4RHV1

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv100
3ZFGA 2HWD2 5DDJ1 3J8F1 1POV3 1NA1B 1OOPA 4YVWC 2VQ0A 2RS13 1VRH2 4RQPB 1ND2C 4PDWB 1R1A3 4AEDC 1PO11 1VBB2 1PGL1 4CEYC 1AR71 1R091 2BPA2 1R081 2PLV2 2HWF2 1TMF1 1MEC1 1BBT2 5L7OA 1NG0A 2X5IA 4CDUC 3JBG1 2BBVA 2R073 1PVC2 1RUD2 1COV1 1QJY2 1ZBE1 1DDLA 1AYN1 3VBFC 2WFF3 1EV13 4Q4Y3 2RMU2 4QPIC 4GMP1 1NY71 4Q4W1 1AR93 4YVSB 1RUC2 1AR83 4RHV2 1Z7S1 1ZBA2 1RUE2 2HWE3 1F8VA 1V9U3 4RS5B 4WM8A 5FMOL 3VBOC 1AL0G 2HWB3 1FOD3 1ND3C 2R063 1NCQB 5BNNC 1VBD1 4NWWA 1RMU3 1FPN3 4CDQC 1TME2 1M06G 1ASJ2 4GB33 3ZFGB 1RUJ3 1SMVA 2RS52 1OOPB 1QJU2 1B35A 1RVF1 3TN93 1VBB1 2FZ2A 3VBHA 2MEV3 2PLV1 4RR3A 4CDXC 1VAKA 1BBT1 1HRI3 1RUG3 4Q4X1 1RUD1 1CJDA 5L7OB 1VBC3 2X5IB 2WLPA 4WM7B 2RMU1 2WS92 5JZGB 1H8TC 1RUC1 4JGZC 2XBO3 1RUH2 1ZBA1 1RUE1 3J8F3 1PO21 1PGW2 4QPGC 3ZFFA 1HXS3 3CJIC 4N43C 4WM8B 1PO13 3JD71 1K5MC 1MQTC 1AR73 1R093 1R083 5C4WA 1OPOA 5J96B 1NCRC 1HXS2 5ABJA 1BMV2 2RR12 2HWC2 1C8M3 1VBE2 1FMD2 3FBMA 4CDWB 3JBG3 2WZR1 5BNPC 1RUI3 1ZBE3 1AYN3 5K0UB 4AEDA 1PIV1 4GMP3 3VBRC 1D4M2 1AYM2 2BFUS 1B35B 4Q4V2 5D8AC 4CEYA 1RHI3 1QJX2 1Z7S3 4RR3B 3VDDA 2R042 4CDUA 4IV1B 2RS33 5ACA1 3VBFA 1C8NA 4QPIA 2RM22 1RUH1 5AC91 1BEV1 3ZFEB 1QQP1 5CFCA 1RUF1 3IDEA 4Z92B 2Y26A 2RS12 3VBOA 1R1A2 1RVF3 4YVSC 4JGYA 5C9AC 4Y4YA 5C4WB 1GFF2 4Q4X3 2GH8A 4CDQA 1VBE1 4NWVA 5ABJB 3LOBA 2R072 3NAPB 1EAH1 1NCQC 2WFF2 1EV12 4Q4Y2 1VBA1 4FTBA 4FTEA 1D4M1 1AYM1 1W39A 1AR63 5A32B 1AR92 3ZFGC 5BNOB 1A6CA 4CDXA 1AR82 1HRV1 1OOPC 2HWE2 1V9U2 2ZZQA 2HWD1 2HWB2 3VDDB 3VBSB 1FOD2 4CDUB 3JD73 2RM21 2R062 5FOJB 1VRH1 3VBFB 5LK7B 1RMU2 3DPRA 1FPN2 5L7OC 4WM7C 5JZGC 2HWF1 4GB32 4QPGA 3VBUC 2RS11 1E57A 1RUJ2 2WZR3 4N43A 5CFCB 1R1A1 3TN92 1PIV3 2ZTNA 2BFUL 1PVC1 1K5MA 2MEV2 4CEWC 1QJY1 1QJZA 5C8CA 3JB8A 1HRI2 1RUG2 4JGYB 1AL23 1VBC2 4IV3A 4CDQB 1WCDJ 4RHV1 4GH4C 5DDJ3 1HQNA 5ACA3 2BUKA 3VBRA 5D8AA 4CDWC 2XBO2 1BEV3 5CFDA 3J8F2 5K0UC 1RUF3 1TMF3 1MEC3 1FOD1 1TME1 1ASJ1 1PO12 2DF7A 4N53C 2R061 1PGL2 4YVWA 1AR72 1R092 2RS51 1COV3 1QJU1 1R082 4RR3C 1ND2A 1POV0 4IV1C 3DPRB 1C8M2 3HAGA 1NA1C 4GB31 4Q4W3 5A33A 3JBG2 3VBHB 1RUJ1 1RUI2 1EAH3 1VB4A 1ZBE2 4RQPC 1AYN2 4PDWC 4QPGB 1VBA3 1NY72 2MEV1 2XPJA 3ZFEC 2ZAHA 2WS91 1CD3G 1RHI2 5C9AA 1HRV3 1Z7S2 5C8CB 1VBD3 1NOVA 2HWD3 4EJRA 2RS32 1PGW1 4IV3B 5C4WC 5ABJC 4FSJA 3ZFFB 2XBO1 3NAPC 1OHFA 1VBB3 4FTSA 5D8AB 1ND3A 1BMV1 1HXS1 2PLV3 5BNNA 4RS5C 2HWF3 2RR11 5CFDB 2HWC1 1BBT3 1RB8G 1RVF2 1FMD1 1IHMA 5BNOC 1PVC3 1RUD3 1QJY3 2RMU3 4YVWB 2IZWA 1C8M1 4Q4V1 4Q4X2 3VBSC 1ND2B 3VDDC 4AEDB 4WM7A 4LLFA 1RUC3 5JZGA 1RUI1 3VBUA 4CEYB 1QJX1 4BCUA 2WWSA 1X33A 4RHV3 5A33B 1ZBA3 1RUE3 1PO23 2R041 4CEWA 1AR62 1RHI1 5CFCC 1PO22 1H8TA 4QPIB 5C9AB 4JGZA 2X5IC 2RS31 1TME3 1POV1 1ASJ3 4GH4A 3JD72 2FZ1A 2RS53 3CJIA 4JGYC 1QJU3 3VBOB 4CDWA 1MQTA 5K0UA 1NCRA 2WZR2 1ND3B 5GKAC 5BNNB 4WM8C 1PIV2 2R071 5J98B 2QQPA 4N53A 5BNPA 2WFF1 1EV11 4Q4Y1 2WS93 1HX6A 4IV1A 2TBVA 1AR91 1NA1A 1AL22 1AR81 1RUH3 5AC93 4GMP0 5DDJ2 1QQP3 2HWE1 4RQPA 1V9U1 5ACA2 4PDWA 3VBUB 3JB4C 3S6PA 4CDXB 5FMOS 3DPRC 1AR61 2HWB1 1B35C 3ZFEA 4Y5Z0 3VBHC 5AC92 4CEWB 1BEV2 1VB2A 1QQP2 1RUF2 1RMU1 1AUYA 1FPN1 1F2NA 2RR13 1TMF2 1MEC2 2HWC3 1H8TB 1VBE3 1FMD3 4JGZB 1COV2 4GH4B 5C8CC 3TN91 4N43B 3CJIB 4YVSA 3NAPA 1D4M3 1AYM3 4Q4V3 4Q4W2 4IV3C 4SBVA 1K5MB 4RS5A 1EAH2 1MQTB 1QJX3 1HRI1 1RUG1 3ZFFC 1NCRB 1VBA2 5A32A 1X36A 2R043 3ZXAC 2GSYA 1VBC1 5BNOA 1NCQA 3M8LA 4N53B 5CFDC 2RM23 5BNPB 1HRV2 1VBD2 1VRH3 3VBSA 4RFT0 1AL21 3VBRB
chains in the Genus database with same CATH superfamily
4Q1RA 5DDJ1 4XABA 1XC6A 4YZ2A 4URAA 1ULEA 5JXJA 1KJRA 2XUEA 3FJSA 2VQ0A 3ZXGA 2RS13 3A22A 2WZ8A 4AGVA 3NV3A 3MW4A 2ERFA 4YFZA 3ZN4A 1PO11 3U10A 4MX3A 3VDCA 1VBB2 5FLHA 1PGL1 3LA3A 4W6XA 5EV7A 2DCTA 1E5RA 3GALA 5GZGA 2PHTA 5T5PA 2WBKA 1BBT2 1YIFA 3C8XA 4QU2A 3A0NA 2A75A 3MGUA 3ZLIA 1G86A 5F5AA 1JW6A 1PMIA 1LOGA 3OEBA 1LRHA 3AMQA 1X8MA 1DDLA 3ZXLA 1QHDA 4I0BA 3ASIA 3GZTB 1EV13 2ADEA 4ATFA 4QPIC 2ZBJA 4BISA 2XL9A 3CO2A 1FNZA 5B4XA 1CZTA 3WF2A 2ZEZA 4C90A 4FQZA 3B5LB 5IK8A 4YVSB 2P1BA 4PI0A 4ARYA 4IE0A 1XXNA 1RITA 2DVDA 2JIGA 1AR83 2W46A 3FHQA 5J1XA 3ITQA 3RFRA 1NZIA 1RUE2 4V2VA 5FMOL 2R30A 3VBOC 3RZKA 3BPSA 2ET1A 2XWJB 3AP6A 4NRQA 2UYAA 2OXBA 2W47A 3IKWA 2NMNA 1H9WA 2WN2A 3WP3A 4UFMA 1VBD1 4IEVA 5BNNC 4QPYA 4V1PA 3WHUA 4CTEA 2EAKA 3J7HA 4WVVA 1W6PB 1LEDA 3QOPA 1W9YA 4LR4A 4FAHA 2JG8A 1W6MA 1RUJ3 4GWJA 3VHRA 4B29A 2TUNA 4AI3A 1OOPB 1XRUA 2D6PA 3PUSA 3RI8A 2FZ2A 4GALA 3O0WA 4FT8A 3I54A 3AP5A 4D6QA 3VL8A 2PLV1 3LPGA 1NLRA 3O5SA 5C7GA 1VAKA 3TNQA 3B00A 4XFHA 3POBA 5AVPA 1GWMA 4QKFA 3IN9A 1C5IA 2J1VA 1J59A 2P34A 2VMCA 4PBPA 1PZ8A 4IEUA 4HETA 5KWRA 4I2OA 3M7AA 2R6QA 4W8JA 1VBC3 1MS8A 2X5IB 1JU4A 1ZYBA 2VMGA 4Y26A 3ZDVA 5JZGB 4FPKA 4FOWA 5IFTA 5FMDA 1RUC1 1UOBA 4HSLA 2G9ZA 4JGZC 4LBJA 1EUTA 1RUH2 1TZOA 2OZ6A 3J8F3 2Q1ZB 2MNGA 2E26A 3KHBA 2GAUA 1A3KA 2E51A 4HVQA 4IEOA 2RJKA 3PVEA 4D8MA 2P2KA 4EWAA 1QOOA 3I3BA 1O3TA 1AXYA 3JD71 1GZWB 4A42A 5EQUA 