5LATA

Hif prolyl hydroxylase 2 (phd2/egln1) p317r variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/un9)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
224
structure length
221
Chain Sequence
b'LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNRNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLKGVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
total genus 65
structure length 221
sequence length 224
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5latA00
3EMRA 3NNFA 4NHYA 5ERLA 4ZPIA 2V4AA 5DAVA 4NHMA 3OBZA 4MHRA 3W20A 2Y33A 3OUJA 5A3UA 5LATA 4Y5TA 2HBUA 2OPWA 3HQRA 5HV0A 5DAWA 4BQYA 3KT4A 4Y5SA 4NHKA 5C5TA 4JZRA 3MGUA 2JIJA 3KT7A 5C5UA 2RDQA 5L9VA 5LA9A 2HBTA 2Y34A 5L9RA 5DAQA 5IAVA 4XABA 4J25A 3PL0A 3KT1A 3GZEA 3BVCA 3ITQA 5DAPA 4XCAA 5LBEA 4Q5OA 5EPAA 5LBFA 2FCVA 2FCUA 2JIGA 5DAXA 3HQUA 5M0TA 4XC9A 3OUIA 3W21A 5LASA 2RDNA 4BQXA 3NNMA 3GJBA 2G19A 4XAAA 5EP9A 4MHUA 3DKQA 2G1MA 4NHLA 3NNJA 2A1XA 4NHXA 5IAXA 4UWDA 4BQWA 4IW3A 4XACA 5LBCA 2FCTA 4NAOA 5LB6A 4XCBA 4ZONA 3NNLA 2RG4A 5L9BA 5HV4A 5EQUA 3OUHA 3GJAA 4KBZA 5IATA 2RDSA 5LBBA 4NMIA 2RDRA
chains in the Genus database with same CATH superfamily
4JKLA 1QJX2 2CDOA 2WDBA 1W39A 3LCPA 5ANNA 4COUA 3RZKA 4V2VA 1OBNA 1W99A 2D6MA 3BU0A 4AQSA 2ES3A 3AL5A 3WG1A 2GN3A 5CG9A 4FTEA 1AR82 4MHRA 5FY5A 4ZZ5A 2D3RA 4LO6B 5ACA2 1E5RA 2MEV1 3D0JA 4Q4V1 1Q8OA 4IEYA 2XLGA 4U36A 4M3CE 3ZPYA 5ANQA 1RUI3 3VZLA 4XTMA 5FCCA 1E5IA 2V73A 2WFF3 2VECA 4FOWA 2HWF1 5I8SA 3AP6A 2ZEZA 3EO6A 5JR7B 4ATFA 3U0ZA 5FP4A 1OVPA 3F95A 5HCFA 4AAXA 1J84A 1W6OB 2JG9C 5CB7A 5EWSA 4HKLA 2GP5A 1QJU1 1ZX5A 3ZKYA 1PM4A 3AK0A 5FP9A 5A80A 2BGOA 2ZGUA 2V09A 5KHGA 4UW6A 2FZ2A 5FY9A 2VZ1A 2YBKA 4LKSA 1WCKA 4CEYC 4QB2A 1HRI2 1N3OA 1RUF2 1XB9A 3OPWA 4HMZA 4LO4B 2Y6FA 4RL7A 2Z79A 2R073 4XBLA 5DZFA 2DBNA 3RZZA 1H4HA 2RM21 3AP4A 1MEC2 4JQRA 1FV2A 1PX3A 3LIGA 2VBBA 4LO5B 4NVPA 4URTA 3ZDVA 4CPBA 4XYXA 5FREA 4NIAA 4DUWA 4O9GA 4B1LA 2ATFA 4H7LA 3AYDA 4CDXC 1A78A 1AL22 1BKZA 2R1BA 4LK6A 1EY2A 1SCSA 1NY72 1LNSA 3VL9A 5FYZA 4HN1A 3GZAA 5JAXA 3H8OA 4ORFA 3BPZA 5JIUA 1FI2A 2RS11 1MZ5A 3UKTA 4ZS2A 3K46A 3LF7A 4WM7A 2V4VA 1BEV3 1EPWA 1S0JA 2WZR3 2R063 4BB3A 2WBKA 5LA2A 4AG4A 5BNOC 3BTZA 2RJKA 2K0GA 4N43A 5LASA 1TMF1 2CWSA 3M2MA 4OI0A 2QJVA 5FY0A 2IUWA 1UU4A 3QBQA 4I02A 1GOGA 2VMIA 2GNBA 2G4IA 4WV8A 3BPSA 1GBGA 2VL4A 1PZ7A 3DXUA 5D21A 1W8FA 4C0HA 3VBFC 4DUVA 1W6PB 5A32A 3DL3A 2HWC3 1NYWA 3WLUA 3ZFEB 5JOWA 2FDGA 4W4ZA 1K3IA 2C0ZA 4UYBA 3V65A 1GV9A 2QZ2A 2YV8A 3N36A 4JDOA 3TNQA 4QQPA 4CCJA 1ND3B 5JUVA 2VUJA 2XJTA 4OYUA 4OHYA 1PZ8A 1OQDA 1R092 1CX4A 5FPVA 4EWEA 1GFF2 4L2NA 2P3IA 5H9QA 1OFNA 3ZFFC 5C33A 5JXIA 4K20A 2E7TA 1UL9A 3Q8AA 3WG2A 1DG6A 3K4ZA 3P6BA 4ZONA 2UWCA 4UW4A 5FY8A 2VVFA 3VBFB 3VBOC 2PA7A 1RMU2 3OTFA 3RS6A 3SH3A 4DMIA 4FPYA 2WS92 3A0NA 4QAWA 4R9AA 5FMBA 2XJQA 2W0XA 2NMOA 3VBFA 3AYEA 4COVA 3MIEA 4KU8A 4MYEA 3CJXA 3PUAA 4BA6A 3SKVA 3PNAA 5IK8A 4Y4YA 3MIDA 4OCTA 1F8VA 5I0UA 3SHRA 4Q1PA 1H6XA 1W8HA 1RUJ2 4ZPIA 5BNOA 2RS51 3ZXGA 1HN0A 5T55A 1UD1A 5J09A 3I2GA 4SBVA 1Q8SA 1ZA7A 3U75A 2OQ6A 4QQHA 1KRIA 1UOFA 1SPPA 2R49A 2RS52 3ATGA 1JYNA 2R6QA 4XJAA 3P3PA 5LRSA 3HJRA 4NROA 1JZ5A 1CIYA 1AXZA 1FXZA 3HQRA 5FUIA 1ENXA 1IS6A 2EIEA 1OA2A 2NLRA 5ISLA 4K8FA 1WW6A 3SC7X 4MGTA 3JQXA 1SMVA 1C8M2 1LKNA 1NCQA 3H3UA 4XZUG 1ONAA 4CEYB 2QE3A 1A3KA 2JIJA 2QKDA 2XL7A 3OBTA 2Q1ZB 5JZGC 2BTVC 1ZZ6A 4AVSA 4W6YA 2WIIB 4R52A 3POEA 1H9PA 2RS32 2IXKA 2WFF2 2EVXA 5EIYB 3RI9A 3BOWA 2W52A 4YFWA 4EV0A 5HCBA 3WNXA 2FDJA 4XFCA 1D4VB 3ZXLA 3D5OA 1YEWA 1NT0A 5FY7A 1W6NB 3VUOA 3LGRA 1FYUA 5DDJ3 3OGJA 3IM0A 4Q8LA 1NLSA 1O3QA 1TE1B 2E31A 1JZ2A 1RUD2 4IEVA 5FZDA 3RYKA 5D1IA 3BKZA 1G6NA 2V5YA 4LNVA 5JMCA 3KV5A 3MV11 4ARYA 2OT7A 1UZYA 4LBKA 3A7QA 4M0HA 4Q4Y2 1ZYBA 2BRTA 2BPA2 3CEWA 1WCDJ 2OYZA 3LDKA 4NPMA 5FZ7A 2WA4A 4CDQA 5A3NA 5FKCA 3FWEA 3KLSA 4XMIA 1HV0A 1GP5A 3Q8CA 1RUJ3 3NV3A 3ECQA 4HPKB 3NAPC 1VBA3 3N7JA 1F4AA 3RZHA 2E33A 2XBO3 2D5FA 2JKBA 3RQ0A 3IBMA 1GR3A 4XXAA 5F3GA 2PMWB 5HXVA 4XUOA 2BGCA 4LBJA 2G9ZA 2VCBA 2HKXA 2JG8C 4QM9A 1N47A 4QX2A 1UZWA 4XACA 1PZ9A 1RUF1 3VBOB 4AI9A 1JW6A 4JTNA 1GZ9A 2DUPA 1UY4A 1D7PM 2JDPA 1QXPA 3WUDA 4R4XA 1UZVA 5K7PA 2Z4FA 2JDHA 3RWNA 1W9FA 1AR91 2C26A 3GF6A 3H8XA 3S7IA 3AXDA 1KGYA 2WNVA 4RHV3 3ZSKA 3WG3A 1O6UA 3A4UA 1W90A 2PELA 5FMCA 1QH7A 5FPLA 2AC1A 1JZ4A 2JG9A 3MW4A 5F3IA 2A6VA 1HRV2 3EJKA 3PJQA 3W59A 2DDUA 1SLBA 1VBB3 2Y6LA 3EYPA 1LU2A 1JYIA 1LOBA 1F5JA 4LHNA 5FUNA 4HFSA 4FQZA 3BCWA 4B4QA 3WCSA 4PDWA 2XKOA 4Q4X3 1BYHA 3DPRC 1C3HA 3RZLA 3H50A 2NM1A 2VXJA 1VRBA 1PVC3 1YQ6A 4P9LA 1WMFA 1BVVA 5D8AC 1G9BA 1PK6C 1YFUA 3FUOA 4YZ3A 2X09A 2PAEA 4TSVA 5DPNA 3OEAA 1Q3EA 5FPUA 1JTZX 2AUYA 1DGRA 4Y3OA 5ABJB 2VGDA 1Y9QA 1RIRA 1CAWA 1IG3A 1OOPA 1RMU1 2HWB1 1JN2P 3IT8A 4NPRA 1W9TA 2VMGA 2WS91 3OGGA 1SBDA 2O8QA 2YUEA 3C2UA 3WR0A 4COZA 2BDRA 2AREA 2BFUL 5FP3A 3TAYA 1RMU3 1LENA 4CXYA 1F31A 1LODA 3RFRA 1LOFC 2P17A 3GDBA 3UNPA 2A5ZA 2YPDA 1FNZA 4MVTA 4GKYA 1XBFA 1IKPA 2Y34A 3N9LA 1PO23 3GALA 2ZAAA 1JUHA 2WSUA 1ZBA3 2QVSB 5KWRA 2QFEA 3H42B 2JECA 1NAEA 1K45A 4CDQC 4A44A 4CP1A 3MF9A 3PVOA 4ZY9A 4FAGA 3K2OA 1GP6A 1YNAA 4CDUC 2J1RA 2Y26A 3U07A 2CDPA 4X6QB 2JDYA 5BY5A 1H1AA 1AYN2 4QGNA 2B42B 1QU0A 5DN2A 1XU2A 1UCXA 5FOBB 5CEHA 2ZGLA 2O14A 3MHZA 4UF0B 2HJIA 5M0TA 3N3HA 3AXEA 3LEIA 2XJVA 2WO2A 1P8JA 3G6JB 1FX5A 1IPSA 1I3HA 4RGGA 2CAVA 1XYPA 2KM2A 3AMHA 3BU7A 4YG0A 4LE4A 5FZCA 1UKGA 4H55A 3PUQA 1E57A 3AZZA 5EYYA 4FAHA 5JSRA 5IVCA 2E6VA 4NHLA 2DCTA 4N7UA 1S2EA 2LTNA 4O9EA 4CSWA 3DV8A 4E4DX 1O4YA 5C4WC 3M8LA 1U0AA 3I49A 1YWKA 3ZIWA 5LK5A 1WCUA 2DCZA 3BODA 4GXLA 1LCLA 4MOAA 2EAKA 4U2AA 1R1A2 3VV1A 1FPN3 1BK1A 3QH6A 5J98B 1B35A 1JMUB 1PIV2 5F5IA 3T2QA 1DLLA 1GZCA 1G7YA 1VMJA 2OA2A 3PHMA 5EQUA 4TTGA 4KBZA 2WZR1 1N3PA 4YYOA 4XDOA 5CFCA 4AFDA 2HWF2 4OUMA 5LBBA 3DCQA 2GDFA 1GP4A 2WWJA 4AVAA 5F5CA 4YM0A 3WD5A 5IK7A 3E5XA 1HLCA 4Y4RA 3Q9OA 4IE6A 4OZOA 1UYZA 1AR81 3CJIC 3IPVA 3INAA 3JB4C 1DLCA 3AJZA 4MO3M 3GHNA 1RUD3 1WUVA 1LR5A 2FBEA 4QT6A 2A6WA 3J4UH 3VB9A 3WDXA 4AVCA 1NX9A 1HRV1 1E5SA 2ET1A 3PTYA 3CIHA 5A33B 3CZUA 1A34A 1ULCA 1GYKA 1O59A 3R0RA 1W04A 4NRQA 3PJYA 1AR83 1C5IA 2LUWA 1HQLA 2Y33A 2A3WA 3I3DA 1FATA 1VBB2 3U37A 1GQHA 4DY5A 3C7FA 2WABA 4F7ZA 2R32A 5CVRA 4MGKE 1Q5OA 4IL7A 4M4PA 4PBOA 2XQXA 5FBZA 4Y5TA 3ZVXA 3EQEA 1GZWA 2CWMA 2P5BA 3MIHA 2D44A 1SZBA 3VKLA 5IVBA 2WAAA 2FMDA 1UX6A 2D43A 2J7MA 4PQQA 3ROUA 3H3LA 1IPKA 1RINA 3ZN4A 5CNAA 3HT2A 4BXFA 5C5TA 1B35C 2HWF3 3F2ZA 4AEJA 2GC0A 4IEPA 4MGIE 4N7IA 5FOJB 1PGL1 4QB1A 4XJZA 2DBIA 1OUSA 3GM8A 3VZMA 3AP7A 3CMGA 5J7MA 4KGQA 2G9FA 4M0NA 1EV13 1DGWA 4M4RA 4XW3A 1J83A 1W8OA 3VDCA 1AR71 3L2YA 1ZZ8A 5LRRA 4FO9A 3B9IA 1D2SA 2PAMA 1KD7A 1VBB1 4WVVA 5FPAA 3SQOA 3NJVA 2KD7A 3PL0A 1XYNA 1LEDA 1V6MA 3OPZA 4DRRA 5A3LA 3GZEA 3AP9A 4NWWA 2MNGA 5A1AA 5FY4A 5H9RA 5DAPA 1HX6A 4ET7A 5I8YA 4JGZB 1VBC2 1MS8A 2ZAHA 4OMCA 2UY8A 4Q0SA 4Q4X2 1JU3A 5LBFA 1VAVA 2XUMA 1AJKA 3GZUC 5BUVA 1PO11 1KITA 4XIKA 1BZWA 2VQ0A 1OHFA 4IEUA 1RITA 2J1TA 2EF6A 4YGDA 2WNOA 4FFIA 4A6OA 2O8OA 2RV9A 4AWDA 4QKFA 5A6ZA 5LA0A 4XDQA 3KB5A 1UNBA 2W47A 4N90A 2ZACA 3LFMA 1UYYA 3FMGA 4LHSA 4BQXA 4Z2WA 4IETA 4JV4A 4LA2A 2P2KA 1QXRA 4AFMA 5K9YA 3DKQA 1JOJA 4HSLA 5FXZA 3ACFA 2ORZA 3POYA 3IIAA 4K9SA 1TMF2 1W6NA 3JBG1 5FZLA 5A32B 5DMYA 1Z7S1 2QBXA 1RYYA 2W5FA 4IGPA 3VDAA 5EJ3A 3LDBA 1KJLA 3U11A 4BOWA 3DECA 3JD73 2VJXA 3PDQA 4D7SA 2P3YA 4LHKA 4ZHNA 4BQWA 4IW3A 4XAEA 5AC93 1DGWX 4HBNA 5GLTA 3J7HA 3ORJA 2CAUA 3ALQA 3LA3A 2ZX4A 4CP0A 1W0OA 3H7YA 2R072 4A4AA 2RJ2A 1O3SA 1YCIA 4D8MA 3QOPA 1W0PA 2W87A 4LXLA 2QNKA 2GNDA 2Z2SB 1AYM1 4RQPA 5KXEA 2BBVA 3E5UA 5IATA 1DZQA 4C91A 3TEXA 2ADDA 3A0KA 4YM1A 2WO3A 2VTXJ 2VZPA 2WN3A 1QQP3 3O0WA 2QUOA 2ETEA 1ODMA 3PIJA 5CZKA 2YB7A 1V6KA 1IQDC 5JMOA 4CUBA 5D2AA 2R062 4N9HA 4C1WA 4XMAA 1VLNA 4ES9A 5I0DA 2Q30A 2TEPA 3NJZA 4B7EA 4N43C 2BV4A 3R05A 4IEXA 1NQDA 1I6XA 3FX3A 4CUCA 5FAXA 2D6PA 3NV4A 5FP7A 1EAH2 4HL0A 4R8HA 1AR61 1S4CA 1H8VA 3IDBB 1OLRA 1NQJA 1WLDA 3SXWA 2XDVA 2YC4A 2NQYA 4MZUA 4JKKA 4QQ2A 1ZNPA 4COYA 4QPGA 4Q4V2 4YW5A 4YPJA 1SDDB 4A45A 3DN7A 3MFAA 4NIGA 2XWJB 1RHI1 2EXKA 3M3IA 3GBGA 5KXBA 1X82A 2VMHA 5A3OA 4JZRA 4DXZA 5FKBA 4QPGB 3RZJA 1WW4A 5FMOL 2JE8A 2RHPA 4CEYA 2GC3A 1I5ZA 1V6OA 1NLRA 1GQGA 2B46X 4K21A 1NKGA 1POV1 1ZVFA 1X50A 5LA9A 3ST7A 3LFIA 2ZMKA 1W6MA 3K75B 2BOJA 4XABA 1RUF3 1AYM2 4NO4A 4GH4B 4UFHA 1N1VA 4YW4A 4DNYA 5C7GA 2XQRA 4KWLA 4Q4W3 1O5UA 2XBO2 5C3RA 2GMEA 1UYXA 4FTSA 1ULFA 5IW0A 4BU2A 1KS4A 4P00B 1UWWA 4KI5M 1GU3A 3I59A 4KGGA 1WCSA 4RHV1 3VGIA 3PMEA 3POIA 4HSJA 5FZ3A 1Z7S3 4HXCA 3ZOIA 1IS4A 1WLCA 1H4GA 3PUHA 3OF1A 3DUIA 4FXKB 1CIWA 2P6CA 2P37A 3J7NA 