4CE8A

Perdeuterated pseudomonas aeruginosa lectin ii complex with hydrogenated l-fucose and calcium
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Perdeuterated Pseudomonas Aeruginosa Lectin II Complex with Hydrogenated L Fucose and Calcium
rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 4ce8A00
1OUXA 2JDYA 2BP6A 2CHHA 1GZTA 5A6ZA 1UQXA 2WR9A 2VNVA 4AOCA 5A6XA 5A6YA 5A6QA 3ZDVA 2JDKA 5A3OA 5A70A 1W8FA 2JDMA 1OVPA 1OUSA 2JDPA 2XR4A 2WRAA 4UT5A 2JDNA 2VUCA 2JDUA 1OURA 2BOJA 2JDHA 1OXCA 2VUDA 5HCHA 1W8HA 1UZVA 4CE8A 2BOIA 2BV4A 5D2AA 1OVSA 3DCQA
chains in the Genus database with same CATH superfamily
4BB3A 4JKLA 1MS8A 4AQSA 1AR71 4NR1A 1D4M1 4OMDA 1GNHA 1JYTA 4P9LA 1WD4A 1IHMA 1ENXA 3OUHA 1PM4A 1SPPB 1Q8OA 3Q8AA 2R16A 5EWSA 3HD8B 3RYRA 1OKQA 2QE3A 2WO2A 1JOJA 1ZZCA 4M3CB 2RS51 1XU2A 5FK8A 3S5QA 5HV4A 1HV1A 3EHKA 4BJ0A 2YGMA 4FPCA 4CUCA 3I59B 3S30A 2DTWA 1F8VA 1Y4WA 1JZ7A 2DU1A 3MIEA 4IXLA 3CLPA 1S2KA 3PDQA 3LSEA 2SBAA 5L36A 1G86A 4Z2WA 3ENRA 5HPOA 3MW4A 1W03A 4AW7A 2Z42A 4MH0E 2VZTA 2FCVA 3UJOA 4CA9A 2RS31 1ZA7A 2ZMKA 4XUOA 2Y6GA 2WJSA 3POGA 1F4AA 4YVSC 2YGLA 1YQ8A 4GULA 5IK7A 3ECQA 4RL7A 1HB2A 3ELNA 4GD4A 1EPZA 4DZGA 2VC9A 5APAA 4NRMA 5DAQA 2DDUA 1TME2 5GZCA 4I09A 5B4NA 4QPIB 2ILMA 3B9IA 5E6HA 3VDAA 3O1TA 4M3CF 1PNGA 3ES1A 2YU2A 3NQHA 3VBHB 1QGLA 1MVEA 1ZZ9A 2WA3A 2D40A 5F6KA 5I8TA 1ULPA 4H3WA 1X36A 1J1LA 2BYVE 2Y60A 4KWKA 5FBJA 4AI0A 3WY6A 4Y1YA 4QQPA 2XL9A 2WWUA 5LB6A 3T30A 4FPHA 2HWC3 3H1MA 4AGRA 2RS11 3BYWA 2WSVA 1VBD1 3RSJA 4GQ7A 5FP7A 2QQNA 5J37A 2DVBA 4XACA 4LA2A 3WF2A 1Q8VA 2B42B 2VZUA 4IE5A 4IEQA 5FZIA 3ZN6B 3NW4A 4LLOA 1UF2C 4XJUA 2XKOA 5FYTA 3UETA 1MZFA 1NKGA 2UYAA 4COVA 3T1LA 3OEAA 2WNUA 3WUDA 3RJ2X 1F9KA 3KQRA 2ZZQA 3TB0A 3VBFC 1QH7A 3ZFGA 2EIBA 4IV1A 4DEQA 1KRIA 1DIWA 4WM8C 2E7QA 4KGGA 2YZ4A 1O4ZA 2R041 3LPGA 5KHKA 2Y34A 4Z82A 2C1FA 2HWE2 5FYIA 4CP2A 5A1AA 1HDKA 5KHJA 1RHI3 4AHYA 1R093 1UY3A 3KGLA 4MXWB 4ZU7A 4S2GA 1HRI3 5TSWA 3BOWA 3VKFC 4ET7A 4CEYC 3OJBA 5A6ZA 2RR11 1JI6A 1OOPA 2ZHLA 2N7GA 1BBT1 2EAKA 1N3PA 4Q4V1 4WVZA 4CUGA 2HWD1 2F6BA 3JD71 1D0HA 5FMBA 5FYZA 4E27A 1PMIA 3TEYA 4HPKB 3E5XA 4J1XA 1IS6A 4CDQC 4DY5A 4BDVB 5FZAA 3AM2A 3SQOA 3HPNA 1O8SA 1H1AA 1QIQA 1OXCA 3AZZA 1MR5A 3KGZA 5FY9A 2O8OA 3K4AA 3MYXA 4F8AA 2G1MA 1SPPA 4J25A 5FMCA 1UZYA 4B8EA 5L7OA 2EXKA 1YQ2A 4YW6A 3LIGA 1D0GA 1FMD1 5FYSA 2WYFA 5FXZA 3ZPOA 3WCRA 2MEV3 1OI6A 3KHBA 4LUKA 2RDRA 1VBE1 2VBPA 3I59A 2QDRA 3TRSB 1HRV1 2PHWA 2VOWA 2B7YA 1ST8A 1D2SA 1WW4A 4INDA 4XPVA 3THDA 1E5RA 2W08A 2VUJA 3LE0A 3POFA 4NWVA 1XE7A 4PBOA 5AVAA 3TYJA 2V5YA 4D8MA 5K8SA 1HQLA 1C8NA 1LGCA 1C28A 2Y0OA 4IL7A 4RS5B 1DYKA 1TVGA 3POBA 3JB4C 3DPRC 2DVFA 3PL0A 5HCBA 2NYYA 4Z8BA 5AC93 5C8CB 1R082 3I97A 4P9YA 4XUNA 1V6MA 1S1AA 1MS9A 2ZEWA 4V2VA 4QXCA 4GH4B 4IV3B 2WQZC 1NA1C 4IEPA 2IFWA 3GBWA 1MEC2 4PIXA 3WX5A 4QPIA 1UYZA 4DY3A 1PGW2 3KCCA 4IEXA 1Z7S3 1OLQA 4LO6B 3U75A 2V09A 3AL5A 5J96B 3VBHA 2WAAA 1LODA 2ZAAA 1RINA 1ULOA 3H3LA 3SC7X 3G6JB 3WINE 5SV8A 3LZZA 1VBC3 4XZPA 4FPOB 1ZBA2 1YFXA 3ZYJB 2Y64A 5IATA 2D5HA 1WLCA 1NUKA 3WUCA 3C3VA 2P37A 3HNBM 2GALA 4ZONA 3T2QA 1LOAA 4CEWC 3IIAA 1POV0 1DG6A 1RUG2 2JE8A 2R072 4BQ4A 4IQPA 5H9QA 1S0BA 1H6YA 2QTWB 4IUGA 4MHUA 3AP4A 5EQUA 5K0UB 4HFSA 2PAKA 3ZN6A 3O12A 2B46X 2K46A 5KR7A 2DFBA 1YJKA 1GZTA 1QU0A 1J3QA 3GCWA 1IOAA 3FZ3A 4RGGA 5GZDA 4OLLA 3SCHA 5J48A 4MGTA 5FZLA 2ERFA 5C33A 1DZQA 2GDFA 2VY0A 3POJA 1A8MA 3HN1A 1LEMA 3FBMA 1GZ9A 5FKBA 4MXWA 1K5MB 3TAYA 1CPMA 2Z5WA 4YM2A 4XIOA 5J98B 1GYKA 2W87A 5FP9A 1K45A 4OI4A 2W1SA 4QX7A 2A6WA 4QX1A 1C1LA 1ZBE1 4MGSA 1UOBA 1PO13 4MOAA 2NZ9A 1FI2A 1HXS3 2EALA 1IG3A 3DL3A 4BXFA 1AYN2 4O9GA 4NHLA 3VZNA 1AJOA 2B4KA 3D82A 4HPKA 4JTOA 3PMEA 3U4SA 2W3JA 1PZ9A 3VKLA 2WN3A 3T0DA 4L92A 4CYDA 5JUVA 1US2A 4PIZA 1VPHA 1APNA 2OUJA 3APBA 3HT1A 4A6OA 2RVAA 1GOGA 4FPKA 4QPWA 1FPN2 2YROA 3NJZA 1SLIA 1U5YA 5DN2A 3I3EA 4CDUC 4K9SA 1FNYA 3QD6A 4FAGA 5DAWA 3S57A 1JUHA 1A34A 1DLLA 1EV13 5EIYB 1Q8SA 4QB1A 3IZOA 2EVXA 5HCHA 4OUMA 3AB0A 4RQPC 4E8DA 3SNMA 2EIGA 1V00A 2YXSA 1OVSA 3ZYRA 2C4XA 1CGPA 1UYPA 4AI3A 5BNQA 5JOWA 2DFCA 2IXJA 4IERA 3H8XA 1WCSA 4KG8A 1PVC3 2J1SA 2VMCA 4AGGA 4XQWA 5D8AC 4EWDA 4R9DA 1RJ7A 3WQ7A 1TE1B 2J7MA 3PMSA 4CCJA 4XZUG 4XJZA 1HQNA 1HN1A 5IVYA 5FYCA 3UGGA 3AC0A 1LOFA 4QDQA 5C8CA 3O1RA 2ZMLA 3TNQA 1VJ2A 4AEDB 3IWZA 4XQDA 4GH4A 1BXHA 4IV3A 2BFUS 1YXWA 3VDCA 3C2UA 5L73A 1CAUB 4LQRA 1J1TA 4I0BA 1Y9GA 3KLSA 5FY1A 4ZY9A 4GALA 4PHZA 4AI9A 4TLGA 3LAGA 2QKDA 1MEC1 4PQQA 1Q43A 4TSVA 2VGDA 4L2NA 2DBIA 3MZHA 2J1RA 2XDVA 4EWAA 4DB5A 1V9U1 2JDAA 3VBSC 3W21A 4M0NA 4IESA 4GMP3 4D7YA 1YFUA 1SACA 3ZN5A 2FCTA 4C1WA 1OFNA 2VCBA 2BVVA 2W47A 3BALA 2EXIA 4R4XA 1ZBA1 1QH6A 4Q0VA 2CGNA 4TLFA 5C5UA 3WT3A 2TEPA 2FDIA 1YFWA 3I7DA 4JAAA 4NRQA 2VZRA 4F3JA 1COV2 4E4ZA 2B45X 1RUG1 1AR92 3RGBA 3WQ1A 3WF0A 3VUOA 1EP0A 1NLSA 2I2SA 3T1MA 3CNAA 1C57A 3NVCA 5T5PA 2VMHA 4OHVA 3AFGA 4CCEA 1ZVFA 3GM8A 2XBO3 5EHDA 3WG1A 4IETA 1O7FA 4WV8A 5A32B 2BU9A 3NV1A 2ZACA 4XEZA 5FPVA 2OQ7A 1K5MA 1RMU2 1RVF1 4QQHA 3SCFA 1U0AA 5L19A 1L7LA 1RUI2 2F4LA 2YY1A 4GWJA 1OHFA 5F37A 2W39A 3FC0A 3VZMA 3D8CA 4G3YC 4XF9A 5KXCA 1VRH3 3K4ZA 3UGHA 1BZWA 1XOYA 2ET1A 3NMBA 3R4DB 2A5ZA 3EQEA 1T2XA 2WZR2 2RMU1 4RHV2 3PLQA 3RMYA 3SCGA 4X8PA 2SLIA 2CDPA 2HWB2 3KT1A 3OYWB 2D3RA 5E89A 4YGEA 3MIDA 3D6EA 3VDDC 1MPXA 4NHKA 2FMDA 3TEWA 2LTNA 5FZDA 1GQHA 2D43A 2DUPA 1CD3G 2JIJA 3KF5A 3MEPA 3W20A 4K21A 4EZHA 3OBRA 5A3LA 2JX9A 5LK5A 4ES9A 3KV5A 2PXJA 4Q4W2 1IPKA 1QJX2 1FATA 1TG7A 3AKTA 4AWDA 4E4SA 3O1MA 1BEV2 2BVBA 2ZKNA 4JQTA 5DUXA 1FPN1 4XFFA 1QJY3 2J1EA 3AJZA 2VQ0A 2QUOA 3I2FA 2XHNA 1LOCA 1W2AX 4QPGB 4DUXA 1JBCA 4M00A 4W4ZA 3EB7A 4YM1A 1VR3A 3FLRA 4YZ4A 2R1DA 5FFOC 3RZZA 1RUC1 1L7RA 5FYMA 4CXWA 3BTXA 3I3QA 4N53B 1CJDA 5KXBA 1DQ1A 5A3UA 2WFF1 3I2DA 2GP5A 3NV4A 1OUXA 1W6OB 2WSUA 4XIKA 1XYNA 1AR82 2CWSA 5FR3A 2QQMA 4AVSA 2R063 1O3SA 4MG2A 2V72A 4P9WA 2H6CA 1EAH1 2Z79A 1BVVA 1ND2B 3KQ4B 5JZGB 1RUNA 3WW4A 2CU5A 4QQ2A 4AEDA 2VW0A 4RYDA 1LU1A 5DZFA 4DEVA 3GDBA 5BYNA 1G7YA 2RM22 3PURA 1JHNA 1CAUA 4KWUA 5ABJB 5ACA2 1G9FA 4D6QA 5IVVA 4PCRA 2GNDA 4F83A 3ZSJA 1SLTA 4AVCA 1AR73 4DFSA 1D4M3 1WW5A 2R6QA 2BNMA 4K7JA 1PNFA 2W1UA 5A7NA 2HWF2 5FBZA 1UAIA 3ZYGA 3U0ZA 1AXZA 2VBBA 5FZBA 4BE3A 5HBAA 5IFPA 2RS53 5I0UA 1NG0A 4COZA 3I54A 4HSLA 1W05A 3FHAA 1HKDA 1W6MB 2A3YA 5JXIA 1QJEA 5F8PA 4EYUA 4RR3B 4BLIA 5K7PA 1QNWA 5IVCA 1BMV1 5FY7A 3PUSA 4AI2A 1AF9A 1OVPA 5D1IA 1UY4A 1HN0A 3ZM8A 5F2SA 1ZRDA 4P5YA 1O3TA 4YW3A 3KMHA 5JWPA 1XE0A 2W46A 2XLFA 1VMHA 4QKFA 3MIHA 3OBTA 4YARA 3LDRA 1SG3A 1WLWA 2VCCA 1LGBA 2P3JA 2A6XA 4JCKA 4NROA 2CHHA 3KF3A 2GSYA 1JYXA 3AFKA 1W9WA 1JN2P 1NCQC 3W58A 1PO22 5F7UA 2DCJA 1W6QA 2BZDA 2KA3A 1S0DA 1QOOA 2BTVC 2XOMA 4W6YA 5FXWA 5IVJA 3USUA 3HMYA 4XMIA 2AYHA 3OGJA 1ACCA 4RHV1 1IPSA 1AX2A 4Q1PA 5A33A 2A3WA 2HBUA 1J3PA 2RS13 3RZKA 1VBD3 1UPSA 3N9NA 1UMIA 3HNYM 1YHFA 1ZZ6A 1QJZA 3PJYA 4XURA 5FJHA 3WQ0A 1PM7A 2HEWF 2PA7A 3LCPA 4KH9A 3WF3A 1LAJA 1WMEA 5CU1A 2O8QA 4A7ZA 4BXSV 5DPNA 2ZHMA 5LA2A 3JQXA 3SH4A 4B1MA 1UY1A 5C9AB 1VMFA 3O7OA 4NJ4A 1LENA 3AXEA 2R49A 2WS92 4XFBA 2JD9A 4QPGA 2YBPA 1UL9A 3T09A 3BB6A 3DYOA 4OHXA 5LBCA 1JUIA 1Q8PA 1XYPA 4A2UA 1F4HA 3JCIA 4Z2AA 3VD4A 5F1RA 2Q4SA 4BYYA 3VZLA 5FTTC 3PVOA 3RYPA 3V0BB 4M01A 3D4KA 1W6OA 1UNBA 2JG8B 3RI8A 4EQVA 4HVQA 1SFPA 2JD4A 1UIKA 2E53A 3NNMA 2RR13 1AYM1 3CU7A 3GHMA 1BBT3 1RUE2 4E8CA 4Q4V3 2A6YA 5JZGA 1NE4A 2HWD3 1RUD2 1TNRA 1ND2A 3I2KA 3JD73 3FFQA 1PIV2 4SLIA 2WT1A 3RYKA 4FPYA 3T4VA 4ITCA 4LO8A 2R0FA 4UYBA 2YPDA 4KU8A 4ZS2A 4P9JA 3MIBA 4OVEA 3IMNA 5ERLA 2ZHNA 4UBGA 1W04A 5T5OA 1YQCA 2HJIA 3O1UA 1VB4A 2FHRA 1LHNA 5ACA1 3I8TA 1AR62 1OKOA 1PVC1 5CFCB 1ULDA 3GNEA 4N43B 1ZZ7A 1FMD3 1GP6A 2Q5TA 4G9SB 4PLOA 2HWF1 4Q26A 2BRTA 5FPXA 4AL9A 5JXJA 2JJ6A 1W6MA 1OF3A 1QF3A 2VOTA 1VBE3 4RR3A 4BPZA 3HQRA 3ZIXA 4UFIA 4MSVA 3D5OA 1HRV3 1VBB2 3RZHA 3VKNA 3J7HA 3OPZA 5K9YA 2Y6LA 3TN92 5T54A 1QJU1 4QU2A 2ARBA 4QXHA 4C90A 5CA6A 3CEWA 3T2TA 5A3NA 4K3UA 3AMNA 1X82A 4Q2FA 3C7GA 3ZKYA 4W8JA 1JU4A 3ZYHA 3RZGA 2QQWA 4XYXA 4LUMA 2J42A 3M8LA 3OD4A 4XFCA 1B35C 1GR3A 4CDXB 5BNNC 4YRDA 2G9GA 4Y24A 3BKZA 2JDUA 4IE4A 1MS0A 1RUF1 4LBJA 1NY72 5LA9A 3U14A 1W8OA 4AF9A 4DNYA 4KQ7A 1DGRN 2D6PA 4S2DA 2OS2A 4LK6A 1W9SA 4CU8A 2WNEA 1X7NA 3CJIB 4I02A 2QQIA 3BI3A 3WCSA 3E97A 5FO8B 4UFJA 4XILA 4QX5A 5H9SA 3GGLA 3UK9A 2XJTA 1PO21 4HT1T 2C5DA 4OHWA 2BGPA 2I07B 2XG3A 3MIFA 5JAXA 4XDPA 4E9KA 