2ZGUA

Crystal structure agrocybe aegerita lectin aal mutant i144g
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSGFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-tumor lectin
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
total genus 33
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zguA00
1C57A 2DU1A 4FPHA 4YM0A 4YZ2A 1LECA 1Q8PA 3NV1A 3A0KA 4XJAA 4HL0A 1B09A 5HCBA 3POSA 1W6OA 3TAYA 4XMAA 3ZSMA 1LHVA 2WJSA 4M00A 2A6XA 1GICA 2PHFA 3AFKA 4Z8BA 1S1AA 2GNBA 2YROA 1APNA 3AXEA 1LHWA 4XILA 3ZXKA 3WHTA 2JE9A 4XZPA 4CRQA 4Q1RA 4YW5A 2R1BA 1LCLA 3A4UA 3IPVA 4FOVA 4AGGA 3B01A 3N3HA 1CVNA 1LULA 1OKQA 5KXBA 1SFYA 3AX4A 3B69A 1AX2A 2R0FA 4FQZA 4M3CE 1Q8VA 1W6NA 2DVDA 2I2SA 2NM1A 5CA6A 1IS6A 1ENSA 3MW2A 1A3KA 1J1TA 4XXAA 1IKQA 2GNDA 4FOYA 5T55A 2D7FA 1WW7A 2D6PA 2P3JA 3POWA 2DTWA 1GZWA 4PQ9A 1GKBA 1V6IA 3WOGA 3WVJA 2E7QA 2YY1A 4K20A 4AVSA 1Q8OA 1UAIA 2UURA 5IT6A 5IK5A 1FATA 4LBLA 1CPNA 3BTAA 5F5QA 3N7KA 4Q1PA 4YM1A 1G9CA 1WLWA 4R9AA 5H9SA 1KQRA 3VKNA 5LK5A 1GZCA 3AP9A 1AF9A 1RINA 4WZFA 2EALA 4GA9A 2CWMA 1LOCA 2D6NA 4Q8LA 1ENQA 1CIWA 1YYNA 4XOGA 2PHWA 4ISQA 1LHUA 3FBYA 4M3CA 1SLAA 1UZYA 2OUJA 2XB6C 1AX0A 2PHRA 4GWNA 3WDWA 5CAZA 1GV9A 4YW3A 1KITA 1QF3A 3VKOA 2GALA 2VU9A 2ARXA 2ZMKA 3AYDA 2GN3A 4R9DA 2P3IA 4FPEA 4UW6A 5DZEA 1JUIA 2CY6A 3UL2A 1A8DA 3MW3A 3FFZA 2G4IA 4UW3A 2GDFA 1FYUA 2C9AA 2DVBA 1SACA 1OFSA 1FV2A 2UWCA 1LOFC 5E89A 1QOSA 2ZMLA 3AP5A 1YI7A 3KQRA 1LENA 4YZ1A 1N1VA 3FLPA 1YO8A 4LBKA 5JOYA 2UWAA 3WDVA 3ZXFA 1F5FA 1F31A 3AP7A 4Q2FA 4XBNA 1QDOA 3O0XA 1GNZA 1PZ8A 4BMEA 1QKQA 3R4UA 3M3EA 2A6WA 2JKBA 1R1ZA 4TYSA 4YZ4A 3SISA 5F9TA 1MS0A 5HCAA 1AVBA 3FLRA 1ULDA 5FREA 2DVGA 4W65A 3NV3A 5KXEA 3HN1A 2ZGNA 2ZA9A 4GKYA 3OYWA 1JXNA 4YM2A 2GMMA 1DLLA 3D6EA 3OY8A 4IQPA 1JOJA 2A7AA 3RG0A 5EXOA 1GYKA 4GWMA 3AYAA 4YGDA 3AZWA 1DYKA 1DQ2A 3QCWA 4XE9A 4D69A 3WDTA 3TB0A 3V0AB 1F9KA 1W6PA 2DUPA 1MVQA 4F83A 3NWKA 2DTYA 3WDXA 2ENRA 4ATEA 1IOAA 1W6MA 4BM8A 5GLUA 3AZYA 1WD4A 3R4SA 2YZ4A 3ZVXA 5E8AA 4ZKTB 1S0DA 1NLSA 5GLWA 4P14A 1AXKA 2SBAA 3MEPA 4FP2A 3POYA 1CPMA 1MS8A 1W6OB 4DPNA 3KM5A 4YLZA 4P9WA 5T5OA 2ZGSA 1V6LA 1SLIA 4YGCA 1AJKA 2YV8A 4UW5A 3WG3A 3ZXEA 2JECA 4YFWA 3IM0A 1IKPA 2HYKA 1SBEA 3M3QA 4BOWA 1AZDA 2D6LX 2ZMNA 3IPVB 1V6OA 2V73A 5T50A 2B7YA 1IS5A 2EXIA 1H30A 1LOBA 1Q8QA 2NZ9A 4FPYA 1QDCA 2NYYA 1G9FA 1G8WA 1SBDA 2EIGA 2JD4A 1GZWB 4DQAA 3PJQA 1UL9A 5EWSA 1D2SA 4JC1A 5DUUA 4XIOA 3ZXLA 5DUWA 5JMCA 1A78A 1VAMA 4LBQA 4Y1XA 1PZ9A 1UZZA 2JE7A 3AZVA 4BLIA 2WKKA 1ULEA 1CESA 2ARBA 3AZXA 3N36A 1QMJA 3U4XA 1LOFA 1VALA 1DGLA 1EPWA 4U2AA 2EXHA 4NOTA 4Q26A 3WUCA 3VKLA 1FNYA 2R16A 2YXSA 3AXDA 3UK9A 2ZHNA 2NP0A 2CTVA 1JHNA 4M3CB 3WV6A 5E88A 4XDQA 1N1TA 2E7TA 1MS9A 2AENA 2AR6A 2H0BA 2WSVA 4H55A 2WNEA 1QNWA 1SLLA 4K1YA 5EYYA 3V65A 5KXDA 4RL7A 1LOAA 3PVEA 1LOGA 1BKZA 1XQNA 2SLIA 4FOWA 4PBOA 5DZFA 4C1WA 1AXZA 1FV3A 4DS0A 5JOZA 3HR9A 1SLCA 3USUA 2ZGRA 3AJZA 3ZXJA 4FPFA 4AGRA 2A3YA 5IK8A 2EAKA 3SH5A 3C2UA 1C1FA 1N3OA 1VIWB 2R49A 4XJWA 5T5JA 3O12A 1WW6A 4YGEA 5H9PA 3ATGA 1UX6A 1O4ZA 2FHRA 1U0AA 3VV1A 1N1SA 1MZ6A 3SNMA 4R9BA 3SH4A 3L2YA 2GMPA 1S0CA 2VW1A 3WZ1A 3RS6A 4DFSA 4YW4A 1ZA4A 1VLNA 2D43A 1QU0A 3ZSJA 4AGVA 3OJBA 1CQ9A 1BYHA 4JRAA 4YGBA 2OVUA 3NV2A 2V5YA 2PELA 5JDBA 1BXHA 2DUQA 2E51A 4FPLA 3PVOA 4FPCA 1CONA 1W6QA 5BYNA 2TEPA 4FPGA 3UJOA 3N35A 3ILFA 1WBFA 4Y20A 2LALA 2R0HA 3OYWB 4M01A 2P3KA 2VY0A 3RRDA 5GZGA 3OY8B 4XBQA 2DWRA 4CTEA 3I8TA 4RA0A 1HDKA 4DRVA 4XMIA 3N7JA 3OGGA 1KDMA 1X50A 3WDYA 3FUQA 1URXA 1MS1A 1V6JA 1WW5A 4XJZA 1W6PB 3LCPA 4FOQA 4XBLA 5KXCA 4NO4A 3DGTA 3PMEA 4LBQD 2CNAA 1W6MB 3D4KA 4I30A 3ZSKA 5EYXA 1FX5A 2DURA 4U36A 2DVAA 4AVVA 5T54A 2GNTA 3M3CA 2ZHKA 3IKWA 5DXDA 1LODA 4KBBA 2ZGOA 2UWBA 1ENRA 4HANA 2ZGLA 4XTPA 1V6KA 5GALA 3WCRA 2ZBJA 2D3PA 5IK7A 1BJQA 1QOOA 4YFZA 1LOEA 5L73A 5H9RA 2YMZA 4WVWA 4Y1UA 4XTMA 3BIWE 4Q27A 3AYEA 4Y1ZA 1ZM1A 2CYFA 4PBPA 1MVEA 3DUIA 1BQPA 4K1ZA 1I3HA 4XJ8A 1N47A 3B00A 4YZ3A 1MS3A 3O5SA 1S0FA 1MR5A 2OUHA 1WCSA 3FLTA 3B3QE 1JYCA 1MS4A 4BPZA 1BZWA 3BOPA 5IK4A 4XHBA 3N7MA 1SLBA 1KDKA 3B9CA 4BQ1A 1WBLA 1DHKB 4LBQB 1LGCA 4YZ5A 5GLTA 2A6ZA 2EXJA 2GMEA 1GSLA 2WT0A 1HKDA 1G9AA 3UJQA 3WDUA 1JBCA 2JDZA 2ZABA 2A3WA 2DVFA 1DBNA 1W6NB 1W0PA 2W68A 2DUOA 4LBNA 3V64A 4YW1A 3Q9OA 3W58A 1HQWA 4GXLA 3RQ0A 4FPOB 5JOXA 1NXD1 4FVVA 4FP3A 1YXWA 4BMBA 3V0BA 2DV9A 1LEMA 4CZSA 1DYPA 1SLTA 2D6OX 1FNZA 3AP6A 1GNHA 3H0OA 4P9YA 5DZGA 4Q8KA 1LGBA 2A71A 2VH9A 2VXRA 3SITA 3USUB 5JLVA 4XYXA 1N1YA 1SCSA 4SLIA 1IS3A 3AK0A 5CBLA 2JJ6A 3APBA 1DIWA 2CL2A 3QLQA 4L8QA 1Z0HA 1WLCA 2A6VA 4LBMA 4Y1YA 2P2KA 4K21A 2D3SA 3VUOA 2Z42A 3ENRA 1C4RA 3JU9A 4Y22A 2NN8A 1UMZA 3VKMA 3OBTA 2P34A 5JVVA 1I1EA 1LESA 1ULFA 3VKFC 2ZKNA 3AP4A 1SBFA 5CNAA 1W6QB 1WUVA 1DQ0A 5GLVA 1QOTA 2XG3A 2AGSA 3W59A 2AH2A 4Y20B 1KJRA 1G86A 1HQLA 3RSJA 1G9BA 5JOWA 2C5DA 1YIFA 4OZXA 5T52A 1N3QA 1DQ6A 1FAYA 1O4YA 3PVNA 3T1LA 3WG4A 1LGNA 3M2MA 1AX1A 5DUXA 1WW4A 3WCSA 3WHUA 2ZHMA 2DYCA 3AYCA 5T5PA 4AWDA 2CWSA 4WVVA 4YG0A 3FUOA 2ZHLA 2E53A 1KJLA 3INAA 1GLHA 1WD3A 