5CU1A

Crystal structure of dmsp lyase dddq from ruegeria pomeroyi dss-3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
197
structure length
197
Chain Sequence
TDPAFQNLLAEFQALHAREPALAGFVALPDSLTPQPVTPVRIPPAALMESDPDLTTTAYAAIRDAFIAAGAVAQWRLTYQGSRLGADFMDRFACYCLIGEGGPFASDSLAAYVVYMPAGLYYPFHQHPAEEIYFILAGEAEFLMEGHPPRRLGPGDHVFHPSGHPHATRTYDRPFMALVLWRGDLETAPVLTYPEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DMSP lyase
publication title To be Published
rcsb
source organism Ruegeria pomeroyi (strain atcc 700808 / dsm 15171 / dss-3)
total genus 46
structure length 197
sequence length 197
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cu1A00
3EQEA 1ZZCA 5KBFA 2VPVA 4DINB 2XLFA 4XFHA 3UKNA 4BHPA 1X82A 1GQHA 4EWDA 3H7JA 5CVRA 1NE6A 2E9QA 1DGRA 2I45A 4H7LA 4BYYA 5I93A 4XFBA 5FQ0A 3TNQA 2OPKA 1YFYA 2MNGA 1CAWB 3R6SA 1RUOA 4LA3A 3FFQA 3HT2A 1ZZ8A 2BEOA 1O3SA 4UBHA 5JSRA 4JVAA 3D82A 5I0RA 2H0VA 1J59A 1DZRA 3NJZA 3BALA 1LR5A 4JTOA 4MGIE 3SCHA 2PHLA 4XF3A 4LUMA 1QXJA 1OFNA 4X6RB 1UIJA 3PLQA 5E16A 4P9GA 3NW4A 3BPZA 4O9GA 3DV8A 3H1WA 4LLOA 3RNSA 5BY5A 2CGPA 4QGNA 4QXKA 5LRRA 4Q0QA 4HVOA 1EP0A 3OCPA 5I8YA 3ETQA 4QMAA 3DKWA 1ZRCA 4AXOA 3L2HA 3PVBB 2GC2A 4Q0UA 1CAUB 1FT9A 4QGLA 4LULA 2B8MA 3WW2A 1OMIA 4IEZA 1FXZA 3FJSA 4AVBA 5EZWA 5J3UA 4AQ6A 4WZCA 2PA7A 2GZWA 4Q0VA 2UYAA 4NVPA 5D1IA 2Q4SA 3QOPA 3MZHA 2ET1A 2UY9A 3S7EA 3CJXA 3KGZA 1U12A 2PHDA 2K0GA 2Y0OA 4I0AA 1YFXA 4IESA 1IPKA 3HQXA 3MYXA 1Y9QA 2IXHA 4AVCA 5BUVA 2WC2A 4I3PA 3UKVA 4LEJA 4EWAA 1YFUA 4FT8A 3DL3A 5I8TA 5FLHA 3IDBB 1PM7A 3USSA 4FAHA 1XE7A 3IDCB 5KHGA 4IEXA 4IEPA 3LA7A 4IEWA 1ZVFA 4MV2A 4I01A 1OD5A 2PTMA 2K9ZA 3E97A 1H1MA 1CGPA 2BYVE 4WBBA 3KGLA 3OTFA 4MGYE 3NL1A 4XF1A 1ZZ6A 4B29A 5T3NA 4BIFA 4EV0A 3EBRA 2PAEA 5LEJA 2IXJA 3CLPA 5FCCA 4XF9A 2BNNA 4FBFA 2P17A 1FI2A 3RZZA 4IEYA 1SFNA 2F4PA 1YWKA 3JZVA 4JV4A 4OLLA 5FQ0B 2D40A 2CAVA 2Q30A 1Q43A 4N9IA 3O14A 4XFAA 4OFGA 1ZRRA 1J58A 1YFWA 2Z2SB 4R8HA 3U11A 1WGPA 4YYOA 2KXLA 3GYDA 3U0ZA 2GC0A 4HMZA 1Y3TA 1O5LA 2EAAA 3H3UA 4YARA 2QVSB 4QM8A 4MZUA 4AVAA 3ES1A 1XE8A 2D5FA 4F8AA 2HJIA 1UIKA 2HKXA 1VJ2A 1X7NA 2GC3A 3WW1A 4IEUA 2FQPA 3S7IA 4L11A 3I7DA 1L3JA 2UYBA 3I54A 4A2UA 3ES4A 5FDBA 1GQGA 3EHKA 1I6XA 1EY2A 4QM9A 3UKTA 1ZZ9A 4ONUA 3E6CC 1X8MA 2ATFA 4GULA 4AQ2A 5HI0A 3LA3A 2H6CA 3RDIA 4PJYA 2IXLA 3SCFA 3MDPA 1RUNA 2VQAA 1X8EA 1EYBA 1OI6A 3FX3A 4I09A 4J1WA 4HVRA 4KU8A 5FLIA 3WW4A 1O3RA 3KMHA 2XHKA 1RC6A 5I0SA 2BNMA 1RTVA 5LRSA 1J1LA 4HZFA 4HSJA 3WW3A 1YUDA 2B9UA 1UCXA 4EWEA 4MGKE 2OYZA 3KCCA 4PIYA 1I5ZA 3LOIA 4XFGA 1CAVA 2XL7A 5FPZA 1PMIA 1YHFA 2XGXA 4FAGA 2QJVA 5AVPA 5KHHA 1O3TA 5I0UA 3I59A 1SQ4A 3E5XA 1ZREA 3HIFA 4I0BA 3GBFA 3ROUA 4XF4A 1NYWA 3EO6A 3LA2A 1CX4A 4HN1A 4KWLA 1O3QA 4TLFA 2BGCA 3SMHA 2FMYA 2DCTA 4D7SA 4LUKA 4KU7A 4Q0SA 3M70A 4WVZA 4BH9A 1LB2A 3RPQA 4UBGA 1LKNA 1ZRFA 5FLJA 1LRHA 5EFUA 2CV6A 1UPIA 4XF0A 3OGJA 4N9HA 1NE4A 1WLTA 4LA2A 1O7FA 3FE5A 1JUHA 3CEWA 4XEZA 3OD0A 4QGMA 4Z07A 2D5HA 4O9EA 1EPZA 1ZX5A 2B5HA 4PIXA 3HT1A 3RYKA 5JR7B 4HVQA 3KSCA 1UD1A 1V70A 3LZZA 2UY8A 3FWEA 2D93A 4XFCA 4EROA 5BPXA 1QY4A 2OZJA 2ET7A 4J1XA 2XKOA 2ZKLA 4L2NA 3FZ3A 3SCGA 2PYTA 3VHRA 3H3ZA 3NKTA 3IWZA 2Q0AA 1H1IA 4I02A 5J48A 4JTNA 4E2SA 1Q3EA 4XFIA 2CAUA 1CAXA 2QCSB 2XLGA 4E2GA 1DGWA 2C0ZA 1UW8A 5JSPA 2PAKA 1Q5OA 2QDRA 3QACA 5I91A 3E6BA 3CO2A 3IBMA 3B02A 2XLAA 4PIZA 3TNPB 3H8UA 2EVXA 1J3RA 5I0TA 1J3QA 5F1RA 4IETA 4META 2QNKA 1VR3A 2Q1ZB 3NSTA 4Q0PA 1HW5A 3EJKA 2PFWA 5FPXA 2ETEA 1RL3A 1O5UA 3ZDSA 4IEQA 2Z69A 3ELNA 3M3IA 1CAVB 3CL1A 4ORFA 3NVCA 1TQ5A 3I59B 5J7MA 2ZCWA 1G6NA 1XRUA 2VECA 2EA7A 2H6BA 1J3PA 2MPFA 4HSLA 1SEFA 4X6QB 3LWCA 4YRDA 4HLTA 4YSFA 1CAWA 4F7ZA 3H1YA 4I2OA 4IEVA 4XFFA 4HN0A 3SHRA 5E1RA 3BCWA 4KWJA 5K8SA 4UXAA 5C8WA 3H9AA 4HBNA 3U10A 2MHFA 2PQQA 3D0SA 1IPJA 1O4TA 1YLLA 3G7DA 2XKPA 3ACLA 4RD7A 3CF6E 1ZRDA 3DN7A 1ZZ7A 4D7TA 2IXKA 3E5QA 3LAGA 4QX5A 2IC1A 3MPBA 5BV6A 3D0JA 4YNIA 5KHKA 1QWRA 3H7YA 2BNOA 2O8QA 3C3VA 3E5UA 1CAUA 3BB6A 4MGZE 3SXWA 2PAMA 2O1QA 4KL1A 3S0MA 4E2QA 5JSOA 4Z82A 4K8FA 4ZU5A 3H50A 4Q29A 3ST7A 5CADA 5I8SA 5JCTA 4KWKA 2N7GA 5C6CA 1WA4A 4LTAA 3N4MA 3E6DA 4IEOA 4XETA 5KHIA 1VP6A 1NXMA 4ZU4A 2GAUA 1NZCA 1RGSA 2GH2A 3RYRA 2GC1A 2V09A 3PNAA 3IIAA 1CAXB 5LEKA 1DZTA 2OA2A 4MX3A 5BXXA 4MUVA 1QXRA 2WFPA 3OF1A 5KHJA 4MH0E 2GU9A 4R52A 1ZZBA 3RYPA 2OZ6A 2IXCA 2XL9A 3H1MA 3BU7A 2IXIA 5CU1A 1ZNPA 4CYDA 4ZU7A 5JAXA 3FHIB 4IERA
chains in the Genus database with same CATH superfamily