3KS7A 5DABA 4AFDA 3FHQA 3M3OA 1NQJA 2OX0A 4DQAA 1AZDA 1C5IA 3ATGA 2XBO1 3NAPB 3NSTA 5FPAA 3BUCA 4PJYA 5FO9B 3POWA 4MGZE 5H9RA 4IGOA 4JGYB 3Q8EA 1AJKA 2DUQA 1VAKA 3ZPYA 3O14A 4N9IA 1OOPC 3VZKA 4FAHA 5JDBA 3EBRA 2A73B 4QWNA 2A6VA 2CAUA 2VW1A 2YYOA 1W9TA 5C9AA 2GN7A 3J8F2 1WUVA 2E9QA 3AZVA 1VRH1 4GB32 4MGQA 5LRSA 4Q4Y1 5LEJA 5C5TA 5LY1A 1N3OA 4PIYA 4BK5A 4K8RB 3AMPA 5L9VA 2GH8A 2IXIA 4IEWA 2VUAA 5FZGA 4YGCA 1IKQA 2KXLA 3N36A 4CU7A 1PK6C 4G4FA 2B8MA 2DBNA 1KXGA 2HH9A 2JG8A 3N7KA 4DUWA 1KD7A 3U4XA 3M7AA 4LORA 2YV8A 1YQ6A 1URXA 4LA3A 1FX5A 1CAWB 2GNBA 5L7OC 3ACFA 2JDPA 4DRRA 1ZBE3 1CVNA 1KFXL 4AFAA 1DCSA 4XW3A 2QQUA 3ACHA 1UYYA 1ND3B 1UPIA 2PYTA 3OBZA 3E5UA 1XRUA 2ZGKA 4GAZA 3EMRA 3H7JA 4Q1RA 4PDWC 3WW3A 4NIDA 3V56A 2HKXA 4RA0A 2HYKA 5J09A 4A45A 3ZXEA 2BEOA 1XPWA 3VBUC 3IT8A 1FOD1 5CFCA 5IW0A 1H1IA 1UMZA 3WNMA 2XMLA 3ZVXA 5M0TA 3RPQA 4HMZA 3HBKA 4N43A 1AR61 4NO4A 2JG9B 5FMOS 4D69A 1JODA 1QJFA 2D6KA 1ULCA 3IPVA 4WVMA 1QDCA 3AYAA 4AGVA 4HETA 4UT5A 4BIFA 1YQ5A 2JDNA 2ZA9A 1REEA 4I01A 5G05L 1YEWA 4JKMA 5FYVA 5J36A 2FZ2A 1H4GA 2G9ZA 3CJXA 1BQPA 1N1VA 3ZXKA 3RS6A 4XOGA 2DV9A 2ZGOA 3AVRA 5CKNA 5LBFA 4Q27A 1CN1A 4I2OA 1JMUB 4LLFA 2NPIA 3VBOC 3AP5A 1P8JA 4H55A 4YPJA 3VHOA 2ZABA 5JVVA 3TN91 4AYUA 3IDAA 4L8QA 4TN7A 1O6UA 4I3PA 4CDXA 4DXZA 4PI2A 2RJ2A 3ZSMA 2ZGLA 1WKYA 2ADDA 5FUIA 1QDOA 4FBFA 1H8TA 1OLME 1DQ0A 4AE2A 3E5QA 2XB6C 4XFHA 4FVVA 3AKPA 1QQP2 2I45A 1UZ0A 3K51A 4Z92B 3LA7A 2WT2A 3CJIA 4DOUA 5FCCA 2BOJA 3HN3A 2PAMA 2WNOA 2Y8KA 3BCWA 1ZNPA 1MEC3 1SLAA 2D97A 4ZHNA 1WD3A 3BGAA 1OA2A 3KD4A 1V9U3 2AEZA 4EWEA 2NLRA 5J3UA 4EZ4A 3OY8B 5HI0A 3E1F1 3GZTB 4IE0A 1G9BA 1GNYA 4FFFA 1NE6A 2QQKA 1ZBA3 1J58A 2PLV2 2PMWB 3NKTA 4WM7C 5DDJ1 4JTNA 3MV11 3TNPB 2OYZA 4EJRA 5ANQA 1I1EA 3W5NA 1U5XA 1RUG3 1V6JA 2R073 3L9JT 4CDWC 5IK5A 2VOXA 3WNXA 2K0GA 4DO0A 2JE7A 3E6CC 2EIEA 2GAUA 2DCYA 1KFUL 4E2GA 1LCLA 1H6XA 4Q4X2 4FOQA 4DS0A 4FFIA 1VALA 4B7EA 1UU4A 5EPAA 2RG4A 2JECA 3N9LA 1UW8A 3AP7A 2QZ3A 3H1WA 5IVBA 4XDQA 2RHPA 1RVF3 2R1BA 2Z2SB 5LEKA 1UN1A 3POYA 1W8NA 5BNPC 2YFUA 1CAWA 4FCAA 4J1WA 2K9ZA 3LEGA 2B39A 2WUHA 4MZUA 1GWLA 5GKAC 4IEOA 4JV4A 3J4UH 1R64A 4P9GA 4A4AA 1BKZA 3VGIA 5HV0A 1ND3A 2RMU3 2JIGA 4XF3A 2UY8A 2GNTA 2ARCA 1OUSA 2XJVA 3FMGA 3H8UA 2YC4A 3DV8A 3WZ1A 4GIQA 2VZPA 3C7HA 3AL6A 5I0SA 3WG4A 5A7WB 3MF9A 2VZQA 1UZZA 4P02B 5F5IA 1NCRA 1PVXA 4COWA 3IB3A 5IVEA 2VECA 1R1A2 1O3QA 4BIOA 2GC3A 1ZRRA 2WNVA 1KQRA 1UMHA 1GMMA 3FFZA 4HXCA 5FP4A 2WINB 2JG9A 1BK0A 1FPN3 1C8M1 1AL22 1SBEA 2XJRA 3N3HA 3WW2A 5HXMA 1WMFA 3C7OA 4OHZA 4CZSA 2CY6A 4OI0A 5C6CA 1N1YA 2A3XA 3DF0A 4XTMA 4TWTA 2J1VA 3VHRA 2QQLA 4YG0A 3KVBA 2LS6A 4P00B 4FPLA 2JB4A 1RUC3 2X53S 2O0OA 5EP9A 5FPUA 3MFCA 4GA9A 5JR7B 2ID4A 3RJRA 2MNGA 3ZSLA 3WP4A 3H7YA 3VDBA 1D7PM 1T6BX 2WFF3 3VD7A 3BVCA 3ACGA 4GKYA 1OQ1A 3GALA 1W2OA 3FJSA 2VMGA 4UXAA 1JYIA 4FTBA 2RJKA 1EAH3 4YVSB 1DGWA 4C1XA 4M3CA 3UKTA 2OZJA 4E4DX 1H9PA 4Y20B 1OH4A 1XXNA 2AH2A 5JI7A 2Q8CA 1RUOA 5L9RA 4BLJA 1E5SA 4RN5A 5A6XA 2VNOA 1RL3A 5A6QA 2EIDA 3SEPA 4I0AA 5I0RA 5H9PA 1LKNA 2BJSA 1LJ7A 4KWLA 3MUY1 1C1FA 3TOJA 3VHNA 3WDVA 1W9YA 1HQWA 3AKQA 3IDCB 4KMQA 3PNAA 3O5SA 2VUCA 4MHRA 4QKNA 4UFKA 3T3YA 1UOJA 3VZOA 3WDXA 1X50A 3OY8A 1V6IA 5IJRA 2XPJA 2ZGMA 2PHDA 1W6NB 3M1HA 3PTYA 4P5HA 3T4HB 4S2FA 4XABA 5LK7B 1VMJA 1OQDA 2DCTA 1WBFA 2LROA 3F2ZA 3HT2A 5EYXA 3HVDA 4IEVA 4Y4RA 3U10A 2G4IA 3QOPA 3MLJA 2HEVF 2PLV1 3ZO0B 2WKKA 5FWJA 1MZEA 4A42A 1YI9A 1WCQA 2EF6A 1COV3 2VMFA 4XHXA 3M3CA 3VBFB 1OT5A 4FSJA 4Q8KA 3K75B 2VULA 3OG2A 1CJPA 3EJKA 4EN7B 4RFRB 1MQTC 2WABA 4WM8B 1S0IA 3BN6A 4AHXA 1WMXA 2AREA 1TME1 1SQ4A 4Q4X1 4XUPA 1O4YA 5EXOA 2WO1A 4B1LA 3KV6A 4PI0A 4NVPA 4BK4A 2W52A 3PVNA 1UU6A 3M4FA 4B4QA 2KM2A 1QKQA 3LEIA 1SCSA 4Q0QA 1KJLA 4YLZA 1IZ3A 4YNIA 4K20A 2DVAA 5JSOA 1H2KA 2DTYA 2MPFA 1N1SA 4BQWA 1IKPA 3IIIA 4CCCA 2Y0IA 4FXKB 4O65A 5FZHA 2XVGA 2ZOEB 1T6GC 5C3OA 4GWMA 3N35A 3ZDSA 3FL7A 4CDQB 5I8SA 2QZ2A 1DDLA 1RXFA 5A6YA 4RHV3 4KBBA 3RZJA 3BOPA 1S2BA 2Y38A 2Q1FA 3RWNA 1NXD1 1QNYA 1JZ4A 3IN9A 5I0DA 3MO4A 3K48A 5F5QA 2JDMA 3X29B 3JBG2 3E6BA 3KV9A 4QAWA 3T2PA 4C0HA 5DUWA 1RC6A 4EN6B 3ILNA 3A23A 4BQ1A 1BJQA 4JRLA 1AXKA 2FQPA 2HWE1 4MLOA 5GLWA 2ZGTA 4JGZC 2YHJA 1NQDA 2EA7A 2E51A 2WLQA 3WD5A 4CP0A 4NMIA 3Q8CA 4PBPA 3JUUA 2F4PA 1IQAA 3LDKA 1AXYA 1G9CA 3H0OA 1DF0A 1WLTA 2BFUL 2GMEA 4K1ZA 1ZREA 3DYPA 1X8EA 3UYJA 4BA6A 5CBLA 2JWPA 5C8WA 3MGUA 1SBDA 3K3OA 4FTEA 2HWC2 4CCOA 5FDBA 1AYM3 3DPRB 5DUUA 5C3SA 2Q8EA 1WBLA 4LT5A 1HB1A 2CGPA 1TQ5A 2VTXJ 1GP5A 1U5IA 3RFRA 3T08A 1YRZA 3K3NA 1JH5A 2ARXA 1NA1B 4TTGA 2RM23 4YW4A 4B4RA 4DXSA 3JXSA 5ACA3 4META 1WLDA 1DQ4A 5IK4A 2AZ5A 2BBVA 4LJHA 1PGL2 3QH6A 4PLMA 1XNTA 3RQ0A 1R092 3ZDVA 2FDGA 1HRI2 3A7QA 3U07A 1W6NA 2HWF3 5D21A 5FZCA 4RS5A 2P5BA 3CQOA 3V65A 4Q29A 4CEWB 2Q0AA 1UXZA 5FPBA 3K4DA 2D93A 3A0KA 1KDKA 1JYNA 1AVBA 4LNVA 1S55A 4O61A 5E1RA 3NV3A 2J22A 4QX2A 3T0AA 3VD3A 3OEBA 3B00A 4HANA 1R081 3RVHA 1QJU3 4YM0A 1GV9A 3DCQA 1RJ8A 1YFYA 4PLNA 3N4MA 5AVPA 4A3ZA 4D6RA 2E32A 4DRVA 2EXJA 3AX4A 3KB5A 1OD3A 1PGW1 3NV2A 3NNFA 1RUF3 1JOBA 4XBNA 5KHHA 3IBMA 2Q8OA 2P2KA 5JXGA 4FP2A 2MEV2 4M4RA 2AC1A 2XONA 4Z1VA 2KD7A 2VQUA 1X9PA 2ZKLA 1HLCA 4ZPIA 1GQPA 5K0UA 3WV6A 4QX3A 1GKBA 4QMAA 2R071 1PO23 2P6CA 2UY9A 4O9EA 2A70A 3ZYFA 4AEKA 4CDQA 4CP1A 4QPGC 3VL8A 5JR2A 3NL1A 1A6CA 3WNLA 2BDRA 2W1WA 1IS4A 3SITA 1S0JA 2IXCA 1Z78A 2WZPP 4KU7A 5C4WB 3C7FA 5BV6A 3MW2A 4CDUB 4JQRA 1OA3A 3OCPA 3OTFA 5FOBB 3FE5A 4QQOA 2C24A 4OUSA 3WR0A 1GICA 3CF6E 3NWKA 4JC1A 4RQPB 1W3XA 1JZ5A 1SDDB 1EPWA 1LOEA 3ETPA 1R1ZA 1RUH2 3LOIA 4N9HA 4D3WA 4Q4Y3 2AEYA 2X5IC 4AHWA 1F2NA 2Q1ZB 3HBZA 3NO8A 4OUEA 2AGSA 4LHNA 2QCSB 4UI9L 4JZRA 1ZYBA 2JKXA 2WT0A 1PHMA 5D8AB 1VBC2 1DGWX 1MZ6A 2WWJA 2Q30A 3U11A 1AYN1 3UT0A 4IEYA 1H2MA 3ZIWA 3W9AA 1DHKB 1NAEA 2TNFA 4FOWA 4Q8LA 2GH2A 2VTFA 1H2NA 1D2QA 2VD7A 2VQTA 1ULEA 2WYSA 4HKOA 1ODNA 4NHMA 2DUOA 3MI8A 5LRRA 3DGTA 4UF0B 4YG3A 3M2MA 4RR3C 4AEJA 2YDEA 4S2HA 1PIV3 4OHYA 1BHGA 2PHFA 5CKMA 2EICA 3J7NA 4HOOA 4QPYA 4R52A 4IW3A 1S0CA 4AQTA 4XCBA 5DMYA 2VM9A 1FOD3 5GALA 3WG3A 5BNOC 3VBSB 4L99A 1V6NA 1AR63 1HIXA 3I2JA 3M70A 2E7TA 1OMIA 2OPKA 5CG9A 1W0NA 4CEWA 1FXZA 1W99A 4AAPA 5C7GA 5CG8A 2BERA 4Y33A 4L9BA 1PO12 4LOTA 5CB7A 3HQUA 2EAAA 1HXS2 4YGBA 4MGKE 5G04L 1FAYA 3QBQA 3CZUA 2O1QA 2D6LX 4LO5B 3T2OA 3LA3A 4AAXA 5F5AA 5IAVA 2CTVA 4Y5Z0 3PUQA 4YFWA 3OSDA 5CYYA 3NJXA 5A7PA 2YB7A 3AZYA 3TN93 4DUVA 2ENRA 5FK7A 1LECA 3UGFA 4BQYA 1YIFA 5FLIA 2WQ4A 2ZJCA 4LE3A 3DXUA 4PF1A 5CNAA 1IS5A 3AYCA 1JZ2A 4DPNA 2XH6A 5FZ8A 5FY4A 2GP3A 3ZXDA 4NE9A 2UYBA 5BY5A 3OUJA 5LZ6A 3H50A 5KBFA 5C9AC 3BPSA 4FT8A 3VKOA 1WZXA 3TEXA 1COV1 1K3IA 3G7DA 3E6DA 1AR91 3NJVA 4NRPA 4FOYA 5KXDA 1XYOA 4QB6A 1ASJ2 1W0OA 5C4WA 5A32A 3JQWA 5DDJ3 1SLBA 4LBMA 4Y22B 3SLIA 2ZHKA 4CUBA 3A4UA 2Y6JA 1A78A 2PHXA 4DXTA 3MF6A 2WZ8A 3KWVA 4DXRA 5FUPA 5JSPA 1YLLA 3FN9A 2D6NA 2QNKA 3LEKA 5KXEA 1RMU1 3MPBA 3QACA 2H6BA 1PZ8A 1RUI1 3GJAA 4TZDA 2PN5A 1W2TA 4W65A 1Y43B 1ZA4A 4PT6A 1CZVA 4LBOA 4C0BA 4CU6A 5C70A 1F31A 1NYWA 1O8PA 2W0XA 2W91A 3K77A 3OYWA 3KVAA 5D8AA 4YVWC 1H2LA 5F39A 2ZX4A 4AFCA 5C71A 2WZR1 1KS4A 2JDHA 2JICA 1POV3 2VNRA 2HWB1 4LKFA 3ZFEB 4M0HA 2W5FA 4HLTA 4IE6A 3P1IA 5A1FA 3AMMA 3HQXA 4Z07A 4ASMB 5FQ0B 3PIGA 1B09A 3D0JA 4P14A 3O1VA 1LEDA 3HAGA 1US3A 4UF0A 4CCKA 4Q4W1 1JW6A 1QJX1 1HB3A 2P1BA 2VMEA 1SFYA 3J9SA 3WLUA 4OQ8A 1UKGA 2F17A 3AZXA 1BEV1 2OXBA 5DQ0A 3GZUC 3U37A 3I3BA 3ZFFB 4BM8A 3VBRC 5A70A 1OA4A 1DLCA 2PQSA 2WO7A 4N90A 2VVEA 3O1OA 3VBSA 2PQQA 2VZVA 4N53A 4NHXA 3SEEA 1V0AA 1V6LA 4XC9A 1C8M3 1UOGA 4QM8A 2UWAA 2YBKA 3GBFA 4JDMA 5FPZA 4BMEA 2XLGA 1ZM1A 3QLQA 5FP3A 4LHSA 1H8TC 5CFDB 3N7JA 4AFBA 1AR81 1UO9A 3GXUA 1N3QA 4ZXKA 1J59A 1CIWA 5FKCA 3RI9A 1H30A 4BISA 4XQ4A 4F7ZA 3C8XA 2ZGRA 4OQ9A 1Q56A 5ABJA 1VE0A 1QEXA 4ISQA 2ZEXA 4OULA 2E7AA 1GNZA 2RM21 4YW2A 1ENQA 2XWBB 3MFAA 3ZXGA 1Q3EA 1U12A 5FLJA 3USSA 2W68A 3VD5A 2VAUA 3UNPA 2WIIB 1QY4A 4Y1XA 4KGQA 1YIPA 2VZ1A 4NIAA 1QJY2 3I3DA 1NCQB 2AENA 5FZMA 1LB2A 4YW1A 1TMF2 2PHUA 1OBNA 2RDQA 3WNKA 2WZEA 3VHPA 4LHKA 4UAPA 1GQGA 4FOVA 5DXDA 3DYMA 3WQBA 2BBAA 4Y26A 4ASKA 1V70A 3GJBA 3H42B 2A7AA 4AHZA 2BGOA 5JMCA 4AVVA 2I74A 1AL0G 3S5AA 4XFIA 4QGNA 2YC0A 3O0XA 3AVSA 4Y22A 1KJRA 3OPWA 2R062 3UESA 3I4IA 2PAEA 3S6PA 1AHSA 1ASJ1 1L7QA 2CYFA 2PFWA 2PLV3 2X10A 5DG1A 3GYDA 3ZOIA 2ZEZA 4YW5A 3GZEA 3DUIA 3ES4A 2VU9A 5FXXA 2E31A 4QDSA 2D6MA 1AR72 2QFEA 1D4M2 1YI7A 2WNUC 1TME3 1G8WA 3N9QA 5GM0A 4Q4X3 