4CE8A

Perdeuterated pseudomonas aeruginosa lectin ii complex with hydrogenated l-fucose and calcium
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Perdeuterated Pseudomonas Aeruginosa Lectin II Complex with Hydrogenated L Fucose and Calcium
rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 4ce8A00
1OURA 2VUCA 2BP6A 5A6XA 2JDYA 2WRAA 2VNVA 2WR9A 5A6QA 1OUXA 2JDPA 2JDMA 1OVSA 5A70A 5A6YA 1UQXA 2JDKA 1OXCA 2BOJA 2BV4A 3DCQA 5A3OA 5A6ZA 2JDUA 5HCHA 1UZVA 2VUDA 2JDNA 2BOIA 1W8FA 4CE8A 2JDHA 3ZDVA 4UT5A 1GZTA 1OUSA 1W8HA 2CHHA 2XR4A 4AOCA 1OVPA 5D2AA
chains in the Genus database with same CATH superfamily
2WBKA 4V2VA 2YMZA 3V65A 1PGL2 3KCCA 3VBHC 4CU8A 1X36A 3VBSC 2RM22 1XYOA 3IBMA 1MQTA 2WWSA 5FP3A 5FK7A 2D3SA 3O1TA 3E6CC 3E1F1 4CDUB 3HJRA 3EXUA 5CKMA 3WCRA 3VGIA 1HN0A 1YQCA 4FXGB 4LBOA 3IDCB 4NN0A 3T30A 3ZSLA 5LW9A 3PVOA 3POJA 2Z69A 3CKHA 4OI1A 4NIHA 4D3WA 3TEXA 5IVJA 2L9LA 2JDAA 3ALQA 4CZSA 4LO5B 3W59A 5A1FA 4FTBA 2E6VA 4XJWA 4F8AA 2ARBA 3RZZA 3RZMA 4UI9L 5LBCA 5KR7A 4GWIA 5JMCA 4NVPA 2C4XA 1QIQA 2ZCWA 4CU7A 4JAAA 2Y33A 4JGZC 1Z78A 4JVAA 4F7ZA 1GNYA 3VBUA 4QKNA 2BWAA 1QJY2 4COZA 4YGEA 1VBE2 2SLIA 3PUAA 5EHDA 3ZFEC 3NJZA 2OPWA 3RVHA 5C3OA 3VBOA 4B4PA 2VCBA 3AKTA 1ZZCA 3THPA 5JUVA 1BKZA 4I09A 4L0PA 3TB0A 4I3PA 1XU2A 3A7QA 3PTRB 1JOBA 2FMYA 2BOJA 1ZZ6A 5DPNA 5F39A 4AAPA 1G9AA 2BVVA 3B9IA 2R071 4ZXEA 5DAXA 2VUDA 4NAOA 5BNNA 4O9EA 2PLV2 5C9AC 2GNBA 2VECA 5CFCB 2TNFA 4CDXC 3O1RA 3BVCA 1VBB2 3I97A 2CYFA 2W1QA 1S0JA 1RJ8A 4CTEA 3VKNA 2B5HA 3VBRA 2XLFA 1BYHA 2P37A 4LR4A 4NIAA 2Q8CA 5C3PA 2AEYA 5DG1A 1H1IA 5KXCA 3RI9A 2ZXQA 1E5RA 3BGAA 2ZGOA 1XBFA 3AMHA 4AI1A 5JOYA 2RS11 3OB8A 4I0AA 2WNVB 2WL1A 3ETQA 5FZDA 4BDVB 5GZGA 1I6XA 4GALA 3O1PA 5AC93 1JHNA 2VC9A 3H1WA 5ANQA 4CCDA 2X10A 4LKDA 1NZIA 4OI2A 3AZXA 2OA2A 3KV5A 4AVAA 3WQ1A 4CDQA 2LALA 3M70A 2CAUA 1JU3A 2C9AA 1YYNA 1RUE1 4IV3C 1V00A 4NIGA 2DBNA 5A7QA 3AL5A 1QEXA 1DLCA 2P3IA 2XONA 1EAH3 4BQ3A 3BTYA 4MXWA 1RHI2 2NLRA 3ZO0B 3LDBA 3PUIA 4LLFA 1TMF1 1WZXA 3E5UA 3T0BA 1ENQA 2G19A 4LORA 4PIYA 3V0AA 4HSLA 3IB3A 1PO22 4P00B 3WG1A 4EZ4A 4J25A 5ANNA 4QGLA 2XLGA 3ACHA 3HT2A 3M1HA 1FX5A 5IATA 5JSOA 1OUSA 1Y3TA 5ERLA 4P14A 1MACA 2K9ZA 3WQ0A 3T4HB 2H0BA 1DZRA 3THTA 1POV1 5J1XA 1UMZA 4XF1A 1K5MC 1XE7A 2WNUB 2EVXA 2VXJA 2ZAAA 1B09A 1AR82 4LE4A 5EQUA 5K7PA 2G9GA 2PA7A 1AX1A 2OUHA 2VZUA 5FYTA 3SMHA 3AP5A 4AFDA 3IMMA 4LK6A 4KBBA 1QDOA 5FYMA 1SDWA 1ZZ7A 5FWEA 4BPZA 3ZSKA 4YZ3A 2XXZA 2WSUA 4AEJA 4E8DA 4YW7A 5FJHA 5FV3A 4CCJA 4XJZA 4UW3A 2H6CA 2YG0A 5F32A 4XUTA 2XJQA 1UPSA 2QQIA 4UF0A 4X8NA 4NR1A 2Y6KA 4NO4A 1HRI1 3PU8A 2Y6LA 3AM2A 5ACA2 5FZIA 3C3VA 1XSQA 1O4ZA 3ZXGA 1QOTA 3DXUA 4I0WB 1H8VA 5JMOA 1QXPA 1CIWA 1W6NB 3DPRB 4LO7A 5CVRA 5KXEA 2BZDA 2NN8A 2VOWA 2Y6FA 3U37A 1GP4A 1PIV2 1YIPA 2ZOEB 3ACLA 3GBWA 3MW2A 1V6JA 1VMHA 4XJUA 5A7WB 2A75A 4XJ9A 1UY4A 3INAA 2Y34A 3D5OA 4AK3A 2QQPA 1O3TA 2ET1A 5B4XA 1YHFA 2Q8EA 2BV4A 3J7LA 4INDA 4XILA 5B2GB 2QUOA 2ILMA 3OBZA 2VNRA 3I49A 2IFWA 3SH4A 2XH6A 1RUI1 3O1UA 1NA1B 1PVC3 1S2EA 3U4SA 2RS32 3R05A 4A6SA 3U07A 1WLWA 5LZ6A 1JYXA 1G9BA 1KGYA 4TTGA 3VBSB 1F2NA 4EN8B 5FBJA 3PJQA 4P9WA 5AFBA 3RFRA 1WA4A 1XOYA 5HXVA 3B00A 5HPOA 4CDUA 2IUWA 4R52A 4F3JA 1VBD2 3AMQA 5IHRA 3UGHA 1QF3A 1RUF1 3T2PA 5ABJC 4AQ6A 4I0BA 3FUOA 4C0HA 1YUDA 2ZGMA 1AJKA 5FPUA 1MZ5A 3AVRA 1YFXA 3X29B 1LR5A 1POQA 3N7MA 4J1XA 1S55A 1Y9QA 1AYM2 4JGZB 1MZ6A 1QJU2 2Q0AA 2EF6A 4BIOA 5IFTA 4P5YA 1COV2 1HV0A 1AYN2 4AWDA 5J36A 2NMNA 1D0HA 1VMJA 1W9TA 1OH4A 5LA0A 3J9SA 1GFF2 1IS4A 1J84A 4UFJA 3LFIA 2Y0OA 1CZTA 1DFQA 2XHNA 4NROA 1S4CA 2VW1A 1YQ2A 2HWC2 3DECA 5GALA 4QDSA 4LQRA 4YVWC 2FZ2A 1W8NA 3ILNA 3E6DA 4AHYA 1W8WA 3I2IA 2MEV3 2DWRA 2VCCA 1DYKA 4CU6A 1LU2A 1TNFA 1RUG1 5CFCA 2LUWA 4AI0A 5J98B 2IXJA 5FY1A 1GBGA 2ZHMA 3O0WA 3LKJA 1N47A 4URTA 1AR91 1AJOA 1NY72 2A70A 4AGRA 5A1LA 2WS92 3K51A 1OQEA 4JKKA 3B9CA 2EIBA 4KWKA 1OLME 4DY3A 3WINE 1FPN1 5FYHA 3FZ3A 1VR3A 1QY4A 3K46A 4YZ4A 5F3CA 2W46A 5JPMB 5BNPB 4TZDA 2P6HA 3NO8A 4P02B 1OKOA 4IV1C 4TLGA 4B1MA 3U14A 3HQRA 4XMIA 5EJ1B 3K4AA 1WCQA 1H6YA 2WNVA 5DN2A 1XE8A 4YM2A 3UL2A 2B7YA 4PF5A 4GH4A 1ENRA 4PI0A 1HXS1 1ZM1A 1UKRA 2V09A 4NJ4A 1RUH1 4XURA 5TSWA 2VUJA 3VD3A 2ZJCA 4MADA 3OUHA 2MPFA 4CPBD 1JBCA 2VW2A 2Y60A 3BB6A 3D8CA 4AR2A 5JOXA 3UKVA 3ZDSA 4UFIA 4XZUG 4W8JA 1PNGA 5KHGA 1GICA 5BXXA 3SNMA 1CJPA 4CEYB 1SFPA 3NV3A 1PZ7A 4Z82A 2W68A 1Q3EA 1WW4A 2VTXA 1MQTC 1BBT1 1VAMA 1A78A 5FXVA 5IK5A 2XG3A 1EP0A 4NRPA 2A6WA 5KC5A 3GF6A 2HWD2 3FHQA 1GWMA 4DXRA 3ZMNA 3BU0A 2V5YA 2VMFA 4CYDA 4GKXA 1YCIA 2E63A 1U0AA 3R4SA 1G86A 1NQJA 2WNUA 4QU1A 3A21A 2XQRA 4RHV3 4CRQA 1VPHA 2X8KA 4MGZE 1W6MA 3ZXEA 1GP6A 4NHXA 1FXZA 2OX0A 2W1UA 4Y22B 3IMNA 3VBUC 1N3PA 1FMD1 5F8PA 3B01A 4AL9A 5F2SA 1PO13 2RVAA 1R081 5GZCA 5FP4A 2QQLA 2WZPP 1RUD1 4QHOA 3VBOC 2BNNA 5E16A 4CCKA 2UY8A 3VL8A 5FY8A 2VMCA 2ZPXA 5J7MA 1QOSA 3NL1A 2J22A 4Q4X2 1ZREA 3Q8BA 5JOZA 2CDOA 4H14A 4R9CA 2HYXA 2WO1A 1HRV1 2W39A 3G7DA 3MPBA 4FBFA 5JAXA 3ZYRA 4PDWB 1R1A3 3DPRA 4QX1A 1G9FA 5BNNC 1DZQA 1EV13 3POGA 1R092 4HLTA 1ULPA 5A3TA 3ZSMA 3PU3A 1Q8SA 5F5IA 4MUVA 4WVMB 3WZ1A 2GH8A 4JHZA 4PJYA 2VNVA 4NMIA 5A7WA 4P08A 4LTAA 2W92A 3OGJA 4Q27A 4K20A 1JOJA 4QX0A 3WW3A 2O14A 2QVSB 1GOGA 2VBPA 3VKFC 1KRIA 3TNPB 2YY1A 3EB7A 3J8F3 3OGVA 4OZOA 2IC1A 4JRLA 3DYMA 1AL22 3OPZA 4HKLA 1XPWA 3WDVA 1BQPA 1J58A 3TYJA 1ASJ2 4XZPA 4ATFA 4OQ9A 1GQPA 2A3WA 2VVEA 5IW0A 4ET7A 5D2AA 5DUVA 1S2BA 1IZ3A 1Z7S3 1BHGA 1MS1A 1V6IA 2WYFA 3D3AA 1SG3A 4WZFA 2WFF3 2B42B 4CDQC 1ODNA 3HBKA 3V0BB 4DUWA 1YO8A 3EHKA 3F95A 3ZFGC 5B4NA 2KA3A 5I0DA 2ZA9A 2AGSA 4KQ7A 4X6QB 3RI8A 1REEA 3RRDA 4EWEA 3EO6A 3AYEA 5EYYA 3RYPA 1VAKA 1AR71 3NMBA 1GOHA 4MH0E 4JGZA 4PIZA 2ZGKA 4NUBA 2AENA 4ZY9A 3SEPA 1XQNA 1H2NA 1L7RA 2D5HA 1I1EA 1HB3A 4LKFA 1LGBA 2XVGA 3LGRA 4DZGA 4YZ2A 1V6OA 2UWAA 1HQLA 3DV8A 4QPYA 2GDFA 2OW4A 3BIWE 2P4EA 2FZ1A 2RM23 2XJUA 3O5SA 1AX0A 1OBNA 3OEBA 3K4ZA 5CFDB 3L9JT 3K4DA 1NYWA 3OD4A 1ZVFA 2Z42A 5EJ3A 4KG0A 1ULDA 2JWPA 2VMHA 2QE3A 2RS52 5FFOC 1OSGA 1H0BA 3SH3A 2ATFA 2V73A 1JUIA 1F9KA 3N36A 4AFCA 2O1QA 3QBQA 3I2DA 4FVVA 1V9U1 2BOIA 4LO6B 3ZYJB 3WD5A 1G7YA 2RMU1 1QJY3 3RZJA 3POBA 4LHKA 2FMDA 1LOFA 4QM8A 1OLRA 3PURA 2VPVA 1JU4A 1REFA 2XDVA 4XTPA 1QXJA 4HG6B 4ASLA 2ZHLA 3ECQA 2GZWA 5FZ0A 2DVFA 4SLIA 5F5CA 1UYXA 4HSJA 1APNA 5BNPA 2ZZQA 5LRRA 1PM7A 4FQ4A 1QJX2 3ACFA 1RUOA 3C7GA 1RMU1 1VBA2 1ZBA1 2WWUA 4QPIB 4CA9A 2Y38A 1F31A 1EYBA 4YYOA 1JMUB 3UNPA 2CGPA 2JE8A 2PLV3 4LUKA 3C7FA 4RFT0 5FPLA 2BYVE 3O0VA 1LRHA 1RIRA 1VBB3 4I2OA 2XR4A 1ZBE3 5KHJA 3KM5A 3NNJA 4CPBA 1OOPC 1WD3A 4NHKA 4QPGB 1WMXA 2VUCA 4QPWA 3MUY1 5L36A 2QZ2A 1ENSA 2JICA 1UU5A 2YGLA 3U4XA 2X5IC 2I07B 4IQPA 4CEYA 5K8SA 1CAUA 3FN9A 4ONUA 3ZN5A 3VD4A 2VBBA 3CO2A 4FFFA 4R4XA 2D43A 4XDOA 1ZNPA 5D1IA 4IEVA 5JCTA 5FZOA 4Q0PA 4CDUC 1ZRFA 4ZU5A 3U1XA 3S5AA 4ZU7A 1WA6X 2ZKNA 2YPDA 3QH7A 4FOWA 3I3EA 1DQ0A 2W1SA 3D82A 4CE8A 1GZTA 1X33A 4IE4A 1I5PA 5SV8A 2P3YA 3ZR6A 1PGW1 3JCIA 4AI9A 4BQ2A 4JCKA 3UV9A 3VBUB 4QB1A 4E8CA 5J37A 3UETA 4ITCA 4Y22A 1EUUA 5LA2A 1RHI3 2V4VA 1QH6A 3NWKA 4Q0SA 1X9PA 1GNHA 3FX3A 3LAGA 4ORFA 3AKSA 1KFXL 4XACA 5FY4A 3T1MA 1GQGA 1WMDA 3LA7A 4EZHA 4FCAA 2B9VA 4XQ4A 1SBDA 1XYNA 4DEVA 1DGRN 2ZEYA 4WM8B 4RS5C 2VD7A 2HWE1 3I2FA 2CTVA 3B3QE 4PDWA 1FOD3 2HWB1 4KWUA 4DO0A 3UESA 4N43A 4J6GA 4BQWA 5C3QA 5L7OB 4K7JA 1AR83 1NG0A 4FPOB 4K21A 5JR2A 5LK7B 4LPLA 2J42A 1XE0A 2DVGA 2R072 2VMEA 3NNGA 4J1WA 3U75A 1MEC1 5IAVA 2HWF1 3WT3A 1X8EA 3OYWB 1UIKA 4W6WA 2BGCA 4IERA 4CP9B 3BI3A 2YBPA 5CA6A 3C7EA 1VRH3 2DVDA 1HQWA 4NOTA 1MVEA 5J09A 3I7DA 3I54A 1SACA 2WZR1 2UURA 2YFUA 5FY9A 1O8SA 3LFMA 1TE1B 3GBFA 4JQTA 4UBGA 2FCTA 3OEAA 1J3QA 1VRBA 2WNVC 4BHPA 3W20A 5LBFA 2JEMA 3CZJA 4IUGA 3POIA 5LBBA 1IPJA 4BLJA 4GH4C 1ULEA 3J4UH 3P1IA 1DQ2A 3ZFGB 2RS12 3MFAA 5C3RA 4MHUA 1U5ZA 2Z4FA 3WLUA 3V0BA 2LW8A 1UYYA 3VD5A 2ZGNA 1MS9A 1N3OA 3FL7A 4RHV2 3ZXLA 4AFAA 3USUA 2LRPA 3HWJA 3OBTA 5A7PA 4XCAA 2QTWB 4BQYA 4FPGA 4XPVA 4AVTA 1IS3A 1PNFA 1PO12 2E7QA 2WINB 4FPKA 5IFPA 3V0AB 5FJKA 2D7FA 3WUCA 2XL9A 3MI8A 2RS33 4PLNA 1CAXB 2X53S 2IVIB 3T3YA 3VKOA 2BRTA 2PHXA 4AHZA 2QFEA 2ENRA 3POYA 2JECA 1CAVB 4OZXA 2BFUL 4MXVA 3WHUA 4DS0A 1DGLA 4DFSA 4A3ZA 3BOPA 1TMF2 2WWJA 5JOWA 5GZEA 1UKGA 1OLMA 4IESA 4WV8A 3HNYM 3B02A 3N7KA 3O7OA 3WDUA 5FY7A 5FIXA 1F4AA 1R1A2 4DXTA 1VBD3 5CFDA 2GN3A 3EQEA 4PQ9A 4AI2A 4DQAA 5A6QA 4BQ1A 2VE1A 4A4AA 4OI4A 4LBLA 1W8ZA 1SLAA 1CN1A 4Y1VA 4A3XA 2EIEA 5HCHA 