;  4GXL A;  3RYK A;  5JXH A;  1URX A;  3DKQ A;  2SLI A;  5FLJ A;  1UZY A;  2E7A A;  1JOJ A;  1VMF A;  1VP6 A;  4UFI A;  5G04 L;  3D4K A;  3NAP A;  1CR7 A;  2HWD 1;  3NWK A;  4BPZ A;  2VVF A;  3JUU A;  5A1F A;  1QDC A;  5JR7 B;  5C4W B;  5LA1 A;  3D0S A;  4NHM A;  2FDI A;  4AVV A;  1E5R A;  5JOW A;  1AR9 2;  3VN4 A;  3FFQ A;  1Z7S 1;  5EFU A;  2GDF A;  1X33 A;  4PIX A;  3M2M A;  2Y6G A;  3IKW A;  4X6R B;  4CDX C;  3ZDS A;  2JJ6 A;  2CV6 A;  2RHP A;  2A7A A;  2BPA 2;  4XMA A;  3R0R A;  4Q4V 2;  4CEY B;  1L7R A;  3BN6 A;  3JBG 3;  2LRP A;  5JAX A;  5CFD A;  4WM7 C;  3W59 A;  4OQ9 A;  4CXW A;  2XUE A;  3U14 A;  1CIY A;  1ULE A;  4R9B A;  5LA9 A;  3VBU A;  5KXB A;  1RUD 3;  1DQ6 A;  5LK5 A;  2VNO A;  3LE0 A;  2Y0O A;  5J1X A;  3V0B A;  4CZS A;  5JIU A;  1WD3 A;  1PNF A;  4N8M A;  3OPZ A;  4RR3 C;  5C7G A;  1H4G A;  3I2I A;  1MZ6 A;  4EWD A;  2Q8E A;  3TAY A;  4IQP A;  2VME A;  4E4H A;  5L9V A;  2WO2 A;  2YC4 A;  3O12 A;  4XE9 A;  4SBV A;  1RMU 1;  2K46 A;  1RUO A;  5ISL A;  3JXS A;  1BHG A;  3FN9 A;  3IM0 A;  4BA6 A;  4MYE A;  4HXC A;  1I3H A;  1VRH 1;  2ARC A;  2VOW A;  4R4Z A;  5I0U A;  5J36 A;  1WA4 A;  1X8M A;  2CDO A;  5F2W A;  2R49 A;  3IAP A;  1V6M A;  3IN9 A;  3WDU A;  3EHK A;  2G9Z A;  5EV7 A;  4HON A;  1JUH A;  1YYN A;  4IEQ A;  4GMP 3;  4N7U A;  5IVF A;  1V00 A;  5HCA A;  5T55 A;  4P9L A;  2ZHN A;  5IK4 A;  2WL1 A;  1MS4 A;  1QJX 3;  4RS5 B;  5C71 A;  1W6O B;  2Y0I A;  3IDB B;  3QOP A;  3KF3 A;  4GJZ A;  1CAX B;  1DHK B;  1LOC A;  3BOW A;  4RHV 3;  1LHU A;  3OEB A;  4BIO A;  4BQ3 A;  1LOF A;  2VUJ A;  3MUZ 1;  1POV 0;  3JB8 A;  4HFS A;  1QHD A;  4XTM A;  4N53 C;  2EXH A;  3ZXE A;  1SBE A;  1FPN 3;  1MVE A;  3T2T A;  5IAT A;  4RQP C;  1NT0 A;  3VKN A;  3E6C C;  2IC1 A;  5DN2 A;  5BNN B;  1CAW B;  2ZEZ A;  3RPQ A;  5L7O A;  1SLI A;  3KVA A;  4S2D A;  5GAL A;  1WZX A;  4KGG A;  5F6K A;  3D82 A;  2A3Y A;  3IT8 A;  3ZN5 A;  1BYH A;  4Y24 A;  1H0B A;  2QQM A;  1QXJ A;  1PK6 B;  4BK4 A;  4YZ5 A;  3NW4 A;  3WHU A;  1ST8 A;  4Y1Y A;  1HN1 A;  1RGS A;  3KHC A;  4AAP A;  3NAP B;  1QIQ A;  4OUL A;  1MZ5 A;  1OOP C;  5FZI A;  3TNP B;  2ZAA A;  1C8M 3;  5FTT C;  4LIT A;  2JIC A;  4Q0S A;  2Y6J A;  3ORJ A;  1U5X A;  4KG0 A;  3ILR A;  3Q8A A;  5J37 A;  5A33 A;  2R06 3;  4QX3 A;  1PGL 1;  3AMN A;  3MEP A;  4GJY A;  1AR6 2;  3LFI A;  2GNM A;  5I0D A;  1AXZ A;  2DVA A;  3MDP A;  3OBA A;  1G9B A;  3FFZ A;  2AUY A;  5H9P A;  4ZKT B;  2EF6 A;  4Z82 A;  2ZHK A;  2YY1 A;  5CAD A;  2GZW A;  1GIC A;  1PMI A;  3RZK A;  3NNJ A;  5A7N A;  4QPY A;  3PU8 A;  1YI7 A;  4CA9 A;  3V0B B;  2WO3 A;  2RS1 1;  1NYW A;  1SAC A;  4I02 A;  3R4U A;  5LBE A;  3SH3 A;  5JZG A;  2E53 A;  3KVB A;  5LEK A;  5C3R A;  4HBN A;  5BNO C;  3BTZ A;  3N7L A;  1LHN A;  4PI0 A;  4LO6 B;  1ZBE 2; 
#chains in the Genus database with same CATH homology
 1OUS A;  2BV4 A;  1OVS A;  5A6X A;  1UZV A;  2XR4 A;  3DCQ A;  1OXC A;  2JDP A;  2JDK A;  1OVP A;  1OUX A;  2JDM A;  4CE8 A;  3ZDV A;  2WR9 A;  5A70 A;  1UQX A;  2VNV A;  2CHH A;  2JDU A;  1W8F A;  2VUD A;  5A6Y A;  5D2A A;  2WRA A;  2BP6 A;  2VUC A;  1OUR A;  5A6Z A;  5HCH A;  4AOC A;  4UT5 A;  1W8H A;  5A6Q A;  5A3O A;  2JDY A;  1GZT A;  2BOJ A;  2JDN A;  2BOI A;  2JDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...