2XVKA 3ZFGC 4IV1C 1CR7A 2G19A 5FJKA 3SISA 4HN0A 1NX9A 1NCRC 1MS1A 3WOGA 1CWPA 2VG9A 3ZFEA 4XBQA 4FO9A 4EN8B 2B9UA 5FY5A 2P3YA 4BHPA 2WNVC 3H8RA 2WBKA 2VCAA 3WVJA 5FQ0A 2ZGNA 2NM1A 5FMOL 2OZ6A 3MV01 2FDFA 3IDBB 3MPPG 4M3CE 5GLUA 5K4LA 3HEIA 1O91A 1JYWA 1I6XA 2JENA 3ZFFA 2H0BA 1IQDC 1SBFA 2W94A 1UCXA 1LULA 3CMGA 2WS91 4C8DA 2RS32 3PIJA 4ATEA 2KR2A 4XF0A 3OGGA 2GN3A 1G9DA 3V0BA 3PUHA 4XF4A 2HWE3 4UW3A 4QHZA 2WL1A 2GU9A 3NNGA 5I0TA 4Q5OA 4Y1UA 4L97A 2E63A 5FYBA 5I91A 1WW7A 5CFDA 1W2NA 2L9LA 3POSA 4C91A 5JOZA 3AKRA 1GBGA 3D3AA 5LA1A 2XVLA 1RUE1 1JZ3A 1RUD1 1PIV1 4LXLA 4ATFA 5IVFA 3MICA 4MGIE 5FMDA 4COUA 3PTRB 3BTYA 2WR9A 2XGXA 5FYYA 4BQ3A 1YCIA 3BU0A 5EV7A 1FV2A 1B35B 1VBD2 3INAA 5BNNB 2VE1A 4FTSA 1PZ7A 3VN4A 3I2IA 2ZGQA 4JVAA 4AI8A 2JDKA 3ETQA 2V73A 3CKHA 4I30A 4BQ5A 4MGYE 5GZEA 2UU8A 3I49A 3H3ZA 3MLLA 1OURA 4N7UA 2GNMA 3WHUA 4FPJA 3U1XA 3FUQA 2DCKA 3Q9OA 4H7LA 1ULFA 4GWIA 4KI5M 1TMF1 1NLRA 2R042 3MUZ1 1MS5A 2MHFA 3OOXA 4K8FA 2XHKA 1HJFA 2LALA 3KCYA 3LSDA 3QCWA 4QPIC 1VBB1 5E88A 3AMHA 4IEZA 4EROA 5LA0A 2W92A 1RTVA 3VBHC 4CCMA 1RITA 2OQ6A 3OBAA 4AQ6A 2RR12 5A80A 1BBT2 2JKBA 4E2SA 3DKWA 3JD72 1OLRA 3BPZA 1GZWB 4FI9A 2HBTA 1W2UA 1R083 2BWAA 4XDOA 1DP0A 3ZYIB 1ALYA 2A71A 4LEJA 1NY71 3JB8A 3ORJA 2LM3A 1W3VA 4AQ2A 3BIEA 4YFZA 2WLPA 1H8VA 5EJ1B 4EN0A 1W8HA 1UZVA 3AKSA 2NP0A 1SCRA 3GHNA 3I3MA 2VNGA 1PK6B 1S2EA 1HB4A 1O59A 4Y5TA 5I93A 3VV1A 5FZ1A 1FMD2 1VB2A 1XB9A 3CL1A 4NIGA 1NOVA 4FPGA 3NAPA 1AUYA 1XE8A 1SLCA 2XJUA 3ACLA 5L7OB 4A41A 2QJVA 4GWNA 1OC1A 3N9OA 4JGYA 1VBE2 1D4VB 1CIYA 1O5LA 4GMP0 1HRV2 1LTEA 5GLTA 4ORFA 3SH5A 2XUMA 1UKRA 5F5CA 2WDBA 3DKQA 4PDWB 1W9FA 3ILFA 1PX4A 4OCTA 3GBGA 3TWIA 2DU0A 3AP6A 4JKKA 1VBA2 3VBUB 2JDZA 2YU1A 5IT6A 2C9AA 3J8F1 4GB31 5FWEA 1I5PA 2ATFA 2OUHA 3JZVA 1LNSA 4CXYA 3CHXA 1FYUA 3JBG3 3IAPA 1Z0HA 2FBEA 1OH3A 1POV1 4LIUA 2YPJA 2IWGB 2ZPXA 4FFHA 1EUUA 2OT7A 1G6NA 3AZWA 5A3PA 1HX6A 5T50A 1J83A 1H4HA 5F6LB 2H0VA 4NHYA 3FBYA 2EXHA 4YG6A 5FXVA 2B9VA 5IHRA 5FP8A 2ARAA 5FOJB 3W5MA 1ODMA 1RYYA 2PHLA 1G9AA 3LWCA 3CZJA 3CO2A 1AYN3 5E8AA 3VBOB 4XETA 5CIRA 1REFA 2GC1A 4NAMA 2TUNA 3PUIA 1UX7A 3ZXLA 2V4AA 1B35A 5BNNA 1I5ZA 3GF6A 3LD8A 2IUWA 1ZRCA 3D0SA 1FNZA 1RUJ2 2C6SA 4FQ4A 4CUAA 5JPMB 4OFGA 1UXXX 4RS5C 2BP6A 1MS4A 3LFIA 3PUAA 4R4ZA 4YW7A 4QB2A 5LBBA 2V5DA 4UW5A 2K2SA 1EY2A 3L2YA 1LOFC 1YUDA 5C8CC 1OFSA 4MXVA 3POEA 1CPNA 1DYOA 4AI1A 2Z4FA 2OVUA 2PHTA 2UWBA 4LHLA 2GC2A 2QDNA 3ZXFA 4BQXA 5IK8A 4GH4C 1YO8A 2IXHA 1WCKA 4IV3C 3ACIA 2QQOA 4ZS3A 1PMHX 2ZTNA 4ES8A 3LGRA 5JCTA 4DMIA 2C26A 2VR4A 3POIA 1Y9MA 1UD1A 1YJLA 4LBKA 3P5BA 1LHWA 2BNNA 5FZ7A 2ETEA 3LEMA 2RDNA 1U5ZA 4YM3A 3R4UA 1JYCA 4LKDA 5JIUA 5B2GB 4LO7A 4R9BA 4WM7B 3KT4A 4IE7A 1ZBE2 3B5LB 4SBVA 2NN8A 2VJXA 3WEZA 2HLEA 3WXPA 2VVDA 5ANNA 4CDWB 1H0BA 1GZWA 1GZCA 5B4XA 2QQJA 1JYVA 1JS9A 4IGPA 2GMPA 5K0UC 4LBQB 3ITQA 1O4TA 4CPBA 3RZMA 4LOSA 4NIHA 1QQP1 2VCMA 4GZ9A 5LATA 3H3UA 4XXPA 2BQPA 3A21A 1GU3A 1PK6A 4DIQA 4XBLA 3ZMOA 3WDWA 1GOHA 4CCLA 2BUKA 4XFAA 5JSRA 5BNPB 1KS5A 1K5MC 1CAXB 1ZRIA 1K42A 5FZOB 3ZKUA 4GKXA 1JTZX 1DBNA 1UY2A 1X8MA 1ENSA 3B01A 5DAVA 4BZ4A 5DG2A 1XSRA 4OZOA 4PQ9A 5GLVA 3VKMA 4E2QA 3AK0A 3AYEA 4QT6A 4AR2A 1A3KA 3ZYPA 4PDWA 3CBNA 4XFGA 1AR93 5IYYA 4HN1A 1YYNA 3I2OA 5FUNA 2ES3A 1PMJX 3VBUA 5FIXA 2W2IA 4UBHA 5DAXA 4AEMA 2DWRA 3KCXA 5LY2A 3LPFA 3VLBB 4XE9A 1VBA1 4ASLA 2NQYA 4CXXA 2A75A 3V64A 4CEYB 2XKPA 1RMU3 2AACA 1LESA 1RUI3 1RXGA 2R30A 1IS3A 2VPVA 5EFUA 4XUTA 5FO7B 1IG0A 2E6VA 3J26N 4QXKA 4X6RB 3J7LA 3R4SA 1RUH3 4WZCA 3J7MA 4XTPA 2BPA2 4YZ5A 4W6WA 2ZXQA 1V9U2 3TBDA 2WZR3 3VB9A 3VBOA 1W0PA 2Y6KA 5A7WA 2PELA 1DQ2A 2HWB3 3ZXJA 1W6PB 3B3QE 2RJLA 1SZBA 1E57A 2ZEYA 3TEZA 2AUYA 1CZTA 2FDJA 3WP6A 2OPWA 1XC6A 1J3RA 1UY0A 1LGNA 3ST7A 3UV9A 5BPXA 1XNAA 4YZ1A 2YG0A 5C3RA 1LRHA 1R1A1 1M4WA 4Q4W3 1RUJ1 1QJX3 5FAXA 4UFLA 1Y3TA 2JB8A 4CPBD 3AMQA 2D6OX 3ON7A 4N7IA 1BEV3 1I3HA 4AEDC 2WO3A 1AL21 1ENRA 5AFBA 4LKSA 4PF5A 4YGDA 1HW5A 4WVWA 4XUQA 3B7MA 1TZOA 3O1PA 2VXJA 1LU2A 1DGLA 1C5HA 5LWBA 4LULA 4QX0A 1ZZBA 1RIRA 1RVF2 4KNCA 1QOTA 4Y1VA 4D7SA 2DF7A 2P6HA 1OLMA 4QKBA 2WFPA 4ONUA 1MVQA 1JXNA 5HXVA 4YZ2A 4Q0UA 4LE4A 4WM7A 3ZLIA 2ZGSA 5JOXA 5A3MA 1V6OA 3T0BA 1AR83 4YVSA 4AVBA 3RWKX 1MZ5A 2GMMA 3NNJA 4NPLA 4W6XA 4A7KA 2RMU2 4CDWA 3BTZA 1CQ9A 4Y20A 3AXDA 3HWJA 1QXRA 5CISA 4LBQA 1CESA 1BMV2 3PHMA 4I3GA 1NT0A 3O0VA 4NIIA 1MQTB 4ARYA 4XMAA 1BCXA 2XLAA 1WA4A 1WMDA 4RGAA 5F3IA 2BW8A 5FZ6A 2X09A 5T5JA 4JX0A 1RHI2 3UL2A 3WW1A 5C4WC 1VP6A 4A44A 5A3TA 5BNPA 4I0WB 2WRAA 4LBLA 4D6SA 1W8TA 4XXAA 1CAXA 2CGOA 2ZBJA 4KL1A 5I8YA 5FZOA 3MW3A 4U2AA 5EJZB 1O3RA 4RFT0 1W28A 4P9IA 3B69A 5CAZA 1RUC2 3OUIA 5FZEA 2X05A 3RMXA 1M06G 1CX4A 3VBFA 4FPFA 1QXPA 4MADA 1KEXA 2WFF2 4XF1A 1F35A 1F5JA 3BU7A 4IEUA 1S0FA 2Y6FA 5FZFA 4A3XA 4WM8A 4JHTA 3ALQA 1WW6A 3LKJA 3A22A 3SXWA 1JOPA 1W90A 4UW6A 5IWFA 5F9TA 2VH9A 1OF4A 5J7MA 1EAH2 1Y9QA 1ASJ3 2E33A 4TXWA 1GLHA 2J1UA 5JOYA 2FDHA 1ZX5A 3LFMA 4NAOA 4CEYA 1VAVA 1FV3A 4XJAA 4JGZB 2WQ8A 4H2AA 2FDKA 3B9CA 3R05A 4O7XA 2DURA 2B5HA 1F15A 3F95A 1JZ6A 3WSOA 2ZZJA 4QHOA 1EYBA 3FLTA 3WDYA 2VVFA 1KDMA 4CRQA 3ME2A 1GP4A 5C3PA 4YYOA 2FZ1A 2IZWA 2X29A 2CWMA 4HK8A 2XJSA 1NLQA 3WHTA 3DXTA 5E16A 1W6PA 2QQPA 1SMVA 2VNVA 2Y33A 4N53C 5FZKA 5F32A 1J84A 1JU3A 4LMFA 5A1LA 4XVHA 2RE9A 1XBFA 5AC92 5JI9A 5FRAA 1ZZ8A 3MBWA 4B29A 1UIJA 2V4VA 3JBG1 4LBQD 1UWWA 2UWCA 3N7LA 4XJ8A 1W8FA 5FY0A 5A3WA 3ZMNA 2DVGA 1UYXA 4AG4A 5CEHA 2BWCA 3U78A 5JZGC 3PU8A 1ND2C 4QGLA 3WP5A 4AXOA 2E26A 1OSGA 1TEIA 1Z7S2 4LITA 2YFZA 2OA2A 3DEMA 3I2GA 1MACA 2IVIB 4EV0A 3FHIB 2VO5A 4QX8A 5ABJC 2WS93 2ADEA 4HKWA 2D3SA 2O14A 2JEMA 1VRBA 2P3IA 4JRAA 4L0PA 4P08A 2D44A 4QGMA 4R9CA 5F3EA 1RB8G 1W8WA 5CVRA 4GJZA 5EJ3A 5LCWL 1UQXA 4RD7A 3RZLA 1GWKA 4ZU5A 4LIVA 5FZ9A 2UURA 5DZGA 3LF7A 3DPRA 2CDOA 5DAPA 5JXHA 2WAOA 4MX3A 3ZR5A 4B7KA 5JPNB 5JIAA 2HWC1 4LR4A 1XNCA 3OPTA 4Q0SA 3NJYA 2YUEA 1RUE3 1W6QB 5FYUA 1NA1A 1UOFA 1RUD3 2JE9A 3RRDA 4BWOA 2P4EA 5J1XA 1W06A 2VL4A 5HCFA 5GLZA 4KBZA 3USUB 1MQTA 1CAVB 1QHDA 2DCZA 3FWEA 2OKXA 1QXJA 2XJPA 1DZRA 1K12A 1VAMA 1XNKA 4JDOA 4RGKA 5A33B 1AX0A 1H1MA 4GXLA 4ZKTB 5CKQA 4K40A 4XHBA 1PGL1 3Q8FA 2VZOA 4CU9A 3WDTA 1RHI1 1R091 4NUBA 1HRI1 1N47A 2QBXA 1XU1A 2DVDA 4LPLA 2PTMA 3IM0A 4OYUA 4X8NA 1TMF3 1Y7BA 1C3HA 4W50A 5CADA 5AFEA 1OD5A 1VBB3 2IFRA 1N1TA 5LASA 2J1AA 4ZZ8A 5L9BA 1GSLA 2VMIA 4HK9A 3ZSEA 5IFTA 1H9WA 2RDSA 3IKWA 4MUVA 4HVRA 1AYM2 3S7EA 1QWRA 2CL2A 3ZFEC 4QQLA 2ZGUA 3CIHA 2G9FA 2OIIA 3K2OA 3RG0A 3GZAA 4CCDA 1EV12 3ZN4A 2XL7A 4JGZA 1GANA 1WWYA 2XUEA 3ROUA 3LDBA 3GCXA 4X6QB 1QOSA 2X5IB 1HV0A 2Z69A 2FMYA 2BGCA 2MEV1 4HZFA 3THTA 2XR4A 3KT7A 1PVC2 2J1TA 2XQXA 3LQCA 3UKVA 3ZFFC 4RSUA 3VDDB 1BVP1 4WVVA 4HONA 2BOIA 4JDNA 2FCUA 3BODA 2HEYF 3M3QA 4MV2A 5T5LA 2XJQA 2Q8DA 1SHWB 3P6BA 4D94A 2JG8C 2ZX2A 3DN7A 4ARXA 4CP9B 3IMMA 4CDUA 3WF1A 3WP3A 1RGSA 3B02A 5F3GA 3ZSKA 3IAQA 5F2WA 3ZR6A 5AC91 5CFDC 2NMOA 4RQPA 1BYHA 1QJU2 1W8UA 1DGRA 2IC1A 2VZ3A 3OGRA 1STMA 2P17A 4WBBA 1UX6A 3RDIA 1V6KA 2R7EB 2RV9A 2YBSA 3ILRA 3J8F3 1RUH1 4GB33 3OGVA 5FV3A 3JU9A 2TBVA 4IDZA 3WG2A 1Z7S1 4HG6B 3N9MA 2VTXA 5BNOB 1LOBA 1LHOA 2GC0A 2WWSA 3ABZA 1DYPA 1RUF2 2XQRA 2ZGPA 1Q5OA 5LBEA 2RS33 5CFCC 4ZXEA 1VBC1 5T55A 4CCNA 3B94A 3WDUA 5FZ4A 4N43C 1GWMA 3NRUA 5HCAA 3SHRA 3AJYA 4B4PA 1S0EA 5T52A 5A7OA 5FZ3A 3EXUA 4AZZA 2Y26A 3OGSA 1VIWB 4QXBA 3PVBB 2LRPA 2WN2A 1BK1A 1CAVA 1OQEA 5A3OA 2XBO2 5GJ6A 5BXXA 2VXRA 3K46A 3V0AB 3URFA 1CONA 4IGQA 4AFMA 3UKNA 3MHZA 3R6SA 1DQ6A 3I2HA 5C3QA 2VOKA 1AX1A 1VLNA 4CDXC 1S4CA 3B93A 2YC2A 3UJQA 3OB8A 4BOWA 5ISLA 4J6GA 3FLPA 1VRH2 4LTAA 5EZWA 4A6SA 4Q4Y2 4AVTA 1JHJA 1GUIA 2VW2A 4Q0PA 5GZFA 4NPMA 1ZRFA 2WC2A 5IUQA 1PO11 3CJIC 1XSQA 1KGYA 2AR6A 2NMNA 2QQVA 4Y3OA 1HXS1 5FY8A 3VD9A 4N8MA 2IXLA 3HJRA 4QD2A 2R043 3BTAA 3BIWE 5LW9A 5FLHA 1EUTA 4KWJA 4GJYA 3M3IA 1XNBA 2IXKA 5IAXA 1MS3A 4Y5SA 2W95A 4BU2A 5FYHA 1IGOA 1YC61 2VUDA 1O5UA 2BNOA 3NAPC 4LKEA 1XNDA 3SH3A 3P3NA 5EYYA 3N9PA 4EE2A 4JGYC 4K6BA 3VZJA 1NZCA 4B3NA 3SKJE 4ISRA 4NPRA 2ZX3A 1EV11 1I9RA 3KV4A 1F5FA 2X5IA 3LB9A 4HSJA 3H1YA 2ZS6B 5SV5A 1SLLA 1QQP3 1WCDJ 1REDA 4AOCA 1L3JA 2D3PA 1FOD2 4YVWB 4MO3M 4UFHA 4XJ9A 4Y1ZA 5T3NA 3LOBA 5KHGA 3VDDA 3P3PA 3LIHA 4UWDA 3PJQA 4D7TA 5KHIA 5A7QA 2ORZA 1YWKA 2VZSA 3ASIA 2FD8A 4CP9A 1TNFA 5JLVA 3PVEA 3IPVB 1A8DA 3NKGA 4FQZA 2JXAA 2CSGA 4H7MA 4WVMB 4EN9B 5F3CA 1YNAA 2CAVA 2VMDA 5D2AA 1BLZA 3SKVA 3KM5A 5FZ0A 4XJWA 4ZZ5A 3KHCA 3DECA 4HKLA 1JZ8A 