3USSA 1Y9GA 5FR3A 3KGZA 3A22A 4EN0A 4FTEA 1COV3 3KS7A 2VTXJ 4MLOA 2DBIA 3KSCA 5DAVA 4KGQA 3O1SA 2K2SA 2BGPA 1BCXA 2GH2A 3O14A 4OCTA 4TWTA 3VN4A 1H2KA 3ZX7A 2EXKA 5A7OA 1FNYA 4IEUA 4OULA 1NAEA 1XRUA 2JDYA 1F15A 3PHMA 5E89A 3SKJE 3AYAA 2WJSA 1Z7S2 3JD71 4Y1UA 1SPPB 1RL3A 2HWC3 4IEPA 3H3LA 3DPRC 5C70A 3KLSA 3M2MA 2VM9A 2QDRA 5JXJA 1HJFA 3AMNA 2YU2A 4QPIA 1HKDA 4PQQA 2XPJA 1S0GA 4U2AA 4C91A 1NXMA 1UYZA 2XVKA 3GYDA 5H9QA 3NV2A 4OHZA 4KWJA 3LA3A 3WW4A 5GKAC 2E32A 3PMSA 3ZR5A 3M3QA 1OOPB 5FDBA 2B45X 2ORZA 2UYAA 5I0RA 3BTXA 2VY0A 2D6MA 2YUEA 2XOMA 4AOCA 1NUKA 2UU8A 4M3CE 4OYUA 1W8TA 3G6JB 3PJYA 4QPGA 1IG0A 1QDCA 1RINA 2X5IB 1F5FA 4N90A 2FQPA 2WZ8A 2JG9B 5FYCA 5C33A 4Z2WA 3O1OA 5GLUA 2X05A 1XNTA 5FZAA 4UXAA 4QXCA 1WW5A 2UYBA 3O12A 3WQBA 5C71A 4LBKA 2ZEZA 1UW8A 3AYCA 2Z2SB 3AX4A 5CEHA 2ZGRA 3H3UA 5CG9A 1GWKA 4QKFA 3FHIB 4QQHA 5LEKA 4HONA 4LLOA 2GSYA 4R4ZA 4AI8A 1RUF2 2XUMA 4FPEA 4CDWC 2PELA 2W91A 3N7LA 1QXRA 4KGGA 5FXWA 3PVNA 5DABA 3Q8CA 2XBO1 4BXSV 3KHCA 2A73B 2VZQA 1UU6A 1Y4WA 4K8RB 1PVXA 2E33A 5I0SA 3KGLA 4META 4IGQA 3A23A 1S0CA 3DKWA 4GMP0 1HLCA 1W0OA 5FLHA 5EZWA 3UK9A 3POFA 4LO8A 4RS5B 3KQ4B 3C7OA 2HWD3 3ZM8A 1UL9A 5FMDA 3VBFB 4WM8A 1ZA4A 4XCBA 4IGOA 3LA2A 1W8HA 1RUC1 3WUDA 3N9QA 4XW3A 3O1VA 2DU1A 2VMIA 4A7YA 1W9YA 5L7OA 3GCXA 4LULA 4RGGA 5FXXA 1A34A 4LUMA 1IS5A 1ZBE2 4BXFA 2DUPA 3ZN4A 1BXHA 2XWBB 3BPZA 5C6CA 2XHKA 1LOFC 3ATGA 4P9YA 4C1WA 4FPJA 4XFIA 1A8DA 2MHFA 3OYWA 4Y5TA 1CVNA 4CP9A 1WCUA 4XBQA 3LIHA 4Q4X3 1VJ2A 4CCEA 5DDJ1 2A71A 1AR92 1F4HA 3H7YA 4O61A 4Y5Z0 3VD7A 5BNPC 3PLQA 3WW2A 3VZNA 3S57A 2CV6A 3HPNA 5FXZA 3AJZA 1J3PA 4W50A 4Q26A 4HFSA 5C8WA 4YW5A 1IQAA 1FPN2 2K0GA 3MIHA 4GH4B 4LBJA 1NCRB 1OFNA 1OA4A 1R093 4AQTA 2XVLA 1OURA 1RVF3 4LA2A 3ZFGA 3IM0A 4E27A 3HOBA 5FZ7A 2VJXA 1S0FA 4XF4A 4ZU4A 2OQ7A 1DQ6A 2KXLA 4XIOA 3S6PA 4CVUA 4QB6A 2XKPA 1HXS2 1W99A 2YFZA 5FUPA 4CP2A 5EIYB 5KXBA 3WNLA 1U5XA 3FE5A 1O6UA 1AL23 3H0OA 4RQPB 3WG4A 4N7UA 4AVSA 4LIVA 1DBNA 2H0VA 3GDBA 4FPLA 4CCCA 4CEYC 2WKKA 1CAXA 2BDRA 3JU9A 4XHXA 2C0ZA 2G4IA 3MLJA 1ASJ3 2FDIA 2PQSA 1CAVA 1F35A 1UXZA 3P3PA 4LO4B 3LB9A 4BB3A 4L92A 3EMRA 3KCXA 4Q4W1 2WAOA 4YW2A 1CPNA 3VHNA 1RUJ3 4QQLA 1JW6A 4XFHA 4EYUA 2PHFA 1FOD2 4JZRA 3WR0A 4OI0A 5FPAA 1VALA 4WVWA 3KMHA 1MZEA 1YFUA 5FZMA 5F3IA 3VHRA 3RZKA 1VB2A 1W6MB 3QCWA 2ZGUA 2GP3A 2YYOA 4KG8A 2TUNA 3Q9OA 5I93A 1SCSA 4YNIA 3LZZA 4YW3A 2ZACA 2A6ZA 4PI2A 1DGWX 4PCRA 5C4WA 3WDYA 3H8XA 1VBC3 3UKNA 3IPVA 3WW1A 4PLOA 1C5HA 1LTEA 2GNTA 1VRH2 4ES8A 4F83A 4XFGA 4XXAA 4M3CB 4D6SA 4QKBA 3T0DA 4PBPA 2I74A 1FMD2 4PLMA 1R082 4KU7A 4BK4A 4PIXA 3AKQA 5AVPA 5C8CB 4XJ8A 4P9IA 2Y0IA 3N9LA 1SPPA 5DZFA 4CCOA 1N3QA 4N7IA 4PDWC 1JODA 4N43C 1W3VA 1BEV3 2YXSA 2JENA 4QX3A 3TN93 1WCDJ 2RS53 4ZS2A 2ZKLA 1HRV2 3PVBB 3BPSA 1OXCA 4XQWA 2JKBA 3RZLA 2ZEXA 3R4UA 2VAUA 4JKLA 4XUOA 4FXKB 1C8M1 3DGTA 4PBOA 4DY5A 1AR61 5E1RA 4RN5A 4ZHNA 2WYSA 1OOPA 4R9AA 1GUIA 1MS8A 4FTSA 1YLLA 2FD8A 4COWA 2VVFA 2X5IA 1PHMA 5LEJA 1IGOA 2JG9A 2R063 4OHYA 4N9IA 1A3KA 2ZX3A 4H7MA 4NWVA 4E4HA 5FKBA 3TRSB 4Y33A 1QJX3 2YPJA 4ISQA 4CXWA 1VBA3 1VAVA 1LOBA 2B9UA 2ORXA 2PYTA 3JQWA 5A3PA 5FZCA 3BCWA 2G1MA 2A6VA 2F6BA 4FP2A 1D7PM 4BE3A 2Q5TA 4DINB 5FMOS 2AACA 1WLTA 1KFUL 4LBQA 3GXUA 4R9BA 4CDWB 1L7LA 4WVZA 2ZGSA 1C1LA 4KH9A 1WBLA 5D21A 5A7SA 2W5FA 5A7NA 4LBNA 3VB9A 3S7IA 2P1BA 5F6LB 1TME1 3HIFA 2JX9A 1AR72 1FATA 5FP9A 4JQRA 2HJIA 4EN9B 4PF1A 5FY0A 4IEZA 1J1LA 2RR11 2LS6A 2R6QA 1PK6B 2ZX1A 2IWGB 1VBE1 3MPPG 4W65A 5FY5A 5CFDC 1SLIA 4HANA 4RS5A 5FZ6A 1W6QB 2E9QA 3AP7A 4GB31 4M0NA 3VBFA 1W8FA 1O59A 2XKOA 2DCJA 2VZ1A 2ZMNA 4MZUA 2XJSA 5GZFA 2YHJA 5T54A 3THCA 4YZ5A 5AFEA 3M3OA 2WLPA 3ZIWA 2Z79A 3W9AA 2AR6A 3JBG1 5FREA 5JLVA 2KR2A 3AZZA 1LHVA 1ZRDA 3B7MA 4Y1ZA 4UWDA 2DCYA 1V9U2 5E88A 1BVP1 1HV1A 1QGLA 2DVBA 3KZ4C 3DN7A 5CKQA 4AYUA 5L9VA 4LT5A 2RMU2 1LOGA 3MV01 3KCYA 3PMEA 4RR3A 1HDKA 4B3NA 4IW3A 5F6KA 2PAEA 2BW8A 5FYIA 1IQDC 1KDKA 3KV6A 4QPIC 2RV9A 4HOOA 4HL0A 4K9SA 4D8MA 4MG2A 4CUAA 1NCRA 4XVHA 3ZKYA 3HN1A 1H4GA 1V6NA 3POSA 5FOJB 2CWMA 1C28A 1RMU2 1TNRA 2BU9A 2EIDA 3LDRA 1XNCA 4M0HA 2VGDA 4DRVA 2R073 4WBBA 1K12A 4YZ1A 2X29A 2XQXA 5FPBA 4AVBA 4CUCA 4DXZA 2PHWA 3ZXFA 4N53B 4P9GA 4QPGC 4XBNA 1WKYA 2QQVA 1KQRA 3AZWA 3A0NA 5F7UA 2C5DA 3DL3A 1N1VA 4LOSA 2VMDA 3KQRA 5J3UA 2F4PA 1MS5A 1SHWB 1W39A 1CAUB 2BVBA 4QGNA 4RQPA 5GLTA 2DUQA 3VKMA 2VXRA 2PHLA 2FCUA 4CCLA 4FSJA 1Q8QA 1XNKA 1MPXA 4Q29A 2OZJA 1TVGA 5FZOB 1GNZA 4K40A 2R1BA 2QQUA 2FCVA 2PQQA 4H55A 2VBDA 4L97A 2Y6GA 1FI2A 2P5BA 4QD2A 1JZ5A 1UO9A 3HVDA 1UYPA 1LEMA 2GAUA 2RS13 4HK9A 1PO21 1AHSA 4Q4Y1 2XJPA 3IAQA 3MDPA 4ASKA 4MGQA 3HNBM 4IGPA 5D8AB 5FP8A 5IVCA 2AYHA 2JIGA 2B4KA 3CQOA 5A3NA 1JYWA 1O5UA 2I45A 2YDEA 1HN1A 1UX7A 1Z0HA 1SFYA 1NT0A 4LHSA 4A2UA 1RUE3 5BUVA 5JR7B 3W58A 4O7XA 3LQCA 3MGUA 5A80A 3RS6A 1CD3G 1S0IA 3KVAA 4LMFA 3VZOA 3R0RA 4M3CA 2IFRA 2VCMA 3RMXA 1TMF3 5F37A 2TBVA 4OUEA 1BLZA 3LSDA 4GD4A 1QU0A 5C8CA 4WM8C 3ZFFA 3AL6A 1QJZA 4LNVA 5LRSA 3AJYA 4N43B 3S30A 3TEZA 2WNEA 5ACA1 4IEWA 1RVF2 2W08A 1CX4A 4BQ4A 4DUXA 5L7OC 3S7EA 1QQP1 4WM7C 1PM4A 3NNFA 1BK0A 1DU3D 1CZVA 4A42A 2BNMA 1POV3 2J7MA 4M3CF 2HWB2 4CUGA 5T5JA 2WZEA 4L11A 4HN0A 3MIEA 1PIV1 4GMP1 4XTMA 1QNWA 4BQ5A 1JZ2A 4CCNA 2IVJA 2R49A 3PUHA 1RYYA 1JZ8A 2RDSA 2VUAA 1UY3A 1KD7A 1VB4A 3H9AA 4L99A 2UWBA 3ZSJA 4A7ZA 5FP7A 1MEC2 1X82A 5I0UA 1C8NA 2HWF2 1S2KA 2AH2A 3OPTA 3GZAA 1UZWA 1D4M1 1V6LA 1QWRA 2JB4A 3B69A 4LOTA 3V64A 2BP6A 3GJBA 2GMEA 2DTYA 4AI3A 4XDQA 5T50A 2WRAA 2CGNA 2ZMLA 1RUJ2 5G05L 3ZXDA 1V6KA 2WZR2 1HRI3 3FHAA 2PHTA 2R32A 1JI6A 3KT1A 1T6BX 4HXCA 5LB6A 4EE2A 1DHKB 4DRRA 2D6KA 2FDKA 3VLBB 3USUB 3VL9A 1LULA 3H8RA 3CHXA 3CJXA 4NHYA 2WQZC 3APBA 2E51A 2ES3A 4P9LA 5BY5A 1K45A 2BBAA 2IXIA 3B93A 4TSVA 2Q30A 5FMOL 1UD1A 2Q8OA 2EA7A 3ZIXA 4CDWA 3VUOA 4FPHA 4Q8KA 1VBC2 2CU5A 2EIGA 2BFUS 5IT6A 1OQDA 3ZPYA 4I02A 4MSVA 3C8XA 5JZGB 1B35C 3POEA 1ND3A 1BZWA 1US2A 3C7HA 1AYM1 1H1MA 4DUVA 4UBHA 1QJU1 3OPWA 1RUI3 4K1YA 1MS4A 3JB8A 3ZYIB 5DXDA 2A3YA 4D6QA 1ZZ9A 2ARXA 2AREA 1AYN1 4QX7A 1UMHA 4Q1PA 1O4YA 1PK6A 2A3XA 4EQVA 3MUZ1 3TOJA 2R16A 5KC6A 1W6OB 2ZX4A 2XGXA 1BEV2 4IETA 2YC4A 2R041 2J1EA 3D0SA 4YGDA 4PT6A 3TN92 1W6QA 3O1MA 3UJQA 4AW7A 3BN6A 4B7EA 4AQSA 4QU2A 3I3QA 3GHNA 5HCFA 1RUF3 3ZMOA 3ZOIA 4ATEA 3CLPA 3RQ0A 5C4WC 1U5IA 2GC2A 2KM2A 1D2SA 1ZYBA 3AMPA 4LKSA 2B46X 4OHVA 1LCLA 4OHWA 3MIDA 3VZJA 3DKQA 1YFYA 3N35A 4YGBA 5HXMA 1RTVA 4JKMA 3NKGA 4DB5A 2VG9A 5BYNA 2R062 4L2NA 2DV9A 2ID4A 2YU1A 1NY71 4Q4V1 1U5YA 3AVSA 1NCQA 2WS91 4EJRA 4FOQA 1OPOA 2J1UA 1KXGA 1NKGA 5IWFA 3BYWA 2YB7A 1C5IA 3JD72 4IXLA 1H8TB 1F5JA 2DCZA 1OPMA 2WDBA 2WO3A 1YEWA 3WNKA 1SLTA 5FYSA 3VDAA 3FLTA 4FFIA 1IHMA 2NZ9A 3H1MA 1LOCA 3VD9A 4M00A 2W47A 5A6XA 4ARXA 1FNZA 1JZ6A 1AX2A 1G9CA 4N53A 1RUG3 2VVDA 1UX6A 3IKWA 3BOWA 4W6YA 4BIFA 1F8VA 1YIFA 2VOTA 5JPNB 1AR93 2JG9C 1WW6A 5J96B 1OA2A 2QZ3A 2ZHNA 3SCHA 1AVBA 1W3XA 4CSWA 4QXBA 3LE0A 1CZSA 1H30A 4XABA 1DQ4A 1D0GA 2QQJA 2WT2A 1GMMA 1IPKA 1FPN3 2Y64A 4AEKA 2GP5A 3PNAA 1POV0 2ZTNA 5GJ6A 3I2OA 1W6PB 5I8SA 1IKQA 2DURA 1SBEA 3KV9A 3E97A 1Q8VA 3P5BA 4XIKA 5FLIA 5D8AA 3R6SA 4RD7A 1OQ1A 1HXS3 2GN7A 3FC0A 1O4TA 1RUH3 2OS2A 4DOUA 1CGPA 3NJVA 1YQ6A 4RA0A 1OF3A 3FBMA 4HKWA 2BEOA 3WDWA 2GMPA 4HZFA 3CMGA 1A6CA 3WF0A 3N9OA 1FV3A 4AGVA 3VDDB 1IS6A 4Y1XA 3PUQA 5C7GA 2XBO2 4NAMA 3NJYA 1ND2A 2AEZA 4W6XA 1JYVA 1GZ9A 4BLIA 2V5DA 1JYIA 1QNYA 2J1AA 1UY1A 3D4KA 4JX0A 3VBFC 4QWNA 1BBT3 4D7TA 1FV2A 5CIRA 2ZMKA 5HCBA 2EICA 1J83A 2JDZA 4EWDA 5FRAA 4WM7B 4BMEA 4JDNA 2WR9A 2VNOA 3I2JA 3LDKA 3N7JA 4HVQA 5AC91 1OVSA 1SDDB 2A1XA 1RUC2 3DXTA 1NXD1 4NIDA 4XMAA 5L73A 2VQUA 3EYPA 1AZDA 3S0MA 3IN9A 1XB9A 1W04A 4COYA 1ZZ8A 2HEYF 3P6BA 4FOVA 2YBSA 4XFCA 4BWOA 1FMD3 1PMJX 2D3PA 2IZWA 4RR3C 1EAH1 2EAAA 5EPAA 4YW4A 4AE2A 1R083 1MS3A 3H8OA 4NWWA 1RUD3 2ZGLA 3FLPA 1MR5A 2JD4A 3OUIA 1JN2P 4GWNA 4E2GA 4XF0A 4EV0A 1NCRC 2J1VA 3SITA 5FAXA 1O5LA 1NZCA 4QDQA 5FOBB 1DP0A 1WMFA 2LTNA 3CL1A 3NW4A 4B4RA 1C57A 1MZFA 1HRV3 3IAPA 3PL0A 1DGRA 5A6YA 3LCPA 1MS0A 3JXSA 3EJKA 4AEDA 3QOPA 5HV4A 4YFWA 1UZ0A 3ACGA 5LBEA 5DMYA 3POWA 1RUE2 3I3MA 1W2AX 4IE7A 1DDLA 5T3NA 2JDNA 4GIQA 4RQPC 4BQXA 4E4DX 1B35B 2QQMA 3TWIA 2QJVA 1VP6A 5JZGA 4QGMA 4N9HA 4NHMA 2ZGPA 3F2ZA 4OUSA 4KWLA 3AP6A 3K48A 4MGYE 1UNBA 3I59B 5K9YA 3MO4A 3L2HA 3RMYA 4QQ2A 3UYJA 4MVTA 4TYSA 1DIWA 2C1FA 1W6OA 2J1SA 3ST7A 3UGGA 5JI7A 1RXGA 2JDKA 2BUKA 4QAWA 4NPLA 4Q4W2 4XETA 4XFAA 1SFNA 3ZXAC 5L19A 2EXJA 1JYTA 5JVVA 