3A0NA

Crystal structure of d-glucuronic acid-bound alginate lyase val-1 from chlorella virus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
242
structure length
242
Chain Sequence
NVISTLDLNLLTKGGGSWNVDGVNMKKSAVTTFDGKRVVKAVYDKNSGTSANPGVGGFSFSAVPDGLNKNAITFAWEVFYPKGFDFARGGKHGGTFIGHGAASGYQHSKTGASNRIMWQEKGGVIDYIYPPSDLKQKIPGLDPEGHGIGFFQDDFKNALKYDVWNRIEIGTKMNTFKNGIPQLDGESYVIVNGKKEVLKRINWSRSPDLLISRFDWNTFFGGPLPSPKNQVAYFTNFQMKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VAL-1
publication title Crystal structure of family 14 polysaccharide lyase with pH-dependent modes of action
pubmed doi rcsb
source organism Chlorella virus
molecule tags Lyase
total genus 61
structure length 242
sequence length 242
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2009-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3a0nA00
3RG0A 3VKFC 1A8DA 3SH5A 4ZKTB 2EXJA 2R0FA 1VIWB 4XJAA 5JLVA 2D6NA 5DG1A 3WG4A 1W6OB 1W6MB 3N7JA 4ITCA 5HCAA 2A3XA 1QOSA 1V6IA 4XBLA 4XBNA 4BPZA 3LSEA 3HMYA 3USUA 2WQZC 2CWMA 1C1FA 1W6QB 3SISA 1V6KA 1KITA 3LSDA 5JVVA 2JE9A 4L8QA 5JOZA 4Y24A 2ZGUA 2SBAA 1S0FA 1VLNA 2D6OX 2FMDA 4TZDA 1VAVA 2DTYA 4GKXA 2D3RA 4R9DA 4GALA 3FLRA 3DUIA 2D44A 1MR5A 4IQPA 1SLBA 2YZ4A 3AZVA 2D6LX 2AENA 4XJ9A 2ZGSA 3ZYPA 3ENRA 2PHUA 5GLUA 1W6NB 1S0GA 4U2AA 3OYWA 4U36A 1ENSA 3WCRA 4GXLA 2EXIA 5DZGA 1EPWA 5T54A 2DU1A 3DGTA 4Q26A 1AJOA 5EYYA 1ENQA 2H0BA 5H9QA 1KJLA 1W6OA 1W6MA 2ZAAA 2LTNA 3ATGA 4ISRA 4YFWA 5GLTA 1WW6A 4BM8A 3C2UA 2EAKA 1N1VA 2DVBA 2UWBA 1CPMA 2DVDA 4BLIA 5CBLA 3UL2A 3AXEA 4P9XA 1W6QA 3I8TA 1MVQA 2CNAA 2JE7A 2EIGA 3V64A 2E51A 2EXHA 3POYA 1CONA 2WT2A 1G9DA 2W68A 2A7AA 4OZXA 4DPNA 3IM0A 1MS4A 1O4YA 4UW4A 3M3QA 3APBA 2V5YA 4Y1YA 2NMOA 1C57A 2UWAA 3OJBA 1LULA 1BKZA 3GNEA 1DYKA 1W6NA 3IN9A 3AP7A 1ZM1A 2A71A 1HLCA 1MZ5A 3I4IA 3MPPG 4JC1A 4R9AA 5E8AA 4ATFA 4R9BA 1S0EA 4XJUA 5EWSA 3B3QE 2Q5TA 2ZGMA 4M3CE 4XBQA 2DUQA 2ZHMA 1LU2A 1WD4A 3HN1A 1UZZA 3FBYA 3H0OA 3NV3A 1IS4A 1LHNA 4Y26A 1H30A 5T5OA 3RSJA 3RQ0A 4LBQB 1IKQA 2ZGNA 1AXKA 2WJSA 4Z8BA 2DVAA 1S0CA 1IKPA 1LOEA 3PVOA 4FVVA 5DUXA 3WNXA 5DUUA 2GN7A 1URXA 1LESA 2YV8A 3KQRA 2AYHA 3QLQA 2GMPA 3AP5A 1FNYA 1SACA 2DVGA 1ULEA 1WBFA 2ZGOA 3AYCA 4YZ4A 4AVVA 3VKLA 4Y22B 1OFSA 1GLHA 2P3KA 5JMCA 2AH2A 1YYNA 2P3IA 4DFSA 1DBNA 2ES3A 1FNZA 3M3OA 1A3KA 1UZYA 4K1YA 1QNYA 2ZKNA 4WV8A 1LEDA 5DXDA 2RHPA 5H9PA 2OW4A 2XG3A 1RITA 3OPZA 4PQ9A 5GZGA 4FPCA 3JUUA 3BODA 1I3HA 2DWRA 3FUQA 2ERFA 3ILFA 1MACA 3ZXEA 2I2SA 2P2KA 2ZGPA 4YW4A 4FPLA 2W08A 4LBQA 3R05A 1KRIA 4YGCA 3BTAA 4P9YA 1WW4A 3WZ1A 1WLWA 1YIFA 4C1XA 2Z42A 3TAYA 2E53A 2EF6A 4MYEA 4Y1ZA 1ULDA 2ZHKA 3A0NA 5KXBA 1LHOA 2VW2A 3AX4A 2D43A 2VW1A 3AP9A 2ZGTA 3BIWE 3Q9OA 5CB7A 1LCLA 5GZDA 1DYPA 3AXDA 4Y22A 3FLPA 4FPFA 2CL2A 1N3PA 4FPYA 4Y1XA 3NV1A 2AUYA 1SCRA 2WNEA 4LBLA 3WUDA 1WLCA 1X50A 1O4ZA 2D6KA 1AF9A 5H9SA 3UK9A 1CN1A 3WCSA 4YZ2A 3B69A 3ZSKA 1MZ6A 1UX6A 2PHXA 4FPEA 5IK7A 2DU0A 5T50A 4R9CA 5KXCA 3RMXA 1FX5A 1KDMA 4AVTA 5F9TA 1MVEA 3UJQA 3WG2A 4W65A 5DUVA 1DQ0A 1DFQA 2JJ6A 1GKBA 2ZMNA 1ULCA 1CIWA 2GMMA 4XXAA 2BQPA 3M3CA 1G9CA 4XILA 1SLIA 4FPJA 2P3JA 2UWCA 3AFKA 5GZEA 3WUCA 1SLCA 5JOWA 2ZMLA 3R4SA 3GALA 2CTVA 1DGLA 1UKGA 1IS5A 1F9KA 3O0XA 5CNAA 2GNMA 1VAMA 2W39A 3B01A 5KXEA 4Y1UA 4F83A 2JECA 5HCBA 1CPNA 4AGGA 3U4XA 2WLQA 3OBTA 4UW6A 1BXHA 5L73A 1S0DA 3FUOA 3KM5A 1CVNA 4Q8KA 2AR6A 4KBBA 1APNA 2ZHLA 2UU8A 1MS5A 4XMAA 3VV1A 1SBDA 5JOXA 4YG0A 3VKMA 4FPOB 2D3SA 5KXDA 1LJ7A 4NOTA 1GZ9A 1D2SA 3AZYA 1LOAA 2ZGLA 1IOAA 2ZGQA 1LODA 3WDXA 3OY8B 4PF5A 4LBKA 4YM2A 4TYSA 1GNHA 2A70A 4XIKA 5AVAA 2OUHA 2PHFA 4XTMA 1RINA 4XOGA 1QF3A 4Q1PA 1C4RA 1CR7A 2DTWA 2VY0A 3D4KA 1TEIA 1Q8VA 5T5PA 5T52A 3WVJA 4PBOA 2R1DA 1LHWA 4DS0A 3AJZA 2WT1A 2DYCA 1QDCA 1H9PA 1NXD1 1DQ5A 1UMZA 1AX2A 5JDBA 2OUJA 5GJ6A 3JU9A 4WZFA 3POWA 1YRZA 4XHBA 3RS6A 4D69A 1G9AA 4Y1VA 1LGCA 2SLIA 4ZXKA 1JW6A 1C1LA 3ZSLA 4BMEA 5F5QA 1DIWA 1N3QA 4GKYA 5GLVA 2E7TA 4FQZA 4YM0A 3INAA 3ZYRA 1W0OA 1N1YA 1AXYA 2D6PA 3ZSMA 1SBEA 5CA6A 2A75A 1UAIA 1BJQA 5GLZA 4M3CB 3WOGA 3OY8A 1UPSA 3AZWA 2NN8A 3ZXFA 3MW4A 4RL7A 3WG3A 1G9BA 3V0AB 3OBRA 1DQ6A 1QNWA 1WBLA 3BOPA 1G8WA 4P9WA 1G86A 4BQ1A 2OVUA 1YI7A 3POSA 3N35A 2ZZJA 4FPGA 2D6MA 4WVWA 3SITA 1ENRA 1Q8OA 3A0KA 4YZ3A 2B7YA 1SLTA 3M3EA 4LBJA 4XTPA 4YM1A 3UJOA 4FQ4A 2WSVA 3V65A 2CYFA 4YGEA 1HQLA 2ARBA 4FPHA 2PHRA 1GV9A 1V6LA 4XIOA 3NWKA 2VXRA 3ILRA 3NV4A 4FOVA 2A6ZA 2ZHNA 1LHUA 3CNAA 1JUIA 2VUAA 2ZA9A 4LBMA 1GZCA 2GNDA 3AZXA 1JHNA 2A3YA 1JOJA 1WW7A 2DUPA 1ULGA 1V6MA 1LOFC 4WVVA 3SLIA 2A5ZA 1WCSA 2DURA 2ZGKA 2ARXA 2KM2A 2PELA 2DVFA 4M01A 3V0AA 3NV2A 1QU0A 1I1EA 1GNZA 1PZ8A 4UW3A 4C1WA 4HANA 1CJPA 3D5OA 1N3OA 5GZFA 3ZSJA 3IKWA 3WDVA 1BYHA 1AVBA 3M1HA 1IS3A 1Q8PA 3IPVB 4LBOA 4YGBA 2EXKA 1UN1A 3WDTA 5IK8A 5JOYA 2C9AA 5BYNA 3WHUA 2VU9A 1OKQA 3WLUA 4ASMB 1GBGA 1LU1A 1S0IA 2GNBA 3W59A 1U0AA 4XYXA 1S0JA 4AYUA 5EYXA 4CZSA 1LOCA 4YLZA 2FHRA 1MS1A 4XDQA 1R1ZA 1Z0HA 4YFZA 2A3WA 1MS8A 2LALA 1OQ1A 3AJYA 1QKQA 1XQNA 1LECA 2E6VA 2NMNA 2NYYA 2JD4A 1Q8QA 4XJZA 5LK5A 1SFYA 3MW3A 4SLIA 1HKDA 1KQRA 3AK0A 3ZXKA 3WDWA 1FAYA 4XE9A 1MS3A 1JYIA 1W6PB 3IMNA 