4RHV1

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv100
1FOD2 2WZR3 1ZBA3 3NAPB 4FSJA 5BNPB 4RHV1 5C8CA 1ASJ2 1VBB2 4NWVA 2PLV3 5ACA2 1R081 4WM7A 4N43C 5K0UA 5J98B 1OHFA 1D4M1 4Q4X3 2RMU3 2WFF2 3J8F1 1H8TB 5BNPA 4WM8C 1RUF1 1C8M2 3VBHA 1VBE2 2HWE3 3M8LA 2TBVA 4RR3C 1NA1B 1RUI1 1VB4A 5BNNB 2QQPA 3JBG1 3VBOA 1R1A2 2RS32 4Q4X1 1D4M2 2XBO1 1AR63 1AR83 1R082 1EV13 1PO12 5L7OC 1RUH2 4WM7C 1NCQA 3VBOC 3NAPA 1RUG3 4SBVA 1AYN3 3JD73 5A33A 1H8TC 1VBC3 3VBSC 4CEYA 4WM8B 4CDXB 3VBUA 2XBO2 1FMD2 1QQP2 2VQ0A 1BBT1 3VBRB 4YVWC 5A32B 5BNNC 1PIV3 5BNPC 2HWD1 4CEYB 4EJRA 1AR71 2HWC3 4Y4YA 1RUE3 3ZFEB 1OPOA 5C4WB 1CD3G 2X5IC 4WM7B 1TMF2 1R092 2HWD2 2X5IB 4GH4A 1VAKA 1BMV1 4PDWA 1IHMA 1BBT2 1RHI3 5CFCC 5ABJB 1MQTC 1AR72 3ZFFA 1POV3 4CDXC 4YVWB 4RR3B 5A32A 1ND2C 5C9AA 1NCRB 4Q4Y2 1AL23 1HRV2 1QJX2 1FPN3 1RMU1 1EAH2 1SMVA 1PO22 1FOD3 2WZR2 2HWB2 5K0UB 1VBA3 1HXS2 1K5MB 3JBG3 2PLV2 5ACA3 1AR61 1RUI2 4Q4X2 2RMU2 4CEWB 1MQTB 2WFF3 1RB8G 4JGYC 4CDUA 1HRI2 1NA1C 3DPRC 1VBE1 4GB33 1NOVA 1RUF3 4JGYB 3J8F3 2WFF1 2BFUS 1NY71 1RUD1 1NCRC 1PIV1 3VBUC 4JGZC 2GH8A 4YVSC 1B35A 3CJIC 4QPIB 1ND3B 4CDQA 1D4M3 2FZ1A 1V9U3 2RS12 5L7OA 2HWB1 5CFCB 1PO21 1EV12 1PVC1 5D8AA 1EAH1 1RMU2 5CFDB 1RUJ3 4RHV2 4CDWB 2HWF3 5C8CB 1PGL2 3DPRB 4AEDA 1M06G 2DF7A 1QJY3 1FPN1 1PGL1 1AR81 3VBFA 2IZWA 2XBO3 1QQP3 2WWSA 1PGW1 1ND2B 5JZGC 3VBHB 3ZFGB 1EV11 1RHI1 4RS5B 1VRH1 3VBUB 4QPGA 1VBD1 4WM8A 3VBHC 4YVSB 4GMP0 1ND3C 5DDJ1 4N43A 5K0UC 3VBSB 1C8NA 4IV3B 5BNOB 2HWC1 1TMF3 5C8CC 2HWD3 4LLFA 4GMP3 3TN92 1HRI1 1WCDJ 5CFDA 1AR73 5JZGB 4Q4W1 4N53C 2PLV1 1VBC1 1AR92 1VB2A 1ZBE3 2BBVA 1HX6A 4BCUA 2ZZQA 1B35B 4QPIA 4Q4Y3 1RUH1 1QJX3 1W39A 2WS91 2R073 4IV3C 4Q4V1 1EAH3 5BNOC 3JB4C 1RUG1 1COV3 5JZGA 4FTSA 2RM22 4RS5A 2HWB3 2HWF1 4Q4W3 1POV1 1VBA2 1HXS3 2RS51 5FMOS 2BUKA 1R1A1 2RS31 2ZAHA 1PVC3 3JBG2 4AEDC 4IV1A 1AYM3 1BEV3 1CJDA 1RUI3 3VBRC 3ZFGC 5AC93 5D8AC 1K5MA 2R042 1HRI3 2HWE1 2WLPA 1BMV2 4GB32 1RUF2 2MEV2 5D8AB 5DDJ3 3J8F2 5AC91 5FOJB 4QPGB 4CDQC 4FTEA 1B35C 3CJIA 4Z92B 4JGZA 1QJZA 1NCRA 1OOPA 2XPJA 1V9U2 2RS13 3VDDB 1VBD2 1TME3 5ABJC 3DPRA 4RFT0 1VRH2 1FOD1 1X33A 4JGYA 1RMU3 2R071 2WS93 4Q4V3 2R063 1RUJ2 4RHV3 1VBA1 2RS52 4PDWB 4RQPA 1AL21 2HWF2 4JGZB 2RM21 5GKAC 1QJY2 1V9U1 1MEC1 1ZBE1 1K5MC 1RUD3 3VDDC 1A6CA 3ZFGA 1RUC3 1ND2A 5C9AC 2RR11 3IDEA 4N53A 1RUE1 2RR13 2RMU1 3ZFFC 1NY72 5CFCA 1NCQB 1AL0G 4RQPB 4RS5C 3TN93 1C8M1 4GH4C 4CDWA 3LOBA 4N53B 3ZXAC 5ACA1 3CJIB 4QPIC 1AYN1 3JD71 1VBB1 1AR93 1ND3A 1ZBE2 1MEC2 1QJU3 1Z7S3 1QJX1 1HRV1 5FMOL 1AUYA 2R061 5CFDC 3HAGA 2R072 5LK7B 1RVF3 4CDWC 1COV2 4NWWA 3ZFFB 2RM23 1TME1 1ZBA2 2ZTNA 4Q4W2 1GFF2 4IV1B 3VBFC 4CDUB 1RUJ1 1ASJ3 1H8TA 3VBSA 4CEYC 1VBB3 1PVC2 3VBFB 3NAPC 1NCQC 5A33B 1POV0 1F8VA 3S6PA 2BPA2 1AYM2 1BEV2 1R091 1TMF1 5AC92 3VDDA 2R043 1C8M3 1VBE3 4GB31 4QPGC 4CDQB 4FTBA 2HWE2 4GMP1 2MEV3 2R041 5DDJ2 1X36A 1AYM1 1BEV1 2FZ2A 4Y5Z0 2MEV1 1R1A3 2RS33 1RUC1 1QQP1 4RR3A 1E57A 4RQPC 1R083 1AR82 1VBD3 1AR62 1TME2 1DDLA 4GH4B 1VRH3 2BFUL 1PO13 2WS92 4Q4V2 2R062 2Y26A 5ABJA 2RS53 1OOPB 1RUH3 2WZR1 1PO11 1AR91 1OOPC 1RUG2 4YVSA 1AYN2 3JD72 1VBC2 3FBMA 2RS11 1FMD3 4N43B 1NG0A 4CEWA 3TN91 1NA1A 1PIV2 4CDUC 1RUD2 2GSYA 3VBRA 1RUC2 4AEDB 1F2NA 2HWC2 1RUE2 4IV1C 4CDXA 2RR12 1R093 3ZFEC 5C4WC 1HQNA 5L7OB 1BBT3 1RHI2 4IV3A 5BNOA 1ASJ1 1PGW2 5C4WA 3ZFEA 5C9AB 1HXS1 2X5IA 1QJY1 3VBOB 1MEC3 1Z7S2 1FMD1 1QJU2 5J96B 1AL22 1HRV3 4Q4Y1 1QJU1 1Z7S1 1ZBA1 5BNNA 1FPN2 4YVWA 1MQTA 4CEWC 1COV1 3JB8A 1RVF1 1RVF2 1PO23 4PDWC
chains in the Genus database with same CATH superfamily
5CKQA 1RYYA 2XL7A 2P2KA 2XL9A 4YW3A 1NXD1 2Q4SA 3NAPB 1XE7A 3C7EA 1X50A 3VKFC 2DFCA 5A3UA 5C8CA 4EWAA 4FFGA 2XLAA 4GKYA 1O7FA 2J1UA 4O9EA 5FP7A 2XJRA 2EIGA 2O8QA 2PLV3 2XWBB 4MH0E 2Y33A 1R081 4A44A 4GJYA 1J58A 2D43A 4XBQA 4K3UA 4QKBA 1O4TA 2AGSA 2K9ZA 4BK4A 5BNPA 5FPXA 5C7GA 3VBHA 1VBE2 2GN7A 2WYFA 4PQ9A 2P3YA 3AM2A 2D3SA 3V56A 5CNAA 2VQTA 4BISA 5A3NA 1DYKA 3AP5A 2YB7A 3WV6A 4D94A 2JD4A 4ARYA 4YZ5A 3JBG1 5KXDA 5GLUA 3U10A 5I93A 3HN1A 3MIFA 5HV4A 3NNFA 4M0NA 1R1A2 3ACFA 4Q4X1 3THCA 4BMEA 1OF4A 4OI4A 3UJQA 4FFIA 3H3UA 4BH9A 2VVEA 2G19A 3POSA 1V6KA 3POYA 4AFBA 1QY4A 5FZMA 2WNVA 1JOJA 2VBPA 2JECA 5ISLA 3DEMA 2VTXJ 4CE8A 3UV9A 3AZXA 3NJXA 3MPPG 2ARAA 1SCSA 2G9FA 1UZWA 4UFHA 4YM0A 4I0BA 5H9SA 1NCQA 1FNZA 3OGSA 4LK6A 3VBOC 3NAPA 1RUG3 3SEPA 5LASA 3JD73 1YWKA 3VBSC 2I74A 1VBC3 4CEYA 3OGGA 4QX3A 5FUNA 5AVPA 3VBUA 1LJ7A 1XNBA 4IQPA 4DB5A 5JOWA 2VQ0A 3R05A 5FYIA 2E33A 1V00A 3AMMA 4TN7A 2WWUA 4BPZA 1J3QA 3VV1A 4COVA 4J1WA 4XUTA 3DXTA 5GZFA 4PQQA 1DFQA 2DVAA 2ZGTA 4RN5A 3SH4A 4KWUA 2JIJA 4DQAA 1G9DA 3ZFEB 2ARCA 2VZRA 4M3CB 1XB9A 2WNEA 1R092 4JDNA 4QB6A 1UW8A 4YW4A 5FIXA 1OLRA 5JI9A 3PU3A 1ULGA 4QHOA 5KXBA 1UD1A 2HWD2 3ZMOA 3AVRA 5J36A 2QUOA 5FYVA 1BK1A 2PHWA 4MYEA 4N9IA 4Y1UA 5FRAA 1BBT2 1IQDC 2DUPA 1NE4A 2ZX0A 4P5YA 3FL7A 5FMBA 3ZN4A 5CAZA 5FLHA 1MQTC 2XJQA 4L8QA 1AR72 2VZVA 4K6BA 3ZFFA 4PIZA 3H8OA 3MFAA 4XURA 3N7JA 1GSLA 1PK6A 3T2QA 4CDXC 5KXEA 