2ZA9A 4YG0A 3WSOA 1H1AA 1BMV2 1NCRC 1DGWA 4J1XA 2JDKA 3NJXA 3AMPA 1DLLA 3ZYPA 4XUTA 4I3PA 3H8UA 1C8M3 5FZCA 3T4VA 2JIJA 5CBLA 2ETEA 3MUY1 4UFIA 3BTYA 5EWSA 1ZA7A 1YFWA 2LS6A 1AYN3 2YU1A 3POSA 4CP2A 1AYM2 1ONAA 1W9FA 1EY2A 1VP6A 2ZKLA 4Q4V2 3VZOA 4DRRA 4Q27A 3U11A 1UNBA 5JPNB 3O1SA 3PVNA 3UKVA 4CVUA 5CISA 1ULCA 1V0AA 2C6SA 1YFXA 2WA4A 3E6DA 4PT6A 1Z7S3 4CCNA 2Y8KA 4RR3B 3VN4A 1UYPA 2JD9A 3ETQA 4RL7A 1YXWA 3UGHA 4JRAA 2ZJCA 2WT0A 1ENSA 2KR2A 3S7IA 1IG0A 2ZHNA 3WNLA 2CTVA 5ACA1 4Y20B 3GZEA 3EHKA 4IXLA 5IVFA 4EN6B 3AVRA 2ZXQA 3Q8AA 5DAPA 4CCLA 5HXVA 3WDWA 2Z69A 2BW8A 4HBNA 4LO6B 4IEWA 3OY8A 3WY6A 2PHDA 1LU1A 3DL3A 1HDKA 3KB5A 2ADDA 4LEJA 1YQ8A 5E8AA 5IW0A 4SLIA 4P00B 5FZLA 1UOJA 1P8JA 1S2KA 5FYBA 2X53S 3UETA 4P5HA 5I0RA 1S0GA 3PUHA 4L99A 5BY5A 4GAZA 4B4QA 1G9CA 2J1SA 2PQSA 3VB9A 1POQA 3THPA 4Z07A 4JGYA 1JODA 1JZ3A 1XU1A 4YRDA 2NQYA 3FLTA 2VU9A 3RJRA 1JZ6A 1IPSA 4HLTA 5IK7A 2EICA 2W87A 3I2IA 3BKZA 2HYKA 1VBE1 2ZMLA 3D82A 4HKOA 4NWVA 3ZYGA 3ST7A 1PK6C 4QM8A 2D98A 3BTAA 1JYNA 2WT1A 1VBA1 4FTBA 2V73A 2VULA 2OYZA 1D4M1 4MGSA 2GNBA 2VTXJ 4D0QA 1RUOA 3HOBA 3C7HA 3POYA 2XQXA 4CDXA 1W8OA 5A6ZA 2YU2A 1I1EA 1MS9A 3VKFC 1V9U2 2ZZQA 3SH3A 2PXJA 3D5OA 3B3QE 4HANA 5KXEA 4LIVA 2VQTA 4JX0A 2HWB2 3VBSB 2LRPA 4X8NA 4XDPA 4CDUB 4EV0A 1NE4A 4QB2A 5BPXA 3VD4A 5FZ3A 2JDYA 3MIGA 3N7MA 4BYYA 3C7FA 4ES9A 4GXLA 2IUWA 3HT2A 5LK7B 3IT8A 1RMU2 3DPRA 3USSA 1JYWA 2VZUA 4Y3OA 2JWPA 4DFSA 1XNBA 3O7OA 1LJ7A 3JCIA 1XNAA 2RVAA 2DUOA 3DV8A 3BUCA 4QPGA 2RS11 3K77A 4N43A 1NKGA 1OVSA 1Y9QA 3SH5A 3C7OA 1NQDA 3E5QA 4Q8KA 3TN92 4N90A 3S5AA 1PVC1 4RA0A 5E89A 1GP5A 2MEV2 2ZGKA 4MH0E 4Y22A 5FZ0A 5GLTA 1XNCA 1JZ8A 2F6BA 3RNSA 5C8CA 1CJPA 4UFLA 1UY0A 2QTWB 1MVEA 4OMCA 1WCKA 3OOXA 1QEXA 2BWCA 4TTGA 4B8EA 1GOHA 2VNRA 3D0SA 4XZPA 1GANA 1QH6A 2NMOA 2ZKNA 4IE5A 4UAPA 1BVP1 3SNMA 4AXOA 4RHV1 3A21A 5FYCA 2QBXA 3INAA 2PHUA 1O59A 3MIBA 4QQPA 4JKLA 5IFPA 2BWAA 2ZGMA 3LDBA 4PHZA 1O3QA 2KA3A 4BQ2A 5FZHA 1AJKA 3K75B 1Q8OA 2A6WA 2AENA 2P4EA 2WLQA 4QM9A 2FDHA 1WLCA 2WNVA 1BEV3 1O91A 1G7YA 1LHNA 3PLQA 4FP3A 3WDXA 5FAXA 3IIIA 3M3CA 2JX9A 2WNUB 1UMHA 3WEZA 4AHWA 2BU9A 5A1FA 2VTXA 2W39A 1W2TA 2DF7A 4N53C 2XJVA 5KHJA 4LHLA 1AR72 1R092 2H0BA 1JOBA 5GZEA 1IQDC 4BK4A 4QDRA 3ZN6B 2ZEYA 4OMDA 4OULA 4Q1PA 1ZZ8A 4IL7A 2JKXA 4Q4W3 5A33A 3VBHB 4W50A 3ZVXA 1RUJ1 2D6OX 4P02B 2VMIA 2XJTA 4NAMA 4DEQA 4RQPC 3CZUA 5EYYA 3BI3A 1NY72 1CPNA 5FZFA 2XPJA 1MS4A 3ZFEC 5CG9A 4A3ZA 3IIAA 4UF0A 1U5XA 4O61A 4MXWB 2GP5A 4LHNA 3ZM8A 5F5CA 4X8PA 2YBKA 3NSTA 1HRV3 4OHWA 5IJRA 4CU8A 2CSGA 3S5QA 1OD5A 3LKJA 4LKSA 1NOVA 1US3A 1A78A 3KM5A 4BU2A 5FDBA 4NRPA 1F35A 2OPKA 2LTNA 1H4GA 2OX0A 3NV4A 1VMFA 4C0BA 2PFWA 2YFUA 1W6PA 5ABJC 4FSJA 4XF0A 3ZFFB 5F3CA 3HBZA 2VZVA 4LIUA 1O3SA 1OHFA 1VBB3 3Q9OA 4FTSA 1UY1A 2A3WA 5D8AB 1FX5A 2JB8A 5FLJA 5BNNA 2WSVA 1WCSA 1W8TA 1SFYA 1BBT3 3IZOA 3OBZA 3I2KA 1O4ZA 3KZ4C 3OGRA 2DU0A 2YB7A 4ZZ8A 4BQ1A 4TSVA 4Q0SA 1S0FA 1AXZA 1O4TA 1GOFA 4OUMA 1RINA 1UZYA 3U75A 1X7NA 2V5DA 1C8M1 3GBWA 4DS0A 5IUQA 1ND2B 4B1MA 3PDQA 4AEDB 4FPFA 5JZGA 3VBUA 4NO4A 4CEYB 4BCUA 2WZPP 2P3KA 2ID4A 3CBNA 4BM8A 2A6VA 4NROA 1RUE3 4FOYA 5FZ9A 2OPWA 3IPVB 4AVCA 5FK7A 4FPGA 1AR62 4OCTA 4AGGA 3TNPB 4HXCA 3UGFA 4XUQA 2LM3A 1JUHA 4LBLA 3NQHA 5A6YA 4XJUA 1PO22 2ZGTA 3OBTA 1W6NB 1XE7A 5FYZA 3UKNA 3CKHA 2HEVF 2Z42A 4JGZA 3VKLA 3ZR5A 3WZ1A 1E5IA 1POV1 1BLZA 4W6YA 5GLWA 5A7NA 1Y7BA 1SFNA 2QQJA 3VZNA 2C5DA 1ULDA 2JE9A 2D43A 3PIGA 4NVPA 3LDKA 1VE0A 3F2ZA 3ETPA 1S0JA 1S0DA 2YZ4A 2OS2A 3LWCA 4YYOA 3W5MA 1ZZCA 1H6XA 2FMDA 3ILFA 3P3NA 5FWEA 4FXKB 2YUEA 3WF1A 1NCRA 4QXKA 1ND3B 5KHKA 5F9TA 1W06A 2VTFA 4YG6A 4ZXKA 1JTZX 1YQ5A 2D6LX 2WWJA 2J1RA 5LA1A 3O1UA 5FZ8A 2R071 3AVSA 5LY2A 4AOCA 1GWKA 1WBFA 3VZKA 2P3IA 4UOJA 2W94A 5JMOA 4Q4Y1 5L9VA 1HN0A 2J1UA 5K9YA 4HOOA 5ERLA 5CIRA 4EROA 2E32A 2DUPA 1LECA 2ZPXA 3BCWA 1VR3A 1NA1A 4XPVA 1DQ2A 3I3DA 1RUH3 2Y60A 2JG8C 2QQUA 4XC9A 2HWE1 2Y6GA 4PDWA 3IDBB 5B2GB 1V00A 4JDNA 3ES4A 4NHYA 1E5SA 3BOWA 4MUVA 4FPEA 2DURA 4XW3A 5JUVA 1AZDA 1OI6A 2DUQA 4XJ9A 5FPLA 1VB2A 2VW2A 1WWYA 1QQP2 2GDFA 1RUF2 1PX3A 4TXWA 3J4UH 1AUYA 2XVKA 1FPN1 4IQPA 1C57A 3WDTA 5F3EA 1SLLA 1MEC2 3HQUA 5FJKA 1S55A 1V6KA 4XTMA 5T55A 4ZKTB 3PTYA 3VD5A 4QHZA 2CV6A 2EA7A 3DKQA 2VZTA 1COV2 5IVCA 2VOKA 4GH4B 2W1SA 3ZKYA 2ET7A 2R0HA 3OTFA 5F32A 4BLIA 2VOVA 1SLTA 1UL9A 2G9FA 4FAGA 1HKDA 2Y6KA 1AYM3 4XBQA 4S2GA 4Q4V3 4H14A 4UI9L 2OUJA 4G4FA 4IV3C 4DQAA 1K5MB 2QQLA 2ZABA 2C9KA 4RS5A 1EAH2 3Q8EA 4QHOA 4FOQA 1FI2A 3ZX7A 1S2EA 4U2AA 3WQ7A 4E8CA 3FC0A 2P3YA 1BK1A 1MPXA 1A34A 3GZAA 1BZWA 3M8LA 4LMFA 5DQ0A 2CGOA 5CFDC 2KD7A 1QDCA 4OHZA 4LKEA 1VRH3 2OIIA 3GGLA 2QQKA 3VBSA 3RDIA 3AFKA 1WLDA 3JQXA 1DGLA 2XJUA 3C7GA 5J37A 4WVMA 4JKMA 1HN1A 4BB3A 4K20A 4J25A 4COUA 3DGTA 4YVWC 3POEA 1OH3A 4B4PA 2D6KA 1LHWA 2VMDA 3C3VA 1AX0A 1XYPA 5DABA 2VVFA 5FXWA 3ZSLA 4F8AA 2D3SA 2WO1A 3I2OA 1GV9A 1R081 2YG0A 1UOGA 4ATEA 5CNAA 4KU8A 2AREA 2NN8A 5GLVA 5I0TA 5T54A 2QNKA 4E9KA 1OUSA 3JBG1 5M0TA 1CAUB 1OVPA 1RUD2 4BQYA 5KXDA 4ZY9A 1QJY2 1ZBE1 