4XC9A 3HEIA 2VZOA 4CP2A 3MIFA 1UY2A 2D6OX 5CFDC 4PLOA 2D98A 3VBSC 1NLQA 2Z42A 1KS5A 4CE8A 5L7OB 5LEKA 5ACA3 1FT9A 4XQ4A 1V0AA 3APBA 3OEBA 1QJX1 1OH3A 3KVAA 1ZBE2 1ZA4A 4H14A 4EN7B 5FP8A 4AVBA 4GAZA 1C8NA 2YU1A 4BHPA 3ENRA 4PLNA 4EN0A 1W9SA 3WP6A 5F5QA 2RS13 1FPN2 3D8CA 3GCWA 1LOFA 2CU5A 4GB33 3S7EA 4PCRA 2V5DA 5FZ8A 1SLIA 1KJRA 2ZX2A 2XR4A 5BNOB 5FZKA 1HB4A 1QOTA 2Y6JA 2VM9A 5CBLA 1ENQA 4MADA 4NAOA 4XFGA 2BW8A 3OY8A 4FCAA 5T5JA 3UT0A 3VBRA 4AOCA 2QQLA 3NRUA 4LT5A 4AXOA 1YO8A 1OA3A 1R081 3GJAA 1W9YA 5BNNC 2HLEA 2Y60A 5EYXA 3QLQA 2ZGPA 1AX2A 2OS2A 2WAOA 2HWD2 4N53B 5IK5A 1J1TA 2LRPA 3E97A 4CUAA 4EE2A 2FQPA 4BJ0A 1OD3A 1Z0HA 3THPA 3WF4A 2W39A 2H6BA 1RVF1 1VAKA 2F17A 3OOXA 1DZTA 5ERLA 4IV1C 4IERA 5JI7A 1V6JA 3MYXA 1GANA 5F3EA 1DQ5A 2CV6A 4A6SA 1C57A 1TQ5A 3USUB 4BIFA 1G8WA 5BNNB 1W9WA 5KHJA 4WM7B 4Y20B 2XLAA 4Q4Y3 1YQ5A 4JKMA 3UETA 3W20A 3H8UA 5FZGA 3T08A 2VZTA 5FWJA 4DOUA 1LHUA 3PU3A 4KU7A 1SHWB 3CL1A 4K8RB 2WNVC 1TNFA 3ZYHA 1URXA 2CHHA 4FFGA 5F5AA 3N9NA 3MPPG 1CJPA 1SEFA 4N8MA 5GLVA 1R083 1Z7S2 4XJWA 4YZ1A 3O1VA 2F4PA 4COWA 2XG3A 4QGLA 4YG6A 4RGAA 2UU8A 1VB2A 1J3PA 1SFYA 1AYN1 2D3PA 3D0SA 4NHKA 3WW2A 4W6WA 5FYBA 1H1IA 4FFFA 2ERFA 2LS6A 2WT1A 1G9AA 3KZ4C 3ZPOA 2IWGB 4E4SA 1SQ4A 3WQBA 4MLOA 4ASLA 2QQJA 3ZSEA 2R043 4BK4A 3NJXA 4XOGA 2B8MA 2XUEA 4CXXA 1BCXA 5FYVA 2OZJA 3VBUA 1JYXA 1CZVA 2A6XA 4XQWA 5F6LB 5L73A 3AP5A 4AQ6A 3BTYA 1S55A 2YZ4A 2BP6A 3T09A 3WW1A 1UMIA 1UZZA 1S0GA 5FLHA 3TYJA 1ULDA 4I2OA 5GJ6A 2BVVA 1LOGA 1UYPA 5IVEA 3ILRA 1CAVA 2XJPA 2PYTA 3OGSA 4KWJA 2K2SA 5LBEA 2WA3A 5FYUA 2E9QA 4NWVA 4Q5OA 5E16A 5C71A 1AF9A 2AEYA 1W2TA 1RGSA 1V9U1 4YVSB 3ZSLA 1J3QA 3KS7A 4L92A 4RFT0 4E8CA 3I7DA 4BWOA 3UGGA 1YC61 5KXDA 5DDJ1 2FDFA 2WNUA 4CP9B 5FO7B 4Z92B 5L19A 1H0BA 3LEGA 1F15A 4CCKA 4LEJA 4L0PA 1J58A 4XAAA 1ZRIA 1ZM1A 4K3UA 5CAZA 4CDXA 1J59A 2DURA 4B3NA 2YROA 4Q26A 3NNJA 2VR4A 1LOAA 3ZN6A 5LEJA 4UF0A 1W28A 1AUYA 3ZYPA 1WMEA 2BQPA 1WBLA 2VCAA 1X8MA 4KBBA 3LQCA 2E51A 3E5QA 4C0BA 4UWDA 3WG4A 4LOTA 3KMHA 5IHRA 2VXRA 3VL8A 5CA6A 4DY3A 1EPZA 3M3OA 1W03A 2CYFA 3TRSB 3V0BA 1BJQA 3WW4A 2WZ8A 4O61A 1MEC1 1RXFA 2DTYA 1FOD3 3NL1A 1MQTB 4OQ9A 2CGPA 2XJUA 4GALA 3ILNA 4AEDB 1TME1 3ACHA 2N7GA 4XQDA 2RDSA 2JE9A 3WNNA 1WGPA 3POGA 3PMSA 3A22A 4XUQA 1WW7A 5HI0A 4X6RB 2QQVA 1C8M3 1XE7A 3C7GA 3OD4A 4M3CA 4KWUA 2W92A 4UBGA 5A7NA 4TZDA 4HLTA 3LEMA 3NWKA 1VBD3 4BLIA 4Q4W1 5CADA 1VB4A 5KHIA 4QXHA 3DYOA 3KQRA 3ZR5A 5E8AA 2V4AA 4AI0A 3DXTA 4NHMA 1NOVA 3POFA 4PIYA 3CO2A 5FZHA 1J1LA 1R1A1 3LOBA 1LGBA 3B9CA 1CAXA 4AHXA 3VBHA 4CCLA 4QHZA 4HK9A 4JVAA 2GH2A 1S0BA 4HVRA 2HH9A 4JGZC 1W06A 5DXDA 1RUH1 2AEZA 1HQWA 1QEXA 2PQSA 3OYWB 4FOYA 4AHWA 3LSEA 3HBZA 3OCPA 4R9BA 4CU8A 4MX3A 5T52A 3HR9A 1PIV3 1X7NA 2PHLA 3MGUA 3S6PA 1AL23 1POV0 2A6YA 3VBRB 1VP6A 1YJLA 2ZA9A 4DUXA 5BYNA 4Q2FA 4H7MA 3WUCA 1OSGA 2K46A 4WM8A 3VKNA 3WSOA 2R0FA 3BOPA 4ATEA 2IZWA 4ZS3A 5JVVA 2E53A 1QXJA 2I74A 4LE3A 3ZYJB 4YLZA 1VBC1 3NV1A 1I9RA 2LROA 1XE8A 4CCCA 4N53A 5GM0A 5JSPA 1DFQA 4IQPA 3GNEA 2QDNA 4LA3A 2VQAA 2XB6C 5E89A 2UYAA 1APNA 2Q8EA 3BIEA 1DYOA 2WNVB 3AYCA 1J3RA 1QJY1 4MSVA 4HK8A 4LORA 4D6RA 1RL3A 4UW5A 3SCFA 3DPRA 3AMPA 3IZOA 4I01A 5EPAA 2VC9A 2HWE1 3MUY1 1U5YA 1QJU2 1UOGA 4CEWB 2ID4A 1O4TA 3ZN5A 4DXTA 3V56A 1GICA 1NY71 5I93A 2B4KA 1YIPA 3B7MA 4OI4A 1D2QA 3LDRA 2IFWA 2GP3A 2H0VA 4JHTA 3K3OA 2WZR2 1KFUL 1PO12 3NNMA 1UO9A 3AC0A 4AYUA 4BDVB 3V0AB 3T1MA 1VBE1 1XSQA 2WS93 4LUMA 1V6NA 4OVEA 3MW2A 4MHUA 5A6XA 3VZKA 2G1MA 1AR73 4QWNA 2DWRA 1AR63 1OPMA 4FOQA 1W0NA 5EV7A 1COV1 5LK7B 2QQMA 4O65A 2AR6A 3AX4A 3UL2A 3URFA 1AX0A 2QQIA 1SBFA 3AKSA 1DZRA 3Q8BA 5GZDA 5B4XA 2ADEA 2JG8A 4XF0A 5AC92 1H8TA 2WO7A 2ZKLA 4YARA 4XFAA 2D40A 2R042 3J8F2 3PTRB 4YVWB 4ZU5A 4BQ4A 1UPIA 3VZJA 3IAQA 4QQLA 1UX7A 2DFBA 3JD71 1GWLA 2VZUA 4NPLA 3VHOA 4YVSC 5I0TA 1RUH3 3NNLA 5L7OA 1WD4A 3GCXA 2Q4SA 5IWFA 5A1LA 1RB8G 2QQWA 1ACCA 2J1UA 5A7QA 1RHI2 4MV2A 1IZ3A 1GMMA 2ZZQA 5BV6A 1W2AX 2XBO1 4EZHA 4NJ4A 5IT6A 1UMHA 1SLTA 2VNVA 2VOXA 1VMFA 2VW1A 3D6EA 4M01A 4ARXA 1JZ7A 3THCA 4LUKA 2VOVA 1YI9A 3J9SA 2RS53 2ZHMA 3KSCA 4HG6B 2DCJA 4P5HA 4XHXA 4YVWC 1EAH1 2PQQA 1O5LA 5FJKA 3VDDA 5F1RA 2HWE2 1HQNA 4KMQA 3VZOA 1AYN3 1IOAA 1REEA 2WNUB 4LKFA 5DAVA 5DDJ2 5APAA 2K9ZA 4OHZA 5C9AB 1CZTA 3HAGA 1YYNA 1EAH3 3BALA 4QMAA 4FPLA 4B7KA 5A6QA 2B9VA 5LA1A 5GZFA 3WOGA 4CDXB 4LQRA 5F9TA 3OSDA 2BEOA 2B9UA 4BMEA 1O7FA 1VBE2 3GYDA 5DABA 3SISA 1YI7A 2W94A 1MZ6A 3IMMA 3W5NA 4P9XA 4ZZ8A 4DO0A 3ES4A 3LB9A 1V6IA 4B29A 5C3SA 3BN6A 3WVJA 2QTWB 4FFHA 4XJUA 4XPVA 4CVUA 2XPJA 4BQ1A 2BUKA 5JZGA 1LGCA 1UKRA 4Q4Y1 4D69A 4LPLA 2WLQA 4LOSA 4DINB 3J7MA 2FZ1A 1C28A 1JH5A 1CN1A 5FZOA 5JR2A 1BK0A 4Y1VA 2ZMLA 3FLRA 3WXPA 4C90A 2PAKA 4META 1PO22 3ZXEA 4IEZA 1HW5A 2RE9A 2YU2A 5IAVA 1DCSA 1W2NA 5J48A 1YLLA 1CESA 1W8TA 4UFIA 3B94A 5FZ1A 3KVBA 3ABZA 1ALYA 4FPEA 1HB3A 3U78A 1UU6A 1LESA 3JBG2 4GULA 1RUD1 4NRMA 3ZXFA 3AVRA 3LWCA 1NXMA 1PVC2 2IXHA 2VW0A 3J26N 1YIFA 3M3CA 1VBA2 3MF6A 3T1LA 1CONA 3ZFFB 3ZXDA 4EYUA 3WCRA 4JDNA 1E5HA 1MQTA 1QWRA 3WHUA 1Q43A 1OURA 3POWA 4A41A 4AI3A 1OXCA 2GMMA 3AJYA 1IHMA 2ORXA 2ARCA 3ZFEA 5C8CA 3IDAA 4LBOA 3VBUB 3ZXKA 1NUKA 5FBJA 4F8AA 5ABJA 5FQ0B 1ZRRA 2VVDA 2RDNA 4RQPB 1Y3TA 1SFNA 4X8NA 1OC1A 3HBKA 3JXSA 2CL2A 3K4AA 1FPN1 4XJ8A 2XJSA 1RVF2 4OMDA 1QJU3 5F2SA 2WJSA 4NE9A 1HRI1 2QQUA 4JRAA 2PLV3 2XKPA 2ENRA 5I0SA 2HWE3 4SLIA 1RUH2 3EHKA 2LM3A 1QHDA 2VZVA 1UOBA 3AYAA 2XVKA 4AAPA 4QD2A 5BNPA 3VZNA 4TLFA 4CU7A 2ZHLA 1WWYA 3CF6E 5EFUA 1DDLA 4LBQA 4P9JA 4BPZA 1UY1A 5FR3A 5FDBA 4LO7A 5EJZB 3NV2A 2FCTA 2BFUS 2Y0IA 5FZMA 5GZCA 1ZRFA 1XNAA 4CEWC 1G9CA 4MG2A 1HN1A 3EBRA 3BTXA 1DQ1A 3CLPA 3O14A 3GZTB 2CSGA 3KCCA 5FPBA 5K0UA 5B2GB 5FLIA 5H9SA 1R091 3PIGA 1GWKA 1JYWA 4YGCA 3AB0A 1XOYA 2ZEWA 1OUXA 2A73B 2R16A 2O1QA 3TWIA 3ZN6B 2E63A 3RRDA 4AGVA 2ILMA 2XWBB 3LEKA 2BERA 1SFPA 4Y26A 1S2BA 1NE4A 3I2HA 1Y43B 4D0QA 1G9DA 3SH5A 4AFAA 5BNPC 4QXBA 3EMRA 1XRUA 4NHYA 1MS5A 1WZXA 5FTTC 5JI9A 5CFDB 1NZCA 1LOEA 3S57A 1PMHX 2P34A 2VBDA 4EZ4A 2DVGA 2GMPA 2X53S 3WV6A 2HEYF 2XONA 2ZBJA 4QHOA 1UIKA 3ZXJA 5FIXA 4Z8BA 5BPXA 5JPMB 1HB1A 1T6BX 1PO13 2C9KA 4QM8A 3B5LB 2Y38A 1ND2B 4LJHA 5A3UA 3RDIA 3H3ZA 3FE5A 3ZYFA 4QGMA 1QQP2 5KHHA 4AHZA 1FMD1 2IXLA 3USSA 2WL1A 5DAWA 1TME3 2X5IC 1HXS1 4UXAA 3USUA 4LLOA 3WQ0A 2C24A 4BQ5A 2BWAA 1UW8A 3CHXA 3B93A 3WZ1A 2IXIA 2EA7A 4XFFA 1ODNA 2WC2A 1WBFA 4FQ4A 3ZDSA 2VPVA 4A2UA 2A75A 2ZXQA 2YG0A 3V0AA 4D94A 4RR3C 5E6HA 3TB0A 5JDBA 3AFKA 3L2HA 4EN9B 2JD4A 3CJIB 4OQ8A 1O4ZA 4AZZA 4JGYB 4AEMA 1KDMA 4FP3A 3WF1A 5C3PA 5KC5A 5JSOA 5JIAA 1OH4A 2OKXA 1PGW2 3WP4A 4PIZA 1X36A 3MFCA 4Q29A 1LU1A 1N1SA 2JENA 2WZPP 2ZGRA 4OULA 4XVHA 1RUC1 3AKTA 3R4DB 4WBBA 4BLJA 5KXCA 4NN0A 1GNHA 4IV1B 4KNCA 4QXCA 1VRH2 4RSUA 1LHNA 2GU9A 3LZZA 4QU2A 1HXS2 3T2TA 4AQ2A 1GWMA 2VE1A 4CU6A 5F8PA 2PFWA 1UY0A 3KGZA 3T4HB 2GZWA 2GNTA 3MIGA 4CCNA 1CAUB 3IN9A 1VMHA 2AZ5A 2MHFA 2BGPA 4GQ7A 4BIOA 3VD5A 4P5YA 1CGPA 3O1RA 1CAUA 1MR5A 1US3A 4OHVA 1OF4A 2VZ3A 1B09A 3TN93 1OQEA 1PVXA 1YUDA 3N35A 3MLJA 3NVCA 3KGLA 5HBAA 3B69A 5FLJA 3ACGA 2WR9A 3R4SA 4HKOA 3RZGA 4OI1A 4GIQA 1ZZCA 5JZGB 4XEZA 3RGBA 2CGNA 4N53C 3LE0A 4PQ9A 1UOJA 1O8PA 1C1FA 4RGKA 1AR93 1T2XA 5ACA1 5IFTA 5JWPA 3AMMA 3I3BA 2ZJCA 3QACA 3SCHA 3CBNA 1UXZA 4P9YA 3AVSA 5E88A 4AEDA 4YFZA 3RPQA 4EROA 1FOD2 4GWJA 5IVFA 5FZAA 3T4VA 1V00A 4XILA 3VBUC 3HMYA 1NG0A 3VHPA 1Q8QA 2ARXA 1ZRDA 4XETA 1POV3 2XMLA 1QOOA 2YPJA 1PIV1 1IS5A 3TNPB 5DUXA 4FVVA 4LO8A 4N43B 4YW1A 3AKQA 1ND3C 4Y1ZA 2B39A 1YRZA 1LEMA 3WDTA 2X5IA 4YSFA 1H9WA 1VE0A 2WKKA 2VMDA 1OPOA 3E6DA 3I59B 4BM8A 1OD5A 1SACA 1UPSA 4YGBA 2BNOA 2ET7A 1QNYA 3I2KA 4XBNA 3ETPA 1VBD1 2PLV1 2EALA 4QDRA 2PHXA 5FZIA 3MICA 4YM2A 4GMP3 4YW3A 3KD4A 3DEMA 3I54A 1S0IA 3SMHA 3VDBA 4S2GA 5EZWA 4ASKA 1CJDA 1DQ0A 4J1WA 2C9AA 4Q4X1 3IWZA 4J6GA 3T2PA 2R7EB 5SV5A 4IV3C 4ISQA 2BU9A 2O0OA 4ITCA 4IEWA 5FYMA 4DPNA 2W1UA 3WY6A 1Y4WA 5FYSA 2EXHA 1LAJA 4FPCA 1RJ7A 4QX7A 1STMA 1D4M3 3DF0A 1WMXA 3IDEA 4QPWA 1XU1A 4JGYC 5I91A 3N7MA 3VD7A 1REDA 3IPVB 4UFKA 2R0HA 1GOFA 3KT7A 4LITA 1W2OA 4HKWA 4JCKA 5BNPB 1WD3A 3UKVA 4LBQD 3PUIA 4P9IA 2JDAA 4B4RA 1L7QA 1ULPA 2IXCA 5DAQA 1S1AA 1NA1A 1LRHA 2D3SA 2MEV2 4PF5A 5T5OA 3O1MA 1EP0A 2W1QA 4RS5B 5FZ9A 3RNSA 1JUIA 1S0DA 4AQTA 1OI6A 2QQPA 2H6CA 2RMU2 2RM23 1W3XA 5GALA 1KXGA 2WQ8A 4E2SA 2JX9A 5DQ0A 1YHFA 2FCVA 2JIGA 2VUAA 2VZQA 2JG9B 4NIIA 3WEZA 2VZSA 4PJYA 3W5MA 4JGZA 3WDUA 4OI2A 4C8DA 1AL0G 3FC0A 1O91A 3JU9A 5FXXA 1L7LA 1LHOA 3SITA 3VBSA 1H6YA 5JLVA 2CTVA 5CFDA 1HXS3 5CISA 4DXSA 4JRLA 2G19A 1HKDA 2DUQA 3FUQA 3MEPA 4Y20A 5ABJC 2JDKA 4Q8KA 3S30A 1X33A 1DGLA 5FZ4A 1ZBA2 1UF2C 2C6SA 2XL9A 4KWKA 4DEQA 4LBMA 2A1XA 1LTEA 1NA1C 2DFCA 2VQUA 5LWBA 2JKXA 1EUUA 2D97A 