3A0NA

Crystal structure of d-glucuronic acid-bound alginate lyase val-1 from chlorella virus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
242
structure length
242
Chain Sequence
b'NVISTLDLNLLTKGGGSWNVDGVNMKKSAVTTFDGKRVVKAVYDKNSGTSANPGVGGFSFSAVPDGLNKNAITFAWEVFYPKGFDFARGGKHGGTFIGHGAASGYQHSKTGASNRIMWQEKGGVIDYIYPPSDLKQKIPGLDPEGHGIGFFQDDFKNALKYDVWNRIEIGTKMNTFKNGIPQLDGESYVIVNGKKEVLKRINWSRSPDLLISRFDWNTFFGGPLPSPKNQVAYFTNFQMKKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VAL-1
publication title Crystal structure of family 14 polysaccharide lyase with pH-dependent modes of action
pubmed doi rcsb
source organism Chlorella virus
molecule tags Lyase
total genus 61
structure length 242
sequence length 242
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2009-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3a0nA00
4XBNA 3FLRA 3OYWB 4JCKA 2R16A 4XTPA 2ZKNA 3MEPA 5IK7A 4M00A 4Y1ZA 1MZ5A 1FX5A 1IKQA 1LGNA 4FPKA 4XJ9A 1CIWA 2JE7A 4YZ3A 1A78A 3OBTA 2DTYA 2RHPA 4YG3A 3AZXA 1AX0A 1Z0HA 2A5ZA 3IMNA 1SLLA 4P9XA 2DVGA 5GLZA 4TZDA 5H9PA 2GNTA 3M2MA 2ZGSA 1GYKA 4FPEA 1KDKA 4FVVA 1LULA 1LGCA 1SLIA 1MS1A 5DZGA 2ZGNA 1VAMA 4FQZA 5JMCA 3JU9A 2PHWA 4R9DA 1FNYA 1C1LA 3O0WA 2ZAAA 1LJ7A 1QGLA 4XBLA 4YGEA 1IKPA 5GJ6A 4CRQA 4DS0A 2A75A 1YI7A 4ASMB 5DZFA 1TEIA 5DUUA 3O12A 1LCLA 2P3KA 3ZSJA 4BMEA 5CAZA 3AZYA 4YW4A 1W6NB 2VW0A 1LOGA 2A6ZA 2DU0A 2EXIA 5F5QA 2A70A 1LU2A 3PJQA 2DVBA 1N3QA 4Q1RA 1F31A 2ZABA 5KXEA 2A6YA 1O4ZA 1C57A 1V6MA 1W0PA 1LOCA 2JKBA 4FP3A 4Y26A 4Q2FA 4DPNA 2ZGQA 2AENA 2P3IA 3WOGA 4BPZA 1GANA 4GA9A 3USUB 3LSEA 4FQ4A 2A6XA 1ULCA 1N3PA 5JLVA 3AZZA 2WLQA 3APBA 4XYXA 1DQ4A 4GWMA 1HQWA 2ZACA 1Q8VA 2ZMKA 5T5OA 2ZGPA 4BM8A 1HKDA 4XHBA 1H9WA 5DXDA 1DLLA 5GZFA 3PVNA 4GXLA 1DYKA 2OVUA 2YV8A 4YGDA 4CZSA 1A3KA 3D4KA 3OY8B 4XMIA 1BQPA 2W08A 5GLWA 1DQ1A 1UAIA 1KRIA 1LOFC 1N3OA 1NXD1 1YO8A 1S0FA 1LEDA 1MVQA 2OW4A 1DGLA 3IPVA 1NLSA 1N1SA 2R1DA 3N7MA 1I1EA 2ZMNA 2GDFA 5HCBA 5IT6A 5DUXA 4RL7A 4DRVA 3WG4A 1LHVA 1UL9A 1CR7A 4FPGA 3BOPA 1LHNA 1QOSA 2H0BA 3AP5A 4NO4A 3ZXLA 2YZ4A 2E51A 2ZHLA 5T55A 1BKZA 1W6OA 4R9CA 1FV2A 4YFWA 4Y1VA 1LHWA 1WW5A 2A71A 2AUYA 4CTEA 1CPMA 5IK4A 1BYHA 3KQRA 4FP2A 4F83A 1KQRA 1CVNA 2Q5TA 4LBLA 1PZ9A 1JXNA 4PQ9A 3FBYA 5BYNA 4XJUA 1FAYA 1MS8A 1LTEA 4YM1A 2FMDA 3O0XA 1WLCA 2AR6A 3UL2A 1S0EA 3WHTA 2VU9A 3WLUA 1AJOA 2DYCA 4HL0A 2P37A 2ERFA 2GNMA 2E7QA 1GBGA 3A0NA 2D3PA 5AVAA 1MS9A 5IUQA 1W6QB 3FFZA 5JOYA 2DVFA 1WUVA 1ULDA 1ULGA 3ZVXA 4AGGA 4DQAA 1QKQA 2DVAA 4JC1A 2E6VA 3GNEA 1MS0A 4XBQA 3SNMA 4LBKA 1JYIA 2ZHKA 3O5SA 4BLJA 3OYWA 4Y22B 1QU0A 2VH9A 5GZDA 5GZEA 3SH3A 1V6LA 3V65A 1LEMA 4XIKA 1PZ7A 2HYKA 4XJWA 1DFQA 1G9AA 2BQPA 4YW1A 1JUIA 3HMYA 3AYEA 3AYCA 3HN1A 3WDYA 3V64A 1A8DA 2C9AA 3W59A 4ISRA 5JDBA 4Q26A 1AJKA 1AX1A 1GNHA 2DVDA 2EF6A 1AZDA 2D6NA 5GLTA 5T5JA 5T5PA 2UWBA 4L8QA 1VIWB 2CYFA 1UZYA 4W65A 1W6PB 5E8AA 1G86A 2EXJA 3L2YA 5SV8A 3INAA 3W58A 1APNA 1RIRA 4UW4A 4ITCA 1UZZA 2UWAA 1Q8SA 3AK0A 3IN9A 3B00A 1MS3A 4K1ZA 4K1YA 3WHUA 2V5YA 3MW3A 1AXYA 1S0IA 5CNAA 4AVVA 4BOWA 3AJZA 2SLIA 5GZGA 1Y7BA 3RRDA 1QMJA 3ILRA 1LENA 1BZWA 1SLBA 2D6LX 3AP9A 1DBNA 2PHUA 3N7KA 1W6MB 1SLAA 1LGBA 3LCPA 3N36A 5JOXA 5H9QA 4YM3A 3MW4A 1OFSA 4RA0A 2A7AA 2WJSA 4PBOA 4DRRA 4FOVA 2D6PA 3WUDA 1VAVA 1W6NA 2CTVA 3PMEA 3NV3A 1UKGA 2JD4A 5EYYA 5KXCA 4MYEA 4XMAA 5EWSA 3QCWA 4BQ1A 3IKWA 1YRZA 4Q27A 3WG2A 2A6VA 4XE9A 2YROA 4HANA 1LOBA 1IS6A 4UW3A 4UW6A 4IQPA 2ZGOA 4H55A 4YFZA 5CB7A 5DUVA 2NZ9A 3R4UA 3USUA 2B7YA 1DQ2A 2DURA 1AF9A 1ULFA 3UK9A 4NOTA 3I4IA 2CY6A 3U4XA 3ZYRA 