2P37A 1Y7BA 1D0HA 3O0VA 1IS4A 1MACA 5T5LA 3T2TA 3ZYRA 4AYUA 1UKGA 1CJPA 4YW2A 1HLCA 4XJUA 3LSDA 4P9XA 2Q5TA 1QNYA 3WNXA 3O0WA 1UN1A 4ISRA 4ATFA 4MYEA 3WG1A 4ASMB 1SCRA 1GZ9A 2E6VA 2W52A 2PHTA 2WT2A 3GALA 4ZXKA 1ULGA 3BODA 4YM3A 1UPSA 1RITA 3RMYA 3ZYPA 3D5OA 3N7LA 4FPKA 3GNEA 2VUAA 5CB7A 3LSEA 4PCRA 4XXPA 2ES3A 1ULCA 2D6KA 1H9WA 1S0BA 5GZEA 3OPZA 1OQ1A 1RIRA 2RHPA 3WUDA 4YG3A 1LU2A 2GNMA 4LBOA 4DRRA 1G7YA 2ZGQA 1VAVA 3T1MA 2WSUA 4FQ4A 4XJ9A 1Q56A 1LTEA 5H9QA 1W0OA 5FRAA 1JYIA 2ZGUA 1S0EA 1AJOA 1G9DA 1MZ5A 2A3XA 4C1XA 1S0JA 1JW6A 3NV4A 1DFQA 2A70A 2NMNA 4XHXA 5GM0A 5GZDA 5DUVA 1DZQA 1N3PA 3A0NA 4BLJA 3WLUA 2PHXA 1LEDA 5IUQA 1WLDA 4ITCA 1H9PA 2A5ZA 2VW0A 2WLQA 4Y24A 4TZDA 1Z78A 3HMYA 4GKXA 3V0BB 4R9CA 1CR7A 2KM2A 2R1DA 4LBJA 2AREA 1LJ7A 1ONAA 3MPPG 2EF6A 3ILRA 2ERFA 2ZZJA 1GANA 3IMNA 3JUUA 3ZPYA 3SLIA 3R05A 1DQ1A 1V6MA 2FMDA 3MW4A 1LU1A 2GN7A 2WT1A 2VW2A 5AVAA 5GZFA 5DG1A 2OW4A 4GALA 2A75A 3SH3A 2WQZC 1CN1A 5GLZA 3AJYA 3IN9A 2AYHA 4UW4A 4Y1VA 5DG2A 2ZGMA 2ZGTA 2LTNA 1V6NA 1PZ7A 1S0IA 1QGLA 3I4IA 2D44A 2UU8A 1YRZA 4YG6A 1GBGA 2ZGKA 3WG2A 4Y22B 3ILNA 1V00A 2DU0A 1JN2P 2D3RA 3M1HA 4FPJA 2AUYA 4Y26A 1S0GA 5SV8A 3CNAA 5GJ6A 2EXKA 3OBRA 3RMXA 2PHUA 3AZZA 2A6YA 1LHNA 4M3CF 3V0AA 1KRIA 2W08A 4PF5A 1DQ4A 1AXYA 1MS5A 1Q8SA 2W39A 5GZCA 1TEIA 3M3OA 3ASIA 4XIKA 2ZACA 4JCKA 2ZGPA 3ZSLA 2BQPA 1DQ5A 2NMOA 1C1LA 2D6MA 4WV8A 5HCFA 1LHOA 2ZAAA 4AVTA
chains in the Genus database with same CATH superfamily
1FXZA 2WFPA 4YM0A 4YZ2A 4BU2A 5EPAA 1QJX3 3NVCA 3NV1A 3KT7A 2WNVA 4AEDA 3A0KA 4XCBA 4DFSA 3HIFA 2OX0A 2JDAA 1LHVA 4XMAA 1JZ6A 2YBKA 1W3VA 3U0ZA 1GICA 2QZ3A 2ATFA 2VNVA 4L97A 2WFF3 3MDPA 1R092 3AXEA 5DAPA 4CDQA 3ZXDA 3J8F1 1OA3A 5KHHA 4Q1RA 4YW5A 2MEV2 1J58A 1LCLA 5EHDA 2W1QA 2Y8KA 3KS7A 4Q0UA 3N3HA 4AGGA 3EB7A 4UBHA 3AX4A 1H8TA 5E6HA 2BNNA 2R0FA 5CA6A 3VGIA 3ZFFA 1IS6A 1UY4A 1S2EA 5BNPC 2HWB3 1WW7A 2P3JA 1OLRA 4GH4A 1GZWA 2R043 2V09A 1AL21 1RL3A 1CPNA 2P4EA 3VBSB 4WM8A 4MUVA 3N7KA 2PFWA 5FZMA 1SMVA 3LFMA 1WMDA 3FWEA 2B39A 5EQUA 5LK5A 5ANNA 5FXXA 5A7NA 4GA9A 2CWMA 4N90A 4HSLA 3AVRA 4LEJA 4OUEA 4XOGA 2PHWA 5C9AB 1POQA 2BEOA 3VHNA 1LHUA 4MHUA 1SLAA 3AFGA 1RXFA 1RUI3 2K46A 4P9JA 3ZXGA 4B3NA 1X33A 2PHRA 5LY2A 1FPN2 2W1WA 1NE6A 2RS13 1QF3A 4JTOA 1YCIA 2IXKA 3PUHA 2GN3A 4R9DA 4FPEA 1UPIA 2QUOA 5DZEA 1S2BA 4Q4X2 3W9AA 5ABJB 5J1XA 1A8DA 1HRI2 3CLPA 3PTYA 2VNOA 2PN5A 4I0BA 5EJZB 5FP8A 3ZYGA 1FYUA 2C9AA 3ZXAC 3BTZA 4PDWB 4Q0VA 2RV9A 2ZMLA 1NZIA 2Z4FA 3KQRA 1LENA 3POFA 2ID4A 3S5AA 4CSWA 4LIVA 3FLPA 4TSVA 4E27A 3P1IA 3ZKUA 3ZXFA 1F5FA 5C3OA 2E7AA 2XQRA 2KD7A 2RE9A 5FYVA 3DYMA 3KV9A 4NRQA 1BEV3 1QKQA 2A6WA 2E32A 1R1ZA 4KWJA 4DXRA 5HCAA 4RQPB 1IGOA 1CWPA 5FREA 1K5MA 1NXMA 1ULDA 2JD9A 3LA3A 1RUC3 2DVGA 4HMZA 4PF1A 3KCCA 3W5NA 1ZYBA 2G9GA 4ES8A 2YG0A 4NHYA 5F5IA 1WGPA 4XUQA 1JTZX 4A3XA 3H8RA 2A7AA 3CKHA 5EXOA 4IUGA 1FMD1 3H3LA 4DXZA 1AHSA 1WA4A 1RUH1 5JPMB 2UYBA 1O6UA 1ZBE3 3O1SA 3LZZA 3J4UH 4QQPA 3NRUA 4F83A 1MVQA 2OXBA 3S5QA 4AOCA 4DXTA 3NWKA 2DTYA 4IE4A 3NJYA 4ATEA 4AFBA 1YEWA 3HVDA 4M4PA 4ZZ5A 2VOTA 3D3AA 5F32A 5E8AA 1YFWA 5JCTA 4GMP0 1S0DA 2ET1A 1NLSA 1ZX5A 3HBZA 1IPSA 4P14A 4G9SB 3MEPA 3OCPA 4FP2A 2BRTA 2HWD3 3LDBA 2RM23 2WS92 3VL8A 3HN3A 4YLZA 1CAUA 4CDXB 2DFCA 1UOFA 4K8FA 4YGCA 1AYN1 3QBQA 1EAH3 4XF1A 3FN9A 3DCQA 4NPMA 1NE4A 2D6LX 4LKFA 1PK6A 4CXWA 4MXWB 2HWF2 1OA2A 4DB5A 1IS5A 1PMHX 4CCCA 3GHNA 2VTFA 5FK7A 1Q3EA 4YWAA 4FSJA 5FZCA 2GP5A 4FAHA 1V0AA 2R071 1OT5A 5FZ6A 4CCDA 3NL1A 4JC1A 1QJX1 2QDRA 1C8M3 4NAOA 1QXPA 3Q8EA 4BLIA 1JI6A 1T6GC 3AZXA 3N36A 1QMJA 3U4XA 1DGLA 4OQ8A 2VCBA 1Y9GA 4NOTA 2D93A 2R16A 4QXKA 4D7TA 2BDRA 1B35B 3UK9A 2ZHNA 3N9MA 4FFIA 4M3CB 5I0SA 2WA3A 2WSVA 4IV1B 2AR6A 2H0BA 4H55A 2HWB1 2WNEA 1SLLA 4JDOA 4EE2A 4R52A 2R041 4LKSA 1LOAA 1XQNA 2SLIA 2XL9A 1RMU3 5DZFA 4DS0A 4LPLA 3ZDSA 1SLCA 4AGRA 3AJZA 4UT5A 3ZXJA 5IAXA 2Y60A 2A3YA 4QPIC 1RUG3 2EAKA 3T0BA 3IDCB 5FLJA 5A7QA 1C1FA 2R49A 4XJWA 3UNPA 4QB2A 3ZLIA 1UZ0A 3O12A 2IUWA 2WO7A 2BBAA 1UX6A 2FHRA 1CZTA 1YIPA 2XJSA 4LHSA 4OMDA 2WWJA 5A3WA 3SNMA 1LRHA 3TN91 4QU1A 3K51A 1S0CA 4QKDA 3WZ1A 4A6OA 1VBB1 2ZPXA 2D43A 2H6BA 4COZA 3ST7A 1WMEA 4ZZ8A 4YNIA 5JXIA 1QJY3 1UZWA 2VZVA 3DL3A 1JYXA 4KBZA 1BYHA 2WNUB 2OVUA 3GDBA 2V5YA 3PNAA 2E51A 4IE7A 1HRV2 4O61A 1GUIA 2PLV2 2RS11 3I97A 3RYKA 1TG7A 1ZREA 3MBWA 2Z69A 1MQTC 3VBHA 3EMRA 2LALA 3RRDA 4ASLA 4I3PA 4HKWA 4DOUA 2VBDA 3OY8B 1XRUA 4XBQA 2AZ5A 4K7JA 5FYMA 1ENXA 1QJU3 2XLAA 3FZ3A 3HT2A 1K3IA 5FP9A 1W8FA 2JDMA 1X50A 3J26N 4GIQA 4OUSA 5GKAC 3WDYA 2QDNA 4CYDA 4RS5C 1MS1A 2JIGA 4ZS2A 3QD6A 4XJZA 5KXCA 5A7PA 4IV3C 4MH0E 4IEQA 2W87A 3DGTA 3PMEA 1ZRIA 2QJVA 5IATA 2FZ1A 2YFZA 4LBQD 3D4KA 4AG4A 5DAXA 1BLZA 3OEBA 5T54A 2GNTA 2QQIA 3IKWA 1PX4A 4V2WA 1AL0G 5IVJA 2FCTA 5SV5A 5HV4A 2NQYA 2XVKA 3JBG3 5FZHA 3WT3A 5KWRA 3RJRA 2ZGLA 4KG8A 1V6KA 2Y33A 4CU7A 5IK7A 1BJQA 1QOOA 2EIBA 1LOEA 4YFZA 2EA7A 5H9RA 3S7IA 2VMDA 4EQVA 5LA2A 1PO13 2G9ZA 5A7SA 4B4RA 1O3QA 1C28A 3AYEA 4KWUA 5CKNA 2P1BA 3C7HA 2FQPA 1BQPA 1POV3 2OT7A 4F7ZA 3ZDVA 1VBA2 4DNYA 1UYPA 4XJ8A 4YVSC 