1N1TA 1GZWB 5EXOA 1Q8SA 1DQ1A 1LTEA 3IPVA 4BOWA 1G9FA 1VALA 4YW1A 3VKNA 2ZBJA 2XB6C 3TB0A 1UL9A 3N7LA 4YW5A 3SH4A 1G7YA 1IS6A 4AGRA 3ILNA 1V6NA 3HR9A 4Q1RA 4GWMA 4DQAA 1LEMA 1N1SA 4K20A 4FOYA 4GA9A 4YGDA 1LHVA 4AVSA 1LOBA 2A6YA 2GDFA 3B9CA 3ZXLA 1LOGA 2YY1A 3PJQA 1D0HA 1FYUA 4AGVA 2D7FA 3N3HA 3AYEA 5GM0A 3AYAA 1F5FA 2G4IA 4ISQA 1DQ2A 3WG1A 4DRRA 4CTEA 5GALA 5DZEA 3MEPA 2ZABA 4P14A 4K1ZA 4YG3A 2CY6A 2JDZA 4YW2A 1ULFA 2NP0A 1AJKA 2PHTA 1QGLA 1ZA4A 4ATEA 2PHWA 4DRVA 4Q27A 1QDOA 5H9RA 2JKBA 3ASIA 2WKKA 1AX1A 1WUVA 2CWSA 1W6PA 3D6EA 1QOTA 1GZWA 1LGBA 4XZPA 2E7QA 4FOWA 1GYKA 1LGNA 3T1LA 5FREA 4YZ5A 2NM1A 3MW2A 1Z78A 2YROA 4GWNA 3AP4A 1SBFA 1S1AA 5SV8A 3RMYA 2ENRA 3L2YA 4YW3A 3VKOA 2ZMKA 1BQPA 3ZXJA 2P34A 1WW5A 2VH9A 4XJWA 2P37A 1JN2P 1FATA 1ONAA 1DQ4A 1J1TA 1JYCA 4BLJA 3PMEA 3AP6A 3SNMA 1GSLA 3O0WA 4LBNA 2A6VA 1H9WA 2D3PA 3WV6A 1JBCA 1AX0A 1DZQA 1WD3A 4Q8LA 3WHTA 2WT0A 1QOOA 3N7MA 1GANA 3A4UA 4LBQD 4XHXA 1DHKB 1FV3A 2WSUA 4NO4A 3V0BB 3AYDA 3SH3A 5HCFA 3PVEA 4M00A 5DZFA 3WDUA 2UURA 2GMEA 1KJRA 4Y20B 2EALA 2R1BA 1YXWA 2DUOA 5E89A 1N47A 4I30A 4YG6A 1KDKA 2ZACA 5IUQA 2GN3A 1V00A 2GALA 3RRDA 4FOQA 4PBPA 3O12A 1BZWA 1CESA 1DLLA 3OGGA 4BMBA 5IT6A 1Y7BA 3VUOA 1PZ9A 2NZ9A 4XJ8A 4CRQA 5T5JA 3PVNA 2DV9A 3AZZA 5T55A 4H55A 4K21A 4PCRA 5T5LA 1LENA 2R16A 2VW0A 5IK5A 1V6JA 2C5DA 4M3CA 4JCKA 4XXPA 1AXZA 3QCWA 2A6XA 1NLSA 1S0BA 1SCSA 2V73A 1PZ7A 4JRAA 1SLLA 1HDKA 1HQWA 1MS9A 3B00A 3O0VA 4Q2FA 3V0BA 3FFZA 1B09A 4YZ1A 4RA0A 1JXNA 1SLAA 4Y20A 2AREA 2A6WA 5E88A 1LOFA 1MS0A 4HL0A 2ZGRA 4FP3A 4XMIA 3USUB 3WDYA 5IK4A 2YXSA 3FLTA 1A78A 2YMZA 1FV2A 2HYKA 2GNTA 2W52A 3LCPA 3N7KA 5DG2A 5GZCA 3N36A 4YM3A 1Q56A 4UW5A 3ZVXA 1AZDA 1F31A 1GICA 2AGSA 3T1MA 4FP2A 4AWDA 3T2TA 2R0HA 1CQ9A 5DUWA 1YO8A 3O5SA 2R49A 1QMJA 3OYWB 3W58A 1WLDA 4M3CF 3R4UA 1V6OA 3M2MA 1W0PA 2TEPA 5GLWA 4FPKA 3ZPYA 5FRAA 1RIRA 5CAZA
chains in the Genus database with same CATH superfamily
2XJPA 3MHZA 5FPUA 2YGLA 1FI2A 4ZKTB 2DCJA 4J25A 1SG3A 1VIWB 1VB2A 3I3BA 3OGVA 2OX0A 2D6NA 4AEDB 3I97A 5K7PA 1W6MB 4ITCA 1BMV2 1JYTA 1TME2 1AYM1 1OQDA 3D8CA 2A3XA 1ALYA 1OF3A 2XJQA 1PK6B 5FZEA 1TMF2 2YU2A 4M4RA 4AFCA 3USUA 4LHNA 3U78A 4QB1A 4EWDA 3LSDA 4LO8A 3HBZA 3VD5A 3DL3A 3K51A 2FDJA 4HPKB 3LPFA 4KL1A 4IUGA 5EZWA 4HN1A 4FAHA 3J9SA 2BNOA 1Z7S2 2D3RA 1ZRIA 2B4KA 4RQPA 1DZRA 1MR5A 2VUDA 4IQPA 4AL9A 2YZ4A 1GNYA 1QQP2 1YQ8A 4QPGB 3FBMA 4XJ9A 2ZGSA 3ENRA 4PHZA 1PGL2 1FMD1 1PO21 4NHKA 1H6XA 1CAVB 2OXBA 3PUHA 5FJKA 5A7WB 1EPWA 3CLPA 4Q5OA 3DGTA 4D6RA 1QJFA 1NE4A 5EYYA 2C9KA 4IERA 4OHXA 5FZDA 3K77A 5FZMA 1PIV2 4AEDA 1W6MA 3FX3A 4ISRA 3EYPA 1EV11 4MH0E 4UFKA 4OI1A 4DOUA 2HJIA 2E33A 1N1VA 1BVVA 3FMGA 1CPMA 1PK6A 2BRTA 1RUC3 1S2BA 5CBLA 3CHXA 5I0DA 4P9XA 2ATFA 3IIIA 4G4FA 1RMU3 3I8TA 3NNLA 1MPXA 2EIGA 1O59A 3LKJA 3JD72 1PMIA 1OC1A 4HPKA 1KFXL 1QY4A 2ZX4A 2WZEA 3O1OA 1MS4A 1O4YA 3I54A 4UW4A 3ZX7A 2RS31 4O9EA 1UU6A 5KHHA 2NMOA 4OI2A 4QPGA 3ZYJB 5FZCA 1UO9A 3POBA 3MPPG 3OBAA 3VBRB 5EFUA 4CCMA 2A71A 1HLCA 3GGLA 3JCIA 1AL21 4R9AA 4ATFA 3NAPC 1CAVA 1S0EA 2VG9A 2G9GA 5A7WA 1EAH1 1H8TB 3ES4A 3OD4A 2YC2A 2ZGMA 4M3CE 4DXSA 1OFNA 4Q4W3 4XBQA 2ZHMA 1WD4A 3HN1A 3SXWA 4BDVB 2GP3A 3LDBA 1FPN1 3B94A 1AR82 3NV3A 1LHNA 4XURA 4LR4A 4Y26A 5F3GA 5T5OA 3RSJA 2IXLA 4WZCA 4FTBA 2FDGA 4Z8BA 1H2MA 4HVQA 3D3AA 3MLLA 4FVVA 4BU2A 2R7EB 3AMHA 3WNXA 2ET7A 1SFNA 4PQQA 2CAUA 5FYMA 3WW2A 3THPA 5FY1A 1DYOA 2BPA2 1T6GC 2MNGA 4A7YA 4SBVA 1WBFA 3SQOA 3TEYA 4GH4C 1OFSA 3ACHA 5JR2A 5JMCA 1VBA1 2Y33A 1YYNA 1UW8A 2X5IB 2P3IA 4KWLA 4KMQA 4Q4X2 4K1YA 1XPWA 1GP6A 4IE4A 5DXDA 1QNYA 3OUHA 2VMFA 1LEDA 1D4M2 2RHPA 3FE5A 3VN4A 3VBRA 4RD7A 2OW4A 2XG3A 3OPZA 3IB3A 4XUQA 1XB9A 5EJ3A 1JOPA 1A6CA 2LUWA 4FPCA 2G9FA 1LKNA 4CDXC 1H8TA 1L7QA 1I3HA 1Q5OA 2DWRA 5FMDA 1JU3A 4D7SA 4CEYB 5K9YA 4GMP3 1VBC3 1RUF3 4N9IA 2I2SA 4RFT0 1H1AA 2P2KA 1CAWB 2YFUA 2XJSA 5DAQA 5C33A 3R05A 4XC9A 1KRIA 4CU7A 2X53S 5BPXA 2Z42A 3DXTA 4AHXA 4XFAA 2BDRA 2HWE3 5EJ1B 1K3IA 4UBHA 1ND3B 3A0NA 1LHOA 2VW2A 3AX4A 4QGNA 5IVJA 2W94A 2VW1A 3T2PA 3X29B 1HRI1 1BEV1 4O61A 2VL4A 4OZOA 3MIHA 5CB7A 1LCLA 4UYBA 3ZR5A 3AXDA 4NE9A 3FLPA 1JTZX 3LD8A 4L2NA 4RGAA 4Y1XA 5BV6A 5IHRA 2X5IA 2AUYA 2OYZA 4QXHA 4N43B 1S4CA 4FAGA 3ZN4A 4YZ2A 3I2OA 1MZ6A 2J1EA 2O1QA 4HKOA 1NAEA 2D40A 3VZMA 4CEYA 3UGFA 5IK7A 1JZ5A 2IWGB 4AFBA 2BU9A 1HXS2 5T50A 4J1WA 4R9CA 2VQ0A 4DXRA 1CAWA 1RUD2 3C3VA 4N53C 3T2QA 4AVTA 3J8F1 1POQA 1MVEA 3Q8BA 4QXKA 3UJQA 3KF3A 3P6BA 2CGPA 2XXZA 1AR61 4AEJA 1ND3A 2OIIA 1Y9GA 5FY5A 5BNPB 3M3CA 1WCQA 1SLIA 1W28A 3H8XA 1H8VA 4MGKE 3MIBA 3ALQA 3J4UH 1BMV1 3VHOA 1NX9A 3R4DB 3WUCA 2GAUA 2ZMLA 1TME1 3N9MA 5C8CB 4E2GA 1QIQA 3C7FA 3R4SA 1XYOA 3GALA 3RGBA 5L19A 2DBNA 2XOMA 3LZZA 1TMF1 3NL1A 1LAJA 1IS5A 2BBAA 4N43A 3VBUB 1JOBA 3HEIA 4OYUA 2JECA 5GKAC 2EIBA 4IDZA 5FKCA 4EE2A 1AR72 4CDQC 5L73A 1QJU3 5EV7A 4A42A 5J1XA 1CVNA 2RM22 3PTYA 1APNA 1Z7S1 1KFUL 5J7MA 1MS5A 1NE6A 3A23A 1QQP1 1FT9A 1SBDA 5JOXA 4IXLA 1CAUB 2X05A 4AAXA 1PGL1 1LOAA 4W6YA 1F35A 3MIEA 3WDXA 4LE4A 3B9IA 4X6QB 4AEMA 4PF5A 2F4LA 4CP9B 5BNPA 4TYSA 4XIKA 2OUHA 5I8YA 1RINA 1QF3A 1PIV1 1R082 3ZFEB 4L11A 2D5FA 1Q8VA 