5KHHA 4M4PA 5C4WB 4ZONA 1P8JA 3FLRA 2DU0A 4TLFA 1EPZA 3IPVB 4LJHA 3FUQA 1YI9A 1WGPA 2LM3A 4P5HA 4Y5SA 4GQ7A 1NE4A 3OSDA 4GXLA 4K6BA 2RDRA 4ZZ8A 2ZEWA 4YPJA 2PTMA 3KWVA 1AR73 5KBFA 2VZTA 5EV7A 5F1RA 2HBUA 4MGIE 1CX1A 1YWKA 4L8QA 3SEEA 3ZN6B 4BISA 4D94A 5IYYA 3JZVA 1PVC1 2HEVF 3UKTA 3GALA 3WG2A 3ZFFC 5C8CC 1W0PA 1ZX5A 4K8FA 2JE7A 3MLLA 1HRI2 5CZKA 1GV9A 1ZZBA 3NQHA 4BCUA 5JXHA 4K1ZA 2JD9A 1OA3A 2WLQA 3ME2A 1UPIA 2DTWA 1UWWA 2IXCA 1O7FA 4AHWA 1XJAA 3AZVA 3NJXA 2B8MA 1H8TA 1QMJA 3U10A 1W0NA 5FZEA 2LROA 3ZDVA 4OMCA 4W4ZA 4NIIA 3WX5A 1ONAA 2ET7A 4B4QA 2PMWB 3H50A 3WNMA 4C90A 4JTNA 4IE5A 3AC0A 4QQPA 1V9U3 2VO5A 1W06A 1C8M2 2Y6JA 1H6XA 3ES4A 3KF5A 5LK5A 4E2SA 1O3SA 1OUXA 4DIQA 1RUI2 2RMU3 1J3RA 1YXWA 3BU7A 4LBMA 2WN2A 2B39A 1SMVA 3N3HA 3K2OA 3E5QA 3NAPC 4KU8A 4XF3A 4CEWB 2CGOA 2PFWA 2ZHKA 3THDA 4QQOA 3WNOA 4AVCA 1IKPA 4GJYA 1H1AA 2JDUA 4RGAA 3D6EA 4LEJA 1LODA 4Q8LA 5JXGA 2PHDA 4IEQA 4LBQD 4LBQB 1W6PA 4AAXA 3A0KA 3HBZA 3QACA 4E9KA 5KHIA 1RMU3 3RYKA 5DUXA 1ZBA3 1RB8G 1LHUA 5IK7A 3AP4A 5LASA 1NLRA 1GZCA 1GZWA 1RC6A 1CPMA 2NM1A 2W3JA 4QM9A 1JZ3A 2MEV1 4URAA 5FZKA 3HNMA 1ND3C 3WP4A 3J7NA 2WUHA 2BNOA 1TEIA 5E6HA 5J48A 3W5NA 4UYBA 2P6CA 2BTVC 3H3ZA 5DAPA 3VDDA 1W05A 4YVSB 4FP3A 4D6RA 4LKEA 1PK6C 3CU7A 1TME2 2GMMA 5FWJA 3I2KA 5FPVA 1I5ZA 4FT8A 3I2HA 2JDHA 4IE6A 5DQ0A 1W8UA 2RR12 4LHLA 4HN1A 3PVEA 4XAEA 3ZXJA 3MLKA 1S0DA 1KS4A 3I4IA 4Q0QA 4AFBA 3MZHA 3N9NA 4WM7A 4E4ZA 2HBTA 2A6YA 3OCPA 5FBZA 1DF0A 4GB32 3BTAA 5IUQA 4RL7A 2DFCA 1I9RA 1LJ7A 1ZRRA 1RUG2 3HQUA 4G4FA 1LGCA 3VV1A 2GNDA 2QNKA 3HR9A 4RR3B 1UY0A 3TBDA 2VZVA 3JBG2 5CBLA 5A1AA 4HK8A 4Y1YA 3NNMA 1NCQC 2XWJB 4OUMA 5C5TA 1Q8OA 2VTFA 4MGKE 4Q0UA 4FAGA 1FYUA 2WT0A 2VZRA 3HQXA 5T52A 1OI6A 5BNOA 3JQXA 4UFHA 2YGMA 3LEMA 3IWZA 3NRUA 4UFKA 3ZPOA 5FQ0B 1V70A 3T2TA 4UOJA 4AQ2A 4HPKB 2QKDA 2HWE3 1ST8A 1SCRA 3ABZA 3N9MA 1LOAA 2W87A 2GC0A 4Q1RA 2HWB3 3GGLA 4MO3M 5LCWL 1GSLA 2PAMA 4N53C 1RUH2 1WLCA 4CXYA 1UF2C 5EP9A 2GU9A 1NX9A 4YM1A 4XE9A 2W52A 2QCSB 2WN3A 1QKQA 4O9GA 4RHV1 1XSRA 1GOFA 1B35A 1MEC3 4H3WA 2HWF3 1W03A 4GAZA 3RDIA 2EXHA 3PUSA 5I0TA 2XLAA 2QDNA 4OFGA 1PO11 3SH5A 1E5SA 5HV0A 1Q8PA 3SKVA 1H9PA 4MHRA 1K5JA 5A3LA 4AFMA 1DLLA 5FO8B 3LPFA 2WZR3 3E5XA 3I59A 1BBT2 3FFQA 4JHTA 1UIJA 2I2SA 5LA9A 1XC6A 5EFUA 5FZ4A 3OTFA 2ADDA 2XJVA 5FYBA 3SC7X 5BPXA 4FAHA 1DZTA 1GU3A 1L3JA 2OPKA 2WT1A 1DYOA 5D8AC 5K0UC 2DDUA 5A6ZA 5HBAA 1R1A1 3OOXA 4Z92B 1CAWB 2E26A 1EV11 1DYPA 2BGOA 4Q4Y2 4QHBA 4BMBA 5C3SA 5IVEA 1RGSA 2RDQA 3MBWA 1H2MA 1GR3A 2DF7A 4FFGA 3W21A 4Z2AA 3MFCA 1RXFA 3WCSA 4M4RA 5H9RA 3AXDA 3CEWA 3DUIA 2VZPA 1KJRA 1PZ9A 4JGYC 3WSOA 2PXJA 2XL7A 5F5AA 3WDXA 3MIGA 4JV4A 4YSFA 2JJ6A 1X7NA 1JXNA 4XUPA 1ND2C 4AF9A 1X50A 1OKQA 3J8F1 1RUD2 3ZN6A 4ARYA 4WZCA 3TNQA 3ZFFB 5JWPA 3MYXA 2DCKA 4DEQA 2YV8A 4JC1A 3C2UA 3LEKA 2CNAA 1X9TA 1LHWA 2C9KA 2HH9A 2ADEA 1LOEA 2QQKA 4C0BA 5I8TA 3T2OA 4GULA 3DYOA 5GLWA 1BMV1 2EAKA 3MICA 3M3IA 3SQOA 2XB6C 1Z7S1 2VL4A 5JI9A 4D0QA 1CONA 1E5HA 2VOKA 3LIGA 3CJIA 2W0XA 2WFF1 2Y26A 3AMMA 3ASIA 3IDAA 4A44A 5JSRA 2VZSA 4HETA 3UGFA 4OHXA 1LAJA 2CY6A 1QQP2 1LHOA 3OD0A 3H42B 3RWNA 1GWLA 1R1ZA 3B94A 4YARA 5DZGA 4YM3A 4G9SB 1YI7A 5M0TA 1XXNA 2VQTA 1G6NA 4GZ9A 1KITA 2RHPA 3NAPB 3ZYGA 3ACIA 4KBZA 2JG8A 2Q1ZB 4XYXA 2MNGA 2P17A 4XEZA 4CEWA 2WO2A 3WG3A 3OBAA 1VMFA 4Q2FA 3ZSEA 1PGL1 5GLVA 1D4M2 1N1YA 3JD73 3N9PA 2RM21 3U0ZA 3GZTB 2Z5WA 2WQ4A 2YC0A 3ZYPA 2VQ0A 4HVOA 4Y4RA 1U12A 5F3GA 2R30A 4C8DA 4YRDA 5I8YA 4AEDC 2ZX2A 3Q8FA 3KV4A 3VBHB 2C6SA 2RJKA 1SZBA 1STMA 3CF6E 3ZYHA 4YG3A 4ISRA 1JYCA 1ND3B 3NNLA 2WNOA 4M01A 4V1PA 4QB2A 4AG4A 5HCAA 5JZGC 3O0XA 2OKXA 4S2GA 1XNAA 3ILFA 1D4VB 4QT6A 2VOVA 1NOVA 5APAA 3CBNA 3WNPA 3HT1A 1QJY1 1Y9MA 4NE9A 5FPZA 5FZ8A 2VZ3A 4YVSA 3IT8A 5GZDA 4TXWA 5FZFA 4X6RB 1ULGA 5BNQA 3IIIA 3M4FA 3NV4A 5DUUA 3HMYA 1SEFA 3IIAA 1LESA 1UU4A 3QD6A 2R1DA 4RGKA 3ZFEB 4CXXA 2VR4A 5BV6A 3CNAA 1HIXA 1W2TA 2BBVA 3ON7A 2Q4SA 2Q8DA 1ZA7A 2P34A 2R042 2W1WA 4RSUA 5IK8A 2OVUA 2A6XA 2PLV1 3OG2A 5AVAA 3D0JA 5IK4A 2NP0A 1GANA 1CQ9A 3WF2A 3LOBA 1VBB1 2VQAA 4AVVA 3MHZA 1ZBE1 1X8MA 5C9AB 2XBO3 1NCQB 1UCXA 1PX4A 3N4MA 4E4SA 1OD5A 3URFA 5A3WA 4B7KA 1XYPA 4SBVA 4CDXB 4A7KA 1PX3A 2Y6HA 4N8MA 5FKCA 3SCFA 2FDJA 4JDMA 3MEPA 1N1TA 3ILRA 2WFPA 2FHRA 4IL7A 4UAPA 3WF4A 5KHKA 3LF7A 2E7AA 4QXHA 3SISA 2D3RA 5L9RA 3T4VA 4Q4V2 1H8TC 4FPYA 3SLIA 3Q8EA 1RITA 2XUEA 5FQ0A 2GALA 1ZBA2 5CNAA 2DYCA 2VW0A 4HPKA 5GLZA 5A3UA 1UZZA 1C4RA 3L2YA 5EWSA 1RUC3 1WLDA 5F2WA 4XC9A 4CP0A 2RE9A 2XMLA 5F9TA 1XU1A 4YG0A 4IEXA 3GJAA 2GC3A 5FTTC 3T0AA 1E57A 3AP9A 3NVCA 1CJDA 5CISA 1DGWA 2D98A 3HN3A 2P3KA 4FQZA 1UOBA 3LOIA 4IV3B 3LEIA 1M06G 1RHI1 4Z1VA 4HKOA 4Y3OA 1W9FA 3I2GA 2OYZA 4YM0A 3VHPA 3UT0A 5DDJ3 1OHFA 4NPMA 3PTYA 1VE0A 2QQNA 3M7AA 2SBAA 3MF6A 2CWSA 1DG6A 1JUHA 2A7AA 1UAIA 2Q1FA 1YC61 1IG3A 3LSEA 3LPGA 1JZ7A 4FI9A 3WVJA 5K0UB 2UY9A 2EALA 5FZGA 3MIBA 4MYEA 4LHNA 1FOD1 1CAWA 1ACCA 3IZOA 3BKZA 1PGW2 1AR81 1M4WA 1GLHA 1QJFA 1K42A 1LECA 1UZVA 2D44A 4JTOA 5KWRA 4JGYB 1C3HA 4P9JA 4YWAA 3VDDC 1K5MB 2O8OA 1ND2B 2NYYA 4UFLA 3AFGA 5JIAA 4S2DA 3P3NA 2IXHA 2ZGQA 1QJEA 5FZ3A 2VH9A 3J7MA 1O91A 2OIIA 1VRH1 5LA1A 5DAWA 3H8UA 4P9XA 2WAAA 2EXIA 1AXZA 1V0AA 4U36A 2JDPA 5FCCA 4ZZ5A 4Q4W3 1W28A 5EJZB 5E8AA 5FPXA 2HWE2 3GHMA 1KEXA 2FDGA 3CZUA 4QXKA 1HQNA 1NQDA 1SLLA 3AK0A 1JHJA 5SV5A 1WD4A 5FYVA 1KDMA 1W9SA 5FMBA 1H2LA 3DEMA 2RJLA 3AYDA 2R0HA 2DVAA 1IPSA 2PHUA 2K46A 3LWCA 3OGRA 5AC92 4MGTA 4LITA 2Q1MA 4D69A 5CADA 1YQ8A 2VMGA 1QH7A 1W6NA 1JZ4A 3W5MA 1HW5A 1N1SA 1URXA 2UWCA 4A41A 5LWBA 2GC1A 1XNDA 2ZX0A 5A32B 4WVVA 1GP5A 1CESA 4QX8A 1ZRCA 3NAPA 2W9XA 2RS31 5FZ1A 4QHZA 2OXBA 2ZS6B 1L7QA 5BNOC 4KI5M 5IVVA 1ZRIA 5IAXA 1EAH2 3JUUA 2P3JA 4CU9A 1FT9A 3VBRC 2ZGTA 1BK1A 4HT1T 1O8PA 1DCSA 5LY2A 4A6OA 5T5OA 1ENXA 1MVQA 5C5UA 1NA1A 4LA3A 4AEDB 3RZGA 3ENRA 4RYDA 4JDOA 4UFMA 1LHNA 1VBD1 1PGSA 2X09A 4ZKTB 1G8WA 4R9DA 5FUNA 3VBSA 3VBHA 1AUYA 2E31A 3T09A 5IVBA 4YW1A 4DNYA 4FO9A 1PMHX 1T6GC 4HVRA 5A3MA 3OGSA 1OLQA 2IXLA 1SBFA 3I3BA 4GWMA 3VZLA 1C8M3 1AR63 2TEPA 2D5FA 5ABJB 1QHDA 3K3NA 1DQ1A 4BOWA 3RYRA 1COV1 1O3QA 5DAQA 3J7HA 2ARAA 2AC1A 5H9PA 5FYYA 2WO7A 3BALA 4ES9A 4ZS3A 2YROA 4GWJA 3DYPA 4MOAA 1WW7A 2C24A 2W2IA 2WSVA 4FOYA 3OF1A 2VCAA 4L9BA 3RWKX 4EN6B 1OF4A 2D40A 1VLNA 1AL0G 2HWC1 5FO7B 3VDCA 1LKNA 3ZFEA 2CHHA 4Q0VA 5A33B 2NPIA 4Q5OA 1GQHA 4XFBA 5FZ9A 4AHXA 3RG0A 3WHTA 2D6PA 2ARCA 4HMZA 2PAKA 4LE3A 2JE9A 3QLQA 3QH6A 4QX5A 4RFRB 4Y20B 4AXOA 4K3UA 1FAYA 3GM8A 3WP5A 2BPA2 4YVWB 5T55A 3AB0A 1OFSA 1WUVA 2JKXA 3U78A 3E6BA 2HYKA 2V4AA 3TAYA 1YQ5A 4GJZA 1S0BA 4QDRA 5A70A 5KXDA 2R7EB 3NKTA 4G3YC 1J59A 3KHBA 5H9SA 5C9AA 3V56A 1TME3 1WCKA 2WABA 1HB2A 1K3IA 4XBLA 3MW3A 4XFFA 4CDXA 2F17A 3KVBA 2E53A 3RPQA 3M8LA 4NPRA 2RR13 3KB5A 1UXXX 3U11A 3PDQA 4GKYA 4XHBA 4B1LA 3BIEA 3J26N 1PVC2 1JH5A 1S1AA 1VBE3 1G9DA 2G9ZA 2IXKA 3OGGA 4B29A 5F3EA 1A8MA 5DUWA 1TG7A 3CJIC 4XQDA 3WY6A 1TQ5A 5FO9B 1PZ8A 3Q8AA 2BERA 4GB33 2W94A 1H4HA 2HKXA 2NMOA 3DF0A 4OVEA 2Y8KA 1JS9A 4IV1B 4JRAA 1UMIA 4YLZA 5GM0A 2NQYA 4D7SA 5CU1A 5JSPA 4X8PA 3MIFA 2YC2A 2D6OX 1US3A 2HLEA 3ZLIA 1SLBA 2HEWF 2QBXA 1HB4A 2VOXA 5L9BA 1S0EA 3JBG3 4I01A 1BVVA 2AUYA 1WMEA 2JG8C 3B5LB 2QQWA 4Y4YA 1JOPA 2PHRA 4CEWC 1OMIA 4IV3A 1OC1A 4H7LA 3WNNA 2P2KA 2KD7A 3UJOA 3OJBA 4QX2A 3WDTA 2DFBA 3WF3A 1BJQA 3KT7A 4BU2A 3OY8B 1ULOA 4YGCA 2DUOA 1YNAA 1GZWB 1ALYA 4BZ4A 3IDEA 4XUQA 2D93A 4R8HA 2HWD1 4E2QA 4IDZA 5K0UA 3SCGA 1MQTB 3HD8B 3PIGA 3RZHA 4AZZA 5I91A 1UZYA 1CR7A 4XUNA 3ROUA 3T2QA 1LB2A 1Y7BA 2G9FA 2N7GA 3OBRA 3ZYFA 1IOAA 1SQ4A 1JYNA 5CG8A 5FYUA 1YJLA 3WP6A 4OMDA 5JXIA 3M3EA 3RJ2X 4JGYA 5CKNA 4COUA 1SLCA 3LD8A 4UW6A 2MEV2 1K5MA 2V72A 4YVSC 2GNMA 1LU1A 1NLSA 1UOGA 1OVPA 2YBKA 3GNEA 3MF9A 5FUIA 3AZYA 3R4DB 3ZYBA 2ZABA 4NRMA 4TN7A 4Q4X1 4FPCA 1CIYA 4C1XA 2ETEA 3AXEA 1QOOA 3K75B 4EROA 4XF9A 1WWYA 3VBOB 1XNBA 3BTZA 1I3HA 1KJLA 3FMGA 5CYYA 3SXWA 3K77A 2DCTA 2JDMA 3K3OA 4S2HA 3GCWA 3WXPA 1D2QA 3HAGA 3ELNA 1LENA 2CDPA 1H9WA 1R091 1PO23 3GZEA 3NV1A 4MGSA 4Q4Y3 4XJAA 3I8TA 3ZKUA 1HB1A 1RVF1 3FFZA 4PHZA 4A45A 2FDFA 1AXYA 5ISLA 3FBYA 1TZOA 2VU9A 3WF1A 5BNNB 5HI0A 3ETPA 3ZVXA 1W8OA 4BH9A 5JIUA 2ZBJA 1V6MA 5IVFA 5FK8A 1GKBA 4Y26A 3BODA 5LATA 4OLLA 2J1RA 4D7YA 3MW4A 1AL21 4WVMA 5A32A 5BNOB 5CFCC 1ULCA 5DDJ2 3BUCA 4EWAA 4BA6A 3VBRB 4NRQA 2ZAHA 2OT7A 3IDBB 4IEYA 1EY2A 1ASJ1 1C1FA 2ERFA 3KD4A 5FMCA 1UQXA 2OUJA 1Y43B 3DCQA 3I3DA 4XXPA 1RUJ1 3ORJA 5ACA3 4KMQA 4YW6A 2D6LX 4YG6A 1Q5OA 