4YZ3A 2Q8DA 4A7KA 1S0FA 2OUHA 2WZR2 1MS4A 1S55A 3DN7A 4UBGA 5FAXA 5FKBA 3UETA 4HVQA 1RB8G 1QQP3 3LKJA 1KDKA 3H7YA 5FXZA 1DHKB 1OQEA 2PHLA 3R0RA 4AI9A 1X9TA 2RM21 3OUHA 4OHZA 3JD72 4J1WA 2B42B 4DINB 1ASJ2 2GMEA 5BXXA 4W4ZA 4ORFA 1UX7A 4Z07A 4JKMA 4XDOA 3AC0A 4QKNA 5M0TA 4CPBA 1L7RA 4DUXA 5J96B 3U11A 5LK7B 1HB1A 2ZABA 4BA6A 2A3WA 1W6NB 1XE7A 1CAWB 1R091 1W0PA 3B7MA 2BUKA 4DY5A 5FDBA 5JI9A 3RQ0A 2VQUA 3MIHA 1NXD1 5FZDA 4FP3A 5LA9A 3V0BA 1LEMA 3BTXA 4LE4A 1GNHA 2GC1A 2FDIA 1UOBA 2A71A 3SITA 1ACCA 4M0NA 1C8M1 3ITQA 4OZOA 4XYXA 2BNMA 3DYPA 1I9RA 4PLNA 1N1YA 2F17A 5AFEA 1UYZA 3ZYFA 4BH9A 4C8DA 3T4VA 4IEPA 3EJKA 3AK0A 1JOBA 4FFGA 2ZX1A 2PA7A 3APBA 2CL2A 1Q43A 2C24A 1WLCA 4EN6B 1IPKA 3VUOA 5J48A 3JU9A 4Y22A 1OD5A 4UOJA 4A4AA 2P34A 1NUKA 1LESA 4E4DX 3OUIA 2ZXQA 2JDPA 3EXUA 3AP4A 3WX5A 3SKJE 1PVC3 1RMU1 3IAPA 2RDQA 5CNAA 3HPNA 4Y4YA 1DQ0A 2XG3A 5FBJA 2AGSA 1KD7A 5D8AA 4I0AA 1D7PM 2AH2A 2Y64A 1G86A 1RUG1 2W91A 3DKQA 4LO5B 3W59A 5I8SA 2C5DA 3K77A 5T52A 4UF0B 3WF3A 4EV0A 3TBDA 1ODNA 4GJZA 3MF6A 4S2HA 5DQ0A 2PYTA 1STMA 1HRI1 5F2SA 4N53C 4XCAA 3K4AA 2DYCA 1W2UA 3AYCA 1EV13 1K12A 4YG0A 2CAVA 1KJLA 3VHPA 3PU3A 3INAA 4A7YA 4TLFA 1GLHA 4KU8A 1QJY1 3F2ZA 4IGQA 1DGWA 3O0VA 1IS4A 2O1QA 4XF4A 3VBFA 1YNAA 2FMYA 1MACA 1WKYA 4HK9A 3H42B 3ZYRA 4AYUA 4E4SA 3J9SA 4IL7A 4MGIE 4XJUA 5ERLA 4KL1A 5CG8A 4QPWA 3WNXA 4ISRA 3MLLA 5FZOA 1AL22 3H8XA 2WT2A 2ZTNA 1AUYA 4Q0SA 4S2DA 4QPYA 4Q29A 4Z82A 4AL9A 2ARCA 3MLKA 1GFF2 3NKTA 4BIOA 2QQLA 1NA1A 3D5OA 4FPKA 3GNEA 5C8CC 3M3IA 5LY1A 3GCWA 1PX3A 2VUAA 4NHKA 4XXPA 2WNVC 4NVPA 4PCRA 1OVSA 4AEDC 2ES3A 1L7LA 2VOVA 4LITA 5EZWA 3IIAA 4PT6A 5GZEA 4UFLA 4CCLA 5FMCA 4RN5A 1PNFA 4YG3A 5FTTC 3B94A 4ZU5A 3HNBM 4QGLA 2ZGQA 5CFCA 3LWCA 3NAPC 1YQ8A 1LTEA 1F4HA 5H9QA 2YDEA 1RUE3 4DMIA 1H8TC 1DZRA 5ACA2 2GH8A 4FFHA 4HVRA 1D4VB 1JS9A 2A3XA 2WS91 3GBFA 1DFQA 2VE1A 1WCKA 2AEYA 2QFEA 3H50A 4DY3A 4OYUA 3E97A 3I3MA 1POV1 1LEDA 1XC6A 4LUMA 5IUQA 3ZN6B 1WLDA 4FAGA 5AC93 2E33A 5FZ4A 5B4NA 4WM8C 4TN7A 4HXCA 4EWAA 2ZJCA 4NWWA 1EYBA 2OQ7A 3HMYA 4JX0A 4YYOA 2HWF1 3M8LA 3ME2A 1W03A 4P9GA 2R1DA 1ZBA3 3I54A 3MPPG 1QQP1 4K8RB 3ILRA 2ERFA 2ZZJA 1GANA 2BWAA 4CDWA 1YHFA 5HXVA 2VNGA 2DCYA 2DCZA 1FI2A 2FMDA 2HEWF 5AVAA 3RZKA 3EBRA 1VB2A 2WQZC 1NG0A 3OOXA 4OCTA 3SCGA 2RDNA 4RS5B 2QQKA 4CEWA 2ET7A 3ZO0B 2LTNA 1PZ7A 5FZ9A 4BWOA 2D44A 4LLOA 2PAMA 2VVFA 4CEYB 4YG6A 1GBGA 3I3BA 5FZBA 1RUH2 3NKGA 3WG2A 2DU0A 3KCXA 2WN2A 2IXLA 5LCWL 3KVBA 3J7NA 2BGOA 2J7MA 1RUJ2 1W2AX 2EXKA 3OBRA 3L2HA 4HOOA 2A6YA 1LHNA 4WM7A 5IHRA 2GC0A 1BK1A 4CUAA 4PI2A 2RMU3 2W08A 3V0AA 1DQ4A 2WZEA 3WNLA 2IZWA 2Y6FA 1UQXA 1NAEA 5FQ0A 4BQ4A 1J3RA 4IEXA 5FMDA 2ZACA 3AMMA 2XL7A 4JCKA 5KBFA 5L9VA 1DQ5A 2R063 1J3PA 1LHOA 3B93A 4LHKA 2Y6KA 3LOBA 1CGPA 2ETEA 3LGRA 5J3UA 3BU7A 3K48A 2RJ2A 1AYN2 5ABJC 2GC2A 4BHPA 4D6QA 1A8MA 4Q4Y3 5HCBA 3TAYA 3OGJA 3POSA 4LK7A 3VBUB 4MG2A 2RG4A 4A6SA 2WINB 4UAPA 2PHFA 5I8TA 3WNPA 5LA1A 1R1A3 1V9U3 3GBWA 3CHXA 4AFMA 2IVJA 4R8HA 1HRV1 3B01A 2DCTA 1LULA 1PGL1 2ZEWA 1AX2A 2I2SA 1KXGA 1QJX2 1H6XA 1J1TA 3KF3A 3TNQA 4COWA 2CDOA 2D6PA 3POWA 1O3RA 4AQTA 1GKBA 1HJFA 3WVJA 2E7QA 2YY1A 4K20A 1JZ3A 1Q8OA 5IT6A 2WFF2 3C7EA 3KV4A 2HLEA 2RR13 3FHAA 4LBLA 2VCCA 3BTAA 5D2AA 5FY8A 5A32A 4E9KA 1GR3A 1YQ6A 3CU7A 4Q1PA 1G9CA 4R9AA 4LO8A 1O5UA 3H9AA 2EALA 1TME3 2O14A 3LOIA 2VQAA 1M4WA 3VD3A 2HWB2 1ENQA 1CIWA 1YYNA 2JG8A 4LORA 3HAGA 1PK6C 2XDVA 1RXGA 2GC3A 2QVSB 2R042 3NNLA 3L9JT 5F6LB 5JAXA 1U5ZA 4EN0A 1VE0A 3FBYA 2QBXA 1UZYA 3Q8BA 1OH3A 4JKLA 1AX0A 4JGYB 2FDGA 1T2XA 1X8EA 3UESA 4AE2A 4KNCA 3RI9A 5CAZA 1GV9A 2P6CA 1KITA 3N9OA 2BOJA 2ARXA 2ZMKA 1REEA 3PLQA 4W8JA 4EJRA 2JENA 4NE9A 4X6QB 2QQWA 2CY6A 3E5XA 1JZ4A 3WP5A 2G19A 2Q0AA 3MW3A 5I8YA 5FZ8A 2J22A 2VZOA 4P5HA 3THTA 5E89A 1OFSA 2UWCA 1JYVA 3E1F1 3ZYBA 1RUI2 1OXCA 1NT0A 1OVPA 4CDUA 1N1VA 1O91A 2WZR1 3CDZB 1YO8A 1W8HA 2XJUA 3I2GA 2ILMA 3JCIA 1SEFA 4XQ4A 2RS12 3AP7A 4O9GA 4UFMA 1GMMA 5C4WA 4YSFA 5J09A 1PZ8A 4WVMA 3H1YA 3NJXA 3M3EA 4TYSA 2EIEA 4YZ4A 4N53B 3I49A 3DYOA 4ZU4A 1AVBA 3FLRA 4NMIA 5FPLA 1C5IA 4I2OA 4W65A 5KXEA 3ZYIB 3T2OA 3O1VA 2CGPA 4XFHA 3HN1A 2Q1ZB 3TEZA 4GJYA 2JDNA 5AC91 3OYWA 1JZ7A 5A70A 3LEIA 4YM2A 4BQXA 4L92A 1SPPB 4GB33 1JOJA 3IDEA 2R30A 1GYKA 4YGDA 3ZX7A 1GOFA 4RGKA 2C26A 4LOSA 1DQ2A 4XQWA 3QCWA 2P5BA 3TB0A 2W1UA 1BEV2 4KQ7A 3I59B 1O3SA 3O1TA 4HPKA 1ND3A 5A6QA 1XU2A 2PQSA 1W6PA 5C8WA 4Z2AA 5IVFA 1RUC2 2X05A 4IV1C 3VBHC 4N43A 1PGW1 1GQPA 4FTBA 4P02B 1OLQA 3FE5A 4BM8A 1VBC3 2IXJA 2X09A 4NIIA 1OLME 2VTXJ 4CE8A 1AR93 3BVCA 2JB8A 3H8OA 4RFRB 5LA0A 2SBAA 2WNVB 4HBNA 4AEDB 1RTVA 1ZBE2 2YUEA 5IYYA 4Q4V3 3GGLA 3AKQA 4QPGA 2ZGSA 1VP6A 5FPUA 1QH6A 3AVSA 2R6QA 4IEVA 1W28A 4UW5A 2XUMA 3ZXEA 4CDQB 4EROA 4KGQA 5I0UA 2HYKA 3KT4A 3JQWA 1SDWA 1AZDA 2ZMNA 1YFUA 3VZKA 2HEYF 2BFUL 5L19A 4IEZA 1H8TB 1H30A 5F6KA 3U75A 3ZFFB 3OTFA 2R061 2IXCA 2JIJA 2NZ9A 1QDCA 2NYYA 4FPYA 2YPJA 2HWD2 5FZ0A 5IJRA 4Z1VA 5I93A 2RM22 2EIGA 2VMEA 4GH4B 2PXJA 3RZZA 4C0BA 1GZWB 3NMBA 4DQAA 3PJQA 5CADA 4P5YA 3O1RA 1DDLA 1D2SA 4QDQA 1CAVA 1EAH2 5JMCA 3I2KA 