1IS4A 3VV1A 2R0FA 4KBBA 5T50A 1DZQA 3FUQA 1G7YA 1G9FA 1Q8QA 3R05A 2DUPA 1U0AA 5E88A 1QF3A 2UWCA 4FOWA 1I3HA 3N3HA 4M01A 3V0BB 1N1VA 3B69A 2FHRA 4PF5A 3KM5A 3M3QA 3ZXKA 3N7JA 3HR9A 3OY8A 1IS3A 1C1FA 2JECA 1WD4A 2XB6C 2CWMA 4YW5A 4GALA 1F5FA 5LK5A 3WG1A 1SACA 3GALA 3RMXA 1CJPA 1XQNA 2A3XA 2GNDA 1AXZA 1J1TA 3IM0A 4FPHA 3ZSKA 3ZSLA 2WKKA 2KM2A 1SLTA 2WNEA 2D6OX 4Y1YA 4YG0A 2CNAA 5HCFA 2I2SA 1S1AA 2GN3A 2R0HA 5JVVA 4XILA 1KITA 5T5LA 1GKBA 3D6EA 2DUQA 4K21A 2ZHNA 3CNAA 4D69A 1CESA 4LBJA 4C1XA 2JDZA 5FRAA 1V6JA 3PVEA 1DQ6A 3WVJA 2DV9A 2GMMA 3RMYA 5KXDA 3ASIA 4XZPA 2JE9A 1ENQA 4Y20B 1GV9A 1MVEA 1JN2P 3B9CA 4LBMA 1IS5A 4AYUA 1W0OA 1SBFA 2Z42A 1G9CA 3N35A 1VALA 3N7LA 3M3OA 3R4SA 2DU1A 1CQ9A 4ZXKA 3WUCA 4LBQD 1GZCA 2DWRA 1CONA 5EXOA 1ENRA 2GMPA 3C2UA 4XXAA 3WDTA 1W6QA 2PHRA 2AH2A 2PHTA 5GALA 1VLNA 2EIGA 1GLHA 3V0AA 2A6WA 2SBAA 1QOOA 2VW1A 2NP0A 1ZM1A 3OBRA 4R9BA 2WSVA 1D2SA 1SBEA 1WLDA 1YXWA 4Y22A 1YIFA 2CWSA 3M3CA 4Q8KA 5IK8A 3RSJA 5GLUA 1FATA 2ZA9A 1Q56A 4OZXA 3AYAA 3MPPG 5EYXA 5H9RA 3SH4A 1ZA4A 1LHUA 1LOAA 4FPCA 5E89A 3V0AB 3VKNA 2TEPA 2WQZC 2AGSA 4FPJA 1DYPA 4M3CE 4YG6A 3FUOA 2ZGLA 1SLCA 4BLIA 2GMEA 1OQ1A 4FOQA 3AX4A 2ZGTA 5HCAA 1KJLA 1W6PA 2GNBA 2ZGRA 4ATEA 5CBLA 4XDQA 5IK5A 1DQ5A 3M1HA 1JBCA 1WBFA 3M3EA 3SITA 4U36A 1ONAA 1JYCA 5F9TA 1KDMA 3OGGA 5L73A 2LTNA 2WT0A 1G8WA 1MS5A 1GICA 2WT1A 2NMOA 1Z78A 1DHKB 3AJYA 5DUWA 4M3CB 4ATFA 3O0VA 3VUOA 1GZWB 1MS4A 3LSDA 1LECA 3NWKA 2YXSA 1W6MA 3AXEA 3BTAA 2D6MA 2EALA 2D3SA 2NYYA 1RINA 5JOWA 1V6IA 2YY1A 4YGBA 3SISA 1F9KA 3DGTA 2P34A 4XIOA 1V6KA 1S0BA 1GNZA 3UJOA 2V73A 3AP4A 2P3JA 3MW2A 1MR5A 3SH5A 2NN8A 1WD3A 3POWA 4YLZA 2AREA 4LBOA 4JRAA 5H9SA 1RITA 1SCRA 1V6NA 2DTWA 3FLTA 4AVTA 1ULEA 1O4YA 3RS6A 4FPFA 3WDWA 4YZ5A 5GZCA 1V00A 3VKLA 4LBNA 2NM1A 3ILNA 1SFYA 4WVWA 5GLVA 2D44A 3V0BA 2OUHA 2G4IA 1WW4A 3D5OA 3H0OA 3T1LA 1HLCA 3AP6A 1WCSA 1JHNA 1G9DA 4AGVA 1QDCA 3AZWA 1S0CA 4XOGA 2ZBJA 1WW6A 1GZ9A 2VY0A 1DQ0A 2AYHA 4XHXA 1CN1A 1QDOA 3OJBA 1FNZA 3ZXEA 1D0HA 2D7FA 2E53A 1LHOA 4SLIA 3FLPA 2P2KA 3WDUA 1UPSA 1BJQA 3A4UA 3AXDA 1WBLA 5CA6A 3NV4A 4P14A 4LBQA 3WG3A 1G9BA 3AZVA 4M3CF 4TYSA 5FREA 4FPOB 4BMBA 1DIWA 1YYNA 2D43A 2VUAA 4FPLA 3TAYA 4FOYA 3NV2A 1Q8OA 1CPNA 1UMZA 2OUJA 2YMZA 5GM0A 4Z8BA 1N1YA 4Y20A 1AXKA 2ZMLA 5T54A 4YW2A 1MACA 1S0JA 2GALA 2EXHA 2W52A 3I8TA 4XTMA 1LU1A 1S0DA 3NV1A 4YZ4A 4LBQB 1GSLA 4Q8LA 2W68A 2D3RA 4GWNA 3ENRA 2ES3A 1EPWA 1H30A 2PELA 2UURA 2EAKA 2WSUA 3TB0A 1H9PA 1SBDA 1URXA 4Q1PA 1SCSA 3WZ1A 1PZ8A 4Y1UA 2GN7A 3B3QE 3WV6A 1JW6A 2DUOA 3B01A 3WDXA 3WDVA 4ZKTB 1N47A 1UX6A 1WLWA 1AVBA 1S0GA 2VW2A 1LOEA 4Y1XA 2XG3A 1LESA 3WNXA 1BXHA 3WCRA 4K20A 4Y24A 4P9WA 2ZZJA 5KXBA 2ARXA 1QOTA 1R1ZA 4YW3A 2ARBA 4YM2A 1MZ6A 3ZPYA 1KJRA 3Q9OA 4C1WA 5JOZA 3RQ0A 2ENRA 1FV3A 3VKMA 3PVOA 3RG0A 2E7TA 2ZHMA 3AP7A 3BIWE 1QNYA 2ZGMA 3POYA 4YZ2A 3QLQA 2ZGUA 4YZ1A 5DG1A 3IPVB 4AVSA 2PHXA 4FPYA 2R49A 3ZXFA 1C4RA 3VKFC 1QNWA 3OPZA 1OKQA 1WW7A 1LODA 2JJ6A 4WV8A 2D6KA 2A3YA 3VKOA 1HQLA 3BODA 3UJQA 1W6OB 3AYDA 3ILFA 3JUUA 4M3CA 4PBPA 1GZWA 4YM0A 4DFSA 1UN1A 1IOAA 4UW5A 3POSA 4GKYA 1N1TA 3T1MA 2R1BA 1AX2A 2UU8A 3AFKA 3ZSMA 4WVVA 1ENSA 4U2AA 1X50A 2A3WA 1B09A 1JOJA 3SLIA 2PHFA 1HDKA 4XJ8A 3WCSA 3ATGA 4XJAA 4GKXA 2CL2A 2C5DA 4AWDA 2VXRA 1FYUA 4XXPA 4AGRA 1Q8PA 2ZGKA 3ZXJA 4WZFA 2NMNA 4P9YA 4I30A 1LOFA 5DZEA 2WT2A 4YGCA 5DG2A 3DUIA 4XJZA 2LALA 3T2TA 3ZYPA 1V6OA 2EXKA 4ISQA 5T52A 2W39A 4PCRA 4R9AA 3A0KA
chains in the Genus database with same CATH superfamily