1LHUA 1ND3C 2C9KA 1C4RA 2LUWA 4QHBA 3VBRB 1ULGA 2P34A 2DYCA 4YWAA 3S0MA 4JHZA 4COYA 5BNOA 4NWWA 4UFMA 1DU3D 4UOJA 1HJGA 1VBA3 3WF4A 3M3EA 2RS52 4Y4YA 3THPA 3ZX7A 4BH9A 2VOVA 2P3KA 1WGPA 4M4PA 4OI2A 4GMP1 4OZXA 3H8OA 1H8TB 2JG9C 4QDRA 1GOFA 2OW4A 3QH7A 4FXGB 4YZ3A 1PX3A 1OPOA 4HL0A 2BV4A 3OF1A 1WA6X 2VQAA 4QU1A 3IDEA 4CTEA 4D0QA 4BCUA 2Y6HA 3PU3A 1SFNA 4LK7A 1XJAA 2D7FA 1FT9A 4HBNA 4OMCA 5DUVA 5JMOA 4V1PA 3V0AA 1GFF2 4LBNA 5DDJ2 4DINB 2ZX1A 4CVUA 1W8ZA 1K5JA 2IVJA 4AVAA 1R1A3 5CZKA 3ZXAC 2YMZA 2Q1MA 3MDPA 4CSWA 2A6ZA 1RUJ3 1S0GA 4UW4A 1OPMA 4WZFA 3WNPA 3HIFA 5DZEA 1AL23 1XQNA 1CZSA 1LHVA 3OD0A 3Q8BA 2C0ZA 4URTA 4LO4B 4NN0A 4XAAA 2LW8A 2ZMNA 4H14A 4YSFA 4URAA 5KC5A 3MIGA 4ZU4A 3RNSA 4MYEA 3R0RA 3VL9A 4A7YA 3AP9A 4MVTA 1LOGA 2QVSB 3FUOA 3W59A 1SEFA 3O0WA 3SMHA 5KC6A 3HR9A 1CX1A 2XWJB 2D98A 2W1QA 3ZYBA 4XAEA 1NXMA 2RS12 3HNMA 4QM9A 2A1XA 3AYDA 1UU5A 4E4HA 5FPLA 5BUVA 1NZIA 4XCAA 2ZAHA 2WA4A 5A7SA 3O1SA 3WNNA 4OI1A 2R0HA 3FX3A 3KSCA 2W9XA 4QKDA 1NCQA 4NOTA 5KWRA 1WCUA 2X8KA 3HOBA 4K1YA 4FPEA 2GZWA 1QJY1 3C7EA 1ONAA 2XXZA 4CE8A 1X9TA 2HYXA 2WNUB 3S7IA 5FREA 4R8HA 2VBDA 4P9XA 4YVWA 3THCA 1PGSA 4TYSA 4IV1B 3ZFGB 4BQ2A 1UZWA 2ZCWA 2JDYA 2CNAA 4U36A 1NCRB 4V2WA 3WNOA 2D5FA 2ORXA 3EYPA 1DZTA 1C8M2 1X33A 4FFGA 2WNVB 4FP3A 1E5IA 1KITA 5GZGA 1LR5A 2ZX0A 1E5HA 1POQA 1W39A 4Q4V2 1IPJA 2CV6A 2HWD2 3NNLA 3H9AA 4R9AA 3A0NA 4BMBA 1OOPB 3KZ4C 2R061 1QMJA 3N7MA 1DQ5A 2ET7A 3L2HA 4KG0A 1Q8QA 4HVOA 2R32A 1DFQA 3LA2A 3CDZB 3VBRA 4AK3A 3MLKA 4L11A 1SDWA 3EO6A 2PHRA
chains in the Genus database with same CATH topology
1OUXA 2JDYA 2BP6A 2CHHA 1GZTA 5A6ZA 1UQXA 2WR9A 2VNVA 4AOCA 5A6XA 5A6YA 5A6QA 3ZDVA 2JDKA 5A3OA 5A70A 1W8FA 2JDMA 1OVPA 1OUSA 2JDPA 2XR4A 2WRAA 4UT5A 2JDNA 2VUCA 2JDUA 1OURA 2BOJA 2JDHA 1OXCA 2VUDA 5HCHA 1W8HA 1UZVA 4CE8A 2BOIA 2BV4A 5D2AA 1OVSA 3DCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUX A;  2JDY A;  2BP6 A;  2CHH A;  1GZT A;  5A6Z A;  1UQX A;  2WR9 A;  2VNV A;  4AOC A;  5A6X A;  5A6Y A;  5A6Q A;  3ZDV A;  2JDK A;  5A3O A;  5A70 A;  1W8F A;  2JDM A;  1OVP A;  1OUS A;  2JDP A;  2XR4 A;  2WRA A;  4UT5 A;  2JDN A;  2VUC A;  2JDU A;  1OUR A;  2BOJ A;  2JDH A;  1OXC A;  2VUD A;  5HCH A;  1W8H A;  1UZV A;  4CE8 A;  2BOI A;  2BV4 A;  5D2A A;  1OVS A;  3DCQ A; 
#chains in the Genus database with same CATH topology
 4BB3 A;  4JKL A;  1MS8 A;  4AQS A;  1AR7 1;  4NR1 A;  1D4M 1;  4OMD A;  1GNH A;  1JYT A;  4P9L A;  1WD4 A;  1IHM A;  1ENX A;  3OUH A;  1PM4 A;  1SPP B;  1Q8O A;  3Q8A A;  2R16 A;  5EWS A;  3HD8 B;  3RYR A;  1OKQ A;  2QE3 A;  2WO2 A;  1JOJ A;  1ZZC A;  4M3C B;  2RS5 1;  1XU2 A;  5FK8 A;  3S5Q A;  5HV4 A;  1HV1 A;  3EHK A;  4BJ0 A;  2YGM A;  4FPC A;  4CUC A;  3I59 B;  3S30 A;  2DTW A;  1F8V A;  1Y4W A;  1JZ7 A;  2DU1 A;  3MIE A;  4IXL A;  3CLP A;  1S2K A;  3PDQ A;  3LSE A;  2SBA A;  5L36 A;  1G86 A;  4Z2W A;  3ENR A;  5HPO A;  3MW4 A;  1W03 A;  4AW7 A;  2Z42 A;  4MH0 E;  2VZT A;  2FCV A;  3UJO A;  4CA9 A;  2RS3 1;  1ZA7 A;  2ZMK A;  4XUO A;  2Y6G A;  2WJS A;  3POG A;  1F4A A;  4YVS C;  2YGL A;  1YQ8 A;  4GUL A;  5IK7 A;  3ECQ A;  4RL7 A;  1HB2 A;  3ELN A;  4GD4 A;  1EPZ A;  4DZG A;  2VC9 A;  5APA A;  4NRM A;  5DAQ A;  2DDU A;  1TME 2;  5GZC A;  4I09 A;  5B4N A;  4QPI B;  2ILM A;  3B9I A;  5E6H A;  3VDA A;  3O1T A;  4M3C F;  1PNG A;  3ES1 A;  2YU2 A;  3NQH A;  3VBH B;  1QGL A;  1MVE A;  1ZZ9 A;  2WA3 A;  2D40 A;  5F6K A;  5I8T A;  1ULP A;  4H3W A;  1X36 A;  1J1L A;  2BYV E;  2Y60 A;  4KWK A;  5FBJ A;  4AI0 A;  3WY6 A;  4Y1Y A;  4QQP A;  2XL9 A;  2WWU A;  5LB6 A;  3T30 A;  4FPH A;  2HWC 3;  3H1M A;  4AGR A;  2RS1 1;  3BYW A;  2WSV A;  1VBD 1;  3RSJ A;  4GQ7 A;  5FP7 A;  2QQN A;  5J37 A;  2DVB A;  4XAC A;  4LA2 A;  3WF2 A;  1Q8V A;  2B42 B;  2VZU A;  4IE5 A;  4IEQ A;  5FZI A;  3ZN6 B;  3NW4 A;  4LLO A;  1UF2 C;  4XJU A;  2XKO A;  5FYT A;  3UET A;  1MZF A;  1NKG A;  2UYA A;  4COV A;  3T1L A;  3OEA A;  2WNU A;  3WUD A;  3RJ2 X;  1F9K A;  3KQR A;  2ZZQ A;  3TB0 A;  3VBF C;  1QH7 A;  3ZFG A;  2EIB A;  4IV1 A;  4DEQ A;  1KRI A;  1DIW A;  4WM8 C;  2E7Q A;  4KGG A;  2YZ4 A;  1O4Z A;  2R04 1;  3LPG A;  5KHK A;  2Y34 A;  4Z82 A;  2C1F A;  2HWE 2;  5FYI A;  4CP2 A;  5A1A A;  1HDK A;  5KHJ A;  1RHI 3;  4AHY A;  1R09 3;  1UY3 A;  3KGL A;  4MXW B;  4ZU7 A;  4S2G A;  1HRI 3;  5TSW A;  3BOW A;  3VKF C;  4ET7 A;  4CEY C;  3OJB A;  5A6Z A;  2RR1 1;  1JI6 A;  1OOP A;  2ZHL A;  2N7G A;  1BBT 1;  2EAK A;  1N3P A;  4Q4V 1;  4WVZ A;  4CUG A;  2HWD 1;  2F6B A;  3JD7 1;  1D0H A;  5FMB A;  5FYZ A;  4E27 A;  1PMI A;  3TEY A;  4HPK B;  3E5X A;  4J1X A;  1IS6 A;  4CDQ C;  4DY5 A;  4BDV B;  5FZA A;  3AM2 A;  3SQO A;  3HPN A;  1O8S A;  1H1A A;  1QIQ A;  1OXC A;  3AZZ A;  1MR5 A;  3KGZ A;  5FY9 A;  2O8O A;  3K4A A;  3MYX A;  4F8A A;  2G1M A;  1SPP A;  4J25 A;  5FMC A;  1UZY A;  4B8E A;  5L7O A;  2EXK A;  1YQ2 A;  4YW6 A;  3LIG A;  1D0G A;  1FMD 1;  5FYS A;  2WYF A;  5FXZ A;  3ZPO A;  3WCR A;  2MEV 3;  1OI6 A;  3KHB A;  4LUK A;  2RDR A;  1VBE 1;  2VBP A;  3I59 A;  2QDR A;  3TRS B;  1HRV 1;  2PHW A;  2VOW A;  2B7Y A;  1ST8 A;  1D2S A;  1WW4 A;  4IND A;  4XPV A;  3THD A;  1E5R A;  2W08 A;  2VUJ A;  3LE0 A;  3POF A;  4NWV A;  1XE7 A;  4PBO A;  5AVA A;  3TYJ A;  2V5Y A;  4D8M A;  5K8S A;  1HQL A;  1C8N A;  1LGC A;  1C28 A;  2Y0O A;  4IL7 A;  4RS5 B;  1DYK A;  1TVG A;  3POB A;  3JB4 C;  3DPR C;  2DVF A;  3PL0 A;  5HCB A;  2NYY A;  4Z8B A;  5AC9 3;  5C8C B;  1R08 2;  3I97 A;  4P9Y A;  4XUN A;  1V6M A;  1S1A A;  1MS9 A;  2ZEW A;  4V2V A;  4QXC A;  4GH4 B;  4IV3 B;  2WQZ C;  1NA1 C;  4IEP A;  2IFW A;  3GBW A;  1MEC 2;  4PIX A;  3WX5 A;  4QPI A;  1UYZ A;  4DY3 A;  1PGW 2;  3KCC A;  4IEX A;  1Z7S 3;  1OLQ A;  4LO6 B;  3U75 A;  2V09 A;  3AL5 A;  5J96 B;  3VBH A;  2WAA A;  1LOD A;  2ZAA A;  1RIN A;  1ULO A;  3H3L A;  3SC7 X;  3G6J B;  3WIN E;  5SV8 A;  3LZZ A;  1VBC 3;  4XZP A;  4FPO B;  1ZBA 2;  1YFX A;  3ZYJ B;  2Y64 A;  5IAT A;  2D5H A;  1WLC A;  1NUK A;  3WUC A;  3C3V A;  2P37 A;  3HNB M;  2GAL A;  4ZON A;  3T2Q A;  1LOA A;  4CEW C;  3IIA A;  1POV 0;  1DG6 A;  1RUG 2;  2JE8 A;  2R07 2;  4BQ4 A;  4IQP A;  5H9Q A;  1S0B A;  1H6Y A;  2QTW B;  4IUG A;  4MHU A;  3AP4 A;  5EQU A;  5K0U B;  4HFS A;  2PAK A;  3ZN6 A;  3O12 A;  2B46 X;  2K46 A;  5KR7 A;  2DFB A;  1YJK A;  1GZT A;  1QU0 A;  1J3Q A;  3GCW A;  1IOA A;  3FZ3 A;  4RGG A;  5GZD A;  4OLL A;  3SCH A;  5J48 A;  4MGT A;  5FZL A;  2ERF A;  5C33 A;  1DZQ A;  2GDF A;  2VY0 A;  3POJ A;  1A8M A;  3HN1 A;  1LEM A;  3FBM A;  1GZ9 A;  5FKB A;  4MXW A;  1K5M B;  3TAY A;  1CPM A;  2Z5W A;  4YM2 A;  4XIO A;  5J98 B;  1GYK A;  2W87 A;  5FP9 A;  1K45 A;  4OI4 A;  2W1S A;  4QX7 A;  2A6W A;  4QX1 A;  1C1L A;  1ZBE 1;  4MGS A;  1UOB A;  1PO1 3;  4MOA A;  2NZ9 A;  1FI2 A;  1HXS 3;  2EAL A;  1IG3 A;  3DL3 A;  4BXF A;  1AYN 2;  4O9G A;  4NHL A;  3VZN A;  1AJO A;  2B4K A;  3D82 A;  4HPK A;  4JTO A;  3PME A;  3U4S A;  2W3J A;  1PZ9 A;  3VKL A;  2WN3 A;  3T0D A;  4L92 A;  4CYD A;  5JUV A;  1US2 A;  4PIZ A;  1VPH A;  1APN A;  2OUJ A;  3APB A;  3HT1 A;  4A6O A;  2RVA A;  1GOG A;  4FPK A;  4QPW A;  1FPN 2;  2YRO A;  3NJZ A;  1SLI A;  1U5Y A;  5DN2 A;  3I3E A;  4CDU C;  4K9S A;  1FNY A;  3QD6 A;  4FAG A;  5DAW A;  3S57 A;  1JUH A;  1A34 A;  1DLL A;  1EV1 3;  5EIY B;  1Q8S A;  4QB1 A;  3IZO A;  2EVX A;  5HCH A;  4OUM A;  3AB0 A;  4RQP C;  4E8D A;  3SNM A;  2EIG A;  1V00 A;  2YXS A;  1OVS A;  3ZYR A;  2C4X A;  1CGP A;  1UYP A;  4AI3 A;  5BNQ A;  5JOW A;  2DFC A;  2IXJ A;  4IER A;  3H8X A;  1WCS A;  4KG8 A;  1PVC 3;  2J1S A;  2VMC A;  4AGG A;  4XQW A;  5D8A C;  4EWD A;  4R9D A;  1RJ7 A;  3WQ7 A;  1TE1 B;  2J7M A;  3PMS A;  4CCJ A;  4XZU G;  4XJZ A;  1HQN A;  1HN1 A;  5IVY A;  5FYC A;  3UGG A;  3AC0 A;  1LOF A;  4QDQ A;  5C8C A;  3O1R A;  2ZML A;  3TNQ A;  1VJ2 A;  4AED B;  3IWZ A;  4XQD A;  4GH4 A;  1BXH A;  4IV3 A;  2BFU S;  1YXW A;  3VDC A;  3C2U A;  5L73 A;  1CAU B;  4LQR A;  1J1T A;  4I0B A;  1Y9G A;  3KLS A;  5FY1 A;  4ZY9 A;  4GAL A;  4PHZ A;  4AI9 A;  4TLG A;  3LAG A;  2QKD A;  1MEC 1;  4PQQ A;  1Q43 A;  4TSV A;  2VGD A;  4L2N A;  2DBI A;  3MZH A;  2J1R A;  2XDV A;  4EWA A;  4DB5 A;  1V9U 1;  2JDA A;  3VBS C;  3W21 A;  4M0N A;  4IES A;  4GMP 3;  4D7Y A;  1YFU A;  1SAC A;  3ZN5 A;  2FCT A;  4C1W A;  1OFN A;  2VCB A;  2BVV A;  2W47 A;  3BAL A;  2EXI A;  