4RHV1

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv100
1VBB3 4CDUC 1QJU3 3VBOB 3NAPB 4Y4YA 5BNNB 1FMD1 1ASJ1 3VBUC 2VQ0A 1B35A 5A33B 4CDQA 1VBE3 1RMU3 3ZFGA 1BMV2 1V9U2 4Q4X2 3VBHC 4JGYC 4YVWC 1NCRB 4N43C 4Q4W1 2HWF2 3JB4C 5GKAC 1BMV1 4Q4X1 1OPOA 4CDUA 1E57A 4Q4V2 2RM22 5C8CC 4QPGB 3VBUA 1PO22 4RR3A 5L7OA 3ZFEA 4Q4V1 3M8LA 3CJIB 3VBFB 1PO21 1V9U3 4Q4X3 1FOD2 4WM7A 2BUKA 5A32B 1COV2 2HWF3 4GMP0 4JGYA 4YVWA 1FOD1 1RUI1 5D8AB 4Q4V3 1AR92 2RM23 4RS5B 1POV1 5CFCB 1PO23 1H8TB 1MEC2 1AR91 3VBSA 2ZTNA 4CEYB 4EJRA 2HWB2 1AR62 1MEC1 1FOD3 5JZGA 5ABJC 1COV3 5K0UB 2HWB1 1AR61 1NCQB 1POV3 4GH4B 1QQP2 2IZWA 1AUYA 1WCDJ 2MEV2 1CD3G 1AR93 1RUH2 1ND3B 3JB8A 5BNOA 1AR81 1RUJ1 1MEC3 1PVC1 1QQP1 4IV1B 1RUD2 1RUH1 2HWB3 5FMOL 1VRH2 1AR63 3VBRA 2X5IC 2WLPA 1RUD1 3ZFFA 1K5MC 1Z7S1 1PVC3 1QQP3 1EV12 1RUH3 1R1A2 1FPN2 3J8F2 1VBD2 1ZBE2 1RUD3 1EV11 1RVF1 2RR12 3NAPA 5DDJ2 2RS11 2PLV2 1EAH2 1R1A1 5BNNA 1FPN1 3J8F1 1VRH3 5C9AB 1VBD1 1ZBE1 1NA1C 1NY72 2RR11 5A33A 5DDJ1 2PLV1 2X5IA 1B35C 4CDQC 1QJU1 1RHI2 4RQPB 1VBA2 1EV13 1NCRA 1HRV2 1R1A3 1FPN3 1RHI1 2BFUL 3J8F3 1VBA1 1VBD3 1ZBE3 2RR13 3DPRB 1HRV1 5DDJ3 2PLV3 1EAH3 5CFCC 4AEDB 1F2NA 2FZ2A 4QPGA 3LOBA 1NA1A 4RR3C 4CDXC 2WWSA 5L7OC 3ZFEC 1RHI3 1OOPB 1MQTB 4NWVA 1VBA3 1HRV3 4JGZB 4WM7C 2R062 2Y26A 4YVSB 5D8AA 4RS5A 4CEWB 1V9U1 4N53B 5CFCA 1RUC2 1H8TA 4RFT0 1VB2A 1IHMA 2HWF1 4PDWB 1HXS2 1C8NA 4CEYA 1RUC1 4CDXA 3VBSC 4CDWB 2RM21 5FMOS 5K0UA 1NCQA 2R063 5JZGC 4IV3C 5BNPB 1BEV2 4GH4A 1ND3A 1VAKA 1HX6A 1RUC3 1BEV1 4IV1A 1COV1 5BNOC 4QPIB 1HXS3 5AC92 1W39A 3VBRC 4WM8B 5AC91 4SBVA 4RQPC 3ZFFC 1QJX2 4Y5Z0 1BEV3 4IV3A 1ND2B 1QJX1 4RHV2 2BPA2 1ZBA2 5AC93 2BFUS 3NAPC 4RHV1 3VBOC 5BNNC 2HWC2 3ZXAC 2DF7A 2MEV1 4GB32 1QJX3 4RQPA 5CFDB 4GB31 1VRH1 5J98B 4RHV3 1NCRC 3VBHB 4JGYB 4YVWB 4N43B 1F8VA 2MEV3 1ZBA3 1AYM2 1VB4A 4AEDA 1BBT2 2TBVA 1AR72 2HWC3 4PDWC 3VBOA 4QPGC 5C8CB 4GB33 3VDDB 1AR71 1GFF2 2RS32 1OOPA 3CJIC 1EAH1 3VBFC 2RS31 4JGZA 2ZAHA 1NY71 4YVSA 4FTEA 4GMP1 1RUE2 1AYM3 1BBT3 2XBO2 5D8AC 1AR73 4N53A 4RS5C 1RUE1 1POV0 4PDWA 1H8TC 2HWE2 2XBO1 2RS33 4CEYC 5C4WB 4GMP3 2HWE1 3CJIA 1PGW2 3VBFA 1D4M2 5K0UC 5BNPA 1NCQC 5A32A 3IDEA 1RUE3 5ABJB 1D4M1 2XBO3 4GH4C 1FMD2 1ASJ2 3JBG2 1ND3C 1PO12 4QPIA 2R061 2HWE3 4IV1C 4FTSA 2RMU2 3JBG1 1RUF2 1PO11 1A6CA 5LK7B 4WM8A 4FTBA 4Q4Y2 1X33A 5CFDC 2X5IB 1TMF2 1D4M3 2RMU1 1DDLA 1RUF1 2R042 4Q4W2 1HXS1 1K5MB 4Q4Y1 1ND2A 1TMF1 2R072 2R041 1FMD3 1ASJ3 3JBG3 1PO13 1NG0A 3TN92 4FSJA 2R071 1M06G 2ZZQA 2RMU3 1RUF3 4NWWA 3TN91 3VDDC 5C9AC 3S6PA 4Q4Y3 2RS52 2WZR2 1TMF3 1NA1B 2R043 4Q4W3 5CFDA 1B35B 4CDQB 1SMVA 1QJY2 1TME2 2RS51 1OHFA 2WZR1 2GH8A 2R073 1RUI2 3VBHA 3ZFGB 4N43A 1NOVA 2QQPA 1C8M2 1QJY1 1TME1 3TN93 1HQNA 1PIV2 2GSYA 2XPJA 3DPRC 1AL22 4AEDC 1C8M1 1VBC2 1R092 1PIV1 5C8CA 1AL21 2RS53 3VDDA 4CDUB 5C9AA 2WZR3 5C4WC 2FZ1A 5J96B 1VBC1 1ZBA1 1R091 3VBUB 4RR3B 4CDXB 1OOPC 1RUG2 1QJY3 1TME3 1MQTC 3ZFEB 2HWC1 5L7OB 1RUI3 4JGZC 1AYN2 1C8M3 1RUG1 4YVSC 1AR82 1PIV3 4WM7B 1RUJ2 1PVC2 1AL23 3JD72 1AYN1 1AL0G 3DPRA 5ACA2 4CEWC 4Z92B 1VBC3 4N53C 1R093 3JD71 1RB8G 5ACA1 2HWD2 5C4WA 4BCUA 1AYM1 2WS92 1BBT1 1QJZA 1RUG3 1Z7S2 1CJDA 4CDWC 2BBVA 3VBSB 1HRI2 1MQTA 2HWD1 1AYN3 2WFF2 2WS91 5ABJA 1AR83 1RUJ3 5BNPC 5JZGB 1HRI1 1RVF2 3JD73 4IV3B 2RS12 2WFF1 5ACA3 1PGL2 1R082 3FBMA 4CEWA 5FOJB 4LLFA 4QPIC 1X36A 2HWD3 5BNOB 1PGL1 1R081 1VBB2 1QJU2 2WS93 1Z7S3 4WM8C 1HRI3 4CDWA 1VBB1 2WFF3 3VBRB 1K5MA 3ZFFB 1VBE2 3HAGA 1RMU2 1RVF3 3ZFGC 2RS13 1ND2C 1PGW1 1R083 1VBE1 1RMU1
chains in the Genus database with same CATH superfamily
4MV2A 5G05L 1MS1A 3GZUC 4HANA 5K9YA 4LHLA 2Q8EA 3ILRA 3NAPB 1UYXA 2AYHA 1FMD1 2J1SA 2Y34A 4N7IA 3VBUC 1ZZ7A 1S0IA 1YJKA 4KU8A 3MPBA 1RUOA 5F39A 2EICA 1A3KA 3ALQA 1OFNA 3CZJA 4Y5TA 2VOVA 3IIIA 4Q0VA 5F5CA 5GLTA 4CSWA 3J7HA 2VBDA 3ZFGA 1V9U2 5BNQA 5E89A 2X09A 2QJVA 3CF6E 3VBHC 5I8YA 3U07A 2N7GA 3WF0A 1UPSA 5J37A 5GZEA 3VKMA 3H3ZA 3JB4C 5FPZA 1IG0A 3ZYRA 4CPBD 1NE4A 2ARAA 3PIJA 1JI6A 1GUIA 4UAPA 4NPMA 1X82A 5T50A 4AVCA 4FAHA 4L8QA 4AFBA 2PHRA 3J7NA 4UBHA 2LW8A 4QPGB 4GALA 1W8TA 3VBUA 3W20A 2PQSA 1QU0A 2OIIA 1KITA 5GZCA 4UT5A 5HXVA 1F4AA 3AP6A 2VNOA 4L92A 1ENXA 4XUNA 1OUSA 1NT0A 2IXCA 5JCTA 5A32B 4LKFA 2ZMNA 4AI3A 5FY1A 1C3HA 4GMP0 3LSDA 1YFYA 4QGLA 4QKNA 4OI2A 4ZS2A 1H4HA 5C5UA 4OZXA 3T0DA 2Y0OA 5FY7A 5KXDA 5I0UA 2ES3A 1UOBA 2XUMA 5D8AB 3ZFEA 4P9JA 3WDTA 2E26A 1H0BA 4R9DA 4NPRA 4RS5B 1POV1 5T5OA 3THPA 1V6NA 4CCEA 4K1YA 2IWGB 3AX4A 5FMDA 1H8TB 4FFIA 1AHSA 4LBLA 2OZ6A 4XFFA 2O1QA 1VAVA 4J1XA 2ZTNA 3VDCA 4XYXA 2VTXA 5T5JA 1MEC1 1SLLA 5C33A 4I2OA 1S4CA 1FOD3 1PZ8A 2EALA 4LK7A 3KHBA 1SLAA 1COV3 1KGYA 4MADA 1NCQB 1RGSA 2JIJA 4BQ4A 5IAXA 2PHFA 2YV8A 3GYDA 3O0VA 4AEKA 5D2AA 5LA9A 2IZWA 1W6MB 1AUYA 1WCDJ 1N3OA 2QQWA 1AR93 1CD3G 4LBQB 1ND3B 1X8MA 5CKNA 5B2GB 3VZOA 5FZGA 3POEA 4XILA 1QJFA 1UMZA 1L7QA 3U4SA 1BYHA 4BOWA 3VD9A 2X5IC 2WLPA 2ZKLA 1RUD1 1PX3A 1UWWA 1O5UA 2SBAA 4XZUG 2VQAA 2Y8KA 1YXWA 3OBZA 1K5MC 3R4SA 4YZ4A 1UU4A 4M00A 1WGPA 1Z7S1 5LY1A 