4RHV1

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv100
2HWD2 2RS11 1VBC3 1QJZA 1PVC2 2PLV3 1ASJ2 1HXS3 1R1A3 1AR92 5BNOB 5FOJB 1D4M3 1EAH3 4GB32 2RS53 4RS5A 1EV11 4JGZB 2R062 2HWF2 4QPGC 4Q4V1 4AEDA 5K0UC 1AR82 1PIV3 3FBMA 1PO21 1Z7S3 1VBE1 4IV3C 4WM7B 3ZFFB 2XBO1 3DPRA 1QQP1 4YVSB 1RUD3 1H8TC 5L7OB 1RMU1 1AR63 4JGYC 3ZFEB 1RUF3 4Y5Z0 1ZBE2 1NY71 1C8M3 1E57A 4CEWA 1V9U1 4CDQA 1RHI3 1ND3A 1RUE1 4CDXA 3VBUC 1R081 2WS93 1QJU1 1QJY2 4RHV1 1ZBA2 3VBSA 4YVWB 1BEV3 1MEC3 1VAKA 1HQNA 3VDDB 5C8CC 1AYM1 1D4M1 1EAH1 4QPGA 5K0UA 1RUG3 1HRV1 3M8LA 5AC93 4N53B 1RVF1 4IV3A 4N43C 2RR12 3JBG1 1VB4A 1EV12 1VBB2 1H8TA 4Q4V2 5DDJ2 2QQPA 1K5MB 4JGYA 2RS13 1NCRC 5D8AB 5C4WC 1VBE2 1F2NA 4RQPC 4FTBA 3VBHB 2X5IC 3VBUA 1C8M1 1RUI1 5BNPC 3HAGA 4GMP0 1NA1B 1OOPC 2Y26A 4QPIA 1C8NA 3TN92 2RMU3 2WS91 1PO23 1V9U2 1RUE2 1OPOA 1BEV1 1HRI2 1R091 2XBO3 1VB2A 5C8CB 4WM8C 1RUJ1 2HWB1 3NAPB 1VBC2 1RMU3 1WCDJ 1RUH2 3DPRC 4N43A 1RUG1 2PLV2 1HXS2 1R1A2 1VBD2 1EAH2 1RUC3 4GMP1 4FSJA 2RS52 3CJIB 1PO11 4NWVA 5C9AB 5C4WA 1BBT1 4RQPA 1QJU3 3VBOC 4RHV3 2ZAHA 1PIV2 4LLFA 1Z7S2 2X5IA 1BMV2 4IV1C 5BNPA 3VBSC 1OHFA 1OOPA 5ACA1 1AYM3 4Q4W1 4Q4Y1 1RUD2 2ZTNA 4GH4C 4Q4X3 3LOBA 1HRV3 1AR62 1AYN3 3J8F1 2BBVA 1RUF2 1RVF3 5J98B 2RMU1 4RS5B 3JBG3 1RHI2 1VBA3 2HWC1 4WM8A 4AEDB 1PGL1 1TME1 1POV0 2WS92 5CFCC 1FMD3 2RM23 3DPRB 1MEC2 1MQTC 2WZR3 1B35C 5CFDC 1RUI3 2R071 1RUC1 2R041 3VBOA 4PDWC 3VBRC 4CEYC 2IZWA 4CEWB 5AC92 2MEV1 4CDQB 1FOD2 1ND3B 4IV1A 4CDXB 2WWSA 4QPIC 1ND2C 4GB33 1TMF1 1R093 4GH4A 1RUJ3 5JZGC 1HX6A 2HWB3 2RS12 2WFF1 4CDUC 2HWE1 2GSYA 5ABJC 1AR71 5FMOL 5FMOS 1COV1 1PGW1 4Q4X1 3VBFC 1AYN1 4QPGB 5K0UB 4GMP3 5BNNC 1PO13 4BCUA 5CFCA 4CDWC 3VDDA 1VBA1 1BBT3 1NG0A 4IV3B 1PO22 1FMD1 1QJX3 2RM21 1VRH1 1MQTA 1H8TB 1X36A 1B35A 5CFDA 2FZ1A 3JD71 4JGYB 5A33A 5ACA3 2RS31 2XBO2 1QQP2 3ZFGC 1AL0G 2WZR1 4PDWA 3VBRA 4Q4W3 2FZ2A 4Q4Y3 4CEYA 2GH8A 1RB8G 1NCQC 4FTEA 5A32B 1RMU2 3VBUB 3J8F3 1DDLA 1ND2A 1NY72 1RUC2 1ASJ1 4EJRA 1AL23 4RR3C 1W39A 2HWC3 1R082 5JZGA 1TME3 4GB31 4CDUA 5ABJA 1QJU2 4RHV2 2R061 5BNOC 2HWF1 3VBFA 1AR81 5BNNA 4JGZC 4CDWA 1AYM2 1D4M2 2R073 2R043 2TBVA 4N43B 2XPJA 4Y4YA 1AUYA 1PGW2 4Q4X2 1HRV2 1AYN2 2MEV3 1RVF2 4WM7C 3ZXAC 1FPN3 3ZFFC 3JBG2 5C4WB 1NCRB 1ZBE1 2BUKA 1QJX1 4YVSC 3ZFGA 1POV3 1VBA2 4RQPB 1TMF3 5J96B 5L7OC 1NCQA 3JB8A 2X5IB 3ZFEC 3TN93 2RM22 2WFF3 3IDEA 2HWE3 1AR73 5BNPB 1GFF2 1COV3 1OOPB 4RR3A 2ZZQA 2WZR2 1M06G 1C8M2 1RUI2 1F8VA 1AL21 2VQ0A 2DF7A 5BNOA 4YVWC 1RUH3 2WLPA 4WM8B 3VDDC 1VRH3 1VBD3 4JGZA 2RR11 1BEV2 3JD73 4Z92B 1R092 2RS33 1VBB1 1RUJ2 4N53C 2HWB2 5DDJ1 1NOVA 2HWD3 3JB4C 4WM7A 3ZFFA 1RUG2 1PVC3 4YVSA 3VBOB 1ASJ3 1AR93 1FPN1 5L7OA 1K5MC 1PO12 5D8AC 3ZFEA 1POV1 1BBT2 4IV1B 3VBSB 2R063 3VBHC 2HWF3 3TN91 1QJX2 1AR83 4GH4B 1SMVA 1NA1C 5ACA2 4YVWA 4Q4W2 1HRI1 4Q4Y2 1VBC1 3J8F2 1RUH1 5CFCB 2RMU2 2PLV1 1HXS1 1R1A1 1ZBE3 1AL22 1VBD1 2HWC2 1PGL2 3NAPC 4N53A 1TME2 2RS51 1X33A 1MQTB 1B35B 5CFDB 1FOD3 2BFUS 2BFUL 1QJY3 1ZBA3 5A33B 1PIV1 2HWD1 3CJIC 4SBVA 1Z7S1 4PDWB 3VBRB 1K5MA 5C9AC 4CEYB 1BMV1 5D8AA 1PVC1 2R042 2R072 1AR91 4QPIB 3VBHA 1ND2B 1RUD1 1A6CA 2MEV2 1AR61 1FPN2 4RFT0 5A32A 1NA1A 5JZGB 1RUF1 2BPA2 4CDUB 5ABJB 2RR13 4FTSA 1TMF2 1EV13 1RHI1 1VBB3 3VBFB 4Q4V3 5DDJ3 2WFF2 2HWE2 5BNNB 1CD3G 1AR72 4RS5C 5LK7B 1COV2 1VBE3 4CDWB 5C8CA 4AEDC 1IHMA 3NAPA 1MEC1 1QQP3 3S6PA 3ZFGB 3CJIA 1FMD2 1VRH2 5AC91 5C9AA 1FOD1 1V9U3 1NCQB 1QJY1 1ZBA1 1RUE3 3JD72 1R083 4NWWA 2RS32 1NCRA 4CEWC 1HRI3 4CDQC 5GKAC 1CJDA 1ND3C 4CDXC 4RR3B
chains in the Genus database with same CATH superfamily
2D3RA 4CPBA 4B1LA 1UO9A 2RS11 1OQ1A 3C8XA 4AHZA 4BZ4A 2K0GA 3GJBA 1PVC2 5T54A 2ZHKA 2NM1A 4A7ZA 2EICA 3OBRA 5BNOB 1AR92 1Q8OA 3WVJA 1D4M3 4ARXA 1GBGA 2VU9A 1CX4A 1RL3A 5FZHA 4IE4A 3LEIA 3ZXKA 3LFIA 1MVQA 5DAVA 2VMDA 4CYDA 1EV11 1VJ2A 3MUY1 4XJUA 4F7ZA 3K48A 1WW7A 4AEDA 3NQHA 1LENA 2Q4SA 2WBKA 5L73A 3WF1A 1O3SA 1PIV3 1ZRDA 3HOBA 3DN7A 1Z7S3 4OUEA 3K75B 4U36A 4LBJA 5LEKA 2NPIA 4I2OA 1DQ1A 2DCKA 3D3AA 4IV3C 1Y43B 3D0JA 3FUOA 4PLOA 3WCSA 3IBMA 1IQDC 4JZRA 2XBO1 4LKFA 1QQP1 1XNCA 1WCSA 3POBA 1V0AA 2ZOEB 1S1AA 1WLDA 4NUBA 1RMU1 2GZWA 5A3OA 4BA6A 4OUMA 5CAZA 3PVOA 4MADA 1U5YA 2PHWA 3ZX7A 2ORXA 5LW9A 4UBHA 5IK7A 5IFTA 3WF3A 2HH9A 2ADDA 4CDXA 3VBUC 1REDA 1CPNA 4XBQA 2O1QA 4QD2A 3VDCA 4Q8KA 2BWAA 3T2OA 4IEXA 4CA9A 2AREA 4Q29A 4DOUA 1QJY2 4RHV1 3E97A 1UU4A 3VBSA 3D8CA 1D0GA 2Y8KA 2XMLA 1O3RA 2PYTA 2GU9A 1H0BA 1K45A 1YQ5A 4AHXA 1STMA 2BOJA 2WL1A 3Q9OA 4L92A 1WMDA 1WLCA 3VDDB 4C90A 3HBZA 4OQ9A 1D4M1 2B9VA 4LE3A 1KFUL 2R49A 4ORFA 4V2WA 3NKGA 4QPGA 5K0UA 4O9GA 3AKSA 3DXTA 2QKDA 1DGWX 2Q1MA 3ZYGA 3C3VA 1GP4A 4LOTA 2BV4A 1OT5A 2BEOA 3KT7A 5AC93 4N53B 4ES9A 2CWSA 2YZ4A 3UKNA 3KHBA 3ZKUA 2C9KA 1O3QA 1UW8A 4B29A 3I3EA 1GOFA 1F31A 4OMCA 5JSRA 3A21A 1I6XA 4AK3A 4YYOA 5BV6A 2X10A 3AM2A 4K21A 5D8AB 3ALQA 3PL0A 5GZEA 3G6JB 1K5JA 2Q1FA 1F2NA 2EAKA 2JE8A 4YGBA 1E5IA 3AJZA 3M3IA 1F5FA 4LKSA 2P6CA 4DXTA 5FR3A 3VBHB 4CUBA 2X5IC 2XKPA 3KF3A 2PHLA 5IHRA 1XYPA 4BXFA 