5IAVA 3HN1A 4H55A 4OHVA 1DQ4A 3T2QA 1EYBA 2UWAA 1MZ5A 3KWVA 5IT6A 2V4AA 2D93A 4X6RB 1U5ZA 2ZX3A 4Q4W1 3WCRA 3VDBA 3MICA 3AZXA 4XHXA 2UWCA 4QWNA 4ARXA 4GKYA 4V2WA 3M3IA 2ZX4A 4RGKA 1V9U3 4D6SA 4WM8A 4MVTA 4E27A 1JMUB 1PMJX 1F4HA 2HWB3 1WD4A 2VCAA 2I07B 4JQTA 5FK8A 2Q1MA 2WNUA 1ZRCA 4AFCA 1QXJA 1N1TA 1VJ2A 1NCQB 4MGIE 5FZ1A 3TRSB 5JMCA 5JLVA 2Y6HA 5A3LA 1RMU3 2H6CA 1YI9A 2P6CA 4XHBA 4AR2A 2VZRA 1FNYA 5FZDA 2EXHA 2ZGPA 4S2DA 1AXKA 1ASJ2 1LOAA 1W0PA 3AP4A 5FY9A 4RFRB 1M06G 2BNOA 5IHRA 2DCZA 3ZFGB 3VV1A 2BVVA 1QJU2 1B35A 2OT7A 1RVF1 1BKZA 1MS1A 4LBOA 1OXCA 1KXGA 1VBB1 2WWUA 3AKTA 2ZMNA 3PUQA 4M00A 4UWDA 3TN93 2W92A 3VBHA 2MEV3 4BXFA 4DRVA 5L19A 1W2AX 5C3SA 1LHVA 3DYOA 2D5HA 1I6XA 4FPCA 4CDXC 4HVRA 2BOIA 4MGZE 5EP9A 1BBT1 3NMBA 4Q4X1 4QGLA 3Q8FA 2BDRA 4CXXA 4DY5A 5L7OB 2SBAA 2UU8A 3O1VA 4JVAA 1YFYA 4YSFA 2WLPA 4WM7B 3WNOA 3GBGA 5G05L 2WS92 2ZHLA 1SEFA 2WNEA 5C3QA 2C9AA 1H8TC 2G9GA 5CEHA 4CUCA 3CF6E 2P37A 1OFNA 3ZMOA 2WZEA 4YPJA 4CE8A 1EUUA 3WP4A 4BDVB 2Y0IA 1RUE1 2VGDA 4QPGC 2BEOA 3ZFFA 2XG3A 4G9SB 4N43C 4PLMA 2VAUA 4R9BA 3ES1A 3PURA 1CONA 4JTOA 1WGPA 3SC7X 5IATA 4Y4RA 3I4IA 4OLLA 2VVEA 2P3JA 3ALQA 1AR73 1R093 4XIKA 5FZ7A 4N9IA 5FYTA 2BJSA 4YW2A 1W2OA 1OPOA 3LCPA 1HXS2 3KLSA 5ABJA 5J96B 3MEPA 1ZRDA 2RR12 3NNMA 1KFUL 3H42B 3H50A 4Q5OA 1B09A 2ZGLA 1FMD2 3FBMA 4M4PA 4AI9A 4CDWB 2WZR1 5EZWA 3LEMA 5JOZA 4P9GA 1ZREA 5K0UB 3VL9A 4AEDA 1PIV1 4GMP3 1LGNA 4XETA 3C7EA 4CEYA 3LAGA 1ULGA 3OBRA 5FPAA 1QJX2 3AZVA 1YCIA 1K45A 4TLFA 4NHLA 4YGEA 2WL1A 1J3RA 3D3AA 2IXIA 4GJZA 4WBBA 3SCHA 3I59A 1CR7A 2Y64A 3SCFA 3VBFA 1LU2A 3RGBA 4QB1A 2RM22 4LE4A 2LALA 3NWKA 5FYHA 3OUHA 3T2OA 3AX4A 4M3CB 1E5HA 2A3XA 2GC1A 3K3NA 3ZYJB 1RUH1 2JEMA 1F4AA 1L7LA 2JDAA 2XJRA 3H3UA 5IVBA 5J3UA 1XNTA 3ZYRA 4CU6A 2MPFA 4QGNA 3UESA 3OD4A 5FYIA 2P5BA 3GZUC 4DUVA 1CAVB 1OFSA 3WLUA 4OFGA 3WT3A 1R1A2 1RJ8A 2ZX2A 3KD4A 4R9AA 4YVSC 4PQ9A 1UF2C 2BTVC 3OUIA 3ROUA 3UYJA 5FY7A 5JI9A 3KCYA 4XFGA 1CAWB 2JG9B 5FIXA 1W6QB 4MXVA 2A3YA 1YFUA 3I3MA 2QFEA 5C4WB 1WW6A 1UCXA 4CDQA 1JOJA 1YHFA 2RE9A 2XLGA 3JQWA 5H9QA 5BXXA 3ZSMA 1Z0HA 1ZZ6A 4ASKA 3LOBA 3N4MA 2HBTA 5LBEA 4ZS2A 2G4IA 4LK6A 2WFF2 3GCXA 4LITA 2VZSA 4IE7A 1H0BA 1OQDA 3WQ1A 3LDRA 5HV0A 5AFBA 1AYM1 2PYTA 3GF6A 1Y3TA 1W39A 3M3OA 1AR63 4JTNA 5A3NA 5FO9B 5IVEA 1W9SA 5LK5A 2DCJA 1AR92 3SMHA 2HJIA 1L7RA 2AR6A 1UYZA 2ZOEB 1A6CA 5BNOB 1OOPC 3KT1A 1QIQA 3NVCA 4MLOA 4YARA 5KHHA 3BIEA 1WA4A 4DXRA 1PMHX 5EPAA 2GC3A 1RXFA 2Z5WA 2HWD1 3VDDB 2DDUA 3FMGA 3R0RA 3ZIWA 2CHHA 3O0XA 2I2SA 3G6JB 4XJAA 2R062 1KS5A 1XJAA 4ZXEA 3W21A 4EE2A 1VRH1 5HCBA 2QZ2A 4XAAA 1UPIA 3TWIA 4LXLA 2D44A 1F15A 3S0MA 5JIAA 1DIWA 5FOBB 2DTWA 1XB9A 4OVEA 3Q8CA 3RQ0A 4COVA 4BQ3A 2RDSA 3HIFA 5JZGC 2ZHKA 2TEPA 2HWF1 3VBUC 2XVGA 1LKNA 1E57A 5FYYA 4E2QA 5JAXA 4HN0A 5CFCB 1MZ6A 5F1RA 4JC1A 3AZZA 2E33A 3KGLA 5F5QA 3FHAA 1ZX5A 2ZTNA 3P1IA 2XJQA 1UW8A 1K5MA 1U0AA 2XUMA 1XSRA 2CU5A 5DUUA 4PIYA 3ZN5A 4AQ2A 5EJ3A 1N1VA 5J36A 5FWJA 2WYFA 4ZONA 1HRI2 1RUG2 1SPPB 1CZSA 1MVQA 2NYYA 1BXHA 5C6CA 4IESA 4IV3A 3PVOA 1W0NA 1DP0A 4XF3A 2VJXA 4FFGA 2BUKA 5FZIA 2YMZA 1CESA 4UW4A 5LBBA 3USUA 3AKSA 4QMAA 3U37A 3IDAA 4OUSA 5I0SA 4ONUA 1Q8PA 3HVDA 2VMEA 2PN5A 1WW4A 3N9PA 4F83A 1X50A 5CFDA 4I3GA 4IETA 1CX1A 1RUF3 4AFBA 2VOWA 4YGCA 4RGAA 3WNXA 2FDFA 2JDNA 3I2FA 4TZDA 3P3PA 4CYDA 4J6GA 1MEC3 4AQTA 3HR9A 1TME1 3ELNA 4RSUA 2VOXA 1PO12 2VCMA 2ATFA 1W90A 3MYXA 1PGL2 2WN3A 4YVWA 2QVSB 2RS51 2ZAAA 4OZXA 5FYSA 1COV3 1J3PA 1H2LA 5BV6A 5C71A 2UYBA 5JXHA 4LHKA 4RR3C 2PAMA 3N9OA 5FZBA 3ZSEA 3LIHA 4XQDA 1POV0 3WUCA 4XAEA 4HL0A 4KG8A 1H30A 5FP7A 1NA1C 2FMYA 2ZHMA 1XE0A 3I2DA 1REEA 3ZYIB 1RUI2 1EAH3 5E1RA 1UX7A 3IM0A 4PDWC 1KD7A 3ACLA 3U14A 1K3IA 2MEV1 5J7MA 3PIJA 5FZOB 2XMLA 5HCFA 2DVBA 4S2FA 2K46A 1BK0A 1RHI2 3KS7A 4LBQB 4XDQA 4AG4A 3LEIA 2YXSA 1OQEA 5C9AA 1IPJA 2JICA 1WKYA 4QXBA 1DQ5A 3H3ZA 2E7TA 1W05A 3TEXA 4COYA 3PU8A 4KI5M 4EN0A 3L2YA 4EJRA 1PGW1 2IXCA 3MLLA 4FPJA 4IEPA 1N1SA 1OQ1A 1H1IA 4ZZ5A 4MGQA 4MV2A 1BYHA 4CU9A 1QNWA 4YW6A 2PQQA 2BP6A 2GNMA 4D94A 5C3PA 1H1MA 2DU1A 4YM2A 5BNQA 1D2SA 2ZACA 3LEKA 2YROA 2PHWA 4GZ9A 2VC9A 4RS5C 4BE3A 2GALA 2HWC1 5GZCA 3OYWB 3RVHA 5FUPA 2FCVA 2Q1FA 3ZDSA 4YZ1A 1KDKA 1CQ9A 1YJKA 5KHGA 1RB8G 1IHMA 2TNFA 1D0HA 4GJYA 4DOUA 5KXBA 1RUD3 4LO4B 3KV6A 4YZ5A 1QJY3 1YJLA 5A7WB 4Q0UA 1WMDA 2AUYA 4GA9A 2IZWA 4ES8A 1QOTA 5FRAA 3LD8A 2Y6JA 4WVZA 5F8PA 2ZS6B 2PTMA 3VBSC 4WM7A 2RJ2A 1UAIA 3GXUA 4GIQA 4LLFA 4AL9A 1EPWA 2DTYA 2WWSA 3J26N 2QKDA 1UZ0A 2RDQA 2DBNA 3PHMA 2R041 5DAQA 3U1XA 3E5XA 3ZXDA 4P9XA 4CEWA 2XR4A 1XSQA 3N3HA 1FXZA 1LEMA 3I3EA 5IVVA 3AZYA 1W03A 4NIDA 3A7QA 5JOYA 1DGRA 5T5LA 1H8TA 4NHMA 4MHUA 5HCAA 2Z2SB 3ZOIA 4FOVA 2R1BA 4W6WA 1O7FA 3HN3A 2ZEWA 1ASJ3 1W9TA 4HG6B 1YYNA 1SDDB 3LSDA 3JD72 4R4ZA 2FZ1A 1PK6B 1DU3D 3MF9A 5JSRA 1QJU3 4INDA 2GH2A 4IGPA 4C0HA 3WX5A 4CDWA 1SQ4A 2Q8EA 4AYUA 4QQOA 2VUJA 4B4RA 3OPWA 4AVTA 4AVVA 5K0UA 2AACA 4DUWA 3I7DA 3VKMA 1F31A 1VPHA 2C4XA 3WW4A 3GHNA 5GKAC 2ZGUA 4Z82A 2K2SA 4AE2A 4WM8C 4UFJA 1RUNA 1RJ7A 4XDOA 3WUDA 