1D4M3 4XBNA 2VUJA 2LM3A 4RQPA 3FLRA 4HVQA 4EN6B 3E97A 5FLHA 4MGKE 1FOD3 3OYWB 5I0TA 4XTPA 2VMEA 2ZEYA 4Z92B 4N8MA 4XACA 4FPKA 1FX5A 5C3PA 2ZZQA 1CIWA 2XUEA 4HMZA 5CZKA 2BNOA 2WWJA 3D82A 5FP3A 1SLLA 2XWJB 2DVGA 4P9XA 4QB2A 2VC9A 5GLZA 5H9PA 3M3IA 2JG9C 2ZGSA 1GWKA 1GYKA 3LWCA 2J1UA 4QT6A 4FVVA 3VBRC 3E6CC 1NT0A 1SLIA 4FFFA 4COZA 2XL7A 2OPKA 4XZUG 1GQHA 5DZGA 3SEEA 5AC92 2G19A 5JXJA 4P9JA 3I7DA 3HPNA 2FCUA 1C1LA 2D93A 4I0AA 4LO5B 2KA3A 4C8DA 5FQ0B 1IKPA 1D7PM 1W2UA 1W2AX 1VBA3 2VVFA 3WQ0A 5C70A 1ODMA 4XUOA 1LCLA 4NMIA 5FY5A 4BMEA 1UYYA 4CUBA 2FDFA 4EWAA 1LOGA 2A6ZA 2QZ3A 2EXIA 2W87A 3P6BA 1YFUA 2AZ5A 5F5QA 1UY4A 1MEC3 1N3QA 4CCDA 3VBHB 1W8ZA 3T4HB 2JKBA 3AMQA 1RUG1 4Y26A 3ITQA 2VVEA 4Q2FA 3VD5A 3WOGA 4BPZA 1AL22 4IL7A 5LWBA 4GA9A 4ARXA 3USUB 4FQ4A 5JR7B 4D7YA 2VUDA 1ULCA 1N3PA 4QXKA 4ZU5A 3S57A 5JLVA 1F35A 4V1PA 1UZVA 3APBA 4XYXA 1UYZA 5LASA 5JR2A 1Q8VA 4META 3NNGA 1NXMA 3IZOA 4DXRA 4YVSB 1VBC1 4XHBA 4N9IA 3VBSB 4J25A 1H9WA 3S30A 1OH4A 2R062 5GZFA 1E57A 4NHKA 4Z2WA 3PVNA 4GXLA 2OVUA 4NIGA 5A7PA 2VECA 5LBCA 1A3KA 1AR91 4L2NA 2W08A 4CSWA 3N9LA 4BE3A 1LOFC 1ENXA 3DCQA 4BQYA 3W21A 1S0FA 1LEDA 1MVQA 1RUJ1 2WL1A 4PIYA 4AE2A 5LB6A 4J1XA 1H1MA 2VJXA 4RL7A 4DRVA 5FYZA 4QM9A 1UL9A 1CR7A 2UYBA 4HT1T 4AG4A 4KU7A 4XFGA 3WW2A 4HK9A 4E2GA 5EIYB 3NNJA 3O1RA 2JDAA 5FZ7A 3KCXA 2ORXA 4FT8A 4K3UA 2AUYA 1YC61 1T6GC 3ACIA 3KQRA 2KD7A 4F83A 3FZ3A 3UGGA 4LBLA 2VQ0A 3NAPB 5F39A 2RR13 2QDRA 3WINE 4YM1A 1LTEA 1OOPB 2VQTA 1WLCA 5FZ4A 5FZOB 1XU1A 3CDZB 4Z07A 4IV1B 4HL0A 1DCSA 5FKCA 4BU2A 2P37A 4L92A 4Q0SA 4CCJA 1PMHX 3K3NA 4AZZA 1GBGA 4AL9A 2D3PA 2VOVA 5AVAA 5FP8A 1ASJ1 4LE4A 3KT7A 5IVYA 3O1PA 1ULDA 1UU5A 1RTVA 4XEZA 1Y9QA 5CKQA 5BNOB 4CXXA 2XKPA 2K9ZA 2JDNA 3O1OA 4HG6B 2B42B 2R073 1EAH1 2BGPA 2WLPA 3AKPA 1RUD2 1S2BA 5FYBA 4AI0A 1DYOA 1ZZ9A 2RS13 1G9AA 4LK6A 4XF0A 1PM7A 4GH4A 5ABJC 5JWPA 3J7NA 2ZOEB 3HMYA 3AYEA 3MIGA 1FI2A 1AL0G 3HN1A 5LA2A 1A8DA 3FMGA 3WDYA 4QX8A 1D4M1 4ISRA 1OKOA 4Q26A 5JMOA 1AX1A 2DVDA 4MGIE 5BNPC 1FOD1 1WMEA 2BOIA 2D6NA 5T5JA 5BV6A 1VIWB 4N90A 1B35B 1W6PB 3I3DA 2QQVA 2BYVE 3L2YA 3INAA 1VB4A 2K2SA 3I2JA 1QXRA 1OF4A 4ITCA 2XBO3 1Q8SA 3TN92 2XPJA 3PVBB 4K1ZA 5IVVA 3IWZA 5LZ6A 2JG8B 1ZVFA 2JDKA 5CNAA 5FPUA 2SLIA 1D2QA 3HN3A 3RRDA 1QMJA 4NPRA 1W28A 4JVAA 2D6LX 1AR82 2WR9A 1NZIA 1W04A 1DBNA 2PHUA 2PQSA 3IDAA 3N7KA 4QQ2A 3QOPA 4X8PA 5F6KA 1OQEA 5FYIA 4FSJA 1LGBA 5H9QA 4XETA 4CCKA 1W2TA 2WJSA 1W2OA 4PBOA 4J1WA 2D6PA 4XF1A 3NV3A 4LA3A 2YU1A 1UKGA 4KG0A 5EYYA 3H8RA 4MYEA 4O9EA 1QXJA 1H1AA 3ETQA 3CZUA 4PDWA 5C8WA 4L0PA 4YW6A 4CEYA 2VVDA 3NRUA 3MGUA 1VBA1 4UW3A 4AF9A 2BVBA 2PN5A 4QQHA 4UBGA 2XONA 5FCCA 2YBSA 1E5HA 2BV4A 2DURA 3NSTA 4O65A 1AF9A 4UFKA 3OGJA 5ABJA 4NOTA 5FPAA 2ZS6B 4Q4W2 1MEC1 3ZYRA 3VV1A 4IEOA 4JRLA 3WD5A 3ZXDA 3FUQA 1G9FA 3WNMA 3R05A 3KMHA 4M01A 4IE7A 4QDSA 5FOBB 2YUEA 4YVWA 1R64A 3KM5A 2Q8CA 3T0BA 1U5ZA 3MFAA 2XB6C 3I3BA 1M06G 4GALA 2G9GA 2W92A 3GALA 4Q29A 5LK5A 3WG1A 4IV3B 3GGLA 2LUWA 2GNDA 1AXZA 5FDBA 3OGSA 2HWB2 3ZN6B 3IM0A 1ZRDA 3ZSKA 2KM2A 4AHZA 4LLOA 2VCCA 1C8NA 1JZ7A 1SG3A 1BHGA 2XHKA 1O5LA 3DPRC 4ET7A 5HCFA 5JXIA 2I2SA 4NN0A 5T5LA 2AEYA 4XILA 1NQJA 3WQ7A 4K21A 1CESA 4QXBA 4I0WB 3K2OA 4LBJA 4C1XA 1KFUL 1UY0A 2W46A 3CL1A 3K4DA 1YJLA 2WUHA 3NJVA 2LROA 5FRAA 3RMYA 5KXDA 3H8OA 2AC1A 4XZPA 3CMGA 1QH7A 5F37A 1SDWA 3OSDA 2BPA2 2Z2SB 3ZR6A 2WFPA 3VDCA 5JSOA 5DPNA 2WN3A 1HRI2 2DU1A 4ZXKA 3WUCA 1GZCA 4B3NA 1CONA 4O9GA 2GMPA 4KWKA 3ZDSA 4MOAA 3WF1A 3DL3A 4LULA 4EN8B 2RR11 4LEJA 2PHRA 2PHTA 5GALA 3PUQA 1R1A3 1VLNA 2JG9B 1RUG2 2VW1A 3AKTA 3MYXA 4LKSA 1O91A 3ME2A 3I2FA 2WSVA 3VBRB 3JCIA 1YXWA 2CWSA 2VE1A 5K8SA 3T09A 1ND2C 3VDBA 