5LATA

Hif prolyl hydroxylase 2 (phd2/egln1) p317r variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/un9)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
224
structure length
221
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNRNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLKGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 221
sequence length 224
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5latA00
2FCUA 5C5UA 5IATA 4NHKA 2HBUA 5HV4A 4NAOA 4NHLA 2OPWA 4XABA 4XC9A 5DAPA 3OUJA 5ERLA 4MHRA 4JZRA 4Y5SA 4NHXA 2V4AA 3OBZA 5DAVA 4NHYA 5EQUA 3BVCA 5M0TA 4XCAA 2Y33A 4MHUA 5L9BA 5LASA 3KT1A 4ZPIA 5LBCA 4UWDA 2RDSA 5L9VA 2FCTA 3NNFA 5LBBA 4BQYA 5LA9A 3HQUA 3NNLA 5C5TA 5DAWA 2HBTA 3OUIA 4ZONA 2A1XA 2FCVA 2RDNA 3HQRA 2RDRA 4BQWA 3EMRA 4XCBA 5DAXA 2RG4A 3KT4A 5LB6A 4IW3A 5IAXA 4XAAA 4NMIA 5A3UA 4J25A 3GJAA 2G19A 3PL0A 5L9RA 2JIGA 3NNJA 2RDQA 3KT7A 4KBZA 5DAQA 4Y5TA 2JIJA 3W21A 3GJBA 2Y34A 4NHMA 3NNMA 5LATA 2G1MA 3ITQA 4Q5OA 3MGUA 4BQXA 3OUHA 3GZEA 5EP9A 3DKQA 4XACA 5HV0A 5LBFA 3W20A 5EPAA 5LBEA 5IAVA
chains in the Genus database with same CATH superfamily
4CCDA 5CEHA 1TME1 5JPNB 1AZDA 1CPNA 4B1MA 2JG8A 1VB4A 1QWRA 3KVAA 1CONA 1WW4A 2DUPA 2VU9A 4FOWA 4EZHA 3AL6A 1QQP3 1JYVA 1H0BA 4IE6A 1JYNA 2E63A 5LY1A 3ETPA 1WCSA 3MIHA 2XL9A 1O5LA 2RMU3 2YB7A 3ZYFA 5JXHA 2G9ZA 3BPZA 4I0WB 2RE9A 2W2IA 4JCKA 1HN0A 2B9VA 2FMYA 3ZXAC 4RL7A 1AL22 3WG2A 3LPGA 1UZ0A 1NLQA 3ES4A 2IFWA 4XDOA 2J1RA 1HV0A 5FREA 2C6SA 4IEOA 3ZSKA 1KJRA 1Z7S3 4M3CA 4X8NA 1VRH3 4A42A 3KZ4C 4U2AA 5FXVA 4AQ2A 2XWBB 4Q4X1 4TYSA 1PGW2 2R041 2DCKA 2HWD1 4K3UA 5DZGA 1BVP1 2X05A 3T4HB 3OBAA 3LSDA 1MR5A 4DFSA 3ZXDA 5LWBA 1GFF2 2HWE1 3CMGA 1PX4A 4PIZA 1YIPA 4YVWA 2O8QA 1UZVA 1O3TA 2PLV2 5FY1A 2ADEA 5FUPA 4HKOA 4IE4A 4YGDA 5KHGA 1ZZ9A 3GNEA 1YI7A 2RS52 2XLGA 4P02B 4FOQA 4QU1A 5H9RA 3N9PA 1E5RA 4HKWA 4D0QA 3I3BA 5J1XA 4QHZA 1WW7A 2OQ7A 5C4WA 4JDMA 1UNBA 5EZWA 3ZXEA 4DIQA 1I1EA 1GOGA 1O5UA 2D43A 4UFKA 2P3YA 4K40A 4FP3A 2W46A 1XJAA 3AP4A 4RGGA 3M3OA 5CG8A 1RUJ3 3BOWA 1HJFA 2LW8A 3ZFGB 1W9WA 2JICA 3N3HA 4RQPB 4BQ4A 3ZR6A 1UX7A 2K46A 1S4CA 1WLWA 5DAXA 4ORFA 3USUA 4XOGA 2CNAA 2NQYA 3ETQA 3H1YA 2XMLA 5JR2A 3S57A 4COWA 1RUF3 2XBO2 3QH7A 5I0TA 4FPHA 4QQLA 1UL9A 1EPZA 2BBAA 2C1FA 5A1LA 4J25A 3FLRA 1NG0A 3AMMA 1OLQA 3Q8BA 4Z07A 1PNGA 4OULA 5FLHA 3S30A 2K0GA 2VCMA 2IXJA 4LKDA 1NCQC 3IMMA 1IPSA 1RYYA 3OYWA 3R4DB 4YG0A 1AVBA 1GNZA 2JIGA 3CKHA 4GMP3 4IUGA 1F4AA 1HW5A 2VULA 3H8OA 4Z1VA 2R7EB 4IL7A 3EJKA 1AX0A 4KBZA 4YGBA 5FY0A 2Y6LA 2VMEA 1ZRCA 4MO3M 3H42B 3DGTA 1GZWB 4CP2A 4YGEA 3OF1A 1RHI1 2VECA 1R093 2YFUA 4N53A 3TN93 4C8DA 5CFCB 5BNPB 1BK1A 3K4ZA 2ZGNA 3D5OA 1AR62 5JMCA 1R1A2 2UYAA 4JGZC 4ZU5A 2F17A 4AFDA 2VCAA 1NCRB 5DUXA 3NAPC 1RUE2 2JXAA 4LT5A 2F4PA 4S2GA 4AFAA 4LK6A 2FDIA 2QBXA 2WZR1 4K21A 4NR1A 2Z2SB 2VBPA 2XWJB 5E89A 5A7WB 1CX1A 4AEJA 3VDDC 4AXOA 3S7EA 2ZGLA 3RDIA 4OUMA 1GQGA 1LNSA 3RVHA 2FZ1A 3UESA 3ZFGA 2WYSA 2G9GA 1EAH2 1FOD1 2QVSB 2EXHA 2W1SA 3DN7A 2PQQA 1DF0A 4ASLA 2Q0AA 2VQUA 4P9GA 2RMU2 2VQ0A 4XQWA 4CDUA 4NHXA 1DFQA 2HLEA 1RUOA 4QHBA 1W6PB 1D4M1 2WBKA 3TEZA 2W1UA 5FP3A 2OZ6A 1Y9GA 2DVGA 2ZGUA 2Y6GA 3LKJA 2VNOA 1POQA 3F95A 4FPOB 5FMOL 1XNTA 1J1LA 2Y33A 4PDWB 3WW4A 2WYFA 1DCSA 2B45X 4WZFA 1Z7S2 4I0BA 4IV3B 1N1YA 2A70A 1OUSA 1ZBA1 2DBNA 4LEJA 4Y1UA 5D2AA 4ZXEA 4AL9A 4DUXA 2D98A 2R073 3EBRA 4EYUA 1DDLA 4EN9B 1G9CA 5L9VA 3WCRA 1D0GA 5EIYB 3I3QA 1L7QA 5I0SA 1XE7A 4Y1ZA 5LA9A 3RFRA 2LROA 4A7YA 2DU0A 2Q8DA 3D4KA 4HOOA 3AMQA 1ODNA 2XJSA 4KU8A 3ASIA 4AYUA 1XSQA 3RZGA 2VOTA 1V0AA 3N7KA 4HVRA 4BYYA 4OHYA 3IPVA 1UU6A 4AVVA 2WNEA 1MS4A 5TSWA 1A3KA 4DS0A 4XW3A 3WQ0A 3VBHA 1REFA 2WFF1 4FAHA 3U0ZA 1IGOA 5A7WA 4P5YA 2CAUA 2Z5WA 5CADA 3GBGA 3AMHA 4XUTA 4XQ4A 2BOIA 1GP4A 4KWKA 3ZX7A 1S0EA 5LA0A 5FPBA 1G9BA 1SQ4A 2NN8A 1ZM1A 3IKWA 3D8CA 2WWUA 5LB6A 1KFUL 1RUJ2 1QJY3 4CDQA 1S0BA 4B3NA 3AMNA 3SH5A 2BUKA 5LW9A 3KCCA 1AL21 1VBB1 3ZDVA 4I2OA 2V5YA 2OZJA 2L9LA 2Y6JA 4Q4Y2 1AXKA 1RUF2 1KXGA 2Y6FA 2W5FA 4KGQA 4UAPA 4XJWA 3WG3A 1O8SA 4BE3A 4YG3A 1FAYA 4KWJA 3NNJA 4XIOA 3UV9A 1W8ZA 5C9AC 3THCA 4A6OA 1KGYA 4AI2A 3VBOA 1JHNA 2D6NA 2ZAHA 2W3JA 2LRPA 1GV9A 1H8TA 1SMVA 1LOCA 1RIRA 2TNFA 2VNRA 2VZVA 2ZMNA 5IFPA 2IFRA 2D6OX 3EHKA 2IXHA 5DXDA 2I45A 4LUMA 2KXLA 2OYZA 3VD3A 1RUD2 2PLV1 4W65A 5EJZB 5IUQA 4UW3A 1R092 2E31A 4XACA 1QXJA 3Q8EA 1S55A 4WM8A 2IZWA 1BMV1 2E6VA 2HWF3 1RUNA 1GR3A 1HN1A 2FDHA 3LA7A 1K45A 2J1EA 4QKNA 4CU8A 1O91A 4GH4C 5LEKA 1ZA4A 4HMZA 1VRBA 3V0BA 2VZSA 4QGLA 2CY6A 3HMYA 2WQZC 3ZYHA 3C8XA 2HBUA 2V09A 4KG8A 1W39A 5EV7A 4XBQA 4LE4A 3VKNA 2ZABA 2I74A 1QNYA 5E1RA 4AQTA 1J3QA 5BXXA 3ZPOA 1OLRA 4PLNA 4C1WA 2VBBA 2XBO1 1FPN3 1JW6A 3S5AA 1A78A 1NA1B 3ZFFA 1DYOA 1M06G 2AEYA 4NN0A 2VH9A 4H14A 4YRDA 1AX2A 5FZ9A 3WP3A 5FPAA 3ME2A 5GZDA 3WW1A 4EZ4A 5C3OA 5C8CA 3H3LA 4IGQA 3SC7X 4EV0A 2H6CA 3F2ZA 4UF0B 1VIWB 4ET7A 2R0FA 5A3WA 3O1RA 2VVFA 4C0BA 2XUEA 2DCZA 3FBMA 1GWLA 1H4GA 3SKJE 4MHUA 4JGYB 3VBSA 4QWNA 2UU8A 4S2DA 3OPZA 1PK6B 5J48A 1H2NA 3JUUA 2H0BA 2QDNA 1QH6A 5A33A 3WDWA 1CAXB 3I2IA 3ZXJA 2ZHLA 4XQDA 1R1A1 4OI4A 1RMU1 1A34A 4XFCA 3KGZA 4W4ZA 4RSUA 1E5IA 1US2A 3FL7A 3MIBA 5T3NA 2WNVC 1RUE1 2Y64A 3Q8FA 3WSOA 2VXRA 1MZEA 3T2OA 1DZQA 5EJ3A 1IHMA 3KV9A 2QQOA 4RR3A 3OB8A 5JDBA 3T0DA 1LULA 1F2NA 2RDNA 5F39A 2X5IC 1RC6A 3DYPA 4BQWA 3KQ4B 2JKBA 3TYJA 1F35A 3VLBB 3WXPA 3O1UA 3WNOA 1VBE3 4LO7A 1FXZA 4JGZB 1Q8PA 4UOJA 3AB0A 3OBTA 4IW3A 1QQP1 5GLTA 1TVGA 4G3YC 1CIYA 1QJFA 1C1FA 2QJVA 1CZTA 4LPLA 1UIJA 4FOYA 4O61A 4YPJA 3S6PA 3SCFA 1W6QA 2RMU1 3GXUA 3WV6A 1QJZA 5A6XA 4MSVA 4XXAA 4AHYA 1QJY2 2ARAA 2R6QA 3ALQA 4QKBA 4BB3A 1JZ6A 4OHXA 2P6HA 3E5QA 5GJ6A 2JD4A 3TRSB 4PF5A 4UF0A 1WD3A 1EV13 2WO1A 4Z2WA 3CNAA 4P9YA 3I59A 4ZXKA 1GQPA 2UWAA 1Z7S1 5FZGA 1SPPB 1VRH1 4OQ9A 5A1FA 4XJ9A 2YROA 1SFNA 3AZZA 4TSVA 2ORZA 5C6CA 3IAQA 4CDXA 2XQXA 4J1WA 3TB0A 3WQ7A 2G1MA 3H7JA 4CTEA 5AFBA 3VKLA 1H6YA 3IDBB 3THPA 2J22A 4QMAA 3BIEA 3OUHA 4BK4A 2VC9A 4MGYE 2DUOA 4GMP0 1MQTC 2WL1A 1K5MC 1AYN3 1LOGA 4KWLA 1Q8VA 3LDRA 1JZ8A 1NCQA 3B00A 4FCAA 2BPA2 2VMHA 3PHMA 3QACA 3D0SA 1L3JA 2XKPA 3I7DA 4IE7A 1V6LA 3MUY1 2HWF2 5DDJ2 2E53A 2R30A 2I2SA 1WLDA 2JE7A 3LOIA 1BZWA 3N9MA 1IOAA 2VPVA 5CZKA 1QDCA 4YZ2A 5J36A 3KWVA 5L19A 2OUHA 4NVPA 2IXKA 1W8FA 2GC2A 2O14A 3M7AA 4OMCA 4AVSA 2P3IA 1RUJ1 3K3NA 3KF5A 3MW3A 3E6DA 3POEA 2Y8KA 1DGRN 3FHQA 3ZSJA 1W90A 2YY1A 3GCWA 3KV6A 4Y24A 2C9KA 1WCQA 4Y5SA 3VBUC 2KD7A 3NAPA 3IWZA 1W2UA 2AREA 1RUF1 2XQRA 1FT9A 2ZS6B 2EAAA 1W6MA 1IZ3A 3FLPA 1VAMA 2YHJA 1JYCA 2BFUL 3OCPA 1JZ2A 3BVCA 4XCAA 3VDCA 4CUCA 4QQHA 2WSVA 3VDDA 4WVZA 4AGGA 1CR7A 1UYXA 5BNNA 5IVBA 4IEUA 4Q8LA 4OHZA 1GBGA 3POBA 4GMP1 4ZPIA 4BCUA 3J26N 1SPPA 5T5LA 4CZSA 3CJIC 4HVOA 2OW4A 1YCIA 4YVWC 1ENXA 4CRQA 1X36A 1QOOA 3NNFA 4BIOA 5B2GB 4PI2A 3W5MA 5CFDC 3VD4A 1R091 4GXLA 3TN91 3NJYA 3PIGA 1QJU3 4P08A 3BU0A 1QNWA 2WLQA 3ZXGA 4JC1A 4UYBA 5B4XA 1UAIA 4GWNA 1ZZ8A 4BWOA 1OHFA 2P6CA 2ID4A 5HXVA 1DGWA 4ZZ8A 4XZPA 4HN1A 3VZOA 1YXWA 3NWKA 3NVCA 1GZTA 3VBUB 1OXCA 2WWJA 3K46A 1XYOA 1TEIA 3BI3A 4JRLA 2ZGOA 3GDBA 5CYYA 2R32A 1W8NA 2YGLA 5DUUA 2PAKA 1JTZX 3FBYA 4FTBA 2GP3A 3ZM8A 2QNKA 2PN5A 1Z0HA 3S7IA 1VBE2 2PFWA 4B7EA 5CA6A 2B7YA 1K42A 4LBLA 2P2KA 2RHPA 3M2MA 1DQ5A 1EP0A 3GJAA 4FPYA 4GIQA 3SEPA 1ULEA 4Q26A 3CZJA 4MXWB 4GH4B 1RUC3 1VALA 3P3PA 5DQ0A 3CHXA 2RDQA 3I3EA 4HSLA 3MF6A 4XIKA 3BIWE 4RHV3 3WVJA 3KT7A 4CCMA 5DAQA 3MIEA 5JOXA 3RRDA 3FC0A 4OZXA 1DP0A 2D40A 2JIJA 3PUIA 5GALA 2GNBA 1FI2A 2VL4A 2W1QA 2QUOA 1Y4WA 4N53C 3HN3A 1W99A 3J7NA 2A75A 3ITQA 4XHXA 1SDDB 2ZCWA 2R071 4XHBA 2F6BA 2LM3A 1DHKB 1B09A 2YBSA 3PVOA 4AFCA 4XYXA 4C90A 3JU9A 1VBA3 1ENSA 2X10A 3O5SA 3LF7A 4UW5A 4E4DX 5BV6A 4E9KA 3ES1A 1F8VA 1AYN2 5C9AA 5F5AA 2FDKA 4OI0A 4Q4X2 1ZBA3 4NIIA 4CCNA 5GLUA 1UZWA 2HWD2 4M0HA 1JODA 1NT0A 3AFGA 1EY2A 3GYDA 3DUIA 4LIUA 4Y22A 1NE6A 2YGMA 2A3XA 1S2EA 3LSEA 3M3CA 4QDRA 5AVAA 4HL0A 4OUEA 3POFA 2FQPA 3OGSA 3WDVA 5C7GA 1ULPA 1Q43A 3SEEA 3H8UA 1H9WA 2RJKA 3ZSMA 3A0KA 2WNVB 5F3IA 4AHZA 1W6NB 5IYYA 4QHOA 4IE5A 1PNFA 3POSA 5FIXA 4A41A 1QJY1 3CQOA 4LLOA 3AYDA 2YC2A 5T5OA 3HBKA 3QLQA 4MGSA 2KR2A 4B1LA 3H1MA 1RUI3 3IT8A 4NROA 2X5IB 4RGKA 4ONUA 5FDBA 4YM1A 2P34A 3MBWA 4CEWB 1L7RA 3TAYA 3DV8A 2VZ1A 3MFAA 3DYOA 3R4SA 3NSTA 5L9BA 1CN1A 1E5HA 2JE8A 1APNA 4A3ZA 4F83A 4Q0QA 4TTGA 4QX1A 4I3GA 4IERA 1PZ9A 5FPVA 5FYTA 1RJ7A 3KS7A 4ISRA 1QXRA 5FP9A 2NLRA 4N7IA 3PVEA 3DECA 3I97A 4UI9L 3POWA 4IE0A 3WF3A 4YSFA 1QH7A 3LDBA 5I0UA 1CAUA 3AJZA 3T30A 3GHMA 2WO3A 2A7AA 2RJ2A 2WQ4A 3AYEA 3W59A 3PURA 1LOEA 4N9HA 4P9LA 5JSRA 2OUJA 3NNLA 3BOPA 4IETA 5JAXA 3E5UA 3Q8CA 2EICA 1MPXA 2AZ5A 3K2OA 3QOPA 3KGLA 1UCXA 1VBC3 3HN1A 1EPWA 2EXIA 2IUWA 