4FCAA 5BYNA 1W6NB 1QQP3 1EV12 2HYKA 1HB2A 1RUH3 1FPN2 1LOBA 2Z2SB 1VBD2 2ADDA 5DDJ2 3UGHA 2D6NA 2PLV2 4N90A 1QXRA 3J8F1 1XRUA 1REDA 4BM8A 3VD3A 2XVGA 5C9AB 1NA1C 2X5IA 4PBOA 1B35C 2R16A 2VR4A 3QH6A 4CDQC 1QJU1 4LORA 4YZ3A 1RHI2 2QZ2A 4CCJA 4RQPB 5DAXA 5F37A 3PLQA 2GC1A 1JXNA 1H6YA 4OULA 3MUY1 1Y43B 4LE3A 3LFIA 2WT2A 5DUVA 4N9HA 1F4HA 2J7MA 1ZBE3 3V0AA 5E16A 3DPRB 1UNBA 3AP4A 1HRV1 3NWKA 3TOJA 1UIJA 2FCVA 1U5YA 2AENA 2W1UA 1WCKA 1CN1A 2WAAA 2ZA9A 2JE8A 2E7QA 2FZ2A 1UY3A 3BTXA 1SDDB 2WNOA 1X9PA 2Q5TA 1F15A 2X10A 1O6UA 3ZM8A 3BPSA 3MEPA 1NA1A 5JMCA 4RR3C 3ZXJA 2WFPA 3D4KA 3Q8EA 1O3RA 2YDEA 1JUIA 4IEVA 4XHXA 3I2JA 3DYMA 4PBPA 2A6XA 2JG9B 3ZPOA 2UY8A 1VBA3 3LA2A 1T6BX 4W6WA 3HNMA 2FDIA 1ULFA 2C5DA 4BQWA 4CCOA 5KR7A 4AL9A 4WM7C 2R062 3FBYA 1QOSA 2NPIA 2EVXA 3RMYA 2XMLA 4ONUA 4Q0UA 1S0DA 3WDUA 2CGPA 3TWIA 3ASIA 5CVRA 3WDXA 4IGOA 1DF0A 1W6PB 3PDQA 4W6YA 3VZNA 2XB6C 5FO8B 5I91A 1UXXX 2J1RA 1S0JA 3ABZA 1IHMA 4JC1A 2A3YA 3MF9A 2HWF1 2W0XA 4RGGA 4XOGA 3UKVA 3O1OA 4ET7A 5JOXA 1C8NA 4CEYA 4DUXA 5B4XA 1XNKA 3R0RA 2X29A 4BISA 4CDWB 4HSLA 4CPBA 2YBKA 1PNGA 4NPLA 2H0BA 3JU9A 4QQ2A 5FZ8A 5K0UA 3WY6A 3UESA 2ZZJA 1TVGA 5FXWA 1CAUA 3PL0A 3APBA 3ZKYA 3WQ7A 3AKPA 4XZPA 5BNPB 4GH4A 1WZXA 5DN2A 2ZS6B 1GICA 4ZHNA 3H3UA 1D0GA 2W3JA 2QUOA 4O65A 2UYAA 4R52A 1LTEA 4PQ9A 5AVPA 5C5TA 1HLCA 5A1FA 1RUC3 2A6YA 3OGRA 1SFPA 1TNRA 3CJXA 1YI7A 1QH6A 2ZX2A 3DXUA 4YW6A 1HXS3 2A73B 4O9EA 5BNOC 1QWRA 4QQLA 1LU1A 2K0GA 2XVKA 3RQ0A 3OGVA 3IDAA 5FPVA 3DUIA 4URTA 1UZZA 2J1EA 4MGZE 2XJRA 5ANNA 4SBVA 5E6HA 5L73A 2VW1A 4AVBA 4BXSV 2EIEA 4RGAA 1WLDA 1K42A 1BEV3 1DZRA 5FZOB 4FPFA 5A3PA 1VJ2A 3PTRB 5E1RA 1YQ6A 4RHV2 4YNIA 4C0BA 3R4DB 1BHGA 3CQOA 2C24A 5F32A 3NJXA 4NO4A 5AC93 1XC6A 1HV1A 3AXEA 4CP1A 3WW3A 3PURA 4XUPA 5BNNC 3MW3A 3P3PA 5GALA 1OVPA 1QF3A 1LKNA 2IVIB 2WO2A 4OUEA 3UGFA 2MEV1 4NRQA 1T6GC 5IFTA 2Q1ZB 2GNDA 5JPMB 3D82A 1L7RA 4MXWA 4GQ7A 2XJQA 5FZFA 1L7LA 5FKBA 4Q29A 3SKVA 4GB31 2LS6A 1DZQA 4AI1A 3NO8A 1VRH1 4YM0A 3FLPA 2D93A 4BWOA 2WUHA 4H14A 4PLOA 4CCDA 3LDKA 3WD5A 1QXJA 2Y6HA 3INAA 3VBHB 4OLLA 3E6CC 4HFSA 5LB6A 5SV5A 1HW5A 1XU1A 4OHXA 5DPNA 3T0AA 3N36A 5A3OA 3HQXA 2TBVA 4E27A 2GH2A 2F17A 5FO9B 3GBFA 3ZYBA 4YM2A 3ZO0B 4YFZA 1BQPA 3Q8FA 2ZEZA 1AR71 4ISQA 4S2FA 3SH3A 2DURA 3MLKA 4I3GA 4DXTA 1JOPA 3C7GA 5FZCA 3H1MA 3ZKUA 1CONA 2RJLA 1NE6A 3VBFC 4GWIA 4P9YA 4AHWA 2FD8A 3AZWA 5H9RA 2RS31 3NNJA 1S0GA 3LA7A 3MIBA 3AMHA 1ALYA 3TEZA 2VC9A 1LOFC 5I8SA 3VHNA 4LHKA 1AYM3 3ZX7A 2XBO2 1I1EA 1GLHA 5DZGA 4N53A 4Z07A 2P5BA 5K4LA 4PI2A 1DQ2A 1CAWA 2XVLA 1RUE1 1SLCA 1IG3A 1OT5A 1POV0 4ORFA 2BTVC 2UWCA 4XJAA 3WNOA 3LF7A 2Q8CA 4XFBA 3RPQA 2VOWA 4IXLA 4S2HA 4JKKA 1CJPA 5GZDA 1XE8A 4LQRA 3USUA 3ITQA 4EWAA 4LXLA 2MHFA 3AJZA 3H42B 5DAVA 1IPJA 2JG8C 4RN5A 4Q8KA 5A80A 4D94A 2CAUA 2G9ZA 3VBFA 4ATEA 5F2WA 4HVQA 5IT6A 3O14A 3O1PA 4LOTA 4CUAA 4I0BA 4W50A 4L9BA 4G3YC 4COZA 1LENA 1LOFA 3D5OA 3I2GA 4MH0E 4YGDA 3EO6A 3RZJA 1D4M1 2OYZA 1UYYA 5B4NA 3JBG2 1PO12 3KMHA 3N4MA 3SH5A 2DV9A 3E6BA 1SPPA 3JZVA 2CWMA 3AP9A 5FZ7A 2HWE3 4W8JA 2XJUA 4Y24A 1ZYBA 1RUF2 3UK9A 3NVCA 5K7PA 3V65A 4AR2A 3KZ4C 4PT6A 2A3XA 2A6ZA 1JHJA 2JDUA 2QTWB 2UY9A 2X5IB 4BQ2A 2DBIA 4E4SA 3RZMA 1DDLA 3EJKA 3N7KA 4Q4W2 1CAVB 4FOWA 1K5MB 4IE7A 4LLOA 3SKJE 4A45A 2DVDA 4UOJA 4FPHA 1TMF1 3GM8A 3KCYA 4MSVA 1FMD3 4Y26A 1Q8OA 2YPJA 4K21A 4LTAA 5FY8A 1NG0A 1OMIA 3ZN6B 1S0CA 2VZSA 3VZMA 3WNPA 3V0AB 2R071 2QQIA 1DYPA 3VKFC 1LOCA 2WKKA 2YFZA 3J7LA 5CADA 5KHKA 2PTMA 4YYOA 3VDDC 3VHPA 2Z69A 3S6PA 3FE5A 1G8WA 4Q4Y3 4K40A 1SG3A 4LBQD 3RGBA 1NA1B 2ZABA 4HONA 4AFCA 3E5XA 2DVAA 3WQ0A 3EB7A 3DYPA 4YARA 4HVOA 1B35B 4IEOA 1EY2A 5DG1A 4CDQB 1ZM1A 2OUJA 2RS51 1IGOA 2RVAA 3MIEA 3VL9A 2OPWA 3T2OA 2C1FA 1R1ZA 4GIQA 4B1MA 5J48A 3FFZA 2QQJA 1RXFA 1VLNA 1WWYA 1UIKA 2NN8A 2P3YA 3K2OA 4HETA 5EP9A 3ZR6A 1LNSA 1C8M2 1QJY1 1TME1 1W9YA 4R4XA 2ORZA 3TN93 1FT9A 3PVEA 2GMEA 1UKRA 2OPKA 2XPJA 2KR2A 4I0WB 4C90A 2VY0A 4BMEA 4AE2A 4YZ5A 3MBWA 4AEDC 2XL9A 1ONAA 1NLSA 3GZEA 5LA2A 3ILFA 4HK8A 3WF3A 1LAJA 3OJBA 1AL21 3VDDA 1AXYA 3E5UA 3P3NA 5HI0A 2FZ1A 1SHWB 2VW2A 3H3LA 4YRDA 3WP5A 2W9XA 1NQDA 2BBAA 1C1LA 1H1AA 4OMCA 4RR3B 1OF3A 3SCHA 1GZWB 2Q4SA 2YGLA 2BNOA 2VVEA 2GNTA 3FL7A 4IEPA 4AVSA 1HIXA 4A6OA 3M3OA 1MACA 2GC3A 1F9KA 2AGSA 2DCTA 5L9RA 1QHDA 1RUG1 1JOBA 1CAUB 2WWUA 2JDZA 1GWMA 1AR82 1PIV3 4WM7B 1PVC2 2JX9A 4R9CA 4MXVA 4FAGA 1K3IA 3KLSA 4FFFA 1AL0G 1GOGA 1VBC3 5FJHA 4XBLA 4A7ZA 2BERA 3O1TA 2DCJA 1UZYA 4GAZA 2Y6FA 1SZBA 4FPJA 2P1BA 2HWD2 2ZHKA 3B69A 5E88A 3DCQA 3LGRA 1YFUA 5FP8A 4COWA 1C28A 1LHWA 1GNYA 2WRAA 2VUJA 4ES9A 4FPCA 1QY4A 2BBVA 3AMMA 4GWJA 2ARXA 1YQ5A 4P14A 2WS91 3WG3A 2ZMLA 1WMDA 3ECQA 4HT1T 3LOIA 3S30A 4DXRA 1H1IA 4D6SA 3KVBA 3JD73 5F1RA 1LULA 3I4IA 2XOMA 2VZVA 3ROUA 4DS0A 5LATA 2WFF1 5ACA3 5KC5A 4A3ZA 3CNAA 1R082 4INDA 1W04A 2GAUA 3EBRA 2OS2A 2W95A 3EYPA 1UY1A 1GNHA 3FBMA 4LMFA 4QQOA 2E32A 2YMZA 4QPIC 5LA0A 1DBNA 1X36A 2V5YA 2Y64A 2AREA 3OBTA 5BNOB 2RHPA 4CCKA 5FY0A 5JIAA 1SEFA 1Z7S3 4FP3A 4N7UA 4QX7A 1OA2A 2AUYA 2D6LX 