5T5PA 1RUE2 1V9U3 3CKHA 5T52A 3UYJA 3LPGA 4FSJA 2VUJA 4QM9A 2R1DA 4Y4RA 1X36A 3K3NA 3VBUA 2PTMA 1DF0A 2WAOA 2RS53 3L9JT 1DQ5A 4XF3A 3GZUC 3ZM8A 1AX2A 3LFIA 2B46X 4MGYE 3JD71 2YG0A 1POV0 4WZFA 1G9AA 2O8OA 3NNMA 3JZVA 4JZRA 1YQ6A 5AFBA 3K4ZA 5FZLA 1RJ8A 1JW6A 1C1LA 1ZZ6A 4LO4B 4F7ZA 4Z92B 1OT5A 3G7DA 2WUHA 4FQZA 4YM0A 1CAUA 3AM2A 3PU3A 5C71A 3BYWA 3EB7A 1FOD2 2Y0OA 4CP9A 2V5DA 5FR3A 4D6SA 1XE0A 3D0JA 4P9WA 1UD1A 4RGGA 2FBEA 3WEZA 2Y0IA 1AR81 4OHWA 2WN2A 4ZS2A 2BERA 2Y6HA 5KBFA 3ZFEA 2ZZJA 2VC9A 3O14A 2D6MA 4HK9A 3H1WA 1LR5A 4YZ3A 2B7YA 3QACA 1SLTA 2LS6A 3KSCA 3M3EA 4LBJA 4YM1A 3V65A 2WSVA 5BUVA 1EUTA 4QDQA 1RUI2 2Q1FA 1VBB3 2K0GA 2JG9B 2VNOA 4UBGA 1GMMA 2XUMA 4XIOA 3NWKA 2VXRA 2VZVA 4ES8A 4AF9A 1LHUA 1JUIA 3GBWA 1O5UA 2WR9A 1GZCA 1RTVA 3A22A 5LB6A 1JHNA 4Q4X1 2A3YA 2UY8A 1JOJA 5FXVA 2DUPA 4PIXA 5DAXA 1D4M1 5FKBA 1ZVFA 1AYN3 3WY6A 2A5ZA 2FD8A 4CUCA 4XAEA 2DURA 2PELA 2YYOA 3POIA 1GNZA 4BWOA 4LULA 3GBFA 2C26A 3D82A 4H2AA 4UW3A 4C1WA 4QHBA 4XW3A 2NPIA 4A3ZA 1BYHA 2QNKA 5F37A 4RHV2 3VDBA 4LBOA 3IPVB 4NWWA 4P02B 3VDCA 5CFCB 1ZRFA 1GU3A 2X29A 1UN1A 4CCCA 2W87A 1A34A 2LROA 1H6YA 1JU4A 3CMGA 4S2HA 4C0BA 4O7XA 3WHUA 3ZFGB 5D1IA 5HXVA 4DEQA 5KHGA 1OKQA 3E5QA 1W2OA 1GBGA 4BIFA 5BNNB 4KG8A 4AI9A 4XYXA 1PGW2 2JG9A 1S0JA 4LKFA 4XF0A 1O8PA 4RS5C 5IWFA 3BPZA 1MS1A 1QH7A 1R1ZA 4XDQA 3VD4A 1JZ6A 1RUOA 2B8MA 2A3WA 3OF1A 1MS8A 2LALA 1W8UA 1W8WA 2VMIA 5FPLA 1O3SA 1AR93 1XQNA 2ZEZA 5C9AB 1VBE3 2WFF2 4UXAA 3RZZA 2NMNA 3JB4C 2O0OA 5A70A 3VDDC 5C8WA 2X8KA 3NNJA 2BNNA 4LORA 1PM7A 2DFBA 5FZBA 3E6DA 3U07A 3ZXKA 2P3YA 3HNYM 1J58A 1F5JA 1JYIA 1HIXA 4AVBA 2J22A 5I91A 4V2WA 1HXS1 1RUD1 3IPVA 5CFCA 1VALA 3VKNA 3ZR6A 1OLME 2BGOA 3TB0A 4ASKA 1UL9A 1G7YA 2Q1ZB 3IT8A 3ZFGA 4ZHNA 1F8VA 2IXIA 3ILNA 3TEXA 3RZMA 5BNNA 3NNGA 1POV1 1LEMA 1N1SA 4PI2A 1PVC3 4YGDA 1LHVA 5ABJC 2A6YA 1U12A 2PAKA 1LOGA 3K4AA 2O14A 3PJQA 5DAWA 4AGVA 4P9JA 5FP4A 4ZPIA 3SEEA 1HN0A 2VQTA 2WYSA 2P4EA 1X8EA 4GWJA 5C9AA 3WG1A 3C8XA 4CTEA 5DPNA 1TNRA 2ZABA 5M0TA 2ETEA 4K1ZA 5FY9A 5JSRA 2NP0A 3MFCA 1W2NA 1QGLA 4A6SA 1AR71 1JODA 2LM3A 4XAAA 2XQRA 3VBSC 4CDWC 4EZHA 3ASIA 3E97A 3KCXA 2WKKA 2RM21 3WW1A 3DEMA 3D6EA 2XONA 1LGBA 1RUG2 1W9WA 1RHI3 2E32A 4A41A 1OSGA 5FJHA 4N90A 2PAEA 5ERLA 3EJKA 4FTEA 1FXZA 4PIYA 1A8MA 1W8TA 2ENRA 3OBZA 3OEBA 4PDWC 4Q4Y2 2J1SA 3VKOA 2P34A 1WW5A 2WWUA 4XJWA 2HBUA 1JN2P 1FATA 1PX3A 2P37A 2VOWA 5DAVA 2R072 2BOJA 1DQ4A 1OA2A 1TQ5A 1AHSA 3M3IA 2YPJA 1VAKA 2VMHA 3PMEA 3SHRA 1R081 5FPXA 2Z4FA 4LBNA 1H9WA 4QX5A 1RUE1 3WV6A 1AX0A 1WD3A 4QPWA 2UYBA 5JXHA 1J3PA 3VZKA 1UYXA 1GQGA 1DHKB 3KGLA 3O1TA 4PT6A 3SH3A 5HCFA 4M00A 5A3PA 3UETA 4Y20B 5AFEA 1RXGA 1W3XA 1C3HA 1QJZA 5CFDB 5I0SA 5I8TA 5D2AA 1W9FA 1RXFA 4QPYA 4AVCA 4I30A 4YG6A 2QQOA 3RRDA 4CDUB 1V00A 5A6ZA 4LA3A 4PBPA 1BZWA 1IPJA 1DLLA 1RUJ2 2ID4A 1FOD1 1UU5A 2V4AA 3IAQA 1M4WA 2VMDA 3LIGA 3KHCA 2FDFA 3CIHA 4QKFA 5J09A 4XJ8A 2FDKA 3T4VA 2Y26A 3MLKA 1JZ2A 3NKTA 4K21A 2RDRA 1LENA 1MEC3 2WZR3 3LDRA 5A1LA 1ZA7A 2A6XA 3TNPB 2V73A 4Q2FA 1SLLA 1HDKA 1HQWA 1H2NA 1RUI1 2EA7A 2JKXA 3B00A 5DDJ3 2W1UA 1B09A 4ARXA 5FZ3A 1K45A 4LNVA 2ZX3A 2WO1A 3OGJA 3ZLIA 2P6HA 5FBJA 1DU3D 4Y20A 3C7EA 4AQ2A 3WNPA 5E88A 5LWBA 1LOFA 3IDBB 5CFDA 4XFFA 4I02A 1MS0A 2WO3A 2ZGRA 3WDYA 2YXSA 3FLTA 2YMZA 3NQHA 2HYKA 5FPAA 5DG2A 5FOJB 2VTXJ 1OOPC 4CDUA 2VOKA 1UY2A 1ZYBA 2FDHA 3HQRA 2X09A 4LHSA 2W95A 3ETPA 3ZVXA 3KCCA 1AZDA 3POJA 4B4RA 4NIIA 4NPRA 5K8SA 3B7MA 4LKSA 5FZKA 2AGSA 1ACCA 1R1A3 1WKYA 1MQTC 4A2UA 1O3QA 2C4XA 4QD2A 2CDOA 2QJVA 2JENA 1IG3A 3OYWB 3PL0A 4RHV1 5FY8A 3NKGA 2B45X 5IVEA 5I0UA 1WLDA 4M3CF 1E57A 5FY7A 5E1RA 1W0PA 4BQYA 3RWKX 4DUWA 4FPKA 1XE7A 4MZUA 5FZ4A 3M8LA 2RS13 3W59A 4DRVA 5IT6A 4XCBA 3O1RA 4YSFA 2H0VA 3R0RA 2EXJA 5FQ0B 4K8RB 4I09A 3ZXAC 3FN9A 3N7JA 4TTGA 3PMSA 5HCAA 1PGW1 2PMWB 4YVWB 3B93A 1V6IA 1EUUA 4XBNA 5FZ1A 5FAXA 4XUOA 1XU2A 3GYDA 3VZOA 3O7OA 2XJVA 1W90A 5FP7A 5IVCA 5JVVA 3ZYGA 2WFF1 3D0SA 5JOZA 1S0FA 2LW8A 1VLNA 4KG0A 4OMDA 4XDOA 2FMDA 4LO6B 4NHXA 2DTYA 1O7FA 1OMIA 1H1IA 2XGXA 4UFMA 4GALA 3FLRA 3DUIA 5L36A 2WNVC 3LA2A 5SV5A 1C8M3 1YUDA 3AZVA 4P00B 3ZYPA 2VQAA 4CUBA 3MFAA 3KWVA 4AFMA 5A1AA 3BCWA 4U2AA 5C3SA 3OYWA 4U36A 3RWNA 4LITA 2EXIA 4OLLA 4QX8A 2K9ZA 4JGZC 1WCDJ 2WL1A 1ENQA 5LRSA 4HVOA 3TRSB 3O1PA 5H9QA 3VZLA 2QQWA 4HLTA 4Q4V3 2W1WA 3WNMA 5FQ0A 1KJLA 4G9SB 5GLTA 4FFGA 1RUH3 1UX7A 4YVWA 1UIKA 2VBBA 3F2ZA 4GIQA 4XEZA 4UWDA 5FCCA 4BLIA 1GOGA 4EYUA 1ZX5A 1U5IA 5D21A 4WM7C 4Z07A 3ZYHA 1MVQA 2EXHA 2Q30A 4A45A 5A32B 3N9QA 2W68A 2A7AA 4OZXA 4DPNA 4CDUC 3HNBM 2Z79A 3VBHC 3APBA 4Y5TA 4NRPA 2V5YA 3UGHA 5FLJA 3K48A 3AL5A 3DPRC 5CKQA 2RJLA 2HKXA 1DYKA 1PX4A 2QZ3A 1QJY3 1RUG1 1ASJ2 1EPZA 5LK7B 2DCKA 1CZTA 1PHMA 1BK0A 1KGYA 4QX1A 3THTA 1OQEA 4GH4B 2DUQA 4Q4Y1 1LU2A 4WM8C 5FZ6A 4EV0A 3E6CC 1UZZA 2XL7A 3FBYA 3GF6A 2CAVA 3H0OA 4IE0A 1SEFA 3S7EA 1H30A 5A3UA 2OKXA 2R071 4LBQB 5C70A 4Z82A 3CJIC 1AXKA 4PF1A 5FZ9A 3WR0A 4QPIC 2Z5WA 1DLCA 1S0CA 1IKPA 5FP3A 1VBD2 5DUUA 1KS5A 3DV8A 3QLQA 1LESA 2YV8A 2AYHA 4R4XA 5L9BA 2GMPA 2WRAA 5DQ0A 4CCLA 1GWMA 4LLOA 1W9SA 4LPLA 4W50A 4EROA 1H1MA 1SACA 3H7JA 4AZZA 5A32A 5J36A 2ZGOA 4LK6A 