4CCOA 3LOIA 3WCSA 2Y34A 3CZJA 3RZHA 4URTA 3H1WA 3UGGA 3OGJA 1X9TA 1EV11 3K51A 2YC0A 2WS93 2WNUC 1HX6A 1OLMA 2GN3A 5HBAA 2BNMA 5FPBA 3AYAA 1URXA 1OLME 2TBVA 4BA6A 2QJVA 3V0AB 1AVBA 1CWPA 1AR81 5AC93 2EAAA 4CPBD 3M70A 5ACA2 2O1QA 4YNIA 5A3TA 3JB4C 2Y0OA 4K21A 4H7MA 4AI1A 1DYPA 2BNNA 1AR61 2VBPA 1B35C 1G9BA 2IFWA 5LEJA 3N7LA 1OLQA 4F3JA 4LPLA 3VBHC 3I8TA 5ANNA 2UURA 4UBGA 4C91A 3KVAA 1JZ5A 4KL1A 1I9RA 1KS4A 1PVXA 1PHMA 2RR13 1AHSA 1X9PA 4AVSA 1TMF2 1H2KA 1KQRA 3ACHA 4HT1T 4YZ3A 4RGGA 4P9JA 2WNOA 3TB0A 3WG3A 3K48A 1FMD3 2W68A 4LOTA 1RIRA 3F95A 2E6VA 3LF7A 2PHRA 1WLTA 3OSDA 4Q26A 2YC2A 3PUIA 5I0DA 3DN7A 1ZZBA 2BGOA 3AXDA 4AHYA 4K3UA 3CJIB 5T52A 4YVSA 4BIFA 2YYOA 1C3HA 3IMNA 5HCHA 4AVBA 5F2SA 4XF4A 3ME2A 4SBVA 4G3YC 1MQTB 1QJX3 4QKNA 2W95A 5A3PA 3ZFFC 2VG9A 1H6YA 4CP1A 2R32A 1VBA2 2VZ3A 4FFFA 5JSPA 3V64A 1AX1A 3PUAA 1PX4A 3ATGA 1VBC1 2OKXA 4LTAA 4PLOA 4MO3M 4YGBA 5BNOA 1CGPA 4TYSA 2QQVA 3THTA 3UKTA 4N53B 1HIXA 4AQ6A 2RM23 5BNPB 1A8DA 1PM7A 2CAUA 5C8WA 2VECA 4Q29A 1UU6A 3SKVA 5FO8B 4RFT0 1WD3A 3T2TA 3FX3A 1VMHA 3VBRB 3LSEA 3P6BA 4RYDA 1O5UA 3J8F1 3G7DA 1JHJA 1OOPA 1UMIA 5FY4A 4HK9A 4UYBA 2A73B 4RQPB 1ND2C 1R1A3 4AEDC 3T0BA 1KEXA 1OKQA 4CEYC 4YLZA 2PAEA 5A1AA 3A23A 1CAXB 2BPA2 4CCDA 3ZYBA 5FZMA 1PNGA 1LHUA 4AHZA 2FBEA 2ORXA 4GWNA 3ZKUA 1MEC1 4Y33A 3HNMA 1U5YA 1LOFA 3NW4A 1WW5A 2X5IA 1JN2P 3THDA 5FPUA 4OYUA 2DVFA 3H8RA 3U78A 3VLBB 2BBVA 1PVC2 4NN0A 5IVYA 1YWKA 3VHNA 1COV1 1APNA 1GYKA 1AYN1 1SPPA 2WFF3 1UIKA 1HQWA 3T08A 2E53A 3VBFC 4QDSA 1OT5A 2RMU2 5K8SA 3U0ZA 1EPZA 2QQMA 4CP9B 2GNTA 5L36A 3K3OA 4I0WB 4W4ZA 3ZSJA 3H7JA 1AR93 2YHJA 3CHXA 1DCSA 5ANQA 3GM8A 4Q0QA 4RHV2 1HB2A 4YZ4A 1Z7S1 1L7QA 1ZBA2 2YPDA 4GD4A 4BXSV 1F8VA 2ENRA 3AL5A 4FXGB 4BOWA 1UYXA 1AL0G 4IE6A 4O65A 1RC6A 1GZWA 4KWKA 4QX5A 5EJZB 2D6MA 1QNYA 1UKGA 4DUXA 1WLWA 3KV5A 4OQ8A 5APAA 1IGOA 2ARXA 1ND3C 2R063 1ST8A 3CEWA 3MFAA 2ES3A 4HPKB 4NWWA 5FMBA 5CZKA 4OI4A 4CDQC 2J1EA 3AP9A 2XOMA 4IGOA 1JBCA 4I30A 4E8DA 4D69A 3HT1A 5CYYA 3B01A 5JPMB 4QQ2A 2KM2A 5DPNA 1FT9A 1GNZA 1O8PA 4Y1YA 2DCKA 2IXKA 1CPMA 3WOGA 1JU3A 5JWPA 2K9ZA 3IMMA 3ZYHA 3GNEA 3AM2A 4QD2A 4IEQA 5DUVA 4QX1A 2R7EB 5I8TA 1ODNA 4JCKA 1G9AA 1RXGA 2FD8A 1UU5A 4D3WA 3NNLA 3ORJA 2G1MA 4RR3A 4MGKE 4A41A 1GICA 1HRI3 1RUG3 1N47A 1O4YA 3AK0A 4XF9A 5C70A 5FZOA 3HNYM 3TEWA 1RUD1 5AVAA 5FUIA 3MF6A 5F6LB 1WBLA 4Y20A 3PJQA 1N3OA 4LKDA 5E6HA 3U4SA 3DUIA 2D3RA 4CCMA 5A3UA 4QX7A 2W2IA 3ZXKA 5LA0A 1OF3A 3BALA 4HKWA 1Q5OA 2B8MA 1YNAA 1IQAA 2XB6C 2XKPA 3D6EA 5LBFA 4Z8BA 3CJXA 5JXIA 3LA2A 3LIGA 1J58A 1ZVFA 4CUBA 5DAWA 1HJFA 1JOPA 1HJGA 2CDOA 1SCSA 2OUHA 3HPNA 2GC2A 4H7LA 1NXD1 2VD7A 4BIOA 2YBSA 2ZX0A 1PO13 4KG0A 4E2GA 1K5MC 1MACA 4R4XA 4UXAA 2X05A 4LNVA 4XF1A 2LROA 1GUIA 3BTXA 3OYWA 5F2WA 1MZEA 1X8EA 5BYNA 1YUDA 2FCTA 4KGGA 3T30A 4P08A 2RDNA 4XURA 2HEYF 3HQXA 5T5OA 2GN7A 4EWDA 2XH6A 1RUI3 1GP6A 3T1LA 2Z4FA 1W6MB 1WUVA 1HV1A 3D8CA 2Q8CA 1W99A 1HB4A 2F4LA 5BUVA 3ZR6A 2IVJA 1QXPA 2WA3A 2LW8A 3DXUA 1RHI3 2D40A 1MS0A 4GULA 4JZRA 1JYIA 2YDEA 4IEZA 2HYXA 1GZ9A 3KCXA 2HKXA 3MV01 4CDUA 5I0UA 2FHRA 1SDWA 3ON7A 5E88A 4A6OA 4IV1B 5KHIA 3SITA 3WW3A 1STMA 1QH7A 3ILNA 5A1LA 3LGRA 1XBFA 3J7NA 3UK9A 3ZXEA 3LPFA 5C3RA 4XUOA 1G8WA 5LCWL 3POIA 4NRMA 5DAXA 4YW5A 5FP3A 1UYYA 4NHKA 4K40A 5FZAA 1BEV1 2NPIA 5AC91 3U4XA 1SLBA 2B4KA 5I8YA 1LAJA 2OQ7A 4LORA 1UZWA 4EWEA 3IDEA 3RMYA 3LEGA 2CWSA 4Z92B 1TQ5A 1W8HA 3M4FA 3J7MA 5G04L 1ZRIA 4AAPA 2AEZA 3OPZA 3J9SA 1AJOA 1W6OB 4BMBA 4XTPA 3E97A 5FR3A 4K8RB 4OI2A 4Z2AA 5FY8A 3MDPA 5C9AC 4M3CF 3AKPA 1SCRA 2GH8A 5CADA 5GM0A 1W2UA 2R072 3N9MA 3NAPB 3O0VA 1VAMA 1NCQC 4NPRA 5H9SA 4BLJA 1NXMA 4Q4Y2 4A6SA 1W3XA 2JXAA 2WQ8A 3ACIA 2H0VA 1ENQA 4FTEA 4QKDA 1A8MA 4TLGA 1K42A 3D4KA 1BMV1 1XYNA 4PI2A 4YGDA 2QQNA 4LK7A 4NPLA 1GZCA 5FCCA 1T6GC 1W8FA 3KV4A 4ZU7A 4NUBA 1I5PA 3WF4A 4XUPA 3ZFGC 4AEJA 4E4HA 1HRV1 5JSOA 3VKNA 2HWE2 1VIWB 3OBAA 1WA6X 4UW3A 3RYRA 4CCJA 5JOXA 3NJVA 3I2GA 5F3IA 4CP0A 3NNGA 3BPZA 1FOD2 3WHTA 5LRRA 2A6XA 2ZGQA 3ZN6A 3JD73 4QX0A 2RM21 2E31A 4AGRA 4CUGA 2XL7A 5FOJB 2Y6LA 4QHBA 1GLHA 1BJQA 3B9IA 3SISA 2WO7A 1FPN2 1GU3A 4E4SA 5L7OC 2EALA 1UQXA 3AKRA 2GC0A 2ZGNA 4FPLA 4L2NA 4XACA 2E9QA 4WM7C 3H3LA 1YRZA 3NJYA 1C5HA 1UXZA 3OY8B 4XQWA 5E16A 4GB32 5I8SA 3S57A 4CXWA 3TAYA 3RG0A 4CZSA 1QGLA 3DXTA 2NZ9A 1R1A1 3MFCA 4QXCA 3ZIXA 4GKXA 2JE7A 3RI9A 4MXWA 4QDQA 4KWUA 5CKQA 2GZWA 2VZQA 4CEWC 3ACFA 2X8KA 2ZZJA 3GJAA 1S4CA 4JGYB 5FP4A 4YM1A 4OI0A 3T0DA 5KR7A 1Y43B 3QH6A 1FATA 2V09A 2C1FA 5FYUA 4ZHNA 2JENA 1LOEA 2DCYA 5JR7B 1HQNA 4L8QA 1JYCA 4QB6A 4LBQD 4CSWA 1RL3A 1H9PA 2V72A 1DYKA 2O14A 3JZVA 5ACA3 3VBRA 1N3QA 5IVJA 1GZTA 1EP0A 5D8AA 5CB7A 2W52A 3NNFA 4R52A 1S1AA 1Q8VA 5A80A 4CDWC 2XBO2 4PBOA 5EFUA 3KF3A 3A4UA 3KGZA 1F9KA 5K0UC 5JI7A 2JB4A 3DEMA 3IBMA 2PA7A 1QMJA 1TMF3 4LBNA 4XCAA 2HLEA 2RV9A 1OMIA 4L11A 1GWLA 5CU1A 3IAQA 3EYPA 2ILMA 2R061 2CNAA 1W8NA 4HKLA 5EHDA 3X29B 3CLPA 2XLAA 4YWAA 2B9VA 1R082 2Q5TA 4N7IA 4XXPA 5H9RA 5KC5A 1ND2A 4O9GA 4KH9A 5A7PA 2QE3A 1TNRA 5DN2A 3ACGA 4Y1UA 3FFQA 