1IOAA 1XYOA 1HRI3 1CX4A 4Y33A 5J7MA 3SLIA 2CTVA 3RZKA 3RG0A 2BU9A 2XGXA 3B7MA 2C4XA 3WR0A 1FV3A 2C9KA 2VMGA 2O8OA 1NAEA 2VMIA 3D6EA 4OI1A 2QNKA 1WCUA 2DUPA 2BVVA 4LO5B 2X53S 1WMXA 2Z42A 1PMIA 4C1XA 4EV0A 3ENRA 1QJU3 3LWCA 4NMIA 3A0KA 3BCWA 3PVBB 4Y4YA 3LIGA 1GQGA 2A71A 1Q8SA 1WCSA 5BNNB 5JR7B 2B8MA 4A7KA 2NQYA 2ZX3A 2W5FA 3WF1A 1XSQA 3O7OA 4X6RB 4K3UA 2WT1A 4M3CB 5A3TA 5GLWA 4XF3A 2AEZA 3ZYFA 1W9SA 4LBKA 4QKDA 2W52A 2E33A 4QPYA 3X29B 5I8TA 4IEYA 3IIAA 5F3GA 3M3IA 3V56A 5IVCA 4YVWC 2W47A 1MS9A 2GDFA 4WBBA 4YW7A 5FYZA 3SEPA 4AQ6A 1UY4A 3RYRA 3AMPA 4AG4A 5GKAC 3POSA 2P3IA 1BZWA 3MW2A 5J36A 1I6XA 2F4PA 1OPOA 4JQTA 4AAXA 5L19A 4JKLA 2QVSB 1CR7A 2XUEA 4LOSA 2QQLA 1LECA 5C8CC 3M3EA 2GN3A 4XVHA 3LCPA 1URXA 3TRSB 4Y5SA 3AZZA 3IZOA 3USUB 5L7OA 4H55A 2V5DA 2AEYA 3M8LA 4OI4A 3DL3A 3VBFB 3Q8CA 4D6RA 5FLHA 5JIUA 1J59A 4NHXA 4Q4X3 3AKTA 4QGMA 1FOD2 3KF5A 5FYSA 3BTYA 5LASA 2BUKA 4FOYA 4U36A 1COV2 2GNBA 2HWF3 2VCCA 3DN7A 4YVWA 1DGWA 2IXJA 2NMNA 3WNLA 4R4ZA 3WNNA 4Y22B 3MZHA 5DQ0A 1RUI1 3FJSA 3AM2A 3D0JA 1W28A 4Q4V3 5L9VA 4ZS3A 1AR92 1PK6A 1SPPB 5JAXA 3DXTA 4XFGA 5A3UA 3LKJA 1JZ5A 1S0EA 1PO23 3KWVA 4FVVA 1ULPA 1WD4A 3OD4A 2YG0A 3WW2A 2BP6A 2XR4A 5FREA 1POQA 2B9UA 2FCTA 2JG8B 5IAVA 5A6QA 5GM0A 4QM8A 3UETA 5JZGA 1OLME 2GC0A 1RC6A 1NQJA 1W8FA 3KQRA 1T2XA 5CYYA 1HB1A 3AZYA 4OHYA 5ERLA 1WW7A 2QQNA 3I2IA 1QQP2 4PF5A 4YWAA 2Z4FA 3H50A 1RUH2 5IJRA 1V6JA 1FAYA 5JVVA 5FOBB 2KXLA 1RUJ1 1KFXL 2CU5A 2DBNA 2WYFA 4BA6A 1CGPA 4QGNA 1SLIA 2HWB3 1H1MA 1AR63 2Q8OA 4KBBA 4Z1VA 2JICA 1UZVA 3AKRA 3ZFFA 2VBBA 2FMYA 3WP4A 4ITCA 2D5FA 3AMNA 4KBZA 4U2AA 5LY2A 3SITA 2OX0A 3OSDA 1ZZ8A 1PVC3 1PNFA 3ACLA 1ZNPA 1WA6X 1OBNA 1LGBA 3LA3A 2H6BA 3V0BA 2JECA 1ZBE2 1RVF1 1EV11 3NW4A 4MO3M 2XHKA 4LO4B 1FPN1 3POYA 2J1TA 1GKBA 4V2WA 1UYZA 4W6XA 5A3WA 3W21A 4QHOA 1ZA4A 2OKXA 1VRH3 1GR3A 2DUQA 1VBD1 1NY72 5A33A 3BTAA 4IEWA 4OFGA 2PLV1 2E63A 4IEXA 4QD2A 5DDJ1 5KC6A 2BW8A 3T2QA 1XNDA 3LFMA 2CYFA 3WW1A 2X8KA 4MOAA 3OGJA 3QD6A 5I0TA 2VCBA 4NUBA 1VBA2 3EHKA 5JPNB 1NCRA 1ZRCA 1E5SA 5JI9A 1BVP1 1R1A3 2LTNA 2PQQA 1RHI1 1UU6A 2VL4A 4CP2A 1YCIA 2P17A 2VCMA 4LR4A 1LU2A 3NJVA 2RR13 5FPXA 3HT1A 3FUQA 1KS5A 4FOVA 4Y3OA 5DABA 4AEDB 4RL7A 5CFCC 1N1YA 2GN7A 5L9BA 2LALA 5FRAA 4ASKA 3LOBA 1YHFA 1XSRA 3U10A 4XTPA 3MPPG 3AYEA 4BPZA 3I3BA 1V6LA 5AFBA 2OXBA 3R4UA 4OYUA 1UYPA 1VRBA 3I59B 4CP9A 2W94A 4P00B 1NUKA 2HLEA 3NNFA 3OEBA 4CU7A 1QNWA 1ACCA 1FI2A 1JYNA 4AI2A 5IVVA 1PM7A 3CIHA 4KG0A 4UI9L 4Y20A 1LHOA 3SQOA 3CL1A 4MZUA 4PF1A 3SHRA 1RYYA 1ULCA 3VHOA 5FP4A 3WVJA 1HKDA 3K46A 5CFCA 1PZ7A 1RUC2 1GU3A 3C7OA 4NJ4A 2DDUA 3ZPYA 2GP5A 3AC0A 1MS4A 1OA4A 2VULA 2XHNA 3OY8A 1HXS2 4P5YA 3ZIXA 1G9DA 2XL7A 2RJ2A 1JYIA 4JCKA 2WIIB 4CVUA 2B9VA 2EIDA 4X6QB 4G9SB 2WN2A 4D0QA 1S2KA 1HJFA 2RM21 5A7OA 1GBGA 5FYHA 1JZ3A 3ORJA 2PHXA 4JVAA 4XXAA 3U78A 2ET1A 3AXDA 4BQYA 4M3CE 1BEV2 1ZRDA 4YW2A 2WNUC 1GP4A 2VBPA 4UFMA 3SMHA 1V00A 1DQ4A 2EIBA 4MGTA 1HX6A 1VAKA 3AP5A 5F3CA 1EUUA 1JYCA 4F83A 4IV1A 1GZTA 1H2MA 3AZXA 3NV1A 4QPIB 2BWAA 3WCRA 2VZRA 5AC92 2NZ9A 4R9AA 3BVCA 3WG4A 1DU3D 4YLZA 1UZ0A 4ASMB 3FHIB 4M4RA 4YW1A 2O14A 3B9IA 3H1WA 5DUXA 4Y5Z0 5IVJA 1AF9A 2WBKA 3IKWA 3OYWA 5GLUA 3JQXA 3L2YA 2KM2A 2WNUA 4PHZA 1Q5OA 4X8PA 3VKOA 2VNVA 2BPA2 5D1IA 1OH3A 1EPWA 2QBXA 4RHV1 2OQ6A 4Q8LA 1AJKA 2XJTA 3K77A 4KWJA 3C7HA 4XHBA 3KV9A 5CKQA 2DF7A 4K8RB 3ZYPA 3ZXAC 3ZDSA 3AL5A 2DU1A 4AFMA 1KEXA 4XQDA 5FYCA 2Z5WA 4NRMA 2WZ8A 3ZSKA 2WYSA 1XPWA 1QJX3 3RZZA 2W1WA 2IVJA 4YZ1A 2VNGA 3CLPA 4P9WA 4P02B 5F5IA 5GLVA 2VGDA 1OD3A 2WNEA 4FFGA 5J98B 2VG9A 3ZN4A 2XONA 3ZSEA 4FQ4A 4KL1A 4MGYE 2UWAA 4AQTA 5A3MA 5KHJA 4Y1XA 4YVWB 1F8VA 3BI3A 4KU7A 3R6SA 1AYM2 2Y60A 1JZ8A 3ON7A 2ZEXA 4PDWC 5H9SA 4Y1UA 1BXHA 2H6CA 4QB6A 2BZDA 3HPNA 3MO4A 3U37A 3OD0A 4DRRA 5C8CB 1YUDA 3PUAA 2FDHA 1W2OA 4MGQA 1W9WA 1ZZCA 1OOPA 2ZMKA 1W05A 1WMFA 4HMZA 3CJIC 1EAH1 4IGPA 3L9JT 4XFHA 2IXHA 2LROA 3NV4A 4H3WA 3I3DA 4WV8A 3SC7X 4PLMA 4AEJA 5IK7A 5FYUA 4JGZA 3IM0A 3I97A 4BE3A 2V4VA 1XNCA 1OD5A 4TLFA 5ANQA 4YVSA 2ZGLA 5JOWA 5EJ1B 4QB1A 5LWBA 1CESA 4IETA 3AVSA 1ZRFA 4HPKA 2I2SA 4HKOA 3VL8A 5JOZA 2IXIA 4YM3A 4ZU7A 2P2KA 4HKWA 4PDWA 1OKOA 3VGIA 2HWE2 2JKXA 2XBO1 3OTFA 4AI0A 3BPZA 2D6OX 1FV2A 5E8AA 5FZKA 3ZXLA 2XJPA 4CEYC 5C4WB 2ID4A 2ADEA 2BGPA 3MHZA 1F5FA 4GMP3 4EWDA 2CSGA 3CJIA 1GOHA 2Y6JA 4OHVA 1J83A 3TEWA 1WKYA 3S57A 1V70A 3J7MA 1A8DA 5JXIA 2Q0AA 5K0UC 4WVMB 3IDEA 1AXKA 3RMXA 2VXRA 4C8DA 5C3PA 1OQDA 3DGTA 3DEMA 4GH4C 4V1PA 1XQNA 4KWLA 1FMD2 5EYYA 3PJYA 2VZPA 3OF1A 4LA3A 3TEYA 5DG2A 4DMIA 1UCXA 2Q1FA 5DZFA 4YW5A 1OLMA 4QWNA 1JYXA 1WLCA 4FTSA 4EN0A 2UURA 1C4RA 3JBG1 1PO11 2BGOA 4LE4A 4LHSA 4A6SA 1LHUA 2PXJA 4WM8A 3RYPA 1SBFA 4IE5A 3WDVA 4Q4Y2 1X33A 3C7EA 5CFDC 2W46A 1RUF1 2OUHA 2JWPA 2D7FA 4O9GA 5KXCA 1KRIA 3BN6A 3CU7A 4XQ4A 3ZSMA 2A6WA 1MS0A 3GHMA 1ODMA 3NKTA 1ND2A 2PFWA 1F31A 4FI9A 1G9FA 4XAEA 3ZXFA 1D7PM 4G4FA 3POJA 4XJ9A 1CZSA 1BK0A 3TN92 4DINB 4LBOA 4AHYA 4QXBA 5FQ0A 4TTGA 2Y6GA 1UW8A 2RE9A 4AW7A 2J42A 3LPFA 1S0FA 4BQ1A 2EF6A 2ZZQA 2HBUA 2RMU3 