3JB4C 4LK7A 4QMAA 4YFZA 1O3RA 3GBGA 4CCMA 1ODMA 1QQP3 1OT5A 5LY1A 4H2AA 2H6BA 1Q56A 1T2XA 4CDQB 5DZEA 3OUJA 1PIV3 4GMP3 2OQ6A 4LXLA 3WOGA 2RG4A 5FZLA 5ABJA 1ULFA 1HX6A 4BM8A 4NHLA 1RUNA 1VBC1 4DXSA 3HEIA 2JXAA 3ITQA 4MV2A 5K4LA 1YJKA 3H7JA 4V2WA 3VZMA 4MXWB 1EUTA 1D4M3 1YFWA 4I30A 2JIJA 4LIUA 4QKDA 5DG2A 1E5IA 2XJTA 5A3OA 1CWPA 3CDZB 5EYXA 2O0OA 4EN7B 1LEDA 3S5QA 4OQ8A 5IVYA 3WNXA 2J1TA 3EBRA 3VZKA 2CL2A 4UT5A 5A33A 2O8QA 2BJSA 1HJGA 1BEV1 1UN1A 1W2NA 2VULA 3FWEA 3KT4A 3NSTA 4KL1A 3TN91 4IEOA 2D6NA 2RS51 3M3CA 5G04L 4Y20A 3TEWA 1UY2A 2WQ8A 4O65A 5T5PA 4COVA 5F5QA 1J1TA 4I3GA 1EV12 1AXKA 1VIWB 4FFHA 1W90A 2WA4A 4YVWA 3WP3A 3AKPA 2PN5A 1OH3A 1PMIA 2AZ5A 1NLQA 2WNUC 4XAAA 1WBFA 4HBNA 2WIIB 3AKRA 4UW4A 2FDHA 3RSJA 5T5LA 2JB8A 4ZPIA 1AYM3 3H1YA 3WQ7A 2F4LA 1QJU3 2QQOA 4GA9A 4Z07A 5FYZA 1R64A 3PIJA 3J8F2 5CB7A 4CP1A 4ZXKA 3CIHA 1AYN3 2R061 2CAVA 4BK5A 4UF0B 3ES1A 3CJIB 1QJX1 5EXOA 3FJSA 1VBA1 2R0FA 3RGBA 4DPNA 1Q43A 1OD3A 2BWCA 1W2UA 2R043 1W9WA 1WCSA 2XJRA 3A4UA 4FPFA 5FZBA 1YRZA 1NE6A 3TEYA 1BMV2 3WEZA 5JDBA 4IV1A 1REDA 4Y24A 1UOFA 2E7TA 3SHRA 2A5ZA 4B8EA 4XOGA 3T08A 3T1LA 1DQ5A 4XDPA 3VHOA 2WFF2 1AF9A 3MV11 4S2FA 5FLJA 1LGNA 1RJ7A 1AR62 2FBEA 3RJRA 2ZZJA 2RJ2A 2W95A 3LEGA 4AEMA 4IE0A 4BJ0A 2VZOA 2VNGA 2JG8B 5FZHA 4CUBA 3VDBA 2WC2A 4AGGA 2OZ6A 2RDNA 3KF3A 1W2OA 2BQPA 5IJRA 2WA3A 4KNCA 1UOJA 3ZXKA 4MX3A 1GYKA 4Z8BA 1LNSA 1EPWA 1JTZX 3AFKA 4UW5A 4ASMB 5CAZA 4Q4V3 2YZ4A 3VKLA 2CSGA 1NA1C 2WS93 1KS5A 3GZUC 2C26A 2D97A 4BYYA 4DMIA 3OY8A 3WV6A 3RNSA
chains in the Genus database with same CATH topology
1OURA 2VUCA 2BP6A 5A6XA 2JDYA 2WRAA 2VNVA 2WR9A 5A6QA 1OUXA 2JDPA 2JDMA 1OVSA 5A70A 5A6YA 1UQXA 2JDKA 1OXCA 2BOJA 2BV4A 3DCQA 5A3OA 5A6ZA 2JDUA 5HCHA 1UZVA 2VUDA 2JDNA 2BOIA 1W8FA 4CE8A 2JDHA 3ZDVA 4UT5A 1GZTA 1OUSA 1W8HA 2CHHA 2XR4A 4AOCA 1OVPA 5D2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUR A;  2VUC A;  2BP6 A;  5A6X A;  2JDY A;  2WRA A;  2VNV A;  2WR9 A;  5A6Q A;  1OUX A;  2JDP A;  2JDM A;  1OVS A;  5A70 A;  5A6Y A;  1UQX A;  2JDK A;  1OXC A;  2BOJ A;  2BV4 A;  3DCQ A;  5A3O A;  5A6Z A;  2JDU A;  5HCH A;  1UZV A;  2VUD A;  2JDN A;  2BOI A;  1W8F A;  4CE8 A;  2JDH A;  3ZDV A;  4UT5 A;  1GZT A;  1OUS A;  1W8H A;  2CHH A;  2XR4 A;  4AOC A;  1OVP A;  5D2A A; 
#chains in the Genus database with same CATH topology
 2WBK A;  4V2V A;  2YMZ A;  3V65 A;  1PGL 2;  3KCC A;  3VBH C;  4CU8 A;  1X36 A;  3VBS C;  2RM2 2;  1XYO A;  3IBM A;  1MQT A;  2WWS A;  5FP3 A;  5FK7 A;  2D3S A;  3O1T A;  3E6C C;  3E1F 1;  4CDU B;  3HJR A;  3EXU A;  5CKM A;  3WCR A;  3VGI A;  1HN0 A;  1YQC A;  4FXG B;  4LBO A;  3IDC B;  4NN0 A;  3T30 A;  3ZSL A;  5LW9 A;  3PVO A;  3POJ A;  2Z69 A;  3CKH A;  4OI1 A;  4NIH A;  4D3W A;  3TEX A;  5IVJ A;  2L9L A;  2JDA A;  3ALQ A;  4CZS A;  4LO5 B;  3W59 A;  5A1F A;  4FTB A;  2E6V A;  4XJW A;  4F8A A;  2ARB A;  3RZZ A;  3RZM A;  4UI9 L;  5LBC A;  5KR7 A;  4GWI A;  5JMC A;  4NVP A;  2C4X A;  1QIQ A;  2ZCW A;  4CU7 A;  4JAA A;  2Y33 A;  4JGZ C;  1Z78 A;  4JVA A;  4F7Z A;  1GNY A;  3VBU A;  4QKN A;  2BWA A;  1QJY 2;  4COZ A;  4YGE A;  1VBE 2;  2SLI A;  3PUA A;  5EHD A;  3ZFE C;  3NJZ A;  2OPW A;  3RVH A;  5C3O A;  3VBO A;  4B4P A;  2VCB A;  3AKT A;  1ZZC A;  3THP A;  5JUV A;  1BKZ A;  4I09 A;  4L0P A;  3TB0 A;  4I3P A;  1XU2 A;  3A7Q A;  3PTR B;  1JOB A;  2FMY A;  2BOJ A;  1ZZ6 A;  5DPN A;  5F39 A;  4AAP A;  1G9A A;  2BVV A;  3B9I A;  2R07 1;  4ZXE A;  5DAX A;  2VUD A;  4NAO A;  5BNN A;  4O9E A;  2PLV 2;  5C9A C;  2GNB A;  2VEC A;  5CFC B;  2TNF A;  4CDX C;  3O1R A;  3BVC A;  1VBB 2;  3I97 A;  2CYF A;  2W1Q A;  1S0J A;  1RJ8 A;  4CTE A;  3VKN A;  2B5H A;  3VBR A;  2XLF A;  1BYH A;  2P37 A;  4LR4 A;  4NIA A;  2Q8C A;  5C3P A;  2AEY A;  5DG1 A;  1H1I A;  5KXC A;  3RI9 A;  2ZXQ A;  1E5R A;  3BGA A;  2ZGO A;  1XBF A;  3AMH A;  4AI1 A;  5JOY A;  2RS1 1;  3OB8 A;  4I0A A;  2WNV B;  2WL1 A;  3ETQ A;  5FZD A;  4BDV B;  5GZG A;  1I6X A;  4GAL A;  3O1P A;  5AC9 3;  1JHN A;  2VC9 A;  3H1W A;  5ANQ A;  4CCD A;  2X10 A;  4LKD A;  1NZI A;  4OI2 A;  3AZX A;  2OA2 A;  3KV5 A;  4AVA A;  3WQ1 A;  4CDQ A;  2LAL A;  3M70 A;  2CAU A;  1JU3 A;  2C9A A;  1YYN A;  1RUE 1;  4IV3 C;  1V00 A;  4NIG A;  2DBN A;  5A7Q A;  3AL5 A;  1QEX A;  1DLC A;  2P3I A;  2XON A;  1EAH 3;  4BQ3 A;  3BTY A;  4MXW A;  1RHI 2;  2NLR A;  3ZO0 B;  3LDB A;  3PUI A;  4LLF A;  1TMF 1;  1WZX A;  3E5U A;  3T0B A;  1ENQ A;  2G19 A;  4LOR A;  4PIY A;  3V0A A;  4HSL A;  3IB3 A;  1PO2 2;  4P00 B;  3WG1 A;  4EZ4 A;  4J25 A;  5ANN A;  4QGL A;  2XLG A;  3ACH A;  3HT2 A;  3M1H A;  1FX5 A;  5IAT A;  5JSO A;  1OUS A;  1Y3T A;  5ERL A;  4P14 A;  1MAC A;  2K9Z A;  3WQ0 A;  3T4H B;  2H0B A;  1DZR A;  3THT A;  1POV 1;  5J1X A;  1UMZ A;  4XF1 A;  1K5M C;  1XE7 A;  2WNU B;  2EVX A;  2VXJ A;  2ZAA A;  1B09 A;  1AR8 2;  4LE4 A;  5EQU A;  5K7P A;  2G9G A;  2PA7 A;  1AX1 A;  2OUH A;  2VZU A;  5FYT A;  3SMH A;  3AP5 A;  4AFD A;  3IMM A;  4LK6 A;  4KBB A;  1QDO A;  5FYM A;  1SDW A;  1ZZ7 A;  5FWE A;  4BPZ A;  3ZSK A;  4YZ3 A;  2XXZ A;  2WSU A;  4AEJ A;  4E8D A;  4YW7 A;  5FJH A;  5FV3 A;  4CCJ A;  4XJZ A;  4UW3 A;  2H6C A;  2YG0 A;  5F32 A;  4XUT A;  2XJQ A;  1UPS A;  2QQI A;  4UF0 A;  4X8N A;  4NR1 A;  2Y6K A;  4NO4 A;  1HRI 1;  3PU8 A;  2Y6L A;  3AM2 A;  5ACA 2;  5FZI A;  3C3V A;  1XSQ A;  1O4Z A;  3ZXG A;  1QOT A;  3DXU A;  4I0W B;  1H8V A;  5JMO A;  1QXP A;  1CIW A;  1W6N B;  3DPR B;  4LO7 A;  5CVR A;  5KXE A;  2BZD A;  2NN8 A;  2VOW A;  2Y6F A;  3U37 A;  1GP4 A;  1PIV 2;  1YIP A;  2ZOE B;  3ACL A;  3GBW A;  3MW2 A;  1V6J A;  1VMH A;  4XJU A;  5A7W B;  2A75 A;  4XJ9 A;  1UY4 A;  3INA A;  2Y34 A;  3D5O A;  4AK3 A;  2QQP A;  1O3T A;  2ET1 A;  5B4X A;  1YHF A;  2Q8E A;  2BV4 A;  3J7L A;  4IND A;  4XIL A;  5B2G B;  2QUO A;  2ILM A;  3OBZ A;  2VNR A;  3I49 A;  2IFW A;  3SH4 A;  2XH6 A;  1RUI 1;  3O1U A;  1NA1 B;  1PVC 3;  1S2E A;  3U4S A;  2RS3 2;  3R05 A;  4A6S A;  3U07 A;  1WLW A;  5LZ6 A;  1JYX A;  1G9B A;  1KGY A;  4TTG A;  3VBS B;  1F2N A;  4EN8 B;  5FBJ A;  3PJQ A;  4P9W A;  5AFB A;  3RFR A;  1WA4 A;  1XOY A;  5HXV A;  3B00 A;  5HPO A;  4CDU A;  2IUW A;  4R52 A;  4F3J A;  1VBD 2;  3AMQ A;  5IHR A;  3UGH A;  1QF3 A;  1RUF 1;  3T2P A;  5ABJ C;  4AQ6 A;  4I0B A;  3FUO A;  4C0H A;  1YUD A;  2ZGM A;  1AJK A;  5FPU A;  1MZ5 A;  3AVR A;  1YFX A;  3X29 B;  1LR5 A;  1POQ A;  3N7M A;  4J1X A;  1S55 A;  1Y9Q A;  1AYM 2;  4JGZ B;  1MZ6 A;  1QJU 2;  2Q0A A;  2EF6 A;  4BIO A;  5IFT A;  4P5Y A;  1COV 2;  1HV0 A;  1AYN 2;  4AWD A;  5J36 A;  2NMN A;  1D0H A;  1VMJ A;  1W9T A;  1OH4 A;  5LA0 A;  3J9S A;  1GFF 2;  1IS4 A;  1J84 A;  4UFJ A;  3LFI A;  2Y0O A;  1CZT A;  1DFQ A;  2XHN A;  4NRO A;  1S4C A;  2VW1 A;  1YQ2 A;  2HWC 2;  3DEC A;  5GAL A;  4QDS A;  4LQR A;  4YVW C;  2FZ2 A;  1W8N A;  3ILN A;  3E6D A;  4AHY A;  1W8W A;  3I2I A;  2MEV 3;  2DWR A;  2VCC A;  1DYK A;  4CU6 A;  1LU2 A;  1TNF A;  1RUG 1;  5CFC A;  2LUW A;  4AI0 A;  5J98 B;  2IXJ A;  5FY1 A;  1GBG A;  2ZHM A;  3O0W A;  3LKJ A;  1N47 A;  4URT A;  1AR9 1;  1AJO A;  1NY7 2;  2A70 A;  4AGR A;  5A1L A;  2WS9 2;  3K51 A;  1OQE A;  4JKK A;  3B9C A;  2EIB A;  4KWK A;  1OLM E;  4DY3 A;  3WIN E;  1FPN 1;  5FYH A;  3FZ3 A;  1VR3 A;  1QY4 A;  3K46 A;  4YZ4 A;  5F3C A;  2W46 A;  5JPM B;  5BNP B;  4TZD A;  2P6H A;  3NO8 A;  4P02 B;  1OKO A;  4IV1 C;  4TLG A;  4B1M A;  3U14 A;  3HQR A;  4XMI A;  5EJ1 B;  3K4A A;  1WCQ A;  1H6Y A;  2WNV A;  5DN2 A;  1XE8 A;  4YM2 A;  3UL2 A;  2B7Y A;  4PF5 A;  4GH4 A;  1ENR A;  4PI0 A;  1HXS 1;  1ZM1 A;  1UKR A;  2V09 A;  4NJ4 A;  1RUH 1;  4XUR A;  5TSW A;  2VUJ A;  3VD3 A;  2ZJC A;  4MAD A;  3OUH A;  2MPF A;  4CPB D;  1JBC A;  2VW2 A;  2Y60 A;  3BB6 A;  3D8C A;  4AR2 A;  5JOX A;  3UKV A;  3ZDS A;  4UFI A;  4XZU G;  4W8J A;  1PNG A;  5KHG A;  1GIC A;  5BXX A;  3SNM A;  1CJP A;  4CEY B;  1SFP A;  3NV3 A;  1PZ7 A;  4Z82 A;  2W68 A;  1Q3E A;  1WW4 A;  2VTX A;  1MQT C;  1BBT 1;  1VAM A;  1A78 A;  5FXV A;  5IK5 A;  2XG3 A;  1EP0 A;  4NRP A;  2A6W A;  5KC5 A;  3GF6 A;  2HWD 2;  3FHQ A;  1GWM A;  4DXR A;  3ZMN A;  3BU0 A;  2V5Y A;  2VMF A;  4CYD A;  4GKX A;  1YCI A;  2E63 A;  1U0A A;  3R4S A;  1G86 A;  1NQJ A;  2WNU A;  4QU1 A;  3A21 A;  2XQR A;  4RHV 3;  4CRQ A;  1VPH A;  2X8K A;  4MGZ E;  1W6M A;  3ZXE A;  1GP6 A;  4NHX A;  1FXZ A;  2OX0 A;  2W1U A;  