3BIWE 1V6NA 1GU3A 2F4LA 3VKMA 3OB8A 1CJPA 4FP2A 3J26N 2WO7A 1ND2C 4YPJA 5JSRA 1O6UA 1AL23 1Q8VA 2CWMA 1QJX2 3AB0A 3BPZA 3MEPA 2VPVA 4NHXA 4W50A 2D40A 5F8PA 4AEKA 5CKNA 1OT5A 2V73A 1SMVA 2ZEYA 4BHPA 4KH9A 5LEKA 4CXYA 1XNKA 2NN8A 4JX0A 1PMJX 1H2LA 3I2KA 4YG6A 2JENA 3WF3A 4AYUA 1UMZA 2OUJA 3JBG3 4MX3A 2A73B 2HEVF 3OBTA 4YM2A 4AZZA 5J7MA 4GQ7A 2X53S 1YXWA 4A6SA 2I07B 2HKXA 5E16A 5FQ0A 3PVNA 5FWJA 2RMU2 2BNNA 1UZYA 2KXLA 2BJSA 4QM9A 1NA1C 4NUBA 2OW4A 1O3RA 1NLRA 2VNVA 4JGYB 5DAQA 2YBKA 3I3DA 5BYNA 2W47A 2A6WA 4B7KA 3SLIA 1NY71 3Q8BA 1W6PA 2GN3A 3A23A 4GZ9A 2W94A 2JDZA 1LHWA 3NV4A 3VBUC 5J37A 4YVSC 4CCLA 1DYPA 3IM0A 2YZ4A 1W6MA 1JYCA 4CPBA 4CDQA 1W90A 2ZHKA 4LLOA 3ZPOA 2RS12 2X8KA 3SC7X 4LT5A 2W46A 2Z69A 4IGOA 1NLSA 2DVBA 3I49A 2F4PA 3TBDA 1ZZ8A 1QKQA 1LGNA 5FZIA 4YGCA 3TAYA 3O1RA 3ZYHA 1Z78A 3X29B 3N3HA 4D6SA 5C8CB 1GNZA 5EIYB 3GZEA 2ZX3A 3NQHA 4YGDA 3A21A 4A7KA 4WVMA 4DXZA 2VR4A 5IHRA 1K42A 1AR81 2CGOA 3LEKA 1J59A 2LW8A 3VD9A 1EPWA 3Q9OA 1J1TA 4U36A 2WAOA 3VBHB 1VRH1 1RITA 1Q8QA 1WMXA 4BB3A 4COYA 4DEQA 3D5OA 1A34A 3LIGA 4UFKA 2MPFA 2EVXA 4XZUG 2ZKLA 3E5XA 2XHNA 1ODNA 3N9OA 1LOFA 2H0BA 2W39A 5EZWA 4Y1YA 1F4HA 1Q5OA 2HWC1 3NL1A 1ULEA 4UF0B 4CTEA 2ZGSA 3I3QA 3WDVA 5JR7B 3B9IA 5C8CC 1FATA 1ST8A 4UYBA 5FP8A 4ZXEA 4FAHA 4B1LA 5C6CA 3RWKX 1Q8SA 4BLIA 3UNPA 5JDBA 1IG0A 5FUIA 4GWJA 4A42A 5FO9B 2B9UA 2JDKA 4NMIA 5GLZA 5LBBA 1O59A 2VCBA 4LHSA 2CYFA 2UY8A 4O9GA 4SLIA 3USUA 4E8DA 4HONA 2PLV1 1VBC1 3K75B 2WNUC 1H30A 3POBA 4RGAA 4WBBA 3DXUA 1ZZ6A 4FOWA 5SV8A 3URFA 2BBVA 1W6OA 4QU1A 4COWA 1US2A 3FZ3A 4M3CF 4Q4Y3 1FV3A 5IVVA 1FNYA 3PVOA 2BERA 2WT2A 1U5YA 1XSQA 2R073 3ZXGA 1EAH3 3HVDA 5JPNB 1SCRA 2JIGA 5FPZA 5D1IA 3K3OA 5J96B 4FTSA 1WLWA 4OZXA 3RNSA 2RS51 3MLKA 5FMOS 4YZ4A 2E51A 3I54A 3U14A 2P34A 4Q2FA 3SCGA 1V70A 4E27A 4QKFA 4EZHA 3I97A 3RS6A 4IV1A 3LSEA 4NPRA 1ZRFA 1DLLA 3OEBA 1JZ6A 1UY3A 1CJDA 1RUI3 2C26A 3ST7A 4AVCA 4Y20B 3VBRC 4KL1A 2C1FA 2VMCA 5FZGA 5AC93 3IDBB 1X8MA 3UKVA 2HWE1 5JXJA 2VMIA 1SLLA 2WLPA 4GB32 1AZDA 2H6BA 2OKXA 2P17A 1SLAA 4IGQA 3CJIA 5JWPA 2QZ3A 4Q27A 3WG3A 2YV8A 4DEVA 1N1SA 4IUGA 4DXRA 3ASIA 2Z2SB 1YYNA 4JGZA 1S0DA 1OOPA 3ZOIA 3I2IA 2FMDA 2QTWB 3PNAA 4XBLA 4D6QA 4QD2A 5FV3A 2JEMA 2XPJA 2ZMLA 3MGUA 5JAXA 1TME3 5ABJC 3DPRA 2D98A 2QQWA 5C3RA 1O5LA 2X05A 3VHOA 1RMU3 2R063 1RUJ2 1OLMA 2ZZJA 3K77A 4LBKA 1UYXA 2MHFA 2RS52 1GZWB 3EJKA 4MG2A 3KQ4B 2DURA 5A3OA 1EYBA 1LU2A 1BJQA 1O4ZA 4I09A 4QB1A 2WSUA 2OVUA 2VZTA 3IPVA 3BGAA 2DBIA 3B69A 1UU4A 1QJY2 1PMIA 2DUQA 4A3XA 2JJ6A 5A7WA 3N7KA 1W9TA 1GWKA 2WAAA 2W1QA 4KU7A 3FE5A 1LOGA 3DYMA 5CB7A 4DUWA 4Z07A 4KGGA 1WCQA 5JOYA 5BPXA 4QQPA 4ZY9A 4WVZA 1JU4A 2I45A 1L7LA 1XBFA 4BOWA 5F2SA 4U2AA 3DYPA 5ANNA 5I8YA 2ZJCA 1ND2A 1WW4A 1OUSA 3DGTA 4H7LA 1GOHA 3PDQA 2ZACA 3AZVA 3VUOA 4LO7A 3M1HA 3POGA 2RR13 1LECA 1V0AA 2RMU1 3ECQA 3PU8A 3PVBB 3ZFFC 5GZGA 5KXCA 1HDKA 1CAUA 2XUEA 3CMGA 4AFMA 3MIGA 5HBAA 1HIXA 3J7NA 4HPKA 2CGPA 1NCQB 1AL0G 4FFHA 1GQGA 2RE9A 4MXVA 3A22A 4LK7A 4MADA 4Q5OA 5F32A 3B93A 3TN93 4YFWA 4CDWA 3GGLA 2GU9A 4N53B 2VZPA 4LA2A 3HQUA 3KHCA 3Q8CA 3IBMA 3UGHA 1UCXA 3J9SA 5FMDA 1UMHA 1AJOA 1LEMA 4L0PA 3ACLA 3ZYPA 4AVVA 4FTBA 1AR93 3ZMNA 1MEC2 1QJU3 4QGNA 1GANA 3LGRA 1R64A 1UXZA 4L11A 3AK0A 4RA0A 5DQ0A 1QIQA 3OGJA 3B9CA 3H3ZA 2BWAA 3HAGA 5DUWA 3VZJA 4UFMA 2BYVE 4E4HA 5LK7B 3V0AA 4Y5SA 1OA3A 3ZYBA 1COV2 2QBXA 4OUSA 4AI1A 2K46A 3N7MA 1ZBA2 3M4FA 2ZTNA 5FKCA 3T30A 3E6CC 3VBFC 2PHUA 3FUOA 1ASJ3 5F5CA 3SH5A 1H1MA 2OT7A 1OD5A 1VBB3 1CR7A 1PVC2 3MV11 4I3GA 5FYTA 4QX8A 3JQWA 3NAPC 3MIDA 5FK7A 3VKLA 4ATFA 4D7YA 5A33B 3GJAA 3LQCA 1LOFC 2D3PA 3S6PA 2BPA2 3KQRA 4LXLA 4QDQA 2ORXA 2AEYA 1TMF1 4E2SA 3I3EA 4GB31 1DQ6A 1VMHA 3VD7A 4BLJA 4GMP1 2B4KA 2R041 4MHUA 5DDJ2 3IB3A 2ZMNA 4EQVA 1O5UA 5AFEA 1UY2A 2PA7A 2YBSA 2ZMKA 4LQRA 1AYM1 1BEV1 4XF4A 3O1UA 1H9PA 2ZEWA 2VD7A 2DCZA 4XIOA 2WINB 4AXOA 4LNVA 3INAA 4X8PA 3U4SA 3FLPA 3T09A 3HNMA 4FVVA 3DUIA 5FY0A 2EAAA 4UAPA 5T52A 4JKMA 1E57A 2V5YA 3KV9A 5IUQA 1R083 1VBD3 4H3WA 3BVCA 1X82A 4GKXA 2D7FA 1VRH3 3WNLA 2VVDA 1OSGA 4LHLA 1KS5A 4ATEA 4META 1JHJA 1PO13 2WS92 3C8XA 4Q4V2 4QQHA 3I2JA 4LO4B 3WUDA 4J1XA 1W6MB 3KT1A 1NUKA 2VW1A 3DV8A 3JCIA 4XF3A 3BKZA 1KD7A 2Y34A 5LBEA 3ZXFA 5JCTA 1DGLA 5K9YA 5FZ8A 4YWAA 3UYJA 4W6WA 2WN2A 4PF5A 5JI7A 3RZGA 3QACA 2RJLA 2X09A 3FBMA 1FMD3 1GP5A 4AI0A 1OLME 2C24A 2FCUA 3CJXA 3LEGA 5FXWA 4DOUA 1NG0A 5A7WB 3VHPA 1BK0A 4E4ZA 5FY1A 1PIV2 4CDUC 3T1LA 1RUD2 3NW4A 4NHLA 5FLIA 3ZDSA 2GSYA 4PIYA 1RUC2 2YFZA 1WBLA 5KHHA 4IE0A 3IDAA 1NX9A 2HWC2 5A6YA 3JU9A 1ONAA 3U37A 3HD8B 4DY5A 1F15A 3NJYA 1JN2P 4LBQA 4NAMA 2WQ8A 3HBZA 4NO4A 5C4WC 2HYKA 4XF0A 1HQNA 1KJLA 3OUIA 4AQTA 3A0KA 2CV6A 2VU9A 1TE1B 1JZ3A 1QOTA 3FJSA 3N4MA 2JG8B 4GAZA 3ZYRA 5BV6A 3H7YA 4I0AA 4XFHA 5F6LB 3VHNA 3MIHA 1HXS1 2X5IA 3PVEA 5IATA 2OIIA 3P6BA 4E2QA 3BOPA 1Q8OA 3VBOB 2DTWA 4S2GA 2FCVA 3JZVA 1FMD1 1HRV3 1G9AA 4BQ2A 5J09A 1MS5A 2OZJA 4YVWA 5T54A 1UYZA 5BNNA 4CEWC 4IE5A 4Y20A 1COV1 5C33A 1JODA 2ZA9A 5I8TA 2B39A 2DU0A 4ZXKA 3BB6A 2WZR3 4B1MA 2SLIA 3WF0A 1G6NA 4XILA 2W1UA 4CCMA 1ZZBA 2BZDA 5BNPB 1DGWX 4XF1A 2JE9A 3VD3A 1AXYA 1JTZX 4W8JA 4XMIA 2LTNA 2WKKA 2Q8DA 2Q1FA 4DXSA 2VQUA 3NNLA 4Z1VA 1WKYA 4MV2A 1S0IA 1UOFA 4NPLA 4QPYA 4XW3A 5J98B 4AVSA 1J84A 1W2TA 3MF9A 4HVOA 2XVKA 3H1MA 4Q4X3 4ISQA 4NIIA 2FDHA 5KHKA 5FZAA 1REEA 2QQVA 2W95A 2RDSA 2W91A 4P9LA 4EZ4A 3BTXA 3C7OA 4HKLA 5J3UA 3M8LA 1FXZA 1IZ3A 1OVPA 3WQ1A 1UYPA 5IYYA 1FT9A 1WLTA 4AAPA 3KV5A 2WO1A 4FFFA 4RSUA 4XQ4A 1ULPA 3PJQA 3KT7A 3EHKA 3WG4A 2ADDA 3VD4A 4NRMA 3WX5A 4TLFA 2RS32 3AXDA 1AX1A 4G4FA 5GLVA 3U0ZA 1DQ4A 4AFDA 4COUA 1OI6A 1ZYBA 5DUUA 1NT0A 4LOSA 1AR83 5GZEA 1DIWA 2DUOA 1HB2A 2AENA 3JXSA 2P3KA 2ES3A 2WYSA 4XFCA 1LB2A 5GM0A 2V72A 5IJRA 1W8FA 3OPTA 1RUH2 4WM7C 4TZDA 1LOBA 1VRBA 3FUQA 4AW7A 1HN0A 3KGLA 3BU7A 4Z2WA 5IAXA 1LHNA 4SBVA 5EJ1B 1AYN3 5A33A 1H8TC 1NAEA 5CG9A 3BOWA 5JIUA 4GJZA 2UY9A 2W1WA 1APNA 2R6QA 5FZ7A 1QQP2 1JS9A 3E5UA 3MPBA 3GBWA 1SLBA 3WG1A 3FWEA 3VBRB 3MI8A 3I4IA 3LPFA 1LRHA 4YVWC 2Q1MA 5A32B 2WT0A 5BNNC 3K4DA 5BNPC 3V0AB 3AYDA 3VZMA 1AR71 3WQBA 3B02A 4AGGA 2ZGNA 1B09A 1GKBA 3MLJA 4Q26A 1W8ZA 4DNYA 2YU2A 1OPOA 2ZGRA 4AGVA 1SPPA 2PYTA 1YC61 3V0BB 1LOAA 1UWWA 4WM7B 1TMF2 3RI9A 1S0GA 5FZ9A 2VQAA 3SH3A 1HLCA 2X5IB 5EFUA 1GZ9A 3OYWB 1RIRA 3NO8A 3PJYA 5SV5A 3AP7A 3H8XA 4I2OA 4PDWA 5FZFA 2E7AA 5ABJB 5DXDA 4XJUA 1MS4A 4P9YA 3GCWA 3OJBA 2F17A 3MLLA 2OS2A 4TXWA 4XFAA 4AF9A 4EN6B 4A2UA 4YVWB 3HWJA 3LIHA 5IWFA 4RR3B 2BNOA 5CBLA 4HBNA 1HQLA 2RJKA 4AOCA 5GZCA 5C9AA 3RGBA 1NCRB 2PHLA 2BGPA 2VULA 4IDZA 2DVDA 3RYPA 2XVGA 3WXPA 2J22A 3UKNA 4QX0A 1YCIA 2WRAA 4E8CA 4C1XA 4V2VA 1W06A 1YIPA 4LBJA 2HWB2 4NAOA 3KHBA 4LITA 4HXCA 3U1XA 5K0UB 3IDCB 1VBA3 2R30A 4OUEA 5TSWA 3LAGA 2KD7A 2VNOA 2JDYA 2PLV2 2ZHNA 4CA9A 3D0JA 2J1VA 4L2NA 2PHFA 1JI6A 1PMHX 4OFGA 1CAXB 4O61A 2VZ1A 1MQTB 3MV01 5FPAA 4BQ3A 4YARA 5KHJA 4XCBA 1HRI2 2CDPA 4XHXA 5E6HA 4H14A 1VBE1 1RUF3 4LUMA 3CL1A 3J8F3 4CUCA 1D4VB 1H4HA 4P02B 3R6SA 1CAVB 2PQSA 3MHZA 1CX1A 1GP6A 1PIV1 2C5DA 2CNAA 2WJSA 4S2DA 1LR5A 4WV8A 2D93A 2JD9A 1B35A 3FC0A 3GZUC 2QNKA 2UWAA 2F6BA 2VO5A 2W9XA 4R8HA 2FZ1A 3DKQA 1V9U3 4IE7A 1W8TA 5T3NA 2ARXA 1F9KA 4ZZ5A 5FY8A 3U75A 2JG8C 2E9QA 1WW7A 4YM3A 2DCYA 2WLQA 1EAH1 5CFDB 1OXCA 4RHV2 5FZCA 4C1WA 2PMWB 2XJTA 1TVGA 3M3OA 3E1F1 4HLTA 4JHZA 5F3IA 1PGL2 4AI3A 1DQ5A 3POIA 3MW4A 2DF7A 1FPN1 3SQOA 4AHWA 5AFBA 2IZWA 2OPWA 2VW0A 4HANA 1JYIA 1KITA 4FPEA 1LOEA 2VMHA 2WWSA 1IPJA 4BQYA 5JZGC 2WFPA 2XJPA 3ZPYA 5FTTC 1V6JA 3GALA 2ETEA 2WNUB 3I59B 3WW1A 2HBTA 3O1OA 1VBD1 3D0SA 2YBPA 5LBCA 4YVSB 4MSVA 4D0QA 1HW5A 4JKLA 4GMP0 1ND3C 1KQRA 5DDJ1 4OHZA 3H9AA 2EAKA 1I5PA 3VBSB 3U07A 3RMYA 2WR9A 4EYUA 1G86A 4XUNA 3ZSLA 4KG8A 4JRAA 2XDVA 3HEIA 5FXVA 5FKBA 3ZN6B 3ZSEA 3NVCA 5KR7A 4R4XA 2HWD3 3GM8A 3LCPA 5FO8B 3O0XA 3B94A 3RZJA 1UYYA 1SLCA 4K20A 2Q0AA 5A3WA 3A7QA 3AL5A 4OCTA 3THPA 4AHYA 5IFTA 1I1EA 1AR73 5JZGB 3NKTA 3IWZA 2LUWA 5BUVA 4Y24A 3HNYM 3I2DA 4P9GA 1HX6A 2XQXA 1B35B 3IIIA 3POJA 3PUHA 1GOFA 1QJX3 2L9LA 5A7SA 4AVBA 2A3XA 1H1AA 1W39A 2WS91 4Q4V1 4IV3C 5BNOC 2ARBA 3FN9A 1RUG1 4MLOA 5JZGA 1DG6A 3WDYA 3B3QE 4RS5A 1VP6A 2OUHA 1UF2C 2HWF1 4Q4W3 4UWDA 1U0AA 5F6KA 4XJ9A 5DN2A 3VKOA 3GNEA 3ZXDA 4FO9A 4B3NA 4E4SA 4EE2A 5A1AA 3M3IA 3QH6A 3JBG2 4OMDA 3GZTB 4Y33A 4PLOA 1LEDA 5JOZA 3LDRA 4Y3OA 2JKBA 2VCAA 2PAMA 5LA0A 5D8AC 1YQ2A 2R042 1SDDB 2BVBA 2WA4A 3ZXLA 2BRTA 5CEHA 3H42B 5FZ6A 1W04A 1BMV2 3TYJA 2JG9B 5FPUA 3ELNA 4A7ZA 1ALYA 4K9SA 4LULA 2VOKA 1MPXA 2WZEA 4FTEA 2E31A 4QKNA 1YLLA 2ORZA 4GALA 5DZEA 5LRRA 1W8HA 2VBDA 3UETA 5FY4A 2DCJA 1ZNPA 1JZ8A 4IEVA 1YFUA 3PIJA 3K4ZA 3LDKA 3NNGA 3WNNA 1DGWA 4I30A 3KCCA 2R32A 3PURA 2A1XA 2OXBA 2R7EB 2BGOA 2RS13 3WSOA 3CKHA 4QX2A 5ERLA 4CCOA 4CXXA 4P08A 1QGLA 1GBGA 3ZLIA 1X33A 3W58A 1XNDA 1A8DA 1H0BA 1O4YA 3AYCA 1S2KA 1W9FA 2PAKA 3M7AA 4FPLA 3TEWA 4PDWB 1AL21 4XDOA 2HYXA 5L73A 3OBZA 1MS0A 2RM21 2VMDA 2ZHMA 1ZZ7A 3KT4A 4TSVA 4XYXA 5IVFA 1UY4A 1CQ9A 1DZTA 3ME2A 5LW9A 1GNHA 3OG2A 3CHXA 4F7ZA 5I91A 1V9U1 3OPWA 5EJ3A 4AEMA 1IPKA 2CL2A 1MEC1 3CIHA 1ZBE1 1E5IA 5C3SA 4IEQA 1WGPA 1GQHA 2A7AA 1PX3A 5FBJA 5EJZB 3NNJA 2ZGMA 4FQZA 4AWDA 5J48A 1YFXA 4LBNA 2HH9A 5FY7A 4IXLA 3VDDC 4CCNA 4XQDA 2Y6LA 5DPNA 5C9AC 2RR11 3IDEA 2PHDA 2JWPA 1ULFA 2Y6KA 3O1PA 1KS4A 3D8CA 3EYPA 1OURA 4DFSA 2ZKNA 1JYNA 4N53A 1RUE1 4IESA 4BJ0A 1JOBA 2FDGA 3S57A 1DQ1A 1NY72 3ILFA 2FD8A 4Y22B 2HEWF 2JDUA 1RJ8A 4YM1A 1JZ4A 4JTOA 3N35A 2W08A 2EALA 1YQ8A 1C8M1 3RPQA 4Q0QA 1KDMA 2YFUA 3NV2A 3ZR5A 3CDZB 4LE4A 3GHMA 5DAWA 4KQ7A 4XEZA 1Y4WA 3T2TA 4FXKB 1QU0A 2E26A 3KLSA 1C3HA 3N9LA 3H8UA 5FXXA 5FXZA 3JD71 5I0RA 1CAVA 3VZKA 4HKOA 2ZOEB 1VBB1 1MS9A 3OGVA 2XUMA 1W0OA 3BU0A 2VZUA 4IE6A 1Z7S3 1MR5A 1XYOA 5E1RA 2IXCA 2O14A 3KV6A 4KBBA 4KI5M 4QX7A 2G1MA 2NLRA 4KU8A 3HMYA 2R072 3TEXA 5CFDC 1REDA 1W9SA 1RVF3 4CDWC 1BLZA 2DV9A 5AVAA 4XJZA 2AREA 4GULA 4LE3A 1SEFA 3WF1A 2QQOA 1H2MA 2P6HA 4IV1B 2DFBA 4AAXA 2PHTA 1UKRA 4CDUB 1BZWA 3ILRA 4WZCA 3WNXA 1HB1A 3WT3A 2E63A 4P00B 3OYWA 4X6QB 3VBFB 2GNMA 1H6XA 2G4IA 2JX9A 2JDAA 3KCYA 2IWGB 2Y6HA 1YNAA 4LO5B 3V0BA 