3SCFA 1MS3A 3HEIA 5FXZA 3FX3A 1UOJA 2GU9A 2D6PA 3HNBM 5KXBA 4PCRA 2DUOA 1X7NA 2R043 5CFDA 3WF2A 1UD1A 4HZFA 4DY3A 3OPTA 4PJYA 5JOYA 2Q1MA 5CAZA 2VECA 3HJRA 1SMVA 4CP9B 3JUUA 1OHFA 5FYBA 5FP3A 1CX1A 3PUHA 1V6MA 2ERFA 5JMOA 2V73A 1W90A 3ZFGB 4N43A 2QQPA 2QDNA 3PU3A 4Y20B 2QDRA 3GALA 3HN3A 1PIV2 4IE6A 4PQQA 2I07B 4F8AA 2JEMA 3BU7A 5CZKA 2Y33A 3WG2A 4EZHA 1QNYA 1C8M1 1VBC2 2BWCA 4QX1A 4BQ5A 2B42B 5I0SA 1BLZA 3EMRA 3P1IA 5CIRA 3RWKX 4MVTA 4SLIA 2WZR3 1H30A 3FN9A 1XBFA 4S2DA 4YG6A 5J96B 1N1TA 3CEWA 1EPZA 3RZLA 4DEQA 2XLFA 1ZBA1 1MPXA 3VBUB 4ISRA 1O4ZA 2YUEA 1ST8A 2JDYA 5A7WA 3VZKA 1UOFA 2WNVA 4KGGA 1I5ZA 2HWC1 1DZTA 1I3HA 1RUI3 2DTYA 2W68A 4I09A 5FZ9A 4ZXEA 1SBDA 3RZGA 4QMAA 2QQVA 1PHMA 2VZUA 1H9WA 5JUVA 3CHXA 4QU2A 4CUBA 5FV3A 1ULOA 4LIUA 5F2SA 4A41A 4TZDA 1W06A 3JD72 3UYJA 1JYWA 2VOKA 1VMFA 4LO8A 1V6KA 4PIYA 4UW3A 3SXWA 4DB5A 1TQ5A 5ACA2 4CEWC 1RJ7A 1MZEA 1R093 4N53C 1NLQA 4F7ZA 5FXXA 5FJKA 3TNPB 4Z82A 3LPGA 2RG4A 4Q0SA 3ES1A 1RB8G 1IKPA 5T5PA 5F9TA 3U11A 3W9AA 1BBT1 2R32A 3AYDA 4A42A 1Z7S2 3TNQA 1YIFA 1CJDA 2FCUA 3C3VA 3OUJA 4XFIA 3UJQA 2ZX0A 1XU2A 4P9IA 1HRI2 2CGNA 2HWD1 3RYKA 4CUCA 5IFPA 1NXMA 1MVEA 1AYN3 1K12A 2QQKA 5FUNA 5ABJA 2HEWF 3IAPA 1LRHA 3GNEA 4XDPA 1RUJ3 1UF2C 3ZN5A 3BOWA 5KHIA 2GMMA 2NYYA 4AXOA 4ZONA 4W65A 1KQRA 2WO3A 3WUDA 1XJAA 2WNUB 4NIDA 3LB9A 2VMFA 3OBRA 4WZCA 4CEWA 2OVUA 4Q1RA 3PMSA 4KWUA 3OUIA 3B00A 3AL6A 1OKQA 3OG2A 4A44A 1FYUA 1R081 2VTFA 1HDKA 1QJU2 4R8HA 4TYSA 3CKHA 4YFWA 5ISLA 2QQOA 4LUMA 5JXGA 1U5ZA 2F6BA 2EAAA 4YG0A 1UXZA 3B94A 4XIKA 2K2SA 2ZEWA 1RVF3 1UO9A 2AACA 3H0OA 2QQMA 4TN7A 3N7MA 4I3PA 5A7PA 4OQ8A 2WSVA 1PGW1 3NNLA 5FYVA 4BIFA 3UL2A 3G7DA 1MZ6A 3TBDA 2FDFA 5IW0A 3VDBA 2YYOA 3VZLA 4RA0A 4XJZA 4QX3A 1VBB3 4CDUC 2YROA 4L99A 1RTVA 5EJZB 2ZEYA 4LBJA 4CCMA 1ASJ1 4UFKA 5DAQA 3MIDA 1JN2P 2YY1A 2VQ0A 1Y3TA 1ZX5A 3IBMA 2V72A 3W5NA 1VBE3 3WG1A 1RMU3 1REEA 1WW4A 3IDBB 4DPNA 3D0SA 1U0AA 1BMV2 1IKQA 1W8OA 4JX0A 4NOTA 4Q4X2 3E6DA 5JSPA 2J1VA 4XPVA 4XIOA 4DIQA 2IXKA 2XKOA 2HWF2 2DU0A 2VZ1A 5CU1A 4FPGA 2PN5A 1ZREA 1AX2A 3BB6A 1NZIA 2JXAA 1N47A 1DP0A 5FBJA 4JTNA 3P6BA 4CDUA 3K4DA 1E57A 4Q4V2 4LEJA 3THDA 3WDYA 5F3EA 3POWA 5HCHA 2BVBA 5J3UA 4AOCA 3MW4A 1KDMA 1PO22 1DGRN 3EQEA 3RVHA 3ZXKA 4BIOA 4Q1PA 5JI7A 2BQPA 1YLLA 2RDRA 1L3JA 2PMWB 1SACA 3N9LA 3VDAA 1UL9A 2HBTA 4D3WA 5C7GA 1UN1A 2WINB 3CJIB 3KF3A 5CG8A 2VTXJ 2P3JA 3ZMOA 2XH6A 1D0HA 4I30A 2DWRA 1W0PA 4FPEA 2IFWA 4QPWA 1W2TA 3FFQA 1M4WA 2VZ3A 4JZRA 1G6NA 3HVDA 1KS4A 1Q3EA 3FZ3A 3GZTB 3KS7A 2E9QA 3ME2A 4XMAA 4XJ8A 1FOD1 4AVVA 4EZ4A 4COUA 4LIVA 2I45A 4UF0A 1ZZ6A 4DQAA 2RM23 3N9OA 4QXCA 4AI8A 2JD9A 1GP6A 2YB7A 4Q0QA 3VUOA 1FNZA 4OUSA 4MHUA 3O1SA 1IQAA 1STMA 1WD3A 5FFOC 1AR91 1UAIA 3VBSA 1QOOA 1J3QA 3K48A 2QQUA 3O0WA 4LHNA 4XFAA 2HWB2 4CEYB 2DCYA 2V09A 1Q43A 4EJRA 1AR62 3W5MA 3VZJA 5FZ1A 5FWJA 4DOUA 5EPAA 1C1FA 3KSCA 4JV4A 3WUCA 1XNBA 5K0UB 2RJKA 4XBNA 5I0RA 1POV3 3JXSA 4D7TA 1QDCA 2R0HA 2VMCA 4LNVA 4CCNA 4GH4B 1LEDA 1OQEA 1JZ6A 2XWJB 3W59A 4JDMA 2MEV2 5FQ0B 3ATGA 3MGUA 2GC2A 5FYIA 4UXAA 1MEC3 1QQP1 5FMCA 2VOXA 5LZ6A 3ST7A 2BEOA 2ET7A 3VD5A 1RUH1 1XE0A 3RI8A 4NVPA 5G04L 1N1VA 1LGCA 1VRH2 3C7FA 4KQ7A 3RJRA 3VBRA 4K20A 3UNPA 1CPNA 2TUNA 1Q8PA 3ZXEA 3IPVA 4FOQA 5GLZA 2BNMA 2ORXA 1UMIA 4XURA 3AVRA 5FZ0A 2CHHA 4HSJA 5FZEA 3I49A 3UV9A 2VCAA 5IK4A 2B5HA 3GHNA 4BB3A 1LOEA 1HN1A 5EWSA 4OMDA 1R1A2 1VP6A 4UWDA 1KJRA 4GJYA 3MICA 1DQ5A 2VNRA 1RITA 4NAOA 4EN8B 2RR12 1RUD3 1MS8A 1NZCA 3IB3A 3NAPA 4E8CA 2RS11 3WP6A 5T3NA 1GP5A 4BU2A 2UYBA 1A8MA 1KXGA 3UGGA 4CUGA 2QCSB 5FY9A 1KD7A 1OH4A 2CV6A 3HOBA 4DNYA 1ZBE1 1JBCA 3O12A 5EIYB 2WC2A 2R0FA 2PHUA 3G6JB 3A7QA 1ULEA 2D5HA 1YWKA 4O7XA 3H7JA 1RUNA 5CB7A 4OI0A 4MXWB 1R64A 4FQZA 2BJSA 2D3PA 2A3WA 2Q30A 1QKQA 2ZGKA 3KM5A 4GKXA 4JRLA 3WOGA 5HV0A 3WP3A 3AZVA 4Y1ZA 3SCGA 1X8EA 1GWLA 3OGSA 2BFUL 3J8F3 1S2EA 1RL3A 3J26N 4EYUA 5LRRA 3DKQA 1VBA1 3OPZA 4FO9A 3ZOIA 1WMEA 1EUTA 1EAH3 1W99A 1F2NA 3H8XA 4LT5A 5DUWA 3E97A 5M0TA 2ETEA 4QPGA 4DY5A 1GQHA 1UPIA 3NNGA 1W9FA 3IDCB 1WA4A 5LEJA 1ZZ9A 4UFJA 2XLAA 1LCLA 4CDXC 5BY5A 2BYVE 1B09A 1HB3A 2YBSA 3N7JA 2IFRA 3I2FA 2HKXA 4LJHA 4WVVA 4GA9A 5EFUA 1TZOA 3PMEA 5IK8A 4NWVA 4KGQA 1YQ8A 4DO0A 1HRV3 2E6VA 5KBFA 2ATFA 1J1LA 5BPXA 4A7YA 1IPKA 5LBEA 1V6IA 4HLTA 5D8AA 1LJ7A 3M2MA 4QT6A 3H8UA 2ZCWA 3T3YA 1K5JA 2VOTA 4RS5A 1V9U1 1APNA 4CEWB 4MYEA 4XF4A 3HWJA 4N53B 3WV6A 1PK6C 1H8TA 1CAWB 1VB2A 2VMDA 3W58A 4AHZA 2CWSA 4QAWA 1Q56A 3LEGA 2IUWA 2R30A 3HBZA 1FATA 4CCCA 1RUC1 2ZGUA 1E5RA 3I8TA 2ZHMA 4QM9A 4TSVA 4UW5A 1U5IA 1WBFA 3A22A 3ZIWA 4CDXA 4AYUA 1SFYA 4L2NA 4CU8A 3RWNA 1NCQA 2YU2A 5JZGC 5FR3A 1GQPA 4OUMA 3ETPA 2WJSA 4IV3C 4XDQA 1JYTA 3NV3A 1W6MA 2D97A 2WABA 3OBAA 3V64A 3CBNA 4P9XA 3ILNA 2WDBA 4CXYA 4LBQA 2ZHLA 1ND3A 4XCAA 1A78A 2PA7A 2VZOA 4JDNA 4AGVA 4AVAA 3KHCA 4GWMA 3VN4A 1BEV1 4A2UA 1FX5A 1LEMA 4LO7A 1W8NA 3MFAA 4OZOA 4I01A 3T4HB 1SQ4A 4NR1A 1J1TA 5T54A 2C26A 1W9TA 4Z2WA 2QZ3A 4QX0A 3WF4A 1JH5A 2JIGA 4JKMA 5AC91 4IEUA 4RQPC 3ZFFC 3DYOA 3N7LA 3RRDA 1QJX2 1UMHA 3T0BA 