3NNGA 5IAXA 4RD7A 2C4XA 1WCQA 2Y8KA 3K3NA 2TBVA 4MGQA 4O7XA 3ZYGA 1ULEA 4AL9A 3WF2A 4QDQA 3B02A 3TN91 1H30A 1QNWA 4XCBA 4D6SA 5F2WA 5T5PA 2BJSA 5JXJA 3G7DA 4CDWA 1YFXA 1O3TA 2WSVA 4RR3A 3B00A 3RMYA 1BBT3 2R041 2R061 2VVEA 5LW9A 3N9PA 3OGVA 4IXLA 4XF4A 1ZREA 5JXHA 1YJKA 1UAIA 2R1DA 4UFMA 2XJRA 2VQTA 4IV3A 3KM5A 5FXWA 4K1YA 2Q1MA 3VD3A 2NMNA 5FYTA 1POQA 4XURA 5A3TA 3N7LA 3SLIA 1CAVB 5F39A 1T6GC 1CD3G 1KFXL 2UWAA 4LBQB 2IVIB 2GSYA 5IVYA 1JOPA 1H2MA 3C7EA 4Q27A 1PMIA 1U5XA 5IUQA 1OLMA 2QDRA 3OBAA 4FPOB 3IKWA 4RA0A 2DVAA 1JYVA 5C9AA 1IPJA 3O1PA 2OX0A 4CP9A 4AVVA 4DS0A 2DVFA 3JCIA 1BEV2 2A3XA 1R1ZA 3FN9A 3LA7A 2Y6HA 3VN4A 3ZFGC 5C4WB 2HBUA 2OPWA 3W58A 3LSDA 4JX0A 3BYWA 4YZ2A 1SLLA 3CZJA 3M3EA 4XF3A 1GOHA 3VDDC 4CDWC 2VOWA 2OPKA 5IK4A 2I07B 3WQ7A 4XF9A 3ZMNA 5J96B 1COV2 1D0HA 3WNOA 3S5AA 4J1XA 2WT0A 2WO1A 1FNYA 1AX1A 2ZX0A 4V1PA 3FFZA 2XXZA 2JB4A 3DYMA 3ZYIB 3WNLA 3KF3A 4Y33A 3ZYBA 3WINE 2J1AA 4XHBA 1W6QB 1KQRA 4L99A 5C3QA 4DB5A 2YBSA 3ZFGB 1JYTA 3O0XA 4Y22A 1GQPA 5JOYA 4UT5A 1ZBE1 1JU4A 2E7QA 5A7PA 2PN5A 4AVTA 3N4MA 1UXXX 1D4M1 2VNRA 3KT1A 3ZMOA 2NYYA 1AJOA 1YQCA 3AMQA 3N9OA 2WUHA 4QDSA 4QX5A 4R9DA 1GKBA 3BVCA 5FYHA 3ZFGA 3BUCA 1RUOA 1JZ3A 4PI2A 4G3YC 1JODA 4Q0QA 2HYXA 2ARAA 4I3PA 3ON7A 3C3VA 4M3CB 1R64A 5C9AC 4E9KA 4QU1A 1OA4A 2W08A 1QIQA 4PBPA 1OT5A 1R082 4FOVA 3WW3A 1YFYA 3Q8EA 2VTFA 4OUEA 5IJRA 4KH9A 4EN8B 4I0AA 3SEPA 3R6SA 1IQAA 5C8CC 3KHCA 2OVUA 3ZX7A 4QQOA 2C5DA 2GAUA 3AZVA 5EHDA 4OHWA 1RUG3 2YGMA 4IE0A 4F83A 4TYSA 4PDWC 5FFOC 3UGHA 3FHQA 2AENA 1BVP1 2VMCA 2WT2A 4A42A 1ND3A 2KXLA 2PTMA 1ENSA 4NHXA 3DYPA 1QJEA 4FPHA 4L11A 5K4LA 2ZEXA 3PVBB 4FI9A 1XE0A 4FPGA 4FT8A 4LTAA 3TBDA 2E7AA 5GLZA 4OLLA 4AEDC 4BCUA 3I3MA 3NKTA 2EIDA 2RR13 2W2IA 3OPTA 5T54A 4DQAA 5FPXA 3HQXA 3RJRA 3E6CC 3ZLIA 4IGOA 2VNOA 5BXXA 2ARBA 3OUHA 1C4RA 4XJ9A 4Q0VA 3OY8B 4IUGA 1LB2A 1FMD2 1R1A3 3WDWA 3S5QA 4A7ZA 2OXBA 1DBNA 1HJFA 1N1YA 1LHWA 1Q8VA 2P1BA 5A7OA 4A7YA 4BQ2A 3W9AA 4D7TA 4HONA 1QOSA 1EYBA 2E32A 5HCHA 4RS5A 4FBFA 1LJ7A 4OHXA 2WYFA 4RYDA 1K12A 3FFQA 3AM2A 5LZ6A 2OUHA 1RUC3 1TMF3 4CCMA 2QQNA 4P02B 1QY4A 3ZIXA 1F2NA 1JHJA 3KCYA 3N9QA 2OIIA 1RXGA 4ZKTB 4LLFA 1UIJA 1ZBE3 1FV3A 2ZGQA 2BWCA 1B35B 3DKWA 2J42A 4QHBA 4AFCA 3KV6A 1GNYA 4AFBA 1BLZA 5J37A 4GA9A 3AKPA 3Q8FA 4AI2A 4X8PA 2ZX3A 1NXD1 2FDKA 3OUJA 1N3QA 2DYCA 5IVJA 4XFHA 4BK5A 2PHWA 4P14A 4BYYA 2XVLA 3GBWA 3RG0A 2D7FA 2J22A 2YFZA 2FDHA 4L9BA 1F9KA 4AI8A 3X29B 4EWDA 2PHUA 4AEKA 2Q8OA 4URAA 4GWMA 1A8DA 4IESA 3UYJA 4BMBA 1LHVA 1WLWA 2DVBA 5K0UC 1OMIA 2ZGTA 1FMD3 3MIBA 4GD4A 5HPOA 2A71A 4WM8C 2UYBA 1W2UA 4XTPA 5IFPA 2Y0OA 2BZDA 4R4ZA 5L7OC 4YZ4A 4B1MA 1DHKB 1RUE3 3J8F1 4P08A 3CNAA 2EIGA 2GH8A 1TG7A 1D0GA 2RDQA 3CQOA 2HBTA 4IDZA 1JOBA 3JD72 3POBA 3MW3A 4ES8A 5GLWA 2X8KA 4CUGA 5FJHA 2XOMA 3U14A 4B8EA 2P6HA 2HWC2 3PURA 4GMP1 2NN8A 3AKRA 1X9TA 4MH0E 1DQ4A 4QPIA 4XCAA 1VALA 1G86A 1NCRB 2OQ7A 2ZX1A 2EAAA 4LKDA 3KCXA 3I2IA 3OG2A 1LECA 3RMXA 5A70A 5LY1A 4Q4V3 1DIWA 5FYCA 3H1MA 3JQWA 4W65A 5FO8B 1VBD2 4FPFA 4K1ZA 4D6QA 4EJRA 1JZ8A 1OLME 1MPXA 2WZEA 4MXWA 3FBYA 3OJBA 1GUIA 3NSTA 4P9WA 4E4ZA 4KG8A 4MGYE 2D6LX 2WNUC 1CPMA 4UBHA 2DF7A 5A1FA 4YNIA 1UMZA 4CCOA 3ACLA 3H1YA 2Q0AA 1DGRN 3ASIA 2WQZC 4HANA 5CIRA 1F5FA 4FPJA 5FYYA 3FHAA 4ASMB 3E1F1 4AGRA 3LPGA 2VO5A 4E4HA 3V64A 2XLFA 2NZ9A 3RVHA 1PHMA 1EV11 3EB7A 1UN1A 1DU3D 2GN7A 2RS33 2ZKNA 3I2JA 5FZFA 4E27A 1US2A 3UJOA 5LB6A 2B5HA 1XNKA 3K51A 1JXNA 2BBAA 3U1XA 1FAYA 2CNAA 1ND2A 1XNBA 1YXWA 2AACA 2JXAA 3KV9A 5G05L 2PHDA 1RVF3 2D6NA 2YMZA 4TWTA 4YWAA 3OD0A 1HDKA 1V6LA 5L36A 4NMIA 5F3CA 2JB8A 3O1OA 1GZTA 2X05A 3VHRA 5CG8A 3N9MA 3O1SA 4WVMB 4XIOA 4PDWB 1TME2 3GBFA 2BVBA 4G4FA 2HYKA 1JI6A 3T2OA 4AGGA 4UFJA 2HWD1 2X29A 1DYKA 3FJSA 1AR72 4XBQA 4BH9A 1MZFA 5JOXA 1XJAA 5A3WA 5JOZA 3OGRA 2TUNA 4YGEA 3R4UA 1GSLA 3HNMA 1PK6A 4A7KA 3FLPA 3JZVA 3JBG3 1MS9A 1QGLA 2PHRA 2YBPA 5FQ0A 1CAWB 1HRV3 2VZRA 3FBMA 4WM7C 1RUC2 1QDCA 3ZO0B 4XFBA 2R071 4PHZA 2JD9A 4RHV2 2GC2A 4K6BA 3WP3A 1XSRA 4IV1A 5HV0A 1BBT1 3VBHB 4XUNA 4HVQA 3I3QA 3WHTA 4GJZA 4GKXA 2WWSA 2C1FA 2JE7A 4CTEA 4HETA 5CFCC 3EXUA 2NP0A 5FZ0A 1XXNA 3ILFA 1HB2A 2HEWF 1PNGA 4AW7A 1OQ1A 3ME2A 4UI9L 3H7JA 4WZFA 4PT6A 2JWPA 5DZEA 2UWBA 4EQVA 1OFSA 4GB32 2RMU1 5L9RA 3OB8A 2VUDA 1H2LA 4YW2A 3A23A 2A3YA 2EXIA 1L3JA 1NA1B 4EN6B 1LULA 3ZSMA 2JJ6A 4I3GA 1VJ2A 4K7JA 1CVNA 3SNMA 3LKJA 4QPGC 5C70A 1S0CA 1RUI1 5DUUA 4TN7A 5J1XA 1K42A 2V72A 3MO4A 1SCRA 3C7OA 2YY1A 3M7AA 2WNEA 4CPBD 1RUJ1 2DUOA 5F37A 1LGNA 3ZFEC 1HJGA 2ZOEB 5I0RA 1MQTC 2HWB2 2RJLA 1MZEA 3ZSJA 3N7KA 4FSJA 1OKOA 3I2OA 2H0BA 4Y1UA 5FRAA 3THTA 1V9U2 3O0VA 1W6MB 5JXGA 2HWB3 1W8NA 3GJBA 3AZXA 3AZYA 2RM22 3L9JT 3HNYM 1RHI3 2ZEYA 1CR7A 3JB8A 5EP9A 2P3KA 4I0BA 2ZHKA 3D4KA 3TEWA 3T0DA 1KEXA 1HV1A 3WNPA 3BTAA 1ND2C 2HEVF 2VU9A 1VRH3 4CYDA 4TXWA 5BNNA 2B7YA 2F6BA 3BGAA 2VG9A 4WVZA 3J7LA 3DPRB 1AYM3 3VD4A 3RJ2X 4XZPA 1ZBA1 3KQ4B 2DU1A 4AF9A 5CFCB 3P1IA 1QQP1 5E1RA 2P3JA 3UESA 1HRI3 1ZZ9A 2JG8B 2WFF1 3KWVA 4JGYA 4INDA 3IDCB 1WMDA 2LALA 4LKEA 1BEV1 3NW4A 1S0FA 5GLUA 4RFRB 4AI1A 4H2AA 1LOCA 1PGW1 2Y64A 4XDPA 4AHYA 1GZWB 1RUE1 3J8F3 4QPIB 4QX1A 3VKFC 2Q5TA 2RDRA 2QZ3A 1ASJ2 2QCSB 5F7UA 1FOD1 3ETQA 3RWKX 2B45X 5A3PA 3I3EA 1JS9A 4IV3B 3P5BA 2ZGKA 1MVEA 1XC6A 1DQ2A 3MV01 1DF0A 3B01A 4IEQA 2E26A 3ZXAC 2XHNA 4YZ5A 4MXWB 2VW2A 3WDYA 4NAMA 4D3WA 3H9AA 2VBPA 3HPNA 3T0BA 4BISA 2GC1A 1TZOA 4QPIC 5FO9B 4Q4W2 3I4IA 3CU7A 1VBA1 3WF0A 3VLBB 1I5PA 1TEIA 1S0EA 2YXSA 1TVGA 1UY3A 2VAUA 3MI8A 3O12A 4QB6A 4W6XA 5F32A 5LATA 5J3UA 1GNZA 3K77A 1QMJA 1W6OA 1WA4A 4IEOA 4OZXA 1UZ0A 1VPHA 1VR3A 1W8ZA 2DCYA 3O7OA 4ISRA 4BQYA 4CCEA 1VIWB 4G9SB 1EV12 1WA6X 3RYRA 4AK3A 2GALA 3H1WA 3THDA 2EIBA 1DP0A 1W05A 4B4PA 5T3NA 5A3MA 5H9PA 3VDDB 5C5UA 4HT1T 1BBT2 1RC6A 3UK9A 2I45A 2J1VA 1O8SA 3HN1A 3TOJA 3HT1A 2Q8DA 2VCCA 4KL1A 2A70A 5L9VA 5JCTA 4GMP0 1AL21 3VKMA 1W6QA 1AHSA 3HWJA 1SG3A 4GWIA 2RR11 4WVMA 2PLV2 2W3JA 5CKMA 5A6YA 1MACA 3NAPA 2PHTA 4H3WA 4UFLA 3QH7A 2BNMA 3LOIA 1L7RA 3VHNA 1CPNA 3IB3A 3PVEA 2AH2A 4HVOA 1PGSA 1REFA 4QPYA 1JZ6A 2W91A 1C8M1 5DAXA 3VBHC 4NIHA 2AGSA 4QX0A 5DUWA 5JPNB 4FTBA 4JTOA 1PK6B 1XYOA 2G9GA 3PLQA 2W9XA 4M3CF 1JYCA 2D5HA 5FZOB 5EJ1B 4PLMA 2ZGNA 3OUIA 4RS5C 5FK8A 3RZMA 4RR3B 4JQTA 5AVAA 2HWD3 4K40A 4IGQA 3KV4A 4CZSA 4MGSA 3ZKUA 1QJFA 3UKNA 1XQNA 1C1LA 1W8UA 4RN5A 2P4EA 4KG0A 4QKNA 3WNKA 2VMEA 1AXKA 3ZYRA 1OOPB 1YQ8A 4BE3A 1MS3A 3FL7A 3NO8A 5DZGA 3WP5A 3O5SA 1BXHA 5DUVA 4YW7A 2ZMNA 2VNGA 1U12A 4QKBA 3C7HA 4W50A 3T30A 4JDMA 4NRPA 2DV9A 2R30A 2X10A 4IE5A 2XVGA 3P3NA 5LBCA 5CYYA 3ZR6A 2F4LA 2UURA 3FLTA 1H8TC 4GB31 4I09A 1XPWA 3SCGA 1OF3A 3M1HA 1K5MA 2VH9A 4W8JA 3M4FA 3POJA 2RG4A 5AC91 2W46A 4HN0A 5EXOA 4F3JA 3QD6A 4AE2A 1ULOA 4DZGA 2VTXA 3SH4A 3AZWA 3TN92 5C4WA 1ST8A 3LAGA 4YRDA 4YG3A 5K0UB 5GZEA 3FZ3A 4Y5Z0 3D82A 3FHIB 3VKOA 1RJ8A 4S2FA 4ZXKA 3MPBA 2RVAA 3ELNA 1Y9MA 4Y24A 5TSWA 4QX8A 2QQOA 1AR62 3PUSA 3UV9A 1IGOA 2FHRA 2VULA 1QJY3 1F35A 5KR7A 5LCWL 1Y7BA 1BQPA 4DIQA 1ENRA 5DG2A 2ZS6B 1NE6A 3GXUA 1NCQB 1S2KA 1X9PA 1WKYA 3BIWE 3NJYA 4GZ9A 1V9U3 4JHZA 4XF1A 3ZM8A 4EWAA 1QJY2 4M00A 5DG1A 1WW5A 4NOTA 4YW6A 4CXWA 4R9CA 1JBCA 5GZGA 1ASJ3 1GLHA 3HNBM 2WFPA 3HN3A 4DEVA 3TEYA 2A6ZA 1NCRC 3I2DA 3I2FA 3WDVA 1QDOA 1PMJX 2L9LA 4CDUA 5IVVA 4LMFA 3VD9A 3O1UA 2BNNA 4Y5SA 1BMV1 1SDWA 1XNCA 2WYSA 3AMNA 4Z07A 1G9FA 1DQ6A 2JICA 4E8DA 1RTVA 4Z1VA 3CKHA 3V0BB 1CZSA 4LIUA 4PF1A 3RI8A 2I2SA 2ZABA 4ZXEA 4CDUB 4CEWA 2VMFA 5HXMA 4BZ4A 4RQPC 5A7SA 5AFEA 1CWPA 3I8TA 2VD7A 1COV3 2VY0A 2Q8CA 3WF3A 4A3XA 1XNTA 1QKQA 4ZU4A 1QJZA 2D93A 4PIXA 5I8TA 1AR92 5HCAA 2YGLA 1W3VA 2DVDA 4CDWB 1OLQA 1M06G 1QF3A 2IC1A 4J25A 2SBAA 1OVSA 4S2HA 5BNQA 3OYWA 4C1XA 4DFSA 4NR1A 1MS1A 4ZU7A 2SLIA 1ASJ1 4I0WB 2FMYA 2YFUA 5C8WA 2J1SA 1D4M2 4LBLA 2HWC1 2IXJA 5FZEA 4WVWA 5A33A 4XFIA 2FCUA 2WLPA 3HQUA 5FYIA 1NCRA 4CA9A 4Z2AA 5C3OA 1SLAA 1X8EA 2ZCWA 1QJX3 2FDIA 4YVWA 2WQ4A 2ZGMA 2Q1FA 2UY9A 2ZPXA 3W21A 3ACIA 4BXSV 5CKNA 3CDZB 4L8QA 2WRAA 4CDQB 3B3QE 1RUNA 2W95A 1C5HA 1KDKA 1XNDA 3AL6A 1PGL2 5K8SA 1ZZBA 3E6BA 5IYYA 4ONUA 1AZDA 2JDMA 3D3AA 4Z82A 3SKJE 2VOKA 4JAAA 3GGLA 2WINB 3UJQA 2PHFA 1H2KA 2BYVE 3WX5A 3KF5A 3MDPA 4CRQA 3MZHA 1H1MA 1BHGA 3T3YA 3MBWA 3T0AA 3TEZA 1PVC1 4Q1RA 5T50A 1MS4A 2PXJA 3AFGA 4BQ3A 2ZGSA 3POSA 2W68A 2Y6KA 5SV8A 3VBOA 3VBRC 5B4NA 4Q0PA 2EICA 5HV4A 1K5MC 5L9BA 3NMBA 3LIHA 2RR12 2RS31 4L97A 5CKQA 1SBEA 4Y22B 4HZFA 2JDZA 3U4SA 4AR2A 4NUBA 3PVNA 2ZGOA 5KHKA 3NKGA 1RUI2 2D6KA 4I30A 2XH6A 5J36A 1OOPC 4LK7A 4LULA 2NPIA 1MS0A 3HOBA 3MLLA 3NNFA 3H0OA 3S0MA 4XUTA 4OUSA 2TNFA 1EUTA 3NAPB 3QCWA 4CCDA 2WWUA 2XHKA 4Q0UA 4IE7A 1Q8PA 5FMOS 3WNMA 4E2QA 1VAMA 3DGTA 3BI3A 3OBZA 1YQ2A 1H2NA 2XGXA 4UOJA 4DXRA 3HIFA 2EXJA 3O1TA 2YC2A 