4LBQA 2X5IA 4QKBA 2JE7A 3AZVA 4WM8B 5CYYA 5KHIA 4HKOA 2WKKA 4Q4W3 1CESA 2ARBA 2H6CA 3C7OA 3E5UA 2RVAA 4HG6B 4X6RB 1X7NA 2DDUA 1LR5A 1LOFA 4A42A 1TZOA 5K0UA 1V9U1 3OSDA 2EXHA 3WUCA 2FCVA 2TNFA 1DLCA 3AXDA 2IWGB 3T09A 2NP0A 1W2OA 3LA7A 3RPQA 2DF7A 2E7TA 4BQYA 4P9WA 5ISLA 1C8M2 5EYYA 2YC0A 3V65A 4AHXA 5BNNA 4CP0A 1JYNA 3PVEA 1KFXL 2XWBB 3THCA 2QQJA 2VNRA 3LD8A 4FOWA 4PBOA 4AEKA 3BCWA 3USUA 4AR2A 2RR11 3W21A 3QH7A 1EPZA 5IVYA 3HQRA 1RUNA 1N3OA 1VIWB 3H1MA 3IBMA 5T3NA 3VB9A 3ATGA 4CU6A 2JG9A 4LO7A 1N1SA 1MZ6A 2X53S 2IFRA 3SH4A 4AI2A 2VW1A 4AHYA 3ZFGC 4YW4A 1VBE3 1ZA4A 1RMU2 2VJXA 5F3EA 2FBEA 4H2AA 1ZRDA 1H1MA 1QEXA 1UF2C 4JRAA 4YGBA 1RUG2 2RS53 3NV2A 3OUJA 2W94A 3OGSA 1BXHA 4XF3A 3IDAA 4FPLA 1K5MB 5ACA1 1COV3 1UU4A 1W6QA 5BYNA 1TVGA 4FPGA 1F2NA 3G6JB 3ILFA 3N35A 5DAQA 4Y20A 4GMP3 4BZ4A 1CX1A 2VY0A 5J36A 1DU3D 1D4M3 4AVAA 1K42A 4ARYA 4CTEA 2QTWB 3MO4A 1U5YA 1VPHA 1KGYA 4I09A 1BVP1 2GAUA 5FYZA 1KDMA 4XFAA 1QJY2 2F4PA 3CEWA 3H8UA 3VL9A 3SCHA 5IVCA 3E6CC 1YUDA 2YC2A 2XGXA 3FUQA 2Z5WA 4ZXEA 4ASKA 4FOQA 4NIAA 4NO4A 1VBD3 5A33A 1ND2A 3ETQA 1C8NA 3ZSKA 3PIJA 4RSUA 1FX5A 4U36A 3M3CA 1QJU2 2FCUA 2ZHKA 2VBBA 4A41A 3RYRA 1R64A 1LODA 2ZGOA 4AHWA 5D8AC 4CP2A 5J7MA 4NIHA 5GALA 2KXLA 3K75B 4QQHA 4GB31 3TNPB 3WY6A 1DGRA 1CAUB 2GH2A 5FOBB 3N9NA 2VVEA 2W1SA 2YMZA 4N7IA 4F3JA 2C6SA 4W50A 1AR83 1MPXA 4XTMA 4E8DA 4DXSA 2ZEYA 3TOJA 5DDJ3 3RI8A 3BPSA 1PK6B 1PMJX 1RUJ1 2CYFA 1MVEA 4XQDA 3WNKA 5BNOA 4XFCA 4ZU7A 1L3JA 5CKQA 2NPIA 1I3HA 2ZS6B 3NW4A 4AHZA 4LO6B 3JBG2 4LHNA 1MS3A 4IGOA 1MR5A 1NY71 1EY2A 1VBC1 3C7GA 5A3PA 1JYCA 1XXNA 3VBFC 3N4MA 1DGWX 4PQQA 3B5LB 4PDWA 1BZWA 1Y9MA 1AR91 1ZZCA 3CZUA 3GZUC 4RHV3 4XHBA 5JSPA 2QQNA 5J98B 2XJPA 1GWLA 1RC6A 1PO12 1WBLA 4IDZA 4OULA 5KHJA 1F8VA 4MGQA 3NNMA 4AF9A 1CZVA 1PIV3 1UMHA 1V70A 3LA2A 4Q0PA 1W3XA 1NCRA 4NHMA 3D0JA 4HZFA 1JBCA 1NA1C 3BGAA 3JB8A 1LKNA 4KU7A 1TMF3 3MYXA 1SZBA 4E4HA 2W68A 1ULPA 2DUOA 2QNKA 3JXSA 5JIAA 4XAEA 1QQP2 2E63A 1HQWA 3Q9OA 4YW1A 3W58A 3VZNA 2VZ3A 3LAGA 3WP6A 5JOXA 1YXWA 2FDJA 5LEKA 4N8MA 3RZGA 4YVWC 1DYPA 1SLTA 1JZ5A 3VZJA 2B9VA 2D6OX 5FXVA 1FNZA 3AP6A 4Q8KA 2Y0IA 5JLVA 3KLSA 5HCHA 2Z2SB 3LEMA 2OQ6A 4Q4W1 4K3UA 5F3IA 1SCSA 2WFF1 1IS3A 3ELNA 3O7OA 3A21A 1C5HA 2JJ6A 4Y5SA 1GWMA 5C33A 3QLQA 2EICA 1CJDA 1D2QA 4OFGA 3MV11 4MXVA 1Z0HA 3FFQA 2A6VA 3WW3A 3CJIA 1UY1A 2D3SA 4K21A 1GQHA 4BE3A 5IVEA 2OZJA 3FC0A 3VD4A 3ENRA 2PTMA 1C4RA 2PMWB 4HETA 2B45X 4M0HA 4X8NA 1UMZA 4HN1A 3VKMA 5JVVA 3KMHA 4LO4B 3QH6A 4QHOA 3VDAA 1HXS3 3WF0A 2G1MA 3F95A 2BNOA 4WBBA 5GLVA 2Q8EA 1QOTA 3UKTA 4CDWC 5JR2A 3VBHB 4CCJA 5JOWA 5HBAA 1RJ7A 1H2MA 5LRSA 4Y33A 1FAYA 2IXIA 4YRDA 2QQVA 5B4XA 1HB4A 2CDPA 5DUXA 1VMHA 3WCSA 2VL4A 5A3TA 2XONA 2CWSA 3IZOA 4WVVA 2P3YA 2ZHLA 1PVC2 3BI3A 1RUI1 4EZHA 1JODA 1W9WA 2N7GA 3MGUA 2C1FA 4E2GA 4INDA 1Y7BA 2ZOEB 2RS51 3NNJA 4CP1A 5JSOA 1UD1A 3IAQA 1PGL2 1WMXA 4LKDA 2BFUS 1COV1 5LEJA 1UKGA 1CJPA 2B5HA 3AMQA 1RVF3 4WM7C 4YW2A 1TNFA 1T6BX 4LXLA 4P9XA 4BYYA 2Q5TA 2RS33 3ES1A 4GMP1 3V56A 3LF7A 1EV12 1W99A 4MV2A 4ZXKA 4URTA 1ZZ6A 2HWC3 3A23A 4G3YC 1RITA 5E1RA 1YQCA 1W04A 5KHKA 3KSCA 5FYUA 3ZYPA 4RR3A 4CEYC 2VXJA 4PI0A 2QCSB 3I7DA 3RZLA 1BEV1 4WZCA 2K0GA 1CX4A 1ULCA 2D6KA 2ZEXA 5A1LA 3S57A 3P3PA 2C0ZA 1RUOA 2HWE3 4JGZA 1I5PA 1RUC1 1OQ1A 5JZGA 2WZPP 3CQOA 2VAUA 3WUDA 4L99A 2QQMA 1G7YA 2WO1A 4HVOA 1W8TA 4R4XA 4MSVA 4X8PA 4FQ4A 4Z2WA 4XJ9A 3G7DA 5IFTA 3WNNA 1OQDA 5FRAA 3CZJA 3POJA 4Q0QA 1XSQA 3K3NA 3B02A 1S0JA 1ZBE1 2JDHA 1E5SA 5GM0A 5GZDA 1UNBA 1VJ2A 1DZQA 3A0NA 2XJRA 1FOD3 4IXLA 3ZFGB 5A7WA 2FDHA 2DFBA 3HBKA 3VBUC 2VBPA 3KV6A 3D8CA 4ITCA 1H9PA 2A5ZA 1GQGA 4QHZA 2JKXA 1Z78A 3V0BB 1RUE2 2CGNA 3O1OA 3C3VA 4NR1A 4R9CA 1CR7A 4EYUA 1TNRA 4CCNA 4IEOA 2YPDA 1CD3G 4JAAA 2EF6A 4RHV1 4QQ2A 2HWD1 3PVBB 2I74A 5FZEA 3SLIA 3R05A 5C70A 1GOGA 3ES4A 1V6MA 2ZX0A 4NIGA 2XJTA 1EAH1 2GN7A 1DP0A 5AC92 1S2KA 3RZJA 5GZFA 5DG1A 2OW4A 5LWBA 5BNPA 5CVRA 3IN9A 2AYHA 3EHKA 1OOPA 1TMF1 3AMNA 2ZGMA 2CAUA 3OEAA 5DG2A 4JQRA 5FO7B 1ZBA2 2UU8A 1YRZA 1W0NA 3LDKA 2ZGKA 3ABZA 4BQWA 2VPVA 4Y22B 3ZSEA 3X29B 1ST8A 3M1HA 4FPJA 2Q8OA 4Y26A 1S0GA 2VOXA 3CNAA 4PHZA 1PGW2 3OBZA 1BVVA 1QHDA 1WCDJ 2W3JA 1OF3A 3B9IA 4SBVA 4CDUC 1KRIA 4PF5A 3S7EA 1W90A 5D8AB 1IG3A 1UOGA 4LULA 2W39A 5GZCA 5HI0A 2O8OA 3ASIA 4JGYC 4XACA 2BQPA 2CHHA 4D8MA 5C4WC 3D0SA 4WV8A 3CO2A 3PTRB 4B1MA 1VRH3 2D97A 4CXXA 5ANQA 3PMSA 1C57A 2HEVF 3T2QA 4FPHA 1PO23 3ZR6A 1LECA 3HWJA 2YBPA 4XUTA 2YBSA 1B09A 2RMU2 2R7EB 1W6OA 2WYSA 3DPRA 3HT1A 4WVZA 3KGZA 4IESA 5AVPA 1RHI3 4QM8A 1CZSA 3VBFB 4BK4A 2XBO3 3AFKA 3MFAA 4Z8BA 5FYTA 1APNA 4GWJA 1LHWA 2R062 2ZEZA 1OPOA 3JZVA 3A4UA 3IPVA 5FYYA 1ND3C 3FJSA 1HW5A 1SFYA 4FQZA 1KS5A 3ETPA 5IAVA 5A3LA 1W6NA 4N43C 1WA6X 3VZMA 2J42A 4Q4Y2 1A3KA 5T55A 4XXAA 5K9YA 4HLTA 5F37A 2D7FA 4AFDA 4DO0A 2Q1FA 3K46A 4LMFA 3RWNA 2A73B 1NA1B 3BPZA 4PQ9A 1HQNA 1SFPA 2VGDA 4LA3A 2ZKLA 4AVSA 1UAIA 2UURA 2VO5A 5IK5A 4EWDA 1R1A2 1AR63 1V9U2 2BVVA 3LB9A 1E5RA 3HNYM 5FP7A 1A34A 1WLWA 4P00B 3VKNA 1KQRA 2BBVA 4CU8A 4QX8A 5CFDA 1GZCA 2G9FA 4LKEA 1AF9A 1RINA 2P17A 