2WYSA 4XEZA 5FZOB 3OEBA 2D3PA 4LHLA 5F3EA 1SQ4A 2GP3A 4CP9B 2BZDA 5F8PA 3TN92 1IKQA 3ST7A 1WMXA 3NKTA 4WVVA 3D0SA 1LODA 5F1RA 4MG2A 4XUNA 1V9U2 4HG6B 1RUE2 4IEUA 4KGGA 2DVDA 1UX6A 2LM3A 2G9GA 4FOVA 4QM8A 4AXOA 1XOYA 3LF7A 2EXJA 4QB2A 1AX1A 5JOYA 4WM8C 4AVAA 2ZMKA 2Y6KA 3JUUA 3SH5A 3NAPB 1AX2A 1VBC2 1H9WA 1KS5A 2QNKA 4YW5A 1NZCA 4QQ2A 5BPXA 4I0BA 5A1AA 2YC2A 3I54A 4N43A 5F9TA 2WA3A 4AGVA 4FOWA 3I2KA 1C4RA 4NPMA 2I2SA 2WO2A 3LEKA 5FMDA 2YB7A 4DUVA 1EAH2 4PBOA 5C3RA 2Y60A 4O61A 4GMP1 1JZ8A 4HVOA 4UWDA 2ZX4A 1UZ0A 3MPBA 4TSVA 2Y6JA 4JDNA 1PO11 2JB8A 4XE9A 5ERLA 1WD4A 3SCFA 4IDZA 1K12A 4JQTA 5C4WA 1W6NB 4AOCA 2NMOA 3VBOC 5DQ0A 3UKVA 4QXHA 4GKXA 3MLKA 1IQAA 1O59A 4XAEA 4MSVA 3ZXFA 4J1WA 5FZAA 4E8CA 4LMFA 2YG0A 1OHFA 1OOPA 5ACA1 5LK5A 2W46A 4Q4W1 2FDFA 1RUD2 2AUYA 1VMHA 3GZEA 4GH4C 4XJZA 2OW4A 4Q4X3 5IFPA 1LOEA 2ZGPA 4DUXA 1AYN3 3KT4A 4HZFA 1W0PA 2PXJA 2BJSA 3ZSJA 3RZKA 2PHXA 5KHHA 1LU2A 3KV5A 4RYDA 2OUJA 1PGL1 4AI8A 2R32A 3UGGA 2ZGRA 4KG8A 4B7EA 3B9IA 4S2FA 1K3IA 4K6BA 4OMDA 3FLRA 2VW1A 2YY1A 1NXMA 4FFFA 4H2AA 4XF9A 1XSQA 2QFEA 3Q8BA 1MS8A 2OA2A 4W6WA 1NT0A 4EYUA 5FZMA 5IVJA 2CWMA 1LULA 3WNKA 5JXIA 1JODA 1LGCA 1VMFA 1HJGA 4AGRA 1B35C 3O0VA 2CGOA 3E6BA 4LT5A 3WW2A 2ORZA 1UPSA 4BMBA 3MW3A 4GWJA 1LHVA 5ISLA 4LK7A 2SLIA 4K1ZA 3JXSA 2IZWA 1DHKB 1XPWA 1O4YA 5CKQA 1FOD2 3AFGA 4JQRA 4XDPA 4H14A 5AFEA 2G9FA 3BN6A 2WWSA 2F4PA 5FXZA 1I3HA 2QQVA 2GC0A 1OH3A 3ES1A 4CXXA 3RI8A 2DURA 4Q0QA 5FYZA 4XQ4A 5TSWA 3SKJE 2ZEWA 1RUJ3 3GHMA 4K8FA 1UY0A 4NHLA 2JENA 1H9PA 3CHXA 1AJKA 2BBAA 4XF4A 1GZTA 1US3A 2IXKA 4Y5SA 3SEEA 5JLVA 4Q4X1 4RN5A 3R4UA 2WUHA 3IIIA 1AYN1 4YM1A 4LO8A 3ILNA 5JVVA 1IS3A 3OSDA 4CP2A 5CFCA 1DQ6A 2WT1A 1F5JA 1FYUA 5A33B 2Y0OA 4IV3B 3N3HA 2WSVA 2UY9A 1WCUA 2VUJA 4ZU4A 1UY3A 1PO22 3BALA 1PMJX 4B4PA 3M2MA 4R4ZA 1LR5A 2PA7A 3CIHA 1YFXA 3ZO0B 1O5UA 4FPHA 2RS31 1CAUA 2JDUA 3V64A 4Y1YA 1OC1A 2IC1A 4Y20B 4XFIA 1CIWA 3PTRB 4GKYA 4Q4Y3 2E31A 1TZOA 3RGBA 1REEA 1UIKA 5HBAA 4O7XA 4FTEA 5A32B 5FJKA 3VBUB 3LIGA 3WXPA 5F6LB 3DECA 2ZX1A 1ND2A 1NY72 2RDNA 5L36A 1V6MA 2JKBA 4YSFA 3ELNA 1ASJ1 3J4UH 4NAOA 1CAVB 5A7WA 1GNYA 1PK6C 4I0AA 4DXRA 4HSJA 2OX0A 1GZWB 2Y6HA 3T09A 5ABJA 5DUWA 5DG2A 1JW6A 1LRHA 1QJU2 5I93A 5FPAA 2PAMA 2WR9A 3KT1A 2D6KA 1IZ3A 1OA4A 1ZZ7A 4LBQA 3A0KA 4MVTA 3VBFA 3O0WA 2DUOA 2JG8C 4OFGA 1H2MA 2LROA 4SLIA 2XG3A 4C91A 1KDKA 3QD6A 2I74A 1GR3A 5LB6A 4UFLA 1AYM2 2J1UA 1ZZ8A 3T08A 3ORJA 3T0AA 1IS6A 1LU1A 3OY8B 1LGNA 1PGW2 2IXLA 3CEWA 4AE2A 5FZ0A 1GICA 4FPOB 4TWTA 3MF9A 5F7UA 1FATA 1RVF2 3VKNA 5FZ1A 5I8YA 2BUKA 1ULPA 5SV5A 1VBA2 4NRPA 4XJ9A 3I2JA 4CU9A 3AKQA 3ZXDA 5B4NA 1DGRA 2H0VA 1Y4WA 2VD7A 2X5IB 3U14A 3O1OA 1OF3A 3LEMA 4XFHA 4QQHA 2R7EB 2RM22 4W65A 2VNRA 4P08A 2CV6A 5J7MA 3B69A 2H6BA 2WO3A 2ILMA 2PQSA 3NNLA 3NV4A 3LA3A 4RR3A 5FBJA 2VJXA 3TAYA 5EFUA 3VKMA 2VOVA 1ZRCA 3ACHA 5GLWA 1E5RA 1UY4A 2XONA 1W3VA 3I3BA 4FT8A 5F37A 1W2UA 3N7KA 2C1FA 4OLLA 4Y33A 4YVWC 4LITA 4M01A 4YM0A 5T5PA 4AEKA 4OHXA 2WLPA 3T4VA 1HB4A 5KXCA 4WM8B 4Y1VA 3NNGA 1CONA 4JGZA 5HCFA 4DUWA 3KWVA 4QGMA 3WOGA 3B7MA 3JD73 1UU5A 3QCWA 5FO7B 3ZYIB 4Z92B 1OD3A 3K46A 1GU3A 1VBB1 4XOGA 4MHRA 1S4CA 4TN7A 5HI0A 2JX9A 2HWB2 5FXVA 1NOVA 2HKXA 2JD4A 1H4HA 1S0GA 2NLRA 4H3WA 4I30A 4WM7A 4DPNA 2UU8A 2YPJA 4QPYA 5FZGA 5C3SA 3WF0A 2CDPA 2J1SA 4XJAA 3H3LA 1FAYA 4NR1A 3DKWA 3VBOB 4AQTA 1J3QA 2ET1A 1R1ZA 3KQ4B 5GZDA 4EWEA 1BBT2 3KSCA 3ZYHA 5F3GA 3V0AA 1ZYBA 3RWKX 2R063 1DLCA 4G4FA 4HPKB 2HWF3 5ANNA 2VO5A 5H9RA 2V5YA 5A3WA 1QJX2 3NWKA 3AXEA 1A8DA 1AR83 4AHWA 3VHNA 4YW4A 4GH4B 3IAQA 2D5HA 2FCUA 1GANA 1H2LA 4D7YA 3H8OA 3MICA 1UXXX 2Q0AA 4MZUA 3GZAA 1KEXA 1PM7A 2VZSA 4OZXA 2UY8A 4LOSA 2NP0A 5D2AA 1E5SA 1HRI1 2GALA 3OF1A 3K3OA 3WNNA 1ULGA 1BVP1 3WNXA 5IW0A 4S2HA 1PHMA 5E6HA 2GH2A 4NO4A 5HV4A 4EQVA 1V6NA 4IE0A 1OFSA 2R1DA 1SDDB 1CIYA 1HXS1 5FRAA 3N4MA 2JWPA 2LW8A 2HWC2 5FYIA 3VDBA 5DPNA 3BI3A 2ENRA 4YWAA 1TME2 3U4SA 1S0FA 2JDHA 1X33A 2QTWB 4QU1A 4Y24A 3TBDA 4DY3A 2VH9A 3ENRA 1RXFA 1B35B 1W6OA 2H0BA 1JOJA 5A6XA 3THDA 2BFUL 2BFUS 3IDBB 3VZKA 2MNGA 1ZBA3 2PAEA 3F2ZA 4MGIE 4DXZA 2CHHA 4TXWA 4DEVA 4LIUA 3N9LA 3KCXA 1JXNA 1RTVA 2W39A 1BMV1 1NUKA 2E7AA 3I3QA 1ULOA 2OQ7A 3TB0A 4AFBA 5FWEA 3OGRA 4XCBA 4N8MA 2VZVA 2VZRA 4RFT0 1FPN2 1SLAA 4XIOA 3P3NA 1K42A 4GWMA 5FP8A 4Q0UA 3H1YA 2RR13 3PU3A 4Q5OA 4FTSA 3VD9A 2XOMA 3CMGA 4ZZ5A 4HETA 1LAJA 1JYIA 5EJZB 3LA2A 3KGLA 4BYYA 4EV0A 4Q4V3 5DDJ3 4XURA 5FQ0A 2WFF2 1JHNA 1S0IA 2HWE2 2XH6A 1CD3G 3NV2A 5LBCA 3R0RA 4ISRA 2ES3A 1VBE3 4P9LA 1W6MB 4AEDC 3I59A 1IHMA 4KQ7A 4CCCA 3GGLA 5FP4A 4M4PA 3V0BA 3B00A 4R52A 3I4IA 3WY6A 2D97A 2WN3A 1LECA 1WCQA 4Y4RA 5KR7A 1D2SA 1VRBA 1PNFA 1VRH2 3DL3A 1ENSA 3MFCA 3PHMA 5C9AA 1JYXA 5CNAA 3L2YA 2WJSA 3EO6A 3FC0A 1ZBA1 2GNMA 1HQLA 1R083 1BQPA 4NWWA 4XZUG 1OPMA 1NCRA 1OVPA 5SV8A 3UV9A 2CSGA 1V6JA 1DZQA 2PTMA 5C71A 4FQ4A 4KMQA 4UW6A 4CDXC 3NJZA 1PX3A 3CQOA 2EIEA 4UW5A 4J1XA 3ZN6A 3FX3A 2B8MA 1QGLA 1LOFA 3AZVA 2PLV3 3PIGA 1XNDA 3WG4A 3LSDA 1R1A3 4NHKA 3DYOA 5FOJB 3CF6E 1UYPA 2A3YA 2JG8B 3PJYA 2RS53 