4Y22 B;  3IMN A;  3VBU C;  1N3P A;  1FMD 1;  5F8P A;  3B01 A;  4AL9 A;  5F2S A;  1PO1 3;  2RVA A;  1R08 1;  5GZC A;  5FP4 A;  2QQL A;  2WZP P;  1RUD 1;  4QHO A;  3VBO C;  2BNN A;  5E16 A;  4CCK A;  2UY8 A;  3VL8 A;  5FY8 A;  2VMC A;  2ZPX A;  5J7M A;  1QOS A;  3NL1 A;  2J22 A;  4Q4X 2;  1ZRE A;  3Q8B A;  5JOZ A;  2CDO A;  4H14 A;  4R9C A;  2HYX A;  2WO1 A;  1HRV 1;  2W39 A;  3G7D A;  3MPB A;  4FBF A;  5JAX A;  3ZYR A;  4PDW B;  1R1A 3;  3DPR A;  4QX1 A;  1G9F A;  5BNN C;  1DZQ A;  1EV1 3;  3POG A;  1R09 2;  4HLT A;  1ULP A;  5A3T A;  3ZSM A;  3PU3 A;  1Q8S A;  5F5I A;  4MUV A;  4WVM B;  3WZ1 A;  2GH8 A;  4JHZ A;  4PJY A;  2VNV A;  4NMI A;  5A7W A;  4P08 A;  4LTA A;  2W92 A;  3OGJ A;  4Q27 A;  4K20 A;  1JOJ A;  4QX0 A;  3WW3 A;  2O14 A;  2QVS B;  1GOG A;  2VBP A;  3VKF C;  1KRI A;  3TNP B;  2YY1 A;  3EB7 A;  3J8F 3;  3OGV A;  4OZO A;  2IC1 A;  4JRL A;  3DYM A;  1AL2 2;  3OPZ A;  4HKL A;  1XPW A;  3WDV A;  1BQP A;  1J58 A;  3TYJ A;  1ASJ 2;  4XZP A;  4ATF A;  4OQ9 A;  1GQP A;  2A3W A;  2VVE A;  5IW0 A;  4ET7 A;  5D2A A;  5DUV A;  1S2B A;  1IZ3 A;  1Z7S 3;  1BHG A;  1MS1 A;  1V6I A;  2WYF A;  3D3A A;  1SG3 A;  4WZF A;  2WFF 3;  2B42 B;  4CDQ C;  1ODN A;  3HBK A;  3V0B B;  4DUW A;  1YO8 A;  3EHK A;  3F95 A;  3ZFG C;  5B4N A;  2KA3 A;  5I0D A;  2ZA9 A;  2AGS A;  4KQ7 A;  4X6Q B;  3RI8 A;  1REE A;  3RRD A;  4EWE A;  3EO6 A;  3AYE A;  5EYY A;  3RYP A;  1VAK A;  1AR7 1;  3NMB A;  1GOH A;  4MH0 E;  4JGZ A;  4PIZ A;  2ZGK A;  4NUB A;  2AEN A;  4ZY9 A;  3SEP A;  1XQN A;  1H2N A;  1L7R A;  2D5H A;  1I1E A;  1HB3 A;  4LKF A;  1LGB A;  2XVG A;  3LGR A;  4DZG A;  4YZ2 A;  1V6O A;  2UWA A;  1HQL A;  3DV8 A;  4QPY A;  2GDF A;  2OW4 A;  3BIW E;  2P4E A;  2FZ1 A;  2RM2 3;  2XJU A;  3O5S A;  1AX0 A;  1OBN A;  3OEB A;  3K4Z A;  5CFD B;  3L9J T;  3K4D A;  1NYW A;  3OD4 A;  1ZVF A;  2Z42 A;  5EJ3 A;  4KG0 A;  1ULD A;  2JWP A;  2VMH A;  2QE3 A;  2RS5 2;  5FFO C;  1OSG A;  1H0B A;  3SH3 A;  2ATF A;  2V73 A;  1JUI A;  1F9K A;  3N36 A;  4AFC A;  2O1Q A;  3QBQ A;  3I2D A;  4FVV A;  1V9U 1;  2BOI A;  4LO6 B;  3ZYJ B;  3WD5 A;  1G7Y A;  2RMU 1;  1QJY 3;  3RZJ A;  3POB A;  4LHK A;  2FMD A;  1LOF A;  4QM8 A;  1OLR A;  3PUR A;  2VPV A;  1JU4 A;  1REF A;  2XDV A;  4XTP A;  1QXJ A;  4HG6 B;  4ASL A;  2ZHL A;  3ECQ A;  2GZW A;  5FZ0 A;  2DVF A;  4SLI A;  5F5C A;  1UYX A;  4HSJ A;  1APN A;  5BNP A;  2ZZQ A;  5LRR A;  1PM7 A;  4FQ4 A;  1QJX 2;  3ACF A;  1RUO A;  3C7G A;  1RMU 1;  1VBA 2;  1ZBA 1;  2WWU A;  4QPI B;  4CA9 A;  2Y38 A;  1F31 A;  1EYB A;  4YYO A;  1JMU B;  3UNP A;  2CGP A;  2JE8 A;  2PLV 3;  4LUK A;  3C7F A;  4RFT 0;  5FPL A;  2BYV E;  3O0V A;  1LRH A;  1RIR A;  1VBB 3;  4I2O A;  2XR4 A;  1ZBE 3;  5KHJ A;  3KM5 A;  3NNJ A;  4CPB A;  1OOP C;  1WD3 A;  4NHK A;  4QPG B;  1WMX A;  2VUC A;  4QPW A;  3MUY 1;  5L36 A;  2QZ2 A;  1ENS A;  2JIC A;  1UU5 A;  2YGL A;  3U4X A;  2X5I C;  2I07 B;  4IQP A;  4CEY A;  5K8S A;  1CAU A;  3FN9 A;  4ONU A;  3ZN5 A;  3VD4 A;  2VBB A;  3CO2 A;  4FFF A;  4R4X A;  2D43 A;  4XDO A;  1ZNP A;  5D1I A;  4IEV A;  5JCT A;  5FZO A;  4Q0P A;  4CDU C;  1ZRF A;  4ZU5 A;  3U1X A;  3S5A A;  4ZU7 A;  1WA6 X;  2ZKN A;  2YPD A;  3QH7 A;  4FOW A;  3I3E A;  1DQ0 A;  2W1S A;  3D82 A;  4CE8 A;  1GZT A;  1X33 A;  4IE4 A;  1I5P A;  5SV8 A;  2P3Y A;  3ZR6 A;  1PGW 1;  3JCI A;  4AI9 A;  4BQ2 A;  4JCK A;  3UV9 A;  3VBU B;  4QB1 A;  4E8C A;  5J37 A;  3UET A;  4ITC A;  4Y22 A;  1EUU A;  5LA2 A;  1RHI 3;  2V4V A;  1QH6 A;  3NWK A;  4Q0S A;  1X9P A;  1GNH A;  3FX3 A;  3LAG A;  4ORF A;  3AKS A;  1KFX L;  4XAC A;  5FY4 A;  3T1M A;  1GQG A;  1WMD A;  3LA7 A;  4EZH A;  4FCA A;  2B9V A;  4XQ4 A;  1SBD A;  1XYN A;  4DEV A;  1DGR N;  2ZEY A;  4WM8 B;  4RS5 C;  2VD7 A;  2HWE 1;  3I2F A;  2CTV A;  3B3Q E;  4PDW A;  1FOD 3;  2HWB 1;  4KWU A;  4DO0 A;  3UES A;  4N43 A;  4J6G A;  4BQW A;  5C3Q A;  5L7O B;  4K7J A;  1AR8 3;  1NG0 A;  4FPO B;  4K21 A;  5JR2 A;  5LK7 B;  4LPL A;  2J42 A;  1XE0 A;  2DVG A;  2R07 2;  2VME A;  3NNG A;  4J1W A;  3U75 A;  1MEC 1;  5IAV A;  2HWF 1;  3WT3 A;  1X8E A;  3OYW B;  1UIK A;  4W6W A;  2BGC A;  4IER A;  4CP9 B;  3BI3 A;  2YBP A;  5CA6 A;  3C7E A;  1VRH 3;  2DVD A;  1HQW A;  4NOT A;  1MVE A;  5J09 A;  3I7D A;  3I54 A;  1SAC A;  2WZR 1;  2UUR A;  2YFU A;  5FY9 A;  1O8S A;  3LFM A;  1TE1 B;  3GBF A;  4JQT A;  4UBG A;  2FCT A;  3OEA A;  1J3Q A;  1VRB A;  2WNV C;  4BHP A;  3W20 A;  5LBF A;  2JEM A;  3CZJ A;  4IUG A;  3POI A;  5LBB A;  1IPJ A;  4BLJ A;  4GH4 C;  1ULE A;  3J4U H;  3P1I A;  1DQ2 A;  3ZFG B;  2RS1 2;  3MFA A;  5C3R A;  4MHU A;  1U5Z A;  2Z4F A;  3WLU A;  3V0B A;  2LW8 A;  1UYY A;  3VD5 A;  2ZGN A;  1MS9 A;  1N3O A;  3FL7 A;  4RHV 2;  3ZXL A;  4AFA A;  3USU A;  2LRP A;  3HWJ A;  3OBT A;  5A7P A;  4XCA A;  2QTW B;  4BQY A;  4FPG A;  4XPV A;  4AVT A;  1IS3 A;  1PNF A;  1PO1 2;  2E7Q A;  2WIN B;  4FPK A;  5IFP A;  3V0A B;  5FJK A;  2D7F A;  3WUC A;  2XL9 A;  3MI8 A;  2RS3 3;  4PLN A;  1CAX B;  2X53 S;  2IVI B;  3T3Y A;  3VKO A;  2BRT A;  2PHX A;  4AHZ A;  2QFE A;  2ENR A;  3POY A;  2JEC A;  1CAV B;  4OZX A;  2BFU L;  4MXV A;  3WHU A;  4DS0 A;  1DGL A;  4DFS A;  4A3Z A;  3BOP A;  1TMF 2;  2WWJ A;  5JOW A;  5GZE A;  1UKG A;  1OLM A;  4IES A;  4WV8 A;  3HNY M;  3B02 A;  3N7K A;  3O7O A;  3WDU A;  5FY7 A;  5FIX A;  1F4A A;  1R1A 2;  4DXT A;  1VBD 3;  5CFD A;  2GN3 A;  3EQE A;  4PQ9 A;  4AI2 A;  4DQA A;  5A6Q A;  4BQ1 A;  2VE1 A;  4A4A A;  4OI4 A;  4LBL A;  1W8Z A;  1SLA A;  1CN1 A;  4Y1V A;  4A3X A;  2EIE A;  5HCH A;  3USS A;  1Y9G A;  5FR3 A;  3KGZ A;  3A22 A;  4EN0 A;  4FTE A;  1COV 3;  3KS7 A;  2VTX J;  4MLO A;  2DBI A;  3KSC A;  5DAV A;  4KGQ A;  3O1S A;  2K2S A;  2BGP A;  1BCX A;  2GH2 A;  3O14 A;  4OCT A;  4TWT A;  3VN4 A;  1H2K A;  3ZX7 A;  2EXK A;  5A7O A;  1FNY A;  4IEU A;  4OUL A;  1NAE A;  1XRU A;  2JDY A;  1F15 A;  3PHM A;  5E89 A;  3SKJ E;  3AYA A;  2WJS A;  1Z7S 2;  3JD7 1;  4Y1U A;  1SPP B;  1RL3 A;  2HWC 3;  4IEP A;  3H3L A;  3DPR C;  5C70 A;  3KLS A;  3M2M A;  2VM9 A;  2QDR A;  5JXJ A;  1HJF A;  3AMN A;  2YU2 A;  4QPI A;  1HKD A;  4PQQ A;  2XPJ A;  1S0G A;  4U2A A;  4C91 A;  1NXM A;  1UYZ A;  2XVK A;  3GYD A;  5H9Q A;  3NV2 A;  4OHZ A;  4KWJ A;  3LA3 A;  3WW4 A;  5GKA C;  2E32 A;  3PMS A;  3ZR5 A;  3M3Q A;  1OOP B;  5FDB A;  2B45 X;  2ORZ A;  2UYA A;  5I0R A;  3BTX A;  2VY0 A;  2D6M A;  2YUE A;  2XOM A;  4AOC A;  1NUK A;  2UU8 A;  4M3C E;  4OYU A;  1W8T A;  3G6J B;  3PJY A;  4QPG A;  1IG0 A;  1QDC A;  1RIN A;  2X5I B;  1F5F A;  4N90 A;  2FQP A;  2WZ8 A;  2JG9 B;  5FYC A;  5C33 A;  4Z2W A;  3O1O A;  5GLU A;  2X05 A;  1XNT A;  5FZA A;  4UXA A;  4QXC A;  1WW5 A;  2UYB A;  3O12 A;  3WQB A;  5C71 A;  4LBK A;  2ZEZ A;  1UW8 A;  3AYC A;  2Z2S B;  3AX4 A;  5CEH A;  2ZGR A;  3H3U A;  5CG9 A;  1GWK A;  4QKF A;  3FHI B;  4QQH A;  5LEK A;  4HON A;  4LLO A;  2GSY A;  4R4Z A;  4AI8 A;  1RUF 2;  2XUM A;  4FPE A;  4CDW C;  2PEL A;  2W91 A;  3N7L A;  1QXR A;  4KGG A;  5FXW A;  3PVN A;  5DAB A;  3Q8C A;  2XBO 1;  4BXS V;  3KHC A;  2A73 B;  2VZQ A;  1UU6 A;  1Y4W A;  4K8R B;  1PVX A;  2E33 A;  5I0S A;  3KGL A;  4MET A;  4IGQ A;  3A23 A;  1S0C A;  3DKW A;  4GMP 0;  1HLC A;  1W0O A;  5FLH A;  5EZW A;  3UK9 A;  3POF A;  4LO8 A;  4RS5 B;  3KQ4 B;  3C7O A;  2HWD 3;  3ZM8 A;  1UL9 A;  5FMD A;  3VBF B;  4WM8 A;  1ZA4 A;  4XCB A;  4IGO A;  3LA2 A;  1W8H A;  1RUC 1;  3WUD A;  3N9Q A;  4XW3 A;  3O1V A;  2DU1 A;  2VMI A;  4A7Y A;  1W9Y A;  5L7O A;  3GCX A;  4LUL A;  4RGG A;  5FXX A;  1A34 A;  4LUM A;  1IS5 A;  1ZBE 2;  4BXF A;  2DUP A;  3ZN4 A;  1BXH A;  2XWB B;  3BPZ A;  5C6C A;  2XHK A;  1LOF C;  3ATG A;  4P9Y A;  4C1W A;  4FPJ A;  4XFI A;  1A8D A;  2MHF A;  3OYW A;  4Y5T A;  1CVN A;  4CP9 A;  1WCU A;  4XBQ A;  3LIH A;  4Q4X 3;  1VJ2 A;  4CCE A;  5DDJ 1;  2A71 A;  1AR9 2;  1F4H A;  3H7Y A;  4O61 A;  4Y5Z 0;  3VD7 A;  5BNP C;  3PLQ A;  3WW2 A;  3VZN A;  3S57 A;  2CV6 A;  3HPN A;  5FXZ A;  3AJZ A;  1J3P A;  4W50 A;  4Q26 A;  4HFS A;  5C8W A;  4YW5 A;  1IQA A;  1FPN 2;  2K0G A;  3MIH A;  4GH4 B;  4LBJ A;  1NCR B;  1OFN A;  1OA4 A;  1R09 3;  4AQT A;  2XVL A;  1OUR A;  1RVF 3;  4LA2 A;  3ZFG A;  3IM0 A;  4E27 A;  3HOB A;  5FZ7 A;  2VJX A;  1S0F A;  4XF4 A;  4ZU4 A;  2OQ7 A;  1DQ6 A;  2KXL A;  4XIO A;  3S6P A;  4CVU A;  4QB6 A;  2XKP A;  1HXS 2;  1W99 A;  2YFZ A;  5FUP A;  4CP2 A;  5EIY B;  5KXB A;  3WNL A;  1U5X A;  3FE5 A;  1O6U A;  1AL2 3;  3H0O A;  4RQP B;  3WG4 A;  4N7U A;  4AVS A;  4LIV A;  1DBN A;  2H0V A;  3GDB A;  4FPL A;  4CCC A;  4CEY C;  2WKK A;  1CAX A;  2BDR A;  3JU9 A;  4XHX A;  2C0Z A;  2G4I A;  3MLJ A;  1ASJ 3;  2FDI A;  2PQS A;  1CAV A;  1F35 A;  1UXZ A;  3P3P A;  4LO4 B;  3LB9 A;  4BB3 A;  4L92 A;  3EMR A;  3KCX A;  4Q4W 1;  2WAO A;  4YW2 A;  1CPN A;  3VHN A;  1RUJ 3;  4QQL A;  1JW6 A;  4XFH A;  4EYU A;  2PHF A;  1FOD 2;  4JZR A;  3WR0 A;  4OI0 A;  5FPA A;  1VAL A;  4WVW A;  3KMH A;  1MZE A;  1YFU A;  5FZM A;  5F3I A;  3VHR A;  3RZK A;  1VB2 A;  1W6M B;  3QCW A;  2ZGU A;  2GP3 A;  2YYO A;  4KG8 A;  2TUN A;  3Q9O A;  5I93 A;  1SCS A;  4YNI A;  3LZZ A;  4YW3 A;  2ZAC A;  2A6Z A;  4PI2 A;  1DGW X;  4PCR A;  5C4W A;  3WDY A;  3H8X A;  1VBC 3;  3UKN A;  3IPV A;  3WW1 A;  4PLO A;  1C5H A;  1LTE A;  2GNT A;  1VRH 2;  4ES8 A;  4F83 A;  4XFG A;  4XXA A;  4M3C B;  4D6S A;  4QKB A;  3T0D A;  4PBP A;  2I74 A;  1FMD 2;  4PLM A;  1R08 2;  4KU7 A;  4BK4 A;  4PIX A;  3AKQ A;  5AVP A;  5C8C B;  4XJ8 A;  4P9I A;  2Y0I A;  3N9L A;  1SPP A;  5DZF A;  4CCO A;  1N3Q A;  4N7I A;  4PDW C;  1JOD A;  4N43 C;  1W3V A;  1BEV 3;  2YXS A;  2JEN A;  4QX3 A;  3TN9 3;  1WCD J;  2RS5 3;  4ZS2 A;  2ZKL A;  1HRV 2;  3PVB B;  3BPS A;  1OXC A;  4XQW A;  2JKB A;  3RZL A;  2ZEX A;  3R4U A;  2VAU A;  4JKL A;  4XUO A;  4FXK B;  1C8M 1;  3DGT A;  4PBO A;  4DY5 A;  1AR6 1;  5E1R A;  4RN5 A;  4ZHN A;  2WYS A;  1OOP A;  4R9A A;  1GUI A;  1MS8 A;  4FTS A;  1YLL A;  2FD8 A;  4COW A;  2VVF A;  2X5I A;  1PHM A;  5LEJ A;  1IGO A;  2JG9 A;  2R06 3;  4OHY A;  4N9I A;  1A3K A;  2ZX3 A;  4H7M A;  4NWV A;  4E4H A;  5FKB A;  3TRS B;  4Y33 A;  1QJX 3;  2YPJ A;  4ISQ A;  4CXW A;  1VBA 3;  1VAV A;  1LOB A;  2B9U A;  2ORX A;  2PYT A;  3JQW A;  5A3P A;  5FZC A;  3BCW A;  2G1M A;  2A6V A;  2F6B A;  4FP2 A;  1D7P M;  4BE3 A;  2Q5T A;  4DIN B;  5FMO S;  2AAC A;  1WLT A;  1KFU L;  4LBQ A;  3GXU A;  4R9B A;  4CDW B;  1L7L A;  4WVZ A;  2ZGS A;  1C1L A;  4KH9 A;  1WBL A;  5D21 A;  5A7S A;  2W5F A;  5A7N A;  4LBN A;  3VB9 A;  3S7I A;  2P1B A;  5F6L B;  1TME 1;  3HIF A;  2JX9 A;  1AR7 2;  1FAT A;  5FP9 A;  4JQR A;  2HJI A;  4EN9 B;  4PF1 A;  5FY0 A;  4IEZ A;  1J1L A;  2RR1 1;  2LS6 A;  2R6Q A;  1PK6 B;  2ZX1 A;  2IWG B;  1VBE 1;  3MPP G;  4W65 A;  5FY5 A;  5CFD C;  1SLI A;  4HAN A;  4RS5 A;  5FZ6 A;  1W6Q B;  2E9Q A;  3AP7 A;  4GB3 1;  4M0N A;  3VBF A;  1W8F A;  1O59 A;  2XKO A;  2DCJ A;  2VZ1 A;  2ZMN A;  4MZU A;  2XJS A;  5GZF A;  2YHJ A;  5T54 A;  3THC A;  4YZ5 A;  5AFE A;  3M3O A;  2WLP A;  3ZIW A;  2Z79 A;  3W9A A;  2AR6 A;  3JBG 1;  5FRE A;  5JLV A;  2KR2 A;  3AZZ A;  1LHV A;  1ZRD A;  3B7M A;  4Y1Z A;  4UWD A;  2DCY A;  1V9U 2;  5E88 A;  1BVP 1;  1HV1 A;  1QGL A;  2DVB A;  3KZ4 C;  3DN7 A;  5CKQ A;  4AYU A;  5L9V A;  4LT5 A;  2RMU 2;  1LOG A;  3MV0 1;  3KCY A;  3PME A;  4RR3 A;  1HDK A;  4B3N A;  4IW3 A;  5F6K A;  2PAE A;  2BW8 A;  5FYI A;  1IQD C;  1KDK A;  3KV6 A;  4QPI C;  2RV9 A;  4HOO A;  4HL0 A;  4K9S A;  4D8M A;  4MG2 A;  4CUA A;  1NCR A;  4XVH A;  3ZKY A;  3HN1 A;  1H4G A;  1V6N A;  3POS A;  5FOJ B;  2CWM A;  1C28 A;  1RMU 2;  1TNR A;  2BU9 A;  2EID A;  3LDR A;  1XNC A;  4M0H A;  2VGD A;  4DRV A;  2R07 3;  4WBB A;  1K12 A;  4YZ1 A;  2X29 A;  2XQX A;  5FPB A;  4AVB A;  4CUC A;  4DXZ A;  2PHW A;  3ZXF A;  4N53 B;  4P9G A;  4QPG C;  4XBN A;  1WKY A;  2QQV A;  1KQR A;  3AZW A;  3A0N A;  5F7U A;  2C5D A;  3DL3 A;  1N1V A;  4LOS A;  2VMD A;  3KQR A;  5J3U A;  2F4P A;  1MS5 A;  1SHW B;  1W39 A;  1CAU B;  2BVB A;  4QGN A;  4RQP A;  5GLT A;  2DUQ A;  3VKM A;  2VXR A;  2PHL A;  2FCU A;  4CCL A;  4FSJ A;  1Q8Q A;  1XNK A;  1MPX A;  4Q29 A;  2OZJ A;  1TVG A;  5FZO B;  1GNZ A;  4K40 A;  2R1B A;  2QQU A;  2FCV A;  2PQQ A;  4H55 A;  2VBD A;  4L97 A;  2Y6G A;  1FI2 A;  2P5B A;  4QD2 A;  1JZ5 A;  1UO9 A;  3HVD A;  1UYP A;  1LEM A;  2GAU A;  2RS1 3;  4HK9 A;  1PO2 1;  1AHS A;  4Q4Y 1;  2XJP A;  3IAQ A;  3MDP A;  4ASK A;  4MGQ A;  3HNB M;  4IGP A;  5D8A B;  5FP8 A;  5IVC A;  2AYH A;  2JIG A;  2B4K A;  3CQO A;  5A3N A;  1JYW A;  1O5U A;  2I45 A;  2YDE A;  1HN1 A;  1UX7 A;  1Z0H A;  1SFY A;  1NT0 A;  4LHS A;  4A2U A;  1RUE 3;  5BUV A;  5JR7 B;  3W58 A;  4O7X A;  3LQC A;  3MGU A;  5A80 A;  3RS6 A;  1CD3 G;  1S0I A;  3KVA A;  4LMF A;  3VZO A;  3R0R A;  4M3C A;  2IFR A;  2VCM A;  3RMX A;  1TMF 3;  5F37 A;  2TBV A;  4OUE A;  1BLZ A;  3LSD A;  4GD4 A;  1QU0 A;  5C8C A;  4WM8 C;  3ZFF A;  3AL6 A;  1QJZ A;  4LNV A;  5LRS A;  3AJY A;  4N43 B;  3S30 A;  3TEZ A;  2WNE A;  5ACA 1;  4IEW A;  1RVF 2;  2W08 A;  1CX4 A;  4BQ4 A;  4DUX A;  5L7O C;  3S7E A;  1QQP 1;  4WM7 C;  1PM4 A;  3NNF A;  1BK0 A;  1DU3 D;  1CZV A;  4A42 A;  2BNM A;  1POV 3;  2J7M A;  4M3C F;  2HWB 2;  4CUG A;  5T5J A;  2WZE A;  4L11 A;  4HN0 A;  3MIE A;  1PIV 1;  4GMP 1;  4XTM A;  1QNW A;  4BQ5 A;  1JZ2 A;  4CCN A;  2IVJ A;  2R49 A;  3PUH A;  1RYY A;  1JZ8 A;  2RDS A;  2VUA A;  1UY3 A;  1KD7 A;  1VB4 A;  3H9A A;  4L99 A;  2UWB A;  3ZSJ A;  4A7Z A;  5FP7 A;  1MEC 2;  1X82 A;  5I0U A;  1C8N A;  2HWF 2;  1S2K A;  2AH2 A;  3OPT A;  3GZA A;  1UZW A;  1D4M 1;  1V6L A;  1QWR A;  2JB4 A;  3B69 A;  4LOT A;  3V64 A;  2BP6 A;  3GJB A;  2GME A;  2DTY A;  4AI3 A;  4XDQ A;  5T50 A;  2WRA A;  2CGN A;  2ZML A;  1RUJ 2;  5G05 L;  3ZXD A;  1V6K A;  2WZR 2;  1HRI 3;  3FHA A;  2PHT A;  2R32 A;  1JI6 A;  3KT1 A;  1T6B X;  4HXC A;  5LB6 A;  4EE2 A;  1DHK B;  4DRR A;  2D6K A;  2FDK A;  3VLB B;  3USU B;  3VL9 A;  1LUL A;  3H8R A;  3CHX A;  3CJX A;  4NHY A;  2WQZ C;  3APB A;  2E51 A;  2ES3 A;  4P9L A;  5BY5 A;  1K45 A;  2BBA A;  2IXI A;  3B93 A;  4TSV A;  2Q30 A;  5FMO L;  1UD1 A;  2Q8O A;  2EA7 A;  3ZIX A;  4CDW A;  3VUO A;  4FPH A;  4Q8K A;  1VBC 2;  2CU5 A;  2EIG A;  2BFU S;  5IT6 A;  1OQD A;  3ZPY A;  4I02 A;  4MSV A;  3C8X A;  5JZG B;  1B35 C;  3POE A;  1ND3 A;  1BZW A;  1US2 A;  3C7H A;  1AYM 1;  1H1M A;  4DUV A;  4UBH A;  1QJU 1;  3OPW A;  1RUI 3;  4K1Y A;  1MS4 A;  3JB8 A;  3ZYI B;  5DXD A;  2A3Y A;  4D6Q A;  1ZZ9 A;  2ARX A;  2ARE A;  1AYN 1;  4QX7 A;  1UMH A;  4Q1P A;  1O4Y A;  1PK6 A;  2A3X A;  4EQV A;  3MUZ 1;  3TOJ A;  2R16 A;  5KC6 A;  1W6O B;  2ZX4 A;  2XGX A;  1BEV 2;  4IET A;  2YC4 A;  2R04 1;  2J1E A;  3D0S A;  4YGD A;  4PT6 A;  3TN9 2;  1W6Q A;  3O1M A;  3UJQ A;  4AW7 A;  3BN6 A;  4B7E A;  4AQS A;  4QU2 A;  3I3Q A;  3GHN A;  5HCF A;  1RUF 3;  3ZMO A;  3ZOI A;  4ATE A;  3CLP A;  3RQ0 A;  5C4W C;  1U5I A;  2GC2 A;  2KM2 A;  1D2S A;  1ZYB A;  3AMP A;  4LKS A;  2B46 X;  4OHV A;  1LCL A;  4OHW A;  3MID A;  3VZJ A;  3DKQ A;  1YFY A;  3N35 A;  4YGB A;  5HXM A;  1RTV A;  4JKM A;  3NKG A;  4DB5 A;  2VG9 A;  5BYN A;  2R06 2;  4L2N A;  2DV9 A;  2ID4 A;  2YU1 A;  1NY7 1;  4Q4V 1;  1U5Y A;  3AVS A;  1NCQ A;  2WS9 1;  4EJR A;  4FOQ A;  1OPO A;  2J1U A;  1KXG A;  1NKG A;  5IWF A;  3BYW A;  2YB7 A;  1C5I A;  3JD7 2;  4IXL A;  1H8T B;  1F5J A;  2DCZ A;  1OPM A;  2WDB A;  2WO3 A;  1YEW A;  3WNK A;  1SLT A;  5FYS A;  3VDA A;  3FLT A;  4FFI A;  1IHM A;  2NZ9 A;  3H1M A;  1LOC A;  3VD9 A;  4M00 A;  2W47 A;  5A6X A;  4ARX A;  1FNZ A;  1JZ6 A;  1AX2 A;  1G9C A;  4N53 A;  1RUG 3;  2VVD A;  1UX6 A;  3IKW A;  3BOW A;  4W6Y A;  4BIF A;  1F8V A;  1YIF A;  2VOT A;  5JPN B;  1AR9 3;  2JG9 C;  1WW6 A;  5J96 B;  1OA2 A;  2QZ3 A;  2ZHN A;  3SCH A;  1AVB A;  1W3X A;  4CSW A;  4QXB A;  3LE0 A;  1CZS A;  1H30 A;  4XAB A;  1DQ4 A;  1D0G A;  2QQJ A;  2WT2 A;  1GMM A;  1IPK A;  1FPN 3;  2Y64 A;  4AEK A;  2GP5 A;  3PNA A;  1POV 0;  2ZTN A;  5GJ6 A;  3I2O A;  1W6P B;  5I8S A;  1IKQ A;  2DUR A;  1SBE A;  3KV9 A;  3E97 A;  1Q8V A;  3P5B A;  4XIK A;  5FLI A;  5D8A A;  3R6S A;  4RD7 A;  1OQ1 A;  1HXS 3;  2GN7 A;  3FC0 A;  1O4T A;  1RUH 3;  2OS2 A;  4DOU A;  1CGP A;  3NJV A;  1YQ6 A;  4RA0 A;  1OF3 A;  3FBM A;  4HKW A;  2BEO A;  3WDW A;  2GMP A;  4HZF A;  3CMG A;  1A6C A;  3WF0 A;  3N9O A;  1FV3 A;  4AGV A;  3VDD B;  1IS6 A;  4Y1X A;  3PUQ A;  5C7G A;  2XBO 2;  4NAM A;  3NJY A;  1ND2 A;  2AEZ A;  4W6X A;  1JYV A;  1GZ9 A;  4BLI A;  2V5D A;  1JYI A;  1QNY A;  2J1A A;  1UY1 A;  3D4K A;  4JX0 A;  3VBF C;  4QWN A;  1BBT 3;  4D7T A;  1FV2 A;  5CIR A;  2ZMK A;  5HCB A;  2EIC A;  1J83 A;  2JDZ A;  4EWD A;  5FRA A;  4WM7 B;  4BME A;  4JDN A;  2WR9 A;  2VNO