4QGLA 1BEV2 2Q8DA 4RFRB 3KV4A 2ZA9A 1IGOA 1Q56A 4OZXA 5EYXA 5L9RA 5ACA3 5K4LA 2W0XA 3RZZA 2VMHA 1VBC2 4FPCA 1VJ2A 4OLLA 5E89A 3NVCA 3VKNA 2RMU2 3AKSA 1PMIA 2VZ1A 2AGSA 5IVFA 1DYPA 4YG6A 2PAEA 2ZGLA 3E6BA 3CBNA 3DPRA 2R071 4CDWC 1AR92 4FOQA 3PIGA 2JD9A 1OH3A 3AFGA 4FAGA 2C1FA 2GNBA 1SPPB 2ZGRA 4QPGA 1X8EA 3VBUC 1L3JA 2IUWA 2RS11 2VZ3A 1RUJ2 3C7EA 4DINB 4EN9B 1WBFA 5BNQA 2QNKA 1ONAA 1JYCA 5F9TA 4IEQA 2WT0A 3HEIA 1G8WA 4EQVA 3O1SA 2ZEXA 3AJYA 4QHBA 2CAVA 4MSVA 4BQXA 3VUOA 1WWYA 1NUKA 2F6BA 1LECA 3U4SA 2YC2A 3N9OA 3I59B 4IE6A 5CFDA 4LHNA 3IAQA 4YGBA 3SISA 4LOTA 3VDDC 2XBO1 4AAXA 5K9YA 5KHJA 4I2OA 3MIDA 4XIOA 4H7MA 3LQCA 1S0BA 1TE1B 3UJOA 4Y4RA 3AP4A 3O1VA 1JZ6A 5FKBA 4I01A 1UZ0A 3J7MA 3UKVA 3D3AA 2Y64A 1UYPA 3ZYFA 4AVTA 2Y26A 3S7EA 2VMIA 4Y5TA 2VZSA 3EYPA 4RR3C 3THCA 3ZFGC 2YU2A 1ULPA 4XF9A 1ASJ2 2X09A 1C28A 3TRSB 1F2NA 4M0NA 3WDWA 1PGL2 4YZ5A 1AYN2 1HXS2 4JZRA 1QQP2 3H42B 5L7OA 2W95A 5D8AC 2D44A 2FDGA 4HSJA 4CDWA 5FZDA 4LORA 1EAH2 3I2OA 4DUVA 4BB3A 3D5OA 1HLCA 4I3GA 1COV3 2WNVB 1JHNA 1W8UA 4IEYA 1R082 4K6BA 4AGVA 1QDCA 2HKXA 2VBDA 3RI9A 1X9TA 4XOGA 2WYFA 1GZ9A 2VO5A 2XWBB 2ZBJA 2CGPA 1JUHA 1XXNA 3U10A 3OD0A 1CN1A 1SZBA 3PTRB 1ZRFA 1FNZA 3N9MA 4LXLA 1KFXL 4ZS2A 5J7MA 5FXWA 1JZ2A 3FLPA 5F3CA 2HWE2 2JKXA 3ELNA 1UOJA 1GNYA 4XAAA 4AFCA 4HETA 4LHLA 5FY4A 1W8WA 2L9LA 3WG3A 3PUSA 4OHZA 3AZVA 4H3WA 3C7GA 2JDMA 3FE5A 3HBKA 3KGZA 2VUAA 3TAYA 1CPNA 2WDBA 2JWPA 2X5IA 4MGYE 5FBZA 4M4PA 2JE8A 2XGXA 3PURA 5FYSA 4YW2A 1MACA 1S0JA 4GB33 1S0DA 4YZ4A 3WY6A 3MIBA 1VRH2 2ZKLA 5K0UA 2VAUA 3KS7A 4JHTA 2QKDA 1UMIA 1EPWA 2JB8A 2UURA 4YNIA 1TZOA 1Y43B 2EAKA 2Q1ZB 2YC0A 4URTA 1H9PA 1URXA 2RS52 5FLJA 1SCSA 4NPMA 5FXZA 5A7WA 5E6HA 3B3QE 5FZIA 1FXZA 2DUOA 3WDXA 1UU6A 1CX1A 2ZX4A 4B7KA 4UBHA 2J1VA 1JODA 2VW2A 4WM8A 3GBWA 1BXHA 4N43C 4K20A 1NA1B 5I0RA 4P9WA 2ZZJA 1MEC2 3M70A 3WR0A 1JZ4A 4NHLA 3ZMNA 1R1A1 5A6ZA 1GP4A 1BK0A 4C1WA 4DUWA 1EUTA 2OQ6A 3OUHA 4JKKA 1ZZCA 1FV3A 3VKMA 1M4WA 5KHKA 3RG0A 2E7TA 1OA2A 2ZHMA 3WF0A 3AP7A 3LB9A 5FZ6A 5A3WA 1RUH2 1QNYA 3BIWE 2RE9A 5J96B 1PO12 2VOKA 2W1SA 2BUKA 2VTXA 4J6GA 4ZPIA 5ACA1 2Y6JA 1C4RA 4QX3A 4QHOA 4X6RB 4HPKA 2FDJA 1O3TA 1F4HA 2YC4A 2A3YA 2XDVA 4WV8A 3ZFFA 4NAMA 3UJQA 1G6NA 4XUQA 1BLZA 5FZAA 4AEDC 1H8TB 2VCMA 2RG4A 2XJVA 3Q8AA 5C8CC 3D0JA 1W8OA 2BNMA 2P1BA 4UW5A 3POSA 4GKYA 1N1TA 2ID4A 3T1MA 2R1BA 1AX2A 4IESA 2GC2A 1UW8A 3AVSA 1DP0A 4PLNA 2A3WA 1B09A 4XCBA 3H8UA 4GD4A 5A6QA 2HEYF 4XJ8A 5CIRA 3WCSA 4FBFA 4DMIA 1YEWA 4QX5A 5CG9A 2GC3A 4NIHA 2CL2A 3GHMA 3I2HA 4IDZA 1FYUA 1XNDA 2ET1A 2XXZA 3CQOA 4LKDA 4AQTA 1W9TA 2ZGKA 5BXXA 2NMNA 3ZO0B 2XLGA 4P9YA 3RZLA 3SCGA 4YGCA 4K7JA 3DUIA 1PIV3 1J3PA 2EXKA 5T52A 5L36A 4PCRA 3ST7A 3A0KA 1US3A 3LDRA 1XNCA 1F15A 2MEV2 4F7ZA 4BYYA 5KR7A 5FLIA 3MEPA 3EB7A 4M00A 5IK7A 1IKQA 1LGNA 2HJIA 4XJ9A 1JH5A 4QB1A 1IG0A 4YZ3A 5D2AA 1UWWA 1IPSA 2G9ZA 1UX7A 2DTYA 3VZJA 4CCNA 2YYOA 4YG3A 1STMA 5FJKA 2YGMA 4MGTA 1AX0A 1XE7A 1VBD3 3ES4A 1RVF3 1WCDJ 1Y9MA 2HLEA 4FPEA 1YQ2A 4B1MA 5C8CA 1PO22 2J42A 3RZMA 1LGCA 1L7QA 4RS5A 2WWUA 2IXLA 1COV1 2RS12 4PI0A 4QAWA 3P1IA 2ZGNA 4DIQA 1SQ4A 5F8PA 5FY9A 5FOJB 2B9UA 1JZ8A 4FQZA 5A32B 4MGQA 4R9DA 5KC5A 2Q8OA 1DG6A 4C0BA 3HQRA 2O8OA 4CCLA 4C0HA 4XBLA 1W2NA 1ZZBA 5DZFA 1OLME 5C3OA 3KF3A 1ND2B 2P3KA 1PK6C 5C9AB 1ND3A 4CE8A 4S2HA 3AZYA 2YHJA 2VW0A 2DU0A 2OS2A 4Y3OA 1LU2A 2GZWA 3H3UA 4HN1A 4BQ5A 1C3HA 4IXLA 2A6YA 1O4ZA 1C57A 3IMMA 4D6QA 4OZOA 1CX4A 4GB31 3ZSEA 1W0PA 1MZEA 1REDA 1VBE3 4DPNA 1YJKA 2AENA 4XFBA 4XQWA 3BPSA 1GANA 3CEWA 4UF0B 2C24A 3VLBB 5EJ1B 3VBUB 3BVCA 3PUAA 2R30A 1VMJA 1J3RA 