3PNAA 3BODA 1V00A 4QX5A 5A70A 4YWAA 1JI6A 1D2QA 1EUUA 1XOYA 3C3VA 3T09A 1F5FA 4FPEA 2HWF1 1JU4A 2CYFA 2E26A 3V56A 5FZBA 3HQRA 4M4PA 4PJYA 1IS5A 1SBDA 2QZ3A 5K0UB 1AYM3 2JE9A 2VAUA 4A4AA 4EN7B 1UIKA 3FHAA 1BVVA 3S5QA 1UY0A 4XFFA 2RV9A 3UYJA 2Q1FA 2P1BA 1OA2A 2CGNA 4Q1PA 4UFHA 3K51A 1RUH3 5FY9A 4QX8A 4CP1A 1MQTB 4W8JA 1H2MA 1K5MB 3U78A 4CDQC 5A3UA 3A7QA 3LEIA 3M3QA 5T54A 1JZ7A 1HRV3 1UMIA 3ACIA 4YM0A 4KI5M 5DMYA 5L7OA 1OLMA 4FPGA 3LDKA 1FPN1 3PL0A 1JXNA 2BTVC 2YZ4A 1LU1A 5IVVA 5A7PA 3ZKUA 3IAPA 1TNRA 3WHTA 5SV8A 3WW2A 5HXMA 2QE3A 3D3AA 2WZR2 4XF4A 3ZN4A 2X5IA 4XUOA 3CBNA 1WCUA 5I91A 3QH6A 1NZIA 5FO7B 3VBOC 2VOWA 3JB4C 4CEYC 1H8TC 3O0XA 4DXRA 4NWWA 1CGPA 4HPKA 5G05L 3DL3A 3WNMA 3R0RA 5BNOA 4AVTA 1QOSA 3NNMA 2EIGA 4LBMA 4R4XA 5T5JA 4CCCA 4W6XA 2BNOA 4Q0VA 1YFWA 4JX0A 4QXCA 2RVAA 2XR4A 1AF9A 1RXFA 3OEBA 4N7UA 3WEZA 3VB9A 1C3HA 4BJ0A 1B35A 3RWNA 2IXLA 4M3CE 2D44A 4E4HA 1WBFA 5CKQA 4MH0E 1W9YA 4DUVA 4M3CB 4Q8KA 2WQ8A 1BQPA 1YFYA 2AH2A 4XXPA 2W68A 3SMHA 1DZRA 4YZ5A 2NMNA 1U5IA 1XRUA 3ZYGA 2JB8A 4JDOA 4D6SA 5D21A 4AHXA 4OHWA 1VBA2 5IATA 1I6XA 5FZFA 3AK0A 3WNXA 1DYPA 4YVWB 1BBT3 1ZBA2 2P4EA 5EWSA 2ZPXA 3AM2A 2WNUC 1TNFA 1K12A 3CEWA 2PAEA 4OMDA 5ERLA 2P3KA 3U07A 3N9NA 4M3CF 4Y3OA 5BY5A 2IVIB 1VBE1 3AMPA 1NXMA 1O3RA 2WT0A 3H8XA 2V4AA 1JYIA 1RVF3 3WY6A 3ZFFC 3ZMNA 5I8YA 1UOFA 1W0NA 5C4WB 1MVQA 5FZOA 5C8CC 1H9PA 5EQUA 4PIYA 1UKGA 2PHXA 5LEJA 1H2LA 2R063 3G7DA 2W92A 4Q0PA 2O8OA 2ZGRA 3BTZA 5A6YA 2WFF2 2VZ3A 1RUI2 2YYOA 4LOSA 2GC3A 3I2GA 3USUB 3V64A 2GH8A 1F5JA 5FLJA 1H1AA 4UBHA 1EV11 4H3WA 3NJZA 4YVSA 2OT7A 3VBSC 1KD7A 1O59A 3ZN5A 5J09A 2B46X 5F3GA 4CU9A 2FDJA 2WSUA 2FCTA 3WOGA 4AWDA 4MXVA 1RGSA 4CDWC 5AC93 4AK3A 5BUVA 1VBB2 5FYCA 1SBFA 1DQ0A 1KFXL 3M4FA 3OGJA 4HANA 5J37A 3RZLA 4XBNA 4PBOA 3X29B 4ES8A 2LTNA 3OYWB 1OKOA 4QU2A 3ILFA 4GJYA 4LJHA 1S0GA 4GD4A 4CSWA 1N3QA 3B9IA 1AYN1 1IPJA 4JHZA 4Y1YA 1QXPA 4RR3C 1VBC2 4HSJA 4QPYA 4BHPA 1G86A 2DVFA 2R49A 3VKMA 5IT6A 2QQPA 1BYHA 3FMGA 4N53B 4XCBA 3KV4A 5I8TA 3CJIA 2RG4A 4JVAA 3NO8A 5JCTA 5IK7A 3GZUC 1AYM2 4X6RB 4AVAA 4HFSA 5CFDA 3O0WA 1UYPA 4B7KA 1LENA 2W95A 4S2HA 2DF7A 2BOJA 4PQQA 1LECA 1UZZA 4QXKA 1H1MA 4EROA 1REEA 4YZ1A 1O7FA 1ULDA 4C1XA 4K8FA 5JR7B 5A3TA 3RWKX 1RUH2 1S1AA 3HD8B 5E16A 1BMV2 2FMDA 5FXWA 1UZYA 1KRIA 2GN3A 3LE0A 4GWJA 1PZ7A 4QB2A 2JDKA 3B5LB 4P9WA 4Y1VA 5D8AA 3WT3A 4IEPA 5FZMA 3E6CC 5FMOS 2Y34A 4WVVA 1DLLA 3IDAA 4NHMA 1YIFA 1ZBE3 1ZZCA 2H6BA 4CDXC 3POGA 1KJLA 4H2AA 4JQRA 2YUEA 1HXS3 5CISA 2VMGA 3NJXA 1IKPA 4IEYA 4CDUB 4Z8BA 3DKQA 4EWAA 2BDRA 2QQKA 1SHWB 5E8AA 3MEPA 1O8PA 4TLGA 4GALA 1ACCA 1VR3A 4EN8B 3OSDA 4BOWA 1UOJA 4QX0A 2EVXA 1QJU1 1QOTA 3PVNA 3WZ1A 3MW2A 1UWWA 5F6LB 2N7GA 1LGCA 2NM1A 3KSCA 4NAOA 1D2SA 3BGAA 4NHLA 2Q8EA 2VZUA 5BPXA 3SH4A 3ACGA 2RR13 3LIHA 4IEWA 1F31A 4KGGA 1ALYA 4URTA 2P37A 3EB7A 5ANNA 5IW0A 3RYPA 4D69A 4D8MA 4NIHA 3ZSLA 4MHRA 4NJ4A 1BBT2 1RXGA 4CXWA 2C5DA 1W6OA 2OA2A 1RMU2 2JDMA 3HPNA 3FLTA 4CYDA 3EXUA 3GF6A 3ZXLA 3OBZA 4E2SA 4EN0A 4AG4A 3IPVB 2GMPA 2QCSB 4FI9A 5DAVA 1CIWA 1PMJX 3CIHA 3CJXA 3MLLA 4RS5C 4E8DA 1WA4A 1LEMA 3VBHB 3KCYA 1RVF2 3ZN6A 4G9SB 5KC6A 1RUC1 3T3YA 1S0DA 2WFPA 3GBWA 1ONAA 4YW5A 5BNNC 4MGTA 5FJKA 4P5HA 2Y26A 4MUVA 2BVBA 4RHV1 3ST7A 3RMXA 4CDQB 1RJ8A 4BK5A 4XJZA 4AI1A 1QQP2 2ZGPA 4NRQA 1HB1A 1UU4A 3A22A 4QKDA 5FYSA 4TLFA 2WLPA 1XYPA 1GUIA 2MHFA 2QQJA 2WS93 3ZFEA 5DAWA 4AAPA 5LY2A 3CF6E 4L0PA 2D6MA 3J8F3 2XHKA 3AP5A 4Y4YA 4XJAA 3LQCA 1RINA 3VBRC 5AC92 3DCQA 1ASJ3 1MS0A 1WMEA 2AUYA 1MACA 1S0CA 2VCCA 1UOGA 1G9FA 2FCVA 2CAVA 4LKFA 2C24A 5A7OA 5FYMA 1SEFA 3VBOB 3PJQA 1UX6A 1H8TB 1AHSA 3THTA 1VBA1 4CEYB 3O1TA 4K6BA 4ASKA 1VRH2 3LIGA 1WBLA 4LORA 2XVKA 3H3ZA 1Q56A 2VMFA 2B42B 4JHTA 4A7KA 2ATFA 2WWSA 3I2DA 4PIXA 3VZNA 3WQBA 4DXSA 2DCJA 3H3UA 4GWMA 4SLIA 4AEMA 4WM8B 3JD73 1I3HA 1U5XA 2D3SA 2W94A 4LK7A 3WDXA 2JDAA 1CZSA 1UMZA 4GWIA 4CCEA 1T6GC 3ORJA 4ATEA 3W5NA 4JKLA 3V0BB 2A6XA 3DF0A 3WG1A 4WVMA 5FYYA 2NP0A 4TXWA 1OOPC 1ODMA 1T6BX 5IVCA 2E7QA 1RUI1 2NYYA 4QX3A 2HWC3 4SBVA 3PDQA 4LBOA 5FMDA 2ZMKA 1LU2A 4BQ5A 3NV1A 1LCLA 4V2VA 4AEDA 1NX9A 5AVPA 5F1RA 2AGSA 1XSRA 5IVFA 1K3IA 1CJPA 2K2SA 5A1AA 3ZFFB 4LHNA 1DU3D 3J4UH 3LB9A 4I09A 4K1ZA 1YQ8A 4JRAA 4FQ4A 3V65A 4XAEA 5C8CB 5F2SA 1HXS2 5LBEA 1WKYA 2VVEA 4Q2FA 1VBD3 3AYCA 1TE1B 1X8EA 2HWB3 2LALA 2ET7A 5DABA 5JIUA 1JU3A 1VBC1 3VBSB 4K7JA 1Y43B 4Z82A 5JWPA 2P17A 4XABA 5J98B 4YGCA 2GMMA 1REDA 5A33B 2JKXA 1HDKA 5FBJA 1V6IA 3LA3A 4PLMA 4AI9A 4DXTA 5C3SA 1AYM1 4NAMA 4B29A 3ILNA 2GH2A 2RR12 1LR5A 1W8WA 3P5BA 4FFIA 4IGPA 3ECQA 5FZCA 3TN92 3N4MA 1RUH1 2B5HA 4E2QA 5IHRA 3ZSEA 1TMF3 3PUSA 2QZ2A 4RR3B 3SNMA 1HRV1 1PIV3 2MEV3 2CV6A 1LJ7A 5FZ7A 2ZOEB 3EQEA 3QBQA 4OYUA 4COUA 3NV4A 1Q8SA 3FE5A 2JEMA 5GZGA 3N9QA 3KT1A 2XUMA 5HCHA 1C28A 4AAXA 3BPSA 3C7EA 3APBA 2WNUA 3IIIA 2QQIA 5FY5A 4FT8A 1LB2A 1W6QB 4BQYA 5A6QA 3VKFC 1XPWA 5HCFA 2YU1A 2Z4FA 1PHMA 1UKRA 3A4UA 4IV1A 3V0AA 2VG9A 1OVPA 2JJ6A 4BXFA 3LOBA 2TEPA 4CUGA 1Q8OA 4IEZA 4NE9A 4LULA 5SV5A 3RSJA 5ABJC 5IVJA 2WS92 3HT1A 3I59B 2QQWA 1SDWA 2GZWA 4QQPA 3J8F2 1GP5A 4XURA 4FAGA 1FV2A 4PI0A 2WZPP 5JZGC 3KVBA 5FZ1A 1WLTA 2J1AA 3PMSA 4EQVA 4CDXB 1SCRA 4ATFA 3VHNA 5F32A 5DN2A 1N3PA 1XU2A 3OOXA 1GQHA 3HIFA 1UY3A 3B69A 3WNPA 1CAWA 2HEWF 3OEAA 3VD7A 1BBT1 4CDWA 5FAXA 1PVC3 2R072 2BWAA 1HB2A 4XE9A 1IKQA 3L9JT 4BISA 5FR3A 3NW4A 1NCQB 1VPHA 2G19A 2VM9A 5L7OC 3Q9OA 1H4HA 2QQUA 1LAJA 3NKTA 2BV4A 1IQAA 1N1VA 4NO4A 1CAVA 1CPMA 4H7LA 2V5DA 3J9SA 1RVF1 1SLLA 2Y0OA 5FXXA 1A8MA 5K9YA 4RYDA 3WQ1A 1N1SA 1FV3A 1SLBA 1YQ6A 4FTEA 1AR83 1D4VB 2PHUA 4R52A 1FATA 2BFUS 5KBFA 2HYXA 1WMFA 2R061 3R05A 3WUDA 2UWBA 4LUKA 1OPMA 1V6NA 5FZ6A 3FUQA 3ZIXA 5BNOC 3VGIA 2A71A 1KEXA 1UO9A 4LR4A 4NPLA 3FFQA 3RMYA 4MV2A 3NAPB 1JOJA 1OF4A 1Q5OA 1I5PA 1J3RA 1JHJA 1W6MB 1B35C 1VAVA 3LZZA 5FYIA 5JOZA 1MZFA 2EIDA 5AC91 5FO9B 5FQ0A 2JECA 2AEZA 2ZX4A 3VDDB 4YARA 1UF2C 2HH9A 2JG9A 5BNNB 2PELA 4L8QA 1AXYA 3OD0A 2IVJA 5FZ8A 1VBD2 3SKVA 3AC0A 4HKLA 2D6LX 1YC61 3NJVA 1PMIA 1SG3A 1QHDA 4FQZA 3AKTA 4A3XA 1ZA7A 2YG0A 3AXDA 2B4KA 3SH3A 4CP0A 4D7YA 5KC5A 1RITA 4J1XA 4L9BA 4FPLA 4QPGA 3DPRA 4B4PA 1QMJA 3H0OA 2Q8OA 2W9XA 3WF2A 3LCPA 5LCWL 4LITA 4FPCA 2VNGA 1W05A 2CGOA 1TG7A 3RNSA 2KM2A 3USSA 1CD3G 1J59A 2RS13 4XFBA 3OPTA 2UY9A 2A3YA 3AFKA 2NZ9A 1JOBA 4AOCA 1F4HA 1OC1A 4IESA 4ZZ5A 3O1SA 1FMD3 2YBKA 4QT6A 1VMFA 1TMF2 5A6ZA 5FZAA 2MEV2 1PIV2 5FZDA 3I2FA 1JYWA 4QX7A 3VZLA 4HVQA 5FBZA 3AZYA 4BPZA 2CWMA 1QDOA 4LBJA 4R9DA 4XUNA 4XTPA 1AR93 4YVSC 5JVVA 4AHWA 4RD7A 3WDUA 2P5BA 1IG3A 1V70A 3WF1A 1JYXA 2ZAAA 5C3RA 2BGOA 2QDRA 4O7XA 3BN6A 5FO8B 2PAMA 1ZBE1 3WG4A 4B8EA 2W87A 4OI1A 5FZ3A 1YHFA 4FPKA 1HXS1 2VZQA 4YFWA 3ZKYA 5IFTA 2GALA 3FWEA 1FPN2 4Q4W3 4RS5A 5I0RA 3TOJA 4HBNA 4BIFA 1OOPB 4A7ZA 4CA9A 1OD5A 1ENRA 1A8DA 1ND2C 3M8LA 3JQXA 1UQXA 3O1OA 4D3WA 3ZOIA 2ES3A 3PUAA 4LLFA 3OY8A 4NIDA 2G9FA 2VR4A 4MYEA 3WF0A 1V9U3 2GNTA 4DQAA 3MI8A 1OH4A 2ORXA 2BGCA 4HT1T 2VE1A 3AKSA 4NMIA 4PF1A 1IS6A 2J1VA 3JBG3 4O9GA 2Q30A 1KITA 2RR11 3J7LA 4I02A 3UT0A 3VKOA 3WUCA 4AI0A 5FPUA 1OBNA 1GOHA 1UW8A 2K9ZA 4LHLA 1LOBA 3UK9A 1D7PM 3WF4A 2WABA 4V1PA 4XF9A 4IGOA 5L9RA 3FX3A 3T08A 3VBRA 1W9TA 5C9AB 2GDFA 2QQVA 3JB8A 3N7LA 4HETA 2VUCA 1R083 1UY1A 3E1F1 4AEKA 1MZ5A 4Y22B 4Y5TA 5KXDA 4AQSA 3ZYJB 5GLVA 4DRVA 5D8AC 4QQ2A 1CVNA 2C4XA 4LQRA 4D94A 1ULGA 5HPOA 1VP6A 1X33A 1AR82 2DTYA 4BQXA 1JS9A 1XC6A 3LGRA 4NRMA 3K48A 3H7YA 4KU7A 2Q1ZB 1YO8A 2GP5A 3GZTB 4D6QA 5LBFA 4K9SA 3IIAA 2VCBA 2UURA 3M70A 3MLKA 1WCDJ 4N43A 2R1DA 2W1WA 3IDEA 1F9KA 4EE2A 4B4RA 1WMXA 1OQEA 1UXXX 2WS91 4TZDA 1OOPA 3O1MA 3J8F1 3WDYA 5A3LA 5GLZA 2VMIA 3NMBA 5IVEA 4DEQA 3B02A 4R4ZA 5FPZA 1ASJ1 2JDPA 2OPWA 4XC9A 4ASMB 1EV12 1CAUB 1LGBA 4OVEA 4XTMA 3W58A 1LKNA 4I3PA 2E51A 1PO13 1OVSA 1X9TA 5FMBA 4H7MA 2B9UA 4QXHA 2YMZA 4QD2A 1S2KA 2DTWA 3PU8A 4DINB 4W6YA 3MV11 1GWMA 3JD71 2ZZQA 1W8HA 2G4IA 4RGAA 2Y0IA 3I2OA 5JXGA 3I2KA 1O3QA 5C8WA 2GMEA 1GP6A 4O65A 1KQRA 2XGXA 1FMD2 2D5FA 4H55A 3INAA 2HWC1 2YPJA 5JXJA 3N7MA 4MOAA 4MADA 2VO5A 4WM7A 5FY4A 4MVTA 1OLME 3ZPYA 4I01A 5A32A 4UFIA 2BU9A 5L7OB 4YLZA 1AR92 4PLOA 1V6KA 3SXWA 1QIQA 3ZFEC 1TQ5A 1W2TA 2BERA 3E6BA 2Y60A 4XFGA 4FBFA 5FY8A 2CTVA 4FP2A 1AX1A 1HQWA 1M4WA 3UGFA 4C91A 3TEYA 2ZX3A 5K4LA 2AENA 2XG3A 4ES9A 4CPBA 3MFCA 4QM9A 2E32A 3LAGA 1VBD1 1GYKA 1U0AA 4HPKB 3MICA 2HWB1 5BNOB 3BTXA 4RQPC 4HK8A 2V72A 4Q4V3 1AL0G 2WT2A 4BLJA 3WD5A 2Q5TA 4QPIC 4Y20A 4CCLA 5FLIA 1LHWA 4Z92B 1IPKA 3BUCA 1IQDC 5CKNA 1YI9A 1LHUA 4JAAA 1MS3A 4Y33A 3POJA 2EXKA 1NQJA 1B35B 5LA2A 4DY5A 2BWCA 3W9AA 3WNNA 1BHGA 3LPFA 3A0NA 4LXLA 5JI7A 3GHNA 1C8NA 3JBG2 3ZYRA 1OPOA 1W03A 2VOVA 1QEXA 1GZCA 2D3RA 5ABJA 3ACFA 3IB3A 1EYBA 1QJU2 4NIAA 1PMHX 1W04A 3WHUA 3VD9A 