4I02A 3DPRB 4CCEA 4M0HA 3C2UA 3HAGA 4PLNA 3RZMA 3JBG2 3IPVA 1ZBE2 5FPXA 1SFPA 2OW4A 2WFPA 4QPGB 2BERA 2WABA 1VBA3 3B02A 4JHTA 1DLCA 1AX2A 2EIBA 3I2JA 1Q8QA 3BVCA 1U5IA 3H8OA 3VGIA 3QBQA 2ORZA 3E6BA 3TEZA 2L9LA 4L9BA 1CIYA 1H4HA 1W6NA 4W65A 4FFIA 4Y22B 4YG3A 2CGPA 3CL1A 5F5IA 5C8CB 1ZRRA 1V6LA 3SHRA 4JQRA 3PMEA 4HFSA 4XILA 4P9WA 3NO8A 4AF9A 3N36A 2RS32 4NJ4A 4EZHA 1UZVA 2GMMA 4MZUA 4XOGA 4XCBA 1OBNA 1W3VA 3E6CC 4OQ9A 2R49A 1UY2A 4ZU4A 2JDUA 5C4WC 4FBFA 5F37A 2A70A 3LA7A 5F6KA 4MG2A 4KBZA 2BGPA 4MYEA 1K5JA 1S0IA 3KSCA 2YPJA 1ND3A 1V6OA 3KHCA 3HBKA 2A5ZA 2RJLA 3T09A 3M3QA 3WF0A 1OH4A 2J1TA 4E4ZA 2WNVB 2A6YA 3WF3A 2R16A 3BU7A 2PAKA 2XVLA 1DZTA 2Q8OA 5LBCA 3SXWA 1I5ZA 1MS3A 1RVF2 1TVGA 2JECA 3GJBA 1Z78A 4RD7A 4BWOA 2D7FA 1PVC3 5BNOC 3NL1A 1BQPA 1UWWA 5B4NA 5IK4A 3RZGA 1QXRA 5LASA 5LB6A 2XLFA 2EXJA 2RMU3 2YV8A 5FP8A 2Y33A 1IKPA 4GQ7A 4Q4V1 4Q4X2 1PNFA 3VDDC 4BJ0A 3AYDA 2BV4A 1IS3A 4FQ4A 2D97A 4DB5A 1RUI1 4CUAA 3EQEA 2O8OA 1X33A 3QLQA 1GKBA 4RHV3 1DQ1A 1ZBA3 5A33B 3VDAA 2RG4A 1PO23 2X09A 3B93A 3BIWE 3EMRA 3K4DA 1F5FA 5DG1A 1UN1A 2WKKA 2XJSA 4PF5A 3H9AA 4BQ4A 2VQUA 2YY1A 3MBWA 1JYVA 1RHI1 1XU2A 3GHMA 2VL4A 3BODA 3WNNA 5CFCC 3JU9A 4UF0B 5LRSA 2IXLA 3EO6A 3MPPG 4AW7A 5CA6A 3R05A 4QPIB 5CKMA 3FZ3A 3E5UA 1LOFC 1F5JA 2C26A 4XXAA 2X5IC 3ECQA 4KWJA 4DINB 4GH4A 1QJEA 4XEZA 5FMCA 1NE6A 2VO5A 3WW2A 1SZBA 4B1LA 1KRIA 4OUEA 3ZYFA 2WQZC 2VH9A 5FQ0B 3VBOB 4P9YA 1OA3A 1S2BA 1QOSA 3ZXJA 5CVRA 3QACA 4LUKA 1SBEA 3WD5A 4ASLA 4CRQA 3W20A 3O14A 1TEIA 2XQRA 2BBAA 3AYEA 2WZR2 5FXXA 4DO0A 1VAVA 1S0BA 3RSJA 2B9UA 4Q8LA 3VZJA 5BNNB 2WUHA 3NV2A 4ORFA 1HW5A 2F17A 1IS6A 1LULA 4X6QB 1PIV2 4TWTA 2QQPA 2BQPA 4XZUG 1IS4A 4A7KA 4Y1ZA 4CPBA 3H1MA 1LNSA 2UY8A 3O1PA 1YLLA 2AC1A 3OGSA 1JS9A 3T2PA 1AF9A 4QKBA 3AYCA 1D4VB 4IV1A 1Q56A 3H7YA 5JXGA 2PELA 3VD3A 1AL22 3FWEA 3L9JT 3LE0A 4Y5TA 5FYVA 2QQOA 4XUNA 4UT5A 5DDJ2 1QQP3 5F3GA 3PJYA 1V9U1 3AC0A 3VBUB 4E4DX 1V6JA 1GSLA 1WMXA 4M4RA 3MIDA 1UX6A 2HWB1 5L73A 4JAAA 1OD3A 1PGSA 5LATA 3WW1A 5D2AA 2BOJA 3KQ4B 3PNAA 2FDKA 2A1XA 1WZXA 4UFHA 3WVJA 1RMU1 4AFDA 1PZ7A 4EN7B 5DZGA 2CYFA 1L3JA 3UT0A 4AFMA 3DKWA 4AEMA 1LOCA 1CAUA 1OURA 4M01A 4PF1A 5T50A 1W6OA 2HBUA 3WDUA 1S0EA 5L9BA 4FVVA 4PQQA 3DECA 4K8FA 2CAVA 4JGZB 3RS6A 1DHKB 5DAVA 3MW3A 1C1FA 5CG8A 1D7PM 3R4DB 3TN91 5HXMA 3CDZB 2QZ3A 2VZPA 3SLIA 2B39A 3NAPA 4CCKA 5JIUA 5JVVA 1SBDA 1OUXA 1V6NA 3RZLA 3JUUA 3NNJA 1OLRA 2CGNA 2BZDA 5H9PA 5JOWA 4QX3A 5LW9A 4IEXA 3SQOA 2VE1A 1CZVA 4ZU5A 1YEWA 4AI8A 1NCRB 5A7OA 1X36A 3MUZ1 2QDRA 2GSYA 3WV6A 2YFZA 3HQRA 2VXRA 1PZ9A 1NCQA 2QQWA 2WYSA 1OA4A 1OA2A 5DG2A 3T4HB 4EN8B 4YW7A 3S7EA 1NX9A 1H8VA 2Y6FA 1VBD2 3MW2A 4LJHA 4IDZA 4O9EA 1JYXA 5LWBA 2AYHA 2VOTA 3FBYA 2HWD2 3TBDA 3ZFGA 5J09A 3GYDA 1POV3 2QDNA 1NA1B 2PHFA 5FZEA 3RYPA 3UNPA 2DFBA 2VNVA 4DXZA 5CAZA 2C0ZA 1VRH2 3OF1A 4LO8A 2VZ1A 4PDWB 5FZGA 3SKJE 2FDGA 4EYUA 2W08A 3O1OA 1AR71 1R091 4QX8A 3V65A 4EQVA 5HV4A 3RMXA 2PLV2 3OB8A 2HWF2 1UIJA 1TMF1 2WC2A 3VHPA 5L7OA 4J1WA 1NG0A 1VRBA 2GMEA 2NP0A 4ASMB 2D5FA 2W0XA 1Q43A 1DF0A 4CDUC 2R073 1LHOA 5KXCA 2QQIA 3L2HA 3VZLA 3Q8BA 4Q4Y3 4QXHA 5FLIA 1DZRA 1QKQA 4GMP1 1NY71 2R1DA 1YQCA 3WDVA 4A45A 1O5LA 4DPNA 4KBBA 3FLPA 1JXNA 3CQOA 1V6IA 3CU7A 5ISLA 4FPHA 1LODA 1RUC2 4ITCA 4AAXA 2HEWF 2WJSA 5D1IA 1RTVA 1SACA 1GBGA 3ILRA 4IUGA 2HWE3 3V0BB 4RS5B 1LESA 3UJOA 3VHOA 3WDYA 3N35A 1FOD3 3IDCB 1QDOA 2DBIA 1GOGA 4A44A 2EVXA 3WQ0A 4IEYA 4K9SA 4OHXA 2B42B 1QY4A 5IAXA 2IWGB 3MIFA 4P5YA 1FPN3 1DGWX 4KQ7A 5CKNA 5A3WA 2D6NA 2K0GA 3VZMA 4B7EA 2VXJA 2Q0AA 4WZCA 1TME2 2P6HA 4YW1A 2VR4A 3OCPA 1XE8A 2LUWA 3NKGA 1CVNA 4GB33 3EBRA 2VPVA 1SMVA 1REFA 2RS52 2X10A 4WVMB 5GALA 3KMHA 2XONA 3A0KA 4Y5SA 1ZRFA 3TOJA 4UW6A 4NIGA 4D7SA 1YI7A 2YGMA 1SG3A 1NZCA 3K2OA 4IERA 4K1ZA 1OPMA 1O8SA 3O1RA 2DV9A 1QF3A 2VNOA 4KU7A 1GNYA 2JKBA 2WAAA 4KNCA 2C24A 1OC1A 3ABZA 3VUOA 4DEVA 2NM1A 1CJDA 4XFBA 2VY0A 4HN1A 1GNHA 3SEEA 2X29A 3ZXFA 5GJ6A 1HQLA 4QGMA 2RMU1 4A2UA 4HK8A 2J22A 4YM3A 4A3XA 4M3CA 3AXEA 5A3MA 3B7MA 4UW5A 5DZEA 4XBLA 1C28A 3BGAA 4M3CE 4RN5A 2XBO3 3ZSKA 2W9XA 5AFEA 1VLNA 1IZ3A 1CAVA 4KWLA 1ZBA1 1X82A 3I49A 5FKBA 4NE9A 2VMFA 1PO21 1O3RA 1PGW2 1PM4A 2G19A 5FZ6A 4AFAA 4AZZA 1HXS3 1SHWB 2GNDA 3CJIC 1IKQA 2E63A 2GU9A 2KXLA 2Y38A 4LULA 1LB2A 3OPTA 4AI0A 4XIOA 2A7AA 3FUOA 4WM8B 4P9LA 2HH9A 2ZX1A 1HV0A 1CAWA 2JG9A 1R64A 3K46A 3RWNA 1MQTC 1W6QA 1IOAA 1H2MA 4JDMA 5K4LA 5FREA 5DMYA 3J7LA 1R083 5C4WA 5SV5A 1WW7A 3DYPA 4XE9A 3OJBA 4XBNA 1G6NA 2CWMA 3ZO0B 1SLCA 2HWC2 3BYWA 3OG2A 2N7GA 1V70A 5GLUA 4DXTA 1UD1A 1RGSA 1VBE2 1VALA 2EXIA 3NJZA 3WP5A 3JBG3 4NPMA 4WV8A 2DWRA 2VCBA 4BQ5A 5BNPC 3N9LA 1D0GA 1XNDA 1ZBE3 1LCLA 3HD8B 1BVVA 4MGYE 4CA9A 4JDOA 2J7MA 3KT7A 3R4SA 5FY1A 3VBRC 4BZ4A 1ZM1A 1D4M2 2BFUS 5D8AC 1B35B 3APBA 3MIHA 3O1TA 2F4PA 3M1HA 3POJA 2VUDA 3NV1A 5A6QA 4NIHA 4KGQA 2EIGA 3AZWA 3BN6A 4K6BA 3VDDA 5FPVA 2R042 3AFGA 4IE4A 2O0OA 4BPZA 2FCUA 4C8DA 2XGXA 2ARAA 3AMMA 4LKFA 2RS33 3HMYA 3LZZA 3PMSA 2ZGRA 3M2MA 2JDPA 1C8NA 1YQ2A 4QPIA 5FY5A 1HB1A 2JJ6A 3DYMA 3EB7A 