3JD73 1F4AA 1HQWA 1PGW1 2ZGPA 3OEAA 5EHDA 4FTBA 1YIPA 1DLLA 1DZRA 2FDHA 2H6BA 3J9SA 1UY1A 3OBAA 3UETA 1UXXX 3RZHA 2VG9A 5J3UA 4I09A 4XF4A 2B39A 2GSYA 4XMIA 3EXUA 3RNSA 4AK3A 1DQ1A 4Q0VA 2VTFA 1XE0A 1UCXA 1KRIA 4K8FA 3VBFB 4QHZA 1N3OA 2W9XA 2V5DA 5C3SA 2OW4A 3NL1A 4ZHNA 2VZVA 3IPVA 1N1SA 4Z1VA 1I1EA 1EV13 3MUZ1 2ZMNA 3W20A 4A6SA 5IT6A 4Q4V3 5JUVA 3LZZA 3O7OA 3NAPA 4RQPC 5FYHA 1T6BX 1QOSA 3BOPA 1UQXA 5FZOA 1W9SA 4LO4B 2HWC3 1W6OA 3ACGA 4AEMA 1LHWA 3ZFGB 4RR3B 3TEXA 4CTEA 1TVGA 5IK4A 4TLGA 3PMSA 1BBT2 5KHIA 1KQRA 3IB3A 3OB8A 4BQ4A 1PNGA 4Q5OA 4CU9A 2WYSA 4E2SA 4LO8A 5FZKA 1RMU2 1YCIA 4HVRA 4XJUA 4E2QA 2FMDA 3VZMA 3JXSA 3HQXA 1NAEA 5LRRA 1FPN2 3WHTA 1GFF2 4TLFA 4NHYA 2XH6A 3MLJA 5IVEA 1POV3 2WAAA 2GNMA 4IETA 3WW1A 3MV01 3A0NA 3KLSA 2E63A 4ORFA 3IT8A 2EVXA 1QJZA 5D21A 4D94A 3AKQA 3ZFEA 1CD3G 3MDPA 1WUVA 3ZVXA 2CDPA 4DQAA 1QKQA 4HBNA 3A21A 1LNSA 4JC1A 4RGAA 4W8JA 2WS92 1JYIA 4XC9A 1UOBA 4IGOA 5FZEA 1AYM3 1BVP1 2MNGA 2R7EB 2JX9A 4Y22B 4QKNA 3SH3A 3VBOA 3V65A 4XIKA 3ZYHA 3IDEA 1DFQA 4INDA 1PIV1 5FPXA 3DYPA 5FAXA 4BK4A 1OBNA 1AR63 1W9WA 4O61A 1POQA 3V64A 3KT1A 3PIJA 5T5PA 1CAUA 3RPQA 1AZDA 1W90A 2VTXJ 1RUC2 3GM8A 2UWBA 1PNFA 2WC2A 1UZYA 5FZLA 3ZN4A 1G86A 3BIEA 4AHXA 3U75A 4YARA 2WNOA 4CDXA 3KT4A 2UWAA 3AK0A 4XFCA 5JIAA 4K1YA 3LD8A 1VBD1 1L7LA 3MW3A 1AXYA 3O14A 1S0IA 3PNAA 1RVF1 3Q8BA 3E5QA 4FXKB 3EO6A 3P5BA 1Y7BA 1W9YA 5FZMA 1PMJX 3GCXA 1SLBA 1FMD3 2C4XA 3AP9A 3QD6A 1ZNPA 1JS9A 1W6MB 1SLAA 2H0VA 2TBVA 3N36A 4GAZA 4L99A 4YM3A 5SV5A 1OFSA 4MH0E 2A7AA 3KCCA 5A1LA 4FOVA 3SKVA 1W6NA 2OQ7A 2CTVA 3JBG3 4PI2A 1CZVA 3WW4A 5KXCA 5F7UA 4PIZA 1O3SA 4R8HA 4BQ1A 5JXGA 4NWVA 1YRZA 3Q8CA 4KG8A 4MXVA 5AVPA 3WG2A 4BWOA 2A6VA 2Y8KA 4MXWA 1X36A 2YROA 4P9LA 4XE9A 5ANQA 1IS6A 1U5YA 5EQUA 4UW6A 1YWKA 4IQPA 1YI9A 4L11A 3T3YA 4ZU7A 3BTZA 1MQTA 2B7YA 1OLMA 1DLCA 2B4KA 2X8KA 3CKHA 2OZJA 1W06A 2ZCWA 1ULFA 3WF3A 3I4IA 3OGRA 4AHWA 4CDUA 5ANNA 2R0FA 1NQDA 5T50A 3RYRA 4CDQA 3ROUA 5DMYA 1VAKA 3MI8A 4FOWA 1I3HA 1TG7A 4NRPA 3V0BB 2GC0A 1VBE1 3LEGA 4AEDB 3SCHA 4UT5A 3L2HA 4MGZE 3HD8B 1KS5A 2Z4FA 4FFHA 3N7JA 2RJ2A 3HR9A 1IS3A 1E5SA 3OY8A 3PU8A 2OYZA 2GAUA 4MX3A 5A3MA 3NQHA 1R092 4W6YA 3JD71 5FYTA 1SACA 2HBTA 2CGOA 3QBQA 2XJQA 2G9FA 4FPHA 2ZAHA 3ON7A 2WKKA 5LA1A 3TBDA 1SLTA 2D6OX 3O1UA 4YG0A 1NLRA 4MUVA 2Q8EA 2FMYA 2WFF2 1D4VB 3D6EA 1RHI3 2UY8A 3AL6A 3B02A 2VBBA 4GH4C 5BUVA 2JDZA 3WVJA 1V6JA 3UGFA 3RJRA 1EV11 2DV9A 2VR4A 3ASIA 4Q4V1 1HN1A 4LITA 4E27A 5I91A 1EY2A 4Y20B 5BNNB 4OULA 1O3RA 1JN2P 1I9RA 3B9CA 3MZHA 3W5NA 5FYUA 2CHHA 4CP9A 4CP0A 2PYTA 2HWC1 1JOPA 1VMHA 3M3OA 1CAVB 4LQRA 2DWRA 3CU7A 3ZKUA 4BHPA 1ENRA 3IIAA 4HFSA 4EWEA 3WDTA 1W6QA 3EJKA 1RUF3 2LW8A 5IAVA 1OFNA 4X8NA 1SDDB 5ERLA 4NPLA 1GLHA 3R6SA 4DEVA 2SBAA 2B9VA 2Z5WA 4LNVA 2YFZA 3CJIA 2BU9A 2UY9A 1SBEA 2W47A 2WZR2 1WLDA 4DXTA 3RZGA 3HNMA 1DGWA 1POV1 1SFNA 2ARAA 4Q8KA 5IVBA 5IK8A 4B29A 3OPWA 3K51A 4FAHA 3T2PA 3SH4A 3P3PA 1WA6X 3HJRA 4OQ8A 1ZA7A 5CVRA 2V4VA 1ZZ7A 1OF3A 2WQZC 1OHFA 3GBGA 5FK8A 4PDWC 5CFCB 4FPJA 4M3CE 3FUOA 3VZNA 4CEYC 2R6QA 1AYM1 3ZYBA 4UWDA 4TWTA 4ZXEA 4B4QA 4E4ZA 5HCAA 5FUNA 3H1WA 4ATEA 1CAXB 2YPJA 3BCWA 3T0AA 4XDQA 4QDRA 4JGYA 1OVPA 4DNYA 5CBLA 1DQ5A 5IK5A 1QJU2 1JBCA 1U5XA 3M3EA 4KMQA 4R52A 1NE6A 1JYVA 2ZX1A 1AR61 5IVCA 4G4FA 2HWD2 1VMFA 2VM9A 3MIHA 2NMOA 5I0UA 3NKTA 3O0VA 4YVWC 3J8F3 4LMFA 4NROA 1VPHA 2W1WA 3BTXA 5IWFA 4E4DX 4QKBA 2GH8A 2D3SA 1RINA 5JOWA 2YGLA 1V6IA 4XW3A 3WNLA 4GWJA 1V6KA 4QPIB 2YG0A 2P3JA 3ZLIA 1WA4A 3NNLA 1FMD1 3K3OA 4NHMA 2Y6LA 1AR73 5IATA 1CGPA 2FDIA 2J1RA 5D1IA 2AACA 4N53A 3MBWA 