3S7IA 5BNQA 4Y22B 5FO7B 1GLHA 2PAMA 2P3KA 2FZ1A 3NJYA 2VTFA 3HIFA 1FNZA 3M3OA 4WV8A 4D6QA 4URAA 2JG8C 2BWAA 3LWCA 1NUKA 5H9PA 2VCAA 1H4HA 1RUF2 1VBC2 2W46A 5GZGA 2JB4A 3ZYBA 2VMCA 2KXLA 2I74A 4NIHA 1RUJ1 3SEPA 3KB5A 1H4GA 2VZ3A 3ILFA 4JTNA 3ZXEA 3HJRA 2HWE2 4XCAA 4YW4A 4FPLA 5CYYA 3UKVA 4C91A 4LBQA 3RZHA 2CHHA 3U10A 1YIFA 1ZZ8A 3S30A 4C1XA 2QVSB 1JYWA 4AI2A 4YW6A 3M4FA 4H14A 2JDMA 4IETA 2DCTA 5KXBA 1NT0A 2YC4A 3AKRA 3FC0A 4KU7A 4CXXA 2ZGTA 4CP0A 3CEWA 3Q9OA 3LEMA 3DYMA 1WA6X 5EHDA 4BHPA 4LOSA 5K0UC 4Y22A 4YRDA 2CL2A 2IVIB 4BQ3A 3TYJA 3MV01 4LBLA 3KLSA 1UXXX 2H6CA 3QH7A 1OLRA 3AKQA 1O4ZA 1W0NA 2MEV2 3W9AA 1AF9A 4KWUA 2B5HA 2NLRA 1CZVA 1YCIA 1CN1A 5H9SA 5LASA 5LBFA 3B69A 4MSVA 3NVCA 2DU0A 3H3LA 3RMXA 1FX5A 4K40A 3BALA 4H7LA 5LATA 2RDNA 3CZUA 4IGOA 5L7OC 1OH3A 4NIDA 1NZCA 4QX7A 4W65A 1AYM3 1DP0A 1ODNA 2L9LA 4CDQB 4E2SA 4GMP0 3FZ3A 2JIGA 5F8PA 5IJRA 1OUXA 3UKNA 1DFQA 2JJ6A 2OPWA 1QEXA 2WO7A 4LJHA 5D8AC 3H3UA 4XFBA 2WYFA 2ZXQA 5IAXA 4L9BA 3NRUA 5JOWA 2KD7A 5JZGC 3MPBA 2RJ2A 5HV0A 1QJU2 4XACA 4JGYB 5CNAA 1F4AA 1UYYA 4Y1UA 3UESA 2WNUC 3FHAA 3E5XA 2VD7A 3U4XA 1VMHA 2AACA 1FMD3 4RR3C 4UW6A 1C5IA 4ZY9A 1RB8G 4AQ6A 1E5SA 2AR6A 1JYVA 1GFF2 2ZHLA 1YIPA 2UU8A 2BV4A 2JDKA 4Y5Z0 3PJYA 2OZJA 2X10A 4MGQA 5KHKA 4M0NA 2RR12 4YG0A 4DY3A 3WP3A 1X82A 2EIDA 3VKMA 1UOBA 1LJ7A 1EV13 4XQWA 4CDQA 3TEZA 4WVMB 1GOFA 3OY8B 4MX3A 1V9U2 2A70A 1KD7A 5CKMA 3THCA 5C3QA 2TNFA 4GB32 5C3PA 1CR7A 5CU1A 3MBWA 4OUEA 2Q1MA 3I2IA 3U14A 5FLIA 2MPFA 1LHWA 2I07B 1GP5A 2RS33 4JGYA 5FOBB 1BLZA 1H9PA 1NXD1 4CUGA 3OSDA 4RN5A 3OUIA 5FYTA 5IVYA 5JUVA 4DXTA 4NRQA 5GJ6A 4RYDA 1AL23 1C5HA 3GJAA 4KGGA 4XHBA 3RS6A 4AEKA 5J96B 2TBVA 1EAH3 2PFWA 2BNMA 4LOTA 5A3TA 4ZXKA 3ZSLA 4AK3A 3T0DA 1OXCA 2EIEA 3E6BA 1N3QA 4GKYA 1FPN3 5A7OA 5BNOC 3BN6A 4IV1C 1H2LA 3ZSMA 1N1YA 2WAAA 1ASJ1 3CU7A 4IE6A 1OKOA 5CA6A 2G9ZA 5GLZA 4UFHA 4M3CB 4OQ8A 4WVMA 1W2AX 3H42B 3OY8A 3AZWA 2NN8A 3ZXFA 1IG0A 2YU1A 2O8QA 1W3VA 4COVA 3BOPA 1JS9A 3RYKA 1G8WA 4EN0A 5I8SA 4Q0PA 2QFEA 5APAA 1R092 3N35A 1GWKA 1ZBA3 4YWAA 1O8SA 1X7NA 4LE3A 3SITA 3WT3A 5FO8B 3ZFFB 1VBD1 1JZ3A 4QQOA 5JR7B 5F6LB 1T6BX 4YGEA 3UNPA 1CX1A 2DCZA 1M06G 2PHRA 4UT5A 3TN92 4XFIA 4AHYA 4IEXA 1K12A 4DZGA 3JQWA 2HWB2 1RGSA 3ZXGA 1QXJA 3WNNA 2JB8A 5CISA 5C4WC 2PQQA 1VP6A 1WW7A 4EN9B 2ZCWA 4CU6A 4FBFA 1ULGA 4DO0A 4MGZE 1ZREA 5FYSA 1UCXA 4WVVA 1PO13 3SLIA 1VBC1 1RUF1 2XDVA 4NJ4A 3VBFC 4B7EA 1OD5A 4RS5B 2ZGKA 4QWNA 1NCQC 5JMOA 2DVFA 1U5XA 3AKSA 3WQ1A 4AHZA 5J3UA 2VZPA 2WA4A 2ARCA 3PUSA 4HSJA 2ILMA 2CV6A 3D5OA 3H1YA 5GZFA 3IKWA 2HWE1 1AVBA 2ZTNA 3M1HA 1Q8PA 1NLQA 3P3NA 5G04L 5I0TA 4W6WA 4CYDA 4BCUA 1HRI3 1BEV3 3VDDB 3WDTA 2R063 5C3OA 5A7NA 5JOYA 1XNTA 5EQUA 5CVRA 1BBT2 2OA2A 2G19A 3H8UA 5FY0A 1AUYA 3UKTA 3ZFFA 2A1XA 5BYNA 4ASMB 3CQOA 4BZ4A 2XL9A 1S0IA 3MIFA 5FUPA 3K75B 4QXCA 3ZXDA 4BISA 1YLLA 4FFHA 3DKQA 2BBVA 1VBE2 1U5YA 3EQEA 4YFZA 5I0RA 4QQHA 4DINB 1S55A 4COZA 1GP4A 2PHDA 5B4XA 1O91A 4E2QA 1OA3A 1IZ3A 4L92A 3VZNA 2WQ4A 4C8DA 3K4DA 1RC6A 4EJRA 2NYYA 4LTAA 2JD4A 3J8F3 2V72A 5LK5A 1SFYA 3MW3A 4RS5A 5ABJB 2MEV1 2JDPA 5IVVA 3AK0A 2OT7A 3J26N 1D4VB 5DAPA 5JXJA 4ZONA 2WZ8A 2VJXA 2WO2A 4XE9A 2ZX1A 1W6PB 4COWA 4YW7A 1F15A 5EP9A 5LBBA 1UMHA 3VDDA 2HWC2 2W2IA 5A1FA 4N7IA 4YW5A 5FUIA 1TME3 3SH4A 5LY1A 1IS6A 4CDWB 4TLGA 2YBKA 5ANNA 1V6NA 5FXWA 1XYPA 3HR9A 3CDZB 1S2EA 2GH2A 2QQNA 2VULA 3KT1A 2XBO2 4E8DA 1REEA 3ZXLA 1DDLA 2G1MA 1E5HA 2VVDA 2IVJA 3BOWA 4AEDC 1WWYA 2XLGA 3AYEA 2IUWA 3POGA 1LNSA 2C1FA 3PLQA 1QJU1 3DN7A 2BTVC 2YBSA 4IEPA 4DRRA 2VBPA 4MOAA 5DZEA 4CXYA 4RSUA 3GHNA 1QQP3 1WA4A 2CY6A 2JDZA 2VGDA 1ULFA 4JTOA 4ATEA 4QHZA 1CIYA 1RHI2 3T3YA 2EAAA 4Q27A 5H9RA 3WXPA 2JKBA 1X8MA 2YBPA 3RYPA 5IFPA 3OEAA 5C8CA 3OD0A 5G05L 2CWSA 1W6PA 4O9GA 1QOTA 4UOJA 5B4NA 1NZIA 5FZIA 5FZFA 2WABA 1GYKA 1Y9QA 4YZ5A 4IEOA 5FREA 2RR11 1PIV3 1Z78A 2YROA 3LA3A 4YARA 2VOVA 2VPVA 4CDWA 1BQPA 1DGRN 1V9U1 2BGCA 1J1TA 4BLJA 5FYYA 4GB31 1VRH2 3JD73 3SNMA 1QJEA 4F3JA 1JBCA 3HOBA 5FO9B 1NA1C 4A6OA 5F2SA 1GANA 2NQYA 3U1XA 4LBQD 4A7KA 5EPAA 3ZOIA 1FV3A 4OHVA 4NROA 2GMEA 1KJRA 2EALA 2HBTA 2OZ6A 3KV6A 1WCUA 4TN7A 5LEKA 2XVGA 3MV11 5E89A 3SCHA 2BYVE 4MLOA 2GN3A 1HW5A 1AR83 5LBEA 3O12A 1F4HA 4RGKA 3TEWA 1ZRRA 3QH6A 4MGSA 4PLMA 3KV9A 1HRV2 2ZEXA 3VHRA 2ZAHA 3RDIA 3BGAA 3T0BA 3W5MA 1Y7BA 3PUIA 4LQRA 4NVPA 1JZ4A 3VUOA 1XNBA 2NZ9A 2WZR2 4NAOA 4CRQA 2BJSA 2ORZA 3PVNA 1OOPB 4DMIA 2DDUA 4KH9A 3AZZA 5T55A 5DDJ2 1I9RA 1OF4A 1R091 2R042 4H55A 4AW7A 2XLAA 5T5LA 2R16A 5IK5A 4MXWB 4JDMA 1HV0A 4XXPA 4W8JA 3K3OA 5J37A 1MQTB 1UNBA 2WA3A 1MS9A 1WGPA 1D4M3 3TN91 1RVF2 5KWRA 1WCKA 1SLAA 2CGOA 1OLQA 3GXUA 2HWB1 5FMOS 2QQLA 5IK4A 2CGNA 1NXMA 1JMUB 4XMIA 5C3RA 1KS4A 3GDBA 3BVCA 3HBKA 1NLRA 3WNLA 2JIJA 3C7OA 3NJZA 3AMPA 3Q8AA 3OOXA 3N36A 1ND2B 1Q56A 5FMCA 2JE8A 2ZEWA 5JSPA 4BA6A 2E26A 2QZ2A 3THDA 4C0HA 4OHZA 1UOJA 2JDUA 1I5PA 4XVHA 5FXZA 3BTZA 1US2A 3O5SA 3AC0A 1E5IA 1UKRA 1ZBE2 3KCYA 4FXKB 1OOPA 2VVEA 5FBZA 3W58A 3R4UA 1V6OA 2JD9A 4KQ7A 5GLWA 3MICA 3MGUA 5GZDA 5F1RA 3ST7A 1BBT1 3DKWA 4MXWA 1A8DA 1Y43B 2WNVB 3SH5A 2R0FA 1MQTA 1TE1B 4XJAA 5JLVA 5DG1A 4EN7B 3WG4A 1J83A 4NHLA 5HPOA 