4R4X A;  1ZBA 1;  1QH6 A;  4Q0V A;  2CGN A;  4TLF A;  5C5U A;  3WT3 A;  2TEP A;  2FDI A;  1YFW A;  3I7D A;  4JAA A;  4NRQ A;  2VZR A;  4F3J A;  1COV 2;  4E4Z A;  2B45 X;  1RUG 1;  1AR9 2;  3RGB A;  3WQ1 A;  3WF0 A;  3VUO A;  1EP0 A;  1NLS A;  2I2S A;  3T1M A;  3CNA A;  1C57 A;  3NVC A;  5T5P A;  2VMH A;  4OHV A;  3AFG A;  4CCE A;  1ZVF A;  3GM8 A;  2XBO 3;  5EHD A;  3WG1 A;  4IET A;  1O7F A;  4WV8 A;  5A32 B;  2BU9 A;  3NV1 A;  2ZAC A;  4XEZ A;  5FPV A;  2OQ7 A;  1K5M A;  1RMU 2;  1RVF 1;  4QQH A;  3SCF A;  1U0A A;  5L19 A;  1L7L A;  1RUI 2;  2F4L A;  2YY1 A;  4GWJ A;  1OHF A;  5F37 A;  2W39 A;  3FC0 A;  3VZM A;  3D8C A;  4G3Y C;  4XF9 A;  5KXC A;  1VRH 3;  3K4Z A;  3UGH A;  1BZW A;  1XOY A;  2ET1 A;  3NMB A;  3R4D B;  2A5Z A;  3EQE A;  1T2X A;  2WZR 2;  2RMU 1;  4RHV 2;  3PLQ A;  3RMY A;  3SCG A;  4X8P A;  2SLI A;  2CDP A;  2HWB 2;  3KT1 A;  3OYW B;  2D3R A;  5E89 A;  4YGE A;  3MID A;  3D6E A;  3VDD C;  1MPX A;  4NHK A;  2FMD A;  3TEW A;  2LTN A;  5FZD A;  1GQH A;  2D43 A;  2DUP A;  1CD3 G;  2JIJ A;  3KF5 A;  3MEP A;  3W20 A;  4K21 A;  4EZH A;  3OBR A;  5A3L A;  2JX9 A;  5LK5 A;  4ES9 A;  3KV5 A;  2PXJ A;  4Q4W 2;  1IPK A;  1QJX 2;  1FAT A;  1TG7 A;  3AKT A;  4AWD A;  4E4S A;  3O1M A;  1BEV 2;  2BVB A;  2ZKN A;  4JQT A;  5DUX A;  1FPN 1;  4XFF A;  1QJY 3;  2J1E A;  3AJZ A;  2VQ0 A;  2QUO A;  3I2F A;  2XHN A;  1LOC A;  1W2A X;  4QPG B;  4DUX A;  1JBC A;  4M00 A;  4W4Z A;  3EB7 A;  4YM1 A;  1VR3 A;  3FLR A;  4YZ4 A;  2R1D A;  5FFO C;  3RZZ A;  1RUC 1;  1L7R A;  5FYM A;  4CXW A;  3BTX A;  3I3Q A;  4N53 B;  1CJD A;  5KXB A;  1DQ1 A;  5A3U A;  2WFF 1;  3I2D A;  2GP5 A;  3NV4 A;  1OUX A;  1W6O B;  2WSU A;  4XIK A;  1XYN A;  1AR8 2;  2CWS A;  5FR3 A;  2QQM A;  4AVS A;  2R06 3;  1O3S A;  4MG2 A;  2V72 A;  4P9W A;  2H6C A;  1EAH 1;  2Z79 A;  1BVV A;  1ND2 B;  3KQ4 B;  5JZG B;  1RUN A;  3WW4 A;  2CU5 A;  4QQ2 A;  4AED A;  2VW0 A;  4RYD A;  1LU1 A;  5DZF A;  4DEV A;  3GDB A;  5BYN A;  1G7Y A;  2RM2 2;  3PUR A;  1JHN A;  1CAU A;  4KWU A;  5ABJ B;  5ACA 2;  1G9F A;  4D6Q A;  5IVV A;  4PCR A;  2GND A;  4F83 A;  3ZSJ A;  1SLT A;  4AVC A;  1AR7 3;  4DFS A;  1D4M 3;  1WW5 A;  2R6Q A;  2BNM A;  4K7J A;  1PNF A;  2W1U A;  5A7N A;  2HWF 2;  5FBZ A;  1UAI A;  3ZYG A;  3U0Z A;  1AXZ A;  2VBB A;  5FZB A;  4BE3 A;  5HBA A;  5IFP A;  2RS5 3;  5I0U A;  1NG0 A;  4COZ A;  3I54 A;  4HSL A;  1W05 A;  3FHA A;  1HKD A;  1W6M B;  2A3Y A;  5JXI A;  1QJE A;  5F8P A;  4EYU A;  4RR3 B;  4BLI A;  5K7P A;  1QNW A;  5IVC A;  1BMV 1;  5FY7 A;  3PUS A;  4AI2 A;  1AF9 A;  1OVP A;  5D1I A;  1UY4 A;  1HN0 A;  3ZM8 A;  5F2S A;  1ZRD A;  4P5Y A;  1O3T A;  4YW3 A;  3KMH A;  5JWP A;  1XE0 A;  2W46 A;  2XLF A;  1VMH A;  4QKF A;  3MIH A;  3OBT A;  4YAR A;  3LDR A;  1SG3 A;  1WLW A;  2VCC A;  1LGB A;  2P3J A;  2A6X A;  4JCK A;  4NRO A;  2CHH A;  3KF3 A;  2GSY A;  1JYX A;  3AFK A;  1W9W A;  1JN2 P;  1NCQ C;  3W58 A;  1PO2 2;  5F7U A;  2DCJ A;  1W6Q A;  2BZD A;  2KA3 A;  1S0D A;  1QOO A;  2BTV C;  2XOM A;  4W6Y A;  5FXW A;  5IVJ A;  3USU A;  3HMY A;  4XMI A;  2AYH A;  3OGJ A;  1ACC A;  4RHV 1;  1IPS A;  1AX2 A;  4Q1P A;  5A33 A;  2A3W A;  2HBU A;  1J3P A;  2RS1 3;  3RZK A;  1VBD 3;  1UPS A;  3N9N A;  1UMI A;  3HNY M;  1YHF A;  1ZZ6 A;  1QJZ A;  3PJY A;  4XUR A;  5FJH A;  3WQ0 A;  1PM7 A;  2HEW F;  2PA7 A;  3LCP A;  4KH9 A;  3WF3 A;  1LAJ A;  1WME A;  5CU1 A;  2O8Q A;  4A7Z A;  4BXS V;  5DPN A;  2ZHM A;  5LA2 A;  3JQX A;  3SH4 A;  4B1M A;  1UY1 A;  5C9A B;  1VMF A;  3O7O A;  4NJ4 A;  1LEN A;  3AXE A;  2R49 A;  2WS9 2;  4XFB A;  2JD9 A;  4QPG A;  2YBP A;  1UL9 A;  3T09 A;  3BB6 A;  3DYO A;  4OHX A;  5LBC A;  1JUI A;  1Q8P A;  1XYP A;  4A2U A;  1F4H A;  3JCI A;  4Z2A A;  3VD4 A;  5F1R A;  2Q4S A;  4BYY A;  3VZL A;  5FTT C;  3PVO A;  3RYP A;  3V0B B;  4M01 A;  3D4K A;  1W6O A;  1UNB A;  2JG8 B;  3RI8 A;  4EQV A;  4HVQ A;  1SFP A;  2JD4 A;  1UIK A;  2E53 A;  3NNM A;  2RR1 3;  1AYM 1;  3CU7 A;  3GHM A;  1BBT 3;  1RUE 2;  4E8C A;  4Q4V 3;  2A6Y A;  5JZG A;  1NE4 A;  2HWD 3;  1RUD 2;  1TNR A;  1ND2 A;  3I2K A;  3JD7 3;  3FFQ A;  1PIV 2;  4SLI A;  2WT1 A;  3RYK A;  4FPY A;  3T4V A;  4ITC A;  4LO8 A;  2R0F A;  4UYB A;  2YPD A;  4KU8 A;  4ZS2 A;  4P9J A;  3MIB A;  4OVE A;  3IMN A;  5ERL A;  2ZHN A;  4UBG A;  1W04 A;  5T5O A;  1YQC A;  2HJI A;  3O1U A;  1VB4 A;  2FHR A;  1LHN A;  5ACA 1;  3I8T A;  1AR6 2;  1OKO A;  1PVC 1;  5CFC B;  1ULD A;  3GNE A;  4N43 B;  1ZZ7 A;  1FMD 3;  1GP6 A;  2Q5T A;  4G9S B;  4PLO A;  2HWF 1;  4Q26 A;  2BRT A;  5FPX A;  4AL9 A;  5JXJ A;  2JJ6 A;  1W6M A;  1OF3 A;  1QF3 A;  2VOT A;  1VBE 3;  4RR3 A;  4BPZ A;  3HQR A;  3ZIX A;  4UFI A;  4MSV A;  3D5O A;  1HRV 3;  1VBB 2;  3RZH A;  3VKN A;  3J7H A;  3OPZ A;  5K9Y A;  2Y6L A;  3TN9 2;  5T54 A;  1QJU 1;  4QU2 A;  2ARB A;  4QXH A;  4C90 A;  5CA6 A;  3CEW A;  3T2T A;  5A3N A;  4K3U A;  3AMN A;  1X82 A;  4Q2F A;  3C7G A;  3ZKY A;  4W8J A;  1JU4 A;  3ZYH A;  3RZG A;  2QQW A;  4XYX A;  4LUM A;  2J42 A;  3M8L A;  3OD4 A;  4XFC A;  1B35 C;  1GR3 A;  4CDX B;  5BNN C;  4YRD A;  2G9G A;  4Y24 A;  3BKZ A;  2JDU A;  4IE4 A;  1MS0 A;  1RUF 1;  4LBJ A;  1NY7 2;  5LA9 A;  3U14 A;  1W8O A;  4AF9 A;  4DNY A;  4KQ7 A;  1DGR N;  2D6P A;  4S2D A;  2OS2 A;  4LK6 A;  1W9S A;  4CU8 A;  2WNE A;  1X7N A;  3CJI B;  4I02 A;  2QQI A;  3BI3 A;  3WCS A;  3E97 A;  5FO8 B;  4UFJ A;  4XIL A;  4QX5 A;  5H9S A;  3GGL A;  3UK9 A;  2XJT A;  1PO2 1;  4HT1 T;  2C5D A;  4OHW A;  2BGP A;  2I07 B;  2XG3 A;  3MIF A;  5JAX A;  4XDP A;  4E9K A;  3KS7 A;  5DAB A;  4AFD A;  3FHQ A;  3M3O A;  1NQJ A;  2OX0 A;  4DQA A;  1AZD A;  1C5I A;  3ATG A;  2XBO 1;  3NAP B;  3NST A;  5FPA A;  3BUC A;  4PJY A;  5FO9 B;  3POW A;  4MGZ E;  5H9R A;  4IGO A;  4JGY B;  3Q8E A;  1AJK A;  2DUQ A;  1VAK A;  3ZPY A;  3O14 A;  4N9I A;  1OOP C;  3VZK A;  4FAH A;  5JDB A;  3EBR A;  2A73 B;  4QWN A;  2A6V A;  2CAU A;  2VW1 A;  2YYO A;  1W9T A;  5C9A A;  2GN7 A;  3J8F 2;  1WUV A;  2E9Q A;  3AZV A;  1VRH 1;  4GB3 2;  4MGQ A;  5LRS A;  4Q4Y 1;  5LEJ A;  5C5T A;  5LY1 A;  1N3O A;  4PIY A;  4BK5 A;  4K8R B;  3AMP A;  5L9V A;  2GH8 A;  2IXI A;  4IEW A;  2VUA A;  5FZG A;  4YGC A;  1IKQ A;  2KXL A;  3N36 A;  4CU7 A;  1PK6 C;  4G4F A;  2B8M A;  2DBN A;  1KXG A;  2HH9 A;  2JG8 A;  3N7K A;  4DUW A;  1KD7 A;  3U4X A;  3M7A A;  4LOR A;  2YV8 A;  1YQ6 A;  1URX A;  4LA3 A;  1FX5 A;  1CAW B;  2GNB A;  5L7O C;  3ACF A;  2JDP A;  4DRR A;  1ZBE 3;  1CVN A;  1KFX L;  4AFA A;  1DCS A;  4XW3 A;  2QQU A;  3ACH A;  1UYY A;  1ND3 B;  1UPI A;  2PYT A;  3OBZ A;  3E5U A;  1XRU A;  2ZGK A;  4GAZ A;  3EMR A;  3H7J A;  4Q1R A;  4PDW C;  3WW3 A;  4NID A;  3V56 A;  2HKX A;  4RA0 A;  2HYK A;  5J09 A;  4A45 A;  3ZXE A;  2BEO A;  1XPW A;  3VBU C;  3IT8 A;  1FOD 1;  5CFC A;  5IW0 A;  1H1I A;  1UMZ A;  3WNM A;  2XML A;  3ZVX A;  5M0T A;  3RPQ A;  4HMZ A;  3HBK A;  4N43 A;  1AR6 1;  4NO4 A;  2JG9 B;  5FMO S;  4D69 A;  1JOD A;  1QJF A;  2D6K A;  1ULC A;  3IPV A;  4WVM A;  1QDC A;  3AYA A;  4AGV A;  4HET A;  4UT5 A;  4BIF A;  1YQ5 A;  2JDN A;  2ZA9 A;  1REE A;  4I01 A;  5G05 L;  1YEW A;  4JKM A;  5FYV A;  5J36 A;  2FZ2 A;  1H4G A;  2G9Z A;  3CJX A;  1BQP A;  1N1V A;  3ZXK A;  3RS6 A;  4XOG A;  2DV9 A;  2ZGO A;  3AVR A;  5CKN A;  5LBF A;  4Q27 A;  1CN1 A;  4I2O A;  1JMU B;  4LLF A;  2NPI A;  3VBO C;  3AP5 A;  1P8J A;  4H55 A;  4YPJ A;  3VHO A;  2ZAB A;  5JVV A;  3TN9 1;  4AYU A;  3IDA A;  4L8Q A;  4TN7 A;  1O6U A;  4I3P A;  4CDX A;  4DXZ A;  4PI2 A;  2RJ2 A;  3ZSM A;  2ZGL A;  1WKY A;  2ADD A;  5FUI A;  1QDO A;  4FBF A;  1H8T A;  1OLM E;  1DQ0 A;  4AE2 A;  3E5Q A;  2XB6 C;  4XFH A;  4FVV A;  3AKP A;  1QQP 2;  2I45 A;  1UZ0 A;  3K51 A;  4Z92 B;  3LA7 A;  2WT2 A;  3CJI A;  4DOU A;  5FCC A;  2BOJ A;  3HN3 A;  2PAM A;  2WNO A;  2Y8K A;  3BCW A;  1ZNP A;  1MEC 3;  1SLA A;  2D97 A;  4ZHN A;  1WD3 A;  3BGA A;  1OA2 A;  3KD4 A;  1V9U 3;  2AEZ A;  4EWE A;  2NLR A;  5J3U A;  4EZ4 A;  3OY8 B;  5HI0 A;  3E1F 1;  3GZT B;  4IE0 A;  1G9B A;  1GNY A;  4FFF A;  1NE6 A;  2QQK A;  1ZBA 3;  1J58 A;  2PLV 2;  2PMW B;  3NKT A;  4WM7 C;  5DDJ 1;  4JTN A;  3MV1 1;  3TNP B;  2OYZ A;  4EJR A;  5ANQ A;  1I1E A;  3W5N A;  1U5X A;  1RUG 3;  1V6J A;  2R07 3;  3L9J T;  4CDW C;  5IK5 A;  2VOX A;  3WNX A;  2K0G A;  4DO0 A;  2JE7 A;  3E6C C;  2EIE A;  2GAU A;  2DCY A;  1KFU