5J1XA 2A6VA 2VL4A 4XZPA 5AC92 3K48A 4AI9A 5A3TA 1XSRA 3MFCA 1C8M3 4QPGC 4AVAA 4CDQB 1LHOA 2HWE2 1H8VA 1W8NA 1Z0HA 5LBFA 1X36A 4M4PA 1RJ7A 2RDNA 4QAWA 3AYAA 5DZFA 3NJZA 3T4VA 1O3QA 2FZ2A 4IETA 1N1VA 2MNGA 5DAPA 3AFGA 4QHBA 4RL7A 1GZWA 4ET7A 1ZREA 4N9HA 1EUTA 4MGKE 3CLPA 4YW2A 1UU6A 1BCXA 4JCKA 2QFEA 2GC0A 2AH2A 4RQPC 5FZ4A 3LB9A 3ZYGA 1AR62 1NLQA 1Q43A 1TME2 4GH4B 3MYXA 1DDLA 2BFUL 3WCSA 1RC6A 4W6XA 2CTVA 2GDFA 2VOWA 1QXRA 3PLQA 1OH3A 4JDMA 2R062 5F2WA 1UZVA 5F39A 5JVVA 1PZ7A 3ZIWA 1OQ1A 4B4QA 1VAMA 4ISRA 2RS53 1HV0A 1OOPB 5A7QA 3ES4A 2XKPA 4LHKA 3S7IA 3AMPA 4AQ6A 1C1LA 3IMMA 1GICA 3RJRA 1UOBA 4TWTA 1UX6A 5EHDA 4YZ3A 1S2EA 1W8WA 2RS11 5F9TA 1GP4A 4RFRB 4ZS2A 4NIAA 2VECA 1CWPA 4XOGA 3TN91 4FPJA 1MS3A 1HV1A 3I3BA 4XIKA 5IW0A 4XACA 5FJHA 3LE0A 4UW4A 5JSOA 1H1IA 2W87A 5DG2A 4QXCA 3VKNA 4AEDB 1F2NA 2ZS6B 3RJ2X 4K7JA 3W5NA 2EIBA 3IAPA 3WDXA 1RUE2 4XPVA 1C4RA 1SG3A 1SBFA 3CNAA 1YJLA 5HV0A 1WA4A 1HB4A 1PK6C 4XFIA 2FCTA 3SMHA 4CDXA 5A3MA 2RR12 2ZGKA 2CGNA 4BIFA 4BQXA 3ZFEC 3OD0A 2ZX4A 3O12A 2ZBJA 4YFZA 5JPMB 2JG9C 5KHGA 1D0HA 2A6ZA 2PHXA 5CVRA 4COZA 1KDKA 1RHI2 4JC1A 1YI7A 2GC1A 2VH9A 5C4WA 2VZOA 4YW5A 3IIAA 2H6CA 2BWCA 1QHDA 2WSVA 2XJVA 3ACHA 5CKMA 3I2OA 2XG3A 2B5HA 1CVNA 5DAVA 3MUZ1 2WNUA 2GAUA 3I59A 3Q8AA 4HG6B 5E89A 1YRZA 1LKNA 1MEC3 1QJU2 2D3RA 4LO8A 2NYYA 1YHFA 3LPGA 1FPN2 3OCPA 5FZ3A 3WR0A 1KFXL 3D4KA 3CQOA 1PO23 4HETA 2YG0A 4PBPA 4PDWC 5LK5A 5FZOB 1FOD2 2J1AA 3I2GA 3W9AA 1ZBA3 5T5OA 4GD4A 3GCXA 1LHUA 2YPDA 2AEZA 4Q8LA 5BNQA 4FSJA 2AYHA 4RHV1 2W92A 1ASJ2 1OD3A 3NV1A 4IEXA 1UX7A 1KXGA 1VBB2 4BQ1A 3AC0A 4UBGA 4CU9A 5H9RA 4DMIA 4NWVA 2WDBA 3BALA 2O1QA 3PTRB 4WVWA 1SBEA 5ACA2 4C90A 1DQ0A 3GBGA 4GWNA 1DHKB 1I9RA 1YQ6A 2WFF2 3VZLA 3J8F1 2NP0A 4CP0A 4WM8C 1IG3A 1JZ7A 3OBRA 5C3OA 4O7XA 4A41A 5JIAA 4EN7B 2YGMA 2ZGPA 5IFPA 2TBVA 4RR3C 1NA1B 4KWJA 2NM1A 2TNFA 4CCDA 5BY5A 3ROUA 4AQSA 1VB4A 1FI2A 3EXUA 3K46A 3NKGA 3O14A 4I3PA 5HCHA 2QQPA 5L9BA 4QX1A 2ATFA 1I6XA 1ACCA 2V09A 4MXWA 1SZBA 1D4M2 5FZLA 4S2FA 3AKPA 1NYWA 1R082 2E7TA 2WN3A 4X8NA 1RUOA 1GWMA 1GV9A 1WMFA 3GHNA 1H6YA 2ZAAA 1EV13 2XLGA 4HN0A 1PO12 1VMJA 2XOMA 1VMFA 4M3CA 3T0DA 3AX4A 1SQ4A 4CYDA 2CSGA 5L7OC 3AZWA 2ILMA 4QPWA 5HPOA 1FV2A 1HJGA 1C5HA 1ENQA 1L7RA 1YI9A 2P5BA 4QQLA 4CDXB 3UT0A 3O5SA 2XBO2 5A6ZA 1U5IA 3OUJA 5KC5A 1FMD2 3MDPA 1F35A 1W6QB 4LBQD 4JV4A 1NE6A 2BQPA 3F95A 5JMCA 5C3QA 3G7DA 4C0BA 2C0ZA 1PIV3 2ZPXA 2E6VA 3GF6A 3MW3A 4EJRA 2YC4A 4XCAA 1AX0A 2DVGA 3FFQA 4QX5A 3WDUA 4YGBA 2BDRA 1LENA 2HWC3 5FYCA 1UPSA 2OA2A 2DU1A 2VCCA 1CD3G 2QKDA 2R0FA 2WNOA 3RRDA 1IOAA 5CZKA 3OF1A 1JH5A 2HLEA 1CGPA 4R9AA 2EXKA 4GH4A 2J7MA 2KR2A 2WBKA 3P3NA 1AXZA 2LALA 3GJBA 3HQXA 4MGZE 2FDKA 2HJIA 2ERFA 2VTXA 3VDCA 4B4PA 3I8TA 5FYSA 1T6BX 4DIQA 3ABZA 1XNAA 5CFCC 5FZHA 4PIXA 1WUVA 4YZ2A 3LEMA 1KEXA 1VE0A 4KGQA 4NHYA 1IS4A 3KD4A 3RYKA 2BP6A 3AYEA 2XXZA 4UI9L 5CG8A 4FXGB 2P3IA 5ANQA 5A6QA 3VGIA 1LNSA 1HRV2 1UNBA 2VBBA 1CPMA 2OQ6A 2VNGA 3MUY1 5DG1A 1CN1A 4PT6A 4UT5A 3RVHA 4CPBD 5IVBA 1NQDA 1RMU1 4TYSA 4D69A 3UGFA 2P1BA 3J4UH 2WZR2 2X29A 1KFUL 1WZXA 3LF7A 4J6GA 4CU7A 4BWOA 1C5IA 1HXS2 4OHXA 1X9TA 2VTFA 2LS6A 5EYXA 2HBUA 2B9VA 4CRQA 1XE8A 2QQMA 1BKZA 2WL1A 3OBAA 1K3IA 3AKQA 3VDAA 4JZRA 5FJKA 1AR61 4QQ2A 3VB9A 3BTAA 2Y0OA 2BU9A 4Q4X2 1RTVA 5APAA 2QQKA 4PBOA 4YW7A 5FYZA 4CEWB 4JGYC 1YQ5A 4A3ZA 4CDUA 4CU6A 1EP0A 1W6QA 3DPRC 2EF6A 1YFWA 2XLFA 5I8SA 3AZZA 4JQRA 2WFF1 2YU1A 2BW8A 2JXAA 3NSTA 1NCRC 2Q8OA 1VIWB 2VNRA 1PK6B 4JGZC 4B4RA 1UOGA 3WNPA 4YRDA 5I0UA 2GMMA 3SCHA 4AHZA 1O3SA 3CJIC 4QPIB 2Y8KA 3IN9A 2JICA 3N9NA 4FPGA 3S7EA 1GYKA 4DUXA 1ZRDA 4JAAA 1UIJA 4URTA 5L7OA 1KRIA 4AR2A 3RQ0A 4BQ5A 1QNWA 3QH7A 5H9QA 4ZKTB 4Y1XA 5CFCB 1QJEA 3KS7A 1YJKA 4XHBA 1XNTA 3OUHA 4AHXA 2UU8A 2VW2A 1L7QA 1MZ6A 4IEZA 4K40A 4CDWB 4CCKA 1CPNA 4YG0A 4D8MA 1G9FA 5KC6A 1L3JA 4PI0A 2HWF3 3OSDA 3AJYA 4QU2A 1WD4A 1TNRA 3DPRB 4XAEA 3TOJA 4AEDA 4H7MA 4CCCA 4PLMA 2EIDA 1UXXX 3VL8A 4CUGA 3TEYA 4N7IA 3UK9A 3WW4A 3O1TA 1GWLA 4FI9A 4KBZA 3K2OA 1JXNA 1HJFA 3V64A 1W2AX 2WZ8A 1QQP3 1OFNA 4OI0A 1PGW1 1ND2B 3NWKA 1UKGA 4Q0SA 4AI8A 1WLCA 2P4EA 1EV11 2UWCA 1W2UA 4XJWA 3PL0A 2WO2A 3SHRA 3VBUB 4HVQA 4YYOA 2WA3A 4WM8A 3VBHC 1JZ5A 1GR3A 1NZIA 5IK4A 3T2PA 2W3JA 2VJXA 1GUIA 1POQA 4XJAA 3U78A 1QJFA 2DCTA 2A6XA 2YMZA 2G9GA 2VUDA 4MOAA 4ZONA 1C8NA 1SBDA 2Y0IA 4IV3B 5D21A 5BNOB 3WUCA 4N8MA 1MZEA 4OULA 1TMF3 1QF3A 2QJVA 1JUIA 4W65A 5FO7B 1UAIA 1Y9GA 3BPSA 4GA9A 4ARXA 4LLFA 5K7PA 4GMP3 1LAJA 4CZSA 4XE9A 1HRI1 2N7GA 2Y38A 3WW2A 5F3GA 4XAAA 1E5HA 2BTVC 1WCDJ 4MGSA 2R16A 4P9JA 3S5QA 4MHRA 4Q4W1 3NNMA 4R9BA 4N53C 1ZRIA 2AUYA 4HZFA 4V1PA 3MICA 4Y1ZA 3T4HB 4BA6A 4OVEA 4XUPA 1VB2A 1ZBE3 1GMMA 4LKFA 1EUUA 2ZZQA 4M0HA 1OMIA 2BOIA 4QPIA 4C0HA 1RUH1 2B42B 3AFKA 1VPHA 3MW2A 2BBAA 1UMIA 1X9PA 2VC9A 1D2SA 1XE0A 2VXJA 3JB4C 1LGBA 4LUKA 2A70A 3N9QA 1YQCA 4NE9A 3AJZA 2RM22 2CAUA 2HWB3 4QB2A 4ASLA 2JDHA 1W28A 1VBA2 3DECA 3O0WA 3WP3A 1JYWA 2NPIA 1R1A1 2IXJA 4DS0A 3SNMA 4BXFA 2NQYA 1DYOA 2RV9A 4KMQA 4AEDC 1UQXA 2CAVA 1ULOA 1ZZ9A 1OPMA 