5FZOB 1DGWX 1VBE1 1QOSA 2VZRA 2HWF3 4XBLA 3U11A 4I2OA 1HN1A 1QHDA 2PYTA 4NRMA 4ZU4A 2PLV2 2WQZC 2CWMA 1C1FA 2CDPA 1XNDA 2Z2SB 4GULA 4JGZB 4JHZA 4LO7A 5EJZB 3SISA 1CGPA 1HB4A 5FYUA 4BYYA 4QGMA 4L8QA 1HXS3 3HQUA 5T3NA 3NMBA 3H8OA 1RUD3 1ND2A 4TZDA 4JAAA 1VAVA 4GKXA 3UT0A 4H3WA 4KGQA 4INDA 4R9DA 4MGTA 4HXCA 1J59A 1NCRC 2WNOA 3T30A 1SLBA 2RMU3 2D6LX 2AENA 4XF1A 2PHUA 4IGPA 3WX5A 1W6NB 1S0GA 3O1SA 4BE3A 4Q4V2 4GXLA 3OPTA 5FYHA 1ST8A 1HB3A 2HWC1 2VCMA 5DZGA 1YC61 5T54A 1HB1A 1RUH2 4ZZ5A 2XKPA 3VBHB 1AJOA 4R52A 4B29A 1ZRDA 2WNVA 2H0BA 3F95A 2QQIA 2WIIB 3DPRB 2ZAAA 2I45A 3LFMA 5FZOA 3WP5A 1YFYA 2XMLA 4BM8A 5BNPC 2EAKA 3AL6A 2UWBA 2WQ8A 2XBO1 2Y8KA 2DVDA 4GJZA 1DCSA 4NR1A 1AR73 3J7NA 3UL2A 1DGRA 3PVBB 4IE7A 2JE7A 4JGZA 1B35C 2HWD3 3ACGA 1ZNPA 4XFGA 3USSA 4YPJA 3V64A 4EQVA 4K8FA 1CONA 2WT2A 2VZOA 5ACA2 1G9DA 2UYAA 3PU8A 3VBUC 3CJIB 1GQPA 4AR2A 1QJY2 1VJ2A 4JKKA 4QPIB 1H2KA 1RHI1 2QCSB 3M3QA 3Q8CA 4ZZ8A 5DMYA 4CEWB 3OCPA 2UWAA 3OJBA 1BKZA 2Y6KA 4GJYA 1W2UA 3GNEA 5C8CC 1W8OA 3RZJA 1W6NA 3IN9A 3AP7A 1ZM1A 3I4IA 5E8AA 4XFCA 4DB5A 4XJUA 1XNKA 1PMJX 3B3QE 5FZ7A 5C5UA 1R083 3RZGA 3VBHA 2E63A 3O1VA 4S2FA 2D98A 1UF2C 1RUE3 4MADA 1US3A 4JQRA 3GM8A 3GJBA 3PDQA 3OG2A 2J42A 2XH6A 2DVAA 4IEYA 4E9KA 2B9UA 3PVOA 1VRH1 1K5MC 2P5BA 2D97A 2WC2A 2GN7A 1URXA 1W8ZA 3KQRA 3ZMNA 4XPVA 2W92A 2BOIA 5FYIA 1OVSA 1FNYA 3N4MA 1YFWA 1P8JA 1SZBA 3H3ZA 4CP2A 3KS7A 2DVGA 1ULEA 1GQHA 3CJIA 3AYCA 4AVVA 2JDNA 4HMZA 2WFPA 4QPIA 4DY5A 5EIYB 4BK4A 2AH2A 1F2NA 2VQUA 4QKNA 4CEWA 1YWKA 4DFSA 2ES3A 5FDBA 1UZYA 2VUCA 3JBG3 4NAMA 3N9OA 4Q0QA 1RITA 3W20A 3ECQA 3WF3A 4D8MA 3EBRA 3TOJA 2JDHA 1NQJA 2QQMA 3SCGA 1UMIA 3BODA 5K0UB 1NKGA 1OURA 2VMEA 4BQ5A 2ERFA 1MACA 1HRV1 2IXJA 3ZYIB 4AI1A 5F3CA 2WWSA 2ZGPA 5F6KA 4UI9L 4Y3OA 5DABA 1GZTA 1COV3 2WS93 2WZR1 4HOOA 4LKDA 3BTAA 4P9YA 4TSVA 1RUI3 4YGCA 3WZ1A 2E53A 4MYEA 5DDJ1 4Y1ZA 2R041 1W8HA 4G3YC 4X8NA 3LOBA 1YHFA 3OGRA 4DEVA 5AC92 3I2JA 3B02A 3BIWE 5IAVA 5L7OB 1DYPA 3O1UA 1RVF1 4FPFA 4ASLA 1N3PA 4EN6B 1I5ZA 3KHBA 3NV1A 3ZKUA 1SCRA 2JXAA 1YI9A 2W1SA 2BW8A 3U37A 5D8AB 4NIGA 3VLBB 1BCXA 4FFFA 1QXRA 1VB4A 4JX0A 4YVSC 4FT8A 1UU4A 4RHV3 3UK9A 5FP9A 4L97A 3WCSA 1PGSA 4OHYA 3ZSKA 1UX6A 2PHXA 4LHLA 4CU8A 4P5YA 3ES1A 4HFSA 1QH6A 2QDRA 1Y4WA 3S0MA 4B1MA 1ZBE1 2QQPA 2EICA 4RR3B 3K2OA 2PXJA 1SHWB 5E16A 1DQ0A 3I3QA 5C6CA 2VR4A 3ON7A 5CFCC 2WZPP 4YYOA 2PHLA 2ZMNA 4CPBD 4H7MA 4RFRB 2BQPA 1VMJA 1G9CA 4FPJA 2P3JA 3ZFGC 2QE3A 2XWBB 2UWCA 3AFKA 5GZEA 4CCJA 1SLCA 4B4QA 1BK1A 5L7OA 4GD4A 4L0PA 3VGIA 1Y3TA 2CTVA 2VO5A 2QDNA 1DGLA 4KWJA 3O0XA 4I01A 2GNMA 2PLV1 2HH9A 2W39A 5D8AA 5LW9A 5FP8A 5HCBA 1CPNA 3T09A 4AGGA 3MI8A 5FPVA 1STMA 1RUC2 4D7TA 3HPNA 1JI6A 1S0DA 3FUOA 5LA9A 4WBBA 2VZ1A 3ROUA 3KM5A 1RMU2 1IPKA 3ZKYA 5C9AC 4KBBA 4Z2AA 4DNYA 3NW4A 3NAPB 1XNAA 1XRUA 3VV1A 4X8PA 2D3SA 4RR3A 5LRRA 1GZ9A 1D2SA 3IWZA 4Q4V1 3AZYA 1J3QA 1SMVA 4ONUA 1RUH1 2J1UA 3LE0A 1JHJA 4F8AA 2PHFA 4B1LA 1VRBA 4XOGA 1OHFA 4NMIA 4Z1VA 1SQ4A 2DTWA 2HEVF 4IV1B 4Q4W2 2VY0A 3D4KA 5FYBA 4AVAA 3RFRA 2GC2A 3N9LA 4IEVA 4PBOA 1XNCA 5JI9A 3AJZA 3WF4A 3KVAA 1UIJA 2WDBA 1PM4A 2VZUA 4BH9A 5F39A 3VBOC 5FK8A 5JDBA 2ZX0A 2YHJA 3KT4A 1RUG3 3JU9A 4AI0A 3POWA 1YRZA 4NN0A 5FXXA 3CBNA 5ACA1 1QJX3 1QJY1 1CAXB 5C5TA 5IVBA 1YNAA 4ZU7A 1LGCA 3NAPA 4BMEA 1GWLA 1XSQA 2PA7A 4GAZA 4Q4Y3 3SKJE 4CDXB 3O1MA 5GLVA 2E7TA 5LA2A 1OI6A 4QDSA 4XUPA 3G6JB 3WQBA 5E6HA 1SBEA 5JI7A 2A75A 1UAIA 1W8FA 1BJQA 1TVGA 3ZYFA 2WINB 4HN0A 5JSOA 1CZSA 4WVZA 2VZQA 4ZS3A 1UPSA 1ZBA2 4P9IA 1G9BA 4RL7A 3S5AA 3OBRA 3EMRA 5C4WB 1RJ7A 1DQ6A 4CCNA 2VNRA 1G86A 5ISLA 5F32A 4BQ1A 2JX9A 2XLFA 4IV1A 2XVLA 4QX3A 3VBFB 3WINE 4XETA 3LEKA 5DN2A 1DZTA 3OPWA 1ENRA 4OMCA 5JXIA 1NCQB 1TZOA 4LA2A 3WW3A 4A44A 3UJOA 1YQ5A 4XTPA 4FQ4A 4BIOA 4GH4A 4BXFA 1UOFA 3W21A 1CD3G 4MG2A 1H0BA 4FOVA 1IHMA 2A6ZA 2ZHNA 3CNAA 4QB6A 2ZA9A 3T0AA 1CAXA 2YDEA 4AQSA 5CADA 1RUJ3 4P5HA 2QQKA 3PIJA 5FUNA 4HKLA 4CDXA 1XXNA 2GSYA 5KR7A 2FDIA 3KT7A 2XJRA 1V6MA 2VBDA 1LOFC 1X9TA 2RE9A 5CFDC 1S2KA 1J1LA 1OH4A 1C28A 3H50A 4E4DX 3LA7A 1Y9MA 1DGWA 2KM2A 2IC1A 3IBMA 4HK8A 4N53B 5AVPA 5K4LA 3NV2A 1QU0A 2R062 3BU0A 4Y5SA 1PZ8A 5C4WA 4HANA 1N3OA 1UY3A 3KZ4C 3WDVA 2TUNA 2P6CA 3OTFA 1GR3A 2ZEYA 2N7GA 3MIGA 4YGBA 2BVVA 2HEWF 3VBFA 4GZ9A 2C9AA 1NCQA 3LF7A 2F4PA 5A6QA 1NOVA 2Q8EA 3WLUA 4AI8A 4D94A 1LU1A 3MUZ1 2BEOA 1U0AA 4CP1A 4FXGB 2VECA 3KMHA 5AC91 1REDA 4AYUA 5EYXA 3MO4A 1LOCA 2CU5A 4CZSA 3BUCA 4YLZA 3DF0A 4BQWA 3GBGA 1VMFA 4M4PA 4AE2A 3L2HA 3AJYA 4EWAA 1W39A 3KF5A 2E6VA 4LUMA 4FFIA 1J84A 4Y4YA 1Q8QA 1K42A 5CIRA 2JWPA 4HSLA 1KQRA 2BFUS 3AMNA 4N53A 4COYA 3GZTB 1JZ8A 4AG4A 2QKDA 1FAYA 3IMNA 3DYOA 5EXOA 4AFAA 1Q8SA 3WNKA 4V1PA 1DQ1A 4EWEA 4BOWA 4XQ4A 4Y33A 3RI9A 1UY1A 2ZBJA 2F6BA 2BWCA 3C7GA 4P08A 2AEZA 3IMMA 4NIAA 1PO23 2YGMA 3MF6A 4AGRA 2W1QA 2ZZQA 4Q1RA 3ZPOA 4DQAA 5B2GB 2JEMA 3KQ4B 4KI5M 4GA9A 2V4VA 1O3TA 1OA4A 4AVSA 1LOBA 2GDFA 3J7MA 5CEHA 3EO6A 3W5NA 1RL3A 3HD8B 3ACLA 5FZ8A 4GWIA 3N3HA 3AFGA 4YVWC 2GC1A 1F5FA 3AYAA 2DCYA 3WW4A 5GALA 2B9VA 3MEPA 4KNCA 3P1IA 4P14A 3RYRA 4YW2A 2E7AA 2PHTA 3I3MA 4MV2A 1RUC1 1ZA4A 2D5HA 1SDDB 4QMAA 4W6XA 1UY0A 1RMU1 