2FD8A 1JHNA 1PX4A 1H8TB 1AVBA 1ULGA 1U5IA 5FUPA 3CJIA 3IAPA 1MEC3 1TNRA 2JEMA 4WZCA 3KT4A 3IMNA 2YC0A 3K4DA 4Y1XA 1W6PA 4QX3A 1O3RA 1DYPA 1U5ZA 5FMDA 4PI0A 5FWEA 1IKQA 5F6KA 4Y1YA 4YM3A 5FK7A 4P9GA 2Z5WA 1CAXB 2X5IB 4YVSA 2RMU3 2A7AA 2DCKA 4FP2A 2GNMA 2Z69A 1QH6A 2BOIA 1R093 2QQKA 3SEEA 1BMV2 2KR2A 4XXPA 5C6CA 1NZIA 1M4WA 1SLCA 1ZRCA 4GWNA 2JDNA 2W1SA 2CY6A 4MXVA 3JUUA 1A6CA 1Y9GA 3M70A 4MGZE 5FY1A 3U10A 2OW4A 1WLTA 1OKQA 1RUE2 2W1WA 1Q56A 1F4HA 2YHJA 4XUPA 5FZ6A 5LY2A 1NCQC 5T5LA 2ZHNA 3MLKA 2VUCA 1K5MB 5D8AB 1AXYA 5CU1A 5A7WB 5FPZA 1YFWA 1A8MA 3BB6A 3ITQA 3OBRA 4DRVA 2RS12 3A21A 3KHBA 3M3QA 4HPKA 2ZZJA 4WM8B 3IIIA 1Z78A 4LIVA 2KA3A 1SPPB 4QKDA 1UQXA 4KQ7A 5D8AA 5A7WA 5FZBA 1IG0A 2OUJA 3LA2A 5FXVA 1MVQA 4GJYA 1VBE3 1N1TA 1PNFA 3PU8A 5FV3A 5G04L 3RSJA 1CX1A 2OZ6A 3WQ1A 3U4XA 3C8XA 4UAPA 2DU0A 2J1EA 2DTWA 4N9IA 4FXGB 3VBSB 2MPFA 4HOOA 1PO21 2IFRA 1V70A 1VBC3 1K5JA 2LW8A 4V2WA 3LD8A 2VCMA 4A3ZA 2ZTNA 1UU5A 4IE4A 3GHMA 3I97A 3MUZ1 4QXKA 3WT3A 5KBFA 2AYHA 2MEV3 1CQ9A 4D7YA 1VRH1 5AVPA 1IS3A 5KC6A 1RUG1 5GKAC 4MUVA 4LR4A 1HIXA 3HD8B 3RYPA 4GH4C 3K48A 4LBNA 1I1EA 3ZFFA 3UGFA 2CGOA 3H8RA 4CU9A 4GH4A 4XE9A 1W8WA 2JDUA 1PM7A 4FPKA 4NIDA 4UW3A 4OFGA 2YYOA 3HVDA 2WN2A 1RUG2 4JC1A 3NQHA 4LHLA 3ES1A 5C8CB 1ZZ7A 4S2DA 2VOTA 2Y6GA 4TLGA 3LPFA 4E2GA 2IVJA 2YDEA 5AFBA
chains in the Genus database with same CATH topology
3EMRA 3NNFA 4NHYA 5ERLA 4ZPIA 2V4AA 5DAVA 4NHMA 3OBZA 4MHRA 3W20A 2Y33A 3OUJA 5A3UA 5LATA 4Y5TA 2HBUA 2OPWA 3HQRA 5HV0A 5DAWA 4BQYA 3KT4A 4Y5SA 4NHKA 5C5TA 4JZRA 3MGUA 2JIJA 3KT7A 5C5UA 2RDQA 5L9VA 5LA9A 2HBTA 2Y34A 5L9RA 5DAQA 5IAVA 4XABA 4J25A 3PL0A 3KT1A 3GZEA 3BVCA 3ITQA 5DAPA 4XCAA 5LBEA 4Q5OA 5EPAA 5LBFA 2FCVA 2FCUA 2JIGA 5DAXA 3HQUA 5M0TA 4XC9A 3OUIA 3W21A 5LASA 2RDNA 4BQXA 3NNMA 3GJBA 2G19A 4XAAA 5EP9A 4MHUA 3DKQA 2G1MA 4NHLA 3NNJA 2A1XA 4NHXA 5IAXA 4UWDA 4BQWA 4IW3A 4XACA 5LBCA 2FCTA 4NAOA 5LB6A 4XCBA 4ZONA 3NNLA 2RG4A 5L9BA 5HV4A 5EQUA 3OUHA 3GJAA 4KBZA 5IATA 2RDSA 5LBBA 4NMIA 2RDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMR A;  3NNF A;  4NHY A;  5ERL A;  4ZPI A;  2V4A A;  5DAV A;  4NHM A;  3OBZ A;  4MHR A;  3W20 A;  2Y33 A;  3OUJ A;  5A3U A;  5LAT A;  4Y5T A;  2HBU A;  2OPW A;  3HQR A;  5HV0 A;  5DAW A;  4BQY A;  3KT4 A;  4Y5S A;  4NHK A;  5C5T A;  4JZR A;  3MGU A;  2JIJ A;  3KT7 A;  5C5U A;  2RDQ A;  5L9V A;  5LA9 A;  2HBT A;  2Y34 A;  5L9R A;  5DAQ A;  5IAV A;  4XAB A;  4J25 A;  3PL0 A;  3KT1 A;  3GZE A;  3BVC A;  3ITQ A;  5DAP A;  4XCA A;  5LBE A;  4Q5O A;  5EPA A;  5LBF A;  2FCV A;  2FCU A;  2JIG A;  5DAX A;  3HQU A;  5M0T A;  4XC9 A;  3OUI A;  3W21 A;  5LAS A;  2RDN A;  4BQX A;  3NNM A;  3GJB A;  2G19 A;  4XAA A;  5EP9 A;  4MHU A;  3DKQ A;  2G1M A;  4NHL A;  3NNJ A;  2A1X A;  4NHX A;  5IAX A;  4UWD A;  4BQW A;  4IW3 A;  4XAC A;  5LBC A;  2FCT A;  4NAO A;  5LB6 A;  4XCB A;  4ZON A;  3NNL A;  2RG4 A;  5L9B A;  5HV4 A;  5EQU A;  3OUH A;  3GJA A;  4KBZ A;  5IAT A;  2RDS A;  5LBB A;  4NMI A;  2RDR A; 
#chains in the Genus database with same CATH topology
 4JKL A;  1QJX 2;  2CDO A;  2WDB A;  1W39 A;  3LCP A;  5ANN A;  4COU A;  3RZK A;  4V2V A;  1OBN A;  1W99 A;  2D6M A;  3BU0 A;  4AQS A;  2ES3 A;  3AL5 A;  3WG1 A;  2GN3 A;  5CG9 A;  4FTE A;  1AR8 2;  4MHR A;  5FY5 A;  4ZZ5 A;  2D3R A;  4LO6 B;  5ACA 2;  1E5R A;  2MEV 1;  3D0J A;  4Q4V 1;  1Q8O A;  4IEY A;  2XLG A;  4U36 A;  4M3C E;  3ZPY A;  5ANQ A;  1RUI 3;  3VZL A;  4XTM A;  5FCC A;  1E5I A;  2V73 A;  2WFF 3;  2VEC A;  4FOW A;  2HWF 1;  5I8S A;  3AP6 A;  2ZEZ A;  3EO6 A;  5JR7 B;  4ATF A;  3U0Z A;  5FP4 A;  1OVP A;  3F95 A;  5HCF A;  4AAX A;  1J84 A;  1W6O B;  2JG9 C;  5CB7 A;  5EWS A;  4HKL A;  2GP5 A;  1QJU 1;  1ZX5 A;  3ZKY A;  1PM4 A;  3AK0 A;  5FP9 A;  5A80 A;  2BGO A;  2ZGU A;  2V09 A;  5KHG A;  4UW6 A;  2FZ2 A;  5FY9 A;  2VZ1 A;  2YBK A;  4LKS A;  1WCK A;  4CEY C;  4QB2 A;  1HRI 2;  1N3O A;  1RUF 2;  1XB9 A;  3OPW A;  4HMZ A;  4LO4 B;  2Y6F A;  4RL7 A;  2Z79 A;  2R07 3;  4XBL A;  5DZF A;  2DBN A;  3RZZ A;  1H4H A;  2RM2 1;  3AP4 A;  1MEC 2;  4JQR A;  1FV2 A;  1PX3 A;  3LIG A;  2VBB A;  4LO5 B;  4NVP A;  4URT A;  3ZDV A;  4CPB A;  4XYX A;  5FRE A;  4NIA A;  4DUW A;  4O9G A;  4B1L A;  2ATF A;  4H7L A;  3AYD A;  4CDX C;  1A78 A;  1AL2 2;  1BKZ A;  2R1B A;  4LK6 A;  1EY2 A;  1SCS A;  1NY7 2;  1LNS A;  3VL9 A;  5FYZ A;  4HN1 A;  3GZA A;  5JAX A;  3H8O A;  4ORF A;  3BPZ A;  5JIU A;  1FI2 A;  2RS1 1;  1MZ5 A;  3UKT A;  4ZS2 A;  3K46 A;  3LF7 A;  4WM7 A;  2V4V A;  1BEV 3;  1EPW A;  1S0J A;  2WZR 3;  2R06 3;  4BB3 A;  2WBK A;  5LA2 A;  4AG4 A;  5BNO C;  3BTZ A;  2RJK A;  2K0G A;  4N43 A;  5LAS A;  1TMF 1;  2CWS A;  3M2M A;  4OI0 A;  2QJV A;  5FY0 A;  2IUW A;  1UU4 A;  3QBQ A;  4I02 A;  1GOG A;  2VMI A;  2GNB A;  2G4I A;  4WV8 A;  3BPS A;  1GBG A;  2VL4 A;  1PZ7 A;  3DXU A;  5D21 A;  1W8F A;  4C0H A;  3VBF C;  4DUV A;  1W6P B;  5A32 A;  3DL3 A;  2HWC 3;  1NYW A;  3WLU A;  3ZFE B;  5JOW A;  2FDG A;  4W4Z A;  1K3I A;  2C0Z A;  4UYB A;  3V65 A;  1GV9 A;  2QZ2 A;  2YV8 A;  3N36 A;  4JDO A;  3TNQ A;  4QQP A;  4CCJ A;  1ND3 B;  5JUV A;  2VUJ A;  2XJT A;  4OYU A;  4OHY A;  1PZ8 A;  1OQD A;  1R09 2;  1CX4 A;  5FPV A;  4EWE A;  1GFF 2;  4L2N A;  2P3I A;  5H9Q A;  1OFN A;  3ZFF C;  5C33 A;  5JXI A;  4K20 A;  2E7T A;  1UL9 A;  3Q8A A;  3WG2 A;  1DG6 A;  3K4Z A;  3P6B A;  4ZON A;  2UWC A;  4UW4 A;  5FY8 A;  2VVF A;  3VBF B;  3VBO C;  2PA7 A;  1RMU 2;  3OTF A;  3RS6 A;  3SH3 A;  4DMI A;  4FPY A;  2WS9 2;  3A0N A;  4QAW A;  4R9A A;  5FMB A;  2XJQ A;  2W0X A;  2NMO A;  3VBF A;  3AYE A;  4COV A;  3MIE A;  4KU8 A;  4MYE A;  3CJX A;  3PUA A;  4BA6 A;  3SKV A;  3PNA A;  5IK8 A;  4Y4Y A;  3MID A;  4OCT A;  1F8V A;  5I0U A;  3SHR A;  4Q1P A;  1H6X A;  1W8H A;  1RUJ 2;  4ZPI A;  5BNO A;  2RS5 1;  3ZXG A;  1HN0 A;  5T55 A;  1UD1 A;  5J09 A;  3I2G A;  4SBV A;  1Q8S A;  1ZA7 A;  3U75 A;  2OQ6 A;  4QQH A;  1KRI A;  1UOF A;  1SPP A;  2R49 A;  2RS5 2;  3ATG A;  1JYN A;  2R6Q A;  4XJA A;  3P3P A;  5LRS A;  3HJR A;  4NRO A;  1JZ5 A;  1CIY A;  1AXZ A;  1FXZ A;  3HQR A;  5FUI A;  1ENX A;  1IS6 A;  2EIE A;  1OA2 A;  2NLR A;  5ISL A;  4K8F A;  1WW6 A;  3SC7 X;  4MGT A;  3JQX A;  1SMV A;  1C8M 2;  1LKN A;  1NCQ A;  3H3U A;  4XZU G;  1ONA A;  4CEY B;  2QE3 A;  1A3K A;  2JIJ A;  2QKD A;  2XL7 A;  3OBT A;  2Q1Z B;  5JZG C;  2BTV C;  1ZZ6 A;  4AVS A;  4W6Y A;  2WII B;  4R52 A;  3POE A;  1H9P A;  2RS3 2;  2IXK A;  2WFF 2;  2EVX A;  5EIY B;  3RI9 A;  3BOW A;  2W52 A;  4YFW A;  4EV0 A;  5HCB A;  3WNX A;  2FDJ A;  4XFC A;  1D4V B;  3ZXL A;  3D5O A;  1YEW A;  1NT0 A;  5FY7 A;  1W6N B;  3VUO A;  3LGR A;  1FYU A;  5DDJ 3;  3OGJ A;  3IM0 A;  4Q8L A;  1NLS A;  1O3Q A;  1TE1 B;  2E31 A;  1JZ2 A;  1RUD 2;  4IEV A;  5FZD A;  3RYK A;  5D1I A;  3BKZ A;  1G6N A;  2V5Y A;  4LNV A;  5JMC A;  3KV5 A;  3MV1 1;  4ARY A;  2OT7 A;  1UZY A;  4LBK A;  3A7Q A;  4M0H A;  4Q4Y 2;  1ZYB A;  2BRT A;  2BPA 2;  3CEW A;  1WCD J;  2OYZ A;  3LDK A;  4NPM A;  5FZ7 A;  2WA4 A;  4CDQ A;  5A3N A;  5FKC A;  3FWE A;  3KLS A;  4XMI A;  1HV0 A;  1GP5 A;  3Q8C A;  1RUJ 3;  3NV3 A;  3ECQ A;  4HPK B;  3NAP C;  1VBA 3;  3N7J A;  1F4A A;  3RZH A;  2E33 A;  2XBO 3;  2D5F A;  2JKB A;  3RQ0 A;  3IBM A;  1GR3 A;  4XXA A;  5F3G A;  2PMW B;  5HXV A;  4XUO A;  2BGC A;  4LBJ A;  2G9Z A;  2VCB A;  2HKX A;  2JG8 C;  4QM9 A;  1N47 A;  4QX2 A;  1UZW A;  4XAC A;  1PZ9 A;  1RUF 1;  3VBO B;  4AI9 A;  1JW6 A;  4JTN A;  1GZ9 A;  2DUP A;  1UY4 A;  1D7P M;  2JDP A;  1QXP A;  3WUD A;  4R4X A;  1UZV A;  5K7P A;  2Z4F A;  2JDH A;  3RWN A;  1W9F A;  1AR9 1;  2C26 A;  3GF6 A;  3H8X A;  3S7I A;  3AXD A;  1KGY A;  2WNV A;  4RHV 3;  3ZSK A;  3WG3 A;  1O6U A;  3A4U A;  1W90 A;  2PEL A;  5FMC A;  1QH7 A;  5FPL A;  2AC1 A;  1JZ4 A;  2JG9 A;  3MW4 A;  5F3I A;  2A6V A;  1HRV 2;  3EJK A;  3PJQ A;  3W59 A;  2DDU A;  1SLB A;  1VBB 3;  2Y6L A;  3EYP A;  1LU2 A;  1JYI A;  1LOB A;  1F5J A;  4LHN A;  5FUN A;  4HFS A;  4FQZ A;  3BCW A;  4B4Q A;  3WCS A;  4PDW A;  2XKO A;  4Q4X 3;  1BYH A;  3DPR C;  1C3H A;  3RZL A;  3H50 A;  2NM1 A;  2VXJ A;  1VRB A;  1PVC 3;  1YQ6 A;  4P9L A;  1WMF A;  1BVV A;  5D8A C;  1G9B A;  1PK6 C;  1YFU A;  3FUO A;  4YZ3 A;  2X09 A;  2PAE A;  4TSV A;  5DPN A;  3OEA A;  1Q3E A;  5FPU A;  1JTZ X;  2AUY A;  1DGR A;  4Y3O A;  5ABJ B;  2VGD A;  1Y9Q A;  1RIR A;  1CAW A;  1IG3 A;  1OOP A;  1RMU 1;  2HWB 1;  1JN2 P;  3IT8 A;  4NPR A;  1W9T A;  2VMG A;  2WS9 1;  3OGG A;  1SBD A;  2O8Q A;  2YUE A;  3C2U A;  3WR0 A;  4COZ A;  2BDR A;  2ARE A;  2BFU L;  5FP3 A;  3TAY A;  1RMU 3;  1LEN A;  4CXY A;  1F31 A;  1LOD A;  