4D7SA 1PHMA 3EBRA 1AYM3 1BEV3 1JBCA 2PHRA 4Q1RA 5FZOA 5LY1A 4OQ9A 5L19A 3WY6A 3MF6A 1K5MA 1OKOA 1OUXA 1QEXA 3EMRA 1HRI3 1WMDA 3UESA 4GWMA 1STMA 2JB8A 4BK5A 1ZX5A 1RUF2 2MEV2 3FHIB 4HKWA 4LTAA 3VLBB 4OQ8A 1A8MA 3J8F2 2VVFA 5FPLA 2A6YA 4MO3M 5DUXA 5FOJB 4QPGB 4CDQC 2LROA 3LOIA 1DGRA 1CZSA 2EA7A 1ZM1A 4I01A 2YC2A 3I3MA 1LULA 2DBNA 2XGXA 4LKEA 4FOVA 4V2WA 1H9WA 3ZM8A 3ES1A 2JDPA 3CU7A 4Z92B 1MS1A 1QJZA 1NCRA 3V65A 4DRVA 3HT1A 2C9KA 4OI1A 4Q0UA 2DDUA 3LFMA 3CBNA 1V9U2 1BVP1 3VDDB 1QDOA 5GZDA 2DYCA 5F7UA 2XMLA 2D5HA 4RFT0 1G8WA 5FY5A 4PHZA 4IE4A 4JGYA 1GZCA 2R071 4RHV3 1JZ2A 3E97A 5FZKA 1VBA1 4KG0A 1ENRA 3KVBA 1YFYA 3JUUA 3AMNA 4RQPA 4JGZB 4LBLA 3WF4A 3BCWA 1XRUA 1WW6A 5GKAC 1YUDA 5GALA 1KGYA 2DWRA 4HSLA 3T0BA 4G3YC 1TZOA 2D6NA 3GBFA 3QLQA 1WBFA 5D2AA 5G05L 3APBA 4NJ4A 5G04L 3H0OA 3WP4A 2Q8EA 1ODMA 4YZ1A 3RZZA 1S4CA 3LDBA 2BVVA 4LBOA 3T08A 4KWKA 3A0NA 3SCFA 1K5MC 3RZMA 1EY2A 1GNYA 4KWLA 1A6CA 3C7HA 1H4GA 1O8PA 2RDRA 3IPVB 4NVPA 1PGSA 5E88A 2A5ZA 1WWYA 5FQ0B 2FMYA 1A3KA 1YO8A 2D6PA 1E5SA 1CAWA 3OY8A 3RFRA 4HSJA 1NQJA 3USUB 5CFCA 2EIEA 2XJSA 4RQPB 4GH4C 1WW5A 1AF9A 1CX4A 1JUHA 5T5JA 5K4LA 5FZBA 2XONA 3UL2A 4E4DX 5ACA1 3CJIB 4QPIC 5JXHA 3JQXA 1AYN1 3H1YA 3RZKA 2QZ2A 2WT1A 3J7HA 4UBHA 1DP0A 1ND3A 4OYUA 1O3TA 1FAYA 3G6JB 3K4AA 2GH2A 4ZU4A 1VJ2A 5JSPA 1QJX1 3RMXA 1ENXA 5F3EA 4E9KA 1AUYA 2R061 4FCAA 4IEUA 1ZRRA 1JYXA 2FDJA 1CAXA 1S1AA 1URXA 1IS3A 4FPOB 1PX4A 2GMPA 4MGTA 2QQIA 1W2OA 1K12A 1UY0A 4Q4W2 3ZVXA 4CU8A 1N3QA 1OA4A 5A3PA 1RUJ1 4CEYC 3VBSA 5C71A 2B8MA 1UPIA 2C4XA 3ZXJA 4HOOA 1QH6A 4FPKA 4NPMA 4PI2A 1NCQC 3PMEA 5FK8A 1POV0 1XJAA 4CP9B 4BE3A 3POFA 5HXVA 5EV7A 1SPPB 1X7NA 5FP4A 4HT1T 3RG0A 3TWIA 4FPHA 3VDDA 1IPSA 3T3YA 2R043 5A6XA 5HCAA 1RINA 2WO3A 1VBE3 3BI3A 3WDTA 5FDBA 4ZS3A 2X10A 4GXLA 4RYDA 3AZYA 2A75A 3HT2A 5FZDA 2SBAA 3NJVA 3TNQA 1T6GC 3C2UA 4TLGA 3PTYA 4Y5Z0 2MEV1 5IVYA 4LO6B 4I02A 2P6CA 2IFWA 3DF0A 5B2GB 4PCRA 4ZZ8A 1OQDA 4E2GA 3WQ0A 5T5LA 3ZIXA 2J1RA 1R1A3 1QQP1 4RR3A 4K21A 3U11A 4EROA 4QWNA 4ES9A 1PNFA 2Z79A 1LESA 4AFCA 4HPKB 5HCBA 3D3AA 2VGDA 1OLQA 1IS6A 2Y64A 1S0CA 1VLNA 1OQEA 3WG2A 4AL9A 1XC6A 2QQUA 5GLWA 4ZPIA 2Y26A 3LSDA 5FP9A 1Q8PA 1Y9QA 3L9JT 1WLDA 4ZU5A 2OPKA 3W21A 4MGIE 3RSJA 4O65A 2WZR1 3FX3A 5LA9A 3THDA 2WUHA 1JU3A 1RUG2 3CO2A 3M70A 4HN1A 4YVSA 5JXIA 3JD72 1VBC2 3VD5A 3I7DA 2YPJA 3T0AA 2FBEA 1ENSA 4R9CA 3WCRA 1N3PA 4N43B 1NZCA 3SEEA 3WW3A 5HI0A 5IK5A 1W6OB 3K51A 2C9AA 4YLZA 2P3JA 2VG9A 4QXKA 3C7GA 1N47A 1NA1A 3J7MA 4RGGA 1O8SA 3ACIA 3UKTA 3S5AA 5L36A 4WVMB 1OA2A 3S30A 1SDWA 2AC1A 3GYDA 1LGCA 4B8EA 3WOGA 3PUIA 1QDCA 3IT8A 1TEIA 1ZA4A 1LCLA 1R093 2AZ5A 1S55A 4ORFA 4UW3A 4QDRA 1N1YA 4A7YA 1RUNA 3HPNA 4BIOA 1N1TA 5EYYA 1PZ8A 4OHWA 1BYHA 2OQ7A 1BBT3 1ZA7A 2G9ZA 2XR4A 1DGRN 2XKOA 3AMQA 4QMAA 1UO9A 4IV3A 3ZFEA 5BNOA 4LPLA 2VZ3A 5CISA 2YGLA 5C9AB 3B00A 4CP2A 1ZZCA 2XVLA 4FBFA 3HR9A 1W6PB 4OHYA 4NHMA 3KM5A 2EXJA 2GNTA 3AP9A 2Z42A 4AGRA 5F5IA 4A6OA 4LKSA 1RGSA 1WD3A 1Z7S2 2Y6FA 3KF5A 1AL22 4F83A 4INDA 3N36A 4G9SB 2UWBA 4Q4Y1 1OFSA 4R52A 1QJU1 1VR3A 1ZBA1 1MZFA 3OD4A 3ZXEA 4FAGA 1MQTA 4XMAA 4YSFA 3JB8A 1RVF1 1RVF2 3LD8A 4CUBA 2FDIA 3LKJA 1AHSA 2Z5WA 5EPAA 4EN0A 1JMUB 1UY1A 2YDEA 3FLTA 1AXKA 2IXLA 1WMEA 1W6NA 4UW5A 4XDPA 3ZX7A 4DO0A 1HKDA 1UL9A 1DZQA 2IC1A 4J25A 4OUMA 2ZCWA 1X8EA 2AR6A 2PFWA 3ORJA 3HIFA 4WM7A 4N43C 5K0UA 1CIWA 2UURA 1OHFA 4LBQB 4AI2A 4JTNA 1D4M1 1WCUA 3ETQA 1V6LA 3LA7A 2Q30A 2RMU3 2ZX1A 3KV4A 4UXAA 1MACA 4XFBA 1H8TB 1QXJA 2W5FA 3KZ4C 4AG4A 1RUF1 1C8M2 1W6NB 4N90A 4BM8A 4L9BA 3H8RA 2HWE3 2UYAA 1P8JA 1W3VA 5I0TA 3VHRA 4Z2AA 5FREA 1BHGA 1RUI1 3W20A 5IK8A 1DBNA 5FUPA 5BNNB 3VZNA 4NRQA 3KGZA 3PUQA 5LEJA 1R1ZA 1U12A 2PXJA 1Y9MA 1S2BA 4PLNA 5HXMA 3BTYA 3VBOA 2EICA 5LZ6A 4LIVA 2A3YA 1F31A 2XBO1 1J3RA 3AKRA 4CP1A 1AR63 1W0NA 2IFRA 1J3PA 1UZZA 2GNBA 1OF3A 3ILNA 5BXXA 1MZ5A 4DRRA 2Y60A 2DVFA 4FOQA 3OTFA 1RL3A 3F2ZA 2WNVC 3RZLA 2JG8A 1QNYA 3M3EA 3KWVA 1Q3EA 4MGYE 1F5JA 4OI2A 3RYRA 5FPBA 2WQ4A 4XUQA 1LTEA 4AFAA 1M4WA 4Y26A 4IGPA 1I3HA 2NMOA 2DCKA 1AVBA 3M3QA 1REFA 4L99A 4JQTA 4WM8B 5C5TA 2PAEA 2VOVA 5FY9A 5F1RA 1K5JA 4GWIA 3EQEA 1DU3D 1G7YA 2WABA 3FHQA 1E5RA 2W52A 5DABA 3FHAA 5EXOA 5LA2A 1BBT1 2QE3A 2D6OX 1LU1A 4CCEA 4Q8KA 2ZXQA 4CXWA 2V4VA 2HWD1 2VY0A 3H1WA 1W3XA 3I2HA 4CEYB 5FWEA 1AX2A 5FZ1A 3ITQA 3L2YA 2XH6A 5HCFA 4XDQA 1OH4A 3SISA 2R49A 4Q1PA 4Y4YA 1RUE3 1Q56A 1FYUA 5A3LA 5C4WB 2BEOA 1PM7A 1DQ2A 2X5IC 4W4ZA 2OX0A 1FX5A 1MVEA 5KWRA 2RJ2A 2QQNA 3R4SA 2ID4A 1VAKA 3WDWA 1W99A 1DZRA 1BMV1 1H2NA 3WEZA 1IHMA 1RHI3 5KBFA 3TEZA 2K0GA 3W59A 1DF0A 4QGMA 3U4XA 3OOXA 1V6OA 1POV3 1U5XA 4DXTA 2RG4A 3ATGA 3CZJA 1ULDA 1XU1A 2JE8A 4BYYA 5A32A 1UIKA 3ZN5A 4Q4Y2 3ZSMA 4BU2A 2E53A 2GNDA 2JE7A 4P9WA 1FPN3 5A80A 2GC2A 2BOJA 3TNPB 1EAH2 4IW3A 5IT6A 2V5DA 1PO22 1T2XA 2JB4A 1A78A 2VUJA 1FOD3 4A45A 2A3WA 2JG9A 3MIBA 4D7TA 1GQPA 3EB7A 5C5UA 1W8UA 4IEYA 2ZEZA 4AQ2A 2QDRA 2WZPP 3RWNA 1JHNA 1K5MB 1AJKA 3ZR6A 4M00A 4URAA 3HBKA 1Y3TA 3H3LA 4XQWA 5ACA3 2Z4FA 1XOYA 5KHIA 1RUI2 5T55A 2CWSA 2B7YA 3FLRA 