4AFAA 3F2ZA 3JBG1 3AVRA 4FPFA 4XQ4A 1QIQA 5GZCA 3KV6A 4D6SA 4MZUA 2OZ6A 5LY2A 4AI1A 4RQPB 1GOGA 4YYOA 2D5FA 1BMV1 2WN2A 3TWIA 4DXZA 4XCAA 2RV9A 5KC6A 2IXKA 3AP6A 1UIKA 3GBFA 3QH6A 1AHSA 4UFMA 4ZZ5A 4V2VA 5A3NA 5FP9A 3KVAA 2VY0A 2PLV3 2DDUA 1Q3EA 4Q4X2 1EUUA 5CISA 1GR3A 3ZXEA 2D7FA 4H14A 2E53A 1OD3A 3BGAA 3WDUA 2P2KA 4Y5Z0 5HBAA 4UXAA 1WGPA 3A4UA 3ZR5A 4JQRA 4PLMA 5EZWA 1LR5A 4YPJA 1BCXA 3NV4A 1Z7S3 3OBZA 4M3CF 1OPMA 3ES1A 1NCRA 4FPOB 3SKJE 4BMBA 2ADDA 4FCAA 5B4XA 1DIWA 5GM0A 1VBD2 4QXCA 5IHRA 2ORZA 3B7MA 3VD3A 1N1YA 2ADEA 2VNVA 5EV7A 5T54A 5J98B 4GMP3 4LO7A 3TNPB 4XTMA 2Y6HA 4X6QB 1LU1A 4LBQB 5DAPA 4COYA 5F1RA 2CGNA 4QPGC 2D3RA 2WQ8A 3ENRA 1IZ3A 4GWNA 4CEWA 1RHI1 1H30A 3B93A 4ZZ8A 1NA1A 3LA7A 3SXWA 2V09A 2WNUA 4Q4Y3 4Q1PA 4A7YA 4BK5A 4LJHA 4W4ZA 5CKMA 3WXPA 1QJY3 3BN6A 4R4XA 2GN7A 3UKTA 1QHDA 4EZ4A 4BXFA 4NJ4A 4KH9A 1N47A 1K5MC 1OA4A 1AVBA 4HKOA 2XMLA 1LOEA 1K45A 4A7KA 3AMNA 3WCRA 1O4TA 5CFDC 3PL0A 1JYXA 2R043 2ARXA 4COWA 5KXBA 1QOTA 4AFMA 1MPXA 4LE3A 5KBFA 2WABA 1RUF1 3HAGA 3H7YA 4IEWA 5FMDA 3C3VA 3ZPYA 1DU3D 5JI9A 1BVVA 5FMOS 5G04L 3Q9OA 1VBE2 1IG3A 5A80A 4A2UA 3RQ0A 1RUI3 4HVOA 5JZGA 1J3QA 5EPAA 3SHRA 1RXFA 1EPZA 2VOWA 3S7IA 1H8TA 4YZ2A 5A7OA 2CU5A 1TMF3 3QLQA 1XOYA 4CCEA 4ZU4A 2VCBA 4AVCA 4AVSA 1WCUA 2BZDA 4FPYA 5FMOL 1ODNA 2JDYA 5JSRA 3I3MA 4IEVA 4E4SA 5L7OC 2VZTA 3T30A 1POV0 2JJ6A 3EMRA 1EP0A 1XNAA 2WO2A 2XJSA 4XPVA 4CUCA 4QD2A 4M3CA 4DFSA 3ILFA 1VE0A 2P4EA 1GZWA 5TSWA 1UN1A 2BRTA 5FZ8A 4FFIA 2E33A 3I2KA 1PVC3 4JTOA 2VNOA 3V56A 2XJRA 4WVMA 3AFKA 4V2WA 1XYOA 1ENSA 4PF1A 1GOHA 2HH9A 3FL7A 4U2AA 1JOJA 2WAOA 3SLIA 2RVAA 2XJTA 5HV4A 4DUXA 2YBKA 2CSGA 2OT7A 4D6RA 5HCHA 2HWC2 3J8F1 4QGMA 4LT5A 2BTVC 2DCZA 2C5DA 4IUGA 1K5MA 4AWDA 2Y6KA 2VXRA 4IGPA 4KWJA 2XLAA 3C7HA 3Q8EA 1I5ZA 4XUNA 5EJ3A 1OVSA 1Q8PA 4AGRA 4WZFA 3ZIXA 2VUCA 4QX7A 2X5IC 4ISQA 1CWPA 1IQDC 2HBUA 3B5LB 4IEXA 4LLFA 4R9AA 1OPOA 2GP5A 1UOGA 3IBMA 4LKEA 5DAWA 3T0DA 1UXZA 4NHXA 5K0UC 3M8LA 1UY3A 4JCKA 3SQOA 1AR71 1YQ8A 2QBXA 4Y1ZA 2FCTA 3A22A 3LPGA 4LIUA 5I8YA 2QCSB 2P6HA 2VZQA 4NIIA 3USSA 1A78A 4HZFA 2YBPA 3VHOA 2RHPA 1Y3TA 2P3YA 2PTMA 3POFA 5A7SA 1Z0HA 3IMNA 5A32A 1TNFA 4DY3A 2EIEA 2GNTA 3M2MA 1X9PA 2DBNA 1AYM2 4P9GA 2Y0OA 2JEMA 1REEA 4WM8C 1NKGA 2JB4A 4HOOA 4I0BA 3S5QA 4IEZA 5LBFA 4BISA 1AL23 3HIFA 1W05A 3OUJA 4QDQA 3BB6A 4K9SA 5A7NA 1DGWX 2ZEZA 5C9AA 1YFWA 5JMCA 2PLV1 3JU9A 2PHWA 1D4M2 3MLKA 1FNYA 1UU4A 4KL1A 2C0ZA 5CKNA 1WCQA 1FOD2 5DQ0A 2ZAAA 3CZJA 3KB5A 4AQSA 5LK7B 3CHXA 5GJ6A 2R063 4DS0A 1YI7A 5FY8A 2FCVA 1TEIA 1Z7S1 1SFPA 2VBPA 3F95A 4XFFA 5DUUA 3VD7A 5G05L 3ZSJA 2A1XA 3KZ4C 4TTGA 3RDIA 5CAZA 2NLRA 1NCQA 4YW4A 3LGRA 3PDQA 4MADA 3LFIA 3TNQA 5IVJA 2DVBA 2VZUA 4Q1RA 1ZBE3 4A44A 4TXWA 1V6MA 3ZFFC 4YSFA 4JGZA 4GMP1 4FP3A 4CEYB 1FMD2 4WM7A 1J59A 3NKGA 3WNKA 3LSEA 2A6XA 2IZWA 4GJYA 3VGIA 3WSOA 3A7QA 2WBKA 5ABJB 2ZXQA 3JBG2 3KVBA 1JU4A 4GWMA 4DY5A 2ZACA 2ZMKA 3B9IA 4Q4Y1 2GU9A 1HKDA 5BY5A 5DXDA 1RYYA 1QJY1 1A34A 5BNPB 1UD1A 4OI2A 1VBA2 2K0GA 2PFWA 1DYKA 1GUIA 4YVWB 2YV8A 4CZSA 4OUSA 4P5YA 3B94A 3D4KA 1E5IA 5FWEA 5GLWA 1BQPA 2P5BA 3THPA 1IHMA 5AFBA 1AUYA 2WWSA 1UIJA 1NXD1 1YO8A 2ZPXA 2R041 2D5HA 1NLSA 2VPVA 3N7MA 2GDFA 4EN0A 4MLOA 4XFAA 3U1XA 5I8TA 4A6OA 1CAWA 4FFGA 3WG4A 1LHVA 2PA7A 4ZS3A 1Q5OA 1LHNA 3T4VA 1RUI1 4NO4A 3OUIA 1RXGA 4JHZA 2XVGA 2E51A 2ZHLA 5E16A 1BKZA 4AHYA 1FV2A 4YFWA 5FZGA 1SMVA 4Y1VA 4LTAA 4PJYA 3KWVA 4OCTA 3MF6A 1TMF1 4OHVA 2OKXA 3WW3A 1CPMA 1KEXA 2QQKA 4QPYA 3ZYIB 3POIA 2PQQA 3RYPA 5FO7B 1RUD3 1NE4A 1REFA 2IXCA 5IAXA 1JXNA 3FBYA 3KHBA 5BYNA 3ACHA 2GP3A 1MS8A 3O0XA 