4AVSA 4J6GA 3IMMA 2RVAA 4RS5A 2A73B 5CG8A 2YGLA 4LKEA 3ACIA 3RFRA 1GMMA 1H6XA 2I07B 2QQWA 1CZTA 4QPGC 4Y1XA 4Q4V1 5K0UC 4FXKB 4X8PA 2CNAA 4KBZA 1XE7A 1OA2A 2D40A 4O65A 3FBMA 2PHTA 4OCTA 5FO8B 2XL9A 5IJRA 3MIEA 1ZRRA 4IUGA 1VBE1 4BU2A 4QXBA 1HDKA 1PMIA 1UY2A 4I02A 1SBDA 4QXCA 4AVBA 2UWBA 2BDRA 4D7SA 3FFZA 3DPRA 2XUEA 4FFGA 2GNBA 5DAWA 4MGSA 4NIIA 1G9CA 1ST8A 2EXKA 5C8WA 5LY1A 2V09A 5GLZA 4OULA 2J1RA 3CNAA 1AR63 4ITCA 1CAWB 1RUF3 3IPVB 1ZBE2 2VCCA 3CO2A 3LDKA 2ZGQA 1U5IA 1S0DA 2QCSB 1SFYA 3MHZA 4CEWA 4M3CB 5A3LA 2VG9A 1RHI3 2WNEA 4YZ1A 4D8MA 1R081 1UYYA 3TRSB 4A3ZA 3VD4A 2D44A 5FWJA 4FPCA 2WS93 5FXWA 2CTVA 4NHXA 4F8AA 5LWBA 3OD0A 2O0OA 1XQNA 1YQ2A 2ZHLA 5L9VA 2D43A 3HR9A 4XHBA 3K77A 1IS4A 4AG4A 2XJQA 4YVWB 5I0TA 3DV8A 1RXGA 3AMMA 4UF0B 5CA6A 4JC1A 1MEC3 2VL4A 2ZXQA 5F2SA 4N9IA 5LZ6A 2WNUA 4YNIA 5A6ZA 2W08A 3OPTA 2ZGUA 1Y9MA 3LSEA 1RINA 3OG2A 3ZYBA 1L7LA 3RZGA 1OH4A 2RG4A 5CZKA 4NPLA 5JR7B 1HRV1 4DMIA 3WNOA 2VZUA 3HEIA 4P9GA 1HB3A 2D5FA 4FPJA 2ZHMA 1V6LA 5K9YA 4N43C 3JBG1 1QF3A 3NNFA 1IS5A 2ZMLA 1VB4A 2ARCA 2WZPP 3RYKA 4JHTA 3T0BA 1EV12 4E2GA 2WC2A 4XBLA 1U5XA 5EJ3A 1H8TA 4IEZA 1OD5A 1LJ7A 1SFNA 1RUOA 3THTA 2WZ8A 3U75A 4DFSA 2RS13 5C4WC 4Z2AA 3N7LA 5F32A 3QOPA 4FTBA 3M70A 2VCMA 5FYSA 2AEZA 1ENQA 4RGKA 2VZ1A 4HONA 3ZPOA 3TEZA 3TNPB 2UWCA 4YZ2A 5A1FA 1RUI1 3VZNA 4GMP0 4QQOA 1N1VA 4M3CE 1OOPC 2Y26A 1OLME 1MACA 3GBWA 4QGNA 5CVRA 4XDQA 1SLTA 3AX4A 2DTWA 2E32A 4UFHA 2RMU3 2WS91 2VOTA 1Y3TA 1I5ZA 3HNYM 3FMGA 3PIJA 1C1LA 1XNAA 3MF6A 2QE3A 3POJA 2IXHA 4IEPA 3MUZ1 1R091 2XBO3 1QJEA 3AVSA 3N36A 2Q30A 2A6XA 5C8CB 3VL8A 2WT0A 1IG3A 4XBNA 2P2KA 3C7EA 4WV8A 3T1MA 2PAKA 3OTFA 4IW3A 3PLQA 1RMU3 1OSGA 1V70A 1WCDJ 1RUH2 2AR6A 4PIZA 1VIWB 4LIVA 2E53A 3ZN4A 3WUCA 4UT5A 4OVEA 4JX0A 4ATFA 2LUWA 4DRRA 1VBD2 2HYXA 4AFCA 1TG7A 4N7UA 2WN2A 1UZWA 1UZYA 5HXVA 1RITA 2PHUA 3LDRA 4NWVA 4FSJA 5EWSA 3POYA 4TLGA 1O3TA 1TVGA 4YG3A 1CPMA 1XNTA 3B94A 2NZ9A 2ETEA 4RQPA 4XAAA 4IE7A 4RHV3 4BISA 4A6SA 4DB5A 1PIV2 4ASMB 1Z7S2 1YNAA 1HQWA 1YLLA 4A7YA 3INAA 4LPLA 4UXAA 2OZJA 3LIHA 2VQTA 2P3IA 2RDRA 5BNPA 1QY4A 3BODA 3UL2A 1GZ9A 1SFPA 3D5OA 3GXUA 4PJYA 2XWJB 1A8MA 3GZTB 3I8TA 3WNMA 2CL2A 2D6OX 3T2QA 1LOGA 5EQUA 5I8TA 3WP4A 3J8F1 2BBVA 5FY1A 1C3HA 4AQSA 2DCTA 2RMU1 4LK6A 4FPGA 2Z5WA 4AEDB 3SCGA 1MS0A 3WW1A 4CCEA 1JOBA 2JE9A 1DF0A 2YROA 3I97A 2F6BA 5CFCC 1FMD3 2VTXA 3ACLA 3OGGA 1UXZA 4QDSA 1D2QA 2V72A 5FUPA 4BIFA 3KB5A 5G05L 3WW3A 1UKGA 4FP2A 2FDHA 5LA9A 3OGSA 1QKQA 2ZKLA 2ZZJA 4MGZE 4OQ8A 1CWPA 2WZR3 1AX0A 4AI1A 2R071 2R041 3NNJA 4R4XA 4XVHA 2OS2A 4A2UA 5DZGA 3IDCB 1W6PB 5AC92 1OLRA 2MEV1 2VMCA 4FPYA 4IGPA 5JDBA 5JCTA 1SLBA 3C7HA 4IV1A 4CDXB 3DGTA 1FNYA 1DZRA 1WBFA 1N1TA 4LNVA 2OPWA 5CKNA 4QPIC 3EYPA 1Z78A 1ND2C 1JZ2A 2W94A 3ZSLA 1TMF1 2BERA 2X09A 1ODMA 2GMPA 1FNZA 2QUOA 3AKPA 4YW2A 4A44A 4M0HA 3IIAA 5ABJC 1AR71 1F4AA 1COV1 4ZPIA 4XHXA 3AFKA 3POSA 5JMOA 3VBFC 5LBEA 1O6UA 1BYHA 4QPGB 5JOWA 4QWNA 5K0UB 4GMP3 1OA3A 1PMHX 1UZZA 5CYYA 1PO13 3O0XA 1W2NA 1YHFA 1G8WA 4LUKA 3ITQA 3VDDA 5KC6A 2VTXJ 3ZSEA 2Q8EA 3T1LA 1LHUA 1RGSA 3SQOA 3M7AA 4W8JA 2ZJCA 2DDUA 4HN0A 5LA0A 4YRDA 4IGQA 1FMD1 3PUSA 1MQTA 2AYHA 5IAVA 1X36A 4C1WA 3SLIA 4BLJA 5CFDA 1G9FA 1CR7A 2FZ1A 2VVDA 1LEMA 3L2HA 3MBWA 4AAPA 2DFBA 3N9MA 5FZFA 2Z2SB 3MYXA 3VHRA 5A33A 1ULEA 5ACA3 5FXXA 5F3CA 2WZR1 4JKKA 4NHMA 4Q4W3 2JJ6A 3C7FA 1HV1A 3VBRA 4CEYA 4DIQA 1F4HA 3WP5A 3WDYA 4QMAA 3HIFA 2WFPA 4GZ9A 3VD5A 2Z69A 5CIRA 4KWLA 2JICA 3WT3A 2DBIA 1JU3A 3KV4A 1DDLA 1IPSA 4FPFA 3NW4A 4FXGB 3VB9A 3FLPA 1NKGA 2IVIB 5HCAA 3DEMA 2H6CA 1PX4A 2BYVE 4RR3C 2WYFA 5E8AA 4AI3A 5A3UA 1BZWA 4HKWA 5JZGA 1JTZX 3RYPA 3HNBM 3WDTA 3PVNA 4WVMA 5DN2A 3WEZA 3ZYPA 1QXJA 4CDUA 4E27A 4XC9A 1ZZ6A 2Q5TA 4LEJA 1O5LA 4CU6A 4UBGA 3ON7A 1VR3A 4YW3A 5BNNA 3H0OA 4JGZC 4AVCA 4CDWA 4JHZA 3Q8CA 4LO6B 1AVBA 2TBVA 3GDBA 4N43B 2O14A 5CG9A 3NNMA 4QKFA 4Y4YA 5FYMA 1AUYA 4ATEA 1OFNA 4EN7B 2DVBA 1TEIA 3HBKA 4Q4X2 1G9AA 1EYBA 1AYN2 3G7DA 4WM7C 2W87A 1KFXL 2E9QA 2R16A 1WUVA 4P9YA 5FYTA 5C4WB 2EIBA 3KD4A 2OYZA 1GQPA 1QH7A 4LA2A 4RSUA 1V00A 5LASA 4YGCA 2FD8A 5J96B 3NO8A 3H8RA 2WAAA 3TN93 1JOPA 1S2KA 4LBMA 4QKBA 4KH9A 3WF2A 2Y6LA 4CUCA 2R30A 5J3UA 3T3YA 4FQZA 1W6NA 3SCHA 1R64A 2VZ3A 1GFF2 3H7YA 4YZ4A 3AL6A 1OOPB 3ZM8A 3ZPYA 2ZZQA 1UN1A 3B01A 1SBEA 2YBKA 3BGAA 3OPWA 3R05A 4XTPA 2E7QA 2VVFA 5F2WA 1YIFA 1C8M2 1EPWA 3MLLA 5GLVA 2ZX2A 3RQ0A 5FUIA 1F8VA 3MGUA 3K4DA 1TE1B 3BKZA 4NAMA 4PQQA 3MW2A 5L9RA 2VVEA 1ZZBA 5FPXA 2LS6A 2VCBA 2YBPA 4A3XA 5DZFA 3PU8A 5T50A 2ZGTA 1W9SA 3VKFC 3RDIA 2XJUA 3OBTA 3OUJA 1BEV2 4B4QA 4EN0A 2BGOA 4HKLA 4CU7A 2O8OA 1ZA7A 2RS33 3BOWA 2ZX0A 5E1RA 2Z4FA 1AXYA 1RUJ2 1O8SA 1A78A 1F35A 1WW6A 2C24A 4LJHA 4XACA 2EXHA 1ONAA 2GDFA 2UURA 3GM8A 2BNNA 1GWLA 2HWD3 3JB4C 2A3WA 3WV6A 3AZYA 3ZFFA 1RUG2 1HW5A 1GNHA 1X50A 2WQ8A 4YVSA 3HMYA 3KCYA 1ASJ3 4QDQA 1APNA 4XCAA 3FZ3A 3OGJA 5JSPA 3NJXA 4JVAA 5L7OA 1UX7A 5IVFA 3HPNA 5A7PA 3M3CA 3OYWA 3WD5A 1CVNA 2ARBA 3ZFEA 4DXSA 4NIGA 5LBFA 5JMCA 2ZHNA 3WHUA 1B09A 4Y26A 1JZ5A 5EP9A 2VE1A 5JSOA 