4NIIA 5EXOA 4FPOB 4LO5B 1UPSA 3QH7A 3MPBA 3FL7A 3RWKX 1W2NA 1KJLA 4JKKA 1UZZA 2VQAA 5DXDA 5EJ1B 3ZFEB 1QQP1 5FY0A 1RUF1 3AJYA 3WG2A 2BGCA 1R1ZA 3B69A 5CFCA 1QU0A 3FUQA 4Y24A 3CNAA 3RZJA 2Y26A 3W5NA 2RS12 2B5HA 3B94A 3VBOA 5FQ0A 3WP6A 1W28A 3BTZA 4Y1XA 1DGRN 3OD0A 3EXUA 1RVF3 2PHXA 2QUOA 4LA2A 4LOSA 5GLZA 4R9DA 3S30A 2XHKA 3MLJA 3IAPA 2BRTA 2Q30A 3ENRA 1UKRA 3KVBA 4L97A 1NUKA 2E7QA 2CY6A 1Y9GA 3OGGA 4PIXA 3TEYA 2W1UA 4Y4YA 2Q8DA 4EZ4A 1GFF2 2VNGA 4Q4X3 4TN7A 4OI1A 3B9CA 3PVBB 5ABJB 3R4UA 5EYXA 4I01A 5FUNA 1EAH1 4FO9A 2DVAA 4OZOA 1J83A 1SLIA 5FXVA 3CMGA 1DFQA 1EV12 4NHXA 4YM0A 2FDIA 4M0NA 1C1LA 4UBHA 2E7AA 1ULPA 1Y4WA 1Y9MA 2O8QA 4PJYA 5A32B 4NOTA 3MZHA 2Q4SA 4PCRA 4D7TA 2JDMA 1AR82 2A6ZA 2JDHA 2I45A 3O12A 1ODMA 3QCWA 3POGA 4A7ZA 1JZ4A 1TG7A 2XWBB 3WNKA 2W3JA 1IS5A 3POWA 1NLQA 1XOYA 4FP2A 3KV9A 4N9HA 4E2SA 4LT5A 4WZFA 5FXZA 4AHXA 3I59B 1XQNA 3PTRB 4COWA 1YIPA 1DG6A 5JR2A 3ZPYA 3WINE 3UV9A 3VBFB 2YC4A 4FPYA 1FV2A 3AMHA 4IGQA 4QAWA 4LE3A 4UFKA 4DZGA 3AL6A 1KFXL 2XJPA 3H8XA 1W9WA 1HB3A 1RUJ2 2WSUA 2VM9A 2WZR3 2W91A 4CXYA 5A7SA 4GWMA 1LGCA 4HONA 4MSVA 2Z79A 1PIV3 3I3QA 2BFUL 3I2HA 3LB9A 1QJY1 3PU3A 2YGLA 1H2NA 4H3WA 4LBQA 4AQSA 1QJZA 1GQPA 3WG1A 1UY3A 1NAEA 1ZZ7A 3MI8A 1GQGA 3JB8A 4P14A 1S0CA 4WVWA 4ZPIA 2WQ4A 1GP4A 4JV4A 4DY3A 2VW1A 3H1YA 4NMIA 1V6MA 1Q8SA 2OA2A 1AL23 3FN9A 4XQ4A 5FBJA 5FKCA 3R6SA 1VBC2 2DFCA 4CDQB 1WCDJ 4GH4C 3T0AA 5DDJ3 2XDVA 4BK5A 1O6UA 2OVUA 3NKTA 2W1WA 1JH5A 4JHZA 2FDJA 4Z2WA 4FFHA 1DYOA 4Q0VA 1ACCA 2B7YA 4AVAA 4COZA 3CIHA 1C4RA 2VVDA 2BVBA 4ZS3A 3VKOA 1ULFA 3O1MA 4BMEA 1LENA 3SEPA 3MIEA 3J8F2 2EXKA 4NAOA 4R9CA 1VMJA 4GWIA 2VZOA 5F39A 5LA2A 1FYUA 2DVGA 4P9IA 1FOD1 1ASJ1 1I3HA 3KCCA 4MADA 2RDRA 5FP9A 1W8WA 3K4ZA 4L0PA 5DZFA 5A7WA 4IW3A 1YQ6A 4BQXA 1QJU1 2JG8B 3AMNA 3NRUA 4PIZA 5FYMA 5A3OA 3RRDA 1UU4A 3E1F1 2ZGSA 1IG3A 5DUXA 4IV1C 4Y1VA 2B45X 5C5TA 1C8M2 3FE5A 2CDPA 3M3EA 4GB31 2GP3A 2FQPA 4K1YA 1VB4A 1AYN2 1JYTA 1ZA4A 3AJZA 3KF5A 2RHPA 2IVIB 2V5YA 2ZEXA 1CX4A 4U36A 2ZAHA 5GZDA 3KT4A 1W0OA 2WS91 1CD3G 4LLOA 3V0BA 2XXZA 2J42A 2IFRA 1Z7S2 3MHZA 1VBD3 4BQWA 2VCCA 4DXSA 3HEIA 4YW4A 3MO4A 1N1YA 2MHFA 2UWBA 3IWZA 5A70A 5D21A 1PK6A 2HWD3 3GCWA 3N9QA 1TNFA 4IV3B 1QJFA 1DZQA 5C3OA 1US2A 2VUCA 5TSWA 1T2XA 4FI9A 4XFIA 4DIQA 4DNYA 1MR5A 2XBO1 4QQHA 2W1QA 3RYKA 2OZJA 3NAPC 3ZPOA 1NLSA 1RYYA 1CN1A 3N7JA 4LO7A 4XMAA 3THCA 3USUB 4O7XA 2IXJA 1NQJA 3JXSA 1U12A 1WCQA 1HXS1 2PLV3 3UJQA 1Q3EA 1KGYA 1UXXX 2HWF3 1NT0A 2RR11 2XHNA 4KMQA 4XMIA 4D7YA 5CFDB 5KBFA 2AH2A 5HI0A 1TE1B 2WO3A 5KC6A 1FMD1 4ISRA 4XJZA 4HMZA 1DQ6A 1W8ZA 2ZGOA 4Q0PA 3VD9A 2I74A 4C1XA 4QT6A 2JE8A 5C5UA 3SH4A 5DUWA 4YVWB 5FO7B 5K7PA 2V4VA 1G9FA 3P5BA 3V0AA 1YO8A 4LA3A 1WMEA 2JD4A 4I0AA 4YFWA 5LZ6A 4ISQA 4XFCA 4DMIA 2VMHA 1ENRA 3FHIB 1RUC3 5FJHA 1SBFA 1QJX1 2GMPA 3GDBA 3IB3A 1ZZ9A 5FPZA 3AKQA 2DYCA 4CCCA 1FV3A 1XNKA 1JHNA 3MV11 1W8UA 3DCQA 2AGSA 3GBFA 2AZ5A 1GMMA 3OGVA 4QPWA 5IK5A 1J1TA 2ZMKA 1G9DA 3BB6A 3W9AA 3LFMA 4C1WA 4FCAA 2ZCWA 1D2QA 4A7YA 4H2AA 1ENXA 1W04A 3RPQA 3URFA 4EN9B 3BU0A 4LHSA 5C9AB 3D0JA 2R0FA 4QX2A 5HPOA 5FBZA 2RS31 1TME3 4XYXA 4OHYA 4NR1A 2NLRA 1LR5A 4BH9A 1WMFA 3DF0A 1OSGA 4MHRA 4AK3A 2EIEA 5C33A 2IC1A 2RS53 2WT2A 3CJIA 2PHLA 4JGYC 4AI2A 5GZFA 1XPWA 1UOFA 4XFAA 4B7KA 4A4AA 1UY4A 3N7KA 4D6RA 2VBDA 3KQRA 2WIIB 1JZ7A 4S2HA 1REDA 1MQTA 1SLAA 5L9RA 5FZ4A 2SLIA 3V56A 3WNMA 1LOBA 5IYYA 2WRAA 4QQLA 4AWDA 5JCTA 2W5FA 3N9NA 4JRLA 1DQ0A 4HSJA 4N7UA 5T3NA 5J98B 3BOPA 4N53A 2ARCA 1KITA 5BNPA 2WFF1 4QU1A 3POFA 4NIAA 2BYVE 2VBBA 1ZNPA 3FLRA 3W58A 1IPKA 1J1LA 5A7QA 1WCUA 4F7ZA 5A6XA 3WR0A 3WQBA 5IWFA 3T1MA 1DBNA 1AR91 3WXPA 2A71A 2WR9A 3PL0A 1MS5A 1J3QA 2EF6A 2EIDA 4GMP0 5FZKA 3QD6A 1FAYA 2P17A 4RQPA 3UL2A 5LY1A 1JI6A 1OKOA 3S6PA 1LGBA 1CIWA 4CDXB 5FMOS 1MZFA 1K12A 3DPRC 4LQRA 1NYWA 5F7UA 3T3YA 3ZFEA 5J48A 4Y5Z0 4META 1CAXA 4R8HA 4BHPA 2AEYA 5LEKA 5EIYB 5FTTC 3FFZA 3OEAA 1KDMA 4CEWB 1BEV2 3SCGA 5AC92 3LQCA 4HZFA 3EJKA 3RJ2X 5JDBA 4MGTA 4LUMA 1F2NA 2WDBA 2OQ6A 3RZZA 2HWC3 1H8TB 3MLKA 1ALYA 4Z1VA 1T6BX 2JDZA 4N8MA 1VBE3 4XJWA 3W59A 3TYJA 3ZMNA 2VUAA 1BCXA 2VW0A 4YW3A 5I93A 1BHGA 4Q2FA 5C8CC 4XFFA 2J1AA 2PMWB 2YBPA 4CP9A 1UO9A 2IXHA 4AEKA 4N43B 3OUJA 1JZ2A 3H0OA 2WO2A 1J84A 1D4M3 4MOAA 1GQHA 1OF4A 3AP7A 2B46X 3K4AA 2UY9A 4Q4W2 4ET7A 1JUIA 3U07A 3I97A 2H6BA 4LBMA 5T5JA 1UMZA 2WINB 1HRI1 1RUG1 4CU7A 2ARBA 1GR3A 1N3PA 5I91A 2CL2A 5A32A 4B3NA 2R043 3ZXAC 3HJRA 3WG4A 1XYOA 4L92A 4XJ8A 5SV8A 3HWJA 4I09A 4XVHA 2QCSB 3LFIA 2JG9C 4HPKA 5FFOC 5LA9A 2WNVC 4K7JA 1QWRA 2XKOA 4HVOA 3VD7A 1M4WA 1HRV2 3AB0A 1HLCA 4LBKA 1YC61 3WNPA 1LTEA 2WAOA 3HNBM 1AL21 5FV3A 2D3PA 1ULOA
chains in the Genus database with same CATH topology