4GIQA 2R1BA 3Q8FA 2WFF3 4AE2A 1RB8G 4B7EA 2R1DA 3LEIA 2ZGOA 3O7OA 5E8AA 4GB33 2D6LX 1NOVA 5FYYA 3HN3A 4KNCA 2QVSB 4P14A 1XYNA 2BFUS 3ZYFA 4K8FA 2R0HA 2NZ9A 3QBQA 3IZOA 4IEOA 2WIIB 2JDNA 1RUD1 4BQ4A 5IVCA 1GLHA 1C28A 3AMHA 1BQPA 1CZTA 2GH8A 4K1ZA 5FZ0A 1ZVFA 1F5FA 1IGOA 1J1LA 1ND3B 2A71A 2VZQA 4MZUA 1D4M3 1SFYA 1SFNA 3C7FA 2B45X 2IXIA 1V6IA 5L9RA 3LFIA 2HWB1 3CF6E 2GP3A 2W2IA 1PO21 1EV12 1PVC1 5D8AA 2D97A 1RMU2 3WNMA 1CIYA 4BXSV 5I0DA 1RUJ3 2JDMA 4S2HA 4IL7A 3VN4A 4L92A 2ZABA 4QXHA 3ZKYA 4PF1A 4NIHA 3T2OA 1TNFA 1M06G 1XNCA 4EWEA 4DY3A 4DPNA 3DCQA 4P9IA 4QM8A 1D0GA 1QJY3 4JVAA 3IMNA 1JYVA 1PGL1 4H55A 3VBFA 4OLLA 2XBO3 4UW6A 1DCSA 4JRLA 1XXNA 4Y4RA 4ITCA 2K2SA 4C91A 5LB6A 4MGQA 5LA1A 4NIDA 2YXSA 4JKKA 5IAVA 3E6DA 3ZFGB 1RHI1 4RS5B 3DL3A 4QPGA 2GP5A 4FP3A 4WZFA 4Y5TA 4LA3A 2KM2A 1EPZA 2QDNA 3ALQA 4R9DA 3WD5A 3SITA 1PVXA 2TUNA 4LIUA 4N43A 5K0UC 1O91A 5B4NA 3AL6A 4EV0A 3WINE 2XJUA 5B4XA 2Y6JA 3BN6A 4QDSA 1G9BA 1W9YA 5F3CA 2RDQA 4A4AA 5JOXA 5JR2A 3D82A 4NN0A 1JYTA 3TN92 2NMNA 3ZSJA 3FFZA 3SXWA 1LODA 1IS5A 4ASKA 5CFDA 2Y6GA 4HMZA 5FBZA 1OKQA 1F4AA 3ACGA 2O0OA 4NOTA 3B01A 4Y22A 5FPVA 5A7OA 2D5FA 3WZ1A 5LRSA 3M2MA 5DMYA 4N7UA 4Q29A 2VZSA 3VDBA 1AR92 2ZGLA 3AXEA 3O1VA 4BCUA 3HNBM 2IXKA 5EWSA 4XFFA 1UN1A 1CONA 1QH7A 2BV4A 3CZUA 4MVTA 2D44A 1COV3 1SLTA 2JKXA 3I2FA 4CP9A 3FMGA 1IKPA 4M01A 4CVUA 1POV1 1HXS3 2Q5TA 5M0TA 2XB6C 3WHTA 4XF9A 2BUKA 1W8OA 2RS31 5CU1A 2ZAHA 1BXHA 1D7PM 1PVC3 4OMCA 3QOPA 1S0BA 5FYMA 5T50A 5JUVA 2FDFA 4HVRA 2GMEA 4R4ZA 3WVJA 2OZ6A 2Q1ZB 4LKDA 1CAWB 3OY8B 4Y1VA 5IVEA 3VL9A 4LORA 4LR4A 1HN1A 1PZ9A 3ZDVA 3ZYIB 3E6BA 3BODA 3CEWA 4P9XA 3ZFGC 1K45A 3KVAA 2IUWA 3NMBA 4OHVA 4XETA 4BZ4A 3WQ7A 3N9PA 5F5QA 2GC3A 5D8AB 5DDJ3 5AC91 2EXIA 1US3A 2J1SA 5FAXA 3UJOA 4LHNA 3LA3A 1JOPA 1B35C 3DYOA 1QOSA 3MIEA 2D6KA 4H2AA 2CY6A 2VM9A 3MO4A 3E5QA 2E32A 1LHVA 4AVTA 1VBD2 5K8SA 3A4UA 1VRH2 1FOD1 3WNKA 1CAUB 2ZGQA 3J7LA 4EN8B 2WS93 2W1SA 4Q4V3 4W6YA 5FR3A 3BIEA 1GOGA 3R4DB 4LBMA 1TQ5A 2HWF2 2VOTA 3H50A 4QHZA 5FMCA 4WVVA 5A7PA 3MZHA 5A70A 2PQQA 4LMFA 4FOYA 5DAXA 4RGKA 4CCJA 5C3PA 1W2NA 4IEPA 3O1SA 1VALA 3AKTA 2ENRA 1QWRA 1I5ZA 3LA2A 3W5MA 4XC9A 2P37A 1ZRCA 4MUVA 1S0JA 1UU5A 2XWJB 1QMJA 2ZGUA 4XUOA 3NV3A 5FFOC 4DZGA 5IVJA 2VMFA 1C1FA 3N9MA 1RUD3 1OBNA 2GZWA 1V6MA 2YROA 4HL0A 4LJHA 4P5HA 3ZFGA 3GXUA 4YW1A 1RUC3 1GZTA 1XPWA 5A1LA 4RD7A 1HQWA 2DTYA 2OYZA 4XTPA 5FYHA 3N7LA 4NHKA 5CADA 4JHTA 1Y43B 1NKGA 4QT6A 1MVQA 5FYBA 2I2SA 2VMEA 4YNIA 1UOJA 4D6RA 1W0PA 2YC0A 3OEAA 4ZHNA 1Y7BA 3USSA 3POWA 5LCWL 4RS5C 4QXBA 1SFPA 1HB3A 1W9WA 2PTMA 3GZAA 5I0SA 3LOBA 2Q8CA 4YW6A 3IKWA 4X6RB 4QGLA 3T1MA 4UFJA 4F3JA 1RXFA 3B7MA 5CIRA 2WC2A 3ZXAC 5DUVA 3P5BA 4QKDA 4EWDA 5CA6A 4XFGA 4UFIA 1BVVA 3GDBA 4DUVA 4HFSA 4FPYA 3SKVA 1OVSA 1YEWA 1ZBE2 4UFLA 4YG3A 5JMOA 1S0EA 5FOBB 1HRV1 2RVAA 1JW6A 4M4RA 5FMOL 3PUSA 3ENRA 2VCMA 1QOOA 3BTZA 3HQRA 3PUAA 3DN7A 4NWWA 3EO6A 3WP5A 2TEPA 2ZHLA 2RM23 2CU5A 1TME1 1PNGA 4XXPA 4XXAA 3ZFFB 2VAUA 4D3WA 1GFF2 2HEYF 3ZSKA 2VMGA 2YY1A 1H8TA 1XQNA 2WWJA 2FHRA 3WNOA 4IEWA 3MBWA 2QCSB 3PIGA 4FT8A 2LM3A 4NR1A 3ZN6A 2YYOA 3AP6A 4PJYA 3AVSA 3TB0A 1F8VA 1AYM2 1BEV2 2KA3A 5FCCA 1R091 1C57A 1G9CA 3TRSB 1CZVA 5LY2A 1QXPA 2XQRA 4C8DA 2W68A 2QQJA 4IERA 2ZX2A 4HK9A 5LATA 3WP6A 2VUCA 1IKQA 1W03A 4XJ8A 2MEV3 5JXGA 2W0XA 2LRPA 3LZZA 2YUEA 3RDIA 3RZHA 3D6EA 3OGRA 5DZGA 4BDVB 3ETPA 5JLVA 5L9VA 5IK7A 4NROA 1UZ0A 4NIGA 4M3CE 1DLCA 3KMHA 4YGEA 4JDOA 3HOBA 1WA6X 4K8RB 5T5PA 2RS33 4L97A 1RUC1 3SKJE 4NRPA 3BYWA 2O8OA 5GLTA 5H9PA 3WLUA 3ZXKA 4LEJA 1AR82 4ASMB 1ULCA 4ONUA 2ADEA 3PHMA 3Q8EA 5FZEA 4Z8BA 2VUAA 2VOXA 4K1YA 4UF0A 5GJ6A 1OC1A 5F37A 2RHPA 5ABJA 1TG7A 4OZOA 5A7NA 2PN5A 1RUH3 2IXHA 2GALA 4Q0PA 2WNVB 2XHKA 4QQOA 4ES8A 1PO11 2PELA 4BMBA 1AR91 1OOPC 2VXRA 1U5ZA 2CHHA 1AYN2 2EXHA 2YHJA 4FPFA 3ZYJB 3ZKUA 2J42A 3THTA 5EQUA 3R4UA 3M3CA 5C70A 3LWCA 3BUCA 3NRUA 5C8WA 2H0VA 5FP3A 5FLJA 4DINB 2BGCA 1IQAA 1NXMA 3VZOA 1KJRA 1PM4A 2BNMA 3C3VA 4XBNA 4CEWA 3H7JA 4BQWA 4Z82A 2QQLA 3O1MA 1H2KA 3KF3A 3VBRA 1MS8A 4EN9B 4XTMA 5LWBA 1YIFA 2B46X 4UOJA 3R0RA 3AKSA 4IV1C 4I0WB 2VE1A 3L2HA 2IVJA 1VAVA 4ZU7A 2V4AA 3UGGA 1W05A 1RXGA 1S0FA 3WF2A 2WQZC 4AEJA 2ET1A 4HK8A 3IAQA 2AACA 1WCSA 3FBYA 3OPZA 4FQ4A 3HJRA 5L7OB 4TTGA 5CYYA 4CSWA 2IVIB 3RI8A 3QCWA 1ASJ1 1PGW2 4LOTA 5FYUA 2E7QA 4B29A 3KB5A 2J1TA 3ZO0B 2D6MA 3KCXA 1SHWB 3WHUA 3S0MA 3PMSA 2CDOA 1QJY1 3O0VA 3P3PA 1SLIA 3ON7A 1XYPA 4MXWB 1N3OA 3DKWA 2UYBA 2FQPA 4F8AA 1SACA 4XVHA 1LOCA 3KSCA 4XABA 1WCKA 2C6SA 1CESA 1Z7S1 5A1FA 3P1IA 4Q0VA 4AK3A 4CUAA 3K3NA 3QD6A 3B5LB 2J1EA 2ET7A 3AP4A 5EP9A 5F5AA 2ZEXA 1XU2A 3POEA 1J83A 4FPCA 1D2QA
chains in the Genus database with same CATH topology