3RFR A;  1LOF C;  2P17 A;  3GDB A;  3UNP A;  2A5Z A;  2YPD A;  1FNZ A;  4MVT A;  4GKY A;  1XBF A;  1IKP A;  2Y34 A;  3N9L A;  1PO2 3;  3GAL A;  2ZAA A;  1JUH A;  2WSU A;  1ZBA 3;  2QVS B;  5KWR A;  2QFE A;  3H42 B;  2JEC A;  1NAE A;  1K45 A;  4CDQ C;  4A44 A;  4CP1 A;  3MF9 A;  3PVO A;  4ZY9 A;  4FAG A;  3K2O A;  1GP6 A;  1YNA A;  4CDU C;  2J1R A;  2Y26 A;  3U07 A;  2CDP A;  4X6Q B;  2JDY A;  5BY5 A;  1H1A A;  1AYN 2;  4QGN A;  2B42 B;  1QU0 A;  5DN2 A;  1XU2 A;  1UCX A;  5FOB B;  5CEH A;  2ZGL A;  2O14 A;  3MHZ A;  4UF0 B;  2HJI A;  5M0T A;  3N3H A;  3AXE A;  3LEI A;  2XJV A;  2WO2 A;  1P8J A;  3G6J B;  1FX5 A;  1IPS A;  1I3H A;  4RGG A;  2CAV A;  1XYP A;  2KM2 A;  3AMH A;  3BU7 A;  4YG0 A;  4LE4 A;  5FZC A;  1UKG A;  4H55 A;  3PUQ A;  1E57 A;  3AZZ A;  5EYY A;  4FAH A;  5JSR A;  5IVC A;  2E6V A;  4NHL A;  2DCT A;  4N7U A;  1S2E A;  2LTN A;  4O9E A;  4CSW A;  3DV8 A;  4E4D X;  1O4Y A;  5C4W C;  3M8L A;  1U0A A;  3I49 A;  1YWK A;  3ZIW A;  5LK5 A;  1WCU A;  2DCZ A;  3BOD A;  4GXL A;  1LCL A;  4MOA A;  2EAK A;  4U2A A;  1R1A 2;  3VV1 A;  1FPN 3;  1BK1 A;  3QH6 A;  5J98 B;  1B35 A;  1JMU B;  1PIV 2;  5F5I A;  3T2Q A;  1DLL A;  1GZC A;  1G7Y A;  1VMJ A;  2OA2 A;  3PHM A;  5EQU A;  4TTG A;  4KBZ A;  2WZR 1;  1N3P A;  4YYO A;  4XDO A;  5CFC A;  4AFD A;  2HWF 2;  4OUM A;  5LBB A;  3DCQ A;  2GDF A;  1GP4 A;  2WWJ A;  4AVA A;  5F5C A;  4YM0 A;  3WD5 A;  5IK7 A;  3E5X A;  1HLC A;  4Y4R A;  3Q9O A;  4IE6 A;  4OZO A;  1UYZ A;  1AR8 1;  3CJI C;  3IPV A;  3INA A;  3JB4 C;  1DLC A;  3AJZ A;  4MO3 M;  3GHN A;  1RUD 3;  1WUV A;  1LR5 A;  2FBE A;  4QT6 A;  2A6W A;  3J4U H;  3VB9 A;  3WDX A;  4AVC A;  1NX9 A;  1HRV 1;  1E5S A;  2ET1 A;  3PTY A;  3CIH A;  5A33 B;  3CZU A;  1A34 A;  1ULC A;  1GYK A;  1O59 A;  3R0R A;  1W04 A;  4NRQ A;  3PJY A;  1AR8 3;  1C5I A;  2LUW A;  1HQL A;  2Y33 A;  2A3W A;  3I3D A;  1FAT A;  1VBB 2;  3U37 A;  1GQH A;  4DY5 A;  3C7F A;  2WAB A;  4F7Z A;  2R32 A;  5CVR A;  4MGK E;  1Q5O A;  4IL7 A;  4M4P A;  4PBO A;  2XQX A;  5FBZ A;  4Y5T A;  3ZVX A;  3EQE A;  1GZW A;  2CWM A;  2P5B A;  3MIH A;  2D44 A;  1SZB A;  3VKL A;  5IVB A;  2WAA A;  2FMD A;  1UX6 A;  2D43 A;  2J7M A;  4PQQ A;  3ROU A;  3H3L A;  1IPK A;  1RIN A;  3ZN4 A;  5CNA A;  3HT2 A;  4BXF A;  5C5T A;  1B35 C;  2HWF 3;  3F2Z A;  4AEJ A;  2GC0 A;  4IEP A;  4MGI E;  4N7I A;  5FOJ B;  1PGL 1;  4QB1 A;  4XJZ A;  2DBI A;  1OUS A;  3GM8 A;  3VZM A;  3AP7 A;  3CMG A;  5J7M A;  4KGQ A;  2G9F A;  4M0N A;  1EV1 3;  1DGW A;  4M4R A;  4XW3 A;  1J83 A;  1W8O A;  3VDC A;  1AR7 1;  3L2Y A;  1ZZ8 A;  5LRR A;  4FO9 A;  3B9I A;  1D2S A;  2PAM A;  1KD7 A;  1VBB 1;  4WVV A;  5FPA A;  3SQO A;  3NJV A;  2KD7 A;  3PL0 A;  1XYN A;  1LED A;  1V6M A;  3OPZ A;  4DRR A;  5A3L A;  3GZE A;  3AP9 A;  4NWW A;  2MNG A;  5A1A A;  5FY4 A;  5H9R A;  5DAP A;  1HX6 A;  4ET7 A;  5I8Y A;  4JGZ B;  1VBC 2;  1MS8 A;  2ZAH A;  4OMC A;  2UY8 A;  4Q0S A;  4Q4X 2;  1JU3 A;  5LBF A;  1VAV A;  2XUM A;  1AJK A;  3GZU C;  5BUV A;  1PO1 1;  1KIT A;  4XIK A;  1BZW A;  2VQ0 A;  1OHF A;  4IEU A;  1RIT A;  2J1T A;  2EF6 A;  4YGD A;  2WNO A;  4FFI A;  4A6O A;  2O8O A;  2RV9 A;  4AWD A;  4QKF A;  5A6Z A;  5LA0 A;  4XDQ A;  3KB5 A;  1UNB A;  2W47 A;  4N90 A;  2ZAC A;  3LFM A;  1UYY A;  3FMG A;  4LHS A;  4BQX A;  4Z2W A;  4IET A;  4JV4 A;  4LA2 A;  2P2K A;  1QXR A;  4AFM A;  5K9Y A;  3DKQ A;  1JOJ A;  4HSL A;  5FXZ A;  3ACF A;  2ORZ A;  3POY A;  3IIA A;  4K9S A;  1TMF 2;  1W6N A;  3JBG 1;  5FZL A;  5A32 B;  5DMY A;  1Z7S 1;  2QBX A;  1RYY A;  2W5F A;  4IGP A;  3VDA A;  5EJ3 A;  3LDB A;  1KJL A;  3U11 A;  4BOW A;  3DEC A;  3JD7 3;  2VJX A;  3PDQ A;  4D7S A;  2P3Y A;  4LHK A;  4ZHN A;  4BQW A;  4IW3 A;  4XAE A;  5AC9 3;  1DGW X;  4HBN A;  5GLT A;  3J7H A;  3ORJ A;  2CAU A;  3ALQ A;  3LA3 A;  2ZX4 A;  4CP0 A;  1W0O A;  3H7Y A;  2R07 2;  4A4A A;  2RJ2 A;  1O3S A;  1YCI A;  4D8M A;  3QOP A;  1W0P A;  2W87 A;  4LXL A;  2QNK A;  2GND A;  2Z2S B;  1AYM 1;  4RQP A;  5KXE A;  2BBV A;  3E5U A;  5IAT A;  1DZQ A;  4C91 A;  3TEX A;  2ADD A;  3A0K A;  4YM1 A;  2WO3 A;  2VTX J;  2VZP A;  2WN3 A;  1QQP 3;  3O0W A;  2QUO A;  2ETE A;  1ODM A;  3PIJ A;  5CZK A;  2YB7 A;  1V6K A;  1IQD C;  5JMO A;  4CUB A;  5D2A A;  2R06 2;  4N9H A;  4C1W A;  4XMA A;  1VLN A;  4ES9 A;  5I0D A;  2Q30 A;  2TEP A;  3NJZ A;  4B7E A;  4N43 C;  2BV4 A;  3R05 A;  4IEX A;  1NQD A;  1I6X A;  3FX3 A;  4CUC A;  5FAX A;  2D6P A;  3NV4 A;  5FP7 A;  1EAH 2;  4HL0 A;  4R8H A;  1AR6 1;  1S4C A;  1H8V A;  3IDB B;  1OLR A;  1NQJ A;  1WLD A;  3SXW A;  2XDV A;  2YC4 A;  2NQY A;  4MZU A;  4JKK A;  4QQ2 A;  1ZNP A;  4COY A;  4QPG A;  4Q4V 2;  4YW5 A;  4YPJ A;  1SDD B;  4A45 A;  3DN7 A;  3MFA A;  4NIG A;  2XWJ B;  1RHI 1;  2EXK A;  3M3I A;  3GBG A;  5KXB A;  1X82 A;  2VMH A;  5A3O A;  4JZR A;  4DXZ A;  5FKB A;  4QPG B;  3RZJ A;  1WW4 A;  5FMO L;  2JE8 A;  2RHP A;  4CEY A;  2GC3 A;  1I5Z A;  1V6O A;  1NLR A;  1GQG A;  2B46 X;  4K21 A;  1NKG A;  1POV 1;  1ZVF A;  1X50 A;  5LA9 A;  3ST7 A;  3LFI A;  2ZMK A;  1W6M A;  3K75 B;  2BOJ A;  4XAB A;  1RUF 3;  1AYM 2;  4NO4 A;  4GH4 B;  4UFH A;  1N1V A;  4YW4 A;  4DNY A;  5C7G A;  2XQR A;  4KWL A;  4Q4W 3;  1O5U A;  2XBO 2;  5C3R A;  2GME A;  1UYX A;  4FTS A;  1ULF A;  5IW0 A;  4BU2 A;  1KS4 A;  4P00 B;  1UWW A;  4KI5 M;  1GU3 A;  3I59 A;  4KGG A;  1WCS A;  4RHV 1;  3VGI A;  3PME A;  3POI A;  4HSJ A;  5FZ3 A;  1Z7S 3;  4HXC A;  3ZOI A;  1IS4 A;  1WLC A;  1H4G A;  3PUH A;  3OF1 A;  3DUI A;  4FXK B;  1CIW A;  2P6C A;  2P37 A;  3J7N A;  4XC9 A;  3HEI A;  2VZO A;  4CP2 A;  3MIF A;  1UY2 A;  2D6O X;  5CFD C;  4PLO A;  2D98 A;  3VBS C;  1NLQ A;  2Z42 A;  1KS5 A;  4CE8 A;  5L7O B;  5LEK A;  5ACA 3;  1FT9 A;  4XQ4 A;  1V0A A;  3APB A;  3OEB A;  1QJX 1;  1OH3 A;  3KVA A;  1ZBE 2;  1ZA4 A;  4H14 A;  4EN7 B;  5FP8 A;  4AVB A;  4GAZ A;  1C8N A;  2YU1 A;  4BHP A;  3ENR A;  4PLN A;  4EN0 A;  1W9S A;  3WP6 A;  5F5Q A;  2RS1 3;  1FPN 2;  3D8C A;  3GCW A;  1LOF A;  2CU5 A;  4GB3 3;  3S7E A;  4PCR A;  2V5D A;  5FZ8 A;  1SLI A;  1KJR A;  2ZX2 A;  2XR4 A;  5BNO B;  5FZK A;  1HB4 A;  1QOT A;  2Y6J A;  2VM9 A;  5CBL A;  1ENQ A;  4MAD A;  4NAO A;  4XFG A;  2BW8 A;  3OY8 A;  4FCA A;  5T5J A;  3UT0 A;  3VBR A;  4AOC A;  2QQL A;  3NRU A;  4LT5 A;  4AXO A;  1YO8 A;  1OA3 A;  1R08 1;  3GJA A;  1W9Y A;  5BNN C;  2HLE A;  2Y60 A;  5EYX A;  3QLQ A;  2ZGP A;  1AX2 A;  2OS2 A;  2WAO A;  2HWD 2;  4N53 B;  5IK5 A;  1J1T A;  2LRP A;  3E97 A;  4CUA A;  4EE2 A;  2FQP A;  4BJ0 A;  1OD3 A;  1Z0H A;  3THP A;  3WF4 A;  2W39 A;  2H6B A;  1RVF 1;  1VAK A;  2F17 A;  3OOX A;  1DZT A;  5ERL A;  4IV1 C;  4IER A;  5JI7 A;  1V6J A;  3MYX A;  1GAN A;  5F3E A;  1DQ5 A;  2CV6 A;  4A6S A;  1C57 A;  1TQ5 A;  3USU B;  4BIF A;  1G8W A;  5BNN B;  1W9W A;  5KHJ A;  4WM7 B;  4Y20 B;  2XLA A;  4Q4Y 3;  1YQ5 A;  4JKM A;  3UET A;  3W20 A;  3H8U A;  5FZG A;  3T08 A;  2VZT A;  5FWJ A;  4DOU A;  1LHU A;  3PU3 A;  4KU7 A;  1SHW B;  3CL1 A;  4K8R B;  2WNV C;  1TNF A;  3ZYH A;  1URX A;  2CHH A;  4FFG A;  5F5A A;  3N9N A;  3MPP G;  1CJP A;  1SEF A;  4N8M A;  5GLV A;  1R08 3;  1Z7S 2;  4XJW A;  4YZ1 A;  3O1V A;  2F4P A;  4COW A;  2XG3 A;  4QGL A;  4YG6 A;  4RGA A;  2UU8 A;  1VB2 A;  1J3P A;  1SFY A;  1AYN 1;  2D3P A;  3D0S A;  4NHK A;  3WW2 A;  4W6W A;  5FYB A;  1H1I A;  4FFF A;  2ERF A;  2LS6 A;  2WT1 A;  1G9A A;  3KZ4 C;  3ZPO A;  2IWG B;  4E4S A;  1SQ4 A;  3WQB A;  4MLO A;  4ASL A;  2QQJ A;  3ZSE A;  2R04 3;  4BK4 A;  3NJX A;  4XOG A;  2B8M A;  2XUE A;  4CXX A;  1BCX A;  5FYV A;  2OZJ A;  3VBU A;  1JYX A;  1CZV A;  2A6X A;  4XQW A;  5F6L B;  5L73 A;  3AP5 A;  4AQ6 A;  3BTY A;  1S55 A;  2YZ4 A;  2BP6 A;  3T09 A;  3WW1 A;  1UMI A;  1UZZ A;  1S0G A;  5FLH A;  3TYJ A;  1ULD A;  4I2O A;  5GJ6 A;  2BVV A;  1LOG A;  1UYP A;  5IVE A;  3ILR A;  1CAV A;  2XJP A;  2PYT A;  3OGS A;  4KWJ A;  2K2S A;  5LBE A;  2WA3 A;  5FYU A;  2E9Q A;  4NWV A;  4Q5O A;  5E16 A;  5C71 A;  1AF9 A;  2AEY A;  1W2T A;  1RGS A;  1V9U 1;  4YVS B;  3ZSL A;  1J3Q A;  3KS7 A;  4L92 A;  4RFT 0;  4E8C A;  3I7D A;  4BWO A;  3UGG A;  1YC6 1;  5KXD A;  5DDJ 1;  2FDF A;  2WNU A;  4CP9 B;  5FO7 B;  4Z92 B;  5L19 A;  1H0B A;  3LEG A;  1F15 A;  4CCK A;  4LEJ A;  4L0P A;  1J58 A;  4XAA A;  1ZRI A;  1ZM1 A;  4K3U A;  5CAZ A;  4CDX A;  1J59 A;  2DUR A;  4B3N A;  2YRO A;  4Q26 A;  3NNJ A;  2VR4 A;  1LOA A;  3ZN6 A;  5LEJ A;  4UF0 A;  1W28 A;  1AUY A;  3ZYP A;  1WME A;  2BQP A;  1WBL A;  2VCA A;  1X8M A;  4KBB A;  3LQC A;  2E51 A;  3E5Q A;  4C0B A;  4UWD A;  3WG4 A;  4LOT A;  3KMH A;  5IHR A;  2VXR A;  3VL8 