1ZZCA 2J7MA 1SBFA 5CKNA 4GB31 2PLV3 1F4AA 4L0PA 2Y26A 3QH6A 2AACA 4XQ4A 4BQXA 1BK0A 4CDXA 2DBNA 1YQ6A 4P14A 1GV9A 4LBOA 5FYBA 1N1TA 2R30A 4XFHA 2F17A 2WLQA 1IGOA 4OHZA 4IGOA 4KMQA 3ZR6A 5KR7A 3MFCA 2WSUA 5FK8A 2E7TA 3M1HA 4EWDA 1DQ6A 1WD3A 2GN3A 5FYCA 4AHWA 1OVPA 4IV1A 4DS0A 1BMV1 2X10A 2ZTNA 1DGRA 2I45A 2WLPA 4H14A 1RUC1 4BYYA 4JDOA 5I93A 2JIGA 5JXJA 4XFBA 3B69A 1HJGA 2VZTA 2D6OX 1MS1A 2ZAHA 5FQ0A 3TNQA 1UY3A 1LENA 2OPKA 3O1OA 1YFYA 4ZY9A 2MNGA 5C3SA 1PO11 3ZXFA 4FP3A 2RMU3 4N7UA 5F2WA 3KZ4C 4LA3A 4OHWA 2FDKA 4BXSV 2WUHA 3AYAA 1O3SA 2LS6A 2ZGLA 3N9MA 3DXUA 3FLRA 4W6YA 5FZHA 1J59A 1W6QB 3NJZA 1SBDA 2DUOA 1LR5A 3MV11 5F9TA 1PGW2 2LALA 3OGVA 5IVYA 5JXGA 4HPKA 3IAPA 1H6XA 2A75A 2PHLA 4XF3A 4BJ0A 3ABZA 3OEAA 4N53B 4TN7A 1CWPA 1QXJA 2ARBA 1UIJA 4Q5OA 1ENQA 3AMMA 3GCXA 4O9GA 4YZ2A 2A73B 2AEYA 1HIXA 1XC6A 1H4GA 5BY5A 1OA4A 4QGNA 5LBEA 4AI2A 1PO23 4LKSA 4Q0QA 2D7FA 3HBZA 4OZOA 4EN8B 4Z2WA 1UL9A 3ETQA 3J7NA 4QDSA 4W65A 1RUI2 4SBVA 3WNMA 1R092 4AXOA 3MF9A 4IGQA 1C3HA 2BFUS 1WCQA 3IAQA 3U1XA 1BCXA 2WNUA 4PT6A 4YGEA 5FP8A 2IFWA 2B45X 4BU2A 1N3OA 4YWAA 1FOD2 2P2KA 4LULA 1ULEA 3FJSA 1LCLA 1OOPC 2BQPA 1MQTB 4AQ6A 4Q0VA 1IG3A 2R1DA 4NVPA 5D1IA 4WVVA 1UZYA 2WZR3 4WM7B 2ET1A 1BZWA 4U36A 4NHLA 5A3NA 2PHTA 1U12A 4ZS2A 4FPJA 4I0AA 1YFXA 2HWE2 4FI9A 2KR2A 2VOTA 3DYPA 3Q9OA 2VULA 1AYM2 2RM22 1NT0A 1KGYA 4CCOA 5B4NA 4AVCA 1N1SA 1UKRA 2QQJA 2A5ZA 4Y20A 4HKOA 3EXUA 4XOGA 3K46A 1DFQA 4RFT0 4IGPA 1H4HA 2Y38A 2V73A 1GLHA 1QEXA 3AMHA 2PHWA 2HWF3 4MOAA 4BQWA 3U4XA 5I8TA 4UFJA 1HX6A 2NN8A 4FAHA 1OLMA 2AGSA 1XE7A 2J22A 3VHNA 4W50A 1ST8A 2EXKA 3IDCB 4D94A 3K77A 4JGZA 4IEXA 5A33B 1LGNA 4GAZA 1RJ8A 2GN7A 1M4WA 3OGRA 1OD5A 4I01A 3NWKA 3E97A 4LLFA 4DXZA 4MHRA 2YHJA 1H1MA 4PDWC 5L7OB 4PBPA 2A3YA 1CGPA 2BYVE 3LSEA 3OTFA 5HCBA 1POQA 3MV01 4QPIA 3OGGA 4UFHA 4XF1A 3WG1A 3ZXLA 3ZXEA 1NCQB 4EV0A 1OKOA 1EAH2 2J1RA 2WO7A 1A8DA 4DUXA 1UF2C 2E7AA 2HWC3 3WF0A 1RHI1 5LEJA 1JODA 4XILA 5FCCA 1FNYA 4L97A 3I2DA 2P17A 5IVFA 3RZZA 5FPBA 4XTMA 1UU6A 2VZ1A 3FL7A 3JZVA 4LO5B 4JV4A 1W2NA 1GZCA 4LXLA 4P00B 4QPGC 4XABA 5F5QA 4C8DA 5ACA1 4UFLA 3UGFA 5A6QA 2RR13 3O0VA 2DTWA 5AC92 4XJUA 2EIGA 4FXGB 1B09A 3J7MA 3POIA 1QNWA 3KF5A 5A3PA 1AX2A 2W47A 1WCUA 4N9IA 3O14A 4QT6A 4XFAA 3Q8CA 4COUA 1YFWA 2VZSA 1URXA 3OSDA 3KM5A 1UOBA 5LY2A 4ASMB 5FY1A 3PUIA 4MVTA 4XJ9A 4YYOA 1JZ3A 5F39A 4QX3A 3U0ZA 2GC0A 3SLIA 1JH5A 4AR2A 5J98B 1RUH1 2WWSA 1VIWB 5FYYA 1DLCA 3H8RA 5M0TA 4YARA 4OQ8A 5FP9A 2QVSB 5C3PA 1JOPA 2G19A 3MLLA 4MZUA 3DPRB 2D44A 4LORA 1HRI1 1TMF1 1POV0 2D5FA 2HJIA 3AKPA 4FPFA 1UIKA 5C4WC 2VMFA 3AJZA 1ZM1A 4YGCA 1VB4A 3ACFA 3ACGA 4LPLA 1WMFA 1FPN2 1NLRA 2GC3A 4KGGA 3WW1A 3NNGA 4E8CA 3AJYA 3FFZA 2ENRA 1UY0A 1COV2 2GP5A 5FKBA 1OURA 4XUOA 1SLLA 2YBKA 4XDPA 1WCKA 3WT3A 1LGBA 3HN3A 3VBHC 3WG2A 2HYXA 5FOJB 4GB33 2VG9A 2VVFA 3GNEA 2L9LA 2BJSA 2WS92 1FAYA 3WNOA 5A1LA 1IS3A 1VB2A 3BODA 4YM2A 4DPNA 2XUMA 3RS6A 1S55A 5IK4A 3N36A 4EZ4A 2I74A 3GBGA 1LU2A 1WD4A 3UKTA 1ENSA 1UOJA 3O1TA 4RS5C 3ZIWA 3VDCA 4AQTA 3PUQA 1JMUB 2OQ6A 3RZJA 4LBQB 2UURA 1RUC3 3R05A 5FJHA 4D6QA 4HL0A 1VBC1 5D2AA 1LHUA 2DURA 2F4LA 3HQRA 5BNQA 2WIIB 4A6SA 2VQAA 1PO13 3I3QA 1PMJX 4AEJA 4QQLA 4J1WA 4HVRA 1CONA 4E9KA 5EJZB 4N43A 2VW1A 2DCYA 3O5SA 1O3RA 2ZGSA 5I0SA 1D7PM 4W6XA 2ZGQA 1NAEA 2RS51 2ZABA 2WT2A 1NUKA 1RUD1 4B7KA 4ZZ5A 2OS2A 1OPMA 2E33A 3I8TA 1YUDA 1WA6X 4EWEA 2WINB 2ZBJA 3KCCA 4Z92B 5D8AA 2RG4A 3ZMNA 4Z8BA 5GLUA 3UYJA 1MEC2 2CSGA 4UW6A 1WCSA 2ARXA 1XNCA 3N3HA 2B7YA 5CG8A 5I0UA 3I59A 3E5XA 1QQP2 1RUJ1 2RVAA 1K45A 1B35C 3JU9A 4FPYA 3EO6A 3B5LB 1SFPA 1CX4A 3SC7X 4HN1A 5FZFA 2ZZQA 3NAPB 2ZJCA 2R0HA 3B94A 3M8LA 5A1AA 4QB2A 2YFZA 1DYKA 1AYN1 2VBDA 3CKHA 1H8VA 4F83A 3OBTA 4AVSA 4D7SA 5FZ0A 4LUKA 1NA1C 3WDUA 1EV11 2YB7A 1OLQA 2XG3A 4Q0SA 3A22A 1DGWX 4GMP0 4XHXA 3PTYA 3SEEA 3THTA 2R071 5L36A 2X09A 2WAAA 1C4RA 4NRQA 1BYHA 1YIPA 4CDUB 1LRHA 5BNNA 4FPHA 3IDAA 5H9PA 4XF0A 1JOJA 3ZVXA 4N9HA 5DMYA 4CUAA 2WT1A 4QX0A 4IE0A 1F2NA 1K5MA 3LOBA 1W9WA 2WO1A 2AZ5A 5JIAA 3VZNA 1ODNA 1AX1A 4KGQA 1GANA 4Z07A 3TOJA 2D5HA 2GALA 2ORXA 2Q1FA 4LJHA 1QH6A 2QFEA 2D98A 1PM4A 2B46X 3RYKA 2FDHA 4FQ4A 4MGSA 3RG0A 1X9TA 4PF5A 5CBLA 3KSCA 5E89A 1ND3C 4J6GA 3K3OA 4AVTA 1NY72 2YU2A 3FBMA 3VL8A 1GU3A 3WVJA 5CEHA 2W2IA 2WNVC 4YGBA 5T5JA 3T4VA 3N9PA 5JZGC 3T3YA 4QX8A 1NQDA 3LD8A 3OYWB 1F5FA 1LHWA 2OZJA 4DO0A 5A32A 2X5IA 1XSRA 3ZFGA 3Q8AA 4L2NA 4CE8A 4DEQA 1JYVA 1ND2C 2PYTA 4RHV1 2SLIA 4ISQA 1SFYA 4MADA 5EIYB 1G9CA 5EQUA 4HXCA 4QHOA 4E4HA 1XOYA 4LE4A 5KXEA 1LTEA 4P08A 5IYYA 5J48A 4JTNA 3VBSC 1XPWA 2QCSB 2WA3A 1QHDA 3N9NA 2J1AA 1DGWA 1UW8A 5EYYA 1RMU1 5JLVA 5FMBA 3B9IA 3RZKA 1H6YA 1CZTA 2ZMNA 3B3QE 5A3UA 4D3WA 3DXTA 1UZZA 4WV8A 5GZEA 3VV1A 1LODA 3SNMA 2PXJA 1ULFA 4LNVA 5IVVA 1MZ6A 5LBCA 3R4SA 4R4XA 2MEV2 2WRAA 1LHNA 5CFCC 1H8TA 3CIHA 2JG8A 4GALA 4IETA 2QNKA 2Q1ZB 2UWAA 5IUQA 2IFRA 3T2OA 5C8CA 3T2TA 2W68A 1R64A 3EJKA 4PLOA 4Q26A 4P5HA 4XPVA 5LA0A 1UMIA 1MS5A 1RUE3 1RUH3 1O5UA 4IW3A 2W39A 1LOFA 2JG9A 5GJ6A 2G1MA 4UF0B 3M3IA 4XTPA 3KT4A 4QU2A 1HRI3 3C2UA 1OOPB 1TMF3 2BW8A 2VMHA 1IS6A 2QE3A 3NVCA 2W46A 3CJIC 1TQ5A 2NM1A 4CDQC 2ZCWA 5IVCA 3S30A 1GSLA 2EA7A 1V6JA 3KB5A 4YZ3A 5FZOB 4IUGA 3HMYA 3V0AB 1WLDA 1H9PA 2VQTA 5LBBA 3I49A 4AHXA 2J1SA 3AZZA 3LIHA 4NMIA 2VVEA 1AR91 1US2A 4MYEA 4CEYC 1O91A 5C7GA 3TEWA 1TVGA 1DQ0A 4DEVA 5C5TA 2DWRA 3H1YA 4I0WB 5CNAA 4I2OA 4UFIA 1J1TA 1SCSA 5A3WA 4YM1A 2XJSA 3BCWA 5E1RA 4YM3A 5K0UA 5GM0A 4P9IA 1CPNA 2XBO2 3MIEA 2ZEWA 3VZKA 3AKQA 3VZOA 4BIOA 1W8UA 1DLLA 4M00A 1HB1A 3OPZA 2D43A 1VE0A 4AZZA 4OI4A 4BQYA 4LE3A 4D7TA 4LIVA 1VBC3 4YPJA 3J8F1 4ITCA 1KXGA 1AR82 2DVDA 3CQOA 5ABJC 4WM7C 2IWGB 2W1QA 3POEA 1ZYBA 2XMLA 5F32A 4AFMA 4IV3C 1AX0A 2IC1A 3I3MA 3MPBA 