4YVWB 3SCFA 2YU1A 1O4TA 1VRBA 1Z7S3 3POEA 3PUQA 4Q8LA 4QAWA 5CFCB 4KWLA 3NO8A 1BCXA 4LIUA 4ISQA 1QJU1 1GP5A 1OSGA 3ZMOA 4JHTA 2OUJA 2HWC1 2RR12 3VBRC 1WCQA 3U1XA 1XNDA 4GWNA 3WDWA 4NJ4A 2XWJB 5FWJA 4AK3A 1UU6A 3ZFEA 1TME2 4XEZA 4UW6A 3UL2A 2P3IA 1JUIA 1W8ZA 1XNBA 2X5IC 1IG0A 1H4GA 4COVA 3KHBA 3FFZA 2YGLA 1UWWA 1SACA 2VULA 5G04L 5L9BA 1LOFC 4LOTA 4CDQC 1QOSA 1SG3A 2J1EA 4DUWA 3JBG1 4D6RA 4YZ1A 3PJYA 3ACHA 4CDWB 2W0XA 1OUXA 3DXTA 4LLFA 2UWAA 1DCSA 4L2NA 1F31A 4JDMA 5F1RA 3ZFFC 2ARAA 3AKRA 2XH6A 3IT8A 4XBNA 4MOAA 1PO11 3VBOA 3VZLA 4NROA 4GH4C 5A1AA 3R4UA 3SISA 5FP3A 2BJSA 3WSOA 5BNNC 2D98A 2WN3A 1IQAA 1RJ8A 2LROA 4CEWB 1H4HA 3NV3A 3GHMA 1XJAA 2ZA9A 2ZGNA 4GKYA 4KMQA 2WNOA 4D7SA 4XVHA 5HV0A 1F15A 4QX7A 3D6EA 5CEHA 1H6YA 3GXUA 3IWZA 4OI1A 1JH5A 4CU9A 2BOIA 2H0VA 3AYAA 2QZ2A 3AZWA 1WCUA 4XF0A 1DYKA 4WM7B 4D69A 1XNTA 3V0AB 4LQRA 1S4CA 1F9KA 1GU3A 1OFNA 3GZAA 3H7JA 5FY1A 1BMV1 5IWFA 5FQ0B 2VUDA 3SEEA 2D5FA 3NNFA 3WQ7A 2ENRA 5FY9A 3HQUA 1IOAA 4UFIA 1W6MA 4QXCA 2WO3A 1AR73 3AZYA 4GB32 3R4SA 2CGOA 2XPJA 5I0RA 4QB1A 5GLWA 2TBVA 4NAMA 1HN0A 3POYA 3SEPA 2UY8A 1MS8A 1ZZ9A 3KM5A 1W8NA 4QPIA 2VCMA 3MLJA 4OHVA 4PIYA 4XETA 2OKXA 2YV8A 1VMFA 4MHRA 2JECA 4YFWA 4XW3A 2AC1A 3M3QA 3OGVA 1NY72 4BOWA 1VBC2 5FZLA 5LBFA 4O65A 5EJ3A 4UFKA 2WUHA 1BBT3 2Y6LA 5A6XA 1AR92 5T50A 1PVXA 1JYTA 2EXIA 5BNQA 2BP6A 1LOBA 4N7UA 3ZN6A 4CA9A 2JE8A 1U12A 4CCOA 1HX6A 1G8WA 1H8VA 1K5MC 1SBDA 2JD4A 4Q4V2 4UXAA 2W46A 1UL9A 5EWSA 4LHLA 5DUUA 3ZXLA 1A78A 4QX0A 1H2KA 1PZ9A 4Y1XA 4QXHA 1MQTA 5A32B 1RHI1 1ULEA 4JDNA 1PVC1 5DN2A 3T4HB 3ZIWA 4QGMA 4A44A 1QXJA 3LQCA 3LIGA 1EPWA 3LPGA 4U2AA 4XABA 2TUNA 2JG8B 1W2NA 2YXSA 4F8AA 2B4KA 5BNOC 4RS5A 5FOJB 2CTVA 2Z79A 3CL1A 1O8PA 1GP6A 1JHNA 3DXUA 2XHKA 1TE1B 2R32A 3HEIA 4IV3A 4XDQA 4BMEA 5LW9A 1ZRCA 1QNWA 4K1YA 1GNYA 1EV11 4B29A 1BHGA 4Q4W2 3PUIA 4RL7A 1BKZA 5JOZA 1HJGA 2YFUA 1AXZA 4BQ3A 3BOWA 1BK0A 3HR9A 1AYM3 2VTXA 2ZGRA 1AR61 3J8F3 3AKPA 3WNOA 3RNSA 4ARXA 4D6SA 1H2NA 1FT9A 4S2FA 5DMYA 1H1IA 4XDPA 4JTNA 5T5JA 4YGEA 2IFWA 5H9PA 1Z7S1 1NCRC 1RGSA 2XLGA 2XOMA 4HONA 1U0AA 3UGHA 4CDUB 2W5FA 3L2YA 1O5LA 1YI9A 1QU0A 3FMGA 5JI7A 3ZSJA 4AGVA 2D5HA 2IVIB 4Y5TA 3GZTB 5G05L 5C4WB 4WVMB 1CQ9A 1Q5OA 2VZ1A 4YVSA 4I01A 2PELA 5JDBA 4B4QA 5J37A 1RUD3 2RJKA 4FPCA 2VZSA 2TEPA 4QQLA 1HB2A 1WBFA 3OYWB 4TXWA 2WAAA 2WYFA 1LAJA 3CMGA 5GZGA 4QMAA 1VBE2 1OF4A 4NHXA 1HDKA 5F2WA 3I3QA 5L7OA 1JZ8A 3OGGA 4KH9A 3GF6A 1W9FA 4A45A 1OBNA 4BXFA 1UO9A 5FXWA 1VMJA 2RS52 2WC2A 2WQ4A 1RUE1 1URXA 5FYCA 2V5DA 4HPKB 1V6JA 1ND3B 1WW5A 4CUGA 4D7YA 1W6PB 1COV2 2V72A 4XBLA 4B1LA 4N43B 4QU2A 5C5UA 3VZOA 4BQ5A 5F3GA 2VUCA 5FPVA 4I30A 3U10A 1D4M2 5EYXA 1HV0A 1K45A 4W6WA 5K4LA 2XJQA 5FMBA 3KQ4B 5DXDA 3VHOA 2FDKA 1UMIA 4KBBA 2Y0OA 2UWBA 3H1WA 1ENRA 4XTPA 2OS2A 2IC1A 1ZVFA 3M7AA 4LK6A 2ZBJA 2B46X 2D3PA 3WCRA 3VD9A 4HKLA 4DZGA 4QPGB 5K8SA 1ZBA1 1VBD2 2X29A 4WVWA 5C6CA 5I0DA 5A1FA 1ULOA 5JXGA 3O1UA 4NN0A 4BISA 3BIWE 4MO3M 4OHYA 3J7LA 4BIFA 3FX3A 3DUIA 1UZVA 4K1ZA 1XYPA 4FO9A 2RDSA 1NCQA 3MICA 3U78A 3USSA 3VBRB 1JHJA 3P5BA 5EJ1B 1AR71 3H3UA 4BPZA 2QQUA 2Y26A 1CAXA 3W5MA 4DEVA 5LZ6A 1NX9A 2VMGA 4ONUA 3BOPA 3OD0A 1FMD3 3P3NA 4YW6A 1AR82 1CAVB 3BN6A 3P6BA 3B9CA 3OF1A 4J25A 4BQ1A 1ALYA 2VUJA 4LBQB 2X5IB 2ZX3A 5DDJ2 4YZ5A 3ZOIA 1DZTA 5GLTA 2A6ZA 2VZQA 1Y43B 1UU5A 3W20A 3BB6A 1GSLA 2WT0A 2RMU1 3KWVA 4Q5OA 3C7FA 1HKDA 2HJIA 2VCAA 5FIXA 2FDFA 3UJQA 5IVVA 2JDZA 4GULA 3LPFA 3T3YA 1BBT1 4JRLA 3HNMA 3V64A 4LR4A 4RHV2 1KFUL 5JMOA 4QHBA 1I5ZA 4A7ZA 1HB3A 3WR0A 4OVEA 4YW7A 2DV9A 5BNNB 2W92A 3MIBA 1OLMA 1PIV2 4CZSA 5JZGC 3VDDA 3H0OA 5EIYB 5DZGA 4Q4Y1 1PMIA 2VH9A 3USUB 4UYBA 1NYWA 2BYVE 4RGGA 3MV01 2XLFA 3J7HA 3PUAA 1TMF2 3PHMA 4SLIA 4Y5Z0 1R1A1 5CBLA 1W9SA 2XXZA 2JG9B 1DIWA 1GP4A 3FBMA 4CCKA 1QXRA 5LBBA 5I91A 4GWIA 4LBMA 4Y1YA 2R073 2JWPA 4CCEA 5C8CA 4FXGB 5CZKA 2NN8A 1NLQA 2QKDA 1OKOA 1IZ3A 4LA2A 5FLHA 3HOBA 1REDA 1SBFA 3OPWA 1W6QB 4AI1A 3TEYA 3POIA 1AYM1 1GOHA 4FTSA 4Y20B 1KJRA 4Z92B 3RSJA 5F7UA 1G9BA 2BPA2 3NAPA 4OZXA 5LBEA 1DQ6A 1O4YA 4COYA 3WG4A 1MEC3 1TME1 4QX2A 4RD7A 5LB6A 2JDYA 1LGNA 2BERA 4BK5A 4ZONA 2HYXA 2VG9A 5FY0A 5F39A 2LRPA 2BTVC 4CP9A 5DABA 1WW4A 2YHJA 4AI0A 2W47A 4AWDA 5IFPA 1OOPC 1HV1A 5C5TA 3FUOA 1HXS2 4RFT0 4C90A 3RYPA 5FO9B 2Q1MA 5A33B 3BYWA 3IDBB 2P37A 3M70A 1ND2B 5FZFA 5JXJA 5FP4A 2EIDA 1PNGA 1JZ2A 5BY5A 1RUD1 4AFAA 1O59A 4G4FA 4XURA 4AI3A 1HLCA 3LSDA 2GSYA 2WZ8A 2ZX4A 3KB5A 1XPWA 1XB9A 4PIZA 2W9XA 2XR4A 4O9EA 4GD4A 1UN1A 3UT0A 1X9PA 3TN93 4MYEA 1O8SA 2V4AA 4YPJA 1J1LA 1SCRA 1GZ9A 2E6VA 2BV4A 4H7MA 4JQTA 1VBB3 2PHTA 2W52A 3GALA 4XUNA 3MIFA 1XOYA 1UPSA 3VD7A 5TSWA 2D40A 3RDIA 5C71A 4B7KA 5BUVA 4LNVA 2WWSA 1UOJA 3RMYA 3E6BA 2OPWA 4QXBA 4W6YA 4XF9A 5BNOB 3DEMA 1RVF2 2ADEA 4LE3A 3VBSA 4OLLA 2J1SA 4BCUA 2RS32 3DPRC 3NQHA 1WZXA 1C3HA 1DF0A 2A1XA 1S0BA 4AAXA 5FYHA 1RUF3 1O7FA 3OPZA 1L7QA 3E6DA 1LU2A 2CSGA 1UY2A 2HWC2 4XC9A 2XKPA 1VAVA 3T1MA 2WSUA 1P8JA 5C9AA 4RYDA 1O3TA 2ZGUA 1S0EA 5IW0A 3ZPOA 1XNAA 2QE3A 2JDUA 2PHDA 1G9DA 1MZ5A 4C1XA 1K5JA 1NCRB 4IE5A 4GZ9A 2A70A 2GP3A 