1W6NA 1TG7A 3MLLA 4OVEA 3URFA 4IV3A 2JDNA 3LEMA 3QBQA 4K7JA 4HBNA 3VD7A 3WW4A 1Z78A 1UX7A 4AF9A 4D8MA 5A3NA 2P4EA 4K6BA 4XETA 5FXVA 5IYYA 2V4AA 4WZFA 2BFUS 2ZOEB 3VBOC 2WT0A 5FZDA 1CAXA 2VVFA 3KCXA 3AJYA 3U4XA 3HR9A 5EHDA 5A3LA 2HYXA 2IC1A 4ZZ5A 1H4GA 4OQ9A 4NIAA 1W2NA 1JTZX 2DVBA 3SNMA 4NAMA 4LULA 3PNAA 2D3RA 4RQPA 1D2SA 4NHMA 2PHLA 3OUHA 3J9SA 4RFRB 3DKWA 3KVAA 2HJIA 5FK8A 1NCRC 2VD7A 2DTWA 2XJVA 1GWKA 3PVNA 1YI9A 2MEV3 1W2UA 3BIWE 2OW4A 1VMHA 1ZBA3 1VB4A 2H0VA 4H2AA 3K3OA 4LBMA 4PI0A 3T2TA 2B4KA 5CKMA 4FXKB 2HWC3 4UF0B 4DXZA 2E31A 3VBOA 3T1MA 2W92A 2CDOA 3AYCA 3OB8A 3ETQA 1CWPA 4GB33 5CG9A 3VDDB 2VAUA 1H2LA 4IGQA 1JODA 3WINE 1US3A 4NIIA 2UWBA 2JG9A 3L2HA 4YGBA 3KT4A 2XKPA 2JDKA 2AH2A 3H1YA 2J1UA 5C3SA 3SH4A 1TNFA 2ZAHA 5H9PA 1E5HA 4E8DA 4XUTA 2WR9A 2ZGOA 2KA3A 3WEZA 1D4VB 1ENSA 3MIGA 4QXKA 1BBT3 1AR73 4UFHA 1W6OA 1Z0HA 1BJQA 1JU3A 1PMHX 1W8ZA 1US2A 1IS3A 4UW6A 5FTTC 4ATFA 1BK1A 4AK3A 5HCAA 4CTEA 1OA3A 2RS33 3VHRA 4HKLA 4KG8A 3BUCA 4D6QA 4L97A 1H2KA 1Y4WA 2FMDA 1MVQA 4JHTA 4JQRA 1ZRRA 2HWE1 5FP9A 2PHWA 2FQPA 1UZWA 5GJ6A 4B7KA 5JDBA 3I3QA 2EXJA 5BNPA 1RUE3 2JKBA 5FCCA 2E51A 5FZ3A 1MZFA 4N8MA 3ZLIA 1X50A 5FDBA 2WQZC 3F95A 2C9AA 4XACA 4IEQA 2CDPA 2P3KA 3C8XA 4UYBA 1O3SA 3KV6A 3T08A 2R061 4IV1C 2YHJA 2VM9A 3WZ1A 4M0NA 3CMGA 2RMU2 2PHTA 1A6CA 1NLRA 4BK4A 3KT7A 4NROA 5LK7B 1VIWB 3O1VA 2I74A 5FLJA 2ZPXA 3LIHA 4FTBA 3B93A 3I3EA 4OCTA 1PVXA 4KMQA 1D4M3 2GZWA 5IWFA 2R042 1S1AA 2DVFA 3N9MA 5EXOA 4EWEA 4CXXA 1GOFA 5FZOA 2OA2A 4XMIA 1VE0A 4J1WA 4Q4Y1 5C6CA 3ZR5A 2A6VA 2B7YA 5FPLA 1ASJ3 1YQ2A 2B46X 2G9FA 2LM3A 2XQRA 4KI5M 4XAAA 3S0MA 2HEVF 5HXMA 4FPKA 5FZAA 2ZJCA 1M06G 3SISA 1GNZA 4XDOA 1W8UA 3S5AA 4WVZA 3TN91 2XQXA 3ZMNA 2C6SA 1ZRIA 2WZR2 1TMF3 4IW3A 1HQLA 2W39A 5F6LB 1W3VA 5FO7B 1OQ1A 1U12A 4MX3A 4CA9A 5C3QA 2R073 1RUI2 1P8JA 3RFRA 3VBHA 3UJOA 1QXPA 1NOVA 3HQUA 5FLIA 1OI6A 3DF0A 2DVGA 3KGLA 2MPFA 1YIPA 2RDSA 1HQWA 3H7YA 3KQ4B 4P5HA 1BKZA 4A4AA 5I0DA 3MIFA 4MHRA 1Q8VA 3M4FA 4Z2AA 3IMNA 4IQPA 5EZWA 1R092 4QX8A 1PIV1 2VJXA 4B1LA 4DUWA 2P6HA 2RS53 5T55A 1YFXA 5FAXA 3ZYGA 2NP0A 3U1XA 2E53A 2WA3A 4NIGA 2YC4A 1VBC1 3AFGA 1BCXA 5IVYA 2EAKA 3WLUA 4CDXB 1OOPC 2ZACA 1ODNA 1QJY3 1TME3 2E7TA 1MQTC 5L7OB 4UFIA 4I0AA 4CU6A 4IDZA 5A7SA 3I2HA 2YXSA 1H9PA 3HNYM 1J84A 2QKDA 4JGZC 1AYN2 3GBWA 1QIQA 2VW0A 4YVSC 3TB0A 3K75B 1RUJ2 4QX2A 1AL23 1PGSA 4FPYA 3POGA 1UOGA 1O8SA 5FYMA 2KD7A 5A1AA 4RSUA 1IS6A 1WUVA 1DYOA 4XW3A 3VV1A 5LA1A 5AVAA 3JD71 3FLRA 4MGIE 1PK6B 1N1SA 3AYAA 5TSWA 4F3JA 5ACA1 5J1XA 3IN9A 5FUIA 1DHKB 4BCUA 4MG2A 1JU4A 4CU9A 1RUG3 4PIXA 2D98A 3O5SA 3RI9A 3LAGA 3K51A 4NIHA 1MQTA 2P34A 1O59A 2NM1A 3AK0A 3NSTA 1OXCA 3KV4A 4IESA 1QDOA 1YNAA 3K3NA 5JZGB 3BOPA 1HRI1 1RVF2 2DFBA 2GMPA 5A6XA 2ZX4A 4IV3B 3RDIA 1RJ8A 1SLBA 5FZHA 4V2VA 3N9NA 1PGL2 4LITA 3BODA 4QX5A 2YZ4A 1I9RA 1XXNA 3UKNA 4AGRA 1O3QA 5J09A 2WAOA 4DXSA 2DCZA 5KHGA 2C0ZA 2ZGMA 1GZ9A 1JZ4A 1VBB2 4KWKA 2WS93 1CAXB 5IVBA 2EXIA 2VO5A 3CDZB 3POIA 4QKBA 2DFCA 4CZSA 4WM8C 1SBEA 1O5LA 1CAVA 5FBZA 2WFF3 5FWEA 1K5MA 1OSGA 5FPBA 3OCPA 1CZVA 3ZFFB 1VBE2 1NX9A 2Y0IA 1RMU2 3HAGA 4K9SA 3VKLA 2ZGRA 2RS13 1ND2C 1Y7BA 3ZXGA 1UX6A 3CO2A 1GYKA 4YZ2A 3S7IA 1G7YA 3ZN6A 2WO1A 1LOGA 2VPVA 3NJZA 2VUDA 5APAA 4NHLA 1OC1A 1QGLA 5IATA 1ZA7A 3V0BB 2J1AA 3VBOB 4ARYA 5BV6A 2PHDA 3ZYHA 3USSA 4B29A 1UKGA 5FPAA 2W2IA 1QOTA 4EN6B 3VD4A 1B35A 2X05A 5A33B 4JTOA 4H7LA 4CDQA 4H7MA 2D40A 2F4LA 2QFEA 4YW4A 1N3QA 1MZ5A 2W08A 2R49A 4HN1A 1AVBA 1HJGA 4R9BA 3LZZA 4XABA 4D7YA 4QDRA 3FHQA 1XNTA 4JGYC 4N9IA 1NCRB 4N43C 4Q4W1 5K8SA 5LBCA 1BMV1 3KB5A 4Q4X1 3D8CA 1W6OB 3POBA 2EXHA 4RYDA 1W03A 1AX1A 2RM22 2WSUA 1DLLA 1O4YA 1JMUB 1RIRA 3OOXA 4RR3A 5D21A 1DYKA 1GZWA 1DIWA 2YC0A 4Q4V1 2WQ8A 5DXDA 1WLWA 2XWBB 1QEXA 3MV11 2WNVC 3ZXDA 4J6GA 1PO21 2J22A 1BVVA 3K4ZA 4UFLA 1V9U3 4XF1A 2JENA 4ZXKA 2G4IA 3QH7A 4LKEA 4RD7A 5FZ4A 2VVDA 3I7DA 3A23A 1NKGA 3LEKA 4WM7A 2G1MA 4Y1YA 3N9PA 3E1F1 1S0BA 4JGYA 3TEXA 1UY2A 2ZKNA 4W4ZA 1C57A 1JW6A 2VQUA 4UBGA 5LCWL 1NYWA 1YYNA 5CA6A 4LBNA 4AFDA 1IS4A 1WW6A 5FZ6A 3N9QA 5KHHA 3A0NA 4CE8A 4IE4A 2WLQA 5CFCB 5KXEA 3B3QE 4E2GA 1DGLA 1MEC2 4C91A 1W2AX 3OY8B 1PZ9A 1W0NA 3PUSA 4QQHA 3K4AA 1DLCA 1DG6A 2PAEA 3GXUA 3I3MA 3O1MA 4BMBA 1O7FA 2ZHNA 2HEYF 5JXJA 1Y9GA 2NMOA 4S2GA 4QDQA 4LUKA 5ABJC 3WNMA 4QKFA 4JAAA 2HWB1 4AWDA 2D43A 1AR61 3OEAA 5F5QA 4BXFA 4E9KA 5T52A 2R1DA 1IZ3A 4BLIA 5AFEA 5CEHA 2WZPP 3BIEA 4TWTA 4MGKE 4BQXA 1YFWA 3KV5A 3JB8A 5CNAA 4HK9A 4A3XA 2QE3A 1RXGA 2O8QA 5BNOA 1AR81 3ZYIB 1PVC1 4IV1B 2XXZA 1RUD2 1UY0A 2VXJA 3QLQA 4NN0A 3WHUA 4CXWA 1FNYA 4PIZA 5LRSA 4ZU4A 3OGGA 3KT1A 2ZGSA 1LESA 2BDRA 4B3NA 5FMOL 1F5JA 4ZKTB 2AC1A 3H9AA 4OHZA 2TEPA 5HBAA 4EN9B 5FY5A 3MUZ1 4XXPA 4M0HA 5LBBA 2BNNA 2YPDA 2A70A 1OLQA 2OQ7A 4DEVA 3WXPA 3BU0A 1O91A 3OYWB 2JDHA 1NXD1 4RGKA 4GXLA 3LQCA 1V0AA 1O3TA 3WQBA 2E7AA 3S5QA 5IK5A 3J8F2 3KGZA 1VPHA 3C2UA 1JHNA 1CIWA 1UU5A 1EAH2 1R1A1 3RSJA 5BNNA 3GZAA 5JR2A 5L7OC 4Q26A 3S7EA 1W8HA 2VH9A 3H8RA 4NRPA 1G9BA 3IT8A 2RR11 2PELA 4M3CA 3SEEA 2YC2A 2D44A 