1RITA 3U07A 3MEPA 1GZ9A 3N7JA 1VRH2 5BNOA 4D0QA 1CQ9A 2V72A 2YBSA 2CGOA 4ZS3A 2O8QA 4FFHA 4GIQA 2DVFA 1BXHA 4MGZE 2RS53 2WN3A 1OSGA 3SXWA 1N3PA 3UESA 1W28A 1RUD3 5KC6A 1LOCA 3OPTA 2JDPA 4E2QA 5JSOA 4CUGA 4YGDA 4CP2A 4O65A 5A3MA 2LW8A 3H50A 3LEMA 3OG2A 3ST7A 3N7MA 4GQ7A 1AL22 4M01A 1H1AA 1WA4A 4K20A 5FPZA 3A4UA 2XWBB 4M3CE 4R9DA 3EYPA 1LOEA 1D0HA 1VBB1 3E6DA 4UWDA 4XETA 1LOGA 1YYNA 5EHDA 4B1MA 1IS5A 3WCRA 1RUJ3 3MIHA 4CRQA 2GAUA 5AVAA 2D6PA 1RGSA 1W2OA 2W5FA 1OPOA 3T0AA 3X29B 4BM8A 4YVWC 2GH8A 1RUG2 3ATGA 1AYN3 1CAXB 3VL9A 5A6XA 1JU3A 1GNHA 2QZ3A 3HVDA 5HV0A 3RI8A 5FY5A 1EV13 2YFUA 4FSJA 2XWJB 3FHAA 2VZUA 1QXRA 1GYKA 1R1A2 3OJBA 3VBRA 4XURA 5FYUA 2PELA 2VOVA 4R52A 5E8AA 1OLRA 3OY8A 2VZ3A 2XL9A 2R073 2YDEA 2ILMA 1QDOA 2JDZA 4C0BA 4I30A 4HT1T 2IVJA 3AXDA 2CHHA 4CYDA 2A70A 3N7LA 5K7PA 3ZSLA 3IN9A 5C4WB 3ON7A 3V56A 2ADEA 2Y6GA 3GHNA 1Q56A 5GZGA 1FMD1 5LBFA 3DEMA 3HOBA 1R082 2VPVA 1JTZX 5A1FA 1W8HA 1WW5A 3VBOA 3VBHB 1JYCA 2VTXA 2Y6FA 4Y5TA 3INAA 3UKNA 2VOKA 4PHZA 2A1XA 4PI2A 3LFMA 1X82A 1GQHA 4CA9A 5HCAA 3H7JA 1OFSA 1GNZA 4DNYA 5FRAA 3I4IA 1NE6A 3ILFA 3T1LA 4B4PA 5A6YA 2HBTA 4H7LA 1HRV1 4XCBA 5JXHA 5CKMA 2CWMA 4RS5B 5A7NA 4U2AA 4XE9A 4QHBA 2BBVA 4Y1XA 2FDIA 2RV9A 2DYCA 1ZBA1 2DCZA 1AZDA 4RHV3 3N35A 3RZLA 1H0BA 1AR62 3WNKA 1VBA3 3EB7A 3OOXA 3PL0A 4I3GA 5FMDA 1MZEA 1DZRA 2P3JA 5FREA 4CPBA 1GP6A 3BALA 5GLWA 5L9RA 2GMMA 4JDMA 4MGTA 2DU0A 2NQYA 1PIV1 3I2HA 4GH4A 1BVP1 1GWMA 1S2BA 1QJX2 1S4CA 2W1UA 3JBG2 1F9KA 4IE6A 1OFNA 3C7HA 3OEBA 3PLQA 5E16A 3AL6A 4P9GA 2YG0A 5FUNA 5IK8A 1RMU3 2TBVA 5FZCA 2NZ9A 4ARYA 1UZWA 4Y1VA 3LKJA 5DABA 3WLUA 1W8FA 2R041 5I8YA 1WW4A 2JICA 3MUZ1 3DKWA 4NN0A 4CXWA 2ZPXA 4TTGA 2B4KA 3ZYIB 1CAUB 3JD71 4NWWA 3VKLA 4LR4A 4WVWA 2VVDA 4FPKA 1B35B 2XJVA 4LHNA 4CEYA 4WZCA 2PA7A 2SBAA 4BB3A 2Q4SA 3SH3A 1GQPA 4ASLA 5IW0A 5A80A 3WUCA 4AGGA 3TEZA 1UQXA 4K9SA 1CJPA 3ZX7A 1NLSA 4CZSA 3K75B 4R9AA 1NA1B 2JDAA 3VZMA 1Y9QA 2ZEYA 5FXVA 1F8VA 5FWEA 5BUVA 1XNBA 3AP6A 4FPLA 4ATFA 4BK5A 1X9PA 3T1MA 2A6ZA 5FZGA 1RVF1 2FCVA 1AR93 1JYIA 1A34A 2ZAAA 4NHMA 5EWSA 2BZDA 1UOFA 2FZ2A 1P8JA 1BKZA 1KS4A 4E4ZA 1TME2 4OYUA 1QIQA 2P6HA 2VUJA 4M0HA 4XC9A 5B4XA 2JDYA 1PZ8A 2HEWF 2ZOEB 4W6WA 5FZ7A 3RI9A 4CCLA 4EN7B 2HEYF 5A3OA 4EZHA 3BUCA 3K51A 1JYTA 1PM7A 1BQPA 1UYXA 2LM3A 3KV5A 2VUCA 4CDWA 2WL1A 5FOBB 3L2YA 3ZKUA 4IEWA 3R4UA 1GZTA 4MV2A 4XUQA 5CFDC 1HB4A 2PTMA 3FN9A 3RJ2X 2YU1A 2YV8A 1ND3B 2JDUA 3VHOA 3J8F3 4AGVA 3OUJA 2EXIA 3NL1A 5F2SA 1L7QA 2WNVB 1W6PA 5JZGB 1SPPB 4ET7A 3VKOA 1PX3A 3EBRA 5FV3A 1ULGA 1HN1A 4LBMA 1D4M1 3WV6A 5IVJA 3AMNA 5FZBA 4YW6A 2IXJA 5FXWA 4XMAA 1ND2B 2VO5A 2BNNA 3M3CA 4D6RA 2CTVA 2VMCA 5DXDA 5KC5A 2RDRA 4S2GA 3RQ0A 5C9AC 4IEYA 4F3JA 1O8SA 4QQ2A 4WM8C 3DCQA 2J1UA 2XJUA 1HB3A 1V6IA 3LEKA 3BI3A 4Q4W2 2D40A 4GKYA 4R9BA 1H9WA 4OZXA 2WA4A 1V6NA 4UT5A 3VBSB 2ZHMA 1FYUA 1QJU1 4BQ5A 1W6MB 2W9XA 2QQIA 4BA6A 1C57A 1Q43A 1VBB3 4IDZA 4L99A 1OUSA 1XYPA 5IT6A 4AEDA 1ZRRA 4LHSA 5A7SA 2Z2SB 1H2LA 1OQEA 2DFCA 4LKDA 4XQDA 4DOUA 3BTYA 1W2TA 2VCAA 3LQCA 3PTRB 1SZBA 3NNLA 3U4SA 2VMGA 4S2HA 1STMA 4HMZA 5DQ0A 5JWPA 1Y3TA 3LDKA 3TEXA 1SCRA 1O5LA 1W8ZA 2G9ZA 1GR3A 2EAAA 3HBKA 4RQPC 4C1XA 5CFCB 1JZ6A 4QQHA 4W8JA 1AF9A 1W6NB 4HK9A 2ZEZA 2ZX1A 5DDJ1 5H9QA 3ES1A 2VY0A 5F5IA 4NPRA 3CNAA 4F8AA 1C8M2 1VBA2 5JOXA 3I97A 5CZKA 1X7NA 4PLMA 5FY7A 4Q1RA 4ARXA 3W5MA 2JDNA 2FDFA 1VMJA 4CDQB 4CP0A 3CJIB 3MO4A 3P3NA 3T0BA 1CJDA 3S7IA 1HXS3 3NJYA 1RB8G 1YQCA 4BOWA 3JCIA 2RS31 1FMD3 1DQ4A 4A2UA 3ES4A 3EHKA 2HWB2 3SKJE 3VKMA 2B9VA 1ENRA 4RYDA 2O14A 2BGPA 5T5PA 1YJLA 4K21A 1QOSA 4QQOA 1W0PA 2XR4A 4JGYC 4ONUA 4TLGA 1NCRC 5F3IA 1X8MA 4S2FA 2PN5A 4K8RB 3LE0A 2XB6C 1QMJA 4AQ2A 5D8AB 2RS11 1UPSA 2XDVA 2WYFA 3LA3A 4NPMA 3THPA 1RJ7A 1HRV3 2H6CA 2DFBA 2XJQA 4ZXKA 1XYOA 1ASJ1 3RWNA 1CD3G 3AYCA 3MDPA 4CP9B 4Z1VA 1VRBA 5JDBA 2P6CA 3JUUA 1EYBA 1OI6A 2WSVA 4CXYA 1ZBA3 2ERFA 5FLIA 4PQ9A 1C1FA 5ABJB 4P9LA 1BEV1 2CDOA 2JECA 2BNMA 5EJ3A 5FXZA 3WP3A 5DAQA 3M3EA 4IV3B 5T52A 5F7UA 2WWJA 3MW2A 2D6NA 2VQUA 3J4UH 4CTEA 1VBE2 5LRSA 4XBQA 1GZWB 3WW3A 2B9UA 1PIV3 1UCXA 4ZKTB 5DAPA 1XYNA 2JDMA 4MGKE 3ZFFA 3JB4C 1G8WA 4OMDA 1PVC1 3R0RA 2VW2A 1VAKA 2GMEA 3KVBA 1CAVA 2ZGUA 2OX0A 4B1LA 2H0BA 4QQPA 3ASIA 4JQTA 4Y26A 2WFF1 3U78A 1O3TA 1OQDA 2O8OA 1SQ4A 2R043 1W6OB 3WDWA 3TWIA 4I0BA 4DY3A 1KJRA 3GM8A 4C1WA 1YNAA 2DDUA 2X8KA 1K5MB 2XQRA 3T4HB 3JD73 2Q5TA 1OD3A 1Y43B 2QQOA 4O7XA 4QHZA 3VBFC 3PUAA 3AP5A 1S2EA 4AI0A 2DCJA 3K3NA 4FPOB 5CB7A 1H2MA 3NV4A 2FHRA 4XJAA 5IK7A 1UMHA 4PQQA 4IQPA 4KU7A 3UK9A 1AJKA 2DUQA 3WNPA 4YVWB 5JPMB 2WO2A 3AM2A 5GALA 1DQ2A 1DBNA 1LKNA 1V9U3 4CCMA 4EYUA 5GZCA 1FV3A 2ZHLA 1AUYA 1LESA 4P9JA 5FP4A 2E31A 1O7FA 4Q4Y1 1RVF3 3GZTB 3HQUA 4XEZA 2R061 1LJ7A 2VXJA 3ZDVA 4NAMA 4M3CA 5FZ3A 4AYUA 1NKGA 4QGMA 2PLV2 4EN0A 1CZSA 3JXSA 5FUPA 1KITA 4PIXA 2WR9A 3VBUA 3FBYA 1WZXA 4OHYA 1QJY3 3THDA 2ES3A 5L73A 4YVSA 4HANA 3AZWA 1SDDB 2ZGNA 3WP5A 1GOHA 1XQNA 4MHUA 1GKBA 4CDXC 1HQNA 2HWD1 2W3JA 5BPXA 5H9SA 3KHCA 1QY4A 1W9YA 4RGKA 2VZOA 3TN91 3VDDA 4H55A 4J1XA 2XKOA 3WDYA 3POBA 2O0OA 1YIFA 3VGIA 3ZYRA 3ILRA 2YPDA 3DECA 4LO4B 2FDGA 4FPGA 