3PIGA 1D0GA 3MUY1 5JR7B 2HWE2 5A3UA 3RGBA 1N3PA 1OHFA 1JOPA 3BU0A 2PQQA 3KV5A 2PHXA 2YYOA 1VB4A 2VM9A 3RJ2X 3FL7A 3TRSB 5ABJA 1A6CA 4Y24A 4AQ2A 4FBFA 4TZDA 1XE0A 5CFDC 3WQBA 2XUEA 3KVAA 2KM2A 3ACGA 5FPBA 4CXYA 2AREA 3OGRA 1ONAA 4JVAA 4RGAA 1MZFA 4I3GA 2Q30A 2IXHA 3IMNA 5F3CA 2DBNA 1DG6A 1QJZA 4Q4V1 5A80A 3ZPYA 3D82A 1DQ1A 1QH7A 4OI4A 1H0BA 1EUTA 1FOD2 4B8EA 4Y3OA 4IETA 2WT1A 2HBUA 1KS4A 1UCXA 4AVBA 4LJHA 4GALA 1R083 2EAAA 3PL0A 1QIQA 1ODMA 4RQPA 5GLZA 3AJYA 4AQSA 4UW4A 1UIJA 3WQ1A 4COUA 1NKGA 3CJIB 1UKRA 3ZFEC 3MIGA 4H3WA 4E8CA 4P08A 1V00A 1JN2P 3AB0A 1BMV2 1JU4A 3S30A 5FUNA 4NWVA 5SV8A 5GJ6A 3RMXA 2PHUA 5CFCC 2VZUA 4M3CF 5FPZA 1W8WA 4P9LA 4XFGA 3BIEA 3ACLA 1AXYA 1Y3TA 1OC1A 3DKWA 3J7MA 3EYPA 3ZSLA 4QKFA 1R093 5DAVA 3VBOC 5HCFA 3CJXA 2ZAAA 2MEV3 5C3PA 1IHMA 4OUMA 3ZN4A 4AVTA 2XVGA 3AL6A 3WF1A 1XSRA 2DU1A 3T2PA 1LNSA 1Q8PA 3NNGA 4UI9L 1UXXX 4XJAA 3I2DA 3NJVA 4HL0A 2L9LA 4KWKA 4V1PA 3ZSMA 2W95A 2WJSA 3C8XA 3Q8AA 4M00A 4CDXA 2UYAA 1YQ5A 2A6XA 2MNGA 2X10A 1S1AA 2GNBA 2YROA 4QDRA 4XILA 3ZXKA 3WHTA 1VRH2 2JE9A 4LTAA 4XZPA 5FZKA 4CRQA 2R1BA 3ACIA 3CF6E 2CV6A 4FOVA 4MXWA 4V2VA 2RJLA 1CVNA 1OKQA 5KXBA 4J1XA 3B69A 4M3CE 5FMOL 1PO22 1MEC1 1Q8VA 2DVDA 2NM1A 1NOVA 5FYIA 1ENSA 3MW2A 2WA4A 1IKQA 2GNDA 2WIIB 4FOYA 2FD8A 4CEWC 4QM9A 1RHI2 2DTWA 1VBE1 1V6IA 3WOGA 3O1MA 2ORXA 2XBO2 4RR3B 4OQ9A 4MGTA 2WL1A 3UKNA 1FATA 5F5QA 4YM1A 3BTYA 1FPN3 4L9BA 5H9SA 1WMFA 4JGZB 2HH9A 3AP9A 5JZGB 4ZY9A 4WZFA 2JDKA 4EN9B 1YJKA 1LOCA 4AI8A 2D6NA 4K9SA 4Q4X3 4R4ZA 1D4M1 1HRI3 3POBA 1B35A 1DYOA 1E5HA 4B4PA 5FJKA 4M3CA 2YC4A 5D21A 2V4VA 3BALA 2XB6C 4IV1A 3N9PA 3OBAA 4AEMA 2VQTA 4CCMA 1AR62 3DV8A 3RFRA 4IEUA 2JXAA 5DPNA 4YW3A 5A6YA 1VBD1 3GJBA 2VQ0A 2GALA 2VU9A 2WBKA 5A7WB 3VKOA 5FWEA 3AYDA 1Z7S2 2CU5A 4AQ6A 3MF9A 2PAEA 3KGLA 4AW7A 1XU1A 2G4IA 3Q8FA 4HK8A 4UW3A 3SQOA 2GDFA 4PLMA 1KEXA 1XBFA 1RUF1 3WF2A 2DVBA 3LE0A 1FV2A 1QJEA 3ALQA 2BW8A 2XQXA 3AP5A 1YI7A 3IIIA 4KI5M 5FZ3A 4E2QA 4ET7A 3HD8B 3N9LA 3WP4A 4LBKA 5JOYA 1UYXA 3WDVA 2XVLA 3WW4A 2VOKA 2O8QA 2FZ2A 3ZYHA 4Q2FA 1AR81 1QDOA 3O0XA 4BXSV 4XFBA 1GNZA 2E31A 2BGPA 4C91A 2WNUA 5DDJ1 2P6HA 5C3SA 2JKBA 3CBNA 5LBCA 4K40A 3ZMNA 1MS0A 5BNPB 5F9TA 1OOPB 4KGGA 1EP0A 1ZRRA 4XUPA 1OMIA 1YLLA 3I2HA 4HSJA 1JXNA 4OI0A 2GMMA 1DLLA 2WLPA 2QQOA 3OY8A 4IQPA 1OUSA 3RG0A 4GWMA 3I3DA 3TYJA 5EFUA 1GZTA 3AMPA 3K3OA 5FY7A 5L36A 5I0TA 3ZN5A 2W2IA 3I2OA 3IMMA 4L0PA 2JG8C 4GAZA 4META 4HN0A 4XE9A 3WDTA 5KR7A 1ZZ8A 5CKMA 5AFBA 1W2TA 2WS93 4MLOA 1PIV1 4AVCA 2YGMA 2DUPA 5JUVA 3EQEA 3WDXA 3SHRA 4BQ2A 3VHRA 5FUPA 2WO2A 1HIXA 1J83A 1R081 2J1VA 5GLUA 3UYJA 4P9IA 2GU9A 1WD4A 2YZ4A 3ZVXA 5F5CA 2HWF3 4ZKTB 4ASMB 4IEYA 3MHZA 5BPXA 2WWUA 1AXKA 4FI9A 1CPMA 1W6OB 3DPRB 1YC61 1XYOA 4DPNA 4JV4A 4O7XA 1W06A 5T5OA 1V6LA 2LM3A 1SLIA 5L7OC 1AJKA 1US3A 4NHLA 4QX1A 5FY5A 3HJRA 3OPTA 3WG3A 3IM0A 3H3ZA 1IKPA 3S0MA 1SBEA 3T0DA 4OI2A 3WXPA 2YU2A 1AR72 3IPVB 3PURA 1V6OA 4JHZA 2V73A 3ZFGA 3PU8A 3R6SA 2B7YA 3RZHA 4AAPA 4NUBA 4FT8A 5CG9A 4H7LA 1Q8QA 1H1AA 1DGRN 1G9FA 2MEV1 5FUIA 2Y6JA 4J6GA 1U5IA 1X82A 2VMIA 1OURA 1XNKA 1UIKA 3ZR5A 4XIOA 5DUWA 1JYWA 4GQ7A 1VAMA 2VZRA 3EO6A 2J1RA 1UZZA 2BWCA 1UXZA 3Q8CA 2WDBA 5JXHA 4IGPA 1W05A 5FKCA 1HXS1 1BBT2 5HPOA 5CFDB 1VALA 2JX9A 5A3MA 3KF5A 5FYBA 4Q26A 1POV0 4OMCA 3VKLA 4HT1T 1FNYA 4CUCA 5FZOB 4QB6A 5LASA 1CAWA 3WV6A 5E88A 1NCQC 1N1TA 1MS9A 2AENA 1YWKA 5A3NA 2C4XA 3GJAA 4YARA 1PGSA 1VAKA 2BZDA 3A22A 5FV3A 4EN8B 5KXDA 4HFSA 1LOGA 4QQOA 4C1WA 1FV3A 2JICA 3ZFEB 3ZYJB 4FPFA 5IK8A 1FPN1 3GM8A 4QPGC 2DCKA 3SH5A 3C2UA 1OI6A 4QWNA 1HRV3 2J1TA 2PLV3 1RVF1 2NLRA 1WW6A 4NIDA 3AMHA 1SQ4A 2RS31 3FHIB 3VV1A 1O4ZA 5FPXA 4Q4X1 4R9BA 2GMPA 4TTGA 2BVBA 3RS6A 1VR3A 3AKSA 1VLNA 4DIQA 2BGCA 1AYM2 1NQDA 5KHGA 3WF4A 2UY9A 5DAWA 3OJBA 5E16A 3VBOB 3J8F2 5BV6A 2F6BA 2DUQA 3E5QA 4XFIA 5FZIA 4LT5A 3PVOA 4M4RA 1SDDB 1CONA 4TWTA 3VDDC 4DUVA 1QWRA 2XHNA 3UJOA 5A7OA 3TEWA 4MZUA 4OHXA 4BDVB 2R0HA 4M01A 3KHCA 2P3KA 3BKZA 3WQ0A 2HWE1 3ZIXA 5EP9A 3FHQA 3WP3A 4UF0A 2DWRA 1REFA 2ZX2A 4D0QA 3I8TA 4RA0A 3O1PA 5K0UC 3MIEA 4DRVA 4XMIA 1NLRA 3N7JA 1OD3A 2J1AA 4PJYA 1F35A 5FZGA 1XE8A 1RUD2 3LCPA 1UY0A 3S6PA 5CIRA 3U37A 2CNAA 1F4AA 1I6XA 1EUUA 1W6MB 1ZRFA 3DF0A 3GZEA 2DURA 1FOD1 2DVAA 2K9ZA 4AVVA 3URFA 4YVWA 5FMOS 3GYDA 1VBA3 2F4LA 3I2IA 4FFFA 1NQJA 1X36A 3U14A 3KT1A 2VR4A 4HANA 3ZKYA 2WZR3 4AFCA 4QPIB 2Q8CA 5L73A 5JWPA 2E26A 4UWDA 4AXOA 1F5JA 2JG9C 4EN7B 2XKOA 4Y1UA 4D94A 1YFXA 1JMUB 1W9TA 2J1UA 4IE0A 4UFHA 4Q27A 4Y1ZA 1ZM1A 5FFOC 3JD73 4PBPA 2I07B 5FZ1A 1ASJ3 2PAKA 5F5AA 3I2FA 4AZZA 1W8UA 3A7QA 3AM2A 5KC5A 1N47A 3B00A 4H14A 5FO8B 3O5SA 2ORZA 3MZHA 1PM7A 2E9QA 1WCSA 2VMHA 1G6NA 3B3QE 3FLTA 3PDQA 2MPFA 1J84A 5FZ7A 3WW2A 5IK4A 3N7MA 1SLBA 2Q4SA 2VOWA 3U07A 1LGCA 1ZNPA 4FTEA 1MQTB 3TEXA 2EXJA 3DECA 2KA3A 1LB2A 3NJZA 1J3QA 4A3ZA 3JB4C 3RVHA 2OPKA 4MGYE 3UGGA 4FXKB 1G9AA 3BUCA 3WDUA 3RWKX 2OA2A 4B7EA 2GZWA 2DVFA 1XNCA 1DBNA 1ND2C 1UW8A 4LBNA 2HBTA 1JUHA 3SXWA 1FMD2 3VBSC 1OPMA 1VRH1 4GXLA 3VN4A 4IV3B 4FPOB 5JSRA 5FCCA 4FVVA 3T0AA 2EVXA 4A2UA 5EV7A 4BMBA 5APAA 