5FP7A 3EXUA 2W1SA 4M01A 3WQ1A 4AQSA 4XF9A 2B45X 2R1BA 3NNMA 4YGEA 1CZTA 5IUQA 5HPOA 1YEWA 1A34A 1EV13 1LHVA 1HRV2 3AB0A 3T2PA 5FZBA 3WDWA 4B8EA 1AZDA 4BDVB 1FPN3 5EQUA 1UQXA 2A7AA 2W87A 4YSFA 5JSRA 2PYTA 2VUAA 4Q0PA 3HT2A 1LGNA 2CGOA 1VBD3 4HVRA 4B4RA 5JXHA 4BLJA 5DDJ3 1JYVA 1GZCA 2PLV3 3DECA 5C71A 4P9GA 4L0PA 3HMYA 4XEZA 2EIGA 5FKCA 3GBGA 3A4UA 5LK5A 3ZSJA 1OVSA 4ZPIA 1XE7A 4DRVA 2WWSA 2Y38A 3ZFEC 4FXGB 1RHI3 4FT8A 4LK6A 4NHKA 1OOPB 3WSOA 4Z8BA 1MQTB 3WNXA 2XJSA 3GGLA 1SCRA 1ZVFA 3MYXA 3JCIA 4JGZB 2Y26A 2RDQA 3QCWA 4GD4A 4YVSB 5GZFA 4QB2A 4AAPA 4Y22A 1PMJX 5CISA 3M70A 3QACA 4TLGA 3R05A 2R6QA 4IE0A 2VMEA 5SV8A 2LUWA 5JSOA 5JLVA 2CNAA 3WT3A 4HPKB 2EXKA 5H9QA 4RFT0 4FPOB 3WCSA 2CAVA 4PDWB 4GJZA 3NKGA 5A7QA 3T09A 2WO7A 2JG8A 3I54A 1IQDC 4OHWA 4ASLA 3ES4A 3VBSC 2BGCA 2O0OA 2JB4A 3ZSLA 1WLTA 1XB9A 5BXXA 3THTA 5GZGA 2GNMA 5FMOS 4LKDA 5HCFA 2XDVA 2R063 2JJ6A 4COYA 5C70A 4XUOA 4JRAA 2GP3A 1DQ1A 3HN1A 3O0XA 3OPWA 4P08A 4AHXA 2W1QA 2Y6KA 2D6KA 4ZU5A 3FUOA 4I02A 4Q27A 2GALA 4D7SA 1ZZBA 1COV1 4LO6B 2BOIA 3GF6A 4B4PA 1G9AA 3GCXA 4O61A 1J3PA 2NLRA 2RV9A 1YJLA 4CCLA 2K9ZA 2WL1A 5FZMA 1HV0A 1EP0A 3HD8B 5FYYA 3WHTA 1JS9A 1W39A 3AKSA 1W6QA 5IHRA 3VBRC 4WM8B 4DFSA 2ZGTA 4E2SA 1E5IA 2A5ZA 3AFKA 2YBPA 4QQPA 3RNSA 2WA4A 3D3AA 1AX0A 5HCBA 3GJAA 3IMMA 3TYJA 2A75A 2YFUA 1S2BA 3AKQA 3Q8BA 5F8PA 1ND2B 5BUVA 4X8NA 1QJX1 2JD4A 1W8WA 1LHNA 2WQ4A 4YM1A 4C0HA 1ZBA2 5A7NA 1TEIA 2BOJA 2PAMA 3NAPC 3ACGA 2HWC2 1OLRA 3BALA 3IWZA 4K8FA 4JHZA 4GB32 3GJBA 4QHZA 2VZTA 5LBFA 2P37A 3KCCA 5CFDB 2YU1A 4HOOA 4LA2A 3VB9A 5DMYA 1J3RA 3NV2A 1HN0A 4DUVA 4RHV3 5FK7A 1GSLA 3NL1A 1H8VA 1ENQA 3N35A 3QOPA 3FHAA 4JGYB 1G9CA 4AZZA 4N43B 2VUCA 4AFAA 1F35A 2JE9A 4AEDA 4L11A 4XUQA 1OURA 1BBT2 2WZEA 1AR72 4BJ0A 2VU9A 4XJUA 3U0ZA 5EV7A 3ACHA 2LRPA 4QPGC 4P9LA 1IPSA 2TNFA 3U75A 2VQTA 3PIGA 3RS6A 1GFF2 1CQ9A 2RS32 4LKSA 3HQRA 1X9TA 5EYXA 3I59A 3FWEA 4CRQA 5A6ZA 3MV01 3HIFA 2FBEA 2OZJA 3LEIA 5A7WB 2RDNA 1W0OA 2WNVB 1QH7A 4C1WA 1NY71 4E4ZA 4M3CF 4XTMA 1EYBA 1SDWA 3NJYA 2ZGNA 4FTEA 4GMP1 4META 5F6KA 1RUE2 5DAWA 3O1UA 4D69A 4XF0A 4QDSA 5D8AC 1G86A 1SLTA 3MDPA 4B7EA 2AR6A 3AMQA 4RS5C 4J25A 4BZ4A 3WX5A 1DGRA 1H8TC 4BYYA 4B4QA 4ARXA 1YQCA 1YC61 2EA7A 1LB2A 5HV4A 2BV4A 3BYWA 3PJQA 3KD4A 3LD8A 4PLNA 1DCSA 3T1LA 2FDGA 1PGW2 2AZ5A 4XFCA 2CL2A 1C5HA 1D4M2 1KJLA 4IEZA 3B5LB 2MNGA 3CZUA 2IXLA 3PHMA 4TXWA 4AI9A 1NCQC 4BQ3A 5A32A 5ABJB 1CVNA 1O8PA 1OUXA 1Q8QA 2XBO3 2Z79A 1QJEA 1XNAA 1ASJ2 1RINA 4Q5OA 1ND3C 1J58A 2VZQA 3BGAA 1U5XA 4QPIA 5IVEA 3MF6A 3Q9OA 2ARCA 2JDPA 2L9LA 1VR3A 2UU8A 1DFQA 5L36A 4BK5A 3F2ZA 4XJWA 5T5LA 5F5AA 2A1XA 1VMJA 3PUIA 3M3CA 5A70A 1JUHA 4KNCA 4XC9A 4IUGA 4XE9A 4CP0A 2ILMA 2JDMA 3MFCA 2ZX1A 2VMHA 3FMGA 1TMF2 1DQ6A 1HB4A 2RMU1 1XOYA 1JOJA 2FDJA 3NMBA 5C8WA 1HXS1 2Q8DA 2ENRA 2XLGA 1XYPA 4UW4A 4FPLA 3NQHA 4HN0A 2R072 4Q2FA 2WWJA 2R041 4IERA 4BHPA 5C3RA 5IVFA 3MI8A 4GKYA 3JBG3 1PO13 3ACIA 1ULGA 4FSJA 5FZLA 4E4DX 3LE0A 4XQWA 2BRTA 4LPLA 1GMMA 3MIHA 4QU1A 2ZAAA 2CY6A 1DGWX 4Y4RA 4AEMA 2G19A 5FIXA 3MLJA 3GCWA 3ZVXA 1RUF3 5CBLA 4NWWA 4AVTA 5DUUA 5C9AC 3O1RA 2D6MA 1CIYA 3B01A 2RS52 4MLOA 1TE1B 3FLTA 3M3QA 1S55A 1MS5A 4NHYA 1CPMA 4Q4W3 1LR5A 3BTZA 1FXZA 1QJY2 1TME2 2WZR1 2GH8A 3LDRA 3PTYA 4EN7B 4ZZ8A 2HH9A 1OFSA 5FMBA 1PM4A 5FY4A 4JDOA 1I5PA 3PVOA 4FFHA 2DYCA 1HQNA 1SCSA 2GSYA 3DPRC 1AL22 1WBLA 2ZBJA 4YG3A 5FUPA 4FBFA 2PAKA 5C8CA 3DV8A 1QMJA 4EQVA 5FPUA 4QHBA 4CDUB 3VKNA 5C9AA 3POFA 5C4WC 1DQ0A 5I93A 4GZ9A 1VAMA 3AP7A 4K1ZA 1LODA 1R091 2G9GA 4E4HA 4E2QA 1N3PA 1RUG2 1PX4A 3ZFEB 2JG9C 4HG6B 3M1HA 5EJ3A 2JDAA 3ELNA 2K46A 1C8M3 1KFUL 3N3HA 3LDBA 3Q8AA 1OF4A 4MGSA 5C3OA 1Y9QA 2VE1A 4KH9A 2B39A 5F3IA 3M7AA 3B02A 1AYN1 2WN3A 3DPRA 4WVWA 4Z92B 2JB8A 2R7EB 3RZHA 3IAQA 3ACFA 4AQ2A 2OT7A 3VLBB 1WCQA 3JQWA 1AJOA 1C5IA 5FYTA 1KDKA 5C4WA 1AYM1 1VALA 2DCKA 1GV9A 2WS92 2D3SA 1QJZA 1K45A 2XG3A 2ZXQA 1XYNA 5LW9A 2ZGPA 4CDWC 4M4PA 1W6QB 2SLIA 3VBSB 1H6XA 1LOAA 2FDKA 1V6OA 4YW3A 3I2OA 2WFF2 4WVMA 3T4VA 4DZGA 3RJ2X 4EROA 4EE2A 4XCBA 4BH9A 1AR83 1WW5A 4URAA 2FHRA 5BNPC 5DAPA 3U14A 1REFA 2RS12 3THCA 3PUQA 2YGMA 4GULA 4CYDA 3HBKA 3LSEA 4NE9A 3I2KA 4QXHA 4COVA 5KWRA 3WNKA 5JWPA 1W6PA 1GANA 2Y6LA 4GWNA 4HL0A 5FOJB 5LEKA 3A21A 4LLFA 3J4UH 1YRZA 4MUVA 4AGGA 4ES8A 4XBQA 5FZIA 3TAYA 3I2DA 3ZDVA 2HWD3 3BKZA 1PGL1 1Y9MA 1W3XA 1JZ2A 2W91A 2JE7A 5A1LA 1O4TA 4IL7A 3B9CA 4CDWA 1IS5A 1VBB1 3P5BA 3VBRB 4ZY9A 1AXZA 3NRUA 3UKTA 1H2NA 3FC0A 3GDBA 3T30A 3IPVB 1ULDA 5F7UA 4HXCA 2P6CA 1D2QA 3ZFGC 5A6YA 1OPMA 3PU8A 1JZ7A 2ZGQA 4YGCA 4Y1VA 3UT0A 1R083 1ENRA 3E5QA 1VBE1 3ZYJB 3H8OA 1MR5A 1RMU1 5DZEA 1SFNA 2ARBA 1YO8A 4FP2A 4YPJA
chains in the Genus database with same CATH topology