1FX5A 2Z42A 1TMF1 5JZGA 2VUAA 2X53S 1OKQA 2XVGA 3OD4A 4LBNA 2MEV1 1PIV1 2PHLA 3AP6A 5I0DA 1YWKA 1UYYA 2OVUA 3A23A 5CFCC 2GNDA 5L73A 3SISA 4RA0A 4R9CA 1GANA 4AEDC 3N35A 1S2BA 1WCKA 2A6WA 4ARYA 4YW4A 3B7MA 5FP4A 1ZRRA 5F5QA 2ZKNA 3NV3A 5F8PA 1NCRC 5FZOB 4TWTA 2O1QA 3CO2A 1VAKA 3U4SA 1DGWX 3VN4A 1OF3A 5KXCA 5KHHA 3M1HA 3RS6A 3I2JA 1PZ8A 5APAA 3AZWA 1H8VA 2WN3A 1H6XA 2BQPA 3U14A 1W9FA 3C7FA 4XDPA 1CESA 5C5UA 4IEXA 1DZTA 1RUC2 4ZS3A 5F3CA 4YVSB 3KHCA 3MW4A 2PTMA 4AVBA 2RS53 2Q8CA 2WIIB 1A6CA 3HQXA 4RHV2 1XNDA 3D82A 1W2NA 1QJX3 2F4LA 5KHKA 5FRAA 3WP5A 1N47A 4DRRA 2VQAA 4XJUA 4XEZA 5FYUA 5C33A 2WZ8A 1JZ5A 3EYPA 3AKPA 5EJ1B 2HEVF 1NLSA 1ZREA 3DXTA 2AC1A 2CSGA 4BMBA 1GICA 1VE0A 2RS33 5IJRA 4XBLA 1PVC1 2C9AA 3WX5A 4BLIA 2VXJA 3H8RA 2ZHKA 4S2FA 2JB4A 2OQ6A 1ZRFA 3B94A 4XPVA 4GA9A 4AQ6A 3C7OA 5I8SA 4PDWC 2YBPA 2HEYF 3CJIB 1NE4A 4IV3C 1PM4A 5F37A 5CNAA 3T1LA 4NPMA 4PQ9A 5FV3A 1AJKA 1SLAA 4GULA 1W8OA 2DFCA 4Y26A 1AR81 3VZMA 5CFDB 5F5CA 2VW0A 1OT5A 3ZXKA 3C7GA 4Y4RA 5JPMB 1U5YA 2WT1A 3O1VA 3KF3A 1NLRA 4XF3A 1C57A 3TBDA 3CU7A 4BM8A 3DYMA 3IBMA 3MIFA 3KLSA 4IV1C 2VZPA 4DZGA 5F7UA 2WJSA 1H1IA 3KM5A 3BKZA 2JDUA 2VJXA 5D8AB 1AR63 3ILRA 1PGL1 3K4AA 4FXGB 5ACA3 3AVRA 5T50A 1GU3A 2XJPA 4CU6A 5LRSA 2GSYA 4XF1A 1YQ2A 4YW7A 1HQLA 4HXCA 3I4IA 4FOVA 2VY0A 1COV1 1SFPA 3MIDA 4E27A 4Q4V2 1SACA 5JOWA 1X7NA 4WV8A 2HKXA 3MIGA 1AUYA 1R64A 3M3IA 2DBIA 2FHRA 5LRRA 5DUWA 4DOUA 4E8CA 4GB33 1EAH3 1QKQA 2B8MA 1ZX5A 1VMHA 2ZKLA 1ND2A 4GKXA 4KBBA 2J1TA 2EXJA 2JDYA 3ZO0B 2RS11 5AFEA 4E4ZA 3JCIA 1UYZA 4LNVA 1FMD1 1W2OA 1MS1A 5H9SA 5LZ6A 3PTRB 1C4RA 2XONA 1W6OB 2VMCA 2V73A 2WZEA 3ZXFA 2DVBA 3RYKA 2ZACA 4MGKE 2BNMA 1JUIA 1YLLA 2D93A 3VBFC 2E7AA 2DU1A 1AR91 3DXUA 3QCWA 3R6SA 5EPAA 3UKVA 1QU0A 1ULCA 2NPIA 4EWEA 2X09A 1GKBA 4INDA 2FCUA 2QFEA 2QTWB 2PHFA 2VNVA 3K77A 1GMMA 2XJUA 1HRV2 3ZN6B 3SHRA 1FYUA 4BQ3A 2CGPA 2ZHMA 4OZOA 1RL3A 2ETEA 3T0BA 3GBFA 4XJ8A 5T52A 2JG9C 1XNCA 2VUDA 1MS9A 4NHKA 4Q4W1 4TN7A 2CDPA 2VGDA 4MLOA 1BJQA 2ZJCA 5KXEA 4O9EA 2OKXA 5DAPA 2ZMLA 3O0VA 3U4XA 1ZZ7A 1XU1A 2CL2A 2XLAA 4DY3A 5GLWA 3BTYA 2WKKA 5F3EA 4MZUA 1HV1A 4UXAA 1GNYA 1ND3C 3JZVA 1BXHA 1SLCA 4JZRA 4XFHA 5FKCA 3ZFEB 1V9U1 4QPGC 4D7SA 1NA1C 3DPRC 1W0PA 3L2HA 1TZOA 1ZVFA 1QJX2 2VOXA 3WINE 2UYBA 3I2HA 1LHNA 1OUXA 2EIBA 2ZXQA 3JBG1 1VJ2A 1UOBA 3FN9A 2XLFA 1W3VA 3NV2A 2W47A 4CP9B 5A7SA 1W9SA 3UL2A 3H9AA 3T2PA 2RS32 4B4QA 4K1YA 2FDGA 4L92A 4RN5A 3P6BA 3CZUA 3N9OA 4JGYC 4KNCA 4QPIB 5LBCA 1R081 5C3PA 5L36A 1PK6C 2AYHA 4CPBD 4Q4Y3 3RI8A 2GAUA 3OTFA 4L99A 1OI6A 4UBGA 2KA3A 2ZTNA 4LBQD 4YYOA 1E57A 4ISQA 4EN6B 3B9CA 3T4VA 3ZDSA 1DGLA 5IK4A 2XPJA 2ZEXA 1HRI3 2ARXA 3IM0A 4GAZA 4CE8A 3ON7A 1ZZ6A 4K20A 4WVMB 2YV8A 3OUIA 4LO8A 3R4UA 2XKOA 4YNIA 3UGHA 3GALA 5DZEA 1LODA 2QQNA 2A6ZA 1RUD3 3HJRA 1N1TA 4JQTA 4R8HA 4HN0A 4R9BA 3KV5A 1HB3A 1GWKA 1MEC3 2EALA 2PHRA 2YC4A 3AZVA 3EMRA 4I0AA 4XZUG 5LK5A 3RPQA 4AEDB 3UNPA 2R062 3VDAA 3KT4A 2Y6KA 2BZDA 3AL5A 2DVAA 4XAAA 2EAKA 3LA2A 2WN2A 5KHJA 1LRHA 5H9QA 5ISLA 5ACA2 4LKEA 1OA3A 1OURA 5KXBA 3SLIA 2ZGTA 3RZJA 2IWGB 1GNHA 1T2XA 5FZEA 1AXZA 3PUHA 5DPNA 3O14A 1LESA 1DQ4A 1PO11 5FK8A 1H30A 1HB4A 2ENRA 3AKRA 4QDQA 3K3OA 4DNYA 5DG2A 4BZ4A 3ROUA 5CVRA 3TWIA 2UY8A 4CP9A 1MS8A 2BGPA 1PGSA 1JH5A 1BK0A 1SZBA 2TUNA 2WUHA 4GB32 4LO6B 4RFT0 5JUVA 4DUWA 4DO0A 4RQPA 1BEV3 2JX9A 1NY72 2WO2A 4OCTA 2J1UA 2D97A 1Y7BA 4QPIA 4YZ4A 1UY4A 1RUG3 1OH3A 4XMAA 4BQ1A 5CG9A 1N3OA 1NQDA 1SLIA 2V4VA 4OHVA 4BA6A 3MPPG 4N43C 1W8TA 4COYA 4FXKB 1NUKA 5JOYA 1W3XA 5HBAA 3RZHA 2GN7A 1J1TA 2VMDA 2GC0A 2YPDA 4YFZA 4FFHA 5JLVA 4ZS2A 2ZA9A 4YM3A 4IXLA 3WNLA 5BYNA 2IXCA 2VW2A 3I3DA 1SLTA 2WNUB 1C8M3 1WW5A 4KL1A 1GZWA 4QB1A 4A45A 1YUDA 4ZKTB 3URFA 5CFCA 5C3QA 4BU2A 5BNPA 5FPLA 3GCXA 2WO7A 1KDKA 1W2AX 5KHIA 1FNYA 1UMHA 4Q4V1 1SCSA 3MHZA 2XXZA 3TEWA 2E9QA 4G4FA 1ZBE2 2YU2A 1NCRA 2TBVA 4IV1B 5IK8A 3V0AB 4HZFA 3OGGA 4PBPA 4FO9A 1G9AA 3GZAA 3KHBA 2O0OA 3N9LA 3MUZ1 3QD6A 2DCYA 1DQ2A 1ZRIA 2JENA 4M0NA 1AJOA 3JXSA 1DYKA 3A21A 4NWVA 4JKMA 3WCSA 3NNGA 3I54A 1ZYBA 1DQ1A 2MPFA 2LS6A 4AGRA 4W50A 2JWPA 5GZFA 2D6PA 2RDSA 2WA3A 5A7QA 2VZOA 5EYYA 1UY2A 3TNQA 1CAWB 1MVEA 1S0IA 2Z79A 3T0AA 4CDWB 2ZGSA 1JYTA 4A2UA 3GM8A 3HQUA 4WM7C 4COZA 1YJLA 1XE8A 5EYXA 1W6PA 4BMEA 1HLCA 3POIA 1O4YA 5JSOA 2VVDA 2DCTA 1CAVB 5LA1A 2XH6A 2A3WA 4YW2A 3VD5A 1PGW1 3CLPA 2XHNA 4ZONA 2A1XA 2W91A 5IK5A 4LKSA 5J7MA 4PDWA 1HRI2 2OPKA 2XJTA 5DZFA 4PT6A 3ZMOA 4IV3A 4LO4B 4URAA 4YW6A 5FZKA 3FHIB 1EUTA 2B39A 3BTAA 3EO6A 3Q8AA 1MEC2 4P9IA 3VBFB 4Q29A 4CEYA 3UJOA 1D0HA 2RS51 3ELNA 4LHSA 3SITA 2WNOA 1LOFC 4OLLA 3PIJA 2H0VA 1IS3A 2ZHNA 1U12A 2RJLA 4NOTA 1CWPA 5DDJ3 1QJX1 4HONA 1Y3TA 3I8TA 5C71A 4UFJA 3ZIWA 2GU9A 4X6QB 5FQ0B 3MO4A 2RM23 2JG9B 3ACLA 5A3OA 1W28A 4E2GA 2VOKA 2RS31 4P14A 2A5ZA 5LK7B 1W06A 4FFGA 1O6UA 1PO23 1V6JA 1ASJ2 1ST8A 3KCXA 3LFMA 5T5PA 3IMNA 2W39A 3MF9A 4L2NA 4RFRB 4ZU4A 2JDNA 5FZ4A 3LD8A 5FZHA 1S0FA 1LGNA 1ND3B 5B4NA 4Q5OA 1KDMA 4QPGB 1OQDA 1BEV2 1NZCA 2DUQA 1J84A 3DPRB 3L2YA 3OPWA 4YG6A 5FCCA 5FP7A 3BYWA 3ZYIB 5KR7A 4GKYA 5HV0A 4PCRA 1GZ9A 1UD1A 1RUG2 1JZ4A 1QJEA 4MX3A 2QKDA 2JDZA 4XUQA 5FZLA 2YXSA 4MGIE 5FYHA 2CU5A 1XBFA 3FZ3A 2FD8A 3JD72 1F15A 4KQ7A 5FXZA 3HR9A 4FPFA 4DMIA 5FY7A 5C70A 4XDQA 3AKQA 5CKMA 4CCKA 2GC1A 5FOJB 4ZU7A 3VUOA 4UW6A 4BDVB 1MZ6A 2XB6C 4UFLA 5F5IA 4QKFA 1AR61 5GKAC 3FUOA 2CHHA 2HWC2 2ADDA 5ACA1 1C8M2 2R1BA 3LEKA 5IWFA 3AVSA 3VBFA 5F6KA 1ZZBA 3ACHA 2E33A 1DGRA 4XMIA 3MPBA 1AR73 1FNZA 4LE3A 5FYZA 2XJQA 1WD4A 4RS5B 3TNPB 4AI3A 5A3PA 5HCAA 3J7HA 3WLUA 4F7ZA 4N9IA 1STMA 1JN2P 1XNKA 4Q0SA 3UJQA 3BALA 4AF9A 3OBRA 1KS4A 3FJSA 2GNMA 3ZLIA 5FKBA 4CEWC 1XNBA 1O4ZA 2PQSA 3ENRA 1XE0A 4GB31 3OY8B 5FJHA 1GOFA 2SLIA 5FWEA 3U10A 1L7LA 5IVYA 3VL9A 2HWB2 1COV3 1EAH1 1NKGA 1IS4A 1NY71 1QF3A 1ULOA 3B93A 3LEMA 3H50A 5CAZA 4MG2A 4V2WA 2XVLA 3C2UA 2BP6A 3AXEA 4WBBA 3ZVXA 1POV3 3LEGA 4WVWA 4AVCA 1H2KA 1LHVA 1ND3A 3RGBA 4Y1XA 2FBEA 5BNQA 3RG0A 2FZ2A 1TME3 5HI0A 1NA1A 4DB5A 5EXOA 1E5SA 3RYRA 4IEVA 4LTAA 3VBRB 4ITCA 1VMJA 2BJSA 1P8JA 3HOBA 3HWJA 2XJRA 4A6SA 4AW7A 1OSGA 2XL7A 3BB6A 5FMCA 3H1WA 5D1IA 3PVBB 5FPXA 1CX4A 3PTYA 3FFZA 4DXZA 1QGLA 4N90A 2OX0A 3IZOA 5K0UC 4JGYA 1X82A 4ZHNA 1R1ZA 2ZGQA 1PK6A 3HNBM 2W08A 5A3MA 4JDNA 1OFSA 2R16A 3PUQA 4HLTA 1LOAA 1CAXA 4JTOA 3VL8A 4AI8A 2BBVA 5FK7A 4XUPA 1ENQA 4Q4X3 5E88A 5JMOA 4N43B 2R043 1WLCA 2HWD3 2XJVA 1YEWA 1YQCA 5T55A 4N8MA 1NXD1 4LO5B 3D6EA 1CJDA 1J83A 1WWYA 4F3JA 2Q1MA 2HWE3 3RI9A 2JG8C 5CIRA 4LHKA 2DWRA 4LA2A 4FVVA 4BH9A 4X8PA 3LFIA 1Q8QA 2RM22 2E7TA 4XETA 4QAWA 4FPJA 5K8SA 1SBEA 4LIVA 1CQ9A 3KQRA 4JGZA 1WA6X 2LUWA 3MGUA 5FYBA 5G04L 3IDCB 1PO22 3MDPA 4IDZA 4W6WA 3SQOA 1BCXA 3CL1A 3PU3A 1X50A 2QQLA 4Q4Y1 3AP9A 3ZYBA 4DPNA 1O3SA 2ERFA 2XDVA 5IAVA 5J3UA 4AE2A 4QB6A 4UT5A 1YFUA 3AX4A 2ZGMA 1PVC2 4CXXA 1JOPA 5CU1A 4CUBA 4AZZA 3UKTA 3B3QE 4UFMA 1YYNA 1HRI1 3D0JA 3O7OA 2DURA 1OD3A 5FOBB 1X8MA 2ZEWA 2W52A 5A7NA 3VV1A 3POYA 1Y9QA 2NMOA 4L97A 2BVVA 1RUD1 2VTFA 3T2QA 4BQ2A 3OUJA 5A3NA 2Z69A 5J96B 2ARCA 2UWCA 1MEC1 4NRPA 2WDBA 4WM7B 1DQ6A 5F2WA 3B01A 5A32B 5GZCA 5JSPA 2PYTA 5FZ0A 4CUAA 4AGVA 4A44A 1VB2A 3IN9A 1G8WA 1LTEA 3UETA 2WRAA 1JZ3A 3S0MA 1UU5A 4R9AA 1V6MA 3ZR5A 3PJYA 1UPSA 1KS5A 4GQ7A 4GZ9A 1JMUB 4L11A 1G6NA 1W8UA 1XNAA 3E5XA 4LBKA 5C4WC 5M0TA 5ANQA 3ATGA 2VBDA 1RHI3 5FTTC 1AR72 2EF6A 2IXIA 3TEXA 5JI9A 4LBQB 2A73B 1PGL2 1WUVA 2WINB 2WC2A 2DDUA 3HNYM 4J6GA 1HQNA 4Y20B 2PA7A 1O4TA 3RQ0A 4QQOA 5CB7A 1BEV1 3KB5A 3WW3A 1COV2 3U37A 3NKGA 2WZR3 4M4RA 5K7PA 5C5TA 1W0OA 3VDBA 2EA7A 1RUG1 2DFBA 4XFIA 2ZEZA 2PMWB 2DYCA 5ABJB 4EJRA 4YZ3A 3J7MA 4QXBA 1TME2 3THDA 1OFNA 3CDZB 2HBTA 1YQ5A 1YRZA 1NOVA 1G7YA 1HX6A 5JZGB 2A6VA 2OS2A 1FOD3 4M01A 3I49A 4CU7A 4NUBA 3AYAA 2RS12 2J42A 2ILMA 2PHWA 2I07B 4LOTA 3RJRA 5F9TA 5KWRA 4D6RA 1D4M3 3RJ2X 1NAEA 1UPIA 1VLNA 2W0XA 3HBZA 1GLHA 4LA3A 2ZX1A 1C8M1 3NL1A 4U36A 4DEVA 2PHTA 3LWCA 1URXA 2ZGKA 5EHDA 4Y5Z0 3VHRA 2YFZA 3WDTA 1HKDA 2R042 4IQPA 4P9XA 4CCOA 3DEMA 1GSLA 1OQ1A 3DKWA 3VBUA 3O12A 3HAGA 3O1PA 2X8KA 2ZZJA 1C5HA 4Q4W2 3BCWA 4Q27A 2C0ZA 3T1MA 3HVDA 4QX2A 2HWE2 4LBQA 5FFOC 3ZFGC 5JXIA 3RZKA 3AZXA 5LATA 2VUJA 2PXJA 1MS5A 4P9JA 2WR9A 2AACA 1WMDA 5EP9A 2ZBJA 2BYVE 5FZIA 1LOFA 3GGLA 3OJBA 4CDUC 1DBNA 2VZRA 1JBCA 3W20A 1PM7A 4IEQA 1V9U2 2Y6HA 3WP4A 1C1LA 4QM8A 1ZRDA 4OFGA 2WFF3 5H9PA 5JIAA 4FSJA 3HEIA 3RZZA 4MXWA 1WGPA 4GH4A 3OGVA 4FFFA 1QY4A 2WAAA 4COVA 1XYNA 2VQTA 4XF0A 4ARXA 2JD9A 1YJKA 3VZJA 4UW4A 4C0HA 1I5ZA 2D6KA 5FWJA 4Q1RA 1HJGA 3E97A 5HV4A 2OIIA 4CCJA 4YM2A 3VHOA 3U1XA 4WZCA 1AL23 2CWSA 1VBB3 3MLJA 4QGNA 3WR0A 1ZNPA 1R082 2FDFA 4KH9A 5I93A 2Y38A 3AJYA 1OMIA 2WAOA 5BNPC 4OQ8A 4JTNA 4MGQA 1JUHA 1RTVA 3N7JA 5E6HA 3KD4A 2AR6A 4AFMA 