1OPOA 2RS52 2Q4SA 3ZMOA 3I3EA 3T2OA 2VMGA 1LB2A 2ZJCA 4I3GA 4XZPA 1NA1B 2E7QA 1O6UA 3AMMA 4FOWA 3T1LA 1W9YA 4Z2WA 3LOIA 3AP4A 1SBFA 3N9NA 3WF1A 3ZXJA 5LA0A 2QQJA 2J1RA 2VH9A 1JYXA 5JIUA 3MDPA 3AB0A 3A7QA 4E4HA 1BHGA 3QBQA 1BVP1 3AP6A 5KC5A 4Q4W1 1CX4A 1GSLA 2XVKA 3O0WA 4QB2A 3ABZA 4DUVA 4Q8LA 4W4ZA 1WMEA 3WHTA 2ADEA 1QOOA 2WT0A 5FZAA 2ZOEB 1EY2A 3A4UA 4JKLA 1YQ2A 4XHXA 1WMFA 3K46A 2WSUA 4PI0A 4QT6A 3Q8EA 4BQ4A 2UURA 1ASJ3 5JWPA 3LIHA 4QHOA 1VBB2 1W9TA 4XUTA 3PHMA 2DUOA 4O65A 1NA1A 5FIXA 3SCFA 2AC1A 1KDKA 1OD3A 2LRPA 1VBA3 2GALA 2IFWA 1C8NA 3MZHA 2W47A 3OGGA 3PIGA 4BMBA 5A6YA 1XBFA 3KGZA 2Y6LA 5F5AA 3LAGA 4HETA 3TWIA 4IV3C 1AYN2 1ZBA1 1VBD3 5A6XA 4KWKA 2JDYA 1HX6A 5JAXA 5FZGA 1UXZA 1TG7A 2XHKA 3OGSA 1R64A 3BIEA 1O3RA 1ZZBA 2BGPA 1NQDA 4LO5B 4PCRA 3MLJA 4GMP1 2GH8A 4CA9A 1L3JA 2OPKA 3H7YA 4M3CA 1HB2A 1VPHA 2HEYF 4JCKA 2MHFA 4JV4A 3I49A 1HQNA 3I2FA 4E27A 3O0VA 3HT1A 3FFZA 4YZ1A 4RA0A 2OS2A 3CF6E 3J7LA 2A6WA 4P9GA 5HCHA 4UFIA 1PO11 3CL1A 3SKVA 1JYNA 1Q3EA 1WMXA 5F3EA 3UGGA 5LZ6A 2Y6JA 1A78A 2FCVA 2GNTA 2V09A 2W52A 3LCPA 4E4ZA 5IYYA 3U0ZA 5GZCA 4YM3A 2B39A 4QQPA 3KVBA 1AR92 1CJDA 1GICA 4LK7A 3T1MA 2C24A 4FP2A 4OCTA 4UFLA 2R061 2R0HA 3S57A 1ULPA 2Y6GA 3V56A 5DUWA 3IZOA 4JDOA 3R6SA 2VAUA 5FMOL 4TLFA 3ZN6B 5BY5A 3CZJA 3M2MA 2TEPA 3ZPYA 1YQCA 1RIRA 5FRAA 5A7PA 3RG0A 5CAZA 2J1TA 3VKFC 1XYNA 2HWF2 1NCRB 3GZEA 1W6OB 1AR63 3KD4A 1KEXA 3OUJA 5BXXA 2ADDA 2Y64A 4BPZA 2MEV3 4RQPC 3LSEA 3HMYA 3BB6A 1PVC2 1W6QB 3NO8A 4LUKA 1D7PM 1V6KA 1KITA 2EVXA 3FJSA 3VBSB 4LHKA 4AFDA 5J98B 2QTWB 2JE9A 3SMHA 3POEA 4Y24A 2RMU2 2SBAA 1W06A 1TMF3 2ZGUA 2D6OX 3CO2A 2Y34A 3AKPA 3DCQA 1IGOA 4B4PA 3JXSA 2D44A 4AAPA 4QM8A 3IDCB 1W03A 1B35B 1KXGA 5GLUA 4CXWA 5A3LA 4PDWB 2VNGA 2Y38A 1Z7S3 2BP6A 1ENSA 3WCRA 3ZN6A 2VZSA 4OI4A 1PK6C 4OI0A 4CCOA 4HBNA 3LQCA 4Q29A 2DU1A 4Q26A 3I2HA 1HJGA 4NUBA 1NCRA 2ZKLA 4OUMA 2DBIA 2K46A 4YFWA 1W6OA 2AEYA 4AOCA 2LTNA 3ATGA 1O4TA 2HWD2 3IIAA 1WW6A 4CPBA 2VZTA 4HVRA 3C2UA 4JKMA 3EHKA 4AXOA 4CCEA 2DVBA 4MXVA 4FI9A 4AI3A 3HAGA 5KHJA 3AXEA 1NG0A 2QQUA 4QPGC 4QU1A 1W6QA 5C7GA 2CNAA 3I2KA 4D3WA 3RNSA 2E51A 3VBSA 3POYA 4ZXEA 3WQ7A 2RJKA 4MO3M 4JGYC 2RR13 4OQ9A 3IM0A 4L99A 1W99A 2WLPA 1L7LA 1K5MB 1VR3A 4Y1YA 1C57A 1W8NA 1LULA 2RS51 5HXMA 4R4ZA 1B35A 4JC1A 4PDWA 1MZ5A 1XE8A 2RV9A 4R9BA 5EWSA 5HV4A 4GB33 2XUEA 2Q5TA 2ET1A 2R32A 5LY2A 2J1VA 1X33A 4IEWA 4CCKA 4HT1T 3GHMA 1IS4A 2GP5A 2VOXA 4N7UA 4LXLA 3RQ0A 1IKQA 2ZGNA 3S6PA 2WJSA 3S5QA 4YNIA 5FLHA 5LBCA 1LOEA 2YPDA 4QX2A 3U4SA 5DUXA 4A7ZA 3J7HA 3N9PA 3PUQA 5IVFA 2BUKA 1QWRA 3LGRA 3VBRC 5HBAA 3AP5A 3JBG2 3WP4A 3LB9A 1H8TC 4YZ4A 1AL0G 1G6NA 1YFUA 1MEC2 2WBKA 2IXHA 4LEJA 3VKLA 4LIUA 3MUY1 4BK5A 1K5MA 5L9RA 2CSGA 1DBNA 3FHIB 3ZSEA 1A3KA 1WZXA 2FMYA 2ZKNA 1VBB1 2WWJA 2VCCA 2PQSA 3KV5A 4PQ9A 2WN3A 4Q4X3 3QOPA 3JUUA 2RG4A 4FCAA 1E5RA 4IEZA 4HKWA 1COV2 2WS92 4DXZA 2RVAA 1R093 3FUQA 2VM9A 2YC0A 1AYN1 2W08A 1TNFA 3VD7A 4B8EA 1W04A 1ZZ9A 1GOHA 1WW4A 1UYPA 1WLWA 3BKZA 4URTA 4YVSB 1R1A2 2EF6A 3JQXA 4Q0VA 3TAYA 2X5IC 3TN93 1ULDA 2HWB3 4UAPA 2ZHKA 1ZZ7A 4IW3A 2D43A 3AP9A 5FPBA 1UY4A 4IL7A 3ZFFC 4A3XA 1IQAA 2RS12 1L7RA 1OBNA 4UF0B 4XDPA 4FPYA 4CEYC 4BXSV 4BJ0A 4I0BA 4XUNA 1D0GA 1U5ZA 2WNEA 1XOYA 4GQ7A 4COUA 2J7MA 3WUDA 1WLCA 1X50A 2ZX2A 4AHWA 2D6KA 4AQTA 2IXKA 5I93A 5FPZA 4QQ2A 4JRLA 1YFXA 1ND3C 4FPEA 1AR91 4IEUA 4N8MA 4ZU5A 1JH5A 4LLFA 3ZIXA 2VE1A 5LA1A 1BBT3 2IFRA 5KXCA 5FZHA 1KDMA 3HN3A 4HZFA 1VE0A 1YJLA 2AZ5A 3KV4A 5F9TA 3WQ0A 4IE5A 3NNFA 4YVSA 5DUVA 1HJFA 1C8M2 2W91A 4PIZA 3WG2A 4N43C 1GKBA 3ZO0B 2XWJB 1ULCA 1CIWA 2GMMA 3FFQA 4XXAA 3WF0A 2XHNA 2HWF1 4XILA 1XJAA 5FFOC 3HNMA 4WM7B 3ZIWA 5L9VA 4KU8A 5F5IA 1NY72 2OQ6A 2RDSA 4Q0UA 4UF0A 3NSTA 1POV3 4CU9A 3PUAA 4FO9A 4OFGA 1UKGA 4S2DA 1F9KA 1VAMA 2DFCA 1PVC1 3B01A 2IZWA 3FWEA 5FYVA 1WLTA 3M7AA 4NPMA 3AVSA 5TSWA 3ZN5A 4D7YA 4F83A 2FQPA 2WLQA 1MZFA 2YUEA 3OBTA 5ABJA 2RMU1 1BXHA 1PVXA 2K2SA 2OQ7A 5FZ0A 5A7SA 4Q8KA 2HWC3 1MZEA 1QXPA 4XQDA 2YB7A 4K7JA 4ORFA 1RYYA 4XMAA 4LIVA 4BB3A 1CWPA 2R6QA 1SFPA 2HYXA 2RM23 3GCXA 3HQXA 4FPOB 2DF7A 2PN5A 4NOTA 3QD6A 4WM8B 4XABA 3VBOB 3BU7A 5KXDA 3WNOA 2ZGLA 1IOAA 5A3WA 2XBO3 3JB8A 2ZGQA 1LODA 2P17A 4LBKA 3SC7X 4YM2A 1GNHA 5AVAA 3ZDVA 2R30A 2XJUA 4XTMA 1W05A 4CSWA 1ZZCA 3VL8A 3E5UA 4Q1PA 4WM7A 1C4RA 5CKNA 4UFJA 4KBZA 1IPSA 2HWD1 5KXEA 5F2WA 4BQ2A 1TEIA 3E1F1 3RI8A 1OLMA 3LDKA 5A80A 3WD5A 3WVJA 2Q0AA 3PNAA 4DS0A 1QJX2 2WT1A 2DYCA 1QDCA 1PMHX 1UMZA 4I0AA 4XF9A 1YEWA 1YJKA 2QQVA 2OUJA 3RPQA 5A33B 4OULA 2JG8B 3DPRA 3ELNA 1HV1A 4D69A 2Z69A 3LEGA 4Y1VA 3UV9A 4QX0A 1PNFA 4FTSA 2SLIA 2KR2A 1Q43A 1SPPB 1V0AA 5F5QA 1DIWA 3BI3A 4IGQA 3INAA 4WM8A 3ZYRA 4QU2A 1W0OA 3VBOA 1AXYA 2D6PA 3ZFEC 4EZ4A 4NWVA 4NHMA 3WF2A 3WOGA 2JDAA 1VRH3 3V0AB 2H6BA 3MW4A 4DUXA 3WG3A 4ES9A 1ENXA 3I59B 4Q0SA 3DYPA 4I0WB 1QNWA 1WBLA 3RZLA 2JICA 4QGLA 1O5LA 1FOD3 3A21A 2OVUA 1YI7A 3POSA 4MGIE 1UZ0A 4FPGA 1NYWA 4MHUA 1OPMA 1UPIA 4WVWA 2VCBA 3ACFA 4JQTA 4B3NA 1Q8OA 3A0KA 2W9XA 5IFTA 3H9AA 2CYFA 3P3PA 1HQLA 2ARBA 3FL7A 4FPHA 1GV9A 1V6LA 2BZDA 3ILRA 3NV4A 3JBG1 2JG8A 4XFHA 4JHTA 5A33A 4C90A 5FWJA 3NJVA 1MEC1 2VUAA 4LBMA 4J6GA 2GNDA 