1PO21 2VMFA 2JB4A 2WRAA 4P9YA 4PLOA 5K7PA 4CVUA 4QDSA 1LGBA 1W9YA 2VXRA 3ON7A 5FPAA 2YB7A 4NPLA 3POGA 3MPBA 3QACA 5C9AC 4AEJA 3AL5A 4XAAA 3VLBB 5C3RA 4JZRA 2XBO1 3OB8A 5B2GB 3LEGA 5JPNB 1PM4A 3N9QA 3ORJA 4N9IA 1OA4A 4IERA 4L8QA 5F8PA 5LATA 1GWKA 2OZ6A 2P2KA 5IVBA 3CIHA 3ZM8A 3WD5A 4CEYA 2Z42A 1E5IA 2AEZA 5A3OA 3VDBA 4W6XA 3WW1A 1ZZBA 2WABA 3OBTA 2OIIA 1I1EA 4YVSB 1ULFA 4PDWC 2X8KA 3VKFC 1IQDC 2ZKNA 2LUWA 3MI8A 4DEQA 1J59A 1WUVA 4XZUG 4FCAA 2VC9A 3OD4A 4ZPIA 1NZCA 1HQLA 5FY4A 1YIFA 1N3QA 3T1LA 2PLV1 3PVNA 1ZZ7A 3ACFA 5A6ZA 2BU9A 2R072 3M2MA 5L7OB 4XPVA 1AX1A 1QY4A 2B9UA 3GCXA 3I2JA 3KZ4C 4RQPC 3SMHA 2ZHMA 3AKTA 5T5PA 3THPA 3THDA 3WHUA 3VD5A 4IE6A 3SC7X 1AL23 2AACA 2E53A 3ECQA 3LEKA 5FBZA 1WD3A 4I02A 5CISA 1W8OA 3VBUA 4Y4RA 4QT6A 4C0HA 1D0HA 4IW3A 5D1IA 1PHMA 4N9HA 2WAOA 4KG0A 5T5LA 2ZZQA 4PIXA 4QX5A 3T2TA 1MEC2 1WWYA 4E2SA 3KCYA 2QQPA 3M4FA 3MFCA 5FK8A 3K4ZA 4S2GA 1QNYA 3O0WA 4ATFA 1UY3A 4BB3A 2DCJA 4CPBD 3WG1A 4QX3A 1US2A 4CUBA 4MGSA 4YM3A 1ULGA 3BODA 2VVDA 4EZ4A 4MX3A 4XFFA 2VZTA 2K2SA 5FZAA 3CJIC 3GBGA 1OH4A 3N7LA 3T30A 5ACA3 5FR3A 4L11A 4JKKA 4ZS3A 3LSEA 2Y6HA 3QOPA 5CB7A 1W39A 3WNMA 1NCQB 3OG2A 5FJHA 4E4ZA 2VECA 1M06G 1Y4WA 1H9WA 3TN92 4CDXC 1CAXB 1RIRA 1VBB2 2RHPA 4ES9A 3T08A 5JIUA 5C7GA 3SKVA 2GNMA 1VBA1 3MIDA 4LBOA 2KR2A 3I3EA 4DRRA 5C3QA 2WQ8A 1Q56A 4ZHNA 3RZMA 3MUZ1 1YQ2A 1W0OA 2XJVA 4URAA 1JYIA 1Y9QA 1MZEA 3LIHA 1AJOA 3UGFA 3VDCA 4JGYA 2VZPA 3LDRA 2ZCWA 2Y34A 4NRPA 1JW6A 3HQXA 3NV4A 3U4SA 2NMNA 4XHXA 2DBIA 5DUVA 1RUF2 3KD4A 1CIYA 3JD71 5HXMA 4BLJA 5KC6A 3WLUA 1ASJ1 3K4DA 2LS6A 3WINE 3PUSA 2JEMA 3LFIA 2WLQA 1SHWB 2VW0A 3K2OA 1TQ5A 3IB3A 4BJ0A 4GKXA 2ZAHA 3VDDB 4XUOA 4LBJA 2LW8A 1LJ7A 3NSTA 5LRRA 1RUH3 2I45A 3JUUA 4MADA 1B35C 1U5XA 4NRMA 5L9RA 2RDRA 4TLGA 1JU3A 1RUJ3 3O14A 3MW4A 4QD2A 1LU1A 5FLIA 5CU1A 3ROUA 5K0UB 2VW2A 3WEZA 1H2LA 2Y38A 1QJFA 2A75A 3SH3A 2HKXA 1YJLA 4N53A 1HN1A 1CN1A 1XYNA 4RR3C 3TWIA 4Y1VA 2WR9A 2ZGTA 1V6NA 1S0IA 3I4IA 1QGLA 2XMLA 2C9KA 5C8CB 3ILNA 4K6BA 4D3WA 2ADDA 1SPPA 4EWEA 4JGZC 2D3RA 4LUKA 2O0OA 3UKVA 2AUYA 2MHFA 4OHWA 3JQXA 4IEWA 2B8MA 1AYN3 1RYYA 3AZZA 4MVTA 2OYZA 3I59A 4MGKE 3UV9A 1R082 1SFNA 1ZA7A 4NPRA 4QGNA 5FYSA 1X8MA 1MS5A 1Q8SA 3NAPB 1TEIA 1YFYA 3M3OA 4XIKA 2ZGPA 4I0WB 2NMOA 1C1LA 3R4DB 2D6MA 4UFJA 2VD7A 2WNUC 1IPJA 3VBRA 4CP9B 1WLTA 4MGZE 2VMCA 1E57A 1UYYA 2Y6GA
chains in the Genus database with same CATH topology
1FXZA 2WFPA 4YM0A 4YZ2A 1QJX3 3NVCA 3NV1A 3KT7A 2WNVA 4AEDA 3A0KA 4DFSA 3HIFA 4XMAA 1LHVA 3U0ZA 1GICA 2QZ3A 2ATFA 4L97A 2WFF3 3MDPA 1R092 3AXEA 4CDQA 3ZXDA 3J8F1 1OA3A 5KHHA 4Q1RA 4YW5A 2MEV2 1J58A 1LCLA 3KS7A 4Q0UA 4AGGA 3N3HA 4UBHA 3AX4A 1H8TA 2BNNA 2R0FA 5CA6A 3VGIA 3ZFFA 1IS6A 5BNPC 2HWB3 1WW7A 2P3JA 1OLRA 4GH4A 1GZWA 2R043 2V09A 1AL21 1RL3A 1CPNA 3VBSB 4WM8A 4MUVA 3N7KA 2PFWA 1SMVA 1WMDA 3FWEA 2B39A 5LK5A 4GA9A 2CWMA 4N90A 4HSLA 4LEJA 4XOGA 2PHWA 5C9AB 3VHNA 2BEOA 1LHUA 1SLAA 3AFGA 4P9JA 1RUI3 3ZXGA 4B3NA 1X33A 2PHRA 1FPN2 1NE6A 2RS13 1QF3A 4JTOA 1YCIA 2IXKA 2GN3A 4R9DA 4FPEA 1UPIA 2QUOA 5DZEA 1S2BA 4Q4X2 3W9AA 5ABJB 1A8DA 1HRI2 3CLPA 3PTYA 2VNOA 2PN5A 4I0BA 3ZYGA 3ZXAC 1FYUA 2C9AA 4PDWB 4Q0VA 2ZMLA 3KQRA 1LENA 3FLPA 4TSVA 4E27A 3ZXFA 1F5FA 2E7AA 2RE9A 1BEV3 1QKQA 2A6WA 4KWJA 1R1ZA 5HCAA 4RQPB 1IGOA 5FREA 1K5MA 1NXMA 1ULDA 3LA3A 1RUC3 2DVGA 4HMZA 3KCCA 1ZYBA 2G9GA 4ES8A 1WGPA 1JTZX 4A3XA 2A7AA 5EXOA 1FMD1 4DXZA 1AHSA 1WA4A 1RUH1 5JPMB 2UYBA 1ZBE3 3LZZA 3J4UH 4QQPA 4F83A 1MVQA 3NWKA 2DTYA 4ATEA 4AFBA 5E8AA 1YFWA 5JCTA 4GMP0 1S0DA 2ET1A 1NLSA 1ZX5A 3HBZA 4P14A 4G9SB 3MEPA 3OCPA 4FP2A 2HWD3 2RM23 2WS92 3VL8A 4YLZA 1CAUA 4CDXB 2DFCA 4K8FA 4YGCA 1AYN1 3QBQA 1EAH3 4XF1A 1NE4A 2D6LX 1PK6A 4MXWB 2HWF2 1OA2A 4DB5A 1IS5A 3GHNA 1Q3EA 4FSJA 4FAHA 2R071 3NL1A 4JC1A 1QJX1 2QDRA 1C8M3 1QXPA 4BLIA 1T6GC 3AZXA 3N36A 1QMJA 3U4XA 1DGLA 4NOTA 2D93A 2R16A 4QXKA 4D7TA 1B35B 3UK9A 2ZHNA 4M3CB 5I0SA 2WA3A 2WSVA 4IV1B 2AR6A 2H0BA 4H55A 2HWB1 2WNEA 1SLLA 4JDOA 4R52A 2R041 1LOAA 1XQNA 2SLIA 2XL9A 1RMU3 5DZFA 4DS0A 3ZDSA 1SLCA 4AGRA 3AJZA 3ZXJA 2A3YA 4QPIC 1RUG3 2EAKA 3IDCB 5FLJA 1C1FA 2R49A 4XJWA 3O12A 1UX6A 2FHRA 1YIPA 3UV9A 2XJSA 3SNMA 3TN91 1LRHA 3K51A 1S0CA 3WZ1A 1VBB1 2ZPXA 2D43A 2H6BA 4COZA 3ST7A 1WMEA 4YNIA 1QJY3 3DL3A 1BYHA 2WNUB 2OVUA 2V5YA 3PNAA 2E51A 1HRV2 2PLV2 2RS11 3RYKA 1ZREA 2Z69A 1MQTC 3VBHA 2LALA 3RRDA 4ASLA 4I3PA 4HKWA 4DOUA 3OY8B 4XBQA 1XRUA 2AZ5A 4K7JA 1ENXA 1QJU3 2XLAA 3FZ3A 3HT2A 5GKAC 1X50A 3J26N 4GIQA 4OUSA 3WDYA 2QDNA 4CYDA 4RS5C 1MS1A 3QD6A 4XJZA 5KXCA 4IV3C 4MH0E 4IEQA 3DGTA 3PMEA 2QJVA 2FZ1A 4LBQD 3D4KA 4AG4A 5T54A 2GNTA 3IKWA 1AL0G 5SV5A 2NQYA 2XVKA 3JBG3 3WT3A 5KWRA 3RJRA 2ZGLA 4KG8A 1V6KA 5IK7A 1BJQA 1QOOA 4YFZA 1LOEA 2EA7A 5H9RA 3S7IA 1PO13 4B4RA 1O3QA 1C28A 3AYEA 2FQPA 1BQPA 1POV3 4F7ZA 1VBA2 4DNYA 4YVSC 4XJ8A 4YZ3A 4A7KA 1S0FA 2OUHA 2WZR2 1MS4A 1S55A 3DN7A 4UBGA 5FAXA 4HVQA 1RB8G 1QQP3 3LKJA 1KDKA 3H7YA 1DHKB 1OQEA 2PHLA 3R0RA 2RM21 4OHZA 3JD72 4J1WA 2B42B 4DINB 1ASJ2 2GMEA 5BXXA 4ORFA 4Z07A 5J96B 3U11A 5LK7B 2ZABA 4BA6A 2A3WA 1W6NB 1W0PA 