4MV2A 1MS1A 3GZUC 4HANA 5K9YA 4LHLA 3ILRA 3NAPB 2AYHA 1FMD1 4N7IA 3VBUC 1ZZ7A 1S0IA 1YJKA 4KU8A 3MPBA 1RUOA 1A3KA 3ALQA 1OFNA 5GLTA 2VOVA 4Q0VA 3ZFGA 1V9U2 5BNQA 5E89A 2QJVA 3CF6E 3VBHC 5I8YA 3U07A 2N7GA 5J37A 1UPSA 5GZEA 3VKMA 3H3ZA 3JB4C 5FPZA 3ZYRA 1NE4A 5T50A 1X82A 4AVCA 4FAHA 4L8QA 4AFBA 2PHRA 4UBHA 4QPGB 4GALA 3VBUA 1QU0A 2OIIA 1KITA 5GZCA 5HXVA 3AP6A 2VNOA 4L92A 1ENXA 5JCTA 2IXCA 5A32B 4AI3A 2ZMNA 1C3HA 4GMP0 3LSDA 1YFYA 4QGLA 4OI2A 1H4HA 4OZXA 2Y0OA 5KXDA 5I0UA 2ES3A 2XUMA 5D8AB 4P9JA 3WDTA 1H0BA 4R9DA 4NPRA 4RS5B 1POV1 5T5OA 3THPA 1V6NA 4K1YA 2IWGB 3AX4A 1H8TB 1AHSA 4LBLA 2OZ6A 4XFFA 2O1QA 1VAVA 4J1XA 2ZTNA 4XYXA 5T5JA 1MEC1 1SLLA 5C33A 4I2OA 1FOD3 1PZ8A 2EALA 1SLAA 1COV3 1NCQB 1RGSA 2PHFA 2YV8A 3GYDA 3O0VA 4AEKA 2IZWA 1W6MB 1AUYA 1WCDJ 1N3OA 1AR93 1CD3G 4LBQB 1ND3B 1X8MA 5B2GB 3VZOA 4XILA 1UMZA 1BYHA 4BOWA 2X5IC 2WLPA 2ZKLA 1RUD1 1O5UA 2SBAA 2VQAA 1YXWA 1K5MC 3R4SA 4YZ4A 1UU4A 4M00A 1WGPA 1Z7S1 4FCAA 5BYNA 1W6NB 1QQP3 1EV12 2HYKA 1RUH3 1FPN2 1LOBA 2Z2SB 1VBD2 5DDJ2 2D6NA 2PLV2 4N90A 1QXRA 3J8F1 1XRUA 1REDA 4BM8A 5C9AB 2XVGA 1NA1C 2X5IA 4PBOA 1B35C 2R16A 3QH6A 4CDQC 1QJU1 4YZ3A 1RHI2 2QZ2A 4RQPB 3PLQA 2GC1A 1JXNA 4OULA 4LE3A 1Y43B 2WT2A 5DUVA 4N9HA 3V0AA 1ZBE3 5E16A 3DPRB 3AP4A 3TOJA 1HRV1 3NWKA 1UIJA 1U5YA 2AENA 1WCKA 1CN1A 2ZA9A 2FZ2A 2E7QA 2Q5TA 3MEPA 1NA1A 5JMCA 4RR3C 3ZXJA 2WFPA 3D4KA 1O3RA 2YDEA 1JUIA 4IEVA 4XHXA 4PBPA 2A6XA 2JG9B 2UY8A 1VBA3 3LA2A 4W6WA 1ULFA 2C5DA 4WM7C 2R062 3FBYA 1QOSA 2NPIA 2EVXA 3RMYA 4ONUA 4Q0UA 3WDUA 1S0DA 2CGPA 3TWIA 3ASIA 5CVRA 3WDXA 1DF0A 1W6PB 3VZNA 4W6YA 5I91A 2XB6C 5FO8B 1S0JA 4RGGA 1IHMA 4JC1A 2A3YA 3MF9A 2HWF1 2W0XA 4XOGA 3UKVA 5JOXA 1C8NA 4CEYA 1XNKA 3R0RA 2X29A 4CDWB 4HSLA 1PNGA 2H0BA 3JU9A 4QQ2A 5K0UA 3WY6A 2ZZJA 1CAUA 3APBA 3WQ7A 3AKPA 4XZPA 5BNPB 4GH4A 2ZS6B 1GICA 3H3UA 1D0GA 2QUOA 2UYAA 4R52A 1LTEA 4PQ9A 5AVPA 1HLCA 1RUC3 2A6YA 1TNRA 3CJXA 1YI7A 1QH6A 2ZX2A 5BNOC 1HXS3 2A73B 4O9EA 1QWRA 4QQLA 1LU1A 2K0GA 2XVKA 3RQ0A 3DUIA 4URTA 1UZZA 4MGZE 2XJRA 4SBVA 5L73A 2VW1A 4AVBA 4RGAA 1WLDA 1BEV3 1DZRA 4FPFA 1VJ2A 5E1RA 4RHV2 4YNIA 4C0BA 3R4DB 4NO4A 5AC93 3AXEA 1HV1A 4CP1A 3WW3A 5BNNC 3MW3A 3P3PA 5GALA 1QF3A 1LKNA 2MEV1 1T6GC 2Q1ZB 2GNDA 5JPMB 3D82A 4MXWA 4GQ7A 2XJQA 4Q29A 4GB31 1DZQA 4AI1A 3NO8A 1VRH1 4YM0A 3FLPA 2D93A 4BWOA 4H14A 4PLOA 3WD5A 1QXJA 3INAA 3VBHB 4OLLA 3E6CC 4HFSA 5SV5A 1HW5A 1XU1A 4OHXA 4E27A 3N36A 3HQXA 2TBVA 2GH2A 5FO9B 3GBFA 4YM2A 3ZO0B 4YFZA 1BQPA 1AR71 4ISQA 4S2FA 3SH3A 2DURA 3MLKA 4I3GA 3H1MA 1CONA 2RJLA 1NE6A 3VBFC 4P9YA 4AHWA 3AZWA 5H9RA 2RS31 1S0GA 3LA7A 3MIBA 3AMHA 1ALYA 1LOFC 5I8SA 3VHNA 4LHKA 1AYM3 3ZX7A 2XBO2 1I1EA 1GLHA 5DZGA 4N53A 4Z07A 1DQ2A 1CAWA 2XVLA 1RUE1 1SLCA 1POV0 4ORFA 2BTVC 2UWCA 4XJAA 4XFBA 2VOWA 4IXLA 4S2HA 5GZDA 1CJPA 1XE8A 3USUA 4EWAA 2MHFA 3AJZA 1IPJA 2JG8C 4Q8KA 4D94A 2CAUA 3VBFA 4ATEA 5IT6A 3O14A 4I0BA 4L9BA 4G3YC 4COZA 1LENA 1LOFA 3D5OA 4MH0E 4YGDA 3EO6A 1D4M1 2OYZA 3JBG2 1PO12 3KMHA 3N4MA 3SH5A 2DV9A 3E6BA 3JZVA 2CWMA 3AP9A 2HWE3 2XJUA 4Y24A 1ZYBA 1RUF2 3UK9A 3NVCA 5K7PA 3V65A 3KZ4C 2A3XA 2A6ZA 2UY9A 2X5IB 4E4SA 1DDLA 3EJKA 3N7KA 4Q4W2 1CAVB 4FOWA 1K5MB 4LLOA 2DVDA 4FPHA 1TMF1 3KCYA 4MSVA 1FMD3 4Y26A 1Q8OA 2YPJA 4K21A 4LTAA 1NG0A 1OMIA 3ZN6B 1S0CA 3VZMA 3V0AB 2R071 1DYPA 3VKFC 1LOCA 2WKKA 5CADA 5KHKA 2PTMA 4YYOA 3VDDC 3VHPA 2Z69A 3S6PA 3FE5A 1G8WA 4Q4Y3 4K40A 4LBQD 1NA1B 2ZABA 4AFCA 3E5XA 2DVAA 3WQ0A 4YARA 4HVOA 1B35B 4IEOA 1EY2A 5DG1A 4CDQB 1ZM1A 2OUJA 2RS51 1IGOA 3MIEA 3VL9A 2C1FA 1R1ZA 4GIQA 5J48A 3FFZA 1VLNA 2NN8A 1UIKA 4HETA 1C8M2 1QJY1 1TME1 4R4XA 3TN93 4AYUA 1FT9A 3PVEA 2GMEA 1UKRA 2OPKA 2XPJA 4I0WB 4C90A 2VY0A 4BMEA 4AE2A 4YZ5A 4AEDC 2XL9A 1ONAA 1NLSA 3ILFA 4HK8A 3OJBA 1AL21 3VDDA 1AXYA 3E5UA 3P3NA 5HI0A 2FZ1A 2VW2A 3WP5A 4YRDA 1NQDA 1C1LA 1H1AA 4RR3B 3SCHA 1GZWB 2Q4SA 2YGLA 2BNOA 2VVEA 2GNTA 4IEPA 4AVSA 1HIXA 3M3OA 1MACA 2GC3A 1F9KA 2AGSA 2DCTA 1QHDA 1RUG1 1CAUB 2JDZA 1AR82 1PIV3 4WM7B 1PVC2 2JX9A 4R9CA 4MXVA 4FAGA 3KLSA 1AL0G 1VBC3 4XBLA 4A7ZA 2DCJA 1UZYA 4FPJA 3B69A 2HWD2 2ZHKA 5E88A 3LGRA 1YFUA 4COWA 1C28A 1LHWA 4ES9A 2VUJA 4FPCA 1QY4A 2BBVA 3AMMA 2ARXA 4P14A 2WS91 3WG3A 2ZMLA 1WMDA 3ECQA 4HT1T 3LOIA 3S30A 1H1IA 5F1RA 3JD73 1LULA 3I4IA 3ROUA 4DS0A 2WFF1 5ACA3 5KC5A 3CNAA 1R082 4INDA 2GAUA 3EBRA 3FBMA 4BPZA 4QQOA 1GNHA 2YMZA 4QPIC 1DBNA 1X36A 2V5YA 2AREA 3OBTA 5BNOB 2RHPA 5JIAA 1SEFA 1Z7S3 4FP3A 4N7UA 1OA2A 2AUYA 2D6LX 1IOAA 1XYOA 1HRI3 1CX4A 5J7MA 3SLIA 2CTVA 3RG0A 2XGXA 3B7MA 3WR0A 1FV3A 2VMGA 2O8OA 2VMIA 3D6EA 4OI1A 2QNKA 2DUPA 2BVVA 4LO5B 2X53S 2Z42A 1PMIA 4C1XA 4EV0A 3ENRA 1QJU3 3LWCA 3A0KA 3BCWA 3PVBB 4Y4YA 1GQGA 2A71A 1Q8SA 1WCSA 5BNNB 5JR7B 2B8MA 4A7KA 2NQYA 2ZX3A 3O7OA 4X6RB 4K3UA 2WT1A 4M3CB 5GLWA 4XF3A 4LBKA 2W52A 4QPYA 3X29B 5I8TA 4IEYA 3IIAA 3M3IA 3V56A 4YVWC 1MS9A 2GDFA 4WBBA 4AQ6A 3RYRA 3AMPA 4AG4A 5GKAC 3POSA 2P3IA 1BZWA 3MW2A 5J36A 1I6XA 2F4PA 1OPOA 5L19A 2QVSB 1CR7A 1LECA 5C8CC 3M3EA 2GN3A 3LCPA 1URXA 3TRSB 3AZZA 3USUB 5L7OA 4H55A 3M8LA 4OI4A 3DL3A 3VBFB 5FLHA 5JIUA 1J59A 4Q4X3 3AKTA 4QGMA 1FOD2 2BUKA 4FOYA 4U36A 1COV2 2GNBA 2HWF3 3DN7A 4YVWA 1DGWA 2IXJA 2NMNA 4R4ZA 4Y22B 3MZHA 1RUI1 3FJSA 3AM2A 3D0JA 4Q4V3 1AR92 1PK6A 5JAXA 4XFGA 3LKJA 1S0EA 1PO23 4FVVA 3OD4A 1WD4A 3WW2A 5FREA 2B9UA 2JG8B 5GM0A 4QM8A 5JZGA 2GC0A 1RC6A 1NQJA 3KQRA 3AZYA 4OHYA 1WW7A 1QQP2 4PF5A 