3AZXA 4QKBA 1SPPA 1HRV3 1UWWA 4LKEA 5FV3A 4ET7A 3ZDSA 4QXBA 2BVBA 1RUNA 4CUAA 1WCSA 2ARXA 4MHRA 5A3OA 3WSOA 4K9SA 4M01A 1COV1 2WS91 1I1EA 3V0AA 2FZ2A 2R043 3I59A 2ZPXA 1CJPA 4QKDA 5CG9A 3ZSJA 2JG9C 3H1MA 1IS3A 2VVFA 2EXKA 3VHNA 5JCTA 2GZWA 5F3IA 5IK8A 4QDRA 1JUHA 3AKTA 2HLEA 1R1A1 1RVF3 2VU9A 2Y6FA 1V70A 5K0UA 2GNBA 4OVEA 2XQXA 1UQXA 5JZGB 3T4HB 3PTRB 1AYM2 1WMDA 4D0QA 1PNGA 3MF9A 3BTYA 2FCTA 3VHPA 2FHRA 2RS11 4NHYA 2WNUB 1Z0HA 1J3RA 5FWEA 3TNQA 1OQ1A 3HWJA 4HG6B 3RJRA 1SDWA 1QKQA 1LECA 4IESA 4CE8A 2RDQA 3IAPA 4XJZA 4SLIA 1GUIA 1ZBE3 1HKDA 3ETQA 4MVTA 3H8RA 2WFF3 3NJXA 3WDWA 3IDAA 1MS3A 5BNNC 1ND2C 1N1TA 1GZWB 1FMD2 1XC6A 1PO22 1LTEA 1G9FA 4YW1A 5FK7A 1W2TA 3T08A 5FMBA 2XB6C 4K3UA 5A3NA 3N7LA 5JPMB 5CG8A 5A3MA 1C8M1 3ITQA 5LEJA 2UY9A 2IXCA 4N9HA 4GWMA 3AMQA 2Q8OA 5CZKA 2GC3A 5JZGA 2PLV3 1EV12 4K20A 4FOYA 2Y60A 2BFUL 4LMFA 1ULOA 4OUSA 3B9CA 2YY1A 1D0HA 2WNUA 1FYUA 1NY71 4LT5A 5JPNB 2D7FA 5GM0A 4IEQA 2G4IA 4ISQA 1DQ2A 2W5FA 3ME2A 2QUOA 4YG3A 5FYCA 1T2XA 1AJKA 2XJTA 5KHIA 4CVUA 2PHWA 3I2DA 1QDOA 2RS32 4X6RB 2ORXA 4V2VA 5BNOB 5IW0A 1ZRCA 4QQLA 3VL9A 4A4AA 3EXUA 1AX1A 1REFA 1WUVA 2P1BA 4JDNA 5FY4A 3VDAA 1GZWA 2ARAA 2XPJA 1AL22 5JIAA 1LGNA 1EYBA 3DECA 2NM1A 3MW2A 2VNVA 1EAH2 4E4SA 4PLOA 4GWNA 1UZVA 1S1AA 5SV8A 2W0XA 3RMYA 3L2YA 2ZS6B 4YW3A 2ZMKA 4BQXA 2YFZA 1FPN2 5ANQA 2C0ZA 1UZWA 4NPLA 3MYXA 1ONAA 3OB8A 1JYCA 3GCWA 1EP0A 1XU1A 5ACA3 3VD3A 2A6VA 2D3PA 1JZ7A 2FCUA 2R073 4XF4A 1DZQA 5KC6A 4P9LA 3N7MA 4XZUG 1QJX1 4IV3B 2C6SA 5FTTC 3PURA 2D93A 4B7KA 3HT2A 5IATA 2XR4A 3CJXA 4NO4A 2B42B 2QBXA 3AYDA 2Q8DA 3U75A 3PVEA 5DZFA 3WDUA 3VD9A 4ARYA 1VBA2 5BNOA 3ACIA 4PJYA 2GU9A 4DIQA 3I2GA 2R1BA 1YXWA 3V0BB 4TWTA 1N47A 5F7UA 1OVPA 5IUQA 2ZACA 2W3JA 4EN8B 1I6XA 4CEWC 5HI0A 4FOQA 1IQDC 2Q8CA 1CESA 4CCDA 2XKOA 2GC0A 3WP6A 3RJ2X 1DG6A 1PO12 1PZ9A 4MUVA 2KA3A 3ORJA 3MIDA 3I7DA 5T5JA 3HVDA 3LEIA 1UOGA 2DV9A 2E31A 4TXWA 3VZJA 2E9QA 1OUSA 2A73B 2VTXA 2VW0A 1V6JA 2C5DA 3TBDA 3M70A 1AXZA 3QCWA 4IV3A 1NLSA 1SCSA 1S0BA 1HRI2 1BEV2 1K5JA 1PZ7A 2J1AA 4JRAA 3IDEA 4S2GA 3AVRA 4I3PA 3BTXA 3V0BA 3BPSA 2VXJA 3I3DA 5LCWL 4R8HA 1JXNA 3RVHA 1ODMA 3GZAA 2AREA 5A7QA 4HONA 2F17A 4J1XA 4HL0A 4FP3A 3USUB 3VB9A 3RZKA 2VOTA 5J48A 3POFA 5FYZA 1FV2A 3N7KA 3C7HA 3P5BA 5JXGA 4UW5A 1F31A 4PLNA 4E8CA 1D2QA 4RQPB 4AWDA 3T2TA 1UYZA 3FHQA 1CQ9A 1XSRA 1YO8A 3J8F2 4QAWA 5F5CA 1LRHA 2R49A 1QMJA 3B5LB 3DXUA 4META 3URFA 5AC93 4K6BA 3Q8FA 1X9PA 1AR62 4M0HA 4JVAA
chains in the Genus database with same CATH topology
2XJPA 2YGLA 1FI2A 4ZKTB 2DCJA 1VIWB 1VB2A 1BMV2 2D6NA 4AEDB 5K7PA 1W6MB 4ITCA 1TME2 1AYM1 1OQDA 3D8CA 2A3XA 1ALYA 2XJQA 1PK6B 1TMF2 4AFCA 3USUA 4LHNA 4EWDA 3LSDA 4LO8A 3HBZA 3DL3A 3K51A 4HPKB 4KL1A 5EZWA 4HN1A 4FAHA 3J9SA 2BNOA 1Z7S2 2D3RA 4RQPA 1DZRA 1MR5A 4IQPA 2YZ4A 1QQP2 4QPGB 3FBMA 4XJ9A 2ZGSA 3ENRA 1PGL2 1FMD1 1PO21 4NHKA 1CAVB 1EPWA 3CLPA 3DGTA 1NE4A 5EYYA 4IERA 4OHXA 1PIV2 4AEDA 1W6MA 3FX3A 4ISRA 1EV11 4MH0E 4OI1A 4DOUA 2HJIA 1N1VA 1BVVA 3FMGA 1CPMA 1PK6A 1RUC3 1S2BA 5CBLA 4P9XA 2ATFA 4G4FA 1RMU3 3I8TA 2EIGA 3LKJA 3JD72 1PMIA 4HPKA 1KFXL 1QY4A 2ZX4A 1MS4A 1O4YA 3I54A 4UW4A 3ZX7A 2RS31 4O9EA 1UU6A 5KHHA 2NMOA 4OI2A 4QPGA 3ZYJB 3MPPG 3VBRB 5EFUA 2A71A 1HLCA 3JCIA 1AL21 4R9AA 4ATFA 3NAPC 1CAVA 1S0EA 2VG9A 2G9GA 1EAH1 1H8TB 3ES4A 3OD4A 2ZGMA 4M3CE 1OFNA 4Q4W3 4XBQA 2ZHMA 1WD4A 3HN1A 3SXWA 1FPN1 3B94A 1AR82 3NV3A 1LHNA 4Y26A 4LR4A 5T5OA 3RSJA 2IXLA 4WZCA 4FTBA 4Z8BA 1H2MA 4HVQA 3MLLA 4FVVA 3AMHA 3WNXA 2ET7A 1SFNA 3WW2A 2CAUA 3THPA 2BPA2 1T6GC 2MNGA 4A7YA 4SBVA 1WBFA 4GH4C 1OFSA 5JMCA 1VBA1 4Q4X2 1YYNA 1UW8A 2X5IB 2P3IA 4KWLA 5IK8A 3MZHA 4K1YA 5DXDA 1QNYA 1LEDA 1D4M2 2RHPA 3FE5A 3VN4A 3VBRA 4RD7A 2OW4A 2XG3A 3OPZA 5EJ3A 4FPCA 1A6CA 2LUWA 2G9FA 1LKNA 4CDXC 1H8TA 1I3HA 1Q5OA 2DWRA 4D7SA 4CEYB 5K9YA 4GMP3 1VBC3 1RUF3 4N9IA 2I2SA 4RFT0 1H1AA 2P2KA 1CAWB 2XJSA 5C33A 3R05A 1KRIA 2X53S 5BPXA 2Z42A 4AHXA 4XFAA 2HWE3 4UBHA 1ND3B 3A0NA 1LHOA 2VW2A 3AX4A 4QGNA 2VW1A 3X29B 1HRI1 1BEV1 5CB7A 3MIHA 1LCLA 3AXDA 4RGAA 3FLPA 1JTZX 5BV6A 4L2NA 4Y1XA 2X5IA 2AUYA 2OYZA 4N43B 4FAGA 3ZN4A 4YZ2A 1MZ6A 2O1QA 4HKOA 5IK7A 2D40A 3VZMA 4CEYA 2IWGB 4AFBA 5T50A 1HXS2 4J1WA 4R9CA 2VQ0A 1CAWA 1RUD2 3C3VA 4N53C 4AVTA 3J8F1 1MVEA 4QXKA 3UJQA 2CGPA 1AR61 4AEJA 1ND3A 2OIIA 5BNPB 3M3CA 1SLIA 1H8VA 4MGKE 3MIBA 3ALQA 3J4UH 1BMV1 3VHOA 3R4DB 3WUCA 2GAUA 2ZMLA 1TME1 5C8CB 4E2GA 3R4SA 5L19A 1XYOA 3GALA 3LZZA 1TMF1 3NL1A 1IS5A 4N43A 3VBUB 2JECA 5GKAC 1AR72 4CDQC 5L73A 1QJU3 5EV7A 1CVNA 2RM22 3PTYA 1APNA 1Z7S1 1KFUL 5J7MA 1MS5A 1NE6A 1QQP1 1FT9A 1SBDA 5JOXA 4IXLA 1CAUB 1PGL1 1LOAA 4W6YA 3MIEA 3WDXA 4LE4A 3B9IA 4X6QB 4AEMA 4PF5A 5BNPA 4TYSA 4XIKA 2OUHA 5I8YA 1RINA 1QF3A 1PIV1 1R082 3ZFEB 4L11A 2D5FA 1Q8VA 5T5PA 1RUE2 1V9U3 4FSJA 5T52A 2VUJA 4QM9A 2R1DA 1X36A 3VBUA 2PTMA 1DF0A 2RS53 3L9JT 1DQ5A 4XF3A 3GZUC 1AX2A 2B46X 4MGYE 3JD71 1POV0 4WZFA 1G9AA 2O8OA 3JZVA 5AFBA 1RJ8A 1JW6A 1C1LA 1ZZ6A 4LO4B 4F7ZA 4Z92B 3G7DA 4FQZA 4YM0A 1CAUA 3AM2A 1FOD2 2Y0OA 3D0JA 4P9WA 1UD1A 4RGGA 2FBEA 2Y0IA 1AR81 4OHWA 5KBFA 3ZFEA 2ZZJA 3O14A 4HK9A 2D6MA 3H1WA 1LR5A 4YZ3A 2B7YA 3QACA 1SLTA 3KSCA 