3N36A 2R0HA 3NQHA 4EWDA 1YFXA 1Y9MA 3ABZA 1WZXA 3U75A 3UKNA 1PX3A 2Q4SA 4NHYA 1DIWA 3WNKA 3U11A 3MYXA 3RZMA 5DDJ1 3VBHC 4I30A 2VW1A 5LASA 2PLV3 3OG2A 5A80A 2RM21 4QPWA 5GZEA 1J3PA 4Z2AA 1RHI2 4PHZA 4UWDA 1BKZA 1I9RA 1UN1A 3K75B 4OI2A 4Q0UA 2P3JA 4ZY9A 2BNNA 4E4SA 2VD7A 5LBBA 2JDHA 1PO21 1LHOA 4YW1A 2ZEYA 2WNVA 5GM0A 1W6NA 4JKKA 2YDEA 1XB9A 4NIGA 1Z78A 2HYKA 4OUSA 1X9PA 1HIXA 1PO12 2JG8B 4QDSA 4META 2MNGA 3BU7A 4XFAA 1ND2B 2A6YA 4HG6B 4CEWA 4XVHA 2RDRA 1U5ZA 1XXNA 2D3PA 1POV0 2VZTA 2XBO3 1OA4A 2OXBA 4F8AA 1IG0A 2ET1A 1US3A 4M00A 1K5JA 4CXYA 2PHDA 1FOD2 1BLZA 2HJIA 2XOMA 2YC0A 2ZX0A 5FYVA 3T2TA 5IAXA 3MZHA 1Q3EA 2ZX2A 1WW6A 5FP8A 5FUIA 4KG0A 2C26A 3AP7A 2X29A 2D5HA 2WA4A 1D4M2 4JV4A 4WM8C 5CBLA 2DV9A 3P3NA 2D7FA 2VTXA 3MV01 4MGZE 3VHPA 2SBAA 3HNMA 5EFUA 2ARBA 2BEOA 1ULFA 2DVDA 3OGRA 1G9DA 1RB8G 3G6JB 4AFBA 3SCGA 4AR2A 2IC1A 4KWUA 1AR71 3P1IA 1C5IA 1S0JA 4YW3A 1LEDA 1DLCA 2BRTA 2VTXJ 4D7TA 4KMQA 3I3MA 3K4DA 5K0UA 4LMFA 2CDOA 2BW8A 2QQMA 4NPRA 3W21A 3ZYPA 4HK9A 1R1A3 2J7MA 3GJBA 3UGGA 1UXZA 1RMU3 3C7HA 5FUNA 1PVXA 1NYWA 4QGMA 1YNAA 3KMHA 4CVUA 4BXSV 1XQNA 4P00B 5HCBA 1V6OA 4GJZA 1RUE3 3NRUA 3JQWA 3SCHA 2J1SA 3PLQA 1J58A 1DG6A 3GZEA 1MQTA 4XILA 1K5MA 1SFYA 3M3EA 5DG1A 3WP6A 3PMEA 5DUVA 3VZKA 4FTSA 1POV1 3HT2A 4K8RB 1CZVA 2EIEA
chains in the Genus database with same CATH topology
2FCUA 5C5UA 5IATA 4NHKA 2HBUA 5HV4A 4NAOA 4NHLA 2OPWA 4XABA 4XC9A 5DAPA 3OUJA 5ERLA 4MHRA 4JZRA 4Y5SA 4NHXA 2V4AA 3OBZA 5DAVA 4NHYA 5EQUA 3BVCA 5M0TA 4XCAA 2Y33A 4MHUA 5L9BA 5LASA 3KT1A 4ZPIA 5LBCA 4UWDA 2RDSA 5L9VA 2FCTA 3NNFA 5LBBA 4BQYA 5LA9A 3HQUA 3NNLA 5C5TA 5DAWA 2HBTA 3OUIA 4ZONA 2A1XA 2FCVA 2RDNA 3HQRA 2RDRA 4BQWA 3EMRA 4XCBA 5DAXA 2RG4A 3KT4A 5LB6A 4IW3A 5IAXA 4XAAA 4NMIA 5A3UA 4J25A 3GJAA 2G19A 3PL0A 5L9RA 2JIGA 3NNJA 2RDQA 3KT7A 4KBZA 5DAQA 4Y5TA 2JIJA 3W21A 3GJBA 2Y34A 4NHMA 3NNMA 5LATA 2G1MA 3ITQA 4Q5OA 3MGUA 4BQXA 3OUHA 3GZEA 5EP9A 3DKQA 4XACA 5HV0A 5LBFA 3W20A 5EPAA 5LBEA 5IAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCU A;  5C5U A;  5IAT A;  4NHK A;  2HBU A;  5HV4 A;  4NAO A;  4NHL A;  2OPW A;  4XAB A;  4XC9 A;  5DAP A;  3OUJ A;  5ERL A;  4MHR A;  4JZR A;  4Y5S A;  4NHX A;  2V4A A;  3OBZ A;  5DAV A;  4NHY A;  5EQU A;  3BVC A;  5M0T A;  4XCA A;  2Y33 A;  4MHU A;  5L9B A;  5LAS A;  3KT1 A;  4ZPI A;  5LBC A;  4UWD A;  2RDS A;  5L9V A;  2FCT A;  3NNF A;  5LBB A;  4BQY A;  5LA9 A;  3HQU A;  3NNL A;  5C5T A;  5DAW A;  2HBT A;  3OUI A;  4ZON A;  2A1X A;  2FCV A;  2RDN A;  3HQR A;  2RDR A;  4BQW A;  3EMR A;  4XCB A;  5DAX A;  2RG4 A;  3KT4 A;  5LB6 A;  4IW3 A;  5IAX A;  4XAA A;  4NMI A;  5A3U A;  4J25 A;  3GJA A;  2G19 A;  3PL0 A;  5L9R A;  2JIG A;  3NNJ A;  2RDQ A;  3KT7 A;  4KBZ A;  5DAQ A;  4Y5T A;  2JIJ A;  3W21 A;  3GJB A;  2Y34 A;  4NHM A;  3NNM A;  5LAT A;  2G1M A;  3ITQ A;  4Q5O A;  3MGU A;  4BQX A;  3OUH A;  3GZE A;  5EP9 A;  3DKQ A;  4XAC A;  5HV0 A;  5LBF A;  3W20 A;  5EPA A;  5LBE A;  5IAV A; 
#chains in the Genus database with same CATH topology
 4CCD A;  5CEH A;  1TME 1;  5JPN B;  1AZD A;  1CPN A;  4B1M A;  2JG8 A;  1VB4 A;  1QWR A;  3KVA A;  1CON A;  1WW4 A;  2DUP A;  2VU9 A;  4FOW A;  4EZH A;  3AL6 A;  1QQP 3;  1JYV A;  1H0B A;  4IE6 A;  1JYN A;  2E63 A;  5LY1 A;  3ETP A;  1WCS A;  3MIH A;  2XL9 A;  1O5L A;  2RMU 3;  2YB7 A;  3ZYF A;  5JXH A;  2G9Z A;  3BPZ A;  4I0W B;  2RE9 A;  2W2I A;  4JCK A;  1HN0 A;  2B9V A;  2FMY A;  3ZXA C;  4RL7 A;  1AL2 2;  3WG2 A;  3LPG A;  1UZ0 A;  1NLQ A;  3ES4 A;  2IFW A;  4XDO A;  2J1R A;  1HV0 A;  5FRE A;  2C6S A;  4IEO A;  3ZSK A;  1KJR A;  1Z7S 3;  4M3C A;  4X8N A;  1VRH 3;  4A42 A;  3KZ4 C;  4U2A A;  5FXV A;  4AQ2 A;  2XWB B;  4Q4X 1;  4TYS A;  1PGW 2;  2R04 1;  2DCK A;  2HWD 1;  4K3U A;  5DZG A;  1BVP 1;  2X05 A;  3T4H B;  3OBA A;  3LSD A;  1MR5 A;  4DFS A;  3ZXD A;  5LWB A;  1GFF 2;  2HWE 1;  3CMG A;  1PX4 A;  4PIZ A;  1YIP A;  4YVW A;  2O8Q A;  1UZV A;  1O3T A;  2PLV 2;  5FY1 A;  2ADE A;  5FUP A;  4HKO A;  4IE4 A;  4YGD A;  5KHG A;  1ZZ9 A;  3GNE A;  1YI7 A;  2RS5 2;  2XLG A;  4P02 B;  4FOQ A;  4QU1 A;  5H9R A;  3N9P A;  1E5R A;  4HKW A;  4D0Q A;  3I3B A;  5J1X A;  4QHZ A;  1WW7 A;  2OQ7 A;  5C4W A;  4JDM A;  1UNB A;  5EZW A;  3ZXE A;  4DIQ A;  1I1E A;  1GOG A;  1O5U A;  2D43 A;  4UFK A;  2P3Y A;  4K40 A;  4FP3 A;  2W46 A;  1XJA A;  3AP4 A;  4RGG A;  3M3O A;  5CG8 A;  1RUJ 3;  3BOW A;  1HJF A;  2LW8 A;  3ZFG B;  1W9W A;  2JIC A;  3N3H A;  4RQP B;  4BQ4 A;  3ZR6 A;  1UX7 A;  2K46 A;  1S4C A;  1WLW A;  5DAX A;  4ORF A;  3USU A;  4XOG A;  2CNA A;  2NQY A;  3ETQ A;  3H1Y A;  2XML A;  5JR2 A;  3S57 A;  4COW A;  1RUF 3;  2XBO 2;  3QH7 A;  5I0T A;  4FPH A;  4QQL A;  1UL9 A;  1EPZ A;  2BBA A;  2C1F A;  5A1L A;  4J25 A;  3FLR A;  1NG0 A;  3AMM A;  1OLQ A;  3Q8B A;  4Z07 A;  1PNG A;  4OUL A;  5FLH A;  3S30 A;  2K0G A;  2VCM A;  2IXJ A;  4LKD A;  1NCQ C;  3IMM A;  1IPS A;  1RYY A;  3OYW A;  3R4D B;  4YG0 A;  1AVB A;  1GNZ A;  2JIG A;  3CKH A;  4GMP 3;  4IUG A;  1F4A A;  1HW5 A;  2VUL A;  3H8O A;  4Z1V A;  2R7E B;  4IL7 A;  3EJK A;  1AX0 A;  4KBZ A;  4YGB A;  5FY0 A;  2Y6L A;  2VME A;  1ZRC A;  4MO3 M;  3H42 B;  3DGT A;  1GZW B;  4CP2 A;  4YGE A;  3OF1 A;  1RHI 1;  2VEC A;  1R09 3;  2YFU A;  4N53 A;  3TN9 3;  4C8D A;  5CFC B;  5BNP B;  1BK1 A;  3K4Z A;  2ZGN A;  3D5O A;  1AR6 2;  5JMC A;  1R1A 2;  2UYA A;  4JGZ C;  4ZU5 A;  2F17 A;  4AFD A;  2VCA A;  1NCR B;  5DUX A;  3NAP C;  1RUE 2;  2JXA A;  4LT5 A;  2F4P A;  4S2G A;  4AFA A;  4LK6 A;  2FDI A;  2QBX A;  2WZR 1;  4K21 A;  4NR1 A;  2Z2S B;  2VBP A;  2XWJ B;  5E89 A;  5A7W B;  1CX1 A;  4AEJ A;  3VDD C;  4AXO A;  3S7E A;  2ZGL A;  3RDI A;  4OUM A;  1GQG A;  1LNS A;  3RVH A;  2FZ1 A;  3UES A;  3ZFG A;  2WYS A;  2G9G A;  1EAH 2;  1FOD 1;  2QVS B;  2EXH A;  2W1S A;  3DN7 A;  2PQQ A;  1DF0 A;  4ASL A;  2Q0A A;  2VQU A;  4P9G A;  2RMU 2;  2VQ0 A;  4XQW A;  4CDU A;  4NHX A;  1DFQ A;  2HLE A;  1RUO A;  4QHB A;  1W6P B;  1D4M 1;  2WBK A;  3TEZ A;  2W1U A;  5FP3 A;  2OZ6 A;  1Y9G A;  2DVG A;  2ZGU A;  2Y6G A;  3LKJ A;  2VNO A;  1POQ A;  3F95 A;  4FPO B;  5FMO L;  1XNT A;  1J1L A;  2Y33 A;  4PDW B;  3WW4 A;  2WYF A;  1DCS A;  2B45 X;  4WZF A;  1Z7S 2;  4I0B A;  4IV3 B;  1N1Y A;  2A70 A;  1OUS A;  1ZBA 1;  2DBN A;  4LEJ A;  4Y1U A;  5D2A A;  4ZXE A;  4AL9 A;  4DUX A;  2D98 A;  2R07 3;  3EBR A;  4EYU A;  1DDL A;  4EN9 B;  1G9C A;  5L9V A;  3WCR A;  1D0G A;  5EIY B;  3I3Q A;  1L7Q A;  5I0S A;  1XE7 A;  4Y1Z A;  5LA9 A;  3RFR A;  2LRO A;  4A7Y A;  2DU0 A;  2Q8D A;  3D4K A;  4HOO A;  3AMQ A;  1ODN A;  2XJS A;  4KU8 A;  3ASI A;  4AYU A;  1XSQ A;  3RZG A;  2VOT A;  1V0A A;  3N7K A;  4HVR A;  4BYY A;  4OHY A;  3IPV A;  1UU6 A;  4AVV A;  2WNE A;  1MS4 A;  5TSW A;  1A3K A;  4DS0 A;  4XW3 A;  3WQ0 A;  3VBH A;  1REF A;  2WFF 1;  4FAH A;  3U0Z A;  1IGO A;  5A7W A;  4P5Y A;  2CAU A;  2Z5W A;  5CAD A;  3GBG A;  3AMH A;  4XUT A;  4XQ4 A;  2BOI A;  1GP4 A;  4KWK A;  3ZX7 A;  1S0E A;  5LA0 A;  5FPB A;  1G9B A;  1SQ4 A;  2NN8 A;  1ZM1 A;  3IKW A;  3D8C A;  2WWU A;  5LB6 A;  1KFU L;  1RUJ 2;  1QJY 3;  4CDQ A;  1S0B A;  4B3N A;  3AMN A;  3SH5 A;  2BUK A;  5LW9 A;  3KCC A;  1AL2 1;  1VBB 1;  3ZDV A;  4I2O A;  2V5Y A;  2OZJ A;  2L9L A;  2Y6J A;  4Q4Y 2;  1AXK A;  1RUF 2;  1KXG A;  2Y6F A;  2W5F A;  4KGQ A;  4UAP A;  4XJW A;  3WG3 A;  1O8S A;  4BE3 A;  4YG3 A;  1FAY A;  4KWJ A;  3NNJ A;  4XIO A;  3UV9 A;  1W8Z A;  5C9A C;  3THC A;  4A6O A;  1KGY A;  4AI2 A;  3VBO A;  1JHN A;  2D6N A;  2ZAH A;  2W3J A;  2LRP A;  1GV9 A;  1H8T A;  1SMV A;  1LOC A;  1RIR A;  2TNF A;  2VNR A;  2VZV A;  2ZMN A;  5IFP A;  2IFR A;  2D6O X;  3EHK A;  2IXH A;  5DXD A;  2I45 A;  4LUM A;  2KXL A;  2OYZ A;  3VD3 A;  1RUD 2;  2PLV 1;  4W65 A;  5EJZ B;  5IUQ A;  4UW3 A;  1R09 2;  2E31 A;  4XAC A;  1QXJ A;  3Q8E A;  1S55 A;  4WM8 A;  2IZW A;  1BMV 1;  2E6V A;  2HWF 3;  1RUN A;  1GR3 A;  1HN1 A;  2FDH A;  3LA7 A;  1K45 A;  2J1E A;  4QKN A;  4CU8 A;  1O91 A;  4GH4 C;  5LEK A;  1ZA4 A;  4HMZ A;  1VRB A;  3V0B A;  2VZS A;  4QGL A;  2CY6 A;  3HMY A;  2WQZ C;  3ZYH A;  3C8X A;  2HBU A;  2V09 A;  4KG8 A;  1W39 A;  5EV7 A;  4XBQ A;  4LE4 A;  3VKN A;  2ZAB A;  2I74 A;  1QNY A;  5E1R A;  4AQT A;  1J3Q A;  5BXX A;  3ZPO A;  1OLR A;  4PLN A;  4C1W A;  2VBB A;  2XBO 1;  1FPN 3;  1JW6 A;  3S5A A;  1A78 A;  1NA1 B;  3ZFF A;  1DYO A;  1M06 G;  2AEY A;  4NN0 A;  2VH9 A;  4H14 A;  4YRD A;  1AX2 A;  5FZ9 A;  3WP3 A;  5FPA A;  3ME2 A;  5GZD A;  3WW1 A;  4EZ4 A;  5C3O A;  5C8C A;  3H3L A;  4IGQ A;  3SC7 X;  4EV0 A;  2H6C A;  3F2Z A;  4UF0 B;  1VIW B;  4ET7 A;  2R0F A;  5A3W A;  