A;  3I2J A;  3LDK A;  3N7J A;  4HVQ A;  5AC9 1;  1OVS A;  1SDD B;  2A1X A;  1RUC 2;  3DXT A;  1NXD 1;  4NID A;  4XMA A;  5L73 A;  2VQU A;  3EYP A;  1AZD A;  3S0M A;  3IN9 A;  1XB9 A;  1W04 A;  4COY A;  1ZZ8 A;  2HEY F;  3P6B A;  4FOV A;  2YBS A;  4XFC A;  4BWO A;  1FMD 3;  1PMJ X;  2D3P A;  2IZW A;  4RR3 C;  1EAH 1;  2EAA A;  5EPA A;  4YW4 A;  4AE2 A;  1R08 3;  1MS3 A;  3H8O A;  4NWW A;  1RUD 3;  2ZGL A;  3FLP A;  1MR5 A;  2JD4 A;  3OUI A;  1JN2 P;  4GWN A;  4E2G A;  4XF0 A;  4EV0 A;  1NCR C;  2J1V A;  3SIT A;  5FAX A;  1O5L A;  1NZC A;  4QDQ A;  5FOB B;  1DP0 A;  1WMF A;  2LTN A;  3CL1 A;  3NW4 A;  4B4R A;  1C57 A;  1MZF A;  1HRV 3;  3IAP A;  3PL0 A;  1DGR A;  5A6Y A;  3LCP A;  1MS0 A;  3JXS A;  3EJK A;  4AED A;  3QOP A;  5HV4 A;  4YFW A;  1UZ0 A;  3ACG A;  5LBE A;  5DMY A;  3POW A;  1RUE 2;  3I3M A;  1W2A X;  4IE7 A;  1DDL A;  5T3N A;  2JDN A;  4GIQ A;  4RQP C;  4BQX A;  4E4D X;  1B35 B;  2QQM A;  3TWI A;  2QJV A;  1VP6 A;  5JZG A;  4QGM A;  4N9H A;  4NHM A;  2ZGP A;  3F2Z A;  4OUS A;  4KWL A;  3AP6 A;  3K48 A;  4MGY E;  1UNB A;  3I59 B;  5K9Y A;  3MO4 A;  3L2H A;  3RMY A;  4QQ2 A;  3UYJ A;  4MVT A;  4TYS A;  1DIW A;  2C1F A;  1W6O A;  2J1S A;  3ST7 A;  3UGG A;  5JI7 A;  1RXG A;  2JDK A;  2BUK A;  4QAW A;  4NPL A;  4Q4W 2;  4XET A;  4XFA A;  1SFN A;  3ZXA C;  5L19 A;  2EXJ A;  1JYT A;  5JVV A;  5KHH A;  4M4P A;  5C4W B;  4ZON A;  1P8J A;  3FLR A;  2DU0 A;  4TLF A;  1EPZ A;  3IPV B;  4LJH A;  3FUQ A;  1YI9 A;  1WGP A;  2LM3 A;  4P5H A;  4Y5S A;  4GQ7 A;  1NE4 A;  3OSD A;  4GXL A;  4K6B A;  2RDR A;  4ZZ8 A;  2ZEW A;  4YPJ A;  2PTM A;  3KWV A;  1AR7 3;  5KBF A;  2VZT A;  5EV7 A;  5F1R A;  2HBU A;  4MGI E;  1CX1 A;  1YWK A;  4L8Q A;  3SEE A;  3ZN6 B;  4BIS A;  4D94 A;  5IYY A;  3JZV A;  1PVC 1;  2HEV F;  3UKT A;  3GAL A;  3WG2 A;  3ZFF C;  5C8C C;  1W0P A;  1ZX5 A;  4K8F A;  2JE7 A;  3MLL A;  1HRI 2;  5CZK A;  1GV9 A;  1ZZB A;  3NQH A;  4BCU A;  5JXH A;  4K1Z A;  2JD9 A;  1OA3 A;  2WLQ A;  3ME2 A;  1UPI A;  2DTW A;  1UWW A;  2IXC A;  1O7F A;  4AHW A;  1XJA A;  3AZV A;  3NJX A;  2B8M A;  1H8T A;  1QMJ A;  3U10 A;  1W0N A;  5FZE A;  2LRO A;  3ZDV A;  4OMC A;  4W4Z A;  4NII A;  3WX5 A;  1ONA A;  2ET7 A;  4B4Q A;  2PMW B;  3H50 A;  3WNM A;  4C90 A;  4JTN A;  4IE5 A;  3AC0 A;  4QQP A;  1V9U 3;  2VO5 A;  1W06 A;  1C8M 2;  2Y6J A;  1H6X A;  3ES4 A;  3KF5 A;  5LK5 A;  4E2S A;  1O3S A;  1OUX A;  4DIQ A;  1RUI 2;  2RMU 3;  1J3R A;  1YXW A;  3BU7 A;  4LBM A;  2WN2 A;  2B39 A;  1SMV A;  3N3H A;  3K2O A;  3E5Q A;  3NAP C;  4KU8 A;  4XF3 A;  4CEW B;  2CGO A;  2PFW A;  2ZHK A;  3THD A;  4QQO A;  3WNO A;  4AVC A;  1IKP A;  4GJY A;  1H1A A;  2JDU A;  4RGA A;  3D6E A;  4LEJ A;  1LOD A;  4Q8L A;  5JXG A;  2PHD A;  4IEQ A;  4LBQ D;  4LBQ B;  1W6P A;  4AAX A;  3A0K A;  3HBZ A;  3QAC A;  4E9K A;  5KHI A;  1RMU 3;  3RYK A;  5DUX A;  1ZBA 3;  1RB8 G;  1LHU A;  5IK7 A;  3AP4 A;  5LAS A;  1NLR A;  1GZC A;  1GZW A;  1RC6 A;  1CPM A;  2NM1 A;  2W3J A;  4QM9 A;  1JZ3 A;  2MEV 1;  4URA A;  5FZK A;  3HNM A;  1ND3 C;  3WP4 A;  3J7N A;  2WUH A;  2BNO A;  1TEI A;  5E6H A;  5J48 A;  3W5N A;  4UYB A;  2P6C A;  2BTV C;  3H3Z A;  5DAP A;  3VDD A;  1W05 A;  4YVS B;  4FP3 A;  4D6R A;  4LKE A;  1PK6 C;  3CU7 A;  1TME 2;  2GMM A;  5FWJ A;  3I2K A;  5FPV A;  1I5Z A;  4FT8 A;  3I2H A;  2JDH A;  4IE6 A;  5DQ0 A;  1W8U A;  2RR1 2;  4LHL A;  4HN1 A;  3PVE A;  4XAE A;  3ZXJ A;  3MLK A;  1S0D A;  1KS4 A;  3I4I A;  4Q0Q A;  4AFB A;  3MZH A;  3N9N A;  4WM7 A;  4E4Z A;  2HBT A;  2A6Y A;  3OCP A;  5FBZ A;  1DF0 A;  4GB3 2;  3BTA A;  5IUQ A;  4RL7 A;  2DFC A;  1I9R A;  1LJ7 A;  1ZRR A;  1RUG 2;  3HQU A;  4G4F A;  1LGC A;  3VV1 A;  2GND A;  2QNK A;  3HR9 A;  4RR3 B;  1UY0 A;  3TBD A;  2VZV A;  3JBG 2;  5CBL A;  5A1A A;  4HK8 A;  4Y1Y A;  3NNM A;  1NCQ C;  2XWJ B;  4OUM A;  5C5T A;  1Q8O A;  2VTF A;  4MGK E;  4Q0U A;  4FAG A;  1FYU A;  2WT0 A;  2VZR A;  3HQX A;  5T52 A;  1OI6 A;  5BNO A;  3JQX A;  4UFH A;  2YGM A;  3LEM A;  3IWZ A;  3NRU A;  4UFK A;  3ZPO A;  5FQ0 B;  1V70 A;  3T2T A;  4UOJ A;  4AQ2 A;  4HPK B;  2QKD A;  2HWE 3;  1ST8 A;  1SCR A;  3ABZ A;  3N9M A;  1LOA A;  2W87 A;  2GC0 A;  4Q1R A;  2HWB 3;  3GGL A;  4MO3 M;  5LCW L;  1GSL A;  2PAM A;  4N53 C;  1RUH 2;  1WLC A;  4CXY A;  1UF2 C;  5EP9 A;  2GU9 A;  1NX9 A;  4YM1 A;  4XE9 A;  2W52 A;  2QCS B;  2WN3 A;  1QKQ A;  4O9G A;  4RHV 1;  1XSR A;  1GOF A;  1B35 A;  1MEC 3;  4H3W A;  2HWF 3;  1W03 A;  4GAZ A;  3RDI A;  2EXH A;  3PUS A;  5I0T A;  2XLA A;  2QDN A;  4OFG A;  1PO1 1;  3SH5 A;  1E5S A;  5HV0 A;  1Q8P A;  3SKV A;  1H9P A;  4MHR A;  1K5J A;  5A3L A;  4AFM A;  1DLL A;  5FO8 B;  3LPF A;  2WZR 3;  3E5X A;  3I59 A;  1BBT 2;  3FFQ A;  4JHT A;  1UIJ A;  2I2S A;  5LA9 A;  1XC6 A;  5EFU A;  5FZ4 A;  3OTF A;  2ADD A;  2XJV A;  5FYB A;  3SC7 X;  5BPX A;  4FAH A;  1DZT A;  1GU3 A;  1L3J A;  2OPK A;  2WT1 A;  1DYO A;  5D8A C;  5K0U C;  2DDU A;  5A6Z A;  5HBA A;  1R1A 1;  3OOX A;  4Z92 B;  1CAW B;  2E26 A;  1EV1 1;  1DYP A;  2BGO A;  4Q4Y 2;  4QHB A;  4BMB A;  5C3S A;  5IVE A;  1RGS A;  2RDQ A;  3MBW A;  1H2M A;  1GR3 A;  2DF7 A;  4FFG A;  3W21 A;  4Z2A A;  3MFC A;  1RXF A;  3WCS A;  4M4R A;  5H9R A;  3AXD A;  3CEW A;  3DUI A;  2VZP A;  1KJR A;  1PZ9 A;  4JGY C;  3WSO A;  2PXJ A;  2XL7 A;  5F5A A;  3WDX A;  3MIG A;  4JV4 A;  4YSF A;  2JJ6 A;  1X7N A;  1JXN A;  4XUP A;  1ND2 C;  4AF9 A;  1X50 A;  1OKQ A;  3J8F 1;  1RUD 2;  3ZN6 A;  4ARY A;  4WZC A;  3TNQ A;  3ZFF B;  5JWP A;  3MYX A;  2DCK A;  4DEQ A;  2YV8 A;  4JC1 A;  3C2U A;  3LEK A;  2CNA A;  1X9T A;  1LHW A;  2C9K A;  2HH9 A;  2ADE A;  1LOE A;  2QQK A;  4C0B A;  5I8T A;  3T2O A;  4GUL A;  3DYO A;  5GLW A;  1BMV 1;  2EAK A;  3MIC A;  3M3I A;  3SQO A;  2XB6 C;  1Z7S 1;  2VL4 A;  5JI9 A;  4D0Q A;  1CON A;  1E5H A;  2VOK A;  3LIG A;  3CJI A;  2W0X A;  2WFF 1;  2Y26 A;  3AMM A;  3ASI A;  3IDA A;  4A44 A;  5JSR A;  2VZS A;  4HET A;  3UGF A;  4OHX A;  1LAJ A;  2CY6 A;  1QQP 2;  1LHO A;  3OD0 A;  3H42 B;  3RWN A;  1GWL A;  1R1Z A;  3B94 A;  4YAR A;  5DZG A;  4YM3 A;  4G9S B;  1YI7 A;  5M0T A;  1XXN A;  2VQT A;  1G6N A;  4GZ9 A;  1KIT A;  2RHP A;  3NAP B;  3ZYG A;  3ACI A;  4KBZ A;  2JG8 A;  2Q1Z B;  4XYX A;  2MNG A;  2P17 A;  4XEZ A;  4CEW A;  2WO2 A;  3WG3 A;  3OBA A;  1VMF A;  4Q2F A;  3ZSE A;  1PGL 1;  5GLV A;  1D4M 2;  1N1Y A;  3JD7 3;  3N9P A;  2RM2 1;  3U0Z A;  3GZT B;  2Z5W A;  2WQ4 A;  2YC0 A;  3ZYP A;  2VQ0 A;  4HVO A;  4Y4R A;  1U12 A;  5F3G A;  2R30 A;  4C8D A;  4YRD A;  5I8Y A;  4AED C;  2ZX2 A;  3Q8F A;  3KV4 A;  3VBH B;  2C6S A;  2RJK A;  1SZB A;  1STM A;  3CF6 E;  3ZYH A;  4YG3 A;  4ISR A;  1JYC A;  1ND3 B;  3NNL A;  2WNO A;  4M01 A;  4V1P A;  4QB2 A;  4AG4 A;  5HCA A;  5JZG C;  3O0X A;  2OKX A;  4S2G A;  1XNA A;  3ILF A;  1D4V B;  4QT6 A;  2VOV A;  1NOV A;  5APA A;  3CBN A;  3WNP A;  3HT1 A;  1QJY 1;  1Y9M A;  4NE9 A;  5FPZ A;  5FZ8 A;  2VZ3 A;  4YVS A;  3IT8 A;  5GZD A;  4TXW A;  5FZF A;  4X6R B;  1ULG A;  5BNQ A;  3III A;  3M4F A;  3NV4 A;  5DUU A;  3HMY A;  1SEF A;  3IIA A;  1LES A;  1UU4 A;  3QD6 A;  2R1D A;  4RGK A;  3ZFE B;  4CXX A;  2VR4 A;  5BV6 A;  3CNA A;  1HIX A;  1W2T A;  2BBV A;  3ON7 A;  2Q4S A;  2Q8D A;  1ZA7 A;  2P34 A;  2R04 2;  2W1W A;  4RSU A;  5IK8 A;  2OVU A;  2A6X A;  2PLV 1;  3OG2 A;  5AVA A;  3D0J A;  5IK4 A;  2NP0 A;  1GAN A;  1CQ9 A;  3WF2 A;  3LOB A;  1VBB 1;  2VQA A;  4AVV A;  3MHZ A;  1ZBE 1;  1X8M A;  5C9A B;  2XBO 3;  1NCQ B;  1UCX A;  1PX4 A;  3N4M A;  4E4S A;  1OD5 A;  3URF A;  5A3W A;  4B7K A;  1XYP A;  4SBV A;  4CDX B;  4A7K A;  1PX3 A;  2Y6H A;  4N8M A;  5FKC A;  3SCF A;  2FDJ A;  4JDM A;  3MEP A;  1N1T A;  3ILR A;  2WFP A;  2FHR A;  4IL7 A;  4UAP A;  3WF4 A;  5KHK A;  3LF7 A;  2E7A A;  4QXH A;  3SIS A;  2D3R A;  5L9R A;  3T4V A;  4Q4V 2;  1H8T C;  4FPY A;  3SLI A;  3Q8E A;  1RIT A;  2XUE A;  5FQ0 A;  2GAL A;  1ZBA 2;  5CNA A;  2DYC A;  2VW0 A;  4HPK A;  5GLZ A;  5A3U A;  1UZZ A;  1C4R A;  3L2Y A;  5EWS A;  1RUC 3;  1WLD A;  5F2W A;  4XC9 A;  4CP0 A;  2RE9 A;  2XML A;  5F9T A;  1XU1 A;  4YG0 A;  4IEX A;  3GJA A;  2GC3 A;  5FTT C;  3T0A A;  1E57 A;  3AP9 A;  3NVC A;  1CJD A;  5CIS A;  1DGW A;  2D98 A;  3HN3 A;  2P3K A;  4FQZ A;  1UOB A;  3LOI A;  4IV3 B;  3LEI A;  1M06 G;  1RHI 1;  4Z1V A;  4HKO A;  4Y3O A;  1W9F A;  3I2G A;  2OYZ A;  4YM0 A;  