3M3EA 4LBJA 4YM1A 3V65A 5BUVA 2WSVA 1RUI2 1VBB3 2K0GA 2JG9B 2VNOA 4UBGA 2XUMA 4XIOA 3NWKA 2VXRA 4ES8A 4AF9A 1LHUA 1JUIA 3GBWA 1O5UA 1GZCA 1RTVA 1JHNA 4Q4X1 2A3YA 2UY8A 1JOJA 2DUPA 4PIXA 1D4M1 1ZVFA 1AYN3 3WY6A 2A5ZA 2DURA 2PELA 2YYOA 1GNZA 4BWOA 4LULA 3GBFA 4UW3A 3D82A 4C1WA 4QHBA 4XW3A 2NPIA 1BYHA 2QNKA 1ZRFA 4RHV2 4LBOA 3IPVB 4NWWA 5CFCB 2X29A 1UN1A 4S2HA 4C0BA 3WHUA 3ZFGB 5D1IA 5HXVA 5KHGA 1OKQA 3E5QA 1GBGA 4BIFA 5BNNB 4KG8A 4XYXA 1PGW2 2JG9A 1S0JA 4XF0A 4RS5C 3BPZA 1MS1A 1QH7A 1R1ZA 4XDQA 1RUOA 2B8MA 2A3WA 3OF1A 1MS8A 2LALA 2VMIA 1O3SA 1AR93 1XQNA 5C9AB 1VBE3 2WFF2 4UXAA 3RZZA 2NMNA 3JB4C 2O0OA 3VDDC 5C8WA 2X8KA 2BNNA 1PM7A 2DFBA 3E6DA 3U07A 3ZXKA 1J58A 1F5JA 1JYIA 1HIXA 4AVBA 5I91A 1HXS1 1RUD1 3IPVA 5CFCA 1VALA 3VKNA 3TB0A 1UL9A 1G7YA 2Q1ZB 3IT8A 3ZFGA 1F8VA 2IXIA 3ILNA 5BNNA 1POV1 1LEMA 1N1SA 1PVC3 4YGDA 1LHVA 5ABJC 2A6YA 1U12A 2PAKA 1LOGA 3PJQA 4AGVA 4P9JA 1X8EA 5C9AA 3WG1A 4CTEA 1TNRA 2ZABA 2ETEA 4K1ZA 5JSRA 2NP0A 3MFCA 1QGLA 1AR71 2LM3A 3VBSC 4CDWC 3ASIA 3E97A 3KCXA 2WKKA 2RM21 3WW1A 3D6EA 1LGBA 1RUG2 1RHI3 1OSGA 4N90A 2PAEA 3EJKA 4FTEA 1FXZA 4PIYA 1A8MA 4PDWC 2ENRA 4Q4Y2 3VKOA 2P34A 1WW5A 4XJWA 2P37A 1JN2P 1FATA 2VOWA 2R072 3M3IA 1DQ4A 1OA2A 1TQ5A 1AHSA 2YPJA 1VAKA 2VMHA 3PMEA 3SHRA 1R081 5FPXA 4LBNA 1H9WA 4QX5A 1RUE1 3WV6A 1AX0A 1WD3A 2UYBA 1J3PA 3VZKA 1GQGA 1DHKB 3KGLA 3SH3A 5HCFA 4M00A 4Y20B 5AFEA 1C3HA 1QJZA 5CFDB 5I0SA 5I8TA 4QPYA 4AVCA 4I30A 4YG6A 3RRDA 4CDUB 1V00A 4LA3A 4PBPA 1BZWA 1IPJA 1DLLA 1RUJ2 1FOD1 1UU5A 1M4WA 5J09A 4XJ8A 2Y26A 3MLKA 3NKTA 4K21A 1LENA 1MEC3 2WZR3 2A6XA 3TNPB 2V73A 4Q2FA 1SLLA 1HDKA 1HQWA 1H2NA 1RUI1 2EA7A 3B00A 5DDJ3 1B09A 4LNVA 2ZX3A 3OGJA 4AQ2A 1DU3D 4Y20A 5E88A 1LOFA 3IDBB 5CFDA 4XFFA 4I02A 1MS0A 2ZGRA 3WDYA 2YXSA 3FLTA 2YMZA 2HYKA 5DG2A 5FOJB 1OOPC 4CDUA 2VOKA 1ZYBA 3ZVXA 3KCCA 1AZDA 4B4RA 4NPRA 5K8SA 3B7MA 2AGSA 1R1A3 1MQTC 4A2UA 1O3QA 4QD2A 2QJVA 2JENA 4RHV1 3OYWB 3NKGA 2B45X 5I0UA 1WLDA 4M3CF 1E57A 5E1RA 1W0PA 5IT6A 4FPKA 1XE7A 4MZUA 3W59A 3M8LA 2RS13 4DRVA 4YSFA 2H0VA 3R0RA 2EXJA 5FQ0B 4I09A 3ZXAC 3N7JA 3PMSA 5HCAA 1PGW1 4YVWB 3B93A 1V6IA 4XBNA 5FAXA 1XU2A 3GYDA 3VZOA 3O7OA 2XJVA 5JVVA 3ZYGA 2WFF1 3D0SA 5JOZA 1S0FA 4KG0A 1VLNA 2FMDA 4LO6B 2DTYA 1O7FA 1OMIA 1H1IA 2XGXA 4GALA 3FLRA 3DUIA 5L36A 2WNVC 3LA2A 5SV5A 1C8M3 1YUDA 3AZVA 3ZYPA 2VQAA 3MFAA 4AFMA 3BCWA 4U2AA 3OYWA 4U36A 3RWNA 2EXIA 4OLLA 2K9ZA 4JGZC 1WCDJ 2WL1A 1ENQA 5LRSA 4HVOA 3TRSB 5H9QA 3VZLA 4Q4V3 4HLTA 5FQ0A 1KJLA 4G9SB 5GLTA 1RUH3 4YVWA 1UIKA 4GIQA 4XEZA 4BLIA 5FCCA 1ZX5A 1U5IA 4Z07A 4WM7C 1MVQA 2EXHA 2Q30A 5A32B 2W68A 2A7AA 4OZXA 4DPNA 2Z79A 3VBHC 3APBA 2V5YA 5FLJA 3K48A 3DPRC 2RJLA 2HKXA 1DYKA 2QZ3A 1QJY3 1RUG1 1ASJ2 1EPZA 5LK7B 2DCKA 1PHMA 3THTA 1OQEA 4GH4B 2DUQA 4Q4Y1 1LU2A 4WM8C 4EV0A 3E6CC 1UZZA 2XL7A 3FBYA 3GF6A 2CAVA 3H0OA 3S7EA 1SEFA 1H30A 2R071 4LBQB 4Z82A 3CJIC 1AXKA 3WR0A 4QPIC 2Z5WA 1S0CA 1IKPA 1VBD2 5DUUA 1KS5A 3DV8A 3QLQA 1LESA 2YV8A 2AYHA 4R4XA 2GMPA 4LLOA 4EROA 1H1MA 1SACA 3H7JA 5A32A 5J36A 2ZGOA 3S7IA 5BNQA 4Y22B 5FO7B 1GLHA 2PAMA 2P3KA 2FZ1A 3HIFA 1FNZA 3M3OA 4WV8A 2JG8C 2BWAA 3LWCA 5H9PA 1H4HA 1RUF2 1VBC2 5GZGA 2KXLA 2I74A 1RUJ1 3KB5A 1H4GA 3ILFA 4JTNA 3ZXEA 2HWE2 4YW4A 4FPLA 3UKVA 4C91A 4LBQA 3U10A 1YIFA 1ZZ8A 3S30A 4C1XA 2QVSB 4AI2A 3M4FA 4H14A 4IETA 5KXBA 2DCTA 3AKRA 3FC0A 4KU7A 2ZGTA 4CP0A 3CEWA 3Q9OA 4BHPA 5K0UC 4Y22A 4YRDA 2CL2A 3TYJA 4LBLA 3KLSA 2H6CA 3QH7A 1OLRA 3AKQA 1O4ZA 3W9AA 2MEV2 1AF9A 2B5HA 2NLRA 1YCIA 5H9SA 1CN1A 3B69A 4MSVA 3NVCA 2DU0A 3RMXA 1FX5A 4K40A 3BALA 4H7LA 5L7OC 1NZCA 4W65A 1AYM3 4CDQB 4E2SA 4GMP0 3FZ3A 3UKNA 1DFQA 2JJ6A 5D8AC 3H3UA 4XFBA 4L9BA 5JOWA 5JZGC 3MPBA 1QJU2 5CNAA 4JGYB 4Y1UA 2WNUC 3E5XA 3U4XA 4RR3C 1FMD3 4UW6A 1C5IA 1RB8G 4AQ6A 2AR6A 1GFF2 2ZHLA 1YIPA 2UU8A 4Y5Z0 3PJYA 2OZJA 5KHKA 4M0NA 2RR12 4YG0A 4DY3A 3WP3A 1X82A 3VKMA 1LJ7A 1EV13 4XQWA 4CDQA 4WVMB 3OY8B 4MX3A 1V9U2 2A70A 1KD7A 2TNFA 4GB32 1CR7A 5CU1A 2Q1MA 5FLIA 2MPFA 1LHWA 2I07B 2RS33 4JGYA 5FOBB 1H9PA 1NXD1 3RS6A 5GJ6A 4AEKA 1AL23 1C5HA 4KGGA 4XHBA 5J96B 2TBVA 1EAH3 2PFWA 2BNMA 4ZXKA 3ZSLA 4AK3A 3E6BA 1N3QA 4GKYA 1FPN3 5BNOC 4IV1C 1H2LA 3ZSMA 1N1YA 1ASJ1 3CU7A 5CA6A 5GLZA 4M3CB 4WVMA 3OY8A 3AZWA 2NN8A 3ZXFA 2O8QA 4COVA 3BOPA 3RYKA 4EN0A 1G8WA 5I8SA 4Q0PA 2QFEA 1R092 3N35A 1ZBA3 1X7NA 4LE3A 3SITA 3WT3A 5FO8B 3ZFFB 1VBD1 4QQOA 5JR7B 5F6LB 4YGEA 2DCZA 1M06G 2PHRA 3TN92 4XFIA 4AHYA 4IEXA 4DZGA 3JQWA 2HWB2 1RGSA 3ZXGA 1QXJA 5C4WC 2PQQA 1VP6A 1WW7A 4EN9B 2ZCWA 4FBFA 1ULGA 4MGZE 1ZREA 1UCXA 4WVVA 1PO13 3SLIA 1VBC1 1RUF1 3VBFC 4B7EA 1OD5A 4RS5B 2ZGKA 1NCQC 2DVFA 1U5XA 3AKSA 3WQ1A 4AHZA 5J3UA 2WA4A 4HSJA 2ILMA 2CV6A 3D5OA 3H1YA 5GZFA 3IKWA 2HWE1 1AVBA 2ZTNA 3M1HA 1Q8PA 5I0TA 3P3NA 4W6WA 4CYDA 4BCUA 1HRI3 1BEV3 3VDDB 3WDTA 2R063 5JOYA 5CVRA 1BBT2 2OA2A 3H8UA 3UKTA 5BYNA 1AUYA 5C6CA 3ZFFA 4ASMB 4BZ4A 2XL9A 1S0IA 3MIFA 3ZXDA 1YLLA 2BBVA 1VBE2 1U5YA 3EQEA 4YFZA 5I0RA 4QQHA 4DINB 1S55A 4COZA 2PHDA 1O91A 4E2QA 1OA3A 1IZ3A 4L92A 3VZNA 2WQ4A 1RC6A 4EJRA 2NYYA 4LTAA 2JD4A 3J8F3 5LK5A 1SFYA 3MW3A 4RS5A 5ABJB 2MEV1 3AK0A 3J26N 1D4VB 4XE9A 4COWA 2ZX1A 1W6PB 3VDDA 2HWC2 4N7IA