3TN91 4LTAA 3SNMA 1DCSA 5A3NA 1W99A 2CYFA 4Q27A 4QPWA 3THPA 3BU0A 3H1WA 3ACFA 5JUVA 4AAXA 3RNSA 3KMHA 5CEHA 1L7RA 1Q8SA 2BOIA 2L9LA 2BW8A 2MPFA 2AZ5A 3POFA 2Q1ZB 1U5ZA 3ILRA 4XW3A 2QDRA 5FO9B 1W8NA 4Q4Y2 4QKNA 4O9EA 5EZWA 2ERFA 1DQ5A 3EHKA 3SITA 2IFRA 3VZJA 1GSLA 4LBOA 4COUA 3LD8A 4YGEA 4D0QA 1JZ4A 2ZGNA 3LCPA 1VBC1 1QMJA 2VMIA 5DABA 5JPMB 5CFCB 1GP6A 5JWPA 4RGAA 4PIYA 2Y33A 3UJOA 2K46A 4E4SA 1LTEA 1LGBA 1GYKA 4L99A 3V65A 1QHDA 4CP1A 4KI5M 4UYBA 3AYAA 5CU1A 5D1IA 5IUQA 2ZGLA 3TYJA 4P9JA 5KHJA 4HK9A 3VZOA 1FOD3 2EVXA 3BTAA 3H8UA 2D7FA 4NN0A 3SEPA 2HWD1 1CAUB 5FLJA 3ZMOA 4SBVA 3ZYRA 1K5MA 5C9AC 1WLTA 2R1BA 4Z82A 1HV0A 3SXWA 4AI0A 1JU4A 3CZUA 3FHQA 3T0DA 4K40A 1LOAA 4QPIB 3Q8FA 5JI7A 3U4XA 1ND2B 2RJLA 3PUIA 4OUSA 1RUD1 2J1TA 1HB1A 3IWZA 4ZXEA 1J59A 4IEWA 5A7WB 4M00A 2XLFA 2PHFA 3O5SA 3KLSA 1W9YA 1UYXA 4META 4XFFA 4COWA 5A32A 1NA1A 4DINB 1FX5A 3DF0A 2P34A 5ABJB 3USSA 1LOFC 1W8OA 1QJFA 3A4UA 2FCVA 4KU8A 3MV11 2X05A 3AKTA 4LBQB 1MS4A 1VBB3 4Q0SA 2O8QA 4NVPA 2ZEXA 3VBFB 4CCJA 2DV9A 2QQJA 3ZYJB 4RS5C 3ACGA 2Q8OA 2Q8DA 1WLWA 5GALA 3H3ZA 3OGVA 4RFRB 4E4HA 3PURA 4BPZA 2A6YA 4H55A 5IAXA 1EPZA 1HLCA 1X9TA 2GN3A 4HVQA 3UETA 1ZZ9A 4RGGA 3BUCA 5I91A 2VNOA 3USUA 3VHPA 4CRQA 4Z1VA 5JAXA 1KRIA 4K20A 5AVPA 2VOKA 4LO4B 1GNZA 1CQ9A 1YQ8A 4L8QA 1J3PA 2VULA 4C8DA 1PNGA 3CJIA 4DY5A 4R9BA 4L0PA 4C1XA 1TQ5A 4QQPA 1FOD1 2A7AA 1OUSA 3U10A 5FZ6A 4CCDA 3JD72 1A34A 5A3PA 1ULCA 4KL1A 1T2XA 2WNVC 3S57A 3O1SA 1OQDA 1WW5A 1GZCA 4CEWC 4K3UA 1HRI3 5GKAC 1PGSA 4IXLA 4RR3B 1WW4A 4AVTA 4BWOA 3POIA 4UW4A 3J7LA 3BIWE 3NV3A 3OBZA 4XFAA 3UNPA 3OB8A 4BIOA 1HN0A 1WWYA 4Q1RA 2OIIA 3BPSA 3H3UA 3KV9A 2ZEYA 1HXS3 5GZFA 3I49A 1G86A 1QOOA 2R0HA 4LORA 4IE6A 4GB32 2WNUC 2Y6FA 5KXEA 1BCXA 1VP6A 2G9ZA 4W6XA 2CGPA 4XTMA 4JGZB 4CCOA 2TNFA 3ZXJA 4ZY9A 2R062 2HWF2 2ZKNA 1YUDA 3UYJA 3I7DA 3IT8A 1AR82 1FT9A 2A6ZA 2EAAA 4KWKA 1PO21 1DGLA 4G9SB 1IOAA 1JYWA 4AEMA 2WA4A 3GBGA 2QQUA 4CCLA 3KVAA 3ETPA 1UMIA 5BNQA 2JDNA 2OZ6A 4WM7B 4ZONA 4FPEA 5FYYA 5E88A 1NLRA 3BYWA 3FL7A 1WCKA 3ZMNA 1CJPA 4AWDA 3H8XA 1H8TC 2BNMA 1OF4A 4MXWA 1QWRA 4GWIA 3B3QE 4PF1A 3VKOA 2XJVA 4KBBA 5CBLA 5FZDA 3L9JT 5FZBA 1WA6X 5HXMA 4Y5Z0 2ZA9A 5BXXA 3AMHA 1NY71 1UIJA 3TOJA 3ZVXA 2WZEA 4AFMA 3V0AB 1JH5A 1E57A 3ASIA 1GLHA 4B8EA 4NROA 3RVHA 4CDQA 1ND3A 2XKOA 1OLQA 4HN1A 3M1HA 2Q8CA 3OUHA 2YFZA 4LBLA 3RRDA 3WZ1A 1KJRA 2CY6A 1QJU1 2QQNA 3AK0A 1HKDA 2UYBA 3MLJA 3N7JA 4Y22A 1ZBA2 3TNQA 4AYUA 4C0HA 1SACA 1ZM1A 2W1QA 2P4EA 4HPKA 3U78A 4CZSA 4GQ7A 2W5FA 4IQPA 4CUGA 3WUDA 1TNFA 1S2BA 2VW0A 2YU2A 2GC3A 1VAKA 4TZDA 1UY1A 2YYOA 1QOSA 2WQZC 1XU1A 4FO9A 2WWUA 1NLSA 5C8CC 1AYM1 1MZ5A 4D6QA 1BJQA 2W9XA 1YEWA 2FQPA 3POEA 4JAAA 3AP4A 3A23A 1Q8PA 1N3QA 1JI6A 2CAVA 1RVF1 3UGHA 5HPOA 2Y38A 2RR12 2PELA 1W6OB 1LHNA 4JCKA 1QNWA 1OBNA 2WSUA 4Q4V2 5DDJ2 1WD3A 1OKOA 1IKPA 3ZXLA 2QQPA 3J7HA 5C5TA 4JGYA 4WZFA 4ZXKA 4B7KA 1VBE2 4EWDA 3IB3A 4RQPC 1GOGA 4XUOA 2JDKA 3TEYA 3VUOA 4CCMA 2XJRA 1YYNA 3LA7A 3HQRA 1V6KA 3ILFA 1H2NA 2VXRA 2ZGSA 4H7MA 5GZCA 5BNPC 2BTVC 3HAGA 1YJKA 2PN5A 4MX3A 1JHJA 2VXJA 2KD7A 1BKZA 3HT2A 4AVVA 2QQLA 4OHYA 3NVCA 3HQUA 1HIXA 1V6IA 2XQXA 3WX5A 3K3NA 2W47A 3B93A 4P9IA 2IVJA 5JPNB 1OPOA 2NQYA 5FQ0B 4JTOA 2YMZA 5J09A 4EN8B 2ZGOA 2YHJA 4BQ5A 2GN7A 5K4LA 1UYZA 1VB2A 3EMRA 5FIXA 2YFUA 3I59B 1WBLA 1CAXA 3CKHA 5FYUA 4Z8BA 1XNBA 2HWB1 2VMEA 1MZEA 1XU2A 4P02B 4PBPA 2EF6A 3ZDSA 3T30A 3M3QA 5EYXA 1O8PA 2PLV2 3GJAA 3V0BB 1X9PA 1OI6A 1R1A2 2XQRA 1ODNA 1W8HA 5EV7A 4XMAA 2CAUA 3KVBA 3M4FA 4HXCA 3SHRA 1RUC3 3LPGA 4CXYA 2ZBJA 3SH4A 1O4ZA 5FBZA 1I1EA 3T2PA 2RS52 3WQ1A 4HMZA 4ARYA 1H1AA 2JDZA 3ROUA 4BLIA 5C9AB 3HN3A 3QH6A 5GM0A 1BBT1 2ZGKA 2QDNA 4XFBA 3N9NA 4EZHA 4DS0A 2ZAHA 1SCRA 1W2AX 5A80A 4LLFA 3PMSA 2WDBA 3ZSMA 4BQYA 1YI7A 1YQCA 3A0NA 3ZLIA 4IV1C 3CLPA 4FFHA 1H30A 2NYYA 3VBSC 2ZMNA 3FFQA 2WABA 4FOYA 4FPLA 4LXLA 3RPQA 3U11A 3WR0A 3ZN6B 1QIQA 5FK8A 2KM2A 4LQRA 3LPFA 2Y6GA 3HJRA 5FJHA 4WVZA 4BQ3A 3ABZA 4R9AA 3B5LB 3LOBA 1HRV3 4KG0A 1AR62 3VL9A 3MIHA 1PK6A 4IE5A 1UMZA 1RUF2 5C3OA 4LHNA 4PI0A 1YRZA 2V5DA 3JBG3 4RS5B 3EBRA 1DFQA 4R9CA 1XBFA 5LBBA 1RHI2 2GNDA 2HWC1 4IEYA 4K1YA 4MV2A 3HD8B 1TME1 4GA9A 5IWFA 1POV0 3IMNA 5IVEA 2WS92 4BDVB 1XB9A 5JOZA 5FY4A 3I2OA 3WDVA 1CZSA 1O7FA 1X8EA 4W50A 3TEWA 4PCRA 4FOQA 1JZ6A 3CJXA 3B9CA 3O1VA 3DPRB 1MEC2 1TNRA 4TYSA 3O14A 1MQTC 2JD9A 4COYA 3K2OA 5CFDC 1JYVA 1RUI3 4F3JA 1RUC1 4Q26A 4X8NA 2FDGA 1DLLA 3P3PA 1VAMA 2WNVB 3VBRC 1KGYA 4CEYC 1W8UA 1BK0A 4CEWB 4E8DA 2XJPA 3W20A 4HBNA 4XYXA 3AMQA 4DNYA 4LLOA 5LATA 3VGIA 2RHPA 1AHSA 3Q8EA 4D94A 3HT1A 1SPPB 2P17A 4PHZA 5F3IA 2AC1A 4QX3A 2RJKA 1R093 4BQXA 2B9UA 4A6OA 2VMHA 1OLMA 2ADEA 1BXHA 5JZGC 1HX6A 3R4SA 5C33A 2RS12 2WFF1 4B1MA 2HWE1 4CDUC 5KXDA 2WNUB 1MS1A 1P8JA 4QKDA 2EIGA 4W4ZA 1ZRFA 4QT6A 3RJ2X 3SKVA 4XUTA 5EXOA 3DYPA 1QH6A 4QGLA 5EHDA 3R6SA 1H1IA 4A45A 4BK4A 5BNNC 5IK4A 2VQAA 2HBUA 4NIHA 4CDWC 1CGPA 3MIDA 1W6QA 3CU7A 5CKMA 3JCIA 3H7JA 3WSOA 4XFCA 4Y5TA 3E6CC 4YW1A 2B46X 1SBFA 2D6PA 1Q8QA 2JG9A 3GBFA 3WNPA 1VRH1 2YDEA 4I3PA 