3O1R A;  2VVF A;  4C0B A;  2XUE A;  2DCZ A;  3FBM A;  1GWL A;  1H4G A;  3SKJ E;  4MHU A;  4JGY B;  3VBS A;  4QWN A;  2UU8 A;  4S2D A;  3OPZ A;  1PK6 B;  5J48 A;  1H2N A;  3JUU A;  2H0B A;  2QDN A;  1QH6 A;  5A33 A;  3WDW A;  1CAX B;  3I2I A;  3ZXJ A;  2ZHL A;  4XQD A;  1R1A 1;  4OI4 A;  1RMU 1;  1A34 A;  4XFC A;  3KGZ A;  4W4Z A;  4RSU A;  1E5I A;  1US2 A;  3FL7 A;  3MIB A;  5T3N A;  2WNV C;  1RUE 1;  2Y64 A;  3Q8F A;  3WSO A;  2VXR A;  1MZE A;  3T2O A;  1DZQ A;  5EJ3 A;  1IHM A;  3KV9 A;  2QQO A;  4RR3 A;  3OB8 A;  5JDB A;  3T0D A;  1LUL A;  1F2N A;  2RDN A;  5F39 A;  2X5I C;  1RC6 A;  3DYP A;  4BQW A;  3KQ4 B;  2JKB A;  3TYJ A;  1F35 A;  3VLB B;  3WXP A;  3O1U A;  3WNO A;  1VBE 3;  4LO7 A;  1FXZ A;  4JGZ B;  1Q8P A;  4UOJ A;  3AB0 A;  3OBT A;  4IW3 A;  1QQP 1;  5GLT A;  1TVG A;  4G3Y C;  1CIY A;  1QJF A;  1C1F A;  2QJV A;  1CZT A;  4LPL A;  1UIJ A;  4FOY A;  4O61 A;  4YPJ A;  3S6P A;  3SCF A;  1W6Q A;  2RMU 1;  3GXU A;  3WV6 A;  1QJZ A;  5A6X A;  4MSV A;  4XXA A;  4AHY A;  1QJY 2;  2ARA A;  2R6Q A;  3ALQ A;  4QKB A;  4BB3 A;  1JZ6 A;  4OHX A;  2P6H A;  3E5Q A;  5GJ6 A;  2JD4 A;  3TRS B;  4PF5 A;  4UF0 A;  1WD3 A;  1EV1 3;  2WO1 A;  4Z2W A;  3CNA A;  4P9Y A;  3I59 A;  4ZXK A;  1GQP A;  2UWA A;  1Z7S 1;  5FZG A;  1SPP B;  1VRH 1;  4OQ9 A;  5A1F A;  4XJ9 A;  2YRO A;  1SFN A;  3AZZ A;  4TSV A;  2ORZ A;  5C6C A;  3IAQ A;  4CDX A;  2XQX A;  4J1W A;  3TB0 A;  3WQ7 A;  2G1M A;  3H7J A;  4CTE A;  5AFB A;  3VKL A;  1H6Y A;  3IDB B;  3THP A;  2J22 A;  4QMA A;  3BIE A;  3OUH A;  4BK4 A;  2VC9 A;  4MGY E;  2DUO A;  4GMP 0;  1MQT C;  2WL1 A;  1K5M C;  1AYN 3;  1LOG A;  4KWL A;  1Q8V A;  3LDR A;  1JZ8 A;  1NCQ A;  3B00 A;  4FCA A;  2BPA 2;  2VMH A;  3PHM A;  3QAC A;  3D0S A;  1L3J A;  2XKP A;  3I7D A;  4IE7 A;  1V6L A;  3MUY 1;  2HWF 2;  5DDJ 2;  2E53 A;  2R30 A;  2I2S A;  1WLD A;  2JE7 A;  3LOI A;  1BZW A;  3N9M A;  1IOA A;  2VPV A;  5CZK A;  1QDC A;  4YZ2 A;  5J36 A;  3KWV A;  5L19 A;  2OUH A;  4NVP A;  2IXK A;  1W8F A;  2GC2 A;  2O14 A;  3M7A A;  4OMC A;  4AVS A;  2P3I A;  1RUJ 1;  3K3N A;  3KF5 A;  3MW3 A;  3E6D A;  3POE A;  2Y8K A;  1DGR N;  3FHQ A;  3ZSJ A;  1W90 A;  2YY1 A;  3GCW A;  3KV6 A;  4Y24 A;  2C9K A;  1WCQ A;  4Y5S A;  3VBU C;  2KD7 A;  3NAP A;  3IWZ A;  1W2U A;  2ARE A;  1RUF 1;  2XQR A;  1FT9 A;  2ZS6 B;  2EAA A;  1W6M A;  1IZ3 A;  3FLP A;  1VAM A;  2YHJ A;  1JYC A;  2BFU L;  3OCP A;  1JZ2 A;  3BVC A;  4XCA A;  3VDC A;  4CUC A;  4QQH A;  2WSV A;  3VDD A;  4WVZ A;  4AGG A;  1CR7 A;  1UYX A;  5BNN A;  5IVB A;  4IEU A;  4Q8L A;  4OHZ A;  1GBG A;  3POB A;  4GMP 1;  4ZPI A;  4BCU A;  3J26 N;  1SPP A;  5T5L A;  4CZS A;  3CJI C;  4HVO A;  2OW4 A;  1YCI A;  4YVW C;  1ENX A;  4CRQ A;  1X36 A;  1QOO A;  3NNF A;  4BIO A;  5B2G B;  4PI2 A;  3W5M A;  5CFD C;  3VD4 A;  1R09 1;  4GXL A;  3TN9 1;  3NJY A;  3PIG A;  1QJU 3;  4P08 A;  3BU0 A;  1QNW A;  2WLQ A;  3ZXG A;  4JC1 A;  4UYB A;  5B4X A;  1UAI A;  4GWN A;  1ZZ8 A;  4BWO A;  1OHF A;  2P6C A;  2ID4 A;  5HXV A;  1DGW A;  4ZZ8 A;  4XZP A;  4HN1 A;  3VZO A;  1YXW A;  3NWK A;  3NVC A;  1GZT A;  3VBU B;  1OXC A;  2WWJ A;  3K46 A;  1XYO A;  1TEI A;  3BI3 A;  4JRL A;  2ZGO A;  3GDB A;  5CYY A;  2R32 A;  1W8N A;  2YGL A;  5DUU A;  2PAK A;  1JTZ X;  3FBY A;  4FTB A;  2GP3 A;  3ZM8 A;  2QNK A;  2PN5 A;  1Z0H A;  3S7I A;  1VBE 2;  2PFW A;  4B7E A;  5CA6 A;  2B7Y A;  1K42 A;  4LBL A;  2P2K A;  2RHP A;  3M2M A;  1DQ5 A;  1EP0 A;  3GJA A;  4FPY A;  4GIQ A;  3SEP A;  1ULE A;  4Q26 A;  3CZJ A;  4MXW B;  4GH4 B;  1RUC 3;  1VAL A;  3P3P A;  5DQ0 A;  3CHX A;  2RDQ A;  3I3E A;  4HSL A;  3MF6 A;  4XIK A;  3BIW E;  4RHV 3;  3WVJ A;  3KT7 A;  4CCM A;  5DAQ A;  3MIE A;  5JOX A;  3RRD A;  3FC0 A;  4OZX A;  1DP0 A;  2D40 A;  2JIJ A;  3PUI A;  5GAL A;  2GNB A;  1FI2 A;  2VL4 A;  2W1Q A;  2QUO A;  1Y4W A;  4N53 C;  3HN3 A;  1W99 A;  3J7N A;  2A75 A;  3ITQ A;  4XHX A;  1SDD B;  2ZCW A;  2R07 1;  4XHB A;  2F6B A;  2LM3 A;  1DHK B;  1B09 A;  2YBS A;  3PVO A;  4AFC A;  4XYX A;  4C90 A;  3JU9 A;  1VBA 3;  1ENS A;  2X10 A;  3O5S A;  3LF7 A;  4UW5 A;  4E4D X;  5BV6 A;  4E9K A;  3ES1 A;  1F8V A;  1AYN 2;  5C9A A;  5F5A A;  2FDK A;  4OI0 A;  4Q4X 2;  1ZBA 3;  4NII A;  4CCN A;  5GLU A;  1UZW A;  2HWD 2;  4M0H A;  1JOD A;  1NT0 A;  3AFG A;  1EY2 A;  3GYD A;  3DUI A;  4LIU A;  4Y22 A;  1NE6 A;  2YGM A;  2A3X A;  1S2E A;  3LSE A;  3M3C A;  4QDR A;  5AVA A;  4HL0 A;  4OUE A;  3POF A;  2FQP A;  3OGS A;  3WDV A;  5C7G A;  1ULP A;  1Q43 A;  3SEE A;  3H8U A;  1H9W A;  2RJK A;  3ZSM A;  3A0K A;  2WNV B;  5F3I A;  4AHZ A;  1W6N B;  5IYY A;  4QHO A;  4IE5 A;  1PNF A;  3POS A;  5FIX A;  4A41 A;  1QJY 1;  3CQO A;  4LLO A;  3AYD A;  2YC2 A;  5T5O A;  3HBK A;  3QLQ A;  4MGS A;  2KR2 A;  4B1L A;  3H1M A;  1RUI 3;  3IT8 A;  4NRO A;  2X5I B;  4RGK A;  4ONU A;  5FDB A;  4YM1 A;  2P34 A;  3MBW A;  4CEW B;  1L7R A;  3TAY A;  3DV8 A;  2VZ1 A;  3MFA A;  3DYO A;  3R4S A;  3NST A;  5L9B A;  1CN1 A;  1E5H A;  2JE8 A;  1APN A;  4A3Z A;  4F83 A;  4Q0Q A;  4TTG A;  4QX1 A;  4I3G A;  4IER A;  1PZ9 A;  5FPV A;  5FYT A;  1RJ7 A;  3KS7 A;  4ISR A;  1QXR A;  5FP9 A;  2NLR A;  4N7I A;  3PVE A;  3DEC A;  3I97 A;  4UI9 L;  3POW A;  4IE0 A;  3WF3 A;  4YSF A;  1QH7 A;  3LDB A;  5I0U A;  1CAU A;  3AJZ A;  3T30 A;  3GHM A;  2WO3 A;  2A7A A;  2RJ2 A;  2WQ4 A;  3AYE A;  3W59 A;  3PUR A;  1LOE A;  4N9H A;  4P9L A;  5JSR A;  2OUJ A;  3NNL A;  3BOP A;  4IET A;  5JAX A;  3E5U A;  3Q8C A;  2EIC A;  1MPX A;  2AZ5 A;  3K2O A;  3QOP A;  3KGL A;  1UCX A;  1VBC 3;  3HN1 A;  1EPW A;  2EXI A;  2IUW A;  3PNA A;  3BOD A;  1V00 A;  4QX5 A;  5A70 A;  4YWA A;  1JI6 A;  1D2Q A;  1EUU A;  1XOY A;  3C3V A;  3T09 A;  1F5F A;  4FPE A;  2HWF 1;  1JU4 A;  2CYF A;  2E26 A;  3V56 A;  5FZB A;  3HQR A;  4M4P A;  4PJY A;  1IS5 A;  1SBD A;  2QZ3 A;  5K0U B;  1AYM 3;  2JE9 A;  2VAU A;  4A4A A;  4EN7 B;  1UIK A;  3FHA A;  1BVV A;  3S5Q A;  1UY0 A;  4XFF A;  2RV9 A;  3UYJ A;  2Q1F A;  2P1B A;  1OA2 A;  2CGN A;  4Q1P A;  4UFH A;  3K51 A;  1RUH 3;  5FY9 A;  4QX8 A;  4CP1 A;  1MQT B;  4W8J A;  1H2M A;  1K5M B;  3U78 A;  4CDQ C;  5A3U A;  3A7Q A;  3LEI A;  3M3Q A;  5T54 A;  1JZ7 A;  1HRV 3;  1UMI A;  3ACI A;  4YM0 A;  4KI5 M;  5DMY A;  5L7O A;  1OLM A;  4FPG A;  3LDK A;  1FPN 1;  3PL0 A;  1JXN A;  2BTV C;  2YZ4 A;  1LU1 A;  5IVV A;  5A7P A;  3ZKU A;  3IAP A;  1TNR A;  3WHT A;  5SV8 A;  3WW2 A;  5HXM A;  2QE3 A;  3D3A A;  2WZR 2;  4XF4 A;  3ZN4 A;  2X5I A;  4XUO A;  3CBN A;  1WCU A;  5I91 A;  3QH6 A;  1NZI A;  5FO7 B;  3VBO C;  2VOW A;  3JB4 C;  4CEY C;  1H8T C;  3O0X A;  4DXR A;  4NWW A;  1CGP A;  4HPK A;  5G05 L;  3DL3 A;  3WNM A;  3R0R A;  5BNO A;  4AVT A;  1QOS A;  3NNM A;  2EIG A;  4LBM A;  4R4X A;  5T5J A;  4CCC A;  4W6X A;  2BNO A;  4Q0V A;  1YFW A;  4JX0 A;  4QXC A;  2RVA A;  2XR4 A;  1AF9 A;  1RXF A;  3OEB A;  4N7U A;  3WEZ A;  3VB9 A;  1C3H A;  4BJ0 A;  1B35 A;  3RWN A;  2IXL A;  4M3C E;  2D44 A;  4E4H A;  1WBF A;  5CKQ A;  4MH0 E;  1W9Y A;  4DUV A;  4M3C B;  4Q8K A;  2WQ8 A;  1BQP A;  1YFY A;  2AH2 A;  4XXP A;  2W68 A;  3SMH A;  1DZR A;  4YZ5 A;  2NMN A;  1U5I A;  1XRU A;  3ZYG A;  2JB8 A;  4JDO A;  4D6S A;  5D21 A;  4AHX A;  4OHW A;  1VBA 2;  5IAT A;  1I6X A;  5FZF A;  3AK0 A;  3WNX A;  1DYP A;  4YVW B;  1BBT 3;  1ZBA 2;  2P4E A;  5EWS A;  2ZPX A;  3AM2 A;  2WNU C;  1TNF A;  1K12 A;  3CEW A;  2PAE A;  4OMD A;  5ERL A;  2P3K A;  3U07 A;  3N9N A;  4M3C F;  4Y3O A;  5BY5 A;  2IVI B;  1VBE 1;  3AMP A;  1NXM A;  1O3R A;  2WT0 A;  3H8X A;  2V4A A;  1JYI A;  1RVF 3;  3WY6 A;  3ZFF C;  3ZMN A;  5I8Y A;  1UOF A;  1W0N A;  5C4W B;  1MVQ A;  5FZO A;  5C8C C;  1H9P A;  5EQU A;  4PIY A;  1UKG A;  2PHX A;  5LEJ A;  1H2L A;  2R06 3;  3G7D A;  2W92 A;  4Q0P A;  2O8O A;  2ZGR A;  3BTZ A;  5A6Y A;  2WFF 2;  2VZ3 A;  1RUI 2;  2YYO A;  4LOS A;  2GC3 A;  3I2G A;  3USU B;  3V64 A;  2GH8 A;  1F5J A;  5FLJ A;  1H1A A;  4UBH A;  1EV1 1;  4H3W A;  3NJZ A;  4YVS A;  2OT7 A;  3VBS C;  1KD7 A;  1O59 A;  3ZN5 A;  5J09 A;  2B46 X;  5F3G A;  4CU9 A;  2FDJ A;  2WSU A;  2FCT A;  3WOG A;  4AWD A;  4MXV A;  1RGS A;  4CDW C;  5AC9 3;  4AK3 A;  5BUV A;  1VBB 2;  5FYC A;  1SBF A;  1DQ0 A;  1KFX L;  3M4F A;  3OGJ A;  4HAN A;  5J37 A;  3RZL A;  4XBN A;  4PBO A;  3X29 B;  4ES8 A;  2LTN A;  3OYW B;  1OKO A;  4QU2 A;  3ILF A;  4GJY A;  4LJH A;  1S0G A;  4GD4 A;  4CSW A;  1N3Q A;  3B9I A;  1AYN 1;  1IPJ A;  4JHZ A;  4Y1Y A;  1QXP A;  4RR3 C;  1VBC 2;  4HSJ A;  4QPY A;  4BHP A;  1G86 A;  2DVF A;  2R49 A;  3VKM A;  5IT6 A;  2QQP A;  1BYH A;  3FMG A;  4N53 B;  4XCB A;  3KV4 