1CAWB 1R091 1XE7A 3B7MA 2BUKA 4DY5A 5FDBA 5JI9A 3RQ0A 3MIHA 1NXD1 4FP3A 3V0BA 1LEMA 4LE4A 1GNHA 2GC1A 2A71A 3SITA 4M0NA 1C8M1 4XYXA 2BNMA 1I9RA 4PLNA 1N1YA 5AFEA 4BH9A 4IEPA 3EJKA 3AK0A 2ZX1A 2PA7A 3APBA 2CL2A 1Q43A 1WLCA 4EN6B 1IPKA 3VUOA 5J48A 3JU9A 4Y22A 1OD5A 2P34A 1LESA 4E4DX 3WX5A 3EXUA 3AP4A 1PVC3 1RMU1 5CNAA 4Y4YA 1DQ0A 2XG3A 2AGSA 1KD7A 5D8AA 4I0AA 2AH2A 3W59A 1G86A 1RUG1 4LO5B 5I8SA 2C5DA 5T52A 4EV0A 3TBDA 3MF6A 4S2HA 2PYTA 1HRI1 4N53C 2DYCA 1W2UA 3AYCA 1EV13 4YG0A 2CAVA 1KJLA 3VHPA 3INAA 4A7YA 4TLFA 1GLHA 4KU8A 1QJY1 1DGWA 3O0VA 1IS4A 2O1QA 4XF4A 3VBFA 1YNAA 2FMYA 1MACA 4HK9A 4AYUA 3ZYRA 4E4SA 3J9SA 4IL7A 4MGIE 4XJUA 4KL1A 5CG8A 3WNXA 4ISRA 3MLLA 1AL22 2WT2A 2ZTNA 1AUYA 4Q0SA 4S2DA 4QPYA 4Q29A 4Z82A 3MLKA 1GFF2 3NKTA 4BIOA 1NA1A 3D5OA 4FPKA 3GNEA 5C8CC 3M3IA 2VUAA 4NHKA 4XXPA 2WNVC 4NVPA 4PCRA 4AEDC 2ES3A 2VOVA 5EZWA 3IIAA 5GZEA 1PNFA 4YG3A 5FTTC 3B94A 4ZU5A 4QGLA 2ZGQA 5CFCA 3LWCA 3NAPC 1LTEA 5H9QA 2YDEA 1RUE3 4DMIA 1H8TC 1DZRA 5ACA2 2GH8A 4HVRA 1D4VB 2A3XA 2WS91 3GBFA 1DFQA 1WCKA 2QFEA 3H50A 4DY3A 3E97A 1POV1 1LEDA 4LUMA 5IUQA 3ZN6B 1WLDA 4FAGA 5AC93 4WM8C 4EWAA 2ZJCA 4NWWA 1EYBA 3HMYA 4YYOA 2HWF1 3M8LA 3ME2A 4P9GA 2R1DA 1ZBA3 3I54A 3MPPG 1QQP1 3ILRA 2ERFA 2ZZJA 1GANA 2BWAA 4CDWA 1YHFA 5HXVA 2VNGA 2DCZA 2DCYA 1FI2A 2FMDA 2HEWF 5AVAA 3EBRA 1VB2A 2WQZC 1NG0A 3SCGA 4RS5B 4CEWA 2ET7A 3ZO0B 2LTNA 1PZ7A 4BWOA 2D44A 4LLOA 2PAMA 2VVFA 4CEYB 4YG6A 1GBGA 3WG2A 1RUH2 3NKGA 2DU0A 3KCXA 2IXLA 1RUJ2 2EXKA 3OBRA 3L2HA 2A6YA 1LHNA 4WM7A 2GC0A 1BK1A 3V0AA 2RMU3 2W08A 1DQ4A 2IZWA 5FQ0A 1J3RA 4IEXA 2ZACA 3AMMA 2XL7A 4JCKA 5KBFA 1DQ5A 2R063 1J3PA 1LHOA 3B93A 4LHKA 3LOBA 1CGPA 2ETEA 3LGRA 5J3UA 3BU7A 3K48A 1AYN2 5ABJC 2GC2A 4BHPA 1A8MA 4Q4Y3 5HCBA 3TAYA 3OGJA 3POSA 3VBUB 2WINB 2PHFA 5I8TA 1R1A3 1V9U3 3GBWA 4AFMA 4R8HA 1HRV1 3B01A 2DCTA 1LULA 1PGL1 1AX2A 2I2SA 1KXGA 1QJX2 1J1TA 3TNQA 4COWA 2D6PA 3POWA 1O3RA 4AQTA 1GKBA 3WVJA 2E7QA 2YY1A 4K20A 1Q8OA 5IT6A 2WFF2 2RR13 4LBLA 3BTAA 5A32A 4E9KA 1GR3A 3CU7A 4Q1PA 1G9CA 4R9AA 4LO8A 1O5UA 3H9AA 2EALA 1TME3 3LOIA 2VQAA 1M4WA 2HWB2 1ENQA 1CIWA 1YYNA 2JG8A 3HAGA 1PK6C 5F6LB 2QVSB 2GC3A 2R042 5JAXA 3L9JT 1U5ZA 4EN0A 3FBYA 1UZYA 1AX0A 4JGYB 1X8EA 4AE2A 4KNCA 3RI9A 5CAZA 1GV9A 1KITA 2ARXA 2ZMKA 1REEA 3PLQA 4EJRA 2JENA 4X6QB 2CY6A 3E5XA 3WP5A 2Q0AA 3MW3A 5I8YA 4P5HA 3THTA 5E89A 1OFSA 2UWCA 1RUI2 4CDUA 1N1VA 1O91A 2WZR1 1YO8A 2XJUA 2ILMA 3JCIA 1SEFA 4XQ4A 2RS12 3AP7A 4O9GA 5C4WA 4YSFA 5J09A 1PZ8A 4WVMA 3H1YA 3M3EA 4TYSA 4YZ4A 4N53B 4ZU4A 1AVBA 3FLRA 1C5IA 4I2OA 4W65A 5KXEA 3ZYIB 2CGPA 4XFHA 3HN1A 2Q1ZB 5AC91 3OYWA 4YM2A 4L92A 4GB33 1JOJA 3IDEA 2R30A 1GYKA 4YGDA 3ZX7A 1DQ2A 4XQWA 3QCWA 3TB0A 1BEV2 4KQ7A 3I59B 1O3SA 4HPKA 1ND3A 1XU2A 1W6PA 5C8WA 1RUC2 4IV1C 4N43A 1PGW1 4FTBA 1OLQA 3FE5A 4BM8A 1VBC3 2IXJA 1AR93 2SBAA 2WNVB 4HBNA 4AEDB 1RTVA 1ZBE2 2YUEA 4Q4V3 3AKQA 4QPGA 2ZGSA 1VP6A 1QH6A 2R6QA 4IEVA 4UW5A 2XUMA 3ZXEA 4CDQB 4EROA 4KGQA 5I0UA 2HYKA 3KT4A 3JQWA 1SDWA 1AZDA 2ZMNA 1YFUA 3VZKA 2HEYF 2BFUL 5L19A 4IEZA 1H8TB 1H30A 5F6KA 3ZFFB 3OTFA 2R061 2IXCA 2NZ9A 4FPYA 1QDCA 2NYYA 4Z1VA 2YPJA 2HWD2 5I93A 2RM22 2EIGA 4GH4B 3RZZA 4C0BA 1GZWB 4DQAA 3PJQA 5CADA 1DDLA 1D2SA 1CAVA 1EAH2 5JMCA 4LBQA 2X5IA 2JE7A 3AZVA 4WM8B 5KHIA 4HKOA 2WKKA 4Q4W3 1CESA 2ARBA 2H6CA 3E5UA 4X6RB 1X7NA 1LR5A 1LOFA 5K0UA 1V9U1 2EXHA 3WUCA 2TNFA 3AXDA 2IWGB 2NP0A 3LA7A 3RPQA 2DF7A 2E7TA 4P9WA 1C8M2 5EYYA 2YC0A 3V65A 4AHXA 5BNNA 4CP0A 3PVEA 1KFXL 2XWBB 2VNRA 4FOWA 4PBOA 4AEKA 3BCWA 3USUA 2RR11 3QH7A 1EPZA 1RUNA 1N3OA 1VIWB 3H1MA 3IBMA 5T3NA 3ATGA 2JG9A 4LO7A 1N1SA 1MZ6A 2X53S 2IFRA 3SH4A 4AI2A 2VW1A 4AHYA 3ZFGC 4YW4A 1VBE3 1ZA4A 1RMU2 1ZRDA 2FBEA 1H1MA 1UF2C 4JRAA 4YGBA 1RUG2 2RS53 3NV2A 1BXHA 4XF3A 4FPLA 1K5MB 5ACA1 1COV3 1UU4A 1W6QA 5BYNA 4FPGA 1F2NA 3G6JB 3ILFA 3N35A 4Y20A 4GMP3 4BZ4A 2VY0A 5J36A 1DU3D 1D4M3 4AVAA 4CTEA 1U5YA 4I09A 1BVP1 2GAUA 3VL9A 1KDMA 4XFAA 1QJY2 2F4PA 3CEWA 3H8UA 3E6CC 3SCHA 1YUDA 2XGXA 3FUQA 2Z5WA 4FOQA 4NO4A 1VBD3 5A33A 1ND2A 3ETQA 1C8NA 3ZSKA 4RSUA 1FX5A 4U36A 3M3CA 1QJU2 2ZHKA 3RYRA 1LODA 2ZGOA 4AHWA 5D8AC 4CP2A 5J7MA 5GALA 2KXLA 3TNPB 4QQHA 4GB31 3WY6A 1DGRA 1CAUB 2GH2A 5FOBB 2VVEA 2YMZA 4N7IA 4F3JA 1AR83 4XTMA 3TOJA 5DDJ3 3RI8A 1PK6B 4XQDA 1RUJ1 2CYFA 1MVEA 5BNOA 4XFCA 4ZU7A 1L3JA 2NPIA 1I3HA 2ZS6B 3NW4A 4AHZA 4LO6B 3JBG2 4LHNA 1MS3A 1MR5A 1NY71 1EY2A 1VBC1 1JYCA 1XXNA 3VBFC 3N4MA 1DGWX 3B5LB 4PDWA 1BZWA 1AR91 1ZZCA 3GZUC 4RHV3 4XHBA 5JSPA 5J98B 2XJPA 1RC6A 1WBLA 1PO12 4OULA 5KHJA 1F8VA 4AF9A 1PIV3 3LA2A 1V70A 4Q0PA 1NCRA 4NHMA 3D0JA 4HZFA 1JBCA 1NA1C 3JB8A 1LKNA 4KU7A 1TMF3 3MYXA 2W68A 2QNKA 2DUOA 5JIAA 4YW1A 1QQP2 2E63A 1HQWA 3Q9OA 3W58A 3VZNA 3WP6A 5JOXA 3LAGA 1YXWA 5LEKA 4YVWC 1DYPA 1SLTA 3VZJA 2D6OX 1FNZA 3AP6A 4Q8KA 2Y0IA 5JLVA 3KLSA 2Z2SB 4Q4W1 4K3UA 1SCSA 2WFF1 1IS3A 3ELNA 3O7OA 1C5HA 2JJ6A 5C33A 3QLQA 4OFGA 1CJDA 1D2QA 4MXVA 1Z0HA 3FFQA 2A6VA 3WW3A 3CJIA 4K21A 2D3SA 1GQHA 4BE3A 2OZJA 3FC0A 3ENRA 2PTMA 1C4RA 4HETA 4M0HA 2B45X 4X8NA 1UMZA 4HN1A 3VKMA 5JVVA 3KMHA 4LO4B 3QH6A 1HXS3