4BXSV 1H8TB 3RI9A 1ZX5A 1XE0A 3T4HB 5APAA 1UD1A 2XBO2 2AACA 1QQP2 2P1BA 3J7NA 3S5QA 4ASLA 4PDWA 3MV01 3WDWA 2GH8A 5T5OA 5K7PA 3E5UA 1LOBA 1Z0HA 1RMU2 2X53S 4BQ1A 2D98A 2E51A 1W9TA 1ZZCA 2A6VA 3J8F3 3MFAA 1CESA 4JDMA 4LBNA 5FPZA 4FP3A 5FZ8A 1G7YA 1UOJA 2ZS6B 4D3WA 5IK5A 1MS3A 1LESA 1RJ7A 4A7KA 3VZMA 4EJRA 1CN1A 2GC2A 1AL23 2AEYA 2YC4A 3MEPA 4LR4A 4YZ3A 4NRMA 5M0TA 3GHNA 4Z07A 1JYNA 2B45X 4UFJA 3APBA 2JKXA 3TEXA 1RYYA 4B4RA 4Q0PA 4RHV2 5DAPA 2FDJA 3WP6A 2VW2A 3AMPA 5EYYA 1S55A 4R8HA 1FV3A 5FPUA 2F17A 4E9KA 2WWJA 1N1SA 3JZVA 4AQ2A 1IPJA 1NE6A 4D6SA 1LHOA 1D4M2 2R073 2R043 3I3MA 1QNYA 4F83A 2VPVA 2CGNA 4L2NA 4YLZA 4JKMA 5FMCA 3KM5A 4WBBA 1KJLA 3NV1A 4YFWA 2MEV3 2QZ2A 2N7GA 1AZDA 4L9BA 2XJTA 5FREA 3ZXAC 3J7MA 4AFAA 4BOWA 3ZFFC 1SDWA 2FHRA 1NE4A 1ZBE1 2DU0A 4YVSC 4OI2A 1POV3 2D3SA 4P5YA 4QX2A 4RQPB 3ZFGA 2QQIA 5F6KA 5AFBA 5KHIA 1TMF3 3KV6A 3IZOA 5L7OC 4M3CF 1NCQA 2X8KA 1Y7BA 2EIDA 4RA0A 3ZFEC 3MDPA 3K4AA 5FY8A 3IDEA 3PTYA 1LOCA 4W6YA 2A70A 1AR73 1A3KA 3EB7A 5BNPB 1W8WA 4DEQA 1COV3 4YG0A 1DQ4A 4Y3OA 1ZNPA 2WZR2 5J37A 1Y9QA 2VMGA 1W06A 1L7QA 4KGQA 5FY0A 1WZXA 1AL21 4NPRA 5T3NA 2DF7A 1T6GC 5BNOA 1UWWA 3OD4A 1N1YA 4FFIA 1RUH3 4KWUA 2C0ZA 4AFDA 1KQRA 5A7OA 5BYNA 4XILA 3DYMA 5FZLA 2XXZA 1VBD3 3LOIA 2WT2A 4QX5A 4PT6A 3T2TA 3JQXA 1ULFA 2DTYA 2OXBA 2GMEA 1UCXA 3ZXEA 4ZKTB 3AZWA 5FPBA 3DUIA 2FMYA 3AZZA 5DAQA 1ZREA 2F4LA 2YPDA 1O91A 3VLBB 5C5UA 5GLUA 4YFZA 1PVC3 2QQMA 4ASKA 3IDAA 2HBTA 4B3NA 3GCWA 3RZMA 5IYYA 3WCRA 1O4TA 1AR93 3ZDVA 1K5MC 3PVEA 1PO12 5FTTC 5LA2A 1D4VB 3BTZA 1POV1 1RJ8A 4PLNA 4IV1B 1G9DA 3ME2A 4UOJA 5JXGA 2XLAA 3VBSB 2JE7A 1Q56A 2XVGA 4IL7A 5FP7A 2HYKA 4CP0A 1IG0A 1W6PA 5FP9A 3AYEA 1LKNA 3GALA 5FFOC 4D69A 1GWKA 3O1PA 1C28A 1NA1C 2HEVF 1LNSA 5ACA2 2JDYA 4XMIA 3BCWA 4Q4W2 1UPIA 3NMBA 5DUXA 3HQXA 3RMYA 4HVRA 5ANQA 4BE3A 1UNBA 2JDMA 1HN1A 2P6HA 3I3DA 1IGOA 1RUH1 4LKDA 3FHIB 2J1EA 4EN6B 1XRUA 4ZS3A 3MI8A 5GLTA 1VBD1 1E5HA 1PGL2 3O1RA 4N53A 5KXBA 2JIGA 1Q43A 3CBNA 1BLZA 1MQTB 4UAPA 3J9SA 3LB9A 5BY5A 2D6MA 5CFDB 1YO8A 3KHCA 5FYBA 1QJY3 4MHUA 4ONUA 3W59A 4E4DX 3PVBB 1W03A 1PIV1 1UF2C 2A75A 4XUQA 3CJIC 4MXVA 3WHTA 1Z7S1 3O12A 4MGKE 1OVSA 4H7LA 3VBRB 4ZU7A 4CEYB 5EIYB 2CDOA 1DG6A 1PVC1 2D6LX 3BPZA 3KGZA 5D8AA 5T55A 3AP7A 5I0SA 2QZ3A 1NAEA 1AR91 5FZ7A 1KDMA 1W0NA 2K2SA 3BU7A 5LY2A 2D93A 3VBHA 4COZA 3AP5A 5H9PA 1DYPA 1KS4A 4IEOA 4P9WA 1A6CA 2OQ6A 3K51A 5FZOA 4XABA 2QJVA 2C9AA 5JZGB 3EXUA 2BPA2 4CP9A 4AI2A 4CDUB 1XSRA 4WVMB 3UJQA 4DQAA 2GP5A 5EJ1B 1JN2P 4NJ4A 3WQ7A 3H1MA 2VZOA 5DMYA 1PM4A 5GZGA 2J1AA 5BNNB 1KD7A 4CVUA 2YUEA 4HOOA 1JZ7A 4ISQA 4GIQA 4CDWB 3UT0A 5KBFA 3RG0A 4URTA 2R6QA 1N47A 1UKRA 1X8MA 4V1PA 1MZ6A 3NAPA 2A6WA 2WAOA 4K8RB 4QHOA 3RZZA 3NRUA 4AHYA 5FP3A 2VUDA 3ZYFA 2W95A 4WVWA 2W92A 4XJ8A 2C5DA 4BM8A 1MPXA 2ZABA 2Y64A 3MO4A 4D7TA 5AC91 1J83A 1VLNA 3N35A 1Q5OA 4AZZA 2EXIA 4LHKA 5A7SA 1V9U3 1QJY1 4OHZA 1RUNA 3SH3A 1UMHA 4XETA 3POGA 1RUE3 4QXKA 3UK9A 4QX1A 1NLQA 1YQ6A 2Y0IA 2RS32 4R9DA 2YC0A 5IT6A 1YFUA 1S0CA 3O7OA 1W05A 4CDQC 2W68A 2VTFA 1CJDA 1ND3C 4LBKA 3THCA 2HWD2 5BUVA 4NIAA 3S7IA 3RSJA 1VBC3 3WG1A 1QJZA 4OI4A 3H42B 1ASJ2 2VGDA 1W9FA 4XZPA 3AZXA 4I0WB 4FVVA 1EAH3 3GCXA 5I0DA 4GWNA 3I2DA 1CZVA 3LGRA 5C3PA 1FXZA 3E5QA 1H1MA 2J42A 5E89A 2P3KA 2E26A 1GQGA 3KS7A 4XF0A 2WLQA 2OT7A 3N9QA 5DXDA 1GWMA 4XUPA 2ZCWA 4OHVA 3ES4A 1S0BA 2VNVA 5DUUA 5FKCA 5FY9A 3BTYA 4MGQA 5JXJA 2XLGA 1SHWB 2XHKA 3ZFFB 1QDCA 3JU9A 3C7OA 2MHFA 5IVBA 4YVSB 2SBAA 4QX0A 1RUD3 3WDXA 5G04L 2VZTA 3JQWA 1H6YA 2W0XA 1VALA 5L7OB 2PQQA 1QU0A 3P6BA 4JGYC 4QHBA 3OYWB 5KC5A 2CU5A 1W2OA 3ZFEB 4FI9A 2OPKA 4AEJA 3E1F1 5C3QA 1C8M3 3ZR6A 2ATFA 2BVBA 4IEVA 1V9U1 2X29A 4LA3A 4NRQA 4WZCA 4YW7A 2WO1A 1RUE1 2QQOA 4A4AA 3BVCA 3NL1A 1PZ7A 2A1XA 1YWKA 2DVAA 2VNGA 2A71A 4IGOA 4N7IA 3V56A 4YARA 4URAA 3BTXA 3P1IA 4UW3A 1W0OA 1PZ9A 4P00B 3VZLA 1OMIA 1C57A 2TUNA 2W91A 4XXPA 4LBQD 1BEV3 2HEYF 5CADA 3ZOIA 1GUIA 5FLHA 1HQNA 2QQKA 1YFWA 4COVA 5E16A 5FK7A 3RZHA 2VMFA 3LZZA 3OEAA 1EAH1 1DGWA 1IPKA 2DUPA 1PZ8A 2FBEA 1RUG3 3AB0A 5JOXA 5B2GB 4JTNA 1BVVA 3M8LA 4GULA 4N90A 4LO5B 2DCYA 4IV3A 3FHAA 1SZBA 3FLTA 4U2AA 5IVYA 1VBB2 2DBNA 3D4KA 4QB6A 4UFKA 3VN4A 5J36A 2UWAA 1W3XA 4OYUA 2ZACA 1FV2A 3ZKYA 1VAVA 1CX1A 1DP0A 4YGDA 1DZTA 1SEFA 5JIAA 1K5MB 3DXUA 2Z42A 4EWAA 1NCRC 1MR5A 1W8FA 1LCLA 1N3OA 2VZQA 4Y20A 5L19A 1OKQA 5H9SA 1ENXA 1EP0A 3PMEA 1LHWA 3AP9A 1J1TA 2P5BA 3HVDA 3VBUA 2W1UA 3HN1A 4L97A 1C8M1 4K9SA 4QB1A 1NA1B 1YXWA 4NIDA 3ZSKA 1HB2A 1CAVA 5DUVA 4QPIA 1C8NA 1POQA 4E2QA 5A3TA 3ZXGA 2IXJA 4ES8A 1GZWA 2IFWA 1PO23 4KWJA 1AF9A 3AYDA 1XE8A 1BEV1 3RYRA 3O1MA 3WW4A 1HRI2 1UQXA 2XB6C 1DYKA 4NHYA 2I45A 1RUJ1 3AP6A 4CXWA 2P3JA 3U07A 5J1XA 1GKBA 5DAXA 4MGYE 5T5LA 4YZ5A 4MGTA 2DYCA 3DPRC 3USUB 1RUG1 1YI9A 1GV9A 2BGCA 2NN8A 3IAPA 1HXS2 1FI2A 3OY8A 4ZS2A 5FUNA 4AL9A 2WRAA 1ZVFA 2P3YA 4A42A 3ZR5A 1ZA4A 2G19A 4HSLA 3P5BA 1H8VA 3CJIB 3NJVA 4IERA 2B39A 4K7JA 4LUMA 5I0RA 3PDQA 1LEDA 3BOPA 4JDOA 4GD4A 1QJU3 3ZN5A 2DCZA 5FZ9A 5A6YA 3WG2A 1D7PM 1UAIA 2ID4A 1MS5A 1T6BX 