1YQ8A 3FZ3A 1J83A 3AZYA 3AMQA 4Q4X1 4TXWA 5JI7A 5A7WB 3H3ZA 3KT7A 4IV1C 4MXVA 1U5XA 5BNPA 5DN2A 2RMU2 4A41A 3POWA 1D4M3 2BOJA 2NPIA 4FVVA 2Q0AA 2EIEA 4QDQA 4AG4A 3WNLA 2QUOA 2UWBA 2ZHKA 3AZXA 2X53S 3KLSA 4GWNA 5T54A 3T2PA 1HB2A 5DUXA 2G9GA 4E2GA 3PVEA 2GNTA 1DYOA 3HNMA 2C0ZA 4XAEA 1VBD1 2XJRA 4PCRA 1TNRA 2BTVC 2QDRA 2Y64A 3QACA 4KBBA 5E6HA 1QH7A 1OF3A 1QF3A 2B42B 2R16A 5I91A 1E5RA 1QJU3 3APBA 3E6BA 4CCKA 4H2AA 1WLWA 2BUKA 1MS3A 2XLAA 3ZFEA 4PIZA 1PO22 3AP9A 1AXZA 4LBLA 3GZEA 4QAWA 3TNPB 3UJQA 4B7EA 5I0TA 1J3QA 3K4AA 2LRPA 2AEZA 4A3XA 3WINE 4LIUA 4JZRA 1HW5A 4CU7A 4A42A 2ETEA 1KJLA 3RVHA 4HFSA 3ZR5A 3O1MA 1JZ4A 2Y6KA 3ZDSA 4IEQA 1WKYA 3IDEA 1W04A 3ELNA 3O7OA 4JCKA 4QX7A 5DDJ3 1BBT1 1O6UA 3CL1A 3PDQA 4UFMA 3BIWE 4Y22B 3WXPA 1K42A 2WNUC 1UOGA 1IKPA 1V00A 2WZR2 4DMIA 5FO8B 1NX9A 2VECA 2GNBA 4HKWA 3ZYJB 4CEWA 4WVMB 2BVBA 2MPFA 4HK8A 2ZEXA 2JKXA 1W0OA 2GSYA 4X6QB 5GLTA 3S57A 1IZ3A 4HLTA 2YC4A 2RS33 2QQPA 2YYOA 1Y9GA 2RDSA 2VW0A 2JDHA 4ZXEA 2ZGMA 5F5AA 1WMEA 3UETA 4HN0A 4M4PA 2VL4A 4GWJA 5D21A 2WDBA 2YC0A 3F2ZA 3UT0A 1W6QA 2HWF2 3WDXA 1JOBA 5FXXA 4XQWA 3MHZA 2DVBA 1IPJA 5DZFA 1KS5A 1S0GA 3RJRA 2XKPA 1RUF1 4RD7A 3OGSA 2RS13 2W1WA 3GJBA 3VZJA 3ZKYA 3ME2A 4NUBA 1A3KA 4N53A 5L19A 5CKQA 4OQ9A 1ASJ3 1XNKA 1POV1 3QH7A 3O1VA 2XHNA 4Y24A 5CFDB 3MF6A 2QDNA 3DYMA 4JGZC 4EN9B 1V9U2 3PMSA 3PURA 4V2WA 1UYPA 1IHMA 4ZONA 3D0JA 2Z4FA 3RMXA 1QWRA 1BEV3 2ADDA 1MR5A 2NYYA 2CNAA 3E5UA 3KV9A 3GJAA 2WBKA 2JXAA 2HWC2 5JMCA 3CBNA 3ZN6A 1UY4A 3S0MA 4QPIC 4CXXA 1IOAA 3JQXA 5FYIA 2A6VA 4INDA 4K8FA 1BLZA 2DTYA 4R9CA 3V0BB 1MQTA 1SACA 1HQLA 1W8OA 3WY6A 1PVC3 1UY1A 2EF6A 4KNCA 1GP5A 5LY1A 2NLRA 3WG4A 1X50A 5C9AB 3I2IA 4XDOA 3C7FA 1K5JA 3N4MA 4WM8B 2OVUA 2WFF3 4J25A 2C5DA 2RR12 1QJY2 1LHOA 1CX1A 1DDLA 1JBCA 1Z7S1 1PK6A 3SQOA 3JQWA 1VMHA 3AYEA 3MLJA 1AR71 3PJQA 4M4RA 3RYRA 4FFIA 3PNAA 4KBZA 1VMFA 5FPUA 3J26N 1PGL2 3GDBA 4XUNA 1DZTA 4MX3A 1I9RA 2JDKA 4LHKA 1N1VA 4YFWA 2Y6HA 5HCFA 1WBLA 3RSJA 3OF1A 2WFPA 4MH0E 1N1YA 3AX4A 1Q8OA 4Q4V1 4RR3A 1ZBE1 2IXCA 3RYPA 4RQPB 3U14A 5FO7B 2Y6JA 4LO8A 2VE1A 3A0NA 4AFDA 4AEKA 2WNOA 3BU7A 1DG6A 4LQRA 5F37A 1O4ZA 1N3QA 4LKFA 4LBNA 2W94A 1DYPA 2LTNA 3FHIB 1H30A 1RHI3 3EQEA 5L7OA 4YFZA 4JHZA 4Q4Y3 1X33A 3M2MA 2YUEA 3QLQA 5SV8A 4DRRA 2R063 3M3QA 4DINB 3HWJA 3ZLIA 4CSWA 1GICA 4DXTA 1NCQA 1DHKB 4GB32 1V6MA 2XLFA 3HEIA 5APAA 2Q8OA 1OUXA 4NIAA 5ACA3 4BHPA 4M3CF 3B00A 1MACA 1OA3A 3CU7A 4YW7A 1F35A 3ZN4A 3SEPA 2DBIA 3ZO0B 4NHXA 2HEVF 4NE9A 1S0BA 2W91A 4NAOA 4GWIA 2HWD3 3BOWA 2P1BA 4JGYB 4XUPA 1NCRB 3TN93 1BMV2 4GMP1 2XPJA 4QD2A 2CY6A 5C70A 1RUC2 1CAWB 1GOGA 3M3OA 2JE9A 4RA0A 4URAA 4RN5A 3HT2A 1H2NA 4Q4X3 1A8MA 3LB9A 2Q8EA 2BEOA 3ZYPA 3J9SA 1PGW1 1PO12 5JSRA 4DB5A 4JVAA 1LECA 5I0RA 2GNMA 2H0VA 4QXCA 3B01A 1SMVA 2QZ2A 1LU1A 2CDPA 4TSVA 4N90A 4JTOA 4MGIE 4BPZA 2NP0A 3IPVB 2VR4A 4XAAA 5FZDA 4COYA 3LPGA 1V6KA 4FTBA 2J1TA 2V4AA 4N43C 4X6RB 3NW4A 1W2UA 3KWVA 1VBD3 3BPZA 4BWOA 4A6OA 4A45A 3H1WA 3RNSA 5A6ZA 1RUI1 3DPRA 1PVXA 2CGPA 1R091 4Y1YA 5LRRA 4AI9A 1QJEA 4OI2A 4FO9A 4AHYA 1FOD1 4CU8A 1ZRCA 4YG3A 3LEGA 3L2HA 3PVBB 5D8AC 4Q8KA 4Q0UA 1FT9A 5FZLA 3ZOIA 4C91A 1XNDA 3J7LA 2D6LX 3KD4A 3WP6A 4AVBA 3C7OA 1JZ8A 3I3DA 2DF7A 5J3UA 1Z78A 2HWE1 4BDVB 2GZWA 3QOPA 2HBUA 2JJ6A 5C6CA 3MZHA 1AYM1 2OPWA 2RM21 3S7EA 1REFA 1BBT3 3KGZA 3LPFA 3VBFB 5J37A 2VU9A 1XJAA 4N8MA 1IPKA 3HQXA 3MYXA 5FY0A 3J7HA 3ZN5A 5JUVA 3TRSB 3Q8EA 3ZXDA 4P5YA 1Q8VA 4I3PA 1DQ5A 1US3A 4LBQA 4KG8A 3SH4A 2XJPA 3T30A 4UFKA 2Y33A 1Y9MA 2WQ4A 4Y33A 4EWAA 1PX4A 1YFUA 2TUNA 4XACA 2QQMA 2RJKA 5GZDA 3VLBB 3WHUA 5BNNC 1G86A 3O1RA 4A7YA 1JZ2A 3GALA 3O0WA 4HETA 1ZRIA 3POSA 3R4DB 3TB0A 1LEMA 3U75A 3USSA 3WNNA 4AAPA 5C71A 2GNDA 1QOTA 1K5MC 5FK7A 1OF4A 2QQUA 5KHGA 5IAXA 2WABA 1M06G 3LA7A 2KA3A 1RUF3 1ZVFA 2PMWB 3ORJA 2ZXQA 3PMEA 4ISRA 5G05L 2K9ZA 4ASKA 4C90A 5KXBA 5A3TA 1FATA 1GBGA 1JI6A 1ENXA 1EAH1 3KGLA 3PUSA 2ZGRA 1DQ1A 3MICA 1POV3 4CDXB 3H3LA 1ZZ6A 2JE7A 2BWCA 1RXGA 4Q27A 1UU4A 1WBFA 4MXWA 1F5JA 1WMDA 2VJXA 5A7PA 1JYNA 3AKTA 3GZUC 3IZOA 3NAPA 4DRVA 4FBFA 4IV1B 1ULDA 4CCCA 1EUTA 5ANNA 1FI2A 2X5IC 3ZFGC 5F6LB 3USUA 4CCEA 4DQAA 1SFNA 2P34A 4MGQA 5AC91 1SLTA 3MGUA 3LSDA 5FQ0B 5FZKA 5CAZA 2XOMA 4XW3A 1HQWA 2Q30A 1G9FA 1KFXL 4LKEA 3VHPA 2D6MA 3GGLA 5CYYA 4XYXA 3KV4A 4CDUA 4GWMA 3ZYBA 4XJZA 4DUWA 3FC0A 4OFGA 5HXMA 1J58A 4R8HA 1Z7S3 3K48A 4DFSA 4BQ2A 2RJLA 1JUIA 2KXLA 2YZ4A 3GYDA 1AR73 4QXBA 4HPKB 1HN0A 5FZAA 5JOWA 2BGOA 2JKBA 3H3UA 1S0DA 4AAXA 2VOXA 4LBQD 3KVAA 4MLOA 1RUE2 1RUH2 3ZM8A 1FPN1 1Q8QA 4NJ4A 4GKXA 1XE8A 1H8TC 2JG8C 4Q4V3 1COV1 1ZBE3 1JHNA 1E5HA 3WUDA 2JWPA 5C8CC 2XUEA 1O59A 1HRI2 1HKDA 1TMF2 1UY2A 4IEUA 3WZ1A 1K3IA 2WNUB 2FQPA 1K12A 1LOFC 2JG9C 2GMPA 2WS91 2FBEA 2OT7A 5DAXA 2I07B 3OYWA 1C5HA 2PHRA 4UAPA 1F15A 4BQ4A 1F31A 3UJOA 2C26A 2VNOA 3WR0A 1GQGA 5BYNA 5FDBA 1L7LA 1PHMA 4H7MA 4CUBA 1I6XA 1NLQA 3ZIXA 2UWCA 1YRZA 5HPOA 1F4HA 4Q2FA 1REDA 3NJVA 2X29A 5LB6A 1ZZ9A 5JOZA 2YPJA 4ZPIA 1GNYA 4NRPA 3K2OA 2ZGKA 4NOTA 3VB9A 4GULA 2VZQA 4UOJA 2WZR1 3FLPA 2C4XA 4Y20B 5FJKA 2W08A 3RDIA 4Z2AA 1YEWA 4PJYA 1QGLA 1W8NA 3ZXKA 2IXLA 4SLIA 3WCSA 