4Q1RA 5DDJ1 4YZ2A 1ULEA 1KJRA 3FJSA 2VQ0A 3ZXGA 2RS13 4AGVA 3NV3A 3MW4A 2ERFA 4YFZA 3ZN4A 1PO11 3U10A 4MX3A 1VBB2 5FLHA 1PGL1 3LA3A 4W6XA 5EV7A 2DCTA 3GALA 5GZGA 2PHTA 5T5PA 1BBT2 1YIFA 4QU2A 3A0NA 2A75A 3MGUA 1G86A 1JW6A 1PMIA 1LOGA 1LRHA 3AMQA 1X8MA 1DDLA 3ZXLA 1QHDA 4I0BA 3ASIA 3GZTB 1EV13 4ATFA 4QPIC 2ZBJA 2XL9A 3CO2A 1FNZA 4C90A 4FQZA 3B5LB 5IK8A 4YVSB 1XXNA 1RITA 2DVDA 1AR83 1RUE2 5FMOL 2R30A 3VBOC 2ET1A 2XWJB 3AP6A 2UYAA 3IKWA 2NMNA 1H9WA 3WP3A 5BNNC 1VBD1 4IEVA 4QPYA 4V1PA 3WHUA 4CTEA 2EAKA 4WVVA 1W6PB 1LEDA 3QOPA 4LR4A 4FAHA 2JG8A 1W6MA 1RUJ3 3VHRA 4B29A 2TUNA 4AI3A 1OOPB 1XRUA 2D6PA 3RI8A 2FZ2A 4GALA 3O0WA 4FT8A 3I54A 3AP5A 3VL8A 2PLV1 1NLRA 3O5SA 1VAKA 3TNQA 3B00A 4XFHA 5AVPA 3IN9A 1C5IA 1J59A 2P34A 4PBPA 1PZ8A 4IEUA 4HETA 5KWRA 4I2OA 3M7AA 2R6QA 1VBC3 1MS8A 2X5IB 1ZYBA 2VMGA 4Y26A 5JZGB 4FPKA 4FOWA 1RUC1 4HSLA 4JGZC 4LBJA 1RUH2 2OZ6A 3J8F3 2Q1ZB 2MNGA 2GAUA 1A3KA 2E51A 4HVQA 4IEOA 2RJKA 3PVEA 2P2KA 4EWAA 1QOOA 1O3TA 1AXYA 3JD71 1GZWB 2ZA9A 4YG0A 1H1AA 1BMV2 1NCRC 1DGWA 4J1XA 3AMPA 1DLLA 3ZYPA 4I3PA 3H8UA 1C8M3 5CBLA 2ETEA 5EWSA 1YFWA 1AYN3 3POSA 4CP2A 1AYM2 1ONAA 2ZKLA 1EY2A 1VP6A 4Q4V2 3VZOA 4DRRA 4Q27A 3U11A 5JPNB 3PVNA 3UKVA 1ULCA 1YFXA 2WA4A 3E6DA 1Z7S3 3VN4A 4RR3B 4RL7A 3ETQA 1YXWA 4JRAA 2ZJCA 2WT0A 1ENSA 3S7IA 2ZHNA 5ACA1 2CTVA 4Y20B 4IXLA 3EHKA 4EN6B 5HXVA 3WDWA 2Z69A 2BW8A 4HBNA 4LO6B 4IEWA 3OY8A 3WY6A 2PHDA 1LU1A 3DL3A 1HDKA 3KB5A 4LEJA 5E8AA 4SLIA 1S2KA 5I0RA 2X53S 4P5HA 1S0GA 4L99A 5BY5A 4B4QA 1G9CA 3THPA 4Z07A 4JGYA 1XU1A 4YRDA 2NQYA 3FLTA 2VU9A 3RJRA 4HLTA 5IK7A 2HYKA 1VBE1 2ZMLA 3D82A 4HKOA 4NWVA 3ZYGA 3ST7A 1PK6C 4QM8A 2D98A 3BTAA 2WT1A 1VBA1 4FTBA 2V73A 2VULA 2OYZA 1D4M1 2GNBA 1RUOA 3POYA 4CDXA 1I1EA 1MS9A 3VKFC 1V9U2 2ZZQA 3SH3A 3D5OA 3B3QE 4HANA 5KXEA 2HWB2 3VBSB 4X8NA 4CDUB 4EV0A 1NE4A 5BPXA 3MIGA 3N7MA 4BYYA 4ES9A 4GXLA 3HT2A 5LK7B 3IT8A 1RMU2 3DPRA 3USSA 4DFSA 1XNBA 3O7OA 1LJ7A 3JCIA 2DUOA 3DV8A 4QPGA 2RS11 4N43A 1Y9QA 3SH5A 1NQDA 3E5QA 4Q8KA 3TN92 4N90A 1PVC1 4RA0A 5E89A 2ZGKA 2MEV2 4MH0E 5GLTA 4Y22A 1XNCA 2F6BA 3RNSA 5C8CA 1CJPA 1MVEA 1WCKA 2BWCA 4B8EA 2VNRA 3D0SA 4XZPA 2NMOA 1GANA 1QH6A 2ZKNA 4AXOA 1BVP1 3SNMA 4RHV1 3INAA 2PHUA 3MIBA 4QQPA 2BWAA 2ZGMA 1O3QA 2KA3A 1AJKA 1Q8OA 2A6WA 2AENA 2WLQA 4QM9A 2WNVA 1WLCA 1BEV3 1O91A 1G7YA 1LHNA 3PLQA 4FP3A 3WDXA 5FAXA 3M3CA 2JX9A 2WNUB 4AHWA 2W39A 2DF7A 4N53C 2XJVA 5KHJA 4LHLA 1AR72 1R092 2H0BA 5GZEA 3ZN6B 4OULA 4Q1PA 1ZZ8A 4IL7A 4Q4W3 5A33A 3VBHB 3ZVXA 1RUJ1 2D6OX 2VMIA 2XJTA 4RQPC 5EYYA 1NY72 1CPNA 2XPJA 1MS4A 3ZFEC 5CG9A 3IIAA 1U5XA 4MXWB 4LHNA 4X8PA 3NSTA 1HRV3 4OHWA 1OD5A 3LKJA 1NOVA 3KM5A 1A78A 5FDBA 2OPKA 2LTNA 1H4GA 3NV4A 4C0BA 2PFWA 1W6PA 5ABJC 4FSJA 4XF0A 3ZFFB 3HBZA 1O3SA 1OHFA 1VBB3 3Q9OA 4FTSA 5D8AB 2A3WA 1FX5A 5FLJA 5BNNA 2WSVA 1WCSA 1SFYA 1BBT3 1O4ZA 3KZ4C 2DU0A 4BQ1A 4TSVA 4Q0SA 1S0FA 1AXZA 1O4TA 4OUMA 1RINA 1UZYA 1X7NA 1C8M1 3GBWA 4DS0A 5IUQA 1ND2B 4AEDB 4FPFA 5JZGA 3VBUA 4NO4A 4CEYB 4BCUA 2WZPP 2P3KA 4BM8A 2A6VA 1RUE3 4FOYA 3IPVB 4AVCA 4FPGA 1AR62 4AGGA 3TNPB 2LM3A 1JUHA 4LBLA 4XJUA 1PO22 2ZGTA 3OBTA 1W6NB 1XE7A 3UKNA 2HEVF 2Z42A 4JGZA 3VKLA 3WZ1A 1POV1 4W6YA 5GLWA 1Y7BA 1SFNA 3VZNA 2C5DA 1ULDA 2JE9A 2D43A 4NVPA 1S0JA 1S0DA 2YZ4A 3LWCA 4YYOA 1ZZCA 2FMDA 3ILFA 3P3NA 4FXKB 2YUEA 1NCRA 4QXKA 1ND3B 5KHKA 5F9TA 4ZXKA 4YG6A 1JTZX 2D6LX 2R071 1WBFA 3VZKA 2P3IA 4Q4Y1 5K9YA 4EROA 5CIRA 2DUPA 1LECA 2ZPXA 3BCWA 1VR3A 1NA1A 4XPVA 1DQ2A 1RUH3 2JG8C 2HWE1 4PDWA 3IDBB 5B2GB 1V00A 4JDNA 3ES4A 3BOWA 4MUVA 4FPEA 2DURA 4XW3A 1AZDA 1OI6A 2DUQA 4XJ9A 1VB2A 2VW2A 2GDFA 1QQP2 1RUF2 3J4UH 1AUYA 2XVKA 1FPN1 4IQPA 1C57A 3WDTA 1SLLA 1MEC2 5T55A 1S55A 1V6KA 4XTMA 4ZKTB 3PTYA 2CV6A 2EA7A 1COV2 2VOKA 4GH4B 2ET7A 2R0HA 3OTFA 4BLIA 2VOVA 1SLTA 1UL9A 2G9FA 4FAGA 1HKDA 1AYM3 4XBQA 4S2GA 4Q4V3 4H14A 2OUJA 4G4FA 4IV3C 4DQAA 1K5MB 2ZABA 4RS5A 1EAH2 4FOQA 1FI2A 3ZX7A 4U2AA 3FC0A 1BK1A 3GZAA 1BZWA 3M8LA 2CGOA 5CFDC 1QDCA 4OHZA 1VRH3 2OIIA 3VBSA 3RDIA 3AFKA 1WLDA 3JQXA 1DGLA 2XJUA 5J37A 4WVMA 4K20A 4COUA 3DGTA 4YVWC 4B4PA 2D6KA 1LHWA 3C3VA 1AX0A 1XYPA 2VVFA 3ZSLA 4F8AA 2D3SA 1GV9A 1R081 4ATEA 5CNAA 4KU8A 2AREA 2NN8A 5GLVA 5I0TA 5T54A 2QNKA 4E9KA 3JBG1 1CAUB 1RUD2 5KXDA 1QJY2 1ZBE1 3HN1A 4H55A 4OHVA 1DQ4A 1EYBA 2UWAA 1MZ5A 5IT6A 2D93A 4X6RB 1U5ZA 2ZX3A 4Q4W1 3WCRA 3MICA 3AZXA 4XHXA 2UWCA 4GKYA 3M3IA 2ZX4A 1V9U3 4WM8A 4MVTA 4E27A 2HWB3 1WD4A 2I07B 2Q1MA 2WNUA 1ZRCA 4AFCA 1QXJA 1N1TA 1VJ2A 1NCQB 4MGIE 3TRSB 5JMCA 5JLVA 5A3LA 1RMU3 2H6CA 1YI9A 4XHBA 1FNYA 2EXHA 2ZGPA 4S2DA 1AXKA 1ASJ2 1LOAA 1W0PA 3AP4A 1M06G 2BNOA 2DCZA 3ZFGB 3VV1A 2BVVA 1QJU2 1B35A 1RVF1 1BKZA 1MS1A 4LBOA 1KXGA 1VBB1 3AKTA 3TN93 2ZMNA 4M00A 3VBHA 5L19A 2MEV3 4DRVA 1LHVA 2D5HA 1I6XA 4FPCA 4CDXC 4HVRA 4MGZE 1BBT1 4Q4X1 4QGLA 4DY5A 5L7OB 2SBAA 2UU8A 4JVAA 1YFYA 4YSFA 2WLPA 4WM7B 3GBGA 2WS92 2ZHLA 1SEFA 2WNEA 2C9AA 1H8TC 2G9GA 3CF6E 2P37A 1OFNA 3ZMOA 3WP4A 2Y0IA 1RUE1 2VGDA 4QPGC 2BEOA 3ZFFA 2XG3A 4G9SB 4N43C 4PLMA 4R9BA 3ES1A 1CONA 4JTOA 1WGPA 3I4IA 4OLLA 2VVEA 2P3JA 3ALQA 1AR73 1R093 4XIKA 4N9IA 4YW2A 1OPOA 3LCPA 1HXS2 3KLSA 5ABJA 5J96B 3MEPA 1ZRDA 2RR12 1KFUL 3H50A 1B09A 2ZGLA 1FMD2 3FBMA 4CDWB 2WZR1 5EZWA 5JOZA 4P9GA 5K0UB 3VL9A 4AEDA 1PIV1 4GMP3 1LGNA 4XETA 4CEYA 3LAGA 1ULGA 3OBRA 1QJX2 3AZVA 1YCIA 4TLFA 4NHLA 4YGEA 2WL1A 1J3RA 2IXIA 4WBBA 3SCHA 3I59A 1CR7A 3SCFA 