A;  5CA6 A;  4DY3 A;  1EPZ A;  3M3O A;  1W03 A;  2CYF A;  3TRS B;  3V0B A;  1BJQ A;  3WW4 A;  2WZ8 A;  4O61 A;  1MEC 1;  1RXF A;  2DTY A;  1FOD 3;  3NL1 A;  1MQT B;  4OQ9 A;  2CGP A;  2XJU A;  4GAL A;  3ILN A;  4AED B;  1TME 1;  3ACH A;  2N7G A;  4XQD A;  2RDS A;  2JE9 A;  3WNN A;  1WGP A;  3POG A;  3PMS A;  3A22 A;  4XUQ A;  1WW7 A;  5HI0 A;  4X6R B;  2QQV A;  1C8M 3;  1XE7 A;  3C7G A;  3OD4 A;  4M3C A;  4KWU A;  2W92 A;  4UBG A;  5A7N A;  4TZD A;  4HLT A;  3LEM A;  3NWK A;  1VBD 3;  4BLI A;  4Q4W 1;  5CAD A;  1VB4 A;  5KHI A;  4QXH A;  3DYO A;  3KQR A;  3ZR5 A;  5E8A A;  2V4A A;  4AI0 A;  3DXT A;  4NHM A;  1NOV A;  3POF A;  4PIY A;  3CO2 A;  5FZH A;  1J1L A;  1R1A 1;  3LOB A;  1LGB A;  3B9C A;  1CAX A;  4AHX A;  3VBH A;  4CCL A;  4QHZ A;  4HK9 A;  4JVA A;  2GH2 A;  1S0B A;  4HVR A;  2HH9 A;  4JGZ C;  1W06 A;  5DXD A;  1RUH 1;  2AEZ A;  1HQW A;  1QEX A;  2PQS A;  3OYW B;  4FOY A;  4AHW A;  3LSE A;  3HBZ A;  3OCP A;  4R9B A;  4CU8 A;  4MX3 A;  5T52 A;  3HR9 A;  1PIV 3;  1X7N A;  2PHL A;  3MGU A;  3S6P A;  1AL2 3;  1POV 0;  2A6Y A;  3VBR B;  1VP6 A;  1YJL A;  2ZA9 A;  4DUX A;  5BYN A;  4Q2F A;  4H7M A;  3WUC A;  1OSG A;  2K46 A;  4WM8 A;  3VKN A;  3WSO A;  2R0F A;  3BOP A;  4ATE A;  2IZW A;  4ZS3 A;  5JVV A;  2E53 A;  1QXJ A;  2I74 A;  4LE3 A;  3ZYJ B;  4YLZ A;  1VBC 1;  3NV1 A;  1I9R A;  2LRO A;  1XE8 A;  4CCC A;  4N53 A;  5GM0 A;  5JSP A;  1DFQ A;  4IQP A;  3GNE A;  2QDN A;  4LA3 A;  2VQA A;  2XB6 C;  5E89 A;  2UYA A;  1APN A;  2Q8E A;  3BIE A;  1DYO A;  2WNV B;  3AYC A;  1J3R A;  1QJY 1;  4MSV A;  4HK8 A;  4LOR A;  4D6R A;  1RL3 A;  4UW5 A;  3SCF A;  3DPR A;  3AMP A;  3IZO A;  4I01 A;  5EPA A;  2VC9 A;  2HWE 1;  3MUY 1;  1U5Y A;  1QJU 2;  1UOG A;  4CEW B;  2ID4 A;  1O4T A;  3ZN5 A;  4DXT A;  3V56 A;  1GIC A;  1NY7 1;  5I93 A;  2B4K A;  1YIP A;  3B7M A;  4OI4 A;  1D2Q A;  3LDR A;  2IFW A;  2GP3 A;  2H0V A;  4JHT A;  3K3O A;  2WZR 2;  1KFU L;  1PO1 2;  3NNM A;  1UO9 A;  3AC0 A;  4AYU A;  4BDV B;  3V0A B;  3T1M A;  1VBE 1;  1XSQ A;  2WS9 3;  4LUM A;  1V6N A;  4OVE A;  3MW2 A;  4MHU A;  5A6X A;  3VZK A;  2G1M A;  1AR7 3;  4QWN A;  2DWR A;  1AR6 3;  1OPM A;  4FOQ A;  1W0N A;  5EV7 A;  1COV 1;  5LK7 B;  2QQM A;  4O65 A;  2AR6 A;  3AX4 A;  3UL2 A;  3URF A;  1AX0 A;  2QQI A;  1SBF A;  3AKS A;  1DZR A;  3Q8B A;  5GZD A;  5B4X A;  2ADE A;  2JG8 A;  4XF0 A;  5AC9 2;  1H8T A;  2WO7 A;  2ZKL A;  4YAR A;  4XFA A;  2D40 A;  2R04 2;  3J8F 2;  3PTR B;  4YVW B;  4ZU5 A;  4BQ4 A;  1UPI A;  3VZJ A;  3IAQ A;  4QQL A;  1UX7 A;  2DFB A;  3JD7 1;  1GWL A;  2VZU A;  4NPL A;  3VHO A;  4YVS C;  5I0T A;  1RUH 3;  3NNL A;  5L7O A;  1WD4 A;  3GCX A;  2Q4S A;  5IWF A;  5A1L A;  1RB8 G;  2QQW A;  1ACC A;  2J1U A;  5A7Q A;  1RHI 2;  4MV2 A;  1IZ3 A;  1GMM A;  2ZZQ A;  5BV6 A;  1W2A X;  2XBO 1;  4EZH A;  4NJ4 A;  5IT6 A;  1UMH A;  1SLT A;  2VNV A;  2VOX A;  1VMF A;  2VW1 A;  3D6E A;  4M01 A;  4ARX A;  1JZ7 A;  3THC A;  4LUK A;  2VOV A;  1YI9 A;  3J9S A;  2RS5 3;  2ZHM A;  3KSC A;  4HG6 B;  2DCJ A;  4P5H A;  4XHX A;  4YVW C;  1EAH 1;  2PQQ A;  1O5L A;  5FJK A;  3VDD A;  5F1R A;  2HWE 2;  1HQN A;  4KMQ A;  3VZO A;  1AYN 3;  1IOA A;  1REE A;  2WNU B;  4LKF A;  5DAV A;  5DDJ 2;  5APA A;  2K9Z A;  4OHZ A;  5C9A B;  1CZT A;  3HAG A;  1YYN A;  1EAH 3;  3BAL A;  4QMA A;  4FPL A;  4B7K A;  5A6Q A;  2B9V A;  5LA1 A;  5GZF A;  3WOG A;  4CDX B;  4LQR A;  5F9T A;  3OSD A;  2BEO A;  2B9U A;  4BME A;  1O7F A;  1VBE 2;  3GYD A;  5DAB A;  3SIS A;  1YI7 A;  2W94 A;  1MZ6 A;  3IMM A;  3W5N A;  4P9X A;  4ZZ8 A;  4DO0 A;  3ES4 A;  3LB9 A;  1V6I A;  4B29 A;  5C3S A;  3BN6 A;  3WVJ A;  2QTW B;  4FFH A;  4XJU A;  4XPV A;  4CVU A;  2XPJ A;  4BQ1 A;  2BUK A;  5JZG A;  1LGC A;  1UKR A;  4Q4Y 1;  4D69 A;  4LPL A;  2WLQ A;  4LOS A;  4DIN B;  3J7M A;  2FZ1 A;  1C28 A;  1JH5 A;  1CN1 A;  5FZO A;  5JR2 A;  1BK0 A;  4Y1V A;  2ZML A;  3FLR A;  3WXP A;  4C90 A;  2PAK A;  4MET A;  1PO2 2;  3ZXE A;  4IEZ A;  1HW5 A;  2RE9 A;  2YU2 A;  5IAV A;  1DCS A;  1W2N A;  5J48 A;  1YLL A;  1CES A;  1W8T A;  4UFI A;  3B94 A;  5FZ1 A;  3KVB A;  3ABZ A;  1ALY A;  4FPE A;  1HB3 A;  3U78 A;  1UU6 A;  1LES A;  3JBG 2;  4GUL A;  1RUD 1;  4NRM A;  3ZXF A;  3AVR A;  3LWC A;  1NXM A;  1PVC 2;  2IXH A;  2VW0 A;  3J26 N;  1YIF A;  3M3C A;  1VBA 2;  3MF6 A;  3T1L A;  1CON A;  3ZFF B;  3ZXD A;  4EYU A;  3WCR A;  4JDN A;  1E5H A;  1MQT A;  1QWR A;  3WHU A;  1Q43 A;  1OUR A;  3POW A;  4A41 A;  4AI3 A;  1OXC A;  2GMM A;  3AJY A;  1IHM A;  2ORX A;  2ARC A;  3ZFE A;  5C8C A;  3IDA A;  4LBO A;  3VBU B;  3ZXK A;  1NUK A;  5FBJ A;  4F8A A;  5ABJ A;  5FQ0 B;  1ZRR A;  2VVD A;  2RDN A;  4RQP B;  1Y3T A;  1SFN A;  4X8N A;  1OC1 A;  3HBK A;  3JXS A;  2CL2 A;  3K4A A;  1FPN 1;  4XJ8 A;  2XJS A;  1RVF 2;  4OMD A;  1QJU 3;  5F2S A;  2WJS A;  4NE9 A;  1HRI 1;  2QQU A;  4JRA A;  2PLV 3;  2XKP A;  2ENR A;  5I0S A;  2HWE 3;  4SLI A;  1RUH 2;  3EHK A;  2LM3 A;  1QHD A;  2VZV A;  1UOB A;  3AYA A;  2XVK A;  4AAP A;  4QD2 A;  5BNP A;  3VZN A;  4TLF A;  4CU7 A;  2ZHL A;  1WWY A;  3CF6 E;  5EFU A;  1DDL A;  4LBQ A;  4P9J A;  4BPZ A;  1UY1 A;  5FR3 A;  5FDB A;  4LO7 A;  5EJZ B;  3NV2 A;  2FCT A;  2BFU S;  2Y0I A;  5FZM A;  5GZC A;  1ZRF A;  1XNA A;  4CEW C;  1G9C A;  4MG2 A;  1HN1 A;  3EBR A;  3BTX A;  1DQ1 A;  3CLP A;  3O14 A;  3GZT B;  2CSG A;  3KCC A;  5FPB A;  5K0U A;  5B2G B;  5FLI A;  5H9S A;  1R09 1;  3PIG A;  1GWK A;  1JYW A;  4YGC A;  3AB0 A;  1XOY A;  2ZEW A;  1OUX A;  2A73 B;  2R16 A;  2O1Q A;  3TWI A;  3ZN6 B;  2E63 A;  3RRD A;  4AGV A;  2ILM A;  2XWB B;  3LEK A;  2BER A;  1SFP A;  4Y26 A;  1S2B A;  1NE4 A;  3I2H A;  1Y43 B;  4D0Q A;  1G9D A;  3SH5 A;  4AFA A;  5BNP C;  4QXB A;  3EMR A;  1XRU A;  4NHY A;  1MS5 A;  1WZX A;  5FTT C;  5JI9 A;  5CFD B;  1NZC A;  1LOE A;  3S57 A;  1PMH X;  2P34 A;  2VBD A;  4EZ4 A;  2DVG A;  2GMP A;  2X53 S;  3WV6 A;  2HEY F;  2XON A;  2ZBJ A;  4QHO A;  1UIK A;  3ZXJ A;  5FIX A;  4Z8B A;  5BPX A;  5JPM B;  1HB1 A;  1T6B X;  1PO1 3;  2C9K A;  4QM8 A;  3B5L B;  2Y38 A;  1ND2 B;  4LJH A;  5A3U A;  3RDI A;  3H3Z A;  3FE5 A;  3ZYF A;  4QGM A;  1QQP 2;  5KHH A;  4AHZ A;  1FMD 1;  2IXL A;  3USS A;  2WL1 A;  5DAW A;  1TME 3;  2X5I C;  1HXS 1;  4UXA A;  3USU A;  4LLO A;  3WQ0 A;  2C24 A;  4BQ5 A;  2BWA A;  1UW8 A;  3CHX A;  3B93 A;  3WZ1 A;  2IXI A;  2EA7 A;  4XFF A;  1ODN A;  2WC2 A;  1WBF A;  4FQ4 A;  3ZDS A;  2VPV A;  4A2U A;  2A75 A;  2ZXQ A;  2YG0 A;  3V0A A;  4D94 A;  4RR3 C;  5E6H A;  3TB0 A;  5JDB A;  3AFK A;  3L2H A;  4EN9 B;  2JD4 A;  3CJI B;  4OQ8 A;  1O4Z A;  4AZZ A;  4JGY B;  4AEM A;  1KDM A;  4FP3 A;  3WF1 A;  5C3P A;  5KC5 A;  5JSO A;  5JIA A;  1OH4 A;  2OKX A;  1PGW 2;  3WP4 A;  4PIZ A;  1X36 A;  3MFC A;  4Q29 A;  1LU1 A;  1N1S A;  2JEN A;  2WZP P;  2ZGR A;  4OUL A;  4XVH A;  1RUC 1;  3AKT A;  3R4D B;  4WBB A;  4BLJ A;  5KXC A;  4NN0 A;  1GNH A;  4IV1 B;  4KNC A;  4QXC A;  1VRH 2;  4RSU A;  1LHN A;  2GU9 A;  3LZZ A;  4QU2 A;  1HXS 2;  3T2T A;  4AQ2 A;  1GWM A;  2VE1 A;  4CU6 A;  5F8P A;  2PFW A;  1UY0 A;  3KGZ A;  3T4H B;  2GZW A;  2GNT A;  3MIG A;  4CCN A;  1CAU B;  3IN9 A;  1VMH A;  2AZ5 A;  2MHF A;  2BGP A;  4GQ7 A;  4BIO A;  3VD5 A;  4P5Y A;  1CGP A;  3O1R A;  1CAU A;  1MR5 A;  1US3 A;  4OHV A;  1OF4 A;  2VZ3 A;  1B09 A;  3TN9 3;  1OQE A;  1PVX A;  1YUD A;  3N35 A;  3MLJ A;  3NVC A;  3KGL A;  5HBA A;  3B69 A;  5FLJ A;  3ACG A;  2WR9 A;  3R4S A;  4HKO A;  3RZG A;  4OI1 A;  4GIQ A;  1ZZC A;  5JZG B;  4XEZ A;  3RGB A;  2CGN A;  4N53 C;  3LE0 A;  4PQ9 A;  1UOJ A;  1O8P A;  1C1F A;  4RGK A;  1AR9 3;  1T2X A;  5ACA 1;  5IFT A;  5JWP A;  3AMM A;  3I3B A;  2ZJC A;  3QAC A;  3SCH A;  3CBN A;  1UXZ A;  4P9Y A;  3AVS A;  5E88 A;  4AED A;  4YFZ A;  3RPQ A;  4ERO A;  1FOD 2;  4GWJ A;  5IVF A;  5FZA A;  3T4V A;  1V00 A;  4XIL A;  3VBU C;  3HMY A;  1NG0 A;  3VHP A;  1Q8Q A;  2ARX A;  1ZRD A;  4XET A;  1POV 3;  2XML A;  1QOO A;  2YPJ A;  1PIV 1;  1IS5 A;  3TNP B;  5DUX A;  4FVV A;  4LO8 A;  4N43 B;  4YW1 A;  3AKQ A;  1ND3 C;  4Y1Z A;  2B39 A;  1YRZ A;  1LEM A;  3WDT A;  2X5I A;  4YSF A;  1H9W A;  1VE0 A;  2WKK A;  2VMD A;  1OPO A;  3E6D A;  3I59 B;  4BM8 A;  1OD5 A;  1SAC A;  1UPS A;  4YGB A;  2BNO A;  2ET7 A;  1QNY A;  3I2K A;  4XBN A;  3ETP A;  1VBD 1;  2PLV 1;  2EAL A;  4QDR A;  2PHX A;  5FZI A;  3MIC A;  4YM2 A;  4GMP 3;  4YW3 A;  3KD4 A;  3DEM A;  3I54 A;  1S0I A;  3SMH A;  3VDB A;  4S2G A;  5EZW A;  4ASK A;  1CJD A;  1DQ0 A;  4J1W A;  2C9A A;  4Q4X 1;  3IWZ A;  4J6G A;  3T2P A;  2R7E B;  5SV5 A;  4IV3 C;  4ISQ A;  2BU9 A;  2O0O A;  4ITC A;  4IEW A;  