4AVBA 2AR6A 4A45A 5EJZB 3UL2A 3WP3A 2VU9A 1YNAA 1O7FA 5C4WA 3LEKA 4RS5C 5FPVA 5LY1A 1PVC1 2ERFA 3AMHA 2E7QA 2OIIA 5IUQA 2QQOA 1OSGA 4CUGA 5A1FA 3WNNA 4NAOA 4EV0A 1GP5A 4JTNA 2OA2A 5JOYA 1GZTA 2DVFA 2IFRA 1ZZ8A 3QH7A 2DVAA 3GJBA 3NNMA 4A41A 3TN93 1Q43A 2Q1MA 4HXCA 4N9HA 1PM4A 2E9QA 2E6VA 2YFUA 1WMFA 2ARCA 3SC7X 4BLJA 3OYWA 1NY71 1NX9A 3OG2A 4XURA 3J7LA 1ND3C 2HYKA 3LE0A 4XJWA 2PAMA 1JYTA 2BVVA 2RR12 1XE8A 2BQPA 1JUIA 5FYVA 1RUF2 4A3ZA 1GWLA 3GZEA 3D8CA 3AYCA 2B46X 5BPXA 1O3QA 2C9AA 4YVSC 5JDBA 4IE4A 1C5IA 1GNHA 1AJKA 1GOFA 4IW3A 4CPBD 3DPRB 1W8FA 5FZCA 2Y60A 5A70A 1HQNA 3NMBA 5LEJA 1QJEA 3I97A 1UOFA 2W94A 4BIFA 3S0MA 2C26A 4QPGB 3HQUA 5SV8A 3W58A 4COUA 3U37A 3NO8A 3WEZA 1RIRA 4MGSA 3IN9A 3S5AA 5FYCA 2DBIA 3VN4A 2IC1A 5LEKA 2V5YA 2QQJA 5GZGA 5J48A 3AJZA 2H6CA 2R072 3WF4A 1LENA 1BZWA 5FQ0A 1RUOA 1OUSA 3GF6A 4BQ3A 2VMDA 4L97A 5I0DA 1AL21 3DECA 3JZVA 3LCPA 2VXJA 5JOXA 2P6CA 3MW4A 5CFDB 5F2WA 4FO9A 2ATFA 4DRRA 3OOXA 1DF0A 5AFEA 1H2KA 4Q0QA 1X8MA 1VAVA 3BU0A 4S2DA 1LB2A 1OURA 2RDSA 1C8M3 2EICA 1U12A 2IVJA 3VL8A 3NAPC 3VDAA 5EWSA 3QCWA 3J8F2 3VBHA 3W9AA 2AEZA 2K46A 2HWB3 1LOBA 3ZM8A 4Y33A 1HV0A 5A6XA 2ZGOA 3U0ZA 2VD7A 4YFZA 5DUVA 2NZ9A 1TME3 3USUA 4KGGA 3GZUC 2XBO2 1DQ2A 1XC6A 1XNBA 2JDHA 4JKLA 4AW7A 4NRMA 3UK9A 2D97A 4H7LA 3U4XA 4EE2A 1DZQA 1ZBE1 3H9AA 4YVSA 1Q8QA 5F6LB 5L7OB 3VBSA 4XUTA 5E88A 1QF3A 4COVA 1X82A 5F5CA 4DXSA 3PLQA 5DABA 4CDWB 3DKWA 1N1VA 4PF5A 2FHRA 4JQTA 5A7QA 4OI0A 2Q4SA 1JTZX 1C1FA 3QACA 1HRI3 5FZBA 2BBVA 4GMP0 4OHXA 1QY4A 1H4HA 3ZFEC 3RMXA 5F3IA 4E9KA 3RZJA 1CJPA 2A3XA 1F8VA 2Y38A 1J1TA 5J36A 3I2IA 5F3GA 4GZ9A 4R4ZA 3M4FA 4QX0A 5CEHA 3SEPA 4Y1YA 1VBB3 1ZBA3 1O6UA 3VBOC 2GN3A 2R0HA 1KITA 1SHWB 4FTSA 2Y34A 2DUQA 4QQLA 2ZHNA 2QQUA 3VDDB 2WA4A 4JDNA 4EWDA 3ABZA 1BEV3 3PVEA 4FI9A 2GMMA 2X5IB 4RHV3 1WKYA 1GQGA 1JOBA 1ENQA 1UY2A 2XJPA 1MVEA 1YFYA 4LBMA 2ZEWA 1OOPA 5FFOC 1IS5A 2JXAA 4OHWA 1SBFA 2RMU3 3LDKA 3RFRA 4AYUA 5EP9A 3N35A 5CADA 5K0UB 3R4SA 4IV1A 1CQ9A 1UKRA 5A3OA 4LBQD 5C6CA 5GKAC 2Y0IA 5EXOA 4CDXC 1RGSA 1RUD1 4XQDA 4XXAA 4BJ0A 4EYUA 3T2QA 1DZTA 3H1YA 2AH2A 3RVHA 5D8AB 2C6SA 5F32A 5A7WB 2QVSB 2EIGA 5LATA 2A6WA 5FMCA 1OUXA 4HSLA 1ZM1A 4CPBA 2OX0A 3ETPA 5BNOA 4PLOA 4IE0A 1D2SA 4EROA 4WM8B 5FZ9A 1YIFA 3K75B 3RI8A 1W0NA 4QKFA 3RSJA 4ES9A 1FATA 5C5TA 4XDPA 5HXVA 2GH2A 3H3LA 3MPPG 1A6CA 5B4NA 2XL9A 3I3QA 4RN5A 3V0AB 4EZHA 4WBBA 3TN91 3HWJA 2VZRA 1OQ1A 1E5RA 1UF2C 2P17A 3AX4A 3GXUA 4NR1A 5I0SA 3ZXAC 1B35A 1MQTC 3PJYA 1W6PA 3CLPA 4QX1A 5FZ0A 4KU8A 3WX5A 2W2IA 4JV4A 4CDUC 4KQ7A 3SITA 3LFMA 4W50A 1W39A 4HK8A 1R1A2 1ULOA 4HPKB 4NE9A 4U36A 1XJAA 4P00B 4CDQC 3OGGA 1PX3A 4N7IA 5FBJA 1CIYA 3ZFFB 1MS5A 1GICA 2JG8A 2WT1A 1AYN3 1DHKB 1HXS3 4OFGA 1QQP3 4OUEA 2IXJA 4QPIA 4YRDA 5DUWA 5I8SA 5KWRA 3E1F1 1MS4A 4LKFA 3LSDA 2IWGB 2YXSA 3BTAA 3THDA 5ACA2 3URFA 1UMHA 2NYYA 3JB4C 3OF1A 4XFHA 1NZCA 2YY1A 2QQLA 2Y6FA 3POBA 4M4RA 1F9KA 1R083 3OGVA 1XSRA 1K5JA 1W8NA 1X7NA 2NPIA 2V73A 3MW2A 1H6YA 2NN8A 3POWA 4KBZA 2J1SA 5H9SA 1SCRA 2HWE3 2BERA 1V6NA 2DTWA 2VMCA 1PVC2 3FLTA 4N43B 1ULEA 2EAAA 2Z69A 1HB4A 4PT6A 5FR3A 3BUCA 4MG2A 4B4RA 5L9BA 2VNRA 3RS6A 1C8M1 1QJFA 2TNFA 2WZPP 5J09A 1V00A 5DAXA 3VKLA 4LBNA 5B2GB 3ILNA 4PQQA 5GLVA 1HB1A 1YFXA 4UAPA 1PVXA 2J1EA 4Z82A 2HWB1 4HKWA 2OUHA 1NY72 4N7UA 2O14A 2BFUS 1I6XA 3N9PA 5FYYA 4CU6A 3ORJA 1O59A 4QQOA 1TME1 5FY0A 1PHMA 1VRH3 2IFWA 3GYDA 4W6XA 2V4AA 1S0CA 2X05A 3WNOA 3KV5A 3VHPA 4IV3A 2AYHA 4XHXA 2RM23 1QDOA 1LRHA 3OJBA 5JPMB 2BFUL 1LHOA 2RS53 3HT1A 3CJIC 4SLIA 3ZN6A 1V9U3 5C8CB 1XB9A 2WZEA 3AXDA 1WBLA 1HX6A 4RS5B 