2X5IA 3MW4A 3SISA 4YG6A 1JMUB 3AVRA 3FE5A 3M3OA 3URFA 3A22A 4JV4A 1NX9A 1BMV2 4OHWA 4PQ9A 2KA3A 2UYAA 2HLEA 3X29B 1ACCA 2WNOA 3DKQA 5FPLA 2OVUA 3HWJA 1BHGA 1AYM3 5LRRA 2VM9A 1I5PA 2Z79A 1X7NA 2BP6A 4Q4Y1 2ZTNA 1DGRN 1QXPA 3F95A 4FAGA 4NOTA 3WP3A 5C6CA 4P5HA 5DG1A 3LE0A 2G1MA 1VPHA 1RVF3 2J22A 5J98B 4UFIA 5I8SA 1WMEA 3EJKA 2IXIA 2OUHA 1ENRA 4GJZA 4LO7A 4Q1PA 4FBFA 3UESA 5FYHA 4EZ4A 5C70A 1VBA3 4WM8A 4HL0A 4E2SA 5GJ6A 2DFCA 1G9BA 4CU8A 2RE9A 4AGGA 3BB6A 3CZJA 1GOHA 2RM23 4HFSA 3WG3A 4HANA 4TTGA 3R4DB 3O1TA 2DWRA 2EA7A 2B7YA 4FAHA 3W9AA 5A6QA 2JG9C 2XL7A 2ZX3A 5KWRA 4MXWB 2KXLA 1MVEA 4BH9A 3POWA 3CDZB 5A3MA 1JYTA 3VBOA 1JUHA 5FZKA 2ARAA 1J3RA 4LHSA 4QHZA 1WMFA 4CCNA 4QX7A 3ECQA 4PDWC 3S5AA 5IVVA 1F9KA 4BJ0A 4CDQB 3RJRA 1XYNA 1ND3B 2E63A 4LE4A 1W28A 1YJLA 1NZIA 2AGSA 3GZUC 3OCPA 2QVSB 3ETQA 3OUIA 4GALA 4PIXA 5FZCA 1JZ3A 4GB33 1UL9A 4UI9L 1JYCA 4Y22B 3RS6A 3WINE 4HK8A 4AF9A 1QEXA 3DCQA 4GH4A 2DVGA 1XJAA 1XC6A 3QBQA 2NMNA 2B5HA 2C6SA 4AI9A 1QOTA 2YV8A 2HWB3 3A7QA 3S0MA 1OUXA 2GSYA 3N7MA 5IVCA 4OI0A 1Q3EA 3MIBA 5FMOL 5FMOS 1PGW1 2LRPA 2BRTA 5CB7A 2E6VA 2WQ4A 1X82A 2XDVA 2BQPA 4BB3A 3FUQA 4BCUA 1DBNA 1W2TA 3WNLA 1VBA1 3HNMA 1BBT3 1YCIA 5F5AA 1NG0A 1SLLA 4CCKA 2W2IA 1U12A 3I2FA 3VD3A 1QDOA 2AENA 4NE9A 1QJX3 2ARXA 2RM21 4Z2WA 5LEJA 2D6NA 2YBSA 2E33A 4M0NA 1B35A 4A41A 3AJYA 5FY5A 2XWBB 3B02A 3JD71 4JGYB 3C2UA 4FPKA 4BK5A 4EE2A 2GMMA 1L3JA 2VOXA 3ZFGC 2HEWF 1AL0G 4LULA 4QQLA 4HKOA 5F5QA 4CTEA 2FZ2A 3D82A 2FDKA 1BK1A 1RB8G 3QACA 1NCQC 1WGPA 3D6EA 1Y9GA 3J26N 4KU7A 1YC61 4Q0VA 5F5IA 3EQEA 5L9BA 2Y34A 4NMIA 3AMNA 4L11A 3KCCA 2V4VA 1XNKA 2VECA 4RL7A 3WF4A 3PUQA 1RUC2 1YIPA 3CL1A 1MS9A 2RDSA 3Q8AA 5FKBA 2JEMA 5K8SA 1W39A 3FJSA 1KXGA 2HWC3 3PJQA 4DZGA 3AXDA 1R082 1WA4A 3AYCA 1TME3 3M3EA 4GB31 4IESA 2VC9A 1Q8VA 4XQWA 5DZEA 4XF3A 1REFA 4RD7A 2XVKA 5BNOC 2R061 4G3YC 1JS9A 2HWF1 1RIRA 4HT1T 1V6OA 1AR81 1W8TA 4E4ZA 3FWEA 5A1LA 5A70A 1ZRIA 1CAXB 1G6NA 4BQ4A 4XXAA 3VDAA 2QBXA 2ZEZA 1JUIA 1XYOA 1JBCA 4BMEA 1W6MA 2BU9A 4EN9B 3I2IA 2J7MA 3OPZA 4MUVA 2XPJA 1LB2A 5FZIA 2VBBA 1HRV2 5A7NA 1UOGA 2BWCA 1NQDA 3ATGA 3GNEA 4MOAA 2B4KA 3H50A 2BNOA 4QAWA 1FPN3 3JBG2 5F5CA 3VD7A 1NCRB 3I2GA 3IM0A 1QJX1 2DUQA 3PUHA 4DO0A 5KHGA 1QXRA 5J48A 2PHDA 1W04A 4OZOA 3VHOA 3LQCA 3RMXA 2EALA 2VBPA 1DYOA 3E5XA 3JB8A 3K4ZA 4GAZA 5F39A 4AR2A 4D6RA 3U0ZA 2WFF3 2HWE3 2E7TA 4OI1A 1UZVA 1US2A 2GNTA 2RJ2A 4XF1A 2GC1A 3WQ0A 4XJWA 3SC7X 2DU1A 2XVLA 5B4XA 4XQDA 1NQJA 3MIFA 2XUMA 5JR2A 1M06G 1EUTA 3W58A 1RUI2 1KITA 3W5NA 1H2KA 1EUUA 1VMJA 2W1SA 1W8ZA 2JDPA 1PK6B 2JECA 3H9AA 2VQ0A 3RWNA 2PHRA 5H9QA 4I09A 4QX8A 3FBYA 5FV3A 2LALA 3OJBA 4IETA 4XIKA 3ZIWA 5FLIA 1SCSA 5IATA 2JG8A 4YW6A 3VDDC 1VRH3 4MYEA 1SLIA 2A3XA 1F15A 2VCAA 3MPPG 4HLTA 2RR11 3I2HA 4ZU5A 2ZPXA 1GP5A 4S2DA 2VY0A 1R092 2FMDA 2J1VA 2TEPA 4I3GA 2VBDA 5FYVA 2WINB 3U1XA 5FZ3A 2W3JA 1AJOA 4N53C 2FCTA 5DDJ1 5FY7A 1GQHA 3WLUA 1C5IA 4Q2FA 2VOWA 1OQEA 2JIJA 1M4WA 1J58A 1RC6A 4Y1UA 1VE0A 4FCAA 1S2EA 4Y1ZA 2BVVA 2P37A 1PVXA 2VUAA 2XJSA 4PF5A 4QDRA 4CUAA 4PI2A 1FPN1 4ZHNA 3W21A 5D8AC 5CISA 1CAWA 1AXKA 3IPVA 2WIIB 3LAGA 4MH0E 2W1WA 3UKTA 4JKLA 3AKRA 3U37A 1DQ2A 4M3CA 4YM2A 2ET7A 4BHPA 3NSTA 3VBHC 3BIEA 4X6QB 4N9HA 4BQWA 2WNVA 2JDAA 4X6RB 1EY2A 1SMVA 4MO3M 5FYCA 2XHNA 1I9RA 3OOXA 4GJYA 4YVWA 5LA1A 2FDIA 1SPPA 4UF0A 2K9ZA 1J84A 1SG3A 1UOBA 3GF6A 3C7GA 2OKXA 4XDOA 1ALYA 2PMWB 3J8F2 5HCBA 2YXSA 4V2VA 4P9XA 3QLQA 3AL5A 1C1FA 5JI9A 2RMU2 2PLV1 3ZIXA 3LDBA 4ZZ8A 5LCWL 1W6QB 1R1A1 1ZBE3 4DRVA 1NYWA 1AL22 1UU6A 2IUWA 5JIUA 2B42B 3S30A 2A5ZA 3NAPC 5HCHA 2C4XA 2RS51 2W52A 5IK8A 2JG9B 2WKKA 4CE8A 1DU3D 2ZGMA 4XFGA 4XPVA 5AVAA 4GXLA 1MZFA 2IWGB 3SMHA 2RDQA 3NJYA 1XXNA 2AH2A 2VZPA 2IXCA 2YGMA 1WKYA 4PDWB 3KZ4C 4CPBD 4JRAA 3WDUA 1ULDA 2R042 2R072 2VR4A 3IN9A 3PUAA 4Q8LA 3VV1A 4S2GA 1W90A 4BQ2A 1J1LA 2G4IA 2PFWA 3O1UA 3OBAA 4IEQA 5A7QA 5HV0A 1OURA 1C5HA 2MEV2 2ZAAA 4AQ6A 5LRSA 1AR61 3IKWA 5EPAA 2GAUA 1UOFA 2C26A 2R0FA 1RUF1 2DVFA 2XR4A 5FDBA 5JXHA 1D0HA 4ET7A 5FZEA 3RZLA 1N3PA 5C7GA 1TMF2 2V4AA 3UGFA 1EV13 2DCJA 1RHI1 4C0BA 3LKJA 4INDA 4AW7A 3AC0A 3KQRA 2XGXA 1W9WA 2VAUA 1YFYA 3FN9A 3LEGA 1AR72 3N9PA 5FPVA 5LK7B 3PNAA 4QM9A 1OXCA 1COV2 3WQBA 4EROA 3W5MA 1HJFA 5C8CA 5FOBB 3MZHA 2BGPA 1DQ0A 3LFMA 4I01A 2JB4A 3RZJA 1MEC1 4M4RA 2WO7A 1QQP3 4YM3A 1AXZA 2JXAA 3E6DA 5T5JA 3KF5A 4QU2A 4CSWA 3S6PA 1DIWA 1U0AA 2VQUA 2HJIA 4KNCA 4JRLA 1S0JA 3N9OA 4TLFA 4YPJA 5FMBA 3ZFGB 1FMD2 5T52A 5I0UA 2YU1A 3LWCA 2KR2A 2VUCA 3S7EA 3TWIA 5D21A 5FAXA 3VKLA 1NCQB 5FCCA 3QH7A 1NXD1 2V73A 4MLOA 5KHKA 2RV9A 4J25A 5FZ4A 1S0EA 1URXA 4P14A 3MIGA 4PLMA 3GYDA 1H4GA 2LTNA 1SLCA 4UFMA
chains in the Genus database with same CATH topology