3VHP A;  3UT0 A;  5DDJ 3;  1OHF A;  4NPM A;  3PTY A;  1VE0 A;  2QQN A;  3M7A A;  2SBA A;  3MF6 A;  2CWS A;  1DG6 A;  1JUH A;  2A7A A;  1UAI A;  2Q1F A;  1YC6 1;  1IG3 A;  3LSE A;  3LPG A;  1JZ7 A;  4FI9 A;  3WVJ A;  5K0U B;  2UY9 A;  2EAL A;  5FZG A;  3MIB A;  4MYE A;  4LHN A;  1FOD 1;  1CAW A;  1ACC A;  3IZO A;  3BKZ A;  1PGW 2;  1AR8 1;  1M4W A;  1GLH A;  1QJF A;  1K42 A;  1LEC A;  1UZV A;  2D44 A;  4JTO A;  5KWR A;  4JGY B;  1C3H A;  4P9J A;  4YWA A;  3VDD C;  1K5M B;  2O8O A;  1ND2 B;  2NYY A;  4UFL A;  3AFG A;  5JIA A;  4S2D A;  3P3N A;  2IXH A;  2ZGQ A;  1QJE A;  5FZ3 A;  2VH9 A;  3J7M A;  1O91 A;  2OII A;  1VRH 1;  5LA1 A;  5DAW A;  3H8U A;  4P9X A;  2WAA A;  2EXI A;  1AXZ A;  1V0A A;  4U36 A;  2JDP A;  5FCC A;  4ZZ5 A;  4Q4W 3;  1W28 A;  5EJZ B;  5E8A A;  5FPX A;  2HWE 2;  3GHM A;  1KEX A;  2FDG A;  3CZU A;  4QXK A;  1HQN A;  1NQD A;  1SLL A;  3AK0 A;  1JHJ A;  5SV5 A;  1WD4 A;  5FYV A;  1KDM A;  1W9S A;  5FMB A;  1H2L A;  3DEM A;  2RJL A;  3AYD A;  2R0H A;  2DVA A;  1IPS A;  2PHU A;  2K46 A;  3LWC A;  3OGR A;  5AC9 2;  4MGT A;  4LIT A;  2Q1M A;  4D69 A;  5CAD A;  1YQ8 A;  2VMG A;  1QH7 A;  1W6N A;  1JZ4 A;  3W5M A;  1HW5 A;  1N1S A;  1URX A;  2UWC A;  4A41 A;  5LWB A;  2GC1 A;  1XND A;  2ZX0 A;  5A32 B;  4WVV A;  1GP5 A;  1CES A;  4QX8 A;  1ZRC A;  3NAP A;  2W9X A;  2RS3 1;  5FZ1 A;  4QHZ A;  2OXB A;  2ZS6 B;  1L7Q A;  5BNO C;  4KI5 M;  5IVV A;  1ZRI A;  5IAX A;  1EAH 2;  3JUU A;  2P3J A;  4CU9 A;  1FT9 A;  3VBR C;  2ZGT A;  1BK1 A;  4HT1 T;  1O8P A;  1DCS A;  5LY2 A;  4A6O A;  5T5O A;  1ENX A;  1MVQ A;  5C5U A;  1NA1 A;  4LA3 A;  4AED B;  3RZG A;  3ENR A;  4RYD A;  4JDO A;  4UFM A;  1LHN A;  1VBD 1;  1PGS A;  2X09 A;  4ZKT B;  1G8W A;  4R9D A;  5FUN A;  3VBS A;  3VBH A;  1AUY A;  2E31 A;  3T09 A;  5IVB A;  4YW1 A;  4DNY A;  4FO9 A;  1PMH X;  1T6G C;  4HVR A;  5A3M A;  3OGS A;  1OLQ A;  2IXL A;  1SBF A;  3I3B A;  4GWM A;  3VZL A;  1C8M 3;  1AR6 3;  2TEP A;  2D5F A;  5ABJ B;  1QHD A;  3K3N A;  1DQ1 A;  4BOW A;  3RYR A;  1COV 1;  1O3Q A;  5DAQ A;  3J7H A;  2ARA A;  2AC1 A;  5H9P A;  5FYY A;  2WO7 A;  3BAL A;  4ES9 A;  4ZS3 A;  2YRO A;  4GWJ A;  3DYP A;  4MOA A;  1WW7 A;  2C24 A;  2W2I A;  2WSV A;  4FOY A;  3OF1 A;  2VCA A;  4L9B A;  3RWK X;  4EN6 B;  1OF4 A;  2D40 A;  1VLN A;  1AL0 G;  2HWC 1;  5FO7 B;  3VDC A;  1LKN A;  3ZFE A;  2CHH A;  4Q0V A;  5A33 B;  2NPI A;  4Q5O A;  1GQH A;  4XFB A;  5FZ9 A;  4AHX A;  3RG0 A;  3WHT A;  2D6P A;  2ARC A;  4HMZ A;  2PAK A;  4LE3 A;  2JE9 A;  3QLQ A;  3QH6 A;  4QX5 A;  4RFR B;  4Y20 B;  4AXO A;  4K3U A;  1FAY A;  3GM8 A;  3WP5 A;  2BPA 2;  4YVW B;  5T55 A;  3AB0 A;  1OFS A;  1WUV A;  2JKX A;  3U78 A;  3E6B A;  2HYK A;  2V4A A;  3TAY A;  1YQ5 A;  4GJZ A;  1S0B A;  4QDR A;  5A70 A;  5KXD A;  2R7E B;  3NKT A;  4G3Y C;  1J59 A;  3KHB A;  5H9S A;  5C9A A;  3V56 A;  1TME 3;  1WCK A;  2WAB A;  1HB2 A;  1K3I A;  4XBL A;  3MW3 A;  4XFF A;  4CDX A;  2F17 A;  3KVB A;  2E53 A;  3RPQ A;  3M8L A;  4NPR A;  2RR1 3;  3KB5 A;  1UXX X;  3U11 A;  3PDQ A;  4GKY A;  4XHB A;  4B1L A;  3BIE A;  3J26 N;  1PVC 2;  1JH5 A;  1S1A A;  1VBE 3;  1G9D A;  2G9Z A;  2IXK A;  3OGG A;  4B29 A;  5F3E A;  1A8M A;  5DUW A;  1TG7 A;  3CJI C;  4XQD A;  3WY6 A;  1TQ5 A;  5FO9 B;  1PZ8 A;  3Q8A A;  2BER A;  4GB3 3;  2W94 A;  1H4H A;  2HKX A;  2NMO A;  3DF0 A;  4OVE A;  2Y8K A;  1JS9 A;  4IV1 B;  4JRA A;  1UMI A;  4YLZ A;  5GM0 A;  2NQY A;  4D7S A;  5CU1 A;  5JSP A;  4X8P A;  3MIF A;  2YC2 A;  2D6O X;  1US3 A;  2HLE A;  3ZLI A;  1SLB A;  2HEW F;  2QBX A;  1HB4 A;  2VOX A;  5L9B A;  1S0E A;  3JBG 3;  4I01 A;  1BVV A;  2AUY A;  1WME A;  2JG8 C;  3B5L B;  2QQW A;  4Y4Y A;  1JOP A;  2PHR A;  4CEW C;  1OMI A;  4IV3 A;  1OC1 A;  4H7L A;  3WNN A;  2P2K A;  2KD7 A;  3UJO A;  3OJB A;  4QX2 A;  3WDT A;  2DFB A;  3WF3 A;  1BJQ A;  3KT7 A;  4BU2 A;  3OY8 B;  1ULO A;  4YGC A;  2DUO A;  1YNA A;  1GZW B;  1ALY A;  4BZ4 A;  3IDE A;  4XUQ A;  2D93 A;  4R8H A;  2HWD 1;  4E2Q A;  4IDZ A;  5K0U A;  3SCG A;  1MQT B;  3HD8 B;  3PIG A;  3RZH A;  4AZZ A;  5I91 A;  1UZY A;  1CR7 A;  4XUN A;  3ROU A;  3T2Q A;  1LB2 A;  1Y7B A;  2G9F A;  2N7G A;  3OBR A;  3ZYF A;  1IOA A;  1SQ4 A;  1JYN A;  5CG8 A;  5FYU A;  1YJL A;  3WP6 A;  4OMD A;  5JXI A;  3M3E A;  3RJ2 X;  4JGY A;  5CKN A;  4COU A;  1SLC A;  3LD8 A;  4UW6 A;  2MEV 2;  1K5M A;  2V72 A;  4YVS C;  2GNM A;  1LU1 A;  1NLS A;  1UOG A;  1OVP A;  2YBK A;  3GNE A;  3MF9 A;  5FUI A;  3AZY A;  3R4D B;  3ZYB A;  2ZAB A;  4NRM A;  4TN7 A;  4Q4X 1;  4FPC A;  1CIY A;  4C1X A;  2ETE A;  3AXE A;  1QOO A;  3K75 B;  4ERO A;  4XF9 A;  1WWY A;  3VBO B;  1XNB A;  3BTZ A;  1I3H A;  1KJL A;  3FMG A;  5CYY A;  3SXW A;  3K77 A;  2DCT A;  2JDM A;  3K3O A;  4S2H A;  3GCW A;  3WXP A;  1D2Q A;  3HAG A;  3ELN A;  1LEN A;  2CDP A;  1H9W A;  1R09 1;  1PO2 3;  3GZE A;  3NV1 A;  4MGS A;  4Q4Y 3;  4XJA A;  3I8T A;  3ZKU A;  1HB1 A;  1RVF 1;  3FFZ A;  4PHZ A;  4A45 A;  2FDF A;  1AXY A;  5ISL A;  3FBY A;  1TZO A;  2VU9 A;  3WF1 A;  5BNN B;  5HI0 A;  3ETP A;  3ZVX A;  1W8O A;  4BH9 A;  5JIU A;  2ZBJ A;  1V6M A;  5IVF A;  5FK8 A;  1GKB A;  4Y26 A;  3BOD A;  5LAT A;  4OLL A;  2J1R A;  4D7Y A;  3MW4 A;  1AL2 1;  4WVM A;  5A32 A;  5BNO B;  5CFC C;  1ULC A;  5DDJ 2;  3BUC A;  4EWA A;  4BA6 A;  3VBR B;  4NRQ A;  2ZAH A;  2OT7 A;  3IDB B;  4IEY A;  1EY2 A;  1ASJ 1;  1C1F A;  2ERF A;  3KD4 A;  5FMC A;  1UQX A;  2OUJ A;  1Y43 B;  3DCQ A;  3I3D A;  4XXP A;  1RUJ 1;  3ORJ A;  5ACA 3;  4KMQ A;  4YW6 A;  2D6L X;  4YG6 A;  1Q5O A;  3JB4 C;  4LK7 A;  4QMA A;  4YFZ A;  1O3R A;  3GBG A;  4CCM A;  1ODM A;  1QQP 3;  1OT5 A;  5LY1 A;  4H2A A;  2H6B A;  1Q56 A;  1T2X A;  4CDQ B;  5DZE A;  3OUJ A;  1PIV 3;  4GMP 3;  2OQ6 A;  4LXL A;  3WOG A;  2RG4 A;  5FZL A;  5ABJ A;  1ULF A;  1HX6 A;  4BM8 A;  4NHL A;  1RUN A;  1VBC 1;  4DXS A;  3HEI A;  2JXA A;  3ITQ A;  4MV2 A;  5K4L A;  1YJK A;  3H7J A;  4V2W A;  3VZM A;  4MXW B;  1EUT A;  1D4M 3;  1YFW A;  4I30 A;  2JIJ A;  4LIU A;  4QKD A;  5DG2 A;  1E5I A;  2XJT A;  5A3O A;  1CWP A;  3CDZ B;  5EYX A;  2O0O A;  4EN7 B;  1LED A;  3S5Q A;  4OQ8 A;  5IVY A;  3WNX A;  2J1T A;  3EBR A;  3VZK A;  2CL2 A;  4UT5 A;  5A33 A;  2O8Q A;  2BJS A;  1HJG A;  1BEV 1;  1UN1 A;  1W2N A;  2VUL A;  3FWE A;  3KT4 A;  3NST A;  4KL1 A;  3TN9 1;  4IEO A;  2D6N A;  2RS5 1;  3M3C A;  5G04 L;  4Y20 A;  3TEW A;  1UY2 A;  2WQ8 A;  4O65 A;  5T5P A;  4COV A;  5F5Q A;  1J1T A;  4I3G A;  1EV1 2;  1AXK A;  1VIW B;  4FFH A;  1W90 A;  2WA4 A;  4YVW A;  3WP3 A;  3AKP A;  2PN5 A;  1OH3 A;  1PMI A;  2AZ5 A;  1NLQ A;  2WNU C;  4XAA A;  1WBF A;  4HBN A;  2WII B;  3AKR A;  4UW4 A;  2FDH A;  3RSJ A;  5T5L A;  2JB8 A;  4ZPI A;  1AYM 3;  3H1Y A;  3WQ7 A;  2F4L A;  1QJU 3;  2QQO A;  4GA9 A;  4Z07 A;  5FYZ A;  1R64 A;  3PIJ A;  3J8F 2;  5CB7 A;  4CP1 A;  4ZXK A;  3CIH A;  1AYN 3;  2R06 1;  2CAV A;  4BK5 A;  4UF0 B;  3ES1 A;  3CJI B;  1QJX 1;  5EXO A;  3FJS A;  1VBA 1;  2R0F A;  3RGB A;  4DPN A;  1Q43 A;  1OD3 A;  2BWC A;  1W2U A;  2R04 3;  1W9W A;  1WCS A;  2XJR A;  3A4U A;  4FPF A;  5FZB A;  1YRZ A;  1NE6 A;  3TEY A;  1BMV 2;  3WEZ A;  5JDB A;  4IV1 A;  1RED A;  4Y24 A;  1UOF A;  2E7T A;  3SHR A;  2A5Z A;  4B8E A;  4XOG A;  3T08 A;  3T1L A;  1DQ5 A;  4XDP A;  3VHO A;  2WFF 2;  1AF9 A;  3MV1 1;  4S2F A;  5FLJ A;  1LGN A;  1RJ7 A;  1AR6 2;  2FBE A;  3RJR A;  2ZZJ A;  2RJ2 A;  2W95 A;  3LEG A;  4AEM A;  4IE0 A;  4BJ0 A;  2VZO A;  2VNG A;  2JG8 B;  5FZH A;  4CUB A;  3VDB A;  2WC2 A;  4AGG A;  2OZ6 A;  2RDN A;  3KF3 A;  1W2O A;  2BQP A;  5IJR A;  2WA3 A;  4KNC A;  1UOJ A;  3ZXK A;  4MX3 A;  1GYK A;  4Z8B A;  1LNS A;  1EPW A;  1JTZ X;  3AFK A;  4UW5 A;  4ASM B;  5CAZ A;  4Q4V 3;  2YZ4 A;  3VKL A;  2CSG A;  1NA1 C;  2WS9 3;  1KS5 A;  3GZU C;  2C26 A;  2D97 A;  4BYY A;  4DMI A;  3OY8 A;  3WV6 A;  3RNS A; 
#chains in the Genus database with same CATH homology
 1OUR A;  2VUC A;  2BP6 A;  5A6X A;  2JDY A;  2WRA A;  2VNV A;  2WR9 A;  5A6Q A;  1OUX A;  2JDP A;  2JDM A;  1OVS A;  5A70 A;  5A6Y A;  1UQX A;  2JDK A;  1OXC A;  2BOJ A;  2BV4 A;  3DCQ A;  5A3O A;  5A6Z A;  2JDU A;  5HCH A;  1UZV A;  2VUD A;  2JDN A;  2BOI A;  1W8F A;  4CE8 A;  2JDH A;  3ZDV A;  4UT5 A;  1GZT A;  1OUS A;  1W8H A;  2CHH A;  2XR4 A;  4AOC A;  1OVP A;  5D2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...