A;  5I8T A;  3CJI A;  2RG4 A;  4JVA A;  3NO8 A;  5JCT A;  5IK7 A;  3GZU C;  1AYM 2;  4X6R B;  4AVA A;  4HFS A;  5CFD A;  3O0W A;  1UYP A;  4B7K A;  1LEN A;  2W95 A;  4S2H A;  2DF7 A;  2BOJ A;  4PQQ A;  1LEC A;  1UZZ A;  4QXK A;  1H1M A;  4ERO A;  1REE A;  4YZ1 A;  1O7F A;  1ULD A;  4C1X A;  4K8F A;  5JR7 B;  5A3T A;  3RWK X;  1RUH 2;  1S1A A;  3HD8 B;  5E16 A;  1BMV 2;  2FMD A;  5FXW A;  1UZY A;  1KRI A;  2GN3 A;  3LE0 A;  4GWJ A;  1PZ7 A;  4QB2 A;  2JDK A;  3B5L B;  4P9W A;  4Y1V A;  5D8A A;  3WT3 A;  4IEP A;  5FZM A;  3E6C C;  5FMO S;  2Y34 A;  4WVV A;  1DLL A;  3IDA A;  4NHM A;  1YIF A;  1ZBE 3;  1ZZC A;  2H6B A;  4CDX C;  3POG A;  1KJL A;  4H2A A;  4JQR A;  2YUE A;  1HXS 3;  5CIS A;  2VMG A;  3NJX A;  1IKP A;  4IEY A;  4CDU B;  4Z8B A;  3DKQ A;  4EWA A;  2BDR A;  2QQK A;  1SHW B;  5E8A A;  3MEP A;  1O8P A;  4TLG A;  4GAL A;  1ACC A;  1VR3 A;  4EN8 B;  3OSD A;  4BOW A;  1UOJ A;  4QX0 A;  2EVX A;  1QJU 1;  1QOT A;  3PVN A;  3WZ1 A;  3MW2 A;  1UWW A;  5F6L B;  2N7G A;  1LGC A;  2NM1 A;  3KSC A;  4NAO A;  1D2S A;  3BGA A;  4NHL A;  2Q8E A;  2VZU A;  5BPX A;  3SH4 A;  3ACG A;  2RR1 3;  3LIH A;  4IEW A;  1F31 A;  4KGG A;  1ALY A;  4URT A;  2P37 A;  3EB7 A;  5ANN A;  5IW0 A;  3RYP A;  4D69 A;  4D8M A;  4NIH A;  3ZSL A;  4MHR A;  4NJ4 A;  1BBT 2;  1RXG A;  4CXW A;  2C5D A;  1W6O A;  2OA2 A;  1RMU 2;  2JDM A;  3HPN A;  3FLT A;  4CYD A;  3EXU A;  3GF6 A;  3ZXL A;  3OBZ A;  4E2S A;  4EN0 A;  4AG4 A;  3IPV B;  2GMP A;  2QCS B;  4FI9 A;  5DAV A;  1CIW A;  1PMJ X;  3CIH A;  3CJX A;  3MLL A;  4RS5 C;  4E8D A;  1WA4 A;  1LEM A;  3VBH B;  3KCY A;  1RVF 2;  3ZN6 A;  4G9S B;  5KC6 A;  1RUC 1;  3T3Y A;  1S0D A;  2WFP A;  3GBW A;  1ONA A;  4YW5 A;  5BNN C;  4MGT A;  5FJK A;  4P5H A;  2Y26 A;  4MUV A;  2BVB A;  4RHV 1;  3ST7 A;  3RMX A;  4CDQ B;  1RJ8 A;  4BK5 A;  4XJZ A;  4AI1 A;  1QQP 2;  2ZGP A;  4NRQ A;  1HB1 A;  1UU4 A;  3A22 A;  4QKD A;  5FYS A;  4TLF A;  2WLP A;  1XYP A;  1GUI A;  2MHF A;  2QQJ A;  2WS9 3;  3ZFE A;  5DAW A;  4AAP A;  5LY2 A;  3CF6 E;  4L0P A;  2D6M A;  3J8F 3;  2XHK A;  3AP5 A;  4Y4Y A;  4XJA A;  3LQC A;  1RIN A;  3VBR C;  5AC9 2;  3DCQ A;  1ASJ 3;  1MS0 A;  1WME A;  2AUY A;  1MAC A;  1S0C A;  2VCC A;  1UOG A;  1G9F A;  2FCV A;  2CAV A;  4LKF A;  2C24 A;  5A7O A;  5FYM A;  1SEF A;  3VBO B;  3PJQ A;  1UX6 A;  1H8T B;  1AHS A;  3THT A;  1VBA 1;  4CEY B;  3O1T A;  4K6B A;  4ASK A;  1VRH 2;  3LIG A;  1WBL A;  4LOR A;  2XVK A;  3H3Z A;  1Q56 A;  2VMF A;  2B42 B;  4JHT A;  4A7K A;  2ATF A;  2WWS A;  3I2D A;  4PIX A;  3VZN A;  3WQB A;  4DXS A;  2DCJ A;  3H3U A;  4GWM A;  4SLI A;  4AEM A;  4WM8 B;  3JD7 3;  1I3H A;  1U5X A;  2D3S A;  2W94 A;  4LK7 A;  3WDX A;  2JDA A;  1CZS A;  1UMZ A;  4GWI A;  4CCE A;  1T6G C;  3ORJ A;  4ATE A;  3W5N A;  4JKL A;  3V0B B;  2A6X A;  3DF0 A;  3WG1 A;  4WVM A;  5FYY A;  2NP0 A;  4TXW A;  1OOP C;  1ODM A;  1T6B X;  5IVC A;  2E7Q A;  1RUI 1;  2NYY A;  4QX3 A;  2HWC 3;  4SBV A;  3PDQ A;  4LBO A;  5FMD A;  2ZMK A;  1LU2 A;  4BQ5 A;  3NV1 A;  1LCL A;  4V2V A;  4AED A;  1NX9 A;  5AVP A;  5F1R A;  2AGS A;  1XSR A;  5IVF A;  1K3I A;  1CJP A;  2K2S A;  5A1A A;  3ZFF B;  4LHN A;  1DU3 D;  3J4U H;  3LB9 A;  4I09 A;  4K1Z A;  1YQ8 A;  4JRA A;  4FQ4 A;  3V65 A;  4XAE A;  5C8C B;  5F2S A;  1HXS 2;  5LBE A;  1WKY A;  2VVE A;  4Q2F A;  1VBD 3;  3AYC A;  1TE1 B;  1X8E A;  2HWB 3;  2LAL A;  2ET7 A;  5DAB A;  5JIU A;  1JU3 A;  1VBC 1;  3VBS B;  4K7J A;  1Y43 B;  4Z82 A;  5JWP A;  2P17 A;  4XAB A;  5J98 B;  4YGC A;  2GMM A;  1RED A;  5A33 B;  2JKX A;  1HDK A;  5FBJ A;  1V6I A;  3LA3 A;  4PLM A;  4AI9 A;  4DXT A;  5C3S A;  1AYM 1;  4NAM A;  4B29 A;  3ILN A;  2GH2 A;  2RR1 2;  1LR5 A;  1W8W A;  3P5B A;  4FFI A;  4IGP A;  3ECQ A;  5FZC A;  3TN9 2;  3N4M A;  1RUH 1;  2B5H A;  4E2Q A;  5IHR A;  3ZSE A;  1TMF 3;  3PUS A;  2QZ2 A;  4RR3 B;  3SNM A;  1HRV 1;  1PIV 3;  2MEV 3;  2CV6 A;  1LJ7 A;  5FZ7 A;  2ZOE B;  3EQE A;  3QBQ A;  4OYU A;  4COU A;  3NV4 A;  1Q8S A;  3FE5 A;  2JEM A;  5GZG A;  3N9Q A;  3KT1 A;  2XUM A;  5HCH A;  1C28 A;  4AAX A;  3BPS A;  3C7E A;  3APB A;  2WNU A;  3III A;  2QQI A;  5FY5 A;  4FT8 A;  1LB2 A;  1W6Q B;  4BQY A;  5A6Q A;  3VKF C;  1XPW A;  5HCF A;  2YU1 A;  2Z4F A;  1PHM A;  1UKR A;  3A4U A;  4IV1 A;  3V0A A;  2VG9 A;  1OVP A;  2JJ6 A;  4BXF A;  3LOB A;  2TEP A;  4CUG A;  1Q8O A;  4IEZ A;  4NE9 A;  4LUL A;  5SV5 A;  3RSJ A;  5ABJ C;  5IVJ A;  2WS9 2;  3HT1 A;  3I59 B;  2QQW A;  1SDW A;  2GZW A;  4QQP A;  3J8F 2;  1GP5 A;  4XUR A;  4FAG A;  1FV2 A;  4PI0 A;  2WZP P;  5JZG C;  3KVB A;  5FZ1 A;  1WLT A;  2J1A A;  3PMS A;  4EQV A;  4CDX B;  1SCR A;  4ATF A;  3VHN A;  5F32 A;  5DN2 A;  1N3P A;  1XU2 A;  3OOX A;  1GQH A;  3HIF A;  1UY3 A;  3B69 A;  3WNP A;  1CAW A;  2HEW F;  3OEA A;  3VD7 A;  1BBT 1;  4CDW A;  5FAX A;  1PVC 3;  2R07 2;  2BWA A;  1HB2 A;  4XE9 A;  1IKQ A;  3L9J T;  4BIS A;  5FR3 A;  3NW4 A;  1NCQ B;  1VPH A;  2G19 A;  2VM9 A;  5L7O C;  3Q9O A;  1H4H A;  2QQU A;  1LAJ A;  3NKT A;  2BV4 A;  1IQA A;  1N1V A;  4NO4 A;  1CAV A;  1CPM A;  4H7L A;  2V5D A;  3J9S A;  1RVF 1;  1SLL A;  2Y0O A;  5FXX A;  1A8M A;  5K9Y A;  4RYD A;  3WQ1 A;  1N1S A;  1FV3 A;  1SLB A;  1YQ6 A;  4FTE A;  1AR8 3;  1D4V B;  2PHU A;  4R52 A;  1FAT A;  2BFU S;  5KBF A;  2HYX A;  1WMF A;  2R06 1;  3R05 A;  3WUD A;  2UWB A;  4LUK A;  1OPM A;  1V6N A;  5FZ6 A;  3FUQ A;  3ZIX A;  5BNO C;  3VGI A;  2A71 A;  1KEX A;  1UO9 A;  4LR4 A;  4NPL A;  3FFQ A;  3RMY A;  4MV2 A;  3NAP B;  1JOJ A;  1OF4 A;  1Q5O A;  1I5P A;  1J3R A;  1JHJ A;  1W6M B;  1B35 C;  1VAV A;  3LZZ A;  5FYI A;  5JOZ A;  1MZF A;  2EID A;  5AC9 1;  5FO9 B;  5FQ0 A;  2JEC A;  2AEZ A;  2ZX4 A;  3VDD B;  4YAR A;  1UF2 C;  2HH9 A;  2JG9 A;  5BNN B;  2PEL A;  4L8Q A;  1AXY A;  3OD0 A;  2IVJ A;  5FZ8 A;  1VBD 2;  3SKV A;  3AC0 A;  4HKL A;  2D6L X;  1YC6 1;  3NJV A;  1PMI A;  1SG3 A;  1QHD A;  4FQZ A;  3AKT A;  4A3X A;  1ZA7 A;  2YG0 A;  3AXD A;  2B4K A;  3SH3 A;  4CP0 A;  4D7Y A;  5KC5 A;  1RIT A;  4J1X A;  4L9B A;  4FPL A;  4QPG A;  3DPR A;  4B4P A;  1QMJ A;  3H0O A;  2Q8O A;  2W9X A;  3WF2 A;  3LCP A;  5LCW L;  4LIT A;  4FPC A;  2VNG A;  1W05 A;  2CGO A;  1TG7 A;  3RNS A;  2KM2 A;  3USS A;  1CD3 G;  1J59 A;  2RS1 3;  4XFB A;  3OPT A;  2UY9 A;  2A3Y A;  3AFK A;  2NZ9 A;  1JOB A;  4AOC A;  1F4H A;  1OC1 A;  4IES A;  4ZZ5 A;  3O1S A;  1FMD 3;  2YBK A;  4QT6 A;  1VMF A;  1TMF 2;  5A6Z A;  5FZA A;  2MEV 2;  1PIV 2;  5FZD A;  3I2F A;  1JYW A;  4QX7 A;  3VZL A;  4HVQ A;  5FBZ A;  3AZY A;  4BPZ A;  2CWM A;  1QDO A;  4LBJ A;  4R9D A;  4XUN A;  4XTP A;  1AR9 3;  4YVS C;  5JVV A;  4AHW A;  4RD7 A;  3WDU A;  2P5B A;  1IG3 A;  1V70 A;  3WF1 A;  1JYX A;  2ZAA A;  5C3R A;  2BGO A;  2QDR A;  4O7X A;  3BN6 A;  5FO8 B;  2PAM A;  1ZBE 1;  3WG4 A;  4B8E A;  2W87 A;  4OI1 A;  5FZ3 A;  1YHF A;  4FPK A;  1HXS 1;  2VZQ A;  4YFW A;  3ZKY A;  5IFT A;  2GAL A;  3FWE A;  1FPN 2;  4Q4W 3;  4RS5 A;  5I0R A;  3TOJ A;  4HBN A;  4BIF A;  1OOP B;  4A7Z A;  4CA9 A;  1OD5 A;  1ENR A;  1A8D A;  1ND2 C;  3M8L A;  3JQX A;  1UQX A;  3O1O A;  4D3W A;  3ZOI A;  2ES3 A;  3PUA A;  4LLF A;  3OY8 A;  4NID A;  2G9F A;  2VR4 A;  4MYE A;  3WF0 A;  1V9U 3;  2GNT A;  4DQA A;  3MI8 A;  1OH4 A;  2ORX A;  2BGC A;  4HT1 T;  2VE1 A;  3AKS A;  4NMI A;  4PF1 A;  1IS6 A;  2J1V A;  3JBG 3;  4O9G A;  2Q30 A;  1KIT A;  2RR1 1;  3J7L A;  4I02 A;  3UT0 A;  3VKO A;  3WUC A;  4AI0 A;  5FPU A;  1OBN A;  1GOH A;  1UW8 A;  2K9Z A;  4LHL A;  1LOB A;  3UK9 A;  1D7P M;  3WF4 A;  2WAB A;  4V1P A;  4XF9 A;  4IGO A;  5L9R A;  3FX3 A;  3T08 A;  3VBR A;  1W9T A;  5C9A B;  2GDF A;  2QQV A;  3JB8 A;  3N7L A;  4HET A;  2VUC A;  1R08 3;  1UY1 A;  3E1F 1;  4AEK A;  1MZ5 A;  4Y22 B;  4Y5T A;  5KXD A;  4AQS A;  3ZYJ B;  5GLV A;  4DRV A;  5D8A C;  4QQ2 A;  1CVN A;  2C4X A;  4LQR A;  4D94 A;  1ULG A;  5HPO A;  1VP6 A;  1X33 A;  1AR8 2;  2DTY A;  4BQX A;  1JS9 A;  1XC6 A;  3LGR A;  4NRM A;  3K48 A;  3H7Y A;  4KU7 A;  2Q1Z B;  1YO8 A;  2GP5 A;  3GZT B;  4D6Q A;  5LBF A;  4K9S A;  3IIA A;  2VCB A;  2UUR A;  3M70 A;  3MLK A;  1WCD J;  4N43 A;  2R1D A;  2W1W A;  3IDE A;  1F9K A;  4EE2 A;  4B4R A;  1WMX A;  1OQE A;  1UXX X;  2WS9 1;  4TZD A;  1OOP A;  3O1M A;  3J8F 1;  3WDY A;  5A3L A;  5GLZ A;  2VMI A;  3NMB A;  5IVE A;  4DEQ A;  3B02 A;  4R4Z A;  5FPZ A;  1ASJ 1;  2JDP A;  2OPW A;  4XC9 A;  4ASM B;  1EV1 2;  1CAU B;  1LGB A;  4OVE A;  4XTM A;  3W58 A;  1LKN A;  4I3P A;  2E51 A;  1PO1 3;  1OVS A;  1X9T A;  5FMB A;  4H7M A;  2B9U A;  4QXH A;  2YMZ A;  4QD2 A;  1S2K A;  2DTW A;  3PU8 A;  4DIN B;  4W6Y