2VMDA 4GMP3 5K0UC 4AEMA 1RUNA 1X8EA 1VBC2 3S5QA 3HR9A 4BLIA 2AENA 4QB1A 1KFUL 2BOIA 2WQ8A 1PZ9A 1LEDA 2XONA 2XHKA 3POYA 4KWUA 4RGGA 3VD9A 1OT5A 4AOCA 3ENRA 2OQ7A 1VLNA 4JGZB 4YZ5A 2GDFA 3EMRA 1J1LA 3NJXA 4FTSA 1RIRA 1Q8PA 2Y0IA 1MEC1 2RS52 3PJYA 4OUSA 5FY9A 2OYZA 3T09A 1RUD2 2E26A 1I5ZA 1V6OA 3LOIA 4L92A 3MIBA 4XFGA 5BNOC 1DU3D 1QQP1 1ULCA 3RGBA 4QPIB 1PMIA 1RUI3 2VCBA 1YHFA 2VCCA 3FUOA 1R093 1OOPA 2A6YA 3VZLA 2QJVA 4Q1PA 5AVPA 4FAGA 5KHHA 4KQ7A 1W8WA 3NRUA 1ZREA 2VNVA 1FOD3 5FZOA 3GBFA 3ROUA 3V0AA 4XF4A 1NYWA 3FMGA 5FMOS 3LA2A 4QB6A 5FYTA 2VAUA 4XJ8A 2V4VA 4FPEA 5T5LA 1RUJ2 2ZGTA 3SMHA 3BTAA 2DCTA 5JIUA 1Y7BA 2HWE3 4MO3M 2DCKA 1XSQA 4NROA 2FZ1A 1AYN2 2D3SA 3C7EA 5FYSA 5C3OA 3GCWA 1AYM3 2RM23 1X36A 4BH9A 3OBRA 3ZXJA 1LB2A 3RPQA 1EV12 4UBGA 1ZRFA 4QU1A 1UKGA 5FLJA 3W59A 5DG2A 1T6GC 1XXNA 2LUWA 5EFUA 1UPIA 2R072 1QDCA 4NPLA 2ID4A 3OGJA 1QJFA 2EIDA 2ZZJA 3LFIA 1NE4A 1WLTA 4QWNA 3ZYHA 2XVGA 2BV4A 4QX2A 3FE5A 3VBRC 1JUHA 1W2AX 3CEWA 3ECQA 5FFOC 3O1UA 3OD0A 3ZSMA 5HCHA 3BN6A 2V5DA 4N7IA 2VTFA 2P3KA 1DP0A 1A78A 1KEXA 2BWAA 1SLCA 3IIIA 4PDWA 5FUIA 1KDMA 5IWFA 3UV9A 4O9EA 1EPZA 1ZX5A 5FZ1A 1NY71 4FPCA 4CVUA 4XJWA 5JR7B 4HVQA 4BZ4A 3LZZA 1W0NA 3WF4A 4K1ZA 2UY8A 4ES8A 3H8OA 4NIIA 2D93A 2VZRA 3LEIA 3VBOC 4DY5A 4EROA 3GF6A 2ZHNA 1VAVA 3AP7A 1KDKA 4KH9A 5DZEA 3AVRA 3ZSEA 2ET7A 1UAIA 4BMBA 1EAH3 5DUWA 2BVVA 3ACHA 5LA1A 5AFEA 2E7QA 4FFGA 2XVKA 4UW4A 3V65A 4V1PA 2R7EB 4YZ4A 3VHRA 4QPGA 2YXSA 2YBPA 4AL9A 4KG0A 1S2KA 1CPMA 1HV1A 3S6PA 5IVEA 3IWZA 4RHV2 3O1PA 2R32A 4QPWA 4YZ1A 4UW5A 5FPVA 3WDTA 4AK3A 5KXCA 1QOOA 2EALA 4NIGA 1ULOA 1N47A 2CAUA 2EXJA 3O12A 1CAXA 5DPNA 5AC93 5F6KA 1C5IA 5JSPA 2PAKA 1MZFA 4YW2A 1GWLA 2WQZC 2MEV1 5GLVA 1ONAA 4W4ZA 4CEWB 3I2OA 1JS9A 1RMU2 3IBMA 2RE9A 1KD7A 4N43B 3RZHA 2K46A 4BK4A 1AHSA 4GH4C 1D4VB 5IJRA 3P6BA 4LOSA 3H8UA 2EVXA 1J3RA 5F1RA 2WYSA 4META 3O1SA 1FNZA 2D6KA 5C4WA 5C5UA 5FTTC 4GA9A 1MS4A 3RZMA 2PFWA 4YW5A 1DF0A 4B4RA 5FPXA 1RL3A 3H0OA 2OUJA 4FTEA 1S0EA 4AE2A 4DZGA 3HNBM 1JYWA 2Z69A 4CUCA 3AFGA 3VBHA 3ILNA 1FPN3 3KHBA 3OUIA 5FY4A 3A23A 2RDQA 3AFKA 4YLZA 2G9FA 2IVIB 4DUVA 1COV3 4ZZ8A 2WZEA 3I59B 2WZ8A 4GD4A 5TSWA 4NIHA 2Q8DA 3MLKA 2JENA 2P3YA 4HSLA 1MVQA 1NOVA 1ULPA 2FCUA 1MS8A 3AL5A 3GHMA 4OVEA 4QKFA 3WDVA 2WS93 4JQRA 3WX5A 5LW9A 2TEPA 2HH9A 3PIJA 4RS5A 1CIWA 1S0CA 3AVSA 1OXCA 1KQRA 4IE7A 2YC2A 4Y4RA 4F7ZA 3GBWA 4Y1UA 1AR92 2W87A 5FZ4A 2XBO1 3AB0A 3NV2A 3BIEA 4XFFA 3SHRA 4KWJA 1PZ7A 3OPWA 5FZ9A 4UXAA 4AQSA 5C8WA 3ZN6B 2PQQA 5HV4A 1G9DA 1JXNA 3D0SA 2F6BA 4OUEA 5BNNB 1YLLA 4MG2A 1SLAA 3ZSJA 4COVA 3CF6E 1AR81 3DN7A 3MIFA 5LA2A 3AP4A 1XU2A 1ZZ7A 2R1BA 1WLCA 1QJZA 2IXKA 4TZDA 3RFRA 3VD7A 3WF3A 1W9FA 3MFAA 3C7GA 3NV1A 1VRH1 3LAGA 4CDWC 4JKKA 2JEMA 4LK6A 3J8F2 4D7YA 1JYXA 3HPNA 1OC1A 1PK6B 2D3RA 2P37A 2K2SA 5KHKA 4YNIA 2E53A 3A21A 3BPSA 4OULA 1ZA4A 1CAUA 3BB6A 3CDZB 4LO7A 4OUMA 2PAMA 3B7MA 2O1QA 4Y4YA 1APNA 3P1IA 2KM2A 3LCPA 2Q1MA 1AL21 4FOWA 3UGGA 3VD5A 1B35A 3WD5A 1MEC3 1WCDJ 2QQLA 4FQZA 2OUHA 2YY1A 4Q29A 4RR3B 3PHMA 5IFPA 5A7OA 3QD6A 4KWKA 2N7GA 5A32B 2X5IB 1LNSA 1QQP3 4TWTA 4WZFA 3ZFGB 2ORZA 3DKQA 5SV5A 2FDJA 1NA1A 1OKQA 1C8NA 3OBAA 4ES9A 2J1EA 5J36A 1VP6A 2RDNA 1RUG1 1MPXA 4B8EA 1VBB2 2ZGPA 4XXPA 2GC1A 2V09A 4E4SA 2R6QA 1PNFA 1QNYA 1R1A1 1YI7A 1Y4WA 2NMOA 3IIAA 5LEKA 1W9SA 1MZ5A 2CL2A 2EIBA 2OA2A 3HN1A 4K1YA 5FYHA 2ZMLA 3LDRA 2JB4A 5L9VA 2ARCA 4AEDC 2XXZA 5E88A 5FO9B 4PI0A 1XU1A 1ZZBA 2OZ6A 2RJ2A 4CU9A 4OHXA 3H1MA 5IFTA 3TAYA 3WQ0A 5JMOA 2VBBA 2IXIA 5J1XA 4S2DA 5EP9A 1U5IA 4URTA 4FOYA 1H8TB 1Z0HA 2JG8B 4ZU7A 4QKBA 1R081 1IPSA 1FX5A 4IERA 2Z79A 2A71A 3MIDA 3W20A 5C8CB 3Q8FA 1ND3A 2AR6A 3I3BA 1XNAA 5DG1A 1V6LA 5LCWL 5CG9A 5KBFA 1D0GA 2QTWB 5LZ6A 4E27A 1HXS2 1UXZA 1XE0A 2WNVA 3F95A 1OQ1A 2JG9B 5JZGA 1SPPA 1FMD2 4K3UA 2PHUA 1E5IA 2VH9A 3ETPA 3AYDA 4YM0A 3GZAA 2W0XA 4L9BA 2LROA 4A4AA 5C33A 1RUE1 2RHPA 5CVRA 1ND2A 1LOAA 3D6EA 2E9QA 3M4FA 4IL7A 5FBJA 5LK7B 3CHXA 4UI9L 1AXYA 3CZJA 4OI0A 4QPYA 2G4IA 4PLNA 1IQDC 4QKDA 3RZGA 3RWKX 4A7ZA 4CCNA 5A3LA 1AR61 1HRV2 3D3AA 3AC0A 3VBSA 3R6SA 4X8PA 3WNXA 1RUOA 3GXUA 4D8MA 1W6MA 1UNBA 3FFQA 3MIGA 4JKMA 3W58A 3H42B 4AGRA 4EN6B 1ZZ8A 2QQWA 4UBHA 5DUUA 5K0UB 3D82A 3SKVA 1ZBA2 5LATA 5FYZA 2VOWA 1QJX1 1BJQA 3JBG1 3KCXA 3LGRA 1VALA 1S0JA 3SCHA 5CFCA 3KT1A 4LUMA 4R4ZA 1QXPA 4UYBA 1U0AA 1W6NA 3MI8A 2XQXA 1PIV2 3DV8A 3DGTA 4LLOA 4QXHA 1PGSA 4QXKA 2MEV3 4HVOA 1EP0A 1HDKA 2JIJA 1BVVA 3OCPA 1JU4A 1WW7A 5JOYA 1U5YA 2Y6LA 3CZUA 4QMAA 3ZXGA 2VZPA 3VKFC 5BNOB 1TE1B 3VD4A 2A3WA 2CWSA 3E1F1 3KV6A 3ZFFC 2GC2A 1D2QA 4XXAA 2A6WA 2R042 3KS7A 4AFBA 2DVAA 4CDQA 3NKGA 3CJIA 4QGLA 3URFA 2DUPA 1QU0A 2B8MA 3N9QA 2WKKA 1OMIA 3D4KA 4QKNA 4IEZA 1FXZA 3WOGA 3WW2A 1WW6A 4GJZA 5EZWA 3JD72 2D3PA 4RGAA 3ZSKA 3W5NA 4B3NA 5AFBA 1LGCA 3WF2A 4XBLA 2JD9A 2UYAA 2OKXA 4EJRA 2UY9A 3CJXA 2FD8A 1FV2A 2PHDA 2K0GA 2VXRA 2Y0OA 3P3PA 4IXLA 4MSVA 4V2VA 1HV0A 3OBZA 2W52A 1VPHA 4IESA 4Y1ZA 4Y5Z0 2IXHA 3HNYM 2BERA 1YXWA 3NNFA 2WC2A 5FMCA 1S0IA 2XJTA 1Q8SA 4JAAA 2VGDA 1TME1 3UNPA 1UWWA 4RSUA 1YO8A 1WWYA 1YC61 2PHXA 5CA6A 5T50A 3UKVA 1DZQA 1W90A 3BTXA 2ZKNA 