2XL7A 2P2KA 2XL9A 4YW3A 1NXD1 2Q4SA 3NAPB 1XE7A 3VKFC 1X50A 2DFCA 5C8CA 4EWAA 2XLAA 4GKYA 1O7FA 4O9EA 2XJRA 2EIGA 2O8QA 2PLV3 2XWBB 4MH0E 1R081 1J58A 2D43A 4XBQA 4K3UA 1O4TA 2AGSA 2K9ZA 5FPXA 5BNPA 3VBHA 1VBE2 2GN7A 4PQ9A 3AM2A 2D3SA 3V56A 5CNAA 1DYKA 3AP5A 3WV6A 4D94A 2JD4A 4YZ5A 3JBG1 5KXDA 5GLUA 3U10A 5I93A 3HN1A 3MIFA 4M0NA 1R1A2 4Q4X1 4BMEA 4OI4A 3UJQA 4BH9A 3H3UA 2VVEA 3POSA 1V6KA 3POYA 4AFBA 1QY4A 2WNVA 1JOJA 2JECA 3UV9A 3AZXA 3MPPG 1SCSA 2G9FA 4YM0A 4I0BA 5H9SA 1NCQA 1FNZA 3VBOC 3NAPA 1RUG3 3JD73 1YWKA 3VBSC 2I74A 1VBC3 4CEYA 3OGGA 3VBUA 5AVPA 1LJ7A 1XNBA 4IQPA 4DB5A 5JOWA 2VQ0A 3R05A 1V00A 3AMMA 4BPZA 1J3QA 3VV1A 4COVA 4J1WA 5GZFA 1DFQA 2DVAA 2ZGTA 3SH4A 4DQAA 1G9DA 3ZFEB 4M3CB 2WNEA 1R092 4JDNA 4YW4A 1UW8A 5JI9A 1OLRA 1ULGA 5KXBA 1UD1A 2HWD2 3ZMOA 5J36A 2QUOA 1BK1A 2PHWA 4MYEA 4N9IA 4Y1UA 5FRAA 1BBT2 3ZN4A 2DUPA 1NE4A 2ZX0A 4DXZA 5CAZA 5FLHA 1MQTC 2XJQA 4L8QA 1AR72 4K6BA 3ZFFA 4PIZA 3MFAA 3N7JA 1GSLA 1PK6A 4CDXC 5KXEA 3BIWE 1V6NA 3VKMA 1CJPA 4FP2A 3J26N 1ND2C 5JSRA 1Q8VA 1AL23 3AB0A 2CWMA 1QJX2 3BPZA 3MEPA 2VPVA 2D40A 4AEKA 2V73A 1SMVA 4BHPA 4KH9A 5LEKA 1XNKA 2NN8A 1H2LA 4YG6A 2JENA 4AYUA 1UMZA 2OUJA 3JBG3 4MX3A 2A73B 2HEVF 3OBTA 4YM2A 5J7MA 4GQ7A 2X53S 1YXWA 2I07B 2HKXA 5E16A 5FQ0A 3PVNA 2RMU2 2BNNA 1UZYA 2KXLA 4QM9A 1NA1C 2OW4A 1O3RA 1NLRA 4JGYB 5BYNA 4B7KA 2A6WA 3SLIA 1NY71 1W6PA 2GN3A 2JDZA 1LHWA 3NV4A 3VBUC 5J37A 4YVSC 1DYPA 3IM0A 2YZ4A 1W6MA 1JYCA 4CDQA 2ZHKA 4LLOA 2RS12 2X8KA 4LT5A 2Z69A 1NLSA 2DVBA 2F4PA 3TBDA 1ZZ8A 1QKQA 1LGNA 4YGCA 3TAYA 1Z78A 3X29B 3N3HA 5C8CB 1GNZA 2ZX3A 4YGDA 4A7KA 4WVMA 1AR81 2CGOA 1J59A 1EPWA 3Q9OA 1J1TA 4U36A 3VBHB 1VRH1 1RITA 1Q8QA 4COYA 3D5OA 2MPFA 2EVXA 2ZKLA 3E5XA 1LOFA 2H0BA 2W39A 5EZWA 4Y1YA 1Q5OA 2HWC1 3NL1A 1ULEA 4CTEA 2ZGSA 3WDVA 5JR7B 3B9IA 5C8CC 1FATA 4FAHA 1Q8SA 4BLIA 5JDBA 5FO9B 2B9UA 5GLZA 5C6CA 2CYFA 2UY8A 4O9GA 4SLIA 3USUA 2PLV1 1VBC1 4WBBA 2WNUC 1H30A 4RGAA 1ZZ6A 4FOWA 5SV8A 3URFA 2BBVA 1W6OA 4COWA 4Q4Y3 3FZ3A 4M3CF 1FV3A 1FNYA 3PVOA 2WT2A 1U5YA 2R073 3ZXGA 1EAH3 5JPNB 1SCRA 5FPZA 5D1IA 4FTSA 1WLWA 4OZXA 3RNSA 2RS51 3MLKA 5FMOS 4YZ4A 2E51A 3I54A 2P34A 4Q2FA 3SCGA 1V70A 3RS6A 4IV1A 3LSEA 4NPRA 1ZRFA 1DLLA 1CJDA 1RUI3 3ST7A 4AVCA 4Y20B 3VBRC 4KL1A 2C1FA 5AC93 3IDBB 1X8MA 3UKVA 2HWE1 2VMIA 1SLLA 2WLPA 4GB32 1AZDA 2H6BA 2P17A 1SLAA 5JWPA 3CJIA 2QZ3A 4Q27A 3WG3A 2YV8A 1N1SA 3ASIA 2Z2SB 1YYNA 4JGZA 1S0DA 1OOPA 2FMDA 3PNAA 4XBLA 4QD2A 2XPJA 2JEMA 2ZMLA 3MGUA 5JAXA 1TME3 5ABJC 3DPRA 2D98A 1O5LA 3VHOA 1RMU3 2R063 1RUJ2 2ZZJA 4LBKA 2MHFA 3EJKA 2RS52 1GZWB 2DURA 1EYBA 1LU2A 1BJQA 1O4ZA 4I09A 2WSUA 2OVUA 3IPVA 3B69A 1UU4A 1QJY2 1PMIA 2DUQA 4A3XA 2JJ6A 3N7KA 4KU7A 3FE5A 1LOGA 5CB7A 4Z07A 4KGGA 5JOYA 5BPXA 4QQPA 4WVZA 2I45A 4BOWA 4U2AA 5I8YA 2ZJCA 1ND2A 1WW4A 3DGTA 4H7LA 2ZACA 3AZVA 3VUOA 4LO7A 3M1HA 2RR13 1LECA 2RMU1 3ECQA 3ZFFC 3PVBB 5GZGA 5KXCA 1HDKA 1CAUA 4AFMA 3MIGA 5HBAA 1HIXA 4HPKA 2CGPA 1NCQB 1AL0G 4MXVA 1GQGA 2RE9A 3TN93 3B93A 4YFWA 4CDWA 2GU9A 4N53B 4LA2A 3IBMA 1UCXA 3J9SA 1AJOA 1LEMA 3ACLA 3ZYPA 4AVVA 1AR93 3ZMNA 1MEC2 1QJU3 4QGNA 1GANA 3LGRA 4L11A 3AK0A 4RA0A 3OGJA 3B9CA 3H3ZA 2BWAA 3HAGA 5DUWA 3VZJA 2BYVE 5LK7B 3V0AA 1OA3A 1COV2 4OUSA 4AI1A 3N7MA 1ZBA2 3M4FA 2ZTNA 3E6CC 3VBFC 2PHUA 3FUOA 1ASJ3 3SH5A 1H1MA 1OD5A 1VBB3 1CR7A 1PVC2 4I3GA 3JQWA 3NAPC 3MIDA 3VKLA 4ATFA 4D7YA 5A33B 1LOFC 2D3PA 3S6PA 2BPA2 3KQRA 1TMF1 4E2SA 4GB31 1DQ6A 4BLJA 4GMP1 2R041 5DDJ2 2ZMNA 1O5UA 5AFEA 2PA7A 2ZMKA 4XF4A 1AYM1 1BEV1 1H9PA 2DCZA 4XIOA 2WINB 4AXOA 4LNVA 3INAA 4X8PA 3FLPA 4FVVA 3DUIA 5T52A 2EAAA 1E57A 2V5YA 5IUQA 1R083 1VBD3 4H3WA 1X82A 4GKXA 2D7FA 1VRH3 2VVDA 1OSGA 4LHLA 1KS5A 4ATEA 4META 1PO13 2WS92 4Q4V2 4QQHA 4LO4B 3WUDA 4J1XA 1W6MB 3KT1A 2VW1A 3DV8A 3JCIA 4XF3A 1KD7A 5JCTA 3ZXFA 1DGLA 5K9YA 4W6WA 4PF5A 5JI7A 3QACA 2RJLA 3FBMA 1FMD3 4AI0A 3CJXA 4DOUA 1NG0A 3VHPA 4E4ZA 1PIV2 4CDUC 3T1LA 1RUD2 3NW4A 4NHLA 5FLIA 3ZDSA 2GSYA 4PIYA 1RUC2 1WBLA 5KHHA 2HWC2 3JU9A 1ONAA 3HD8B 4DY5A 4LBQA 1JN2P 3HBZA 4NO4A 5C4WC 2HYKA 4XF0A 1HQNA 1KJLA 4AQTA 3A0KA 2CV6A 2VU9A 1TE1B 1QOTA 3FJSA 3N4MA 2JG8B 5BV6A 3ZYRA 3H7YA 4I0AA 4XFHA 5F6LB 3VHNA 3MIHA 1HXS1 2X5IA 3PVEA 2OIIA 4E2QA 3BOPA 1Q8OA 3VBOB 2DTWA 4S2GA 3JZVA 1FMD1 1HRV3 1G9AA 5J09A 1MS5A 2OZJA 4YVWA 5T54A 5BNNA 4CEWC 5C33A 4Y20A 1COV1 2ZA9A 5I8TA 2B39A 2DU0A 4ZXKA 3BB6A 2WZR3 2SLIA 1G6NA 4XILA 1ZZBA 5BNPB 1DGWX 4XF1A 2JE9A 1AXYA 1JTZX 4XMIA 2LTNA 2WKKA 4Z1VA 4MV2A 4XW3A 1S0IA 4QPYA 5J98B 4AVSA 4BIFA 3MF9A 4HVOA 2XVKA 3H1MA 4Q4X3 4ISQA 5KHKA 1REEA 4P9LA 4HKLA 5J3UA 3M8LA 1FXZA 1IZ3A 3WQ1A 1FT9A 1WLTA 4RSUA 4XQ4A 3PJQA 3KT7A 3EHKA 3WG4A 3WX5A 4TLFA 2RS32 3AXDA 1AX1A 4G4FA 5GLVA 3U0ZA 1DQ4A 4AFDA 4COUA 1OI6A 1ZYBA 5DUUA 1AR83 5GZEA 1DIWA 2DUOA 2AENA 2P3KA 2ES3A 4XFCA 1LB2A 5GM0A 1RUH2 4WM7C 4TZDA 1LOBA 3FUQA 4AW7A 3KGLA 3BU7A 4Z2WA 1LHNA 4SBVA 1AYN3 5A33A 1H8TC 5CG9A 3BOWA 5JIUA 2UY9A 1APNA 2R6QA 1QQP2 3E5UA 3MPBA 3GBWA 1SLBA 3WG1A 3FWEA 3VBRB 3MI8A 3I4IA 1LRHA 4YVWC 2Q1MA 5A32B 2WT0A 5BNNC 5BNPC 3V0AB 3AYDA 3VZMA 1AR71 4AGGA 3B02A 2ZGNA 1B09A 1GKBA 3MLJA 4Q26A 4DNYA 1OPOA 2ZGRA 4AGVA 2PYTA 3V0BB 1LOAA 4WM7B 1TMF2 3RI9A 1S0GA 2VQAA 3SH3A 1HLCA 2X5IB 5EFUA 1GZ9A 3OYWB 1RIRA 3NO8A 3PJYA 5SV5A 3AP7A 4I2OA 4PDWA 2E7AA 5ABJB 5DXDA 4XJUA 1MS4A 4P9YA 3OJBA 3MLLA 4XFAA 4EN6B 4AF9A 4A2UA 4YVWB 3HWJA 4RR3B 2BNOA 5CBLA 