A;  3MV1 1;  1GWM A;  3JD7 1;  2ZZQ A;  1W8H A;  2G4I A;  4RGA A;  2Y0I A;  3I2O A;  5JXG A;  3I2K A;  1O3Q A;  5C8W A;  2GME A;  1GP6 A;  4O65 A;  1KQR A;  2XGX A;  1FMD 2;  2D5F A;  4H55 A;  3INA A;  2HWC 1;  2YPJ A;  5JXJ A;  3N7M A;  4MOA A;  4MAD A;  2VO5 A;  4WM7 A;  5FY4 A;  4MVT A;  1OLM E;  3ZPY A;  4I01 A;  5A32 A;  4UFI A;  2BU9 A;  5L7O B;  4YLZ A;  1AR9 2;  4PLO A;  1V6K A;  3SXW A;  1QIQ A;  3ZFE C;  1TQ5 A;  1W2T A;  2BER A;  3E6B A;  2Y60 A;  4XFG A;  4FBF A;  5FY8 A;  2CTV A;  4FP2 A;  1AX1 A;  1HQW A;  1M4W A;  3UGF A;  4C91 A;  3TEY A;  2ZX3 A;  5K4L A;  2AEN A;  2XG3 A;  4ES9 A;  4CPB A;  3MFC A;  4QM9 A;  2E32 A;  3LAG A;  1VBD 1;  1GYK A;  1U0A A;  4HPK B;  3MIC A;  2HWB 1;  5BNO B;  3BTX A;  4RQP C;  4HK8 A;  2V72 A;  4Q4V 3;  1AL0 G;  2WT2 A;  4BLJ A;  3WD5 A;  2Q5T A;  4QPI C;  4Y20 A;  4CCL A;  5FLI A;  1LHW A;  4Z92 B;  1IPK A;  3BUC A;  1IQD C;  5CKN A;  1YI9 A;  1LHU A;  4JAA A;  1MS3 A;  4Y33 A;  3POJ A;  2EXK A;  1NQJ A;  1B35 B;  5LA2 A;  4DY5 A;  2BWC A;  3W9A A;  3WNN A;  1BHG A;  3LPF A;  3A0N A;  4LXL A;  5JI7 A;  3GHN A;  1C8N A;  3JBG 2;  3ZYR A;  1OPO A;  1W03 A;  2VOV A;  1QEX A;  1GZC A;  2D3R A;  5ABJ A;  3ACF A;  3IB3 A;  1EYB A;  1QJU 2;  4NIA A;  1PMH X;  1W04 A;  3WHU A;  3VD9 A;  1FX5 A;  2Z42 A;  1TMF 1;  5JZG A;  2VUA A;  2X53 S;  1OKQ A;  2XVG A;  3OD4 A;  4LBN A;  2MEV 1;  1PIV 1;  2PHL A;  3AP6 A;  5I0D A;  1YWK A;  1UYY A;  2OVU A;  3A23 A;  5CFC C;  2GND A;  5L73 A;  3SIS A;  4RA0 A;  4R9C A;  1GAN A;  4AED C;  3N35 A;  1S2B A;  1WCK A;  2A6W A;  4ARY A;  4YW4 A;  3B7M A;  5FP4 A;  1ZRR A;  5F5Q A;  2ZKN A;  3NV3 A;  5F8P A;  1NCR C;  5FZO B;  4TWT A;  2O1Q A;  3CO2 A;  1VAK A;  3U4S A;  1DGW X;  3VN4 A;  1OF3 A;  5KXC A;  5KHH A;  3M1H A;  3RS6 A;  3I2J A;  1PZ8 A;  5APA A;  3AZW A;  1H8V A;  2WN3 A;  1H6X A;  2BQP A;  3U14 A;  1W9F A;  3C7F A;  4XDP A;  1CES A;  5C5U A;  4IEX A;  1DZT A;  1RUC 2;  4ZS3 A;  5F3C A;  4YVS B;  3KHC A;  3MW4 A;  2PTM A;  4AVB A;  2RS5 3;  2Q8C A;  2WII B;  1A6C A;  3HQX A;  4RHV 2;  1XND A;  3D82 A;  1W2N A;  1QJX 3;  2F4L A;  5KHK A;  5FRA A;  3WP5 A;  1N47 A;  4DRR A;  2VQA A;  4XJU A;  4XEZ A;  5FYU A;  5C33 A;  2WZ8 A;  1JZ5 A;  3EYP A;  3AKP A;  5EJ1 B;  2HEV F;  1NLS A;  1ZRE A;  3DXT A;  2AC1 A;  2CSG A;  4BMB A;  1GIC A;  1VE0 A;  2RS3 3;  5IJR A;  4XBL A;  1PVC 1;  2C9A A;  3WX5 A;  4BLI A;  2VXJ A;  3H8R A;  2ZHK A;  4S2F A;  2JB4 A;  2OQ6 A;  1ZRF A;  3B94 A;  4XPV A;  4GA9 A;  4AQ6 A;  3C7O A;  5I8S A;  4PDW C;  2YBP A;  2HEY F;  3CJI B;  1NE4 A;  4IV3 C;  1PM4 A;  5F37 A;  5CNA A;  3T1L A;  4NPM A;  4PQ9 A;  5FV3 A;  1AJK A;  1SLA A;  4GUL A;  1W8O A;  2DFC A;  4Y26 A;  1AR8 1;  3VZM A;  5CFD B;  5F5C A;  2VW0 A;  1OT5 A;  3ZXK A;  3C7G A;  4Y4R A;  5JPM B;  1U5Y A;  2WT1 A;  3O1V A;  3KF3 A;  1NLR A;  4XF3 A;  1C57 A;  3TBD A;  3CU7 A;  4BM8 A;  3DYM A;  3IBM A;  3MIF A;  3KLS A;  4IV1 C;  2VZP A;  4DZG A;  5F7U A;  2WJS A;  1H1I A;  3KM5 A;  3BKZ A;  2JDU A;  2VJX A;  5D8A B;  1AR6 3;  3ILR A;  1PGL 1;  3K4A A;  4FXG B;  5ACA 3;  3AVR A;  5T50 A;  1GU3 A;  2XJP A;  4CU6 A;  5LRS A;  2GSY A;  4XF1 A;  1YQ2 A;  4YW7 A;  1HQL A;  4HXC A;  3I4I A;  4FOV A;  2VY0 A;  1COV 1;  1SFP A;  3MID A;  4E27 A;  4Q4V 2;  1SAC A;  5JOW A;  1X7N A;  4WV8 A;  2HKX A;  3MIG A;  1AUY A;  1R64 A;  3M3I A;  2DBI A;  2FHR A;  5LRR A;  5DUW A;  4DOU A;  4E8C A;  4GB3 3;  1EAH 3;  1QKQ A;  2B8M A;  1ZX5 A;  1VMH A;  2ZKL A;  1ND2 A;  4GKX A;  4KBB A;  2J1T A;  2EXJ A;  2JDY A;  3ZO0 B;  2RS1 1;  5AFE A;  4E4Z A;  3JCI A;  1UYZ A;  4LNV A;  1FMD 1;  1W2O A;  1MS1 A;  5H9S A;  5LZ6 A;  3PTR B;  1C4R A;  2XON A;  1W6O B;  2VMC A;  2V73 A;  2WZE A;  3ZXF A;  2DVB A;  3RYK A;  2ZAC A;  4MGK E;  2BNM A;  1JUI A;  1YLL A;  2D93 A;  3VBF C;  2E7A A;  2DU1 A;  1AR9 1;  3DXU A;  3QCW A;  3R6S A;  5EPA A;  3UKV A;  1QU0 A;  1ULC A;  2NPI A;  4EWE A;  2X09 A;  1GKB A;  4IND A;  2FCU A;  2QFE A;  2QTW B;  2PHF A;  2VNV A;  3K77 A;  1GMM A;  2XJU A;  1HRV 2;  3ZN6 B;  3SHR A;  1FYU A;  4BQ3 A;  2CGP A;  2ZHM A;  4OZO A;  1RL3 A;  2ETE A;  3T0B A;  3GBF A;  4XJ8 A;  5T52 A;  2JG9 C;  1XNC A;  2VUD A;  1MS9 A;  4NHK A;  4Q4W 1;  4TN7 A;  2CDP A;  2VGD A;  4MLO A;  1BJQ A;  2ZJC A;  5KXE A;  4O9E A;  2OKX A;  5DAP A;  2ZML A;  3O0V A;  3U4X A;  1ZZ7 A;  1XU1 A;  2CL2 A;  2XLA A;  4DY3 A;  5GLW A;  3BTY A;  2WKK A;  5F3E A;  4MZU A;  1HV1 A;  4UXA A;  1GNY A;  1ND3 C;  3JZV A;  1BXH A;  1SLC A;  4JZR A;  4XFH A;  5FKC A;  3ZFE B;  1V9U 1;  4QPG C;  4D7S A;  1NA1 C;  3DPR C;  1W0P A;  3L2H A;  1TZO A;  1ZVF A;  1QJX 2;  2VOX A;  3WIN E;  2UYB A;  3I2H A;  1LHN A;  1OUX A;  2EIB A;  2ZXQ A;  3JBG 1;  1VJ2 A;  1UOB A;  3FN9 A;  2XLF A;  1W3V A;  3NV2 A;  2W47 A;  4CP9 B;  5A7S A;  1W9S A;  3UL2 A;  3H9A A;  3T2P A;  2RS3 2;  4B4Q A;  4K1Y A;  2FDG A;  4L92 A;  4RN5 A;  3P6B A;  3CZU A;  3N9O A;  4JGY C;  4KNC A;  4QPI B;  5LBC A;  1R08 1;  5C3P A;  5L36 A;  1PK6 C;  2AYH A;  4CPB D;  4Q4Y 3;  3RI8 A;  2GAU A;  3OTF A;  4L99 A;  1OI6 A;  4UBG A;  2KA3 A;  2ZTN A;  4LBQ D;  4YYO A;  1E57 A;  4ISQ A;  4EN6 B;  3B9C A;  3T4V A;  3ZDS A;  1DGL A;  5IK4 A;  2XPJ A;  2ZEX A;  1HRI 3;  2ARX A;  3IM0 A;  4GAZ A;  4CE8 A;  3ON7 A;  1ZZ6 A;  4K20 A;  4WVM B;  2YV8 A;  3OUI A;  4LO8 A;  3R4U A;  2XKO A;  4YNI A;  3UGH A;  3GAL A;  5DZE A;  1LOD A;  2QQN A;  2A6Z A;  1RUD 3;  3HJR A;  1N1T A;  4JQT A;  4R8H A;  4HN0 A;  4R9B A;  3KV5 A;  1HB3 A;  1GWK A;  1MEC 3;  2EAL A;  2PHR A;  2YC4 A;  3AZV A;  3EMR A;  4I0A A;  4XZU G;  5LK5 A;  3RPQ A;  4AED B;  3UNP A;  2R06 2;  3VDA A;  3KT4 A;  2Y6K A;  2BZD A;  3AL5 A;  2DVA A;  4XAA A;  2EAK A;  3LA2 A;  2WN2 A;  5KHJ A;  1LRH A;  5H9Q A;  5ISL A;  5ACA 2;  4LKE A;  1OA3 A;  1OUR A;  5KXB A;  3SLI A;  2ZGT A;  3RZJ A;  2IWG B;  1GNH A;  1T2X A;  5FZE A;  1AXZ A;  3PUH A;  5DPN A;  3O14 A;  1LES A;  1DQ4 A;  1PO1 1;  5FK8 A;  1H30 A;  1HB4 A;  2ENR A;  3AKR A;  4QDQ A;  3K3O A;  4DNY A;  5DG2 A;  4BZ4 A;  3ROU A;  5CVR A;  3TWI A;  2UY8 A;  4CP9 A;  1MS8 A;  2BGP A;  1PGS A;  1JH5 A;  1BK0 A;  1SZB A;  2TUN A;  2WUH A;  4GB3 2;  4LO6 B;  4RFT 0;  5JUV A;  4DUW A;  4DO0 A;  4RQP A;  1BEV 3;  2JX9 A;  1NY7 2;  2WO2 A;  4OCT A;  2J1U A;  2D97 A;  1Y7B A;  4QPI A;  4YZ4 A;  1UY4 A;  1RUG 3;  1OH3 A;  4XMA A;  4BQ1 A;  5CG9 A;  1N3O A;  1NQD A;  1SLI A;  2V4V A;  4OHV A;  4BA6 A;  3MPP G;  4N43 C;  1W8T A;  4COY A;  4FXK B;  1NUK A;  5JOY A;  1W3X A;  5HBA A;  3RZH A;  2GN7 A;  1J1T A;  2VMD A;  2GC0 A;  2YPD A;  4YFZ A;  4FFH A;  5JLV A;  4ZS2 A;  2ZA9 A;  4YM3 A;  4IXL A;  3WNL A;  5BYN A;  2IXC A;  2VW2 A;  3I3D A;  1SLT A;  2WNU B;  1C8M 3;  1WW5 A;  4KL1 A;  1GZW A;  4QB1 A;  4A45 A;  1YUD A;  4ZKT B;  3URF A;  5CFC A;  5C3Q A;  4BU2 A;  5BNP A;  5FPL A;  3GCX A;  2WO7 A;  1KDK A;  1W2A X;  5KHI A;  1FNY A;  1UMH A;  4Q4V 1;  1SCS A;  3MHZ A;  2XXZ A;  3TEW A;  2E9Q A;  4G4F A;  1ZBE 2;  2YU2 A;  1NCR A;  2TBV A;  4IV1 B;  5IK8 A;  3V0A B;  4HZF A;  3OGG A;  4PBP A;  4FO9 A;  1G9A A;  3GZA A;  3KHB A;  2O0O A;  3N9L A;  3MUZ 1;  3QD6 A;  2DCY A;  1DQ2 A;  1ZRI A;  2JEN A;  4M0N A;  1AJO A;  3JXS A;  1DYK A;  3A21 A;  4NWV A;  4JKM A;  3WCS A;  3NNG A;  3I54 A;  1ZYB A;  1DQ1 A;  2MPF A;  2LS6 A;  4AGR A;  4W50 A;  2JWP A;  5GZF A;  2D6P A;  2RDS A;  2WA3 A;  5A7Q A;  2VZO A;  5EYY A;  1UY2 A;  3TNQ A;  1CAW B;  1MVE A;  1S0I A;  2Z79 A;  3T0A A;  4CDW B;  2ZGS A;  1JYT A;  4A2U A;  3GM8 A;  3HQU A;  4WM7 C;  4COZ A;  1YJL A;  1XE8 A;  5EYX A;  1W6P A;  4BME A;  1HLC A;  3POI A;  1O4Y A;  5JSO A;  2VVD A;  2DCT A;  1CAV B;  5LA1 A;  2XH6 A;  2A3W A;  4YW2 A;  3VD5 A;  1PGW 1;  3CLP A;  2XHN A;  4ZON A;  2A1X A;  2W91 A;  5IK5 A;  4LKS A;  5J7M A;  4PDW A;  1HRI 2;  2OPK A;  2XJT A;  5DZF A;  4PT6 A;  3ZMO A;  4IV3 A;  4LO4 B;  4URA A;  4YW6 A;  5FZK A;  3FHI B;  1EUT A;  2B39 A;  3BTA A;  3EO6 A;  3Q8A A;  1MEC 2;  4P9I A;  3VBF B;  4Q29 A;  4CEY A;  3UJO A;  1D0H A;  2RS5 1;  3ELN A;  4LHS A;  3SIT A;  2WNO A;  1LOF C;  4OLL A;  3PIJ A;  2H0V A;  1IS3 A;  2ZHN A;  1U12 A;  2RJL A;  4NOT A;  1CWP A;  5DDJ 3;  1QJX 1;  4HON A;  1Y3T A;  3I8T A;  5C71 A;  4UFJ A;  3ZIW A;  2GU9 A;  4X6Q B;  5FQ0 B;  3MO4 A;  2RM2 3;  2JG9 B;  3ACL A;  5A3O A;  1W28 A;  4E2G A;  2VOK A;  2RS3 1;  4P14 A;  2A5Z A;  5LK7 B;  1W06 A;  4FFG A;  1O6U A;  1PO2 3;  1V6J A;  1ASJ 2;  1ST8 A;  3KCX A;  3LFM A;  5T5P A;  3IMN A;  2W39 A;  3MF9 A;  4L2N A;  4RFR B;  4ZU4 A;  2JDN A;  5FZ4 A;  3LD8 A;  5FZH A;  