L;  4E2G A;  1LCL A;  1H6X A;  4Q4X 2;  4FOQ A;  4DS0 A;  4FFI A;  1VAL A;  4B7E A;  1UU4 A;  5EPA A;  2RG4 A;  2JEC A;  3N9L A;  1UW8 A;  3AP7 A;  2QZ3 A;  3H1W A;  5IVB A;  4XDQ A;  2RHP A;  1RVF 3;  2R1B A;  2Z2S B;  5LEK A;  1UN1 A;  3POY A;  1W8N A;  5BNP C;  2YFU A;  1CAW A;  4FCA A;  4J1W A;  2K9Z A;  3LEG A;  2B39 A;  2WUH A;  4MZU A;  1GWL A;  5GKA C;  4IEO A;  4JV4 A;  3J4U H;  1R64 A;  4P9G A;  4A4A A;  1BKZ A;  3VGI A;  5HV0 A;  1ND3 A;  2RMU 3;  2JIG A;  4XF3 A;  2UY8 A;  2GNT A;  2ARC A;  1OUS A;  2XJV A;  3FMG A;  3H8U A;  2YC4 A;  3DV8 A;  3WZ1 A;  4GIQ A;  2VZP A;  3C7H A;  3AL6 A;  5I0S A;  3WG4 A;  5A7W B;  3MF9 A;  2VZQ A;  1UZZ A;  4P02 B;  5F5I A;  1NCR A;  1PVX A;  4COW A;  3IB3 A;  5IVE A;  2VEC A;  1R1A 2;  1O3Q A;  4BIO A;  2GC3 A;  1ZRR A;  2WNV A;  1KQR A;  1UMH A;  1GMM A;  3FFZ A;  4HXC A;  5FP4 A;  2WIN B;  2JG9 A;  1BK0 A;  1FPN 3;  1C8M 1;  1AL2 2;  1SBE A;  2XJR A;  3N3H A;  3WW2 A;  5HXM A;  1WMF A;  3C7O A;  4OHZ A;  4CZS A;  2CY6 A;  4OI0 A;  5C6C A;  1N1Y A;  2A3X A;  3DF0 A;  4XTM A;  4TWT A;  2J1V A;  3VHR A;  2QQL A;  4YG0 A;  3KVB A;  2LS6 A;  4P00 B;  4FPL A;  2JB4 A;  1RUC 3;  2X53 S;  2O0O A;  5EP9 A;  5FPU A;  3MFC A;  4GA9 A;  5JR7 B;  2ID4 A;  3RJR A;  2MNG A;  3ZSL A;  3WP4 A;  3H7Y A;  3VDB A;  1D7P M;  1T6B X;  2WFF 3;  3VD7 A;  3BVC A;  3ACG A;  4GKY A;  1OQ1 A;  3GAL A;  1W2O A;  3FJS A;  2VMG A;  4UXA A;  1JYI A;  4FTB A;  2RJK A;  1EAH 3;  4YVS B;  1DGW A;  4C1X A;  4M3C A;  3UKT A;  2OZJ A;  4E4D X;  1H9P A;  4Y20 B;  1OH4 A;  1XXN A;  2AH2 A;  5JI7 A;  2Q8C A;  1RUO A;  5L9R A;  4BLJ A;  1E5S A;  4RN5 A;  5A6X A;  2VNO A;  1RL3 A;  5A6Q A;  2EID A;  3SEP A;  4I0A A;  5I0R A;  5H9P A;  1LKN A;  2BJS A;  1LJ7 A;  4KWL A;  3MUY 1;  1C1F A;  3TOJ A;  3VHN A;  3WDV A;  1W9Y A;  1HQW A;  3AKQ A;  3IDC B;  4KMQ A;  3PNA A;  3O5S A;  2VUC A;  4MHR A;  4QKN A;  4UFK A;  3T3Y A;  1UOJ A;  3VZO A;  3WDX A;  1X50 A;  3OY8 A;  1V6I A;  5IJR A;  2XPJ A;  2ZGM A;  2PHD A;  1W6N B;  3M1H A;  3PTY A;  4P5H A;  3T4H B;  4S2F A;  4XAB A;  5LK7 B;  1VMJ A;  1OQD A;  2DCT A;  1WBF A;  2LRO A;  3F2Z A;  3HT2 A;  5EYX A;  3HVD A;  4IEV A;  4Y4R A;  3U10 A;  2G4I A;  3QOP A;  3MLJ A;  2HEV F;  2PLV 1;  3ZO0 B;  2WKK A;  5FWJ A;  1MZE A;  4A42 A;  1YI9 A;  1WCQ A;  2EF6 A;  1COV 3;  2VMF A;  4XHX A;  3M3C A;  3VBF B;  1OT5 A;  4FSJ A;  4Q8K A;  3K75 B;  2VUL A;  3OG2 A;  1CJP A;  3EJK A;  4EN7 B;  4RFR B;  1MQT C;  2WAB A;  4WM8 B;  1S0I A;  3BN6 A;  4AHX A;  1WMX A;  2ARE A;  1TME 1;  1SQ4 A;  4Q4X 1;  4XUP A;  1O4Y A;  5EXO A;  2WO1 A;  4B1L A;  3KV6 A;  4PI0 A;  4NVP A;  4BK4 A;  2W52 A;  3PVN A;  1UU6 A;  3M4F A;  4B4Q A;  2KM2 A;  1QKQ A;  3LEI A;  1SCS A;  4Q0Q A;  1KJL A;  4YLZ A;  1IZ3 A;  4YNI A;  4K20 A;  2DVA A;  5JSO A;  1H2K A;  2DTY A;  2MPF A;  1N1S A;  4BQW A;  1IKP A;  3III A;  4CCC A;  2Y0I A;  4FXK B;  4O65 A;  5FZH A;  2XVG A;  2ZOE B;  1T6G C;  5C3O A;  4GWM A;  3N35 A;  3ZDS A;  3FL7 A;  4CDQ B;  5I8S A;  2QZ2 A;  1DDL A;  1RXF A;  5A6Y A;  4RHV 3;  4KBB A;  3RZJ A;  3BOP A;  1S2B A;  2Y38 A;  2Q1F A;  3RWN A;  1NXD 1;  1QNY A;  1JZ4 A;  3IN9 A;  5I0D A;  3MO4 A;  3K48 A;  5F5Q A;  2JDM A;  3X29 B;  3JBG 2;  3E6B A;  3KV9 A;  4QAW A;  3T2P A;  4C0H A;  5DUW A;  1RC6 A;  4EN6 B;  3ILN A;  3A23 A;  4BQ1 A;  1BJQ A;  4JRL A;  1AXK A;  2FQP A;  2HWE 1;  4MLO A;  5GLW A;  2ZGT A;  4JGZ C;  2YHJ A;  1NQD A;  2EA7 A;  2E51 A;  2WLQ A;  3WD5 A;  4CP0 A;  4NMI A;  3Q8C A;  4PBP A;  3JUU A;  2F4P A;  1IQA A;  3LDK A;  1AXY A;  1G9C A;  3H0O A;  1DF0 A;  1WLT A;  2BFU L;  2GME A;  4K1Z A;  1ZRE A;  3DYP A;  1X8E A;  3UYJ A;  4BA6 A;  5CBL A;  2JWP A;  5C8W A;  3MGU A;  1SBD A;  3K3O A;  4FTE A;  2HWC 2;  4CCO A;  5FDB A;  1AYM 3;  3DPR B;  5DUU A;  5C3S A;  2Q8E A;  1WBL A;  4LT5 A;  1HB1 A;  2CGP A;  1TQ5 A;  2VTX J;  1GP5 A;  1U5I A;  3RFR A;  3T08 A;  1YRZ A;  3K3N A;  1JH5 A;  2ARX A;  1NA1 B;  4TTG A;  2RM2 3;  4YW4 A;  4B4R A;  4DXS A;  3JXS A;  5ACA 3;  4MET A;  1WLD A;  1DQ4 A;  5IK4 A;  2AZ5 A;  2BBV A;  4LJH A;  1PGL 2;  3QH6 A;  4PLM A;  1XNT A;  3RQ0 A;  1R09 2;  3ZDV A;  2FDG A;  1HRI 2;  3A7Q A;  3U07 A;  1W6N A;  2HWF 3;  5D21 A;  5FZC A;  4RS5 A;  2P5B A;  3CQO A;  3V65 A;  4Q29 A;  4CEW B;  2Q0A A;  1UXZ A;  5FPB A;  3K4D A;  2D93 A;  3A0K A;  1KDK A;  1JYN A;  1AVB A;  4LNV A;  1S55 A;  4O61 A;  5E1R A;  3NV3 A;  2J22 A;  4QX2 A;  3T0A A;  3VD3 A;  3OEB A;  3B00 A;  4HAN A;  1R08 1;  3RVH A;  1QJU 3;  4YM0 A;  1GV9 A;  3DCQ A;  1RJ8 A;  1YFY A;  4PLN A;  3N4M A;  5AVP A;  4A3Z A;  4D6R A;  2E32 A;  4DRV A;  2EXJ A;  3AX4 A;  3KB5 A;  1OD3 A;  1PGW 1;  3NV2 A;  3NNF A;  1RUF 3;  1JOB A;  4XBN A;  5KHH A;  3IBM A;  2Q8O A;  2P2K A;  5JXG A;  4FP2 A;  2MEV 2;  4M4R A;  2AC1 A;  2XON A;  4Z1V A;  2KD7 A;  2VQU A;  1X9P A;  2ZKL A;  1HLC A;  4ZPI A;  1GQP A;  5K0U A;  3WV6 A;  4QX3 A;  1GKB A;  4QMA A;  2R07 1;  1PO2 3;  2P6C A;  2UY9 A;  4O9E A;  2A70 A;  3ZYF A;  4AEK A;  4CDQ A;  4CP1 A;  4QPG C;  3VL8 A;  5JR2 A;  3NL1 A;  1A6C A;  3WNL A;  2BDR A;  2W1W A;  1IS4 A;  3SIT A;  1S0J A;  2IXC A;  1Z78 A;  2WZP P;  4KU7 A;  5C4W B;  3C7F A;  5BV6 A;  3MW2 A;  4CDU B;  4JQR A;  1OA3 A;  3OCP A;  3OTF A;  5FOB B;  3FE5 A;  4QQO A;  2C24 A;  4OUS A;  3WR0 A;  1GIC A;  3CF6 E;  3NWK A;  4JC1 A;  4RQP B;  1W3X A;  1JZ5 A;  1SDD B;  1EPW A;  1LOE A;  3ETP A;  1R1Z A;  1RUH 2;  3LOI A;  4N9H A;  4D3W A;  4Q4Y 3;  2AEY A;  2X5I C;  4AHW A;  1F2N A;  2Q1Z B;  3HBZ A;  3NO8 A;  4OUE A;  2AGS A;  4LHN A;  2QCS B;  4UI9 L;  4JZR A;  1ZYB A;  2JKX A;  2WT0 A;  1PHM A;  5D8A B;  1VBC 2;  1DGW X;  1MZ6 A;  2WWJ A;  2Q30 A;  3U11 A;  1AYN 1;  3UT0 A;  4IEY A;  1H2M A;  3ZIW A;  3W9A A;  1DHK B;  1NAE A;  2TNF A;  4FOW A;  4Q8L A;  2GH2 A;  2VTF A;  1H2N A;  1D2Q A;  2VD7 A;  2VQT A;  1ULE A;  2WYS A;  4HKO A;  1ODN A;  4NHM A;  2DUO A;  3MI8 A;  5LRR A;  3DGT A;  4UF0 B;  4YG3 A;  3M2M A;  4RR3 C;  4AEJ A;  2YDE A;  4S2H A;  1PIV 3;  4OHY A;  1BHG A;  2PHF A;  5CKM A;  2EIC A;  3J7N A;  4HOO A;  4QPY A;  4R52 A;  4IW3 A;  1S0C A;  4AQT A;  4XCB A;  5DMY A;  2VM9 A;  1FOD 3;  5GAL A;  3WG3 A;  5BNO C;  3VBS B;  4L99 A;  1V6N A;  1AR6 3;  1HIX A;  3I2J A;  3M70 A;  2E7T A;  1OMI A;  2OPK A;  5CG9 A;  1W0N A;  4CEW A;  1FXZ A;  1W99 A;  4AAP A;  5C7G A;  5CG8 A;  2BER A;  4Y33 A;  4L9B A;  1PO1 2;  4LOT A;  5CB7 A;  3HQU A;  2EAA A;  1HXS 2;  4YGB A;  4MGK E;  5G04 L;  1FAY A;  3QBQ A;  3CZU A;  2O1Q A;  2D6L X;  4LO5 B;  3T2O A;  3LA3 A;  4AAX A;  5F5A A;  5IAV A;  2CTV A;  4Y5Z 0;  3PUQ A;  4YFW A;  3OSD A;  5CYY A;  3NJX A;  5A7P A;  2YB7 A;  3AZY A;  3TN9 3;  4DUV A;  2ENR A;  5FK7 A;  1LEC A;  3UGF A;  4BQY A;  1YIF A;  5FLI A;  2WQ4 A;  2ZJC A;  4LE3 A;  3DXU A;  4PF1 A;  5CNA A;  1IS5 A;  3AYC A;  1JZ2 A;  4DPN A;  2XH6 A;  5FZ8 A;  5FY4 A;  2GP3 A;  3ZXD A;  4NE9 A;  2UYB A;  5BY5 A;  3OUJ A;  5LZ6 A;  3H50 A;  5KBF A;  5C9A C;  3BPS A;  4FT8 A;  3VKO A;  1WZX A;  3TEX A;  1COV 1;  1K3I A;  3G7D A;  3E6D A;  1AR9 1;  3NJV A;  4NRP A;  4FOY A;  5KXD A;  1XYO A;  4QB6 A;  1ASJ 2;  1W0O A;  5C4W A;  5A32 A;  3JQW A;  5DDJ 3;  1SLB A;  4LBM A;  4Y22 B;  3SLI A;  2ZHK A;  4CUB A;  3A4U A;  2Y6J A;  1A78 A;  2PHX A;  4DXT A;  3MF6 A;  2WZ8 A;  3KWV A;  4DXR A;  5FUP A;  5JSP A;  1YLL A;  3FN9 A;  2D6N A;  2QNK A;  3LEK A;  5KXE A;  1RMU 1;  3MPB A;  3QAC A;  2H6B A;  1PZ8 A;  1RUI 1;  3GJA A;  4TZD A;  2PN5 A;  1W2T A;  4W65 A;  1Y43 B;  1ZA4 A;  4PT6 A;  1CZV A;  4LBO A;  4C0B A;  4CU6 A;  5C70 A;  1F31 A;  1NYW A;  1O8P A;  2W0X A;  2W91 A;  3K77 A;  3OYW A;  3KVA A;  5D8A A;  4YVW C;  1H2L A;  5F39 A;  2ZX4 A;  4AFC A;  5C71 A;  2WZR 1;  1KS4 A;  2JDH A;  2JIC A;  1POV 3;  2VNR A;  2HWB 1;  4LKF A;  3ZFE B;  4M0H A;  2W5F A;  4HLT A;  4IE6 A;  3P1I A;  5A1F A;  3AMM A;  3HQX A;  4Z07 A;  4ASM B;  5FQ0 B;  3PIG A;  1B09 A;  3D0J A;  4P14 A;  3O1V A;  1LED A;  3HAG A;  1US3 A;  4UF0 A;  4CCK A;  4Q4W 1;  1JW6 A;  1QJX 1;  1HB3 A;  2P1B A;  2VME A;  1SFY A;  3J9S A;  3WLU A;  4OQ8 A;  1UKG A;  2F17 A;  3AZX A;  1BEV 1;  2OXB A;  5DQ0 A;  3GZU C;  3U37 A;  3I3B A;  3ZFF B;  4BM8 A;  3VBR C;  5A70 A;  1OA4 A;  1DLC A;  2PQS A;  2WO7 A;  4N90 A;  2VVE A;  3O1O A;  3VBS A;  2PQQ A;  2VZV A;  4N53 A;  4NHX