5FYM A;  4DPN A;  2W1U A;  3WY6 A;  1Y4W A;  5FYS A;  2EXH A;  1LAJ A;  4FPC A;  1RJ7 A;  4QX7 A;  1STM A;  1D4M 3;  3DF0 A;  1WMX A;  3IDE A;  4QPW A;  1XU1 A;  4JGY C;  5I91 A;  3N7M A;  3VD7 A;  1RED A;  3IPV B;  4UFK A;  2R0H A;  1GOF A;  3KT7 A;  4LIT A;  1W2O A;  4HKW A;  4JCK A;  5BNP B;  1WD3 A;  3UKV A;  4LBQ D;  3PUI A;  4P9I A;  2JDA A;  4B4R A;  1L7Q A;  1ULP A;  2IXC A;  5DAQ A;  1S1A A;  1NA1 A;  1LRH A;  2D3S A;  2MEV 2;  4PF5 A;  5T5O A;  3O1M A;  1EP0 A;  2W1Q A;  4RS5 B;  5FZ9 A;  3RNS A;  1JUI A;  1S0D A;  4AQT A;  1OI6 A;  2QQP A;  2H6C A;  2RMU 2;  2RM2 3;  1W3X A;  5GAL A;  1KXG A;  2WQ8 A;  4E2S A;  2JX9 A;  5DQ0 A;  1YHF A;  2FCV A;  2JIG A;  2VUA A;  2VZQ A;  2JG9 B;  4NII A;  3WEZ A;  2VZS A;  4PJY A;  3W5M A;  4JGZ A;  3WDU A;  4OI2 A;  4C8D A;  1AL0 G;  3FC0 A;  1O91 A;  3JU9 A;  5FXX A;  1L7L A;  1LHO A;  3SIT A;  3VBS A;  1H6Y A;  5JLV A;  2CTV A;  5CFD A;  1HXS 3;  5CIS A;  4DXS A;  4JRL A;  2G19 A;  1HKD A;  2DUQ A;  3FUQ A;  3MEP A;  4Y20 A;  5ABJ C;  2JDK A;  4Q8K A;  3S30 A;  1X33 A;  1DGL A;  5FZ4 A;  1ZBA 2;  1UF2 C;  2C6S A;  2XL9 A;  4KWK A;  4DEQ A;  4LBM A;  2A1X A;  1LTE A;  1NA1 C;  2DFC A;  2VQU A;  5LWB A;  2JKX A;  1EUU A;  2D97 A;  3NNG A;  5IAX A;  4RD7 A;  2C4X A;  1WCQ A;  2Y8K A;  3K3N A;  2TBV A;  4MGQ A;  4O7X A;  3ZYG A;  1ULE A;  4AL9 A;  3WF2 A;  4QDQ A;  3B02 A;  3TN9 1;  1H30 A;  1QNW A;  4XCB A;  4D6S A;  5F2W A;  5T5P A;  2BJS A;  5JXJ A;  3G7D A;  4CDW A;  1YFX A;  1O3T A;  2WSV A;  4RR3 A;  3B00 A;  3RMY A;  1BBT 3;  2R04 1;  2R06 1;  2VVE A;  5LW9 A;  3N9P A;  3OGV A;  4IXL A;  4XF4 A;  1ZRE A;  5JXH A;  1YJK A;  1UAI A;  2R1D A;  4UFM A;  2XJR A;  2VQT A;  4IV3 A;  3KM5 A;  5FXW A;  4K1Y A;  2Q1M A;  3VD3 A;  2NMN A;  5FYT A;  1POQ A;  4XUR A;  5A3T A;  3N7L A;  3SLI A;  1CAV B;  5F39 A;  1T6G C;  1CD3 G;  1KFX L;  2UWA A;  4LBQ B;  2IVI B;  2GSY A;  5IVY A;  1JOP A;  1H2M A;  3C7E A;  4Q27 A;  1PMI A;  1U5X A;  5IUQ A;  1OLM A;  2QDR A;  3OBA A;  4FPO B;  3IKW A;  4RA0 A;  2DVA A;  1JYV A;  5C9A A;  1IPJ A;  3O1P A;  2OX0 A;  4CP9 A;  4AVV A;  4DS0 A;  2DVF A;  3JCI A;  1BEV 2;  2A3X A;  1R1Z A;  3FN9 A;  3LA7 A;  2Y6H A;  3VN4 A;  3ZFG C;  5C4W B;  2HBU A;  2OPW A;  3W58 A;  3LSD A;  4JX0 A;  3BYW A;  4YZ2 A;  1SLL A;  3CZJ A;  3M3E A;  4XF3 A;  1GOH A;  3VDD C;  4CDW C;  2VOW A;  2OPK A;  5IK4 A;  2I07 B;  3WQ7 A;  4XF9 A;  3ZMN A;  5J96 B;  1COV 2;  1D0H A;  3WNO A;  3S5A A;  4J1X A;  2WT0 A;  2WO1 A;  1FNY A;  1AX1 A;  2ZX0 A;  4V1P A;  3FFZ A;  2XXZ A;  2JB4 A;  3DYM A;  3ZYI B;  3WNL A;  3KF3 A;  4Y33 A;  3ZYB A;  3WIN E;  2J1A A;  4XHB A;  1W6Q B;  1KQR A;  4L99 A;  5C3Q A;  4DB5 A;  2YBS A;  3ZFG B;  1JYT A;  3O0X A;  4Y22 A;  1GQP A;  5JOY A;  4UT5 A;  1ZBE 1;  1JU4 A;  2E7Q A;  5A7P A;  2PN5 A;  4AVT A;  3N4M A;  1UXX X;  1D4M 1;  2VNR A;  3KT1 A;  3ZMO A;  2NYY A;  1AJO A;  1YQC A;  3AMQ A;  3N9O A;  2WUH A;  4QDS A;  4QX5 A;  4R9D A;  1GKB A;  3BVC A;  5FYH A;  3ZFG A;  3BUC A;  1RUO A;  1JZ3 A;  4PI2 A;  4G3Y C;  1JOD A;  4Q0Q A;  2HYX A;  2ARA A;  4I3P A;  3ON7 A;  3C3V A;  4M3C B;  1R64 A;  5C9A C;  4E9K A;  4QU1 A;  1OA4 A;  2W08 A;  1QIQ A;  4PBP A;  1OT5 A;  1R08 2;  4FOV A;  3WW3 A;  1YFY A;  3Q8E A;  2VTF A;  4OUE A;  5IJR A;  4KH9 A;  4EN8 B;  4I0A A;  3SEP A;  3R6S A;  1IQA A;  5C8C C;  3KHC A;  2OVU A;  3ZX7 A;  4QQO A;  2C5D A;  2GAU A;  3AZV A;  5EHD A;  4OHW A;  1RUG 3;  2YGM A;  4IE0 A;  4F83 A;  4TYS A;  4PDW C;  5FFO C;  3UGH A;  3FHQ A;  2AEN A;  1BVP 1;  2VMC A;  2WT2 A;  4A42 A;  1ND3 A;  2KXL A;  2PTM A;  1ENS A;  4NHX A;  3DYP A;  1QJE A;  4FPH A;  4L11 A;  5K4L A;  2ZEX A;  3PVB B;  4FI9 A;  1XE0 A;  4FPG A;  4FT8 A;  4LTA A;  3TBD A;  2E7A A;  5GLZ A;  4OLL A;  4AED C;  4BCU A;  3I3M A;  3NKT A;  2EID A;  2RR1 3;  2W2I A;  3OPT A;  5T54 A;  4DQA A;  5FPX A;  3HQX A;  3RJR A;  3E6C C;  3ZLI A;  4IGO A;  2VNO A;  5BXX A;  2ARB A;  3OUH A;  1C4R A;  4XJ9 A;  4Q0V A;  3OY8 B;  4IUG A;  1LB2 A;  1FMD 2;  1R1A 3;  3WDW A;  3S5Q A;  4A7Z A;  2OXB A;  1DBN A;  1HJF A;  1N1Y A;  1LHW A;  1Q8V A;  2P1B A;  5A7O A;  4A7Y A;  4BQ2 A;  3W9A A;  4D7T A;  4HON A;  1QOS A;  1EYB A;  2E32 A;  5HCH A;  4RS5 A;  4FBF A;  1LJ7 A;  4OHX A;  2WYF A;  4RYD A;  1K12 A;  3FFQ A;  3AM2 A;  5LZ6 A;  2OUH A;  1RUC 3;  1TMF 3;  4CCM A;  2QQN A;  4P02 B;  1QY4 A;  3ZIX A;  1F2N A;  1JHJ A;  3KCY A;  3N9Q A;  2OII A;  1RXG A;  4ZKT B;  4LLF A;  1UIJ A;  1ZBE 3;  1FV3 A;  2ZGQ A;  2BWC A;  1B35 B;  3DKW A;  2J42 A;  4QHB A;  4AFC A;  3KV6 A;  1GNY A;  4AFB A;  1BLZ A;  5J37 A;  4GA9 A;  3AKP A;  3Q8F A;  4AI2 A;  4X8P A;  2ZX3 A;  1NXD 1;  2FDK A;  3OUJ A;  1N3Q A;  2DYC A;  5IVJ A;  4XFH A;  4BK5 A;  2PHW A;  4P14 A;  4BYY A;  2XVL A;  3GBW A;  3RG0 A;  2D7F A;  2J22 A;  2YFZ A;  2FDH A;  4L9B A;  1F9K A;  4AI8 A;  3X29 B;  4EWD A;  2PHU A;  4AEK A;  2Q8O A;  4URA A;  4GWM A;  1A8D A;  4IES A;  3UYJ A;  4BMB A;  1LHV A;  1WLW A;  2DVB A;  5K0U C;  1OMI A;  2ZGT A;  1FMD 3;  3MIB A;  4GD4 A;  5HPO A;  2A71 A;  4WM8 C;  2UYB A;  1W2U A;  4XTP A;  5IFP A;  2Y0O A;  2BZD A;  4R4Z A;  5L7O C;  4YZ4 A;  4B1M A;  1DHK B;  1RUE 3;  3J8F 1;  4P08 A;  3CNA A;  2EIG A;  2GH8 A;  1TG7 A;  1D0G A;  2RDQ A;  3CQO A;  2HBT A;  4IDZ A;  1JOB A;  3JD7 2;  3POB A;  3MW3 A;  4ES8 A;  5GLW A;  2X8K A;  4CUG A;  5FJH A;  2XOM A;  3U14 A;  4B8E A;  2P6H A;  2HWC 2;  3PUR A;  4GMP 1;  2NN8 A;  3AKR A;  1X9T A;  4MH0 E;  1DQ4 A;  4QPI A;  4XCA A;  1VAL A;  1G86 A;  1NCR B;  2OQ7 A;  2ZX1 A;  2EAA A;  4LKD A;  3KCX A;  3I2I A;  3OG2 A;  1LEC A;  3RMX A;  5A70 A;  5LY1 A;  4Q4V 3;  1DIW A;  5FYC A;  3H1M A;  3JQW A;  4W65 A;  5FO8 B;  1VBD 2;  4FPF A;  4K1Z A;  4D6Q A;  4EJR A;  1JZ8 A;  1OLM E;  1MPX A;  2WZE A;  4MXW A;  3FBY A;  3OJB A;  1GUI A;  3NST A;  4P9W A;  4E4Z A;  4KG8 A;  4MGY E;  2D6L X;  2WNU C;  1CPM A;  4UBH A;  2DF7 A;  5A1F A;  4YNI A;  1UMZ A;  4CCO A;  3ACL A;  3H1Y A;  2Q0A A;  1DGR N;  3ASI A;  2WQZ C;  4HAN A;  5CIR A;  1F5F A;  4FPJ A;  5FYY A;  3FHA A;  4ASM B;  3E1F 1;  4AGR A;  3LPG A;  2VO5 A;  4E4H A;  3V64 A;  2XLF A;  2NZ9 A;  3RVH A;  1PHM A;  1EV1 1;  3EB7 A;  1UN1 A;  1DU3 D;  2GN7 A;  2RS3 3;  2ZKN A;  3I2J A;  5FZF A;  4E27 A;  1US2 A;  3UJO A;  5LB6 A;  2B5H A;  1XNK A;  3K51 A;  1JXN A;  2BBA A;  3U1X A;  1FAY A;  2CNA A;  1ND2 A;  1XNB A;  1YXW A;  2AAC A;  2JXA A;  3KV9 A;  5G05 L;  2PHD A;  1RVF 3;  2D6N A;  2YMZ A;  4TWT A;  4YWA A;  3OD0 A;  1HDK A;  1V6L A;  5L36 A;  4NMI A;  5F3C A;  2JB8 A;  3O1O A;  1GZT A;  2X05 A;  3VHR A;  5CG8 A;  3N9M A;  3O1S A;  4WVM B;  4XIO A;  4PDW B;  1TME 2;  3GBF A;  2BVB A;  4G4F A;  2HYK A;  1JI6 A;  3T2O A;  4AGG A;  4UFJ A;  2HWD 1;  2X29 A;  1DYK A;  3FJS A;  1AR7 2;  4XBQ A;  4BH9 A;  1MZF A;  5JOX A;  1XJA A;  5A3W A;  5JOZ A;  3OGR A;  2TUN A;  4YGE A;  3R4U A;  1GSL A;  3HNM A;  1PK6 A;  4A7K A;  3FLP A;  3JZV A;  3JBG 3;  1MS9 A;  1QGL A;  2PHR A;  2YBP A;  5FQ0 A;  1CAW B;  1HRV 3;  2VZR A;  3FBM A;  4WM7 C;  1RUC 2;  1QDC A;  3ZO0 B;  4XFB A;  2R07 1;  4PHZ A;  2JD9 A;  4RHV 2;  2GC2 A;  4K6B A;  3WP3 A;  1XSR A;  4IV1 A;  5HV0 A;  1BBT 1;  3VBH B;  4XUN A;  4HVQ A;  3I3Q A;  3WHT A;  4GJZ A;  4GKX A;  2WWS A;  2C1F A;  2JE7 A;  4CTE A;  4HET A;  5CFC C;  3EXU A;  2NP0 A;  5FZ0 A;  1XXN A;  3ILF A;  1HB2 A;  2HEW F;  1PNG A;  4AW7 A;  1OQ1 A;  3ME2 A;  4UI9 L;  3H7J A;  4WZF A;  4PT6 A;  2JWP A;  5DZE A;  2UWB A;  4EQV A;  1OFS A;  4GB3 2;  2RMU 1;  5L9R A;  3OB8 A;  2VUD A;  1H2L A;  4YW2 A;  3A23 A;  2A3Y A;  2EXI A;  1L3J A;  1NA1 B;  4EN6 B;  1LUL A;  3ZSM A;  2JJ6 A;  4I3G A;  1VJ2 A;  4K7J A;  1CVN A;  3SNM A;  3LKJ A;  4QPG C;  5C70 A;  1S0C A;  1RUI 1;  5DUU A;  4TN7 A;  5J1X A;  1K42 A;  2V72 A;  3MO4 A;  1SCR A;  3C7O A;  2YY1 A;  3M7A A;  2WNE A;  4CPB D;  1RUJ 1;  2DUO A;  5F37 A;  1LGN A;  3ZFE C;  1HJG A;  2ZOE B;  5I0R A;  1MQT C;  2HWB 2;  2RJL A;  1MZE A;  3ZSJ A;  3N7K A;  4FSJ A;  1OKO A;  3I2O A;  2H0B A;  4Y1U A;  5FRA A;  3THT A;  1V9U 2;  3O0V A;  1W6M B;  5JXG A;  2HWB 3;  1W8N A;  3GJB A;  3AZX A;  3AZY A;  2RM2 2;  3L9J T;  3HNY M;  1RHI 3;  2ZEY A;  1CR7 A;  3JB8 A;  5EP9 A;  2P3K A;  4I0B A;  2ZHK A;  3D4K A;  3TEW A;  3T0D A;  1KEX A;  1HV1 A;  3WNP A;  3BTA A;  1ND2 C;  2HEV F;  2VU9 A;  1VRH 3;  4CYD A;  4TXW A;  5BNN A;  2B7Y A;  2F6B A;  3BGA A;  2VG9 A;  4WVZ A;  3J7L A;  3DPR B;  1AYM 3;  3VD4 A;  3RJ2 X;  4XZP A;  1ZBA 1;  3KQ4 B;  2DU1 A;  4AF9 A;  5CFC B;  3P1I A;  1QQP 1;  5E1R A;  2P3J A;  3UES A;  