3VBFA 1LU2A 2RM22 4LE4A 2LALA 3NWKA 3AX4A 4M3CB 2A3XA 2GC1A 3ZYJB 1RUH1 2JEMA 3H3UA 2XJRA 5J3UA 3ZYRA 2MPFA 4QGNA 3OD4A 3GZUC 1CAVB 1OFSA 3WLUA 4OFGA 3WT3A 1R1A2 1RJ8A 2ZX2A 3KD4A 4R9AA 4YVSC 4PQ9A 1UF2C 2BTVC 3ROUA 5JI9A 3KCYA 4XFGA 1CAWB 2JG9B 1W6QB 4MXVA 2A3YA 1YFUA 2QFEA 5C4WB 1WW6A 1UCXA 4CDQA 1JOJA 2XLGA 1YHFA 2RE9A 3JQWA 5H9QA 5BXXA 3ZSMA 1Z0HA 1ZZ6A 3LOBA 3N4MA 2G4IA 2WFF2 1H0BA 1OQDA 3WQ1A 5AFBA 1AYM1 2PYTA 3GF6A 1Y3TA 1W39A 3M3OA 1AR63 4JTNA 5FO9B 5LK5A 2DCJA 1AR92 3SMHA 2HJIA 2AR6A 2ZOEB 5BNOB 1A6CA 1OOPC 3KT1A 3NVCA 4MLOA 4YARA 5KHHA 1WA4A 2GC3A 2Z5WA 2HWD1 3VDDB 3FMGA 3R0RA 3ZIWA 3O0XA 2I2SA 3G6JB 4XJAA 2R062 1KS5A 1VRH1 5HCBA 2QZ2A 1UPIA 3TWIA 2D44A 3S0MA 5JIAA 1DIWA 5FOBB 2DTWA 4OVEA 3RQ0A 4COVA 3HIFA 5JZGC 2ZHKA 2TEPA 2HWF1 3VBUC 2XVGA 1LKNA 1E57A 4E2QA 5JAXA 4HN0A 5CFCB 1MZ6A 5F1RA 4JC1A 3AZZA 3KGLA 5F5QA 1ZX5A 2ZTNA 2XJQA 1UW8A 1K5MA 1U0AA 2XUMA 5DUUA 4PIYA 3ZN5A 4AQ2A 5EJ3A 1N1VA 5J36A 1HRI2 1RUG2 1MVQA 2NYYA 1BXHA 5C6CA 4IESA 4IV3A 3PVOA 4XF3A 2BUKA 2YMZA 1CESA 4UW4A 3USUA 3AKSA 4QMAA 4OUSA 5I0SA 4ONUA 1Q8PA 2PN5A 1WW4A 4F83A 1X50A 5CFDA 4I3GA 4IETA 1RUF3 4AFBA 2VOWA 4YGCA 4RGAA 3WNXA 4TZDA 3P3PA 4CYDA 4J6GA 1MEC3 4AQTA 3HR9A 1TME1 3ELNA 4RSUA 2VOXA 1PO12 2ATFA 3MYXA 1PGL2 4YVWA 2QVSB 2RS51 2ZAAA 4OZXA 5BV6A 1COV3 1J3PA 1H2LA 2UYBA 4LHKA 4RR3C 2PAMA 3ZSEA 4XQDA 1POV0 3WUCA 4HL0A 4KG8A 1H30A 1NA1C 2FMYA 2ZHMA 3I2DA 1REEA 3ZYIB 1RUI2 1EAH3 5E1RA 3IM0A 4PDWC 1KD7A 3ACLA 2MEV1 5J7MA 5HCFA 2DVBA 4S2FA 1RHI2 3KS7A 4LBQB 4XDQA 4AG4A 2YXSA 1OQEA 5C9AA 1IPJA 2JICA 1DQ5A 3H3ZA 2E7TA 4COYA 4EN0A 3L2YA 4EJRA 1PGW1 2IXCA 3MLLA 4FPJA 4IEPA 1N1SA 1OQ1A 1H1IA 4MV2A 1BYHA 1QNWA 2PQQA 4D94A 2GNMA 1H1MA 2DU1A 4YM2A 5BNQA 1D2SA 2ZACA 2YROA 2PHWA 4RS5C 4BE3A 2GALA 2HWC1 5GZCA 3OYWB 4YZ1A 3ZDSA 5KHGA 1RB8G 1KDKA 1CQ9A 1YJKA 1IHMA 2TNFA 1D0HA 4DOUA 5KXBA 1RUD3 4LO4B 4YZ5A 1QJY3 1YJLA 4Q0UA 1WMDA 2AUYA 4GA9A 2IZWA 4ES8A 1QOTA 5FRAA 4WVZA 2ZS6B 2PTMA 3VBSC 4WM7A 1UAIA 4GIQA 4LLFA 1EPWA 2DTYA 2WWSA 3J26N 2QKDA 3PHMA 2R041 3ZXDA 3E5XA 4P9XA 4CEWA 3N3HA 1FXZA 1LEMA 3AZYA 5JOYA 1DGRA 5T5LA 1H8TA 4NHMA 5HCAA 2Z2SB 4FOVA 2R1BA 4W6WA 1O7FA 1ASJ3 1YYNA 3LSDA 3JD72 4R4ZA 2FZ1A 1PK6B 1DU3D 3MF9A 5JSRA 1QJU3 4INDA 2GH2A 4C0HA 3WX5A 4CDWA 1SQ4A 4AYUA 4QQOA 2VUJA 4B4RA 4AVTA 4AVVA 5K0UA 3I7DA 3VKMA 1F31A 3WW4A 3GHNA 5GKAC 2ZGUA 4Z82A 2K2SA 4AE2A 4WM8C 1RUNA 1RJ7A 3WUDA 3LOIA 3WCSA 4URTA 3H1WA 3OGJA 1EV11 3K51A 2YC0A 2WS93 2WNUC 1HX6A 2GN3A 5HBAA 2BNMA 3AYAA 1URXA 2TBVA 4BA6A 2QJVA 3V0AB 1AVBA 1AR81 5AC93 2EAAA 3M70A 5ACA2 2O1QA 4YNIA 3JB4C 2Y0OA 4K21A 4H7MA 4AI1A 1DYPA 2BNNA 1AR61 1G9BA 1B35C 2IFWA 5LEJA 3N7LA 1OLQA 4F3JA 3VBHC 3I8TA 2UURA 4UBGA 4C91A 4KL1A 1I9RA 1KS4A 1PVXA 1PHMA 2RR13 1AHSA 4AVSA 1TMF2 1H2KA 1KQRA 4HT1T 4YZ3A 4RGGA 4P9JA 3TB0A 3WG3A 3K48A 1FMD3 2W68A 1RIRA 2E6VA 2PHRA 1WLTA 4Q26A 3DN7A 1ZZBA 3AXDA 4AHYA 4K3UA 3CJIB 5T52A 4YVSA 4BIFA 2YYOA 1C3HA 3IMNA 4AVBA 4XF4A 3ME2A 4SBVA 4G3YC 1MQTB 1QJX3 3ZFFC 2VG9A 4CP1A 2R32A 1VBA2 5JSPA 3V64A 1AX1A 3ATGA 1VBC1 5BNOA 4LTAA 4PLOA 4YGBA 1CGPA 4TYSA 3THTA 3UKTA 4N53B 1HIXA 4AQ6A 2RM23 5BNPB 1A8DA 1PM7A 2CAUA 5C8WA 2VECA 4Q29A 1UU6A 5FO8B 4RFT0 1WD3A 3T2TA 3FX3A 3VBRB 3LSEA 1O5UA 3J8F1 3G7DA 1OOPA 4HK9A 2A73B 4RQPB 1ND2C 1R1A3 4AEDC 1OKQA 4CEYC 4YLZA 2PAEA 1CAXB 2BPA2 1PNGA 1LHUA 4AHZA 2FBEA 4GWNA 1MEC1 1U5YA 1LOFA 3NW4A 1WW5A 2X5IA 1JN2P 2DVFA 2BBVA 3VLBB 1PVC2 4NN0A 3VHNA 1YWKA 1COV1 1APNA 1GYKA 1AYN1 3VBFC 2WFF3 1UIKA 1HQWA 2E53A 2RMU2 5K8SA 3U0ZA 1EPZA 2GNTA 5L36A 4I0WB 3ZSJA 3H7JA 1AR93 2YHJA 4Q0QA 4RHV2 4YZ4A 1Z7S1 1ZBA2 1F8VA 2ENRA 4FXGB 4BOWA 1AL0G 1RC6A 1GZWA 4KWKA 4QX5A 2D6MA 1QNYA 1UKGA 1WLWA 1IGOA 2ARXA 1ND3C 2R063 3CEWA 3MFAA 2ES3A 4HPKB 4NWWA 4OI4A 4CDQC 3AP9A 1JBCA 4I30A 4D69A 3HT1A 3B01A 5JPMB 4QQ2A 2KM2A 1FT9A 1GNZA 4Y1YA 2DCKA 2IXKA 1CPMA 3WOGA 5JWPA 2K9ZA 3GNEA 3AM2A 4QD2A 4IEQA 5DUVA 5I8TA 4JCKA 1G9AA 1UU5A 4D3WA 4RR3A 4MGKE 1GICA 1HRI3 1RUG3 1N47A 1O4YA 3AK0A 4XF9A 1RUD1 5AVAA 3MF6A 5F6LB 1WBLA 4Y20A 3PJQA 1N3OA 3DUIA 2D3RA 3ZXKA 3BALA 4HKWA 1Q5OA 2B8MA 1YNAA 1IQAA 2XB6C 2XKPA 3D6EA 4Z8BA 3CJXA 3LA2A 1J58A 1ZVFA 1SCSA 2OUHA 2GC2A 4H7LA 1NXD1 4BIOA 2ZX0A 1PO13 4KG0A 4E2GA 1K5MC 1MACA 4R4XA 4UXAA 4LNVA 4XF1A 3OYWA 1MZEA 1X8EA 5BYNA 1YUDA 4KGGA 2HEYF 3HQXA 5T5OA 2GN7A 4EWDA 2XH6A 1RUI3 3T1LA 1W6MB 1WUVA 1HV1A 3D8CA 5BUVA 2WA3A 1QXPA 1RHI3 2D40A 1MS0A 4GULA 1JYIA 2YDEA 4IEZA 1GZ9A 3KCXA 2HKXA 4CDUA 5I0UA 2FHRA 1SDWA 5E88A 4IV1B 5KHIA 3SITA 3WW3A 1QH7A 3ILNA 3LGRA 3UK9A 1G8WA 4YW5A 4NHKA 4K40A 5AC91 1BEV1 2NPIA 3U4XA 1SLBA 5I8YA 4EWEA 3IDEA 3RMYA 2CWSA 4Z92B 1TQ5A 3M4FA 3OPZA 3J9SA 1AJOA 1W6OB 4BMBA 4XTPA 3E97A 4OI2A 3MDPA 5C9AC 4M3CF 3AKPA 1SCRA 2GH8A 5CADA 5GM0A 1W2UA 2R072 3O0VA 3NAPB 1VAMA 1NCQC 4NPRA 5H9SA 4BLJA 1NXMA 4Q4Y2 2JXAA 4FTEA 2H0VA 1ENQA 1A8MA 3D4KA 1XYNA 4YGDA 5FCCA 1GZCA 1T6GC 4ZU7A 3ZFGC 4AEJA 1HRV1 5JSOA 3VKNA 2HWE2 1VIWB 4UW3A 3RYRA 5JOXA 4CP0A 3BPZA 1FOD2 3WHTA 5LRRA 2A6XA 2ZGQA 3ZN6A 3JD73 2RM21 4AGRA