A;  3SEE A;  1V0A A;  1V6L A;  4XC9 A;  1C8M 3;  1UOG A;  4QM8 A;  2UWA A;  2YBK A;  3GBF A;  4JDM A;  5FPZ A;  4BME A;  2XLG A;  1ZM1 A;  3QLQ A;  5FP3 A;  4LHS A;  1H8T C;  5CFD B;  3N7J A;  4AFB A;  1AR8 1;  1UO9 A;  3GXU A;  1N3Q A;  4ZXK A;  1J59 A;  1CIW A;  5FKC A;  3RI9 A;  1H30 A;  4BIS A;  4XQ4 A;  4F7Z A;  3C8X A;  2ZGR A;  4OQ9 A;  1Q56 A;  5ABJ A;  1VE0 A;  1QEX A;  4ISQ A;  2ZEX A;  4OUL A;  2E7A A;  1GNZ A;  2RM2 1;  4YW2 A;  1ENQ A;  2XWB B;  3MFA A;  3ZXG A;  1Q3E A;  1U12 A;  5FLJ A;  3USS A;  2W68 A;  3VD5 A;  2VAU A;  3UNP A;  2WII B;  1QY4 A;  4Y1X A;  4KGQ A;  1YIP A;  2VZ1 A;  4NIA A;  1QJY 2;  3I3D A;  1NCQ B;  2AEN A;  5FZM A;  1LB2 A;  4YW1 A;  1TMF 2;  2PHU A;  1OBN A;  2RDQ A;  3WNK A;  2WZE A;  3VHP A;  4LHK A;  4UAP A;  1GQG A;  4FOV A;  5DXD A;  3DYM A;  3WQB A;  2BBA A;  4Y26 A;  4ASK A;  1V70 A;  3GJB A;  3H42 B;  2A7A A;  4AHZ A;  2BGO A;  5JMC A;  4AVV A;  2I74 A;  1AL0 G;  3S5A A;  4XFI A;  4QGN A;  2YC0 A;  3O0X A;  3AVS A;  4Y22 A;  1KJR A;  3OPW A;  2R06 2;  3UES A;  3I4I A;  2PAE A;  3S6P A;  1AHS A;  1ASJ 1;  1L7Q A;  2CYF A;  2PFW A;  2PLV 3;  2X10 A;  5DG1 A;  3GYD A;  3ZOI A;  2ZEZ A;  4YW5 A;  3GZE A;  3DUI A;  3ES4 A;  2VU9 A;  5FXX A;  2E31 A;  4QDS A;  2D6M A;  1AR7 2;  2QFE A;  1D4M 2;  1YI7 A;  2WNU C;  1TME 3;  1G8W A;  3N9Q A;  5GM0 A;  4Q4X 3;  2XVK A;  3ZFG C;  4IV1 C;  1CR7 A;  2G19 A;  5FJK A;  3SIS A;  4HN0 A;  1NX9 A;  1NCR C;  1MS1 A;  3WOG A;  1CWP A;  2VG9 A;  3ZFE A;  4XBQ A;  4FO9 A;  4EN8 B;  2B9U A;  5FY5 A;  2P3Y A;  4BHP A;  2WNV C;  3H8R A;  2WBK A;  2VCA A;  3WVJ A;  5FQ0 A;  2ZGN A;  2NM1 A;  5FMO L;  2OZ6 A;  3MV0 1;  2FDF A;  3IDB B;  3MPP G;  4M3C E;  5GLU A;  5K4L A;  3HEI A;  1O91 A;  1JYW A;  1I6X A;  2JEN A;  3ZFF A;  2H0B A;  1IQD C;  1SBF A;  2W94 A;  1UCX A;  1LUL A;  3CMG A;  2WS9 1;  4C8D A;  2RS3 2;  3PIJ A;  4ATE A;  2KR2 A;  4XF0 A;  3OGG A;  2GN3 A;  1G9D A;  3V0B A;  3PUH A;  4XF4 A;  2HWE 3;  4UW3 A;  4QHZ A;  2WL1 A;  2GU9 A;  3NNG A;  5I0T A;  4Q5O A;  4Y1U A;  4L97 A;  2E63 A;  5FYB A;  5I91 A;  1WW7 A;  5CFD A;  1W2N A;  2L9L A;  3POS A;  4C91 A;  5JOZ A;  3AKR A;  1GBG A;  3D3A A;  5LA1 A;  2XVL A;  1RUE 1;  1JZ3 A;  1RUD 1;  1PIV 1;  4LXL A;  4ATF A;  5IVF A;  3MIC A;  4MGI E;  5FMD A;  4COU A;  3PTR B;  3BTY A;  2WR9 A;  2XGX A;  5FYY A;  4BQ3 A;  1YCI A;  3BU0 A;  5EV7 A;  1FV2 A;  1B35 B;  1VBD 2;  3INA A;  5BNN B;  2VE1 A;  4FTS A;  1PZ7 A;  3VN4 A;  3I2I A;  2ZGQ A;  4JVA A;  4AI8 A;  2JDK A;  3ETQ A;  2V73 A;  3CKH A;  4I30 A;  4BQ5 A;  4MGY E;  5GZE A;  2UU8 A;  3I49 A;  3H3Z A;  3MLL A;  1OUR A;  4N7U A;  2GNM A;  3WHU A;  4FPJ A;  3U1X A;  3FUQ A;  2DCK A;  3Q9O A;  4H7L A;  1ULF A;  4GWI A;  4KI5 M;  1TMF 1;  1NLR A;  2R04 2;  3MUZ 1;  1MS5 A;  2MHF A;  3OOX A;  4K8F A;  2XHK A;  1HJF A;  2LAL A;  3KCY A;  3LSD A;  3QCW A;  4QPI C;  1VBB 1;  5E88 A;  3AMH A;  4IEZ A;  4ERO A;  5LA0 A;  2W92 A;  1RTV A;  3VBH C;  4CCM A;  1RIT A;  2OQ6 A;  3OBA A;  4AQ6 A;  2RR1 2;  5A80 A;  1BBT 2;  2JKB A;  4E2S A;  3DKW A;  3JD7 2;  1OLR A;  3BPZ A;  1GZW B;  4FI9 A;  2HBT A;  1W2U A;  1R08 3;  2BWA A;  4XDO A;  1DP0 A;  3ZYI B;  1ALY A;  2A71 A;  4LEJ A;  1NY7 1;  3JB8 A;  3ORJ A;  2LM3 A;  1W3V A;  4AQ2 A;  3BIE A;  4YFZ A;  2WLP A;  1H8V A;  5EJ1 B;  4EN0 A;  1W8H A;  1UZV A;  3AKS A;  2NP0 A;  1SCR A;  3GHN A;  3I3M A;  2VNG A;  1PK6 B;  1S2E A;  1HB4 A;  1O59 A;  4Y5T A;  5I93 A;  3VV1 A;  5FZ1 A;  1FMD 2;  1VB2 A;  1XB9 A;  3CL1 A;  4NIG A;  1NOV A;  4FPG A;  3NAP A;  1AUY A;  1XE8 A;  1SLC A;  2XJU A;  3ACL A;  5L7O B;  4A41 A;  2QJV A;  4GWN A;  1OC1 A;  3N9O A;  4JGY A;  1VBE 2;  1D4V B;  1CIY A;  1O5L A;  4GMP 0;  1HRV 2;  1LTE A;  5GLT A;  4ORF A;  3SH5 A;  2XUM A;  1UKR A;  5F5C A;  2WDB A;  3DKQ A;  4PDW B;  1W9F A;  3ILF A;  1PX4 A;  4OCT A;  3GBG A;  3TWI A;  2DU0 A;  3AP6 A;  4JKK A;  1VBA 2;  3VBU B;  2JDZ A;  2YU1 A;  5IT6 A;  2C9A A;  3J8F 1;  4GB3 1;  5FWE A;  1I5P A;  2ATF A;  2OUH A;  3JZV A;  1LNS A;  4CXY A;  3CHX A;  1FYU A;  3JBG 3;  3IAP A;  1Z0H A;  2FBE A;  1OH3 A;  1POV 1;  4LIU A;  2YPJ A;  2IWG B;  2ZPX A;  4FFH A;  1EUU A;  2OT7 A;  1G6N A;  3AZW A;  5A3P A;  1HX6 A;  5T50 A;  1J83 A;  1H4H A;  5F6L B;  2H0V A;  4NHY A;  3FBY A;  2EXH A;  4YG6 A;  5FXV A;  2B9V A;  5IHR A;  5FP8 A;  2ARA A;  5FOJ B;  3W5M A;  1ODM A;  1RYY A;  2PHL A;  1G9A A;  3LWC A;  3CZJ A;  3CO2 A;  1AYN 3;  5E8A A;  3VBO B;  4XET A;  5CIR A;  1REF A;  2GC1 A;  4NAM A;  2TUN A;  3PUI A;  1UX7 A;  3ZXL A;  2V4A A;  1B35 A;  5BNN A;  1I5Z A;  3GF6 A;  3LD8 A;  2IUW A;  1ZRC A;  3D0S A;  1FNZ A;  1RUJ 2;  2C6S A;  4FQ4 A;  4CUA A;  5JPM B;  4OFG A;  1UXX X;  4RS5 C;  2BP6 A;  1MS4 A;  3LFI A;  3PUA A;  4R4Z A;  4YW7 A;  4QB2 A;  5LBB A;  2V5D A;  4UW5 A;  2K2S A;  1EY2 A;  3L2Y A;  1LOF C;  1YUD A;  5C8C C;  1OFS A;  4MXV A;  3POE A;  1CPN A;  1DYO A;  4AI1 A;  2Z4F A;  2OVU A;  2PHT A;  2UWB A;  4LHL A;  2GC2 A;  2QDN A;  3ZXF A;  4BQX A;  5IK8 A;  4GH4 C;  1YO8 A;  2IXH A;  1WCK A;  4IV3 C;  3ACI A;  2QQO A;  4ZS3 A;  1PMH X;  2ZTN A;  4ES8 A;  3LGR A;  5JCT A;  4DMI A;  2C26 A;  2VR4 A;  3POI A;  1Y9M A;  1UD1 A;  1YJL A;  4LBK A;  3P5B A;  1LHW A;  2BNN A;  5FZ7 A;  2ETE A;  3LEM A;  2RDN A;  1U5Z A;  4YM3 A;  3R4U A;  1JYC A;  4LKD A;  5JIU A;  5B2G B;  4LO7 A;  4R9B A;  4WM7 B;  3KT4 A;  4IE7 A;  1ZBE 2;  3B5L B;  4SBV A;  2NN8 A;  2VJX A;  3WEZ A;  2HLE A;  3WXP A;  2VVD A;  5ANN A;  4CDW B;  1H0B A;  1GZW A;  1GZC A;  5B4X A;  2QQJ A;  1JYV A;  1JS9 A;  4IGP A;  2GMP A;  5K0U C;  4LBQ B;  3ITQ A;  1O4T A;  4CPB A;  3RZM A;  4LOS A;  4NIH A;  1QQP 1;  2VCM A;  4GZ9 A;  5LAT A;  3H3U A;  4XXP A;  2BQP A;  3A21 A;  1GU3 A;  1PK6 A;  4DIQ A;  4XBL A;  3ZMO A;  3WDW A;  1GOH A;  4CCL A;  2BUK A;  4XFA A;  5JSR A;  5BNP B;  1KS5 A;  1K5M C;  1CAX B;  1ZRI A;  1K42 A;  5FZO B;  3ZKU A;  4GKX A;  1JTZ X;  1DBN A;  1UY2 A;  1X8M A;  1ENS A;  3B01 A;  5DAV A;  4BZ4 A;  5DG2 A;  1XSR A;  4OZO A;  4PQ9 A;  5GLV A;  3VKM A;  4E2Q A;  3AK0 A;  3AYE A;  4QT6 A;  4AR2 A;  1A3K A;  3ZYP A;  4PDW A;  3CBN A;  4XFG A;  1AR9 3;  5IYY A;  4HN1 A;  1YYN A;  3I2O A;  5FUN A;  2ES3 A;  1PMJ X;  3VBU A;  5FIX A;  2W2I A;  4UBH A;  5DAX A;  4AEM A;  2DWR A;  3KCX A;  5LY2 A;  3LPF A;  3VLB B;  4XE9 A;  1VBA 1;  4ASL A;  2NQY A;  4CXX A;  2A75 A;  3V64 A;  4CEY B;  2XKP A;  1RMU 3;  2AAC A;  1LES A;  1RUI 3;  1RXG A;  2R30 A;  1IS3 A;  2VPV A;  5EFU A;  4XUT A;  5FO7 B;  1IG0 A;  2E6V A;  3J26 N;  4QXK A;  4X6R B;  3J7L A;  3R4S A;  1RUH 3;  4WZC A;  3J7M A;  4XTP A;  2BPA 2;  4YZ5 A;  4W6W A;  2ZXQ A;  1V9U 2;  3TBD A;  2WZR 3;  3VB9 A;  3VBO A;  1W0P A;  2Y6K A;  5A7W A;  2PEL A;  1DQ2 A;  2HWB 3;  3ZXJ A;  1W6P B;  3B3Q E;  2RJL A;  1SZB A;  1E57 A;  2ZEY A;  3TEZ A;  2AUY A;  1CZT A;  2FDJ A;  3WP6 A;  2OPW A;  1XC6 A;  1J3R A;  1UY0 A;  1LGN A;  3ST7 A;  3UV9 A;  5BPX A;  1XNA A;  4YZ1 A;  2YG0 A;  5C3R A;  1LRH A;  1R1A 1;  1M4W A;  4Q4W 3;  1RUJ 1;  1QJX 3;  5FAX A;  4UFL A;  1Y3T A;  2JB8 A;  4CPB D;  3AMQ A;  2D6O X;  3ON7 A;  4N7I A;  1BEV 3;  1I3H A;  4AED C;  2WO3 A;  1AL2 1;  1ENR A;  5AFB A;  4LKS A;  4PF5 A;  4YGD A;  1HW5 A;  4WVW A;  4XUQ A;  3B7M A;  1TZO A;  3O1P A;  2VXJ A;  1LU2 A;  1DGL A;  1C5H A;  5LWB A;  4LUL A;  4QX0 A;  1ZZB A;  1RIR A;  1RVF 2;  4KNC A;  1QOT A;  4Y1V A;  4D7S A;  2DF7 A;  2P6H A;  1OLM A;  4QKB A;  2WFP A;  4ONU A;  1MVQ A;  1JXN A;  5HXV A;  4YZ2 A;  4Q0U A;  4LE4 A;  4WM7 A;  3ZLI A;  2ZGS A;  5JOX A;  5A3M A;  1V6O A;  3T0B A;  1AR8 3;  4YVS A;  4AVB A;  3RWK X;  1MZ5 A;  2GMM A;  3NNJ A;  4NPL A;  4W6X A;  4A7K A;  2RMU 2;  4CDW A;  3BTZ A;  1CQ9 A;  4Y20 A;  3AXD A;  3HWJ A;  1QXR A;  5CIS A;  4LBQ A;  1CES A;  1BMV 2;  3PHM A;  4I3G A;  1NT0 A;  3O0V A;  4NII A;  1MQT B;  4ARY A;  4XMA A;  1BCX A;  2XLA A;  1WA4 A;  1WMD A;  4RGA A;  5F3I A;  2BW8 A;  5FZ6 A;  2X09 A;  5T5J A;  4JX0 A;  1RHI 2;  3UL2 A;  3WW1 A;  5C4W C;  1VP6 A;  4A44 A;  5A3T A;  5BNP A;  4I0W B;  2WRA A;  4LBL A;  4D6S A;  1W8T A;  4XXA A;  1CAX A;  2CGO A;  2ZBJ A;  4KL1 A;  5I8Y A;  5FZO A;  3MW3 A;  4U2A A;  5EJZ B;  1O3R A;  4RFT 0;  1W28 A;  4P9I A;  3B69 A;  5CAZ A;  1RUC 2;  3OUI A;  5FZE A;  2X05 A;  3RMX A;  1M06 G;  1CX4 A;  3VBF A;  