1HRI 3;  1ZZ9 A;  2JG8 B;  2WFF 1;  3KWV A;  4JGY A;  4IND A;  3IDC B;  1WMD A;  2LAL A;  4LKE A;  1BEV 1;  3NW4 A;  1S0F A;  5GLU A;  4RFR B;  4AI1 A;  4H2A A;  1LOC A;  1PGW 1;  2Y64 A;  4XDP A;  4AHY A;  1GZW B;  1RUE 1;  3J8F 3;  4QPI B;  4QX1 A;  3VKF C;  2Q5T A;  2RDR A;  2QZ3 A;  1ASJ 2;  2QCS B;  5F7U A;  1FOD 1;  3ETQ A;  3RWK X;  2B45 X;  5A3P A;  3I3E A;  1JS9 A;  4IV3 B;  3P5B A;  2ZGK A;  1MVE A;  1XC6 A;  1DQ2 A;  3MV0 1;  1DF0 A;  3B01 A;  4IEQ A;  2E26 A;  3ZXA C;  2XHN A;  4YZ5 A;  4MXW B;  2VW2 A;  3WDY A;  4NAM A;  4D3W A;  3H9A A;  2VBP A;  3HPN A;  3T0B A;  4BIS A;  2GC1 A;  1TZO A;  4QPI C;  5FO9 B;  4Q4W 2;  3I4I A;  3CU7 A;  1VBA 1;  3WF0 A;  3VLB B;  1I5P A;  1TEI A;  1S0E A;  2YXS A;  1TVG A;  1UY3 A;  2VAU A;  3MI8 A;  3O12 A;  4QB6 A;  4W6X A;  5F32 A;  5LAT A;  5J3U A;  1GNZ A;  3K77 A;  1QMJ A;  1W6O A;  1WA4 A;  4IEO A;  4OZX A;  1UZ0 A;  1VPH A;  1VR3 A;  1W8Z A;  2DCY A;  3O7O A;  4ISR A;  4BQY A;  4CCE A;  1VIW B;  4G9S B;  1EV1 2;  1WA6 X;  3RYR A;  4AK3 A;  2GAL A;  3H1W A;  3THD A;  2EIB A;  1DP0 A;  1W05 A;  4B4P A;  5T3N A;  5A3M A;  5H9P A;  3VDD B;  5C5U A;  4HT1 T;  1BBT 2;  1RC6 A;  3UK9 A;  2I45 A;  2J1V A;  1O8S A;  3HN1 A;  3TOJ A;  3HT1 A;  2Q8D A;  2VCC A;  4KL1 A;  2A70 A;  5L9V A;  5JCT A;  4GMP 0;  1AL2 1;  3VKM A;  1W6Q A;  1AHS A;  3HWJ A;  1SG3 A;  4GWI A;  2RR1 1;  4WVM A;  2PLV 2;  2W3J A;  5CKM A;  5A6Y A;  1MAC A;  3NAP A;  2PHT A;  4H3W A;  4UFL A;  3QH7 A;  2BNM A;  3LOI A;  1L7R A;  3VHN A;  1CPN A;  3IB3 A;  3PVE A;  2AH2 A;  4HVO A;  1PGS A;  1REF A;  4QPY A;  1JZ6 A;  2W91 A;  1C8M 1;  5DAX A;  3VBH C;  4NIH A;  2AGS A;  4QX0 A;  5DUW A;  5JPN B;  4FTB A;  4JTO A;  1PK6 B;  1XYO A;  2G9G A;  3PLQ A;  2W9X A;  4M3C F;  1JYC A;  2D5H A;  5FZO B;  5EJ1 B;  4PLM A;  2ZGN A;  3OUI A;  4RS5 C;  5FK8 A;  3RZM A;  4RR3 B;  4JQT A;  5AVA A;  2HWD 3;  4K40 A;  4IGQ A;  3KV4 A;  4CZS A;  4MGS A;  3ZKU A;  1QJF A;  3UKN A;  1XQN A;  1C1L A;  1W8U A;  4RN5 A;  2P4E A;  4KG0 A;  4QKN A;  3WNK A;  2VME A;  1AXK A;  3ZYR A;  1OOP B;  1YQ8 A;  4BE3 A;  1MS3 A;  3FL7 A;  3NO8 A;  5DZG A;  3WP5 A;  3O5S A;  1BXH A;  5DUV A;  4YW7 A;  2ZMN A;  2VNG A;  1U12 A;  4QKB A;  3C7H A;  4W50 A;  3T30 A;  4JDM A;  4NRP A;  2DV9 A;  2R30 A;  2X10 A;  4IE5 A;  2XVG A;  3P3N A;  5LBC A;  5CYY A;  3ZR6 A;  2F4L A;  2UUR A;  3FLT A;  1H8T C;  4GB3 1;  4I09 A;  1XPW A;  3SCG A;  1OF3 A;  3M1H A;  1K5M A;  2VH9 A;  4W8J A;  3M4F A;  3POJ A;  2RG4 A;  5AC9 1;  2W46 A;  4HN0 A;  5EXO A;  4F3J A;  3QD6 A;  4AE2 A;  1ULO A;  4DZG A;  2VTX A;  3SH4 A;  3AZW A;  3TN9 2;  5C4W A;  1ST8 A;  3LAG A;  4YRD A;  4YG3 A;  5K0U B;  5GZE A;  3FZ3 A;  4Y5Z 0;  3D82 A;  3FHI B;  3VKO A;  1RJ8 A;  4S2F A;  4ZXK A;  3MPB A;  2RVA A;  3ELN A;  1Y9M A;  4Y24 A;  5TSW A;  4QX8 A;  2QQO A;  1AR6 2;  3PUS A;  3UV9 A;  1IGO A;  2FHR A;  2VUL A;  1QJY 3;  1F35 A;  5KR7 A;  5LCW L;  1Y7B A;  1BQP A;  4DIQ A;  1ENR A;  5DG2 A;  2ZS6 B;  1NE6 A;  3GXU A;  1NCQ B;  1S2K A;  1X9P A;  1WKY A;  3BIW E;  3NJY A;  4GZ9 A;  1V9U 3;  4JHZ A;  4XF1 A;  3ZM8 A;  4EWA A;  1QJY 2;  4M00 A;  5DG1 A;  1WW5 A;  4NOT A;  4YW6 A;  4CXW A;  4R9C A;  1JBC A;  5GZG A;  1ASJ 3;  1GLH A;  3HNB M;  2WFP A;  3HN3 A;  4DEV A;  3TEY A;  2A6Z A;  1NCR C;  3I2D A;  3I2F A;  3WDV A;  1QDO A;  1PMJ X;  2L9L A;  4CDU A;  5IVV A;  4LMF A;  3VD9 A;  3O1U A;  2BNN A;  4Y5S A;  1BMV 1;  1SDW A;  1XNC A;  2WYS A;  3AMN A;  4Z07 A;  1G9F A;  1DQ6 A;  2JIC A;  4E8D A;  1RTV A;  4Z1V A;  3CKH A;  3V0B B;  1CZS A;  4LIU A;  4PF1 A;  3RI8 A;  2I2S A;  2ZAB A;  4ZXE A;  4CDU B;  4CEW A;  2VMF A;  5HXM A;  4BZ4 A;  4RQP C;  5A7S A;  5AFE A;  1CWP A;  3I8T A;  2VD7 A;  1COV 3;  2VY0 A;  2Q8C A;  3WF3 A;  4A3X A;  1XNT A;  1QKQ A;  4ZU4 A;  1QJZ A;  2D93 A;  4PIX A;  5I8T A;  1AR9 2;  5HCA A;  2YGL A;  1W3V A;  2DVD A;  4CDW B;  1OLQ A;  1M06 G;  1QF3 A;  2IC1 A;  4J25 A;  2SBA A;  1OVS A;  4S2H A;  5BNQ A;  3OYW A;  4C1X A;  4DFS A;  4NR1 A;  1MS1 A;  4ZU7 A;  2SLI A;  1ASJ 1;  4I0W B;  2FMY A;  2YFU A;  5C8W A;  2J1S A;  1D4M 2;  4LBL A;  2HWC 1;  2IXJ A;  5FZE A;  4WVW A;  5A33 A;  4XFI A;  2FCU A;  2WLP A;  3HQU A;  5FYI A;  1NCR A;  4CA9 A;  4Z2A A;  5C3O A;  1SLA A;  1X8E A;  2ZCW A;  1QJX 3;  2FDI A;  4YVW A;  2WQ4 A;  2ZGM A;  2Q1F A;  2UY9 A;  2ZPX A;  3W21 A;  3ACI A;  4BXS V;  5CKN A;  3CDZ B;  4L8Q A;  2WRA A;  4CDQ B;  3B3Q E;  1RUN A;  2W95 A;  1C5H A;  1KDK A;  1XND A;  3AL6 A;  1PGL 2;  5K8S A;  1ZZB A;  3E6B A;  5IYY A;  4ONU A;  1AZD A;  2JDM A;  3D3A A;  4Z82 A;  3SKJ E;  2VOK A;  4JAA A;  3GGL A;  2WIN B;  3UJQ A;  2PHF A;  1H2K A;  2BYV E;  3WX5 A;  3KF5 A;  3MDP A;  4CRQ A;  3MZH A;  1H1M A;  1BHG A;  3T3Y A;  3MBW A;  3T0A A;  3TEZ A;  1PVC 1;  4Q1R A;  5T50 A;  1MS4 A;  2PXJ A;  3AFG A;  4BQ3 A;  2ZGS A;  3POS A;  2W68 A;  2Y6K A;  5SV8 A;  3VBO A;  3VBR C;  5B4N A;  4Q0P A;  2EIC A;  5HV4 A;  1K5M C;  5L9B A;  3NMB A;  3LIH A;  2RR1 2;  2RS3 1;  4L97 A;  5CKQ A;  1SBE A;  4Y22 B;  4HZF A;  2JDZ A;  3U4S A;  4AR2 A;  4NUB A;  3PVN A;  2ZGO A;  5KHK A;  3NKG A;  1RUI 2;  2D6K A;  4I30 A;  2XH6 A;  5J36 A;  1OOP C;  4LK7 A;  4LUL A;  2NPI A;  1MS0 A;  3HOB A;  3MLL A;  3NNF A;  3H0O A;  3S0M A;  4XUT A;  4OUS A;  2TNF A;  1EUT A;  3NAP B;  3QCW A;  4CCD A;  2WWU A;  2XHK A;  4Q0U A;  4IE7 A;  1Q8P A;  5FMO S;  3WNM A;  4E2Q A;  1VAM A;  3DGT A;  3BI3 A;  3OBZ A;  1YQ2 A;  1H2N A;  2XGX A;  4UOJ A;  4DXR A;  3HIF A;  2EXJ A;  3O1T A;  2YC2 A;  2FD8 A;  1JHN A;  1PX4 A;  1H8T B;  1AVB A;  1ULG A;  1U5I A;  5FUP A;  3CJI A;  3IAP A;  1MEC 3;  1TNR A;  2JEM A;  4WZC A;  3KT4 A;  3IMN A;  2YC0 A;  3K4D A;  4Y1X A;  1W6P A;  4QX3 A;  1O3R A;  1DYP A;  1U5Z A;  5FMD A;  4PI0 A;  5FWE A;  1IKQ A;  5F6K A;  4Y1Y A;  4YM3 A;  5FK7 A;  4P9G A;  2Z5W A;  1CAX B;  2X5I B;  4YVS A;  2RMU 3;  2A7A A;  2DCK A;  4FP2 A;  2GNM A;  2Z69 A;  1QH6 A;  2BOI A;  1R09 3;  2QQK A;  3SEE A;  1BMV 2;  2KR2 A;  4XXP A;  5C6C A;  1NZI A;  1M4W A;  1SLC A;  1ZRC A;  4GWN A;  2JDN A;  2W1S A;  2CY6 A;  4MXV A;  3JUU A;  1A6C A;  1Y9G A;  3M70 A;  4MGZ E;  5FY1 A;  3U10 A;  2OW4 A;  1WLT A;  1OKQ A;  1RUE 2;  2W1W A;  1Q56 A;  1F4H A;  2YHJ A;  4XUP A;  5FZ6 A;  5LY2 A;  1NCQ C;  5T5L A;  2ZHN A;  3MLK A;  2VUC A;  1K5M B;  5D8A B;  1AXY A;  5CU1 A;  5A7W B;  5FPZ A;  1YFW A;  1A8M A;  3BB6 A;  3ITQ A;  3OBR A;  4DRV A;  2RS1 2;  3A21 A;  3KHB A;  3M3Q A;  4HPK A;  2ZZJ A;  4WM8 B;  3III A;  1Z78 A;  4LIV A;  2KA3 A;  1SPP B;  4QKD A;  1UQX A;  4KQ7 A;  5D8A A;  5A7W A;  5FZB A;  1IG0 A;  2OUJ A;  3LA2 A;  5FXV A;  1MVQ A;  4GJY A;  1VBE 3;  1N1T A;  1PNF A;  3PU8 A;  5FV3 A;  5G04 L;  3RSJ A;  1CX1 A;  2OZ6 A;  3WQ1 A;  3U4X A;  3C8X A;  4UAP A;  2DU0 A;  2J1E A;  2DTW A;  4N9I A;  4FXG B;  3VBS B;  2MPF A;  4HOO A;  1PO2 1;  2IFR A;  1V70 A;  1VBC 3;  1K5J A;  2LW8 A;  4V2W A;  3LD8 A;  2VCM A;  4A3Z A;  2ZTN A;  1UU5 A;  4IE4 A;  3GHM A;  3I97 A;  3MUZ 1;  4QXK A;  3WT3 A;  5KBF A;  2AYH A;  2MEV 3;  1CQ9 A;  4D7Y A;  1VRH 1;  5AVP A;  1IS3 A;  5KC6 A;  1RUG 1;  5GKA C;  4MUV A;  4LR4 A;  1HIX A;  3HD8 B;  3RYP A;  4GH4 C;  3K48 A;  4LBN A;  1I1E A;  3ZFF A;  3UGF A;  2CGO A;  3H8R A;  4CU9 A;  4GH4 A;  4XE9 A;  1W8W A;  2JDU A;  1PM7 A;  4FPK A;  4NID A;  4UW3 A;  4OFG A;  2YYO A;  3HVD A;  2WN2 A;  1RUG 2;  4JC1 A;  3NQH A;  4LHL A;  3ES1 A;  5C8C B;  1ZZ7 A;  4S2D A;  2VOT A;  2Y6G A;  4TLG A;  3LPF A;  4E2G A;  2IVJ A;  2YDE A;  5AFB A; 
#chains in the Genus database with same CATH homology
 3EMR A;  3NNF A;  4NHY A;  5ERL A;  4ZPI A;  2V4A A;  5DAV A;  4NHM A;  3OBZ A;  4MHR A;  3W20 A;  2Y33 A;  3OUJ A;  5A3U A;  5LAT A;  4Y5T A;  2HBU A;  2OPW A;  3HQR A;  5HV0 A;  5DAW A;  4BQY A;  3KT4 A;  4Y5S A;  4NHK A;  5C5T A;  4JZR A;  3MGU A;  2JIJ A;  3KT7 A;  5C5U A;  2RDQ A;  5L9V A;  5LA9 A;  2HBT A;  2Y34 A;  5L9R A;  5DAQ A;  5IAV A;  4XAB A;  4J25 A;  3PL0 A;  3KT1 A;  3GZE A;  3BVC A;  3ITQ A;  5DAP A;  4XCA A;  5LBE A;  4Q5O A;  5EPA A;  5LBF A;  2FCV A;  2FCU A;  2JIG A;  5DAX A;  3HQU A;  5M0T A;  4XC9 A;  3OUI A;  3W21 A;  5LAS A;  2RDN A;  4BQX A;  3NNM A;  3GJB A;  2G19 A;  4XAA A;  5EP9 A;  4MHU A;  3DKQ A;  2G1M A;  4NHL A;  3NNJ A;  2A1X A;  4NHX A;  5IAX A;  4UWD A;  4BQW A;  4IW3 A;  4XAC A;  5LBC A;  2FCT A;  4NAO A;  5LB6 A;  4XCB A;  4ZON A;  3NNL A;  2RG4 A;  5L9B A;  5HV4 A;  5EQU A;  3OUH A;  3GJA A;  4KBZ A;  5IAT A;  2RDS A;  5LBB A;  4NMI A;  2RDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...