1WMXA 4LEJA 4YG0A 4BQ3A 4CP9A 2BP6A 1RVF2 4FT8A 4MXWB 1L7RA 2XBO3 3N9OA 5FYVA 1U5ZA 2I2SA 3DL3A 3MBWA 3O0XA 5FLHA 3VBRB 3IDBB 3B93A 3OY8B 2YMZA 5ABJA 5KXDA 3MUY1 3N9LA 4WM7A 1PNGA 4YG6A 1ALYA 2B39A 4IV3A 5EXOA 5FPLA 1UU5A 3USUB 1UMZA 4IEPA 5FAXA 1GZWA 1AR83 3HAGA 1W9TA 2WWUA 1AJOA 1S0FA 4LK7A 3WP4A 4D6SA 4WBBA 5GKAC 3VBUC 4MGYE 1E57A 4DXSA 2A7AA 1VRH3 4B29A 3VBOB 4YVSC 5T3NA 3W9AA 4BIFA 4CP1A 3T2QA 2BRTA 1JZ7A 3BKZA 4AF9A 3A0KA 2W1SA 1W6OA 1ODMA 1YI9A 5A7QA 2PAEA 2HLEA 3WQBA 2VMIA 3VDAA 3CLPA 3VDDC 4XF9A 2UU8A 1D4M2 3NQHA 4BLJA 4Q4W1 2EICA 4BE3A 1AL23 2IZWA 2F4PA 3T08A 1YWKA 5A33A 3IT8A 1TG7A 2IUWA 4OLLA 5BNPC 2NMNA 3LDBA 2OW4A 4XIOA 4YVWA 1G9BA 1AL0G 2CAVA 2WNEA 2FMDA 4QDRA 4LO6B 3A7QA 3PVOA 1JZ5A 3I2FA 2VNRA 5T5OA 5I0DA 4FOQA 3VDBA 3AK0A 1QJU2 4FXKB 1QKQA 1RUG3 4DXRA 3U11A 1BK1A 1WGPA 2WJSA 2Z42A 3AKSA 4P9YA 2J1VA 5FBZA 1KRIA 4COWA 4AHZA 4YW1A 2XVLA 4GH4B 1SLBA 1R1A3 3VKNA 3PVNA 4YW4A 1C8M1 1VBA1 3FHQA 4LBJA 3ZFEC 1OVSA 4QM8A 1UN1A 4NRMA 1IS4A 4AVAA 5K9YA 2VCMA 2P3IA 1NG0A 2ZACA 4NO4A 5F3GA 1MS9A 5DDJ2 2HKXA 4XUTA 1VJ2A 4A3ZA 3SH5A 3OUHA 5C3RA 1IG0A 2E6VA 4XDQA 1R083 4XIKA 4L11A 2HWB1 4JKLA 3I7DA 4LBKA 1L3JA 2UYBA 3I54A 5L9BA 1MVEA 4K7JA 4EQVA 2E51A 4Y3OA 5FZEA 5HXVA 4CEYB 3RMYA 1O8PA 2VUDA 2RS32 3MPPG 4CCDA 1EY2A 4QM9A 5A7WA 4CEWC 3ZMOA 1JN2P 4OI1A 3NNJA 1OA2A 4FP2A 3UL2A 1GWKA 2JX9A 3SITA 4XZUG 5FP7A 3E6CC 2ATFA 2BBAA 3B9CA 5HI0A 2CYFA 3IKWA 1OBNA 2JB8A 4LITA 2AUYA 5CISA 4BISA 1R1ZA 5LA9A 3SCFA 1H2KA 4O61A 3DF0A 3KF3A 2RS12 2VC9A 1REEA 3NV3A 1AR63 1CVNA 1DGLA 4G9SB 1HLCA 3FX3A 4I09A 4NIDA 1ASJ2 1DGRN 4KU8A 3NO8A 1W3XA 3WW4A 3T0DA 3KMHA 1VBE1 3ACIA 2YGLA 1RC6A 1UX6A 4G3YC 4N53C 2WO3A 5ANQA 2VQ0A 1RTVA 5ERLA 4BCUA 4CDWB 1QJX3 5FIXA 3JBG3 3BYWA 3W21A 1BEV2 4JC1A 4HZFA 3NNMA 1NXD1 4HSJA 5FY8A 1CESA 4X8NA 4XBNA 3ZYFA 1TEIA 4FCAA 4Y5SA 4LT5A 1LOBA 1W05A 4PIYA 5GLZA 5EYXA 5FMOL 1OHFA 1XNTA 2J42A 2XL7A 4Y22A 1W6PB 2DU1A 2XGXA 2Q8CA 1PVC2 2V5YA 4D69A 5IHRA 2YROA 5FKCA 5FZ6A 2FCTA 5LASA 3WQ7A 2ZX3A 1I1EA 3HIFA 2VZVA 2YGMA 4WVMA 2WFF2 2QKDA 1MQTC 3TYJA 1NZIA 1XBFA 2CGNA 4KWLA 1OLME 1UYYA 1VAMA 5F3EA 3OD4A 3WF1A 1O3QA 4K40A 4TLFA 2BGCA 2VMEA 3POGA 2FMYA 5JXIA 2AH2A 1CN1A 4PDWB 2BDRA 4QX1A 2P4EA 3M70A 4NR1A 3D8CA 3IMMA 3BU0A 2WZPP 4GZ9A 4WVZA 1PK6C 4XZPA 3AXEA 2WN2A 5IVBA 4TYSA 3MW4A 5DAVA 4AEDB 2CV6A 5FP3A 1HJFA 2AREA 2C9AA 4JDNA 4M0NA 3BTZA 5EPAA 1TME3 4LA2A 4C0HA 1W3VA 3ZYGA 1IQAA 1GMMA 2AC1A 2PLV1 1T2XA 4RR3C 3VD3A 3WHTA 4QPGB 1RHI2 1TNFA 3AZVA 3IMNA 1OH3A 4PBOA 4Q4Y2 5CFDA 1C28A 3M7AA 4LMFA 4DIQA 2QQVA 2R062 1CIYA 3ZXAC 2VBPA 3ALQA 2B5HA 2E32A 2EAKA 2R0FA 4AWDA 4EE2A 3HT1A 2VTXJ 2C24A 1ZA7A 4AFCA 1EUUA 4JRAA 5L7OC 3KQ4B 1UD1A 1V70A 1RINA 1WUVA 3FUQA 5ACA2 3POJA 3FWEA 3THCA 4XFCA 3U37A 1SDWA 4OMCA 3V0BA 2VNGA 3LF7A 1NCQC 2QQKA 1YJKA 3DYOA 1A6CA 4K6BA 2HWD2 4OHVA 5C9AA 2ZKLA 2RMU1 3OB8A 3TEYA 5K4LA 4OCTA 5EJ1B 3TN92 4ATEA 1GOFA 3HJRA 3IB3A 4WM8A 3SCGA 3WG3A 2Y60A 2X05A 3TBDA 3NMBA 3D5OA 3NKTA 5FZIA 1HXS1 5DZGA 3I3EA 4Q4X2 5CADA 5J96B 5KWRA 2A3XA 1H1IA 4I02A 4XHBA 5JCTA 3G6JB 5B2GB 1S1AA 2JE8A 4A44A 4E2SA 1Q3EA 1RXFA 4Q4W3 4XFIA 5T55A 2XLGA 1SG3A 5DUVA 4BMEA 2P5BA 4AI1A 1Q5OA 5CIRA 2A6XA 5FPAA 3ITQA 1PO21 1UXXX 3ZPYA 2VM9A 3MW3A 1G7YA 3CO2A 1CR7A 1J84A 1VBD2 2KD7A 3B02A 4RQPA 1GP4A 4KI5M 2WT0A 3K4DA 3H8XA 3PU3A 1SBEA 1JW6A 1AVBA 5F8PA 1XB9A 5H9RA 5C3QA 1VR3A 3NSTA 4Q0PA 5LK5A 1NQJA 3DPRC 4NHYA 4XVHA 5DAWA 4COZA 3ZFFB 1UYZA 1C8M3 2ZA9A 4GJYA 3BGAA 4A7KA 3BVCA 4P9WA 1CAVB 1I3HA 1YCIA 3PIGA 4GXLA 4ORFA 3RRDA 1W06A 5J7MA 1C1LA 1G6NA 1XRUA 1BBT2 3S5AA 2H6BA 2TNFA 1J3PA 2W92A 1W99A 5FZMA 1LAJA 3VUOA 2BPA2 1W39A 1SEFA 2BFUL 3C8XA 3LWCA 4L8QA 4YRDA 4JGYA 5FYMA 3VN4A 3WQ1A 1NCRA 2DVGA 2HWB3 3CMGA 2VUAA 2ZX0A 1TZOA 2C1FA 2GP3A 3QBQA 4YSFA 1CAWA 3IM0A 5FR3A 4LHLA 4YW3A 2HWF1 4IEVA 4HKLA 4G4FA 1RYYA 4HONA 2ZX4A 1UZ0A 3I2KA 4IE4A 4RFRB 4BXFA 1W03A 5K8SA 3H9AA 1LHVA 4UF0A 4HBNA 3U10A 3PUHA 3FLTA 3K4ZA 2MHFA 1O4TA 3ZPOA 3G7DA 2D97A 1V0AA 1SLIA 3ACLA 4AI8A 3IPVA 1ZRDA 5EV7A 1CZVA 1D2SA 2OXBA 2R49A 2Z5WA 1YQ2A 1EPWA 2C9KA 3AMPA 3E5QA 4P02B 4B4QA 4CU6A 5IATA 1RUF2 2QQNA 1V9U1 2WAOA 3Q8BA 3P5BA 5G04L 4AFAA 1SHWB 4HG6B 4ZHNA 4M3CB 4QX5A 3KCYA 1DIWA 1O4YA 4JX0A 3AKRA 2BU9A 5A70A 2QBXA 5BV6A 2HWC1 3VBUB 1VBE3 5JPNB 4JHTA 3N7KA 5ISLA 3H7YA 2BNOA 3C3VA 1IKQA 2E63A 2PHFA 3PU8A 4YVSB 4AW7A 4IE5A 1E5SA 5FZ8A 4KL1A 5GZFA 5J09A 5FWJA 1YQ5A 2ZGOA 4Z82A 4ZU5A 1T6BX 3VDDB 2C6SA 2RR11 1QJY1 5I8SA 5JVVA 1MS0A 4E4DX 1JHJA 3VBFA 1UZVA 2PQSA 1ACCA 4LOTA 4LTAA 3JB8A 4H3WA 3NAPC 4IEOA 5KHIA 5BNPB 2DV9A 3QCWA 4AI3A 1BHGA 1PMHX 2EXHA 3WSOA 1NXMA 2XH6A 4ZU4A 5IK5A 1PGL1 1UO9A 5F5CA 4CPBD 3HD8B 4Q8LA 1UX7A 4XCAA 1NZCA 2GH2A 2HYKA 2ZMKA 3V64A 3SISA 2Y8KA 4UW3A 3DUIA 4CCJA 4PF1A 2AYHA 1Z7S2 3UGHA 4BQ1A 3L9JT 3POFA 3I2JA 4FOVA 5F3CA 1G9AA 1I5PA 2ZS6B 1AR72 5BXXA 2W95A 3BOPA 4FFFA 4CDUC 4HOOA 4MUVA 5KHJA 2ZX2A 2GU9A 1AXKA 2OIIA 4JRLA 4NWVA 4E8DA 5HBAA 5JR2A 4P9XA 1W8TA 2VD7A 3LIGA 3KQRA 4AVVA 5JI9A 3ZFEB 2JD4A 3WEZA 1LULA 3I2GA 4NHKA 4Q4V2 4XMIA 1ZNPA 1ZBE2 5CU1A 5LWBA 2CU5A 1GUIA 1OH4A 1GFF2 2Y34A 4RL7A 5IAVA 5JAXA 2ARAA 1DCSA