4HBNA 1HQLA 2RJKA 5GZCA 5C9AA 1NCRB 2PHLA 2VULA 2DVDA 3RYPA 2XVGA 3WXPA 1YCIA 4C1XA 1YIPA 4LBJA 2HWB2 5K0UB 3IDCB 1VBA3 2R30A 5TSWA 3LAGA 2VNOA 2PLV2 2ZHNA 3D0JA 4L2NA 2PHFA 4OFGA 1CAXB 4YARA 1MQTB 5KHJA 1HRI2 4XHXA 4H14A 1VBE1 1RUF3 4LUMA 3CL1A 3J8F3 1D4VB 1H4HA 3R6SA 1CAVB 1PIV1 2C5DA 2CNAA 2WJSA 4S2DA 1LR5A 4WV8A 2D93A 1B35A 3FC0A 3GZUC 2UWAA 2QNKA 2F6BA 4R8HA 2FZ1A 1V9U3 5T3NA 2ARXA 1F9KA 2JG8C 2E9QA 1WW7A 4YM3A 2DCYA 2WLQA 1EAH1 5CFDB 4RHV2 4C1WA 3M3OA 4HLTA 1PGL2 4AI3A 1DQ5A 3MW4A 2DF7A 1FPN1 4AHWA 5AFBA 2IZWA 2VW0A 4HANA 1JYIA 1KITA 4FPEA 1LOEA 2VMHA 2WWSA 1IPJA 5JZGC 2WFPA 2XJPA 3ZPYA 5FTTC 1V6JA 3GALA 2ETEA 2WNUB 3I59B 3WW1A 1VBD1 3D0SA 4YVSB 4MSVA 1HW5A 4GMP0 1ND3C 1KQRA 5DDJ1 4OHZA 3H9AA 2EAKA 3VBSB 3U07A 3RMYA 1G86A 3ZSLA 4KG8A 4JRAA 3ZN6B 3ZSEA 3NVCA 4R4XA 2HWD3 3LCPA 5FO8B 3O0XA 3B94A 1SLCA 4K20A 2Q0AA 3THPA 4AHYA 1I1EA 1AR73 5JZGB 3NKTA 3IWZA 2LUWA 5BUVA 4Y24A 3I2DA 4P9GA 1HX6A 1B35B 1QJX3 4AVBA 2A3XA 1H1AA 1W39A 2WS91 4Q4V1 4IV3C 5BNOC 2ARBA 1RUG1 4MLOA 5JZGA 1DG6A 3WDYA 3B3QE 4RS5A 1VP6A 2OUHA 1UF2C 2HWF1 4Q4W3 1U0AA 5F6KA 4XJ9A 3VKOA 3GNEA 3ZXDA 4FO9A 4B3NA 4E4SA 3M3IA 3QH6A 3JBG2 3GZTB 4PLOA 1LEDA 5JOZA 2JKBA 2PAMA 5D8AC 2R042 2BVBA 2WA4A 3ZXLA 1BMV2 3TYJA 2JG9B 3ELNA 4A7ZA 1ALYA 4K9SA 4LULA 2VOKA 4FTEA 1YLLA 4GALA 5DZEA 5LRRA 2DCJA 1ZNPA 4IEVA 1YFUA 1DGWA 4I30A 3KCCA 2R32A 2RS13 1QGLA 1GBGA 1X33A 3W58A 1XNDA 1A8DA 1H0BA 1O4YA 3AYCA 1S2KA 4FPLA 2PAKA 3M7AA 4PDWB 1AL21 5L73A 4TSVA 1MS0A 2RM21 2ZHMA 4XYXA 1ZZ7A 3KT4A 1CQ9A 1DZTA 3ME2A 1GNHA 4F7ZA 5I91A 1V9U1 5EJ3A 4AEMA 1IPKA 2CL2A 1MEC1 1ZBE1 4IEQA 1WGPA 1GQHA 2A7AA 4FQZA 2ZGMA 4AWDA 5J48A 1YFXA 4LBNA 4IXLA 3VDDC 4XQDA 5C9AC 2RR11 3IDEA 2PHDA 1ULFA 1KS4A 3D8CA 4DFSA 2ZKNA 4N53A 1RUE1 4IESA 1DQ1A 1NY72 3ILFA 4Y22B 2HEWF 1RJ8A 4YM1A 4JTOA 3N35A 2W08A 2EALA 1C8M1 3RPQA 4Q0QA 1KDMA 3NV2A 4LE4A 3GHMA 4KQ7A 4XEZA 3T2TA 4FXKB 1QU0A 3KLSA 1C3HA 3H8UA 3JD71 5I0RA 1CAVA 3VZKA 4HKOA 2ZOEB 1VBB1 1MS9A 2XUMA 1W0OA 1Z7S3 1MR5A 1XYOA 5E1RA 2IXCA 4KBBA 2NLRA 4KU8A 3HMYA 2R072 5CFDC 1REDA 1RVF3 4CDWC 2DV9A 5AVAA 4XJZA 2AREA 4GULA 4LE3A 1SEFA 1H2MA 4IV1B 2DFBA 2PHTA 1UKRA 4CDUB 1BZWA 3ILRA 4WZCA 3WNXA 3WT3A 2E63A 4X6QB 3OYWA 3VBFB 2GNMA 2G4IA 2JX9A 3KCYA 2IWGB 1YNAA 4LO5B 3V0BA 2A6VA 4XZPA 5AC92 3K48A 3MFCA 1C8M3 4QPGC 4AVAA 4CDQB 1LHOA 2HWE2 1H8VA 1Z0HA 1X36A 1RJ7A 3AYAA 5DZFA 3NJZA 1O3QA 2FZ2A 4IETA 1N1VA 2MNGA 3AFGA 4QHBA 4RL7A 1GZWA 1ZREA 4N9HA 4MGKE 3CLPA 4YW2A 1UU6A 1BCXA 4JCKA 2QFEA 2GC0A 2AH2A 4RQPC 3LB9A 3ZYGA 1AR62 1Q43A 1TME2 1DDLA 4GH4B 3MYXA 2BFUL 3WCSA 1RC6A 4W6XA 2CTVA 2GDFA 2VOWA 1QXRA 3PLQA 4JDMA 2R062 3ZIWA 5JVVA 4B4QA 5B2GB 1PZ7A 1OQ1A 1VAMA 4ISRA 2RS53 1HV0A 1OOPB 3ES4A 2XKPA 4LHKA 3S7IA 3AMPA 4AQ6A 1C1LA 1GICA 3RJRA 4TWTA 1UX6A 4YZ3A 2RS11 5F9TA 2VECA 4XOGA 3TN91 4FPJA 1MS3A 1HV1A 4XIKA 4UW4A 5JSOA 1H1IA 5DG2A 3VKNA 4AEDB 1F2NA 2ZS6B 3RJ2X 4K7JA 3WDXA 1RUE2 4XPVA 1C4RA 1SBFA 3CNAA 1YJLA 1WA4A 1PK6C 4XFIA 3SMHA 4CDXA 5A3MA 2RR12 2ZGKA 2CGNA 3ZFEC 3OD0A 2ZX4A 3O12A 2ZBJA 4YFZA 5JPMB 2JG9C 5KHGA 1D0HA 2A6ZA 2PHXA 5CVRA 4COZA 1KDKA 1RHI2 4JC1A 1YI7A 2GC1A 2VH9A 5C4WA 4YW5A 3IIAA 2H6CA 2BWCA 1QHDA 2WSVA 2XJVA 2XG3A 2B5HA 1CVNA 2WNUA 2GAUA 3I59A 5E89A 1YRZA 1LKNA 1MEC3 1QJU2 2D3RA 4LO8A 2NYYA 1YHFA 1FPN2 3OCPA 3WR0A 1KFXL 3D4KA 1PO23 4HETA 4PBPA 4PDWC 5LK5A 1FOD2 3W9AA 1ZBA3 5T5OA 1LHUA 4Q8LA 4FSJA 5BNQA 2AYHA 4RHV1 1ASJ2 3NV1A 4IEXA 4BQ1A 1KXGA 1VBB2 4UBGA 5H9RA 4DMIA 4NWVA 3BALA 2O1QA 4WVWA 5ACA2 1SBEA 4C90A 1DQ0A 3GBGA 4GWNA 1DHKB 1I9RA 2WFF2 3VZLA 2NP0A 3J8F1 4CP0A 4WM8C 3OBRA 5JIAA 4EN7B 2YGMA 2ZGPA 2TBVA 4RR3C 1NA1B 4KWJA 2NM1A 2TNFA 5BY5A 3ROUA 4AQSA 1VB4A 1FI2A 3EXUA 3NKGA 3O14A 4I3PA 2QQPA 2ATFA 1I6XA 4MXWA 2V09A 1D4M2 4S2FA 3AKPA 1NYWA 1R082 2E7TA 4X8NA 1RUOA 1GV9A 1WMFA 3GHNA 2ZAAA 1EV13 2XLGA 4HN0A 1PO12 4M3CA 3AX4A 1SQ4A 4CYDA 5L7OC 3AZWA 2ILMA 1FV2A 1C5HA 1ENQA 1YI9A 4QQLA 4CDXB 3O5SA 2XBO2 1U5IA 5KC5A 1FMD2 3MDPA 1W6QB 4LBQD 4JV4A 1NE6A 2BQPA 5JMCA 3G7DA 4C0BA 2C0ZA 1PIV3 2ZPXA 2E6VA 3GF6A 3MW3A 4EJRA 1AX0A 2DVGA 3FFQA 4QX5A 3WDUA 4YGBA 1LENA 2HWC3 1UPSA 2OA2A 2DU1A 1CD3G 2QKDA 2R0FA 3RRDA 1IOAA 3OF1A 1JH5A 1CGPA 4R9AA 2EXKA 4GH4A 3P3NA 1AXZA 2LALA 3HQXA 4MGZE 2HJIA 2ERFA 4B4PA 5CFCC 3I8TA 4PIXA 1WUVA 4YZ2A 4KGQA 1IS4A 3KD4A 3RYKA 3AYEA 5CG8A 4FXGB 2P3IA 3VGIA 1HRV2 2VNGA 3UKNA 1CPMA 5DG1A 1CN1A 1NQDA 1RMU1 4TYSA 4D69A 3J4UH 2WZR2 2X29A 1KFUL 4J6GA 4BWOA 1C5IA 1HXS2 4OHXA 5EYXA 1XE8A 2WL1A 1BKZA 3AKQA 1AR61 4QQ2A 3BTAA 2Y0OA 4Q4X2 1RTVA 4CEWB 4PBOA 4JGYC 4CDUA 1EP0A 1W6QA 3DPRC 2EF6A 1YFWA 2XLFA 5I8SA 3AZZA 4JQRA 2WFF1 2BW8A 2JXAA 3NSTA 1NCRC 2Q8OA 1VIWB 2VNRA 1PK6B 4JGZC 4B4RA 4YRDA 5I0UA 2GMMA 3SCHA 4AHZA 1O3SA 3CJIC 4QPIB 3IN9A 2JICA 4FPGA 3S7EA 1GYKA 1ZRDA 4JAAA 1UIJA 4URTA 5L7OA 1KRIA 3RQ0A 5CFCB 1QNWA 3QH7A 5H9QA 4ZKTB 4Y1XA 3KS7A 1YJKA 4XHBA 4AHXA 2UU8A 2VW2A 1MZ6A 4IEZA 4K40A 4CDWB 5KC6A 1CPNA 4YG0A 1G9FA 1L3JA 2HWF3 3AJYA 4QU2A 1WD4A 1TNRA 3DPRB 3TOJA 4AEDA 4H7MA 4PLMA 3VL8A 4N7IA 3UK9A