2D3RA 2RS11 1OQ1A 4AHZA 4BZ4A 2K0GA 5T54A 1PVC2 2ZHKA 2NM1A 4A7ZA 3OBRA 5BNOB 1AR92 1Q8OA 3WVJA 1D4M3 1GBGA 2VU9A 1CX4A 1RL3A 3ZXKA 1MVQA 4CYDA 1EV11 1VJ2A 4XJUA 4F7ZA 3K48A 1WW7A 4AEDA 1LENA 2Q4SA 5L73A 1O3SA 1PIV3 1ZRDA 3DN7A 1Z7S3 4U36A 4LBJA 5LEKA 2NPIA 4I2OA 1DQ1A 2DCKA 4IV3C 4PLOA 1Y43B 3D0JA 3FUOA 3WCSA 3IBMA 2XBO1 1QQP1 1XNCA 1WCSA 2ZOEB 1S1AA 1WLDA 1RMU1 2GZWA 4BA6A 4OUMA 5CAZA 3PVOA 1U5YA 2PHWA 3ZX7A 4UBHA 5IK7A 4CDXA 3VBUC 1REDA 1CPNA 4XBQA 2O1QA 4QD2A 4Q8KA 2BWAA 4IEXA 2AREA 4Q29A 4DOUA 1QJY2 4RHV1 3E97A 1UU4A 3VBSA 3D8CA 1D0GA 1O3RA 2PYTA 2GU9A 1H0BA 4AHXA 2WL1A 3Q9OA 4L92A 3VDDB 1WMDA 1WLCA 4C90A 3HBZA 1D4M1 4LE3A 1KFUL 2R49A 4ORFA 3NKGA 4QPGA 5K0UA 4O9GA 3AKSA 2QKDA 1DGWX 2Q1MA 3ZYGA 3C3VA 2BEOA 3KT7A 5AC93 4N53B 4ES9A 2CWSA 2YZ4A 3UKNA 1O3QA 1UW8A 4B29A 1F31A 5JSRA 1I6XA 4AK3A 4YYOA 5BV6A 3AM2A 4K21A 5D8AB 3ALQA 5GZEA 3G6JB 1F2NA 2EAKA 4YGBA 3AJZA 3M3IA 1F5FA 3VBHB 2X5IC 2XKPA 2PHLA 1XYPA 4XEZA 2D3PA 4LHLA 1SQ4A 3TN92 1IKQA 3ST7A 3NKTA 4WVVA 3D0SA 1LODA 5F1RA 1V9U2 1RUE2 4IEUA 4KGGA 2DVDA 1UX6A 2LM3A 2G9GA 4FOVA 4QM8A 4AXOA 2EXJA 1AX1A 5JOYA 4WM8C 4AVAA 2ZMKA 3SH5A 3JUUA 3NAPB 1AX2A 1VBC2 1H9WA 1KS5A 2QNKA 4YW5A 1NZCA 4QQ2A 5BPXA 4I0BA 5F9TA 3I54A 4N43A 2WA3A 4AGVA 4FOWA 1C4RA 2I2SA 1EAH2 4PBOA 4GMP1 4HVOA 2ZX4A 4TSVA 3MPBA 3SCFA 4XE9A 4JDNA 1PO11 3WHTA 1WD4A 5C4WA 1W6NB 2NMOA 3VBOC 3UKVA 4GKXA 3MLKA 1IQAA 4MSVA 3ZXFA 4J1WA 1OHFA 1OOPA 5ACA1 5LK5A 4Q4W1 1RUD2 2AUYA 4GH4C 4XJZA 2OW4A 4Q4X3 1LOEA 2ZGPA 1AYN3 3KT4A 4HZFA 1W0PA 3ZSJA 2PHXA 5KHHA 1LU2A 2OUJA 1PGL1 4AI8A 2R32A 5KHGA 2ZGRA 4KG8A 4B7EA 3B9IA 4S2FA 4K6BA 3FLRA 2VW1A 2YY1A 1NXMA 4XF9A 2QFEA 1MS8A 2OA2A 4W6WA 2CWMA 1LULA 1LGCA 4AGRA 1B35C 3O0VA 2CGOA 3E6BA 4LT5A 3WW2A 1UPSA 4BMBA 3MW3A 1LHVA 2SLIA 4K1ZA 2IZWA 1DHKB 1O4YA 1FOD2 3AFGA 4JQRA 4H14A 5AFEA 2G9FA 2WWSA 2F4PA 1I3HA 2GC0A 3ES1A 3RI8A 2DURA 4Q0QA 4XQ4A 5TSWA 1RUJ3 3GHMA 4K8FA 4NHLA 2JENA 1H9PA 1AJKA 4XF4A 2IXKA 5JLVA 4Q4X1 3R4UA 1AYN1 4YM1A 4LO8A 3ILNA 5JVVA 1IS3A 4CP2A 5CFCA 1DQ6A 2WT1A 1F5JA 1FYUA 2Y0OA 4IV3B 3N3HA 2WSVA 2UY9A 2VUJA 4ZU4A 1PO22 3BALA 4B4PA 3M2MA 4R4ZA 1LR5A 2PA7A 1YFXA 3ZO0B 1O5UA 4FPHA 2RS31 1CAUA 3V64A 4Y1YA 2IC1A 4Y20B 4XFIA 1CIWA 4Q4Y3 4GKYA 5HBAA 1REEA 1UIKA 4FTEA 5A32B 3VBUB 3WXPA 5F6LB 2ZX1A 1ND2A 1NY72 5L36A 1V6MA 2JKBA 4YSFA 3ELNA 1ASJ1 3J4UH 1CAVB 1PK6C 4I0AA 4HSJA 1GZWB 5ABJA 5DUWA 5DG2A 1JW6A 1LRHA 1QJU2 5I93A 2PAMA 3KT1A 2D6KA 1IZ3A 1OA4A 1ZZ7A 4LBQA 3A0KA 4MVTA 3VBFA 3O0WA 2DUOA 2JG8C 4OFGA 1H2MA 4SLIA 2XG3A 4C91A 1KDKA 3QD6A 2I74A 1GR3A 1AYM2 1ZZ8A 1IS6A 1LU1A 3OY8B 1LGNA 1PGW2 2IXLA 3CEWA 4AE2A 1GICA 4FPOB 4TWTA 3MF9A 1FATA 1RVF2 3VKNA 5I8YA 2BUKA 5SV5A 1VBA2 4XJ9A 3AKQA 3ZXDA 1DGRA 2H0VA 2X5IB 4XFHA 4QQHA 2RM22 4W65A 2VNRA 2CV6A 5J7MA 3B69A 2H6BA 2ILMA 3NV4A 3LA3A 4RR3A 3TAYA 5EFUA 3VKMA 2VOVA 1ZRCA 5GLWA 4FT8A 1W2UA 3N7KA 2C1FA 4OLLA 4YVWC 4AEKA 4M01A 4YM0A 5T5PA 4OHXA 2WLPA 5KXCA 4WM8B 4Y1VA 1CONA 4JGZA 5HCFA 4QGMA 3WOGA 3B7MA 3JD73 1UU5A 3QCWA 5FO7B 3ZYIB 4Z92B 1VBB1 4XOGA 5HI0A 2JX9A 2HWB2 2JD4A 1NOVA 2HKXA 1H4HA 1S0GA 2NLRA 4H3WA 4I30A 4WM7A 4DPNA 2UU8A 2YPJA 4QPYA 4XJAA 1FAYA 4NR1A 3DKWA 3VBOB 4AQTA 1J3QA 2ET1A 1R1ZA 5GZDA 4EWEA 1BBT2 3KSCA 3V0AA 1ZYBA 2R063 4G4FA 4HPKB 2HWF3 5H9RA 2V5YA 4AHWA 1QJX2 3NWKA 3AXEA 1A8DA 1AR83 3VHNA 4YW4A 4GH4B 2D5HA 1GANA 1H2LA 4D7YA 3MICA 2Q0AA 4MZUA 3GZAA 1PM7A 4OZXA 2UY8A 2NP0A 1HRI1 2GALA 3OF1A 1ULGA 1BVP1 3WNXA 4S2HA 1PHMA 2GH2A 4NO4A 1V6NA 1OFSA 2R1DA 1HXS1 5FRAA 3N4MA 2HWC2 2ENRA 1TME2 1S0FA 1X33A 4Y24A 3TBDA 4DY3A 2VH9A 3ENRA 1B35B 1W6OA 2H0BA 1JOJA 2BFUL 2BFUS 3IDBB 3VZKA 2MNGA 1ZBA3 2PAEA 4MGIE 4DXZA 3KCXA 1JXNA 1RTVA 2W39A 1BMV1 2E7AA 3TB0A 4AFBA 4RFT0 1FPN2 1SLAA 4XIOA 3P3NA 4GWMA 4Q0UA 3H1YA 2RR13 4FTSA 4HETA 1JYIA 4BYYA 3LA2A 3KGLA 4EV0A 4Q4V3 5DDJ3 5FQ0A 2WFF2 1JHNA 1S0IA 2HWE2 2XH6A 1CD3G 3NV2A 3R0RA 4ISRA 2ES3A 1VBE3 4P9LA 1W6MB 4AEDC 3I59A 1IHMA 4KQ7A 3V0BA 3B00A 4R52A 3I4IA 3WY6A 2D97A 1LECA 1D2SA 1PNFA 1VRH2 3DL3A 1ENSA 3MFCA 3PHMA 5C9AA 5CNAA 3L2YA 2WJSA 3EO6A 3FC0A 1ZBA1 2GNMA 1HQLA 1R083 1BQPA 4NWWA 1OPMA 1NCRA 5SV8A 3UV9A 2PTMA 1V6JA 1DZQA 4FQ4A 4UW6A 4CDXC 3NJZA 4UW5A 4J1XA 3ZN6A 3FX3A 2B8MA 1QGLA 1LOFA 3AZVA 2PLV3 1XNDA 3WG4A 3LSDA 1R1A3 4NHKA 5FOJB 3CF6E 2A3YA 2JG8B 3PJYA 2RS53 4AVSA 4J6GA 4RS5A 2A73B 5CG8A 2YGLA 2I07B 4Y1XA 4QPGC 4Q4V1 5K0UC 4FXKB 4X8PA 2CNAA 1XE7A 1OA2A 2D40A 3FBMA 2PHTA 5FO8B 2XL9A 3MIEA 1ZRRA 1VBE1 1HDKA 1PMIA 4I02A 1SBDA 4AVBA 2UWBA 4D7SA 3FFZA 3DPRA 2GNBA 1G9CA 2EXKA 5C8WA 2V09A 5GLZA 4OULA 3CNAA 1AR63 4ITCA 1CAWB 1RUF3 3IPVB 1ZBE2 3CO2A 2ZGQA 1U5IA 1S0DA 2QCSB 1SFYA 4CEWA 4M3CB 5A3LA 2VG9A 1RHI3 2WNEA 4YZ1A 1R081 3TRSB 2D44A 4FPCA 2WS93 2CTVA 4F8AA 3OD0A 2O0OA 1XQNA 2ZHLA 2D43A 3HR9A 4XHBA 1IS4A 4AG4A 2XJQA 4YVWB 5I0TA 3DV8A 3AMMA 5CA6A 4JC1A 1MEC3 4N9IA 2WNUA 4YNIA 2W08A 2ZGUA 3LSEA 1RINA 5JR7B 1HRV1 4DMIA 4P9GA 2D5FA 4FPJA 2ZHMA 1V6LA 5K9YA 4N43C 3JBG1 1QF3A 1IS5A 2ZMLA 1VB4A 3RYKA 2WZPP 1EV12 4E2GA 2WC2A 4XBLA 1U5XA 5EJ3A 1H8TA 4IEZA 1OD5A 1LJ7A 1SFNA 1RUOA 3THTA 4DFSA 2RS13 5C4WC 3N7LA 3QOPA 4FTBA 3M70A 1ENQA 3TNPB 2UWCA 4YZ2A 1RUI1 3VZNA 4GMP0 4QQOA 1N1VA 4M3CE 1OOPC 2Y26A 3GBWA 1MACA 4QGNA 5CVRA 4XDQA 1SLTA 3AX4A 2DTWA 2RMU3 2WS91 1Y3TA 1I5ZA 3FMGA 1C1LA 3MF6A 2QE3A 2IXHA 4IEPA 1R091 2XBO3 5C8CB 3N36A 2Q30A 2A6XA 3VL8A 2WT0A 