chains in the Genus database with same CATH topology
1ZZCA 1SBFA 4GB31 2PLV3 2Y26A 3QH6A 4XQ4A 4CDXA 4P14A 1GV9A 4LBOA 1N1TA 2R30A 4XFHA 2WLQA 1IGOA 4OHZA 3MFCA 2WSUA 4EWDA 2E7TA 3M1HA 1DQ6A 1WD3A 2GN3A 4AHWA 4DS0A 4IV1A 1BMV1 2ZTNA 1DGRA 2I45A 2WLPA 4H14A 1RUC1 4BYYA 4JDOA 5I93A 4XFBA 3B69A 2D6OX 1MS1A 2ZAHA 5FQ0A 3TNQA 1LENA 2OPKA 1YFYA 2MNGA 1PO11 3ZXFA 4FP3A 2RMU3 4N7UA 3KZ4C 4LA3A 4OHWA 3AYAA 1O3SA 2ZGLA 3FLRA 4W6YA 1J59A 1W6QB 3NJZA 1SBDA 2DUOA 1LR5A 5F9TA 1PGW2 2LALA 4HPKA 2A75A 2PHLA 4XF3A 4N53B 1QXJA 2ARBA 1UIJA 1ENQA 3AMMA 4O9GA 4YZ2A 2A73B 1HIXA 5BY5A 1H4GA 1OA4A 4QGNA 4AI2A 1PO23 4Q0QA 2D7FA 3HBZA 4EN8B 4Z2WA 1UL9A 3ETQA 4W65A 1RUI2 4SBVA 1R092 4AXOA 3MF9A 1C3HA 2BFUS 1BCXA 2WNUA 4YGEA 2IFWA 2B45X 1N3OA 1FOD2 2P2KA 4LULA 1ULEA 3FJSA 1LCLA 1OOPC 2BQPA 1MQTB 4AQ6A 4Q0VA 2R1DA 4NVPA 5D1IA 4WVVA 1UZYA 2WZR3 4WM7B 2ET1A 1BZWA 4U36A 4NHLA 2PHTA 1U12A 4FPJA 4I0AA 1YFXA 2HWE2 3Q9OA 2VULA 1AYM2 2RM22 4AVCA 1N1SA 1UKRA 2A5ZA 4Y20A 4HKOA 3EXUA 4XOGA 1DFQA 4RFT0 1H4HA 2Y38A 2V73A 1GLHA 3AMHA 2PHWA 2HWF3 3U4XA 5I8TA 1HX6A 2NN8A 4FAHA 2AGSA 1XE7A 3VHNA 2EXKA 3IDCB 4D94A 4JGZA 4IEXA 5A33B 1LGNA 1RJ8A 2GN7A 1M4WA 4I01A 1OD5A 4LLFA 3NWKA 3E97A 4DXZA 4PDWC 2YHJA 1H1MA 5L7OB 4PBPA 2A3YA 1CGPA 2BYVE 3LSEA 3OTFA 5HCBA 4QPIA 3OGGA 4XF1A 3WG1A 3ZXLA 3ZXEA 1NCQB 4EV0A 1EAH2 1A8DA 1UF2C 2E7AA 2HWC3 1RHI1 5LEJA 4XILA 5FCCA 1FNYA 4L97A 3I2DA 2P17A 3RZZA 4XTMA 1UU6A 3JZVA 4LO5B 4JV4A 5F5QA 1GZCA 4QPGC 5ACA1 2RR13 3O0VA 2DTWA 5AC92 4XJUA 2EIGA 4FXGB 1B09A 1QNWA 1AX2A 4N9IA 3O14A 4QT6A 4XFAA 4COUA 1YFWA 1URXA 3KM5A 4XJ9A 4MVTA 4YYOA 3U0ZA 2GC0A 3SLIA 1JH5A 5J98B 1RUH1 2WWSA 1VIWB 4YARA 2QVSB 3MLLA 4MZUA 3DPRB 2D44A 1HRI1 1TMF1 1POV0 2D5FA 2HJIA 3AKPA 4FPFA 1UIKA 5C4WC 3AJZA 1ZM1A 4YGCA 1VB4A 1WMFA 1FPN2 1NLRA 2GC3A 4KGGA 3WW1A 3AJYA 3FFZA 2ENRA 1COV2 1SLLA 3WT3A 1WCKA 1LGBA 3VBHC 3WG2A 5FOJB 4GB33 2VG9A 2VVFA 3GNEA 2WS92 1FAYA 1IS3A 1VB2A 3BODA 4YM2A 4DPNA 2XUMA 3RS6A 1S55A 5IK4A 3N36A 2I74A 3GBGA 1LU2A 1WD4A 3UKTA 1ENSA 4RS5C 3ZIWA 4AQTA 4LBQB 2UURA 1RUC3 3R05A 4HL0A 1VBC1 1LHUA 2DURA 5BNQA 2WIIB 2VQAA 1PO13 4AEJA 4QQLA 4J1WA 4HVRA 1CONA 4E9KA 4N43A 2VW1A 2DCYA 3O5SA 1O3RA 2ZGSA 5I0SA 4W6XA 2ZGQA 2RS51 2ZABA 2WT2A 1RUD1 4B7KA 1OPMA 3I8TA 1YUDA 4EWEA 2WINB 2ZBJA 3KCCA 4Z92B 5D8AA 3ZMNA 4Z8BA 5GLUA 1MEC2 4UW6A 1WCSA 2ARXA 1XNCA 3N3HA 2B7YA 5CG8A 5I0UA 3I59A 3E5XA 1QQP2 1RUJ1 1B35C 3JU9A 4FPYA 3EO6A 3B5LB 1CX4A 4HN1A 2ZZQA 3NAPB 2ZJCA 2R0HA 3B94A 3M8LA 1DYKA 1AYN1 1H8VA 4F83A 3OBTA 4AVSA 4D7SA 3WDUA 4LUKA 1NA1C 1EV11 1OLQA 2XG3A 4Q0SA 4GMP0 1DGWX 4XHXA 3PTYA 3THTA 2R071 5L36A 1C4RA 1BYHA 1YIPA 4CDUB 1LRHA 5BNNA 4FPHA 5H9PA 4XF0A 1JOJA 3ZVXA 4N9HA 2WT1A 1F2NA 1K5MA 3LOBA 2AZ5A 5JIAA 3VZNA 1AX1A 4KGQA 1GANA 4Z07A 3TOJA 2D5HA 2GALA 1QH6A 2QFEA 2D98A 2B46X 3RYKA 4FQ4A 3RG0A 4PF5A 5CBLA 3KSCA 5E89A 1ND3C 4J6GA 4AVTA 1NY72 3FBMA 3VL8A 3WVJA 2WNVC 4YGBA 5T5JA 5JZGC 1NQDA 3OYWB 1F5FA 1LHWA 2OZJA 5A32A 2X5IA 3ZFGA 4L2NA 1ND2C 2PYTA 4RHV1 2SLIA 4ISQA 1SFYA 1G9CA 4LE4A 5KXEA 1LTEA 5J48A 4JTNA 3VBSC 2QCSB 2WA3A 1QHDA 1DGWA 1UW8A 5EYYA 1RMU1 5JLVA 3B9IA 2ZMNA 3B3QE 4D3WA 1UZZA 4WV8A 5GZEA 3VV1A 1LODA 3SNMA 1ULFA 4LNVA 1MZ6A 3R4SA 4R4XA 2MEV2 5CFCC 1LHNA 1H8TA 2JG8A 4GALA 4IETA 2QNKA 2Q1ZB 2UWAA 5IUQA 2IFRA 5C8CA 3T2TA 2W68A 3EJKA 4PLOA 4Q26A 4P5HA 4XPVA 1MS5A 1RUE3 1RUH3 1O5UA 2W39A 1LOFA 2JG9A 5GJ6A 3M3IA 4XTPA 3KT4A 4QU2A 1HRI3 3C2UA 1OOPB 1TMF3 2BW8A 2VMHA 1IS6A 2QE3A 3NVCA 3CJIC 4CDQC 1TQ5A 2NM1A 2ZCWA 3S30A 1GSLA 2EA7A 1V6JA 3KB5A 4YZ3A 3HMYA 3V0AB 1WLDA 1H9PA 4AHXA 3AZZA 2VVEA 1AR91 4MYEA 1O91A 1DQ0A 2DWRA 3H1YA 4I0WB 5CNAA 4I2OA 1J1TA 1SCSA 4YM1A 2XJSA 3BCWA 5E1RA 4YM3A 5K0UA 5GM0A 4P9IA 1CPNA 2XBO2 3MIEA 3VZKA 3AKQA 3VZOA 4BIOA 1DLLA 4M00A 3OPZA 2D43A 4OI4A 4LE3A 4D7TA 1VBC3 3J8F1 4ITCA 1KXGA 1AR82 2DVDA 5ABJC 4WM7C 2IWGB 1ZYBA 4AFMA 4IV3C 1AX0A 2IC1A 3MPBA 1RITA 3U07A 3MEPA 1GZ9A 3N7JA 1VRH2 5BNOA 1CQ9A 2CGOA 2O8QA 4GIQA 2DVFA 1BXHA 4MGZE 2RS53 4COWA 1OSGA 3SXWA 1N3PA 1RUD3 5KC6A 1LOCA 4E2QA 5JSOA 4YGDA 4CP2A 5A3MA 3H50A 3ST7A 3N7MA 4GQ7A 1AL22 4M01A 1H1AA 1WA4A 4K20A 3A4UA 2XWBB 4M3CE 4R9DA 1LOEA 1D0HA 1VBB1 3E6DA 4XETA 1LOGA 1YYNA 1IS5A 3WCRA 1RUJ3 3MIHA 4CRQA 2GAUA 5AVAA 2D6PA 1RGSA 3X29B 4BM8A 1OPOA 4YVWC 2GH8A 1RUG2 3ATGA 1AYN3 1CAXB 3VL9A 1GNHA 2QZ3A 3RI8A 1EV13 2XWJB 1QXRA 1GYKA 1R1A2 3OJBA 3VBRA 2PELA 2VOVA 4R52A 5E8AA 1OLRA 3OY8A 2XL9A 2R073 2YDEA 2ILMA 1QDOA 2JDZA 4C0BA 4I30A 4HT1T 3AXDA 4CYDA 2A70A 3N7LA 5K7PA 3ZSLA 3IN9A 5C4WB 3V56A 3GHNA 1Q56A 5GZGA 1FMD1 1R082 2VPVA 1JTZX 1WW5A 3VBOA 3VBHB 1JYCA 3INAA 3UKNA 2VOKA 1X82A 1GQHA 5HCAA 3H7JA 1OFSA 1GNZA 4DNYA 5FRAA 3I4IA 1NE6A 3ILFA 3T1LA 4B4PA 4H7LA 1HRV1 2CWMA 4RS5B 4U2AA 4XE9A 4QHBA 2BBVA 4Y1XA 2DYCA 1ZBA1 2DCZA 1AZDA 4RHV3 3N35A 1H0BA 1AR62 1VBA3 4I3GA 1MZEA 1DZRA 2P3JA 5FREA 3BALA 5GLWA 2GMMA 4JDMA 2DU0A 2NQYA 1PIV1 4GH4A 1BVP1 1S2BA 1QJX2 3JBG2 1F9KA 1OFNA 3PLQA 5E16A 4P9GA 5IK8A 1RMU3 2TBVA 2NZ9A 4Y1VA 3LKJA 3WLUA 2R041 5I8YA 1WW4A 2JICA 3DKWA 4NN0A 2ZPXA 3ZYIB 1CAUB 3JD71 4NWWA 3VKLA 