4FPF A;  1QXP A;  4MAD A;  1KEX A;  2WFF 2;  4XF1 A;  1F35 A;  1F5J A;  3BU7 A;  4IEU A;  1S0F A;  2Y6F A;  5FZF A;  4A3X A;  4WM8 A;  4JHT A;  3ALQ A;  1WW6 A;  3LKJ A;  3A22 A;  3SXW A;  1JOP A;  1W90 A;  4UW6 A;  5IWF A;  5F9T A;  2VH9 A;  1OF4 A;  5J7M A;  1EAH 2;  1Y9Q A;  1ASJ 3;  2E33 A;  4TXW A;  1GLH A;  2J1U A;  5JOY A;  2FDH A;  1ZX5 A;  3LFM A;  4NAO A;  4CEY A;  1VAV A;  1FV3 A;  4XJA A;  4JGZ B;  2WQ8 A;  4H2A A;  2FDK A;  3B9C A;  3R05 A;  4O7X A;  2DUR A;  2B5H A;  1F15 A;  3F95 A;  1JZ6 A;  3WSO A;  2ZZJ A;  4QHO A;  1EYB A;  3FLT A;  3WDY A;  2VVF A;  1KDM A;  4CRQ A;  3ME2 A;  1GP4 A;  5C3P A;  4YYO A;  2FZ1 A;  2IZW A;  2X29 A;  2CWM A;  4HK8 A;  2XJS A;  1NLQ A;  3WHT A;  3DXT A;  5E16 A;  1W6P A;  2QQP A;  1SMV A;  2VNV A;  2Y33 A;  4N53 C;  5FZK A;  5F32 A;  1J84 A;  1JU3 A;  4LMF A;  5A1L A;  4XVH A;  2RE9 A;  1XBF A;  5AC9 2;  5JI9 A;  5FRA A;  1ZZ8 A;  3MBW A;  4B29 A;  1UIJ A;  2V4V A;  3JBG 1;  4LBQ D;  1UWW A;  2UWC A;  3N7L A;  4XJ8 A;  1W8F A;  5FY0 A;  5A3W A;  3ZMN A;  2DVG A;  1UYX A;  4AG4 A;  5CEH A;  2BWC A;  3U78 A;  5JZG C;  3PU8 A;  1ND2 C;  4QGL A;  3WP5 A;  4AXO A;  2E26 A;  1OSG A;  1TEI A;  1Z7S 2;  4LIT A;  2YFZ A;  2OA2 A;  3DEM A;  3I2G A;  1MAC A;  2IVI B;  4EV0 A;  3FHI B;  2VO5 A;  4QX8 A;  5ABJ C;  2WS9 3;  2ADE A;  4HKW A;  2D3S A;  2O14 A;  2JEM A;  1VRB A;  2P3I A;  4JRA A;  4L0P A;  4P08 A;  2D44 A;  4QGM A;  4R9C A;  5F3E A;  1RB8 G;  1W8W A;  5CVR A;  4GJZ A;  5EJ3 A;  5LCW L;  1UQX A;  4RD7 A;  3RZL A;  1GWK A;  4ZU5 A;  4LIV A;  5FZ9 A;  2UUR A;  5DZG A;  3LF7 A;  3DPR A;  2CDO A;  5DAP A;  5JXH A;  2WAO A;  4MX3 A;  3ZR5 A;  4B7K A;  5JPN B;  5JIA A;  2HWC 1;  4LR4 A;  1XNC A;  3OPT A;  4Q0S A;  3NJY A;  2YUE A;  1RUE 3;  1W6Q B;  5FYU A;  1NA1 A;  1UOF A;  1RUD 3;  2JE9 A;  3RRD A;  4BWO A;  2P4E A;  5J1X A;  1W06 A;  2VL4 A;  5HCF A;  5GLZ A;  4KBZ A;  3USU B;  1MQT A;  1CAV B;  1QHD A;  2DCZ A;  3FWE A;  2OKX A;  1QXJ A;  2XJP A;  1DZR A;  1K12 A;  1VAM A;  1XNK A;  4JDO A;  4RGK A;  5A33 B;  1AX0 A;  1H1M A;  4GXL A;  4ZKT B;  5CKQ A;  4K40 A;  4XHB A;  1PGL 1;  3Q8F A;  2VZO A;  4CU9 A;  3WDT A;  1RHI 1;  1R09 1;  4NUB A;  1HRI 1;  1N47 A;  2QBX A;  1XU1 A;  2DVD A;  4LPL A;  2PTM A;  3IM0 A;  4OYU A;  4X8N A;  1TMF 3;  1Y7B A;  1C3H A;  4W50 A;  5CAD A;  5AFE A;  1OD5 A;  1VBB 3;  2IFR A;  1N1T A;  5LAS A;  2J1A A;  4ZZ8 A;  5L9B A;  1GSL A;  2VMI A;  4HK9 A;  3ZSE A;  5IFT A;  1H9W A;  2RDS A;  3IKW A;  4MUV A;  4HVR A;  1AYM 2;  3S7E A;  1QWR A;  2CL2 A;  3ZFE C;  4QQL A;  2ZGU A;  3CIH A;  2G9F A;  2OII A;  3K2O A;  3RG0 A;  3GZA A;  4CCD A;  1EV1 2;  3ZN4 A;  2XL7 A;  4JGZ A;  1GAN A;  1WWY A;  2XUE A;  3ROU A;  3LDB A;  3GCX A;  4X6Q B;  1QOS A;  2X5I B;  1HV0 A;  2Z69 A;  2FMY A;  2BGC A;  2MEV 1;  4HZF A;  3THT A;  2XR4 A;  3KT7 A;  1PVC 2;  2J1T A;  2XQX A;  3LQC A;  3UKV A;  3ZFF C;  4RSU A;  3VDD B;  1BVP 1;  4WVV A;  4HON A;  2BOI A;  4JDN A;  2FCU A;  3BOD A;  2HEY F;  3M3Q A;  4MV2 A;  5T5L A;  2XJQ A;  2Q8D A;  1SHW B;  3P6B A;  4D94 A;  2JG8 C;  2ZX2 A;  3DN7 A;  4ARX A;  4CP9 B;  3IMM A;  4CDU A;  3WF1 A;  3WP3 A;  1RGS A;  3B02 A;  5F3G A;  3ZSK A;  3IAQ A;  5F2W A;  3ZR6 A;  5AC9 1;  5CFD C;  2NMO A;  4RQP A;  1BYH A;  1QJU 2;  1W8U A;  1DGR A;  2IC1 A;  2VZ3 A;  3OGR A;  1STM A;  2P17 A;  4WBB A;  1UX6 A;  3RDI A;  1V6K A;  2R7E B;  2RV9 A;  2YBS A;  3ILR A;  3J8F 3;  1RUH 1;  4GB3 3;  3OGV A;  5FV3 A;  3JU9 A;  2TBV A;  4IDZ A;  3WG2 A;  1Z7S 1;  4HG6 B;  3N9M A;  2VTX A;  5BNO B;  1LOB A;  1LHO A;  2GC0 A;  2WWS A;  3ABZ A;  1DYP A;  1RUF 2;  2XQR A;  2ZGP A;  1Q5O A;  5LBE A;  2RS3 3;  5CFC C;  4ZXE A;  1VBC 1;  5T55 A;  4CCN A;  3B94 A;  3WDU A;  5FZ4 A;  4N43 C;  1GWM A;  3NRU A;  5HCA A;  3SHR A;  3AJY A;  4B4P A;  1S0E A;  5T52 A;  5A7O A;  5FZ3 A;  3EXU A;  4AZZ A;  2Y26 A;  3OGS A;  1VIW B;  4QXB A;  3PVB B;  2LRP A;  2WN2 A;  1BK1 A;  1CAV A;  1OQE A;  5A3O A;  2XBO 2;  5GJ6 A;  5BXX A;  2VXR A;  3K46 A;  3V0A B;  3URF A;  1CON A;  4IGQ A;  4AFM A;  3UKN A;  3MHZ A;  3R6S A;  1DQ6 A;  3I2H A;  5C3Q A;  2VOK A;  1AX1 A;  1VLN A;  4CDX C;  1S4C A;  3B93 A;  2YC2 A;  3UJQ A;  3OB8 A;  4BOW A;  5ISL A;  4J6G A;  3FLP A;  1VRH 2;  4LTA A;  5EZW A;  4A6S A;  4Q4Y 2;  4AVT A;  1JHJ A;  1GUI A;  2VW2 A;  4Q0P A;  5GZF A;  4NPM A;  1ZRF A;  2WC2 A;  5IUQ A;  1PO1 1;  3CJI C;  1XSQ A;  1KGY A;  2AR6 A;  2NMN A;  2QQV A;  4Y3O A;  1HXS 1;  5FY8 A;  3VD9 A;  4N8M A;  2IXL A;  3HJR A;  4QD2 A;  2R04 3;  3BTA A;  3BIW E;  5LW9 A;  5FLH A;  1EUT A;  4KWJ A;  4GJY A;  3M3I A;  1XNB A;  2IXK A;  5IAX A;  1MS3 A;  4Y5S A;  2W95 A;  4BU2 A;  5FYH A;  1IGO A;  1YC6 1;  2VUD A;  1O5U A;  2BNO A;  3NAP C;  4LKE A;  1XND A;  3SH3 A;  3P3N A;  5EYY A;  3N9P A;  4EE2 A;  4JGY C;  4K6B A;  3VZJ A;  1NZC A;  4B3N A;  3SKJ E;  4ISR A;  4NPR A;  2ZX3 A;  1EV1 1;  1I9R A;  3KV4 A;  1F5F A;  2X5I A;  3LB9 A;  4HSJ A;  3H1Y A;  2ZS6 B;  5SV5 A;  1SLL A;  1QQP 3;  1WCD J;  1RED A;  4AOC A;  1L3J A;  2D3P A;  1FOD 2;  4YVW B;  4MO3 M;  4UFH A;  4XJ9 A;  4Y1Z A;  5T3N A;  3LOB A;  5KHG A;  3VDD A;  3P3P A;  3LIH A;  4UWD A;  3PJQ A;  4D7T A;  5KHI A;  5A7Q A;  2ORZ A;  1YWK A;  2VZS A;  3ASI A;  2FD8 A;  4CP9 A;  1TNF A;  5JLV A;  3PVE A;  3IPV B;  1A8D A;  3NKG A;  4FQZ A;  2JXA A;  2CSG A;  4H7M A;  4WVM B;  4EN9 B;  5F3C A;  1YNA A;  2CAV A;  2VMD A;  5D2A A;  1BLZ A;  3SKV A;  3KM5 A;  5FZ0 A;  4XJW A;  4ZZ5 A;  3KHC A;  3DEC A;  4HKL A;  1JZ8 A;  1LHU A;  1ND3 C;  2C9K A;  1C4R A;  2LUW A;  4QHB A;  3VBR B;  1ULG A;  2P34 A;  2DYC A;  4YWA A;  3S0M A;  4JHZ A;  4COY A;  5BNO A;  4NWW A;  4UFM A;  1DU3 D;  4UOJ A;  1HJG A;  1VBA 3;  3WF4 A;  3M3E A;  2RS5 2;  4Y4Y A;  3THP A;  3ZX7 A;  4BH9 A;  2VOV A;  2P3K A;  1WGP A;  4M4P A;  4OI2 A;  4GMP 1;  4OZX A;  3H8O A;  1H8T B;  2JG9 C;  4QDR A;  1GOF A;  2OW4 A;  3QH7 A;  4FXG B;  4YZ3 A;  1PX3 A;  1OPO A;  4HL0 A;  2BV4 A;  3OF1 A;  1WA6 X;  2VQA A;  4QU1 A;  3IDE A;  4CTE A;  4D0Q A;  4BCU A;  2Y6H A;  3PU3 A;  1SFN A;  4LK7 A;  1XJA A;  2D7F A;  1FT9 A;  4HBN A;  4OMC A;  5DUV A;  5JMO A;  4V1P A;  3V0A A;  1GFF 2;  4LBN A;  5DDJ 2;  4DIN B;  2ZX1 A;  4CVU A;  1W8Z A;  1K5J A;  2IVJ A;  4AVA A;  1R1A 3;  5CZK A;  3ZXA C;  2YMZ A;  2Q1M A;  3MDP A;  4CSW A;  2A6Z A;  1RUJ 3;  1S0G A;  4UW4 A;  1OPM A;  4WZF A;  3WNP A;  3HIF A;  5DZE A;  1AL2 3;  1XQN A;  1CZS A;  1LHV A;  3OD0 A;  3Q8B A;  2C0Z A;  4URT A;  4LO4 B;  4NN0 A;  4XAA A;  2LW8 A;  2ZMN A;  4H14 A;  4YSF A;  4URA A;  5KC5 A;  3MIG A;  4ZU4 A;  3RNS A;  4MYE A;  3R0R A;  3VL9 A;  4A7Y A;  3AP9 A;  4MVT A;  1LOG A;  2QVS B;  3FUO A;  3W59 A;  1SEF A;  3O0W A;  3SMH A;  5KC6 A;  3HR9 A;  1CX1 A;  2XWJ B;  2D98 A;  2W1Q A;  3ZYB A;  4XAE A;  1NXM A;  2RS1 2;  3HNM A;  4QM9 A;  2A1X A;  3AYD A;  1UU5 A;  4E4H A;  5FPL A;  5BUV A;  1NZI A;  4XCA A;  2ZAH A;  2WA4 A;  5A7S A;  3O1S A;  3WNN A;  4OI1 A;  2R0H A;  3FX3 A;  3KSC A;  2W9X A;  4QKD A;  1NCQ A;  4NOT A;  5KWR A;  1WCU A;  2X8K A;  3HOB A;  4K1Y A;  4FPE A;  2GZW A;  1QJY 1;  3C7E A;  1ONA A;  2XXZ A;  4CE8 A;  1X9T A;  2HYX A;  2WNU B;  3S7I A;  5FRE A;  4R8H A;  2VBD A;  4P9X A;  4YVW A;  3THC A;  1PGS A;  4TYS A;  4IV1 B;  3ZFG B;  4BQ2 A;  1UZW A;  2ZCW A;  2JDY A;  2CNA A;  4U36 A;  1NCR B;  4V2W A;  3WNO A;  2D5F A;  2ORX A;  3EYP A;  1DZT A;  1C8M 2;  1X33 A;  4FFG A;  2WNV B;  4FP3 A;  1E5I A;  1KIT A;  5GZG A;  1LR5 A;  2ZX0 A;  1E5H A;  1POQ A;  1W39 A;  4Q4V 2;  1IPJ A;  2CV6 A;  2HWD 2;  3NNL A;  3H9A A;  4R9A A;  3A0N A;  4BMB A;  1OOP B;  3KZ4 C;  2R06 1;  1QMJ A;  3N7M A;  1DQ5 A;  2ET7 A;  3L2H A;  4KG0 A;  1Q8Q A;  4HVO A;  2R32 A;  1DFQ A;  3LA2 A;  3CDZ B;  3VBR A;  4AK3 A;  3MLK A;  4L11 A;  1SDW A;  3EO6 A;  2PHR A; 
#chains in the Genus database with same CATH homology
 1OUX A;  2JDY A;  2BP6 A;  2CHH A;  1GZT A;  5A6Z A;  1UQX A;  2WR9 A;  2VNV A;  4AOC A;  5A6X A;  5A6Y A;  5A6Q A;  3ZDV A;  2JDK A;  5A3O A;  5A70 A;  1W8F A;  2JDM A;  1OVP A;  1OUS A;  2JDP A;  2XR4 A;  2WRA A;  4UT5 A;  2JDN A;  2VUC A;  2JDU A;  1OUR A;  2BOJ A;  2JDH A;  1OXC A;  2VUD A;  5HCH A;  1W8H A;  1UZV A;  4CE8 A;  2BOI A;  2BV4 A;  5D2A A;  1OVS A;  3DCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...