4XBNA 2P2KA 4WV8A 3T1MA 2PAKA 3OTFA 3PLQA 1RMU3 1OSGA 1V70A 1WCDJ 1RUH2 2AR6A 4PIZA 1VIWB 2E53A 3ZN4A 3WUCA 4OVEA 4ATFA 4DRRA 2LUWA 1VBD2 4AFCA 4N7UA 5HXVA 1UZYA 4FSJA 1RITA 2PHUA 4NWVA 5EWSA 3POYA 1O3TA 4YG3A 1CPMA 3B94A 2NZ9A 2ETEA 4RQPA 4RHV3 4DB5A 1PIV2 4ASMB 1Z7S2 1YNAA 1HQWA 1YLLA 4A7YA 3INAA 4UXAA 2OZJA 2P3IA 5BNPA 1QY4A 3BODA 3UL2A 1GZ9A 3D5OA 4PJYA 2XWJB 1A8MA 3GZTB 3I8TA 2CL2A 2D6OX 1LOGA 5I8TA 3WP4A 3J8F1 2BBVA 1C3HA 4AQSA 2DCTA 2RMU1 4FPGA 2Z5WA 4AEDB 3SCGA 1MS0A 3WW1A 2JE9A 1DF0A 2YROA 2F6BA 5CFCC 1FMD3 3OGGA 3ACLA 1D2QA 4BIFA 3KB5A 3WW3A 1UKGA 4FP2A 1QKQA 2ZKLA 2ZZJA 4MGZE 2WZR3 1AX0A 4AI1A 2R071 2R041 4R4XA 4A2UA 5DZGA 3IDCB 1W6PB 5AC92 1OLRA 2MEV1 4FPYA 5JDBA 5JCTA 1SLBA 4IV1A 4CDXB 3DGTA 1FNYA 1DZRA 1WBFA 1N1TA 4LNVA 4QPIC 1Z78A 1ND2C 3ZSLA 1TMF1 2GMPA 1FNZA 2QUOA 3AKPA 4YW2A 4M0HA 3IIAA 5ABJC 1AR71 1COV1 4XHXA 3AFKA 3POSA 3VBFC 4QPGB 1BYHA 5JOWA 5K0UB 4GMP3 1OA3A 1UZZA 1PO13 3O0XA 1YHFA 1G8WA 4LUKA 3VDDA 5KC6A 3ZSEA 3T1LA 1LHUA 1RGSA 3M7AA 2ZJCA 4HN0A 4YRDA 1FMD1 1MQTA 2AYHA 1X36A 4C1WA 3SLIA 4BLJA 5CFDA 1G9FA 1CR7A 2FZ1A 2VVDA 1LEMA 3L2HA 2DFBA 2Z2SB 3MYXA 3VHRA 5A33A 1ULEA 5ACA3 2WZR1 4NHMA 3VBRA 4Q4W3 2JJ6A 1HV1A 4CEYA 3WP5A 3WDYA 4QMAA 3HIFA 2WFPA 2Z69A 5CIRA 4KWLA 2JICA 3WT3A 1DDLA 4FPFA 3NW4A 4FXGB 3FLPA 5HCAA 2H6CA 4RR3C 2BYVE 5E8AA 4AI3A 1BZWA 4HKWA 5JZGA 1JTZX 3RYPA 3WDTA 3PVNA 4WVMA 4CDUA 3ZYPA 1QXJA 4E27A 1ZZ6A 2Q5TA 4LEJA 1O5LA 4UBGA 1VR3A 4YW3A 5BNNA 3H0OA 4JGZC 4AVCA 4CDWA 4LO6B 1AVBA 2TBVA 4N43B 5CG9A 4Y4YA 4ATEA 1AUYA 4EN7B 1OFNA 1G9AA 2DVBA 1TEIA 4Q4X2 1EYBA 1AYN2 3G7DA 4WM7C 1KFXL 2E9QA 2R16A 1WUVA 4P9YA 5C4WB 3KD4A 2OYZA 1QH7A 4LA2A 4RSUA 1V00A 4YGCA 5J96B 3NO8A 3TN93 1S2KA 4LBMA 4KH9A 2R30A 5J3UA 4FQZA 1W6NA 3SCHA 1GFF2 3H7YA 4YZ4A 1OOPB 3ZPYA 2ZZQA 1UN1A 3B01A 1SBEA 3R05A 4XTPA 2E7QA 2VVFA 1YIFA 1C8M2 1EPWA 3MLLA 5GLVA 2ZX2A 3RQ0A 1F8VA 3MGUA 1TE1B 3MW2A 2VVEA 1ZZBA 5FPXA 4A3XA 5DZFA 5T50A 2ZGTA 3VKFC 3RDIA 2XJUA 3OBTA 1BEV2 4B4QA 4EN0A 4HKLA 2O8OA 2RS33 3BOWA 2ZX0A 5E1RA 1AXYA 1RUJ2 1WW6A 1A78A 2EXHA 1ONAA 2UURA 2GDFA 2BNNA 3WV6A 2HWD3 3JB4C 2A3WA 3AZYA 3ZFFA 1RUG2 1HW5A 1GNHA 1X50A 4YVSA 3HMYA 3KCYA 1ASJ3 1APNA 3FZ3A 3OGJA 5JSPA 4JVAA 5L7OA 3WD5A 3M3CA 3OYWA 1CVNA 2ARBA 3ZFEA 5JMCA 2ZHNA 3WHUA 1B09A 4Y26A 5JSOA 3TN91 4LTAA 3SNMA 4Q27A 2CYFA 3THPA 3H1WA 3RNSA 3KMHA 1Q8SA 2BW8A 2MPFA 2AZ5A 2Q1ZB 1U5ZA 3ILRA 4XW3A 2QDRA 5FO9B 4Q4Y2 4O9EA 5EZWA 2ERFA 1DQ5A 3EHKA 3SITA 2IFRA 3VZJA 1GSLA 4LBOA 4COUA 4YGEA 2ZGNA 3LCPA 1VBC1 1QMJA 2VMIA 5JPMB 5CFCB 5JWPA 4RGAA 4PIYA 3UJOA 4E4SA 1LTEA 1LGBA 1GYKA 4L99A 3V65A 1QHDA 4CP1A 5CU1A 3AYAA 5D1IA 5IUQA 2ZGLA 3TYJA 4P9JA 5KHJA 4HK9A 3VZOA 1FOD3 2EVXA 3BTAA 3H8UA 2D7FA 4NN0A 2HWD1 1CAUB 5FLJA 3ZMOA 4SBVA 3ZYRA 1K5MA 5C9AC 1WLTA 2R1BA 4Z82A 1HV0A 3SXWA 4AI0A 4K40A 1LOAA 4QPIB 5JI7A 3U4XA 1ND2B 2RJLA 4OUSA 1RUD1 3IWZA 1J59A 4IEWA 4M00A 2XLFA 2PHFA 3O5SA 3KLSA 4COWA 4META 4XFFA 5A32A 1NA1A 4DINB 1FX5A 3DF0A 2P34A 5ABJB 3USSA 1LOFC 4KU8A 3A4UA 3AKTA 4LBQB 1MS4A 1VBB3 4Q0SA 2O8QA 4NVPA 3VBFB 2DV9A 3ZYJB 4RS5C 2Q8OA 1WLWA 5GALA 3H3ZA 4BPZA 2A6YA 4H55A 1EPZA 1HLCA 2GN3A 4HVQA 1ZZ9A 4RGGA 5I91A 2VNOA 3USUA 3VHPA 4CRQA 4Z1VA 5JAXA 1KRIA 4K20A 5AVPA 2VOKA 4LO4B 1GNZA 1CQ9A 4L8QA 1J3PA 2VULA 1PNGA 3CJIA 4DY5A 4R9BA 4C1XA 1TQ5A 4QQPA 1FOD1 2A7AA 3U10A 3JD72 1ULCA 4KL1A 2WNVC 1OQDA 1WW5A 1GZCA 4CEWC 4K3UA 1HRI3 5GKAC 1PGSA 4IXLA 4RR3B 1WW4A 4AVTA 4BWOA 4UW4A 3NV3A 3BIWE 4XFAA 4BIOA 4Q1RA 2OIIA 3H3UA 1HXS3 5GZFA 1G86A 1QOOA 2R0HA 4GB32 2WNUC 5KXEA 2CGPA 1BCXA 1VP6A 4W6XA 4XTMA 4JGZB 2TNFA 3ZXJA 2R062 2HWF2 2ZKNA 1YUDA 3I7DA 3IT8A 1AR82 1FT9A 2A6ZA 2EAAA 4KWKA 1PO21 1DGLA 4G9SB 1IOAA 4AEMA 2WA4A 3GBGA 5BNQA 2OZ6A 4WM7B 4FPEA 5E88A 1NLRA 1WCKA 3ZMNA 1CJPA 4AWDA 1H8TC 2BNMA 4MXWA 1QWRA 3B3QE 3VKOA 2XJVA 4KBBA 5CBLA 3L9JT 4Y5Z0 2ZA9A 5BXXA 3AMHA 1NY71 1UIJA 3TOJA 3ZVXA 4AFMA 3V0AB 1JH5A 1E57A 3ASIA 1GLHA 4B8EA 4CDQA 1ND3A 2XKOA 1OLQA 4HN1A 3M1HA 4LBLA 3RRDA 3WZ1A 1KJRA 2CY6A 1QJU1 3AK0A 3MLJA 1HKDA 2UYBA 3N7JA 4Y22A 4AYUA 1ZBA2 3TNQA 4C0HA 1SACA 1ZM1A 4CZSA 4HPKA 4GQ7A 4IQPA 3WUDA 1TNFA 1S2BA 2VW0A 2GC3A 1VAKA 4TZDA 2YYOA 1QOSA 2WQZC 1XU1A 4FO9A 5C8CC 1NLSA 1AYM1 1MZ5A 1BJQA 2FQPA 4JAAA 3AP4A 1Q8PA 1N3QA 2CAVA 1RVF1 2Y38A 2RR12 2PELA 1W6OB 1LHNA 4JCKA 1QNWA 2WSUA 4Q4V2 5DDJ2 1WD3A 1IKPA 3ZXLA 2QQPA 4JGYA 4WZFA 4ZXKA 4B7KA 1VBE2 4EWDA 4RQPC 3VUOA 2XJRA 1YYNA 3LA7A 1V6KA 3ILFA 1H2NA 2VXRA 2ZGSA 4H7MA 5GZCA 5BNPC 2BTVC 3HAGA 1YJKA 2PN5A 4MX3A 1BKZA 3HT2A 4AVVA 4OHYA 3NVCA 3WX5A 1HIXA 1V6IA 3B93A 4P9IA 5JPNB 1OPOA 2NQYA 5FQ0B 4JTOA 2YMZA 5J09A 4EN8B 2ZGOA 2YHJA 2GN7A 1VB2A 3I59B 1WBLA 1CAXA 4Z8BA 1XNBA 2HWB1 1MZEA 1XU2A 4PBPA 2EF6A 3ZDSA 3M3QA 5EYXA 2PLV2 3V0BB 1OI6A 1R1A2 5EV7A 4XMAA 2CAUA 3M4FA 3SHRA 1RUC3 2ZBJA 3SH4A 1O4ZA 5FBZA 1I1EA 2RS52 3WQ1A 4HMZA 1H1AA 2JDZA 3ROUA 4BLIA 5C9AB 3QH6A 5GM0A 1BBT1 2ZGKA 2QDNA 4XFBA 4DS0A 2ZAHA 1SCRA 4LLFA 3PMSA 3ZSMA 1YI7A 3A0NA 4IV1C 3CLPA 1H30A 2NYYA 3VBSC 2ZMNA 3FFQA 4FOYA 4FPLA 3RPQA <