3H50A 1RUH2 1V6JA 1FAYA 5JVVA 5FOBB 2KXLA 1RUJ1 1KFXL 4BA6A 1CGPA 4QGNA 1SLIA 2HWB3 1H1MA 1AR63 2Q8OA 4KBBA 4Z1VA 2JICA 3AKRA 3ZFFA 2FMYA 3WP4A 4ITCA 2D5FA 3AMNA 4U2AA 3SITA 1ZZ8A 1PVC3 1PNFA 3ACLA 1ZNPA 1LGBA 3LA3A 2H6BA 3V0BA 2JECA 1ZBE2 1RVF1 1EV11 3NW4A 2XHKA 4LO4B 1FPN1 3POYA 1GKBA 4W6XA 1ZA4A 1VRH3 1GR3A 2DUQA 1VBD1 1NY72 5A33A 3BTAA 4IEWA 4OFGA 2PLV1 2E63A 4IEXA 4QD2A 5DDJ1 5KC6A 2BW8A 1XNDA 2CYFA 3WW1A 2X8KA 5I0TA 3OGJA 3QD6A 1VBA2 3EHKA 5JPNB 1NCRA 1ZRCA 5JI9A 1BVP1 1R1A3 2LTNA 2PQQA 1RHI1 1UU6A 4CP2A 1YCIA 2P17A 4LR4A 1LU2A 2RR13 5FPXA 3HT1A 3FUQA 1KS5A 4FOVA 5CFCC 4AEDB 4RL7A 1N1YA 2GN7A 2LALA 5FRAA 3LOBA 1YHFA 3U10A 4XTPA 3MPPG 3AYEA 1V6LA 5AFBA 3R4UA 3I59B 1QNWA 1FI2A 4AI2A 1PM7A 4KG0A 4Y20A 1LHOA 3VHOA 3CL1A 4MZUA 3SHRA 1ULCA 3WVJA 1HKDA 5CFCA 1PZ7A 1RUC2 3ZPYA 3OY8A 1MS4A 1OA4A 2VULA 3ZIXA 1HXS2 1G9DA 2XL7A 1JYIA 4JCKA 2WIIB 4X6QB 4G9SB 1S2KA 2RM21 1GBGA 2PHXA 4JVAA 4XXAA 2ET1A 3AXDA 4M3CE 1BEV2 1ZRDA 4YW2A 2WNUC 3SMHA 1V00A 1DQ4A 1HX6A 1VAKA 3AP5A 1JYCA 4F83A 4IV1A 1H2MA 3AZXA 3NV1A 4QPIB 2BWAA 3WCRA 5AC92 2NZ9A 4R9AA 3WG4A 1DU3D 4YLZA 4ASMB 3FHIB 4YW1A 3B9IA 3H1WA 5DUXA 4Y5Z0 1AF9A 3IKWA 3OYWA 5GLUA 3JQXA 3L2YA 2KM2A 2WNUA 1Q5OA 4X8PA 3VKOA 2BPA2 5D1IA 1EPWA 4RHV1 4Q8LA 1AJKA 2XJTA 4KWJA 4XHBA 3ZYPA 3ZXAC 2DF7A 3ZDSA 2DU1A 4AFMA 4XQDA 2Z5WA 3ZSKA 1QJX3 3RZZA 4YZ1A 2VNGA 3CLPA 4P9WA 5GLVA 2VGDA 2WNEA 5J98B 2VG9A 3ZN4A 3ZSEA 4AQTA 4FQ4A 4KL1A 4MGYE 2UWAA 5A3MA 5KHJA 4Y1XA 4YVWB 1F8VA 4KU7A 3R6SA 1AYM2 5H9SA 4PDWC 4Y1UA 1BXHA 2H6CA 3OD0A 4DRRA 5C8CB 1YUDA 1ZZCA 1OOPA 2ZMKA 4HMZA 1WMFA 3CJIC 1EAH1 3L9JT 4XFHA 2IXHA 3NV4A 4H3WA 4WV8A 4AEJA 5IK7A 4PLMA 4JGZA 3IM0A 4BE3A 1XNCA 1OD5A 4TLFA 4YVSA 2ZGLA 5JOWA 1CESA 4IETA 1ZRFA 4HPKA 2I2SA 4HKOA 3VL8A 5JOZA 2IXIA 4YM3A 4ZU7A 2P2KA 4HKWA 4PDWA 3VGIA 2HWE2 2XBO1 3OTFA 4AI0A 3BPZA 2D6OX 1FV2A 5E8AA 3ZXLA 2XJPA 4CEYC 5C4WB 4EWDA 1F5FA 4GMP3 3CJIA 4OHVA 1V70A 1A8DA 2Q0AA 5K0UC 4WVMB 3IDEA 1AXKA 3RMXA 2VXRA 1OQDA 3DGTA 4GH4C 4V1PA 1XQNA 4KWLA 1FMD2 5EYYA 3PJYA 3OF1A 4LA3A 5DG2A 4DMIA 1UCXA 4FTSA 5DZFA 4YW5A 1WLCA 4EN0A 2UURA 1C4RA 3JBG1 1PO11 4LE4A 1LHUA 4WM8A 3RYPA 1SBFA 3WDVA 4Q4Y2 1X33A 5CFDC 1RUF1 2OUHA 2D7FA 4O9GA 5KXCA 1KRIA 3CU7A 4XQ4A 3ZSMA 2A6WA 1MS0A 3GHMA 3NKTA 1ND2A 2PFWA 1F31A 1G9FA 3ZXFA 4G4FA 4XJ9A 4DINB 3TN92 4LBOA 4AHYA 5FQ0A 1UW8A 2RE9A 4AW7A 4BQ1A 1S0FA 2EF6A 2ZZQA 2RMU3 3SCFA 1MS3A 3FX3A 2GU9A 2D6PA 5KXBA 4PCRA 2DUOA 1X7NA 2R043 5CFDA 5JOYA 1UD1A 4HZFA 4DY3A 4PJYA 2Q1MA 5CAZA 2VECA 1SMVA 3JUUA 1OHFA 1V6MA 2ERFA 2V73A 3ZFGB 4N43A 2QQPA 2QDNA 4Y20B 2QDRA 3GALA 1PIV2 2I07B 4F8AA 2JEMA 3BU7A 3WG2A 1QNYA 1C8M1 1VBC2 2BWCA 5I0SA 2B42B 5CIRA 4MVTA 4SLIA 2WZR3 1H30A 4S2DA 4YG6A 5J96B 1N1TA 3CEWA 1EPZA 2XLFA 1ZBA1 3VBUB 4ISRA 2YUEA 1O4ZA 3VZKA 2WNVA 4KGGA 1I5ZA 2HWC1 1DZTA 1I3HA 1RUI3 2DTYA 2W68A 4I09A 1SBDA 4QMAA 1PHMA 1H9WA 4QU2A 4TZDA 3JD72 2VOKA 4LO8A 5ACA2 1V6KA 4PIYA 4UW3A 3SXWA 4DB5A 1TQ5A 4CEWC 1RJ7A 1MZEA 1R093 4N53C 4F7ZA 3TNPB 4Z82A 4Q0SA 3ES1A 1RB8G 1IKPA 5T5PA 5F9TA 3U11A 3W9AA 1BBT1 2R32A 3AYDA 1Z7S2 3TNQA 1YIFA 1CJDA 3C3VA 4XFIA 3UJQA 2ZX0A 1XU2A 4P9IA 1HRI2 2CGNA 2HWD1 3RYKA 1NXMA 1MVEA 1AYN3 5ABJA 2HEWF 1LRHA 3GNEA 5KHIA 1RUJ3 1UF2C 3ZN5A 3BOWA 2GMMA 2NYYA 4AXOA 4W65A 1KQRA 3WUDA 2WNUB 3LB9A 3OBRA 4WZCA 4CEWA 2OVUA 4Q1RA 3PMSA 3B00A 1OKQA 1FYUA 1R081 1HDKA 1QJU2 4R8HA 4TYSA 4YFWA 4LUMA 1U5ZA 2F6BA 2EAAA 4YG0A 3B94A 4XIKA 2K2SA 1RVF3 3H0OA 3N7MA 4I3PA 2WSVA 1PGW1 4BIFA 3UL2A 3G7DA 1MZ6A 3TBDA 2YYOA 3VZLA 4RA0A 4XJZA 1VBB3 4CDUC 2YROA 4L99A 1RTVA 4LBJA 1ASJ1 3MIDA 1JN2P 2YY1A 2VQ0A 1Y3TA 1ZX5A 3IBMA 1VBE3 3WG1A 1RMU3 1REEA 1WW4A 3IDBB 4DPNA 3D0SA 1U0AA 1BMV2 1IKQA 4NOTA 4Q4X2 3E6DA 5JSPA 4XPVA 4XIOA 2IXKA 2XKOA 2HWF2 2DU0A 5CU1A 4FPGA 2PN5A 1ZREA 1AX2A 3BB6A 2JXAA 1N47A 4JTNA 4CDUA 1E57A 4Q4V2 4LEJA 3WDYA 3POWA 2BVBA 5J3UA 3MW4A 1KDMA 1PO22 1DGRN 3EQEA 3ZXKA 4BIOA 4Q1PA 5JI7A 2BQPA 1YLLA 3ZFEA 1L3JA 1SACA 1UL9A 4D3WA 1UN1A 2WINB 3CJIB 5CG8A 2P3JA 3ZMOA 2XH6A 1D0HA 4I30A 2DWRA 1W0PA 4FPEA 2IFWA 3FFQA 1M4WA 1G6NA 4XMAA 1KS4A 1Q3EA 3FZ3A 3GZTB 3KS7A 2E9QA 3ME2A 4XJ8A 1FOD1 4AVVA 4COUA 2I45A 1ZZ6A 4DQAA 2RM23 4AI8A 3VUOA 4Q0QA 1FNZA 4OUSA 1IQAA 1WD3A 5FFOC 1AR91 1UAIA 3VBSA 1QOOA 1J3QA 3K48A 3O0WA 4LHNA 4XFAA 4CEYB 2HWB2 4EJRA 2DCYA 2V09A 1Q43A 1AR62 3VZJA 4DOUA 1C1FA 3KSCA 4JV4A 3WUCA 1XNBA 5K0UB 2RJKA 4XBNA 5I0RA 1POV3 4D7TA 1QDCA 2R0HA 4LNVA 4GH4B 1LEDA 1OQEA 2XWJB 3W59A 4JDMA 2MEV2 5FQ0B 3ATGA 3MGUA 2GC2A 4UXAA 1MEC3 1QQP1 2VOXA 3ST7A 2BEOA 2ET7A 1RUH1 3RI8A 4NVPA 1N1VA 1LGCA 1VRH2 3RJRA 4KQ7A 3VBRA 4K20A 1CPNA 2TUNA 1Q8PA 3ZXEA 3IPVA 4FOQA 5GLZA 2BNMA 4HSJA 3UV9A 5IK4A 2B5HA 3GHNA 1LOEA 5EWSA 1R1A2 1VP6A 1KJRA 3MICA 1DQ5A 2VNRA 1RITA 4EN8B 2RR12 1RUD3 1MS8A 1NZCA 3NAPA 2RS11 3WP6A 5T3NA 2UYBA 1A8MA 1KXGA 2QCSB 1KD7A 2CV6A 4DNYA 1ZBE1 1JBCA 3O12A 2WC2A 2R0FA 2PHUA 3G6JB 1ULEA 2D5HA 1YWKA 1RUNA 3H7JA 5CB7A 4OI0A 4MXWB 4FQZA 2D3PA 2A3WA 2Q30A 1QKQA 2ZGKA 3KM5A 4GKXA 4JRLA 3WOGA 3WP3A 3AZVA 4Y1ZA 3SCGA