1S0F A;  1LGN A;  1ND3 B;  5B4N A;  4Q5O A;  1KDM A;  4QPG B;  1OQD A;  1BEV 2;  1NZC A;  2DUQ A;  1J84 A;  3DPR B;  3L2Y A;  3OPW A;  4YG6 A;  5FCC A;  5FP7 A;  3BYW A;  3ZYI B;  5KR7 A;  4GKY A;  5HV0 A;  4PCR A;  1GZ9 A;  1UD1 A;  1RUG 2;  1JZ4 A;  1QJE A;  4MX3 A;  2QKD A;  2JDZ A;  4XUQ A;  5FZL A;  2YXS A;  4MGI E;  5FYH A;  2CU5 A;  1XBF A;  3FZ3 A;  2FD8 A;  3JD7 2;  1F15 A;  4KQ7 A;  5FXZ A;  3HR9 A;  4FPF A;  4DMI A;  5FY7 A;  5C70 A;  4XDQ A;  3AKQ A;  5CKM A;  4CCK A;  2GC1 A;  5FOJ B;  4ZU7 A;  3VUO A;  4UW6 A;  4BDV B;  1MZ6 A;  2XB6 C;  4UFL A;  5F5I A;  4QKF A;  1AR6 1;  5GKA C;  3FUO A;  2CHH A;  2HWC 2;  2ADD A;  5ACA 1;  1C8M 2;  2R1B A;  3LEK A;  5IWF A;  3AVS A;  3VBF A;  5F6K A;  1ZZB A;  3ACH A;  2E33 A;  1DGR A;  4XMI A;  3MPB A;  1AR7 3;  1FNZ A;  4LE3 A;  5FYZ A;  2XJQ A;  1WD4 A;  4RS5 B;  3TNP B;  4AI3 A;  5A3P A;  5HCA A;  3J7H A;  3WLU A;  4F7Z A;  4N9I A;  1STM A;  1JN2 P;  1XNK A;  4Q0S A;  3UJQ A;  3BAL A;  4AF9 A;  3OBR A;  1KS4 A;  3FJS A;  2GNM A;  3ZLI A;  5FKB A;  4CEW C;  1XNB A;  1O4Z A;  2PQS A;  3ENR A;  1XE0 A;  4GB3 1;  3OY8 B;  5FJH A;  1GOF A;  2SLI A;  5FWE A;  3U10 A;  1L7L A;  5IVY A;  3VL9 A;  2HWB 2;  1COV 3;  1EAH 1;  1NKG A;  1IS4 A;  1NY7 1;  1QF3 A;  1ULO A;  3B93 A;  3LEM A;  3H50 A;  5CAZ A;  4MG2 A;  4V2W A;  2XVL A;  3C2U A;  2BP6 A;  3AXE A;  4WBB A;  3ZVX A;  1POV 3;  3LEG A;  4WVW A;  4AVC A;  1H2K A;  1LHV A;  1ND3 A;  3RGB A;  4Y1X A;  2FBE A;  5BNQ A;  3RG0 A;  2FZ2 A;  1TME 3;  5HI0 A;  1NA1 A;  4DB5 A;  5EXO A;  1E5S A;  3RYR A;  4IEV A;  4LTA A;  3VBR B;  4ITC A;  1VMJ A;  2BJS A;  1P8J A;  3HOB A;  3HWJ A;  2XJR A;  4A6S A;  4AW7 A;  1OSG A;  2XL7 A;  3BB6 A;  5FMC A;  3H1W A;  5D1I A;  3PVB B;  5FPX A;  1CX4 A;  3PTY A;  3FFZ A;  4DXZ A;  1QGL A;  4N90 A;  2OX0 A;  3IZO A;  5K0U C;  4JGY A;  1X82 A;  4ZHN A;  1R1Z A;  2ZGQ A;  1PK6 A;  3HNB M;  2W08 A;  5A3M A;  4JDN A;  1OFS A;  2R16 A;  3PUQ A;  4HLT A;  1LOA A;  1CAX A;  4JTO A;  3VL8 A;  4AI8 A;  2BBV A;  5FK7 A;  4XUP A;  1ENQ A;  4Q4X 3;  5E88 A;  5JMO A;  4N43 B;  2R04 3;  1WLC A;  2HWD 3;  2XJV A;  1YEW A;  1YQC A;  5T55 A;  4N8M A;  1NXD 1;  4LO5 B;  3D6E A;  1CJD A;  1J83 A;  1WWY A;  4F3J A;  2Q1M A;  2HWE 3;  3RI9 A;  2JG8 C;  5CIR A;  4LHK A;  2DWR A;  4LA2 A;  4FVV A;  4BH9 A;  4X8P A;  3LFI A;  1Q8Q A;  2RM2 2;  2E7T A;  4XET A;  4QAW A;  4FPJ A;  5K8S A;  1SBE A;  4LIV A;  1CQ9 A;  3KQR A;  4JGZ A;  1WA6 X;  2LUW A;  3MGU A;  5FYB A;  5G04 L;  3IDC B;  1PO2 2;  3MDP A;  4IDZ A;  4W6W A;  3SQO A;  1BCX A;  3CL1 A;  3PU3 A;  1X50 A;  2QQL A;  4Q4Y 1;  3AP9 A;  3ZYB A;  4DPN A;  1O3S A;  2ERF A;  2XDV A;  5IAV A;  5J3U A;  4AE2 A;  4QB6 A;  4UT5 A;  1YFU A;  3AX4 A;  2ZGM A;  1PVC 2;  4CXX A;  1JOP A;  5CU1 A;  4CUB A;  4AZZ A;  3UKT A;  3B3Q E;  4UFM A;  1YYN A;  1HRI 1;  3D0J A;  3O7O A;  2DUR A;  1OD3 A;  5FOB B;  1X8M A;  2ZEW A;  2W52 A;  5A7N A;  3VV1 A;  3POY A;  1Y9Q A;  2NMO A;  4L97 A;  2BVV A;  1RUD 1;  2VTF A;  3T2Q A;  4BQ2 A;  3OUJ A;  5A3N A;  2Z69 A;  5J96 B;  2ARC A;  2UWC A;  1MEC 1;  4NRP A;  2WDB A;  4WM7 B;  1DQ6 A;  5F2W A;  3B01 A;  5A32 B;  5GZC A;  5JSP A;  2PYT A;  5FZ0 A;  4CUA A;  4AGV A;  4A44 A;  1VB2 A;  3IN9 A;  1G8W A;  1LTE A;  3UET A;  2WRA A;  1JZ3 A;  3S0M A;  1UU5 A;  4R9A A;  1V6M A;  3ZR5 A;  3PJY A;  1UPS A;  1KS5 A;  4GQ7 A;  4GZ9 A;  1JMU B;  4L11 A;  1G6N A;  1W8U A;  1XNA A;  3E5X A;  4LBK A;  5C4W C;  5M0T A;  5ANQ A;  3ATG A;  2VBD A;  1RHI 3;  5FTT C;  1AR7 2;  2EF6 A;  2IXI A;  3TEX A;  5JI9 A;  4LBQ B;  2A73 B;  1PGL 2;  1WUV A;  2WIN B;  2WC2 A;  2DDU A;  3HNY M;  4J6G A;  1HQN A;  4Y20 B;  2PA7 A;  1O4T A;  3RQ0 A;  4QQO A;  5CB7 A;  1BEV 1;  3KB5 A;  3WW3 A;  1COV 2;  3U37 A;  3NKG A;  2WZR 3;  4M4R A;  5K7P A;  5C5T A;  1W0O A;  3VDB A;  2EA7 A;  1RUG 1;  2DFB A;  4XFI A;  2ZEZ A;  2PMW B;  2DYC A;  5ABJ B;  4EJR A;  4YZ3 A;  3J7M A;  4QXB A;  1TME 2;  3THD A;  1OFN A;  3CDZ B;  2HBT A;  1YQ5 A;  1YRZ A;  1NOV A;  1G7Y A;  1HX6 A;  5JZG B;  2A6V A;  2OS2 A;  1FOD 3;  4M01 A;  3I49 A;  4CU7 A;  4NUB A;  3AYA A;  2RS1 2;  2J42 A;  2ILM A;  2PHW A;  2I07 B;  4LOT A;  3RJR A;  5F9T A;  5KWR A;  4D6R A;  1D4M 3;  3RJ2 X;  1NAE A;  1UPI A;  1VLN A;  2W0X A;  3HBZ A;  1GLH A;  4LA3 A;  2ZX1 A;  1C8M 1;  3NL1 A;  4U36 A;  4DEV A;  2PHT A;  3LWC A;  1URX A;  2ZGK A;  5EHD A;  4Y5Z 0;  3VHR A;  2YFZ A;  3WDT A;  1HKD A;  2R04 2;  4IQP A;  4P9X A;  4CCO A;  3DEM A;  1GSL A;  1OQ1 A;  3DKW A;  3VBU A;  3O12 A;  3HAG A;  3O1P A;  2X8K A;  2ZZJ A;  1C5H A;  4Q4W 2;  3BCW A;  4Q27 A;  2C0Z A;  3T1M A;  3HVD A;  4QX2 A;  2HWE 2;  4LBQ A;  5FFO C;  3ZFG C;  5JXI A;  3RZK A;  3AZX A;  5LAT A;  2VUJ A;  2PXJ A;  1MS5 A;  4P9J A;  2WR9 A;  2AAC A;  1WMD A;  5EP9 A;  2ZBJ A;  2BYV E;  5FZI A;  1LOF A;  3GGL A;  3OJB A;  4CDU C;  1DBN A;  2VZR A;  1JBC A;  3W20 A;  1PM7 A;  4IEQ A;  1V9U 2;  2Y6H A;  3WP4 A;  1C1L A;  4QM8 A;  1ZRD A;  4OFG A;  2WFF 3;  5H9P A;  5JIA A;  4FSJ A;  3HEI A;  3RZZ A;  4MXW A;  1WGP A;  4GH4 A;  3OGV A;  4FFF A;  1QY4 A;  2WAA A;  4COV A;  1XYN A;  2VQT A;  4XF0 A;  4ARX A;  2JD9 A;  1YJK A;  3VZJ A;  4UW4 A;  4C0H A;  1I5Z A;  2D6K A;  5FWJ A;  4Q1R A;  1HJG A;  3E97 A;  5HV4 A;  2OII A;  4CCJ A;  4YM2 A;  3VHO A;  3U1X A;  4WZC A;  1AL2 3;  2CWS A;  1VBB 3;  3MLJ A;  4QGN A;  3WR0 A;  1ZNP A;  1R08 2;  2FDF A;  4KH9 A;  5I93 A;  2Y38 A;  3AJY A;  1OMI A;  2WAO A;  5BNP C;  4OQ8 A;  4JTN A;  4MGQ A;  1JUH A;  1RTV A;  3N7J A;  5E6H A;  3KD4 A;  2AR6 A;  4AFM A;  3N36 A;  2R0H A;  3NQH A;  4EWD A;  1YFX A;  1Y9M A;  3ABZ A;  1WZX A;  3U75 A;  3UKN A;  1PX3 A;  2Q4S A;  4NHY A;  1DIW A;  3WNK A;  3U11 A;  3MYX A;  3RZM A;  5DDJ 1;  3VBH C;  4I30 A;  2VW1 A;  5LAS A;  2PLV 3;  3OG2 A;  5A80 A;  2RM2 1;  4QPW A;  5GZE A;  1J3P A;  4Z2A A;  1RHI 2;  4PHZ A;  4UWD A;  1BKZ A;  1I9R A;  1UN1 A;  3K75 B;  4OI2 A;  4Q0U A;  2P3J A;  4ZY9 A;  2BNN A;  4E4S A;  2VD7 A;  5LBB A;  2JDH A;  1PO2 1;  1LHO A;  4YW1 A;  2ZEY A;  2WNV A;  5GM0 A;  1W6N A;  4JKK A;  2YDE A;  1XB9 A;  4NIG A;  1Z78 A;  2HYK A;  4OUS A;  1X9P A;  1HIX A;  1PO1 2;  2JG8 B;  4QDS A;  4MET A;  2MNG A;  3BU7 A;  4XFA A;  1ND2 B;  2A6Y A;  4HG6 B;  4CEW A;  4XVH A;  2RDR A;  1U5Z A;  1XXN A;  2D3P A;  1POV 0;  2VZT A;  2XBO 3;  1OA4 A;  2OXB A;  4F8A A;  1IG0 A;  2ET1 A;  1US3 A;  4M00 A;  1K5J A;  4CXY A;  2PHD A;  1FOD 2;  1BLZ A;  2HJI A;  2XOM A;  2YC0 A;  2ZX0 A;  5FYV A;  3T2T A;  5IAX A;  3MZH A;  1Q3E A;  2ZX2 A;  1WW6 A;  5FP8 A;  5FUI A;  4KG0 A;  2C26 A;  3AP7 A;  2X29 A;  2D5H A;  2WA4 A;  1D4M 2;  4JV4 A;  4WM8 C;  5CBL A;  2DV9 A;  3P3N A;  2D7F A;  2VTX A;  3MV0 1;  4MGZ E;  3VHP A;  2SBA A;  3HNM A;  5EFU A;  2ARB A;  2BEO A;  1ULF A;  2DVD A;  3OGR A;  1G9D A;  1RB8 G;  3G6J B;  4AFB A;  3SCG A;  4AR2 A;  2IC1 A;  4KWU A;  1AR7 1;  3P1I A;  1C5I A;  1S0J A;  4YW3 A;  1LED A;  1DLC A;  2BRT A;  2VTX J;  4D7T A;  4KMQ A;  3I3M A;  3K4D A;  5K0U A;  4LMF A;  2CDO A;  2BW8 A;  2QQM A;  4NPR A;  3W21 A;  3ZYP A;  4HK9 A;  1R1A 3;  2J7M A;  3GJB A;  3UGG A;  1UXZ A;  1RMU 3;  3C7H A;  5FUN A;  1PVX A;  1NYW A;  4QGM A;  1YNA A;  3KMH A;  4CVU A;  4BXS V;  1XQN A;  4P00 B;  5HCB A;  1V6O A;  4GJZ A;  1RUE 3;  3NRU A;  3JQW A;  3SCH A;  2J1S A;  3PLQ A;  1J58 A;  1DG6 A;  3GZE A;  1MQT A;  4XIL A;  1K5M A;  1SFY A;  3M3E A;  5DG1 A;  3WP6 A;  3PME A;  5DUV A;  3VZK A;  4FTS A;  1POV 1;  3HT2 A;  4K8R B;  1CZV A;  2EIE A; 
#chains in the Genus database with same CATH homology
 2FCU A;  5C5U A;  5IAT A;  4NHK A;  2HBU A;  5HV4 A;  4NAO A;  4NHL A;  2OPW A;  4XAB A;  4XC9 A;  5DAP A;  3OUJ A;  5ERL A;  4MHR A;  4JZR A;  4Y5S A;  4NHX A;  2V4A A;  3OBZ A;  5DAV A;  4NHY A;  5EQU A;  3BVC A;  5M0T A;  4XCA A;  2Y33 A;  4MHU A;  5L9B A;  5LAS A;  3KT1 A;  4ZPI A;  5LBC A;  4UWD A;  2RDS A;  5L9V A;  2FCT A;  3NNF A;  5LBB A;  4BQY A;  5LA9 A;  3HQU A;  3NNL A;  5C5T A;  5DAW A;  2HBT A;  3OUI A;  4ZON A;  2A1X A;  2FCV A;  2RDN A;  3HQR A;  2RDR A;  4BQW A;  3EMR A;  4XCB A;  5DAX A;  2RG4 A;  3KT4 A;  5LB6 A;  4IW3 A;  5IAX A;  4XAA A;  4NMI A;  5A3U A;  4J25 A;  3GJA A;  2G19 A;  3PL0 A;  5L9R A;  2JIG A;  3NNJ A;  2RDQ A;  3KT7 A;  4KBZ A;  5DAQ A;  4Y5T A;  2JIJ A;  3W21 A;  3GJB A;  2Y34 A;  4NHM A;  3NNM A;  5LAT A;  2G1M A;  3ITQ A;  4Q5O A;  3MGU A;  4BQX A;  3OUH A;  3GZE A;  5EP9 A;  3DKQ A;  4XAC A;  5HV0 A;  5LBF A;  3W20 A;  5EPA A;  5LBE A;  5IAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...