4LR4A 4WVWA 2VVDA 4FPKA 1B35B 2XJVA 4LHNA 4CEYA 4WZCA 2PA7A 2SBAA 2Q4SA 3SH3A 4ASLA 3WUCA 4AGGA 4K9SA 1CJPA 3ZX7A 1NLSA 4CZSA 4R9AA 1NA1B 3VZMA 1Y9QA 1F8VA 5BUVA 1XNBA 3AP6A 4FPLA 4ATFA 3T1MA 2A6ZA 1RVF1 1AR93 1JYIA 2ZAAA 4NHMA 5EWSA 2FZ2A 1BKZA 1KS4A 4E4ZA 1TME2 2VUJA 4M0HA 1PZ8A 2HEWF 2ZOEB 4W6WA 3RI9A 4EN7B 2HEYF 3K51A 1PM7A 1BQPA 2LM3A 4CDWA 2WL1A 5FOBB 3L2YA 4IEWA 3R4UA 4MV2A 5CFDC 2PTMA 3RJ2X 2YV8A 1ND3B 3VHOA 3J8F3 4AGVA 2EXIA 3NL1A 2WNVB 1W6PA 5JZGB 3VKOA 3EBRA 1ULGA 4LBMA 1D4M1 3WV6A 3AMNA 2IXJA 4XMAA 1ND2B 2BNNA 3M3CA 2CTVA 5DXDA 5KC5A 4S2GA 3RQ0A 5C9AC 4IEYA 4F3JA 4QQ2A 4WM8C 2XJUA 1V6IA 4Q4W2 2D40A 4GKYA 4R9BA 1H9WA 4OZXA 2WA4A 1V6NA 3VBSB 2ZHMA 1FYUA 1QJU1 1W6MB 4BA6A 1C57A 1Q43A 1VBB3 4L99A 1XYPA 5IT6A 4AEDA 1ZRRA 2Z2SB 1H2LA 1OQEA 2DFCA 4XQDA 4DOUA 2VMGA 4S2HA 4HMZA 5JWPA 1Y3TA 1SCRA 1O5LA 5CFCB 1GR3A 2EAAA 4RQPC 4C1XA 4QQHA 1AF9A 1W6NB 4HK9A 2ZX1A 5DDJ1 5H9QA 3ES1A 2VY0A 4NPRA 3CNAA 4F8AA 1C8M2 1VBA2 5JOXA 1X7NA 4PLMA 4Q1RA 4CDQB 4CP0A 3CJIB 3P3NA 1CJDA 3S7IA 1HXS3 1RB8G 4BOWA 3JCIA 2RS31 1FMD3 1DQ4A 4A2UA 3ES4A 3EHKA 2HWB2 3VKMA 1ENRA 5T5PA 1YJLA 4K21A 1QOSA 4QQOA 1W0PA 4JGYC 4ONUA 1NCRC 1X8MA 4S2FA 2PN5A 2XB6C 1QMJA 4AQ2A 5D8AB 2RS11 1UPSA 3LA3A 3THPA 1RJ7A 1HRV3 2H6CA 2DFBA 2XJQA 4ZXKA 1XYOA 1ASJ1 3RWNA 1CD3G 3AYCA 3MDPA 4Z1VA 5JDBA 3JUUA 1EYBA 1OI6A 2WSVA 1ZBA3 2ERFA 5FLIA 4PQ9A 1C1FA 5ABJB 4P9LA 1BEV1 2JECA 2BNMA 5EJ3A 3WP3A 5T52A 3M3EA 4IV3B 3MW2A 2D6NA 3J4UH 4CTEA 1VBE2 5LRSA 4XBQA 1GZWB 3WW3A 2B9UA 1PIV3 1UCXA 4ZKTB 1XYNA 4MGKE 3ZFFA 3JB4C 1G8WA 1PVC1 3R0RA 2VW2A 1VAKA 2GMEA 1CAVA 2ZGUA 2H0BA 4QQPA 3ASIA 4Y26A 2WFF1 1O3TA 1OQDA 2O8OA 1SQ4A 2R043 1W6OB 3WDWA 3TWIA 4I0BA 4DY3A 1KJRA 4C1WA 1YNAA 2X8KA 1K5MB 3JD73 2Q5TA 1Y43B 3VBFC 4AI0A 3AP5A 2DCJA 4FPOB 5CB7A 1H2MA 3NV4A 2FHRA 4XJAA 5IK7A 4IQPA 4KU7A 3UK9A 1AJKA 2DUQA 4YVWB 5JPMB 3AM2A 5GALA 1DQ2A 1DBNA 1LKNA 1V9U3 5GZCA 1FV3A 2ZHLA 1AUYA 1LESA 4P9JA 1O7FA 4Q4Y1 1RVF3 3GZTB 4XEZA 2R061 1LJ7A 4M3CA 4AYUA 4QGMA 2PLV2 4EN0A 1KITA 4PIXA 3VBUA 3FBYA 4OHYA 1QJY3 2ES3A 5L73A 4YVSA 4HANA 3AZWA 2ZGNA 3WP5A 1XQNA 1GKBA 4CDXC 1HQNA 2HWD1 5BPXA 5H9SA 1QY4A 3TN91 3VDDA 4H55A 4J1XA 2XKOA 3WDYA 2O0OA 1YIFA 3VGIA 3ZYRA 3ILRA 4LO4B 4FPGA 3FZ3A 5JI7A 3AZYA 3AMQA 4Q4X1 3H3ZA 3KT7A 4IV1C 4MXVA 1U5XA 5BNPA 2RMU2 3POWA 1D4M3 2NPIA 4FVVA 2Q0AA 4AG4A 2QUOA 2UWBA 2ZHKA 3AZXA 2X53S 3KLSA 4GWNA 5T54A 5DUXA 2G9GA 4E2GA 3PVEA 2GNTA 2C0ZA 1VBD1 2XJRA 4PCRA 1TNRA 2BTVC 2QDRA 3QACA 4KBBA 5I91A 1QH7A 1QF3A 2B42B 2R16A 1QJU3 3APBA 3E6BA 1WLWA 2BUKA 1MS3A 2XLAA 3ZFEA 4PIZA 1PO22 3AP9A 1AXZA 4LBLA 3TNPB 3UJQA 4B7EA 5I0TA 1J3QA 4A3XA 3WINE 1HW5A 2ETEA 1KJLA 4HFSA 3ZDSA 4IEQA 3IDEA 3ELNA 3O7OA 4JCKA 5DDJ3 1BBT1 3CL1A 4Y22B 3BIWE 3WXPA 2WNUC 1IKPA 1V00A 2WZR2 4DMIA 5FO8B 2VECA 2GNBA 4HKWA 3ZYJB 4CEWA 4WVMB 2BVBA 2MPFA 4HK8A 1W0OA 2GSYA 4X6QB 5GLTA 1IZ3A 4HLTA 2RS33 2QQPA 2YYOA 2VW0A 2ZGMA 1WMEA 4HN0A 2YC0A 1W6QA 2HWF2 3WDXA 4XQWA 2DVBA 1IPJA 5DZFA 1KS5A 1S0GA 3RJRA 2XKPA 1RUF1 4RD7A 2RS13 3VZJA 3ME2A 1A3KA 4N53A 5L19A 1ASJ3 1XNKA 1POV1 3QH7A 4Y24A 5CFDB 3MF6A 2QDNA 4EN9B 4JGZC 1V9U2 3PMSA 1IHMA 3D0JA 3RMXA 1QWRA 1BEV3 2NYYA 1MR5A 2CNAA 3E5UA 2JXAA 2HWC2 5JMCA 3ZN6A 3S0MA 4QPIC 1IOAA 3JQXA 2A6VA 4INDA 4K8FA 2DTYA 4R9CA 3V0BB 1MQTA 1SACA 1HQLA 3WY6A 1PVC3 4KNCA 2EF6A 2NLRA 3WG4A 1X50A 5C9AB 3N4MA 4WM8B 2OVUA 2WFF3 2C5DA 2RR12 1QJY2 1LHOA 1DDLA 1JBCA 1Z7S1 1PK6A 3JQWA 3AYEA 3MLJA 1AR71 3PJQA 3RYRA 3PNAA 3J26N 1PGL2 1DZTA 4MX3A 1I9RA 4LHKA 1N1VA 5HCFA 1WBLA 3RSJA 3OF1A 2WFPA 4MH0E 1N1YA 3AX4A 1Q8OA 4Q4V1 4RR3A 1ZBE1 2IXCA 3RYPA 4RQPB 5FO7B 4LO8A 4AFDA 3A0NA 4AEKA 3BU7A 1DG6A 1O4ZA 1N3QA 4LBNA 1DYPA 2LTNA 3FHIB 1H30A 1RHI3 3EQEA 5L7OA 4YFZA 5SV8A 4Q4Y3 1X33A 3M2MA 2YUEA 3QLQA 4DRRA 2R063 3M3QA 4DINB 3HWJA 1GICA 1NCQA 1DHKB 4GB32 1V6MA 2XLFA 2Q8OA 5ACA3 4BHPA 4M3CF 3B00A 1MACA 1OA3A 3CU7A 3ZN4A 3ZO0B 2HEVF 1S0BA 2HWD3 3BOWA 4JGYB 1NCRB 3TN93 1BMV2 4GMP1 2XPJA 4QD2A 2CY6A 1RUC2 1CAWB 3M3OA 2JE9A 4RA0A 3HT2A 1H2NA 4Q4X3 1A8MA 3LB9A 2BEOA 3ZYPA 3J9SA 1PGW1 1PO12 5JSRA 4DB5A 4JVAA 1LECA 5I0RA 2GNMA 2H0VA 3B01A 1SMVA 2QZ2A 1LU1A 4TSVA 4N90A 4JTOA 4MGIE 4BPZA 2NP0A 3IPVB 4COYA 1V6KA 4FTBA 4X6RB 4N43C 3NW4A 1W2UA 1VBD3 3BPZA 4BWOA 3H1WA 3RNSA 1RUI1 3DPRA 1PVXA 2CGPA 1R091 4Y1YA 5LRRA 4OI2A 4FO9A 1FOD1 1ZRCA 4YG3A 3L2HA 3PVBB 5D8AC 4Q8KA 4Q0UA 1FT9A 4C91A 1XNDA 2D6LX 3KD4A 3WP6A 4AVBA 2DF7A 5J3UA 1Z78A 2HWE1 2GZWA 3QOPA 3MZHA 2JJ6A 1AYM1 2RM21 3S7EA 3VBFB 1REFA 1BBT3 3KGZA 5J37A 2VU9A 1IPKA 3HQXA 3MYXA 3ZN5A 3TRSB 3ZXDA 1Q8VA 4I3PA 1DQ5A 4LBQA 4KG8A 3SH4A 2XJPA 2WQ4A 4EWAA 1YFUA 2TUNA 3VLBB 5GZDA 2RJKA 3WHUA 5BNNC 1G86A 4A7YA 3GALA 3O0WA 4HETA 3POSA 3R4DB 3TB0A 3USSA 1LEMA 4ASMB 2GNDA 1QOTA 1K5MC 5KHGA 1M06G 3LA7A 2KA3A 1RUF3 1ZVFA 3PMEA 4ISRA 2K9ZA 4C90A 5KXBA 1FATA 1GBGA 1ENXA 1EAH1 3KGLA 2ZGRA 1DQ1A 3MICA 1POV3 4CDXB 1ZZ6A 2JE7A 2BWCA 4Q27A 1UU4A 1WBFA 4MXWA 1F5JA 1WMDA 3AKTA 3GZUC 3NAPA 4DRVA 4FBFA 4IV1B 1ULDA 1FI2A 2X5IC 3ZFGC 5F6LB 3USUA 4DQAA 1SFNA 2P34A 5AC91 1SLTA 3MGUA 3LSDA 5FQ0B 5CAZA 4XW3A 1HQWA 2Q30A 1G9FA 1KFXL 3VHPA