2FDKA 4P14A 4LBQA 1HIXA 4B8EA 1GMMA 2QTWB 1HRI1 5FMBA 2FD8A 4DOUA 1YYNA 2D43A 1Q8OA 1RUNA 4Z8BA 4CCOA 4KGQA 4QX2A 1AXKA 5FXVA 2BDRA 5C7GA 2W52A 3I8TA 3NV1A 1VBB1 1ZBA1 1COV2 1UO9A 2PMWB 1ND3B 4JGYC 5FJHA 2PELA 5FZ3A 1RUH3 2WSUA 1BEV1 1PO13 4RHV1 3GJAA 5FY1A 4IE5A 2JG9A 2RMU1 4Y1UA 5A33B 3B01A 3WDVA 3ACFA 4ZKTB 4UFLA 1S0GA 1WLWA 3VBRA 3LA3A 1ZX5A 3IIIA 2J22A 3WNXA 4MHRA 4Y24A 5F3EA 4UI9L 2XUMA 3WQ1A 4BZ4A 4OI4A 3N4MA 1TNRA 1JI6A 4TSVA 1ZBE2 1RUE3 4YW3A 3J26N 2ARBA 2CDOA 4GB32 5C3RA 2FBEA 3IDCB 3FBMA 2PHLA 1WCKA 3PUIA 1DGRA 4RSUA 3UKNA 4DZGA 2ENRA 4CCMA 3PVOA 2J1TA 4D8MA 3RZKA 2ZGMA 3VD4A 4N53C 4ASMB 1SPPA 2ZGUA 4YZ1A 1PGW2 2WNVC 1F5JA 2EIBA 3IPVB 2R49A 3NJXA 3E5XA 5FPLA 1WW7A 2JDUA 1LODA 3DF0A 4MVTA 5FZFA 3VKOA 3ZXGA 5FYMA 3LOBA 4F3JA 3BODA 1OA3A 3NJYA 1W6OB 3AYDA 3J7HA 1GWMA 3OEBA 5FPZA 1PK6B 2MEV3 2RS33 5E1RA 3X29B 2BOJA 2ZX2A 3K46A 2B5HA 5M0TA 4LIVA 2PXJA 3I59A 3KF5A 3LDBA 5FUIA 4YWAA 1H8VA 3RYKA 5LW9A 2WO1A 2WRAA 2ETEA 1PGL1 5ISLA 3FHIB 1AYN1 1HXS1 4GKXA 4XJAA 1QQP1 3FJSA 2TUNA 2HEVF 2WZ8A 4AI8A 4AI9A 2YDEA 1QJX3 3H1MA 4NUBA 5JCTA 4OYUA 4XXPA 1PO23 1NCRC 2FQPA 3GZTB 4I30A 1LOFA 4W6WA 2WT2A 4OUMA 4D3WA 3ZFEB 1JU3A 1IPJA 1R081 2LALA 5LA9A 5LBEA 3ZYPA 3HNYM 2MHFA 2W1UA 2E26A 1JHJA 4ONUA 1OD5A 3LF7A 3POJA 5DAQA 3TEYA 1MZFA 4E8DA 4PIXA 1KGYA 2HWE1 2R16A 4P02B 4QGNA 2ZKNA 1O8SA 3VBOB 4OMCA 1MZ5A 4CEWC 2JE7A 1KS4A 1ZREA 5DDJ3 2WNVA 3CJXA 1NA1C 2QQNA 2WNUC 3OBTA 3AZXA 4AQ2A 2A5ZA 1VRBA 5A3TA 4NVPA 4TZDA 2WINB 2XHNA 4JDOA 5L9VA 1CAUB 3DN7A 4LR4A 1KDKA 4LUKA 4QXHA 5K7PA 3I2DA 4GIQA 1LULA 4XUPA 2BWCA 2FZ2A 1A8MA 1MS1A 3TYJA 2WQ4A 3POGA 1VRH1 4BQ2A 4AFBA 5C71A 3AKRA 1PIV2 2KR2A 3VHNA 2VL4A 1OC1A 4JKMA 4CDXB 1VAMA 2QDNA 2JDPA 4GQ7A 4KI5M 2BW8A 3NJZA 3NNFA 4GULA 3ZDVA 3RJ2X 3CO2A 2RM21 4WZCA 5CYYA 5JIUA 1ACCA 2RS51 2XR4A 1OXCA 2VCAA 3O0WA 1LJ7A 1QGLA 1V9U1 3MIFA 4GJZA 2BGCA 5JZGC 4YGEA 4QU1A 2VGDA 4D7SA 1J1LA 1VR3A 4CRQA 2A75A 3IDBB 5EFUA 1H8TC 3O12A 2F4PA 1RJ8A 2F17A 4A7ZA 4AI3A 1CZTA 4OVEA 1PGSA 1W6NB 4UFHA 2A70A 4AAPA 1RVF2 3PJQA 1F31A 2ZABA 5KXEA 1ZRCA 2VMGA 2BNNA 4D0QA 3LIHA 4MO3M 2I45A 1LOCA 4MXWB 5IW0A 2OXBA 5BNPA 1US2A 2ZGQA 2P3IA 4IERA 1MQTB 4P08A 4S2FA 4CP2A 1NG0A 3AZZA 4B4PA 2WLQA 4JX0A 3GDBA 4PHZA 1RUH1 1DQ4A 2I74A 5T3NA 1C8M2 1PO11 5IJRA 4CDUB 5T5OA 3EQEA 3R4DB 4BM8A 2UYAA 2MPFA 4CDQB 1BBT3 3FC0A 2VMFA 3ZYJB 4BA6A 4RYDA 1H0BA 1RMU3 4C90A 4YGDA 3G7DA 4AEJA 1QH6A 2BBAA 1TME2 1XNKA 3OY8B 1FPN3 1UAIA 2EA7A 1LKNA 2W91A 3JQWA 2RDRA 3MV11 1DGLA 2R1DA 4XF3A 1RUE1 1HRV3 5HCBA 2X53S 5DUXA 3FHAA 5A3UA 2R32A 2QE3A 2DCJA 4FPGA 3ZXLA 3P3NA 2H0BA 3AP5A 2YZ4A 3SMHA 2WS93 5T55A 4R9CA 3C7FA 1HB3A 3PU3A 1WW5A 2A71A 3JD72 3U78A 2XLFA 1BYHA 1IPKA 4FP2A 1CVNA 2Q5TA 2IXHA 2J7MA 1PZ9A 2X29A 1YQ6A 3BPZA 3HBZA 2HWF3 4PQ9A 2VQAA 4BQWA 4C91A 1FAYA 1UZWA 2ZX0A 1ST8A 1QWRA 3VHRA 4QU2A 2JIJA 2Q1FA 3GCWA 4CP9B 1S0EA 1VBB2 1ZBA2 5DAVA 3WLUA 3E5UA 3U14A 3UESA 2N7GA 1AJOA 5J37A 2DYCA 1T2XA 4KNCA 2MEV1 1RUC3 2RS31 3HVDA 1S4CA 1EV12 3EHKA 1MS9A 3FN9A 4Q4V2 5C9AC 1W6QB 1Y4WA 2BEOA 4RHV2 2DF7A 3FFZA 1NYWA 4AGGA 1ULGA 3MHZA 3PTYA 5F5IA 4E8CA 2CAUA 1XSQA 4RGGA 3CJIB 4L9BA 3T08A 3GNEA 4XBQA 1MS0A 4H2AA 3SNMA 4LBKA 3UV9A 4CYDA 2ZHKA 3O5SA 1QJX1 3WNPA 5A6YA 1JZ3A 1QU0A 1CJDA 2VH9A 5GZDA 5GZEA 5IFPA 1V6LA 1PO21 2QUOA 2BGOA 1LEMA 5FTTC 1PZ7A 1NCQC 3E6DA 1C5HA 1V0AA 3C7OA 5F5AA 4UOJA 5AC93 5HPOA 3C8XA 4YW1A 5FV3A 2ZJCA 5JXHA 4JGZC 3W59A 1JYNA 3ALQA 4WM7C 2EF6A 2G1MA 4CU8A 2ZX3A 5GLTA 4L8QA 1OLRA 2CYFA 4BIOA 4W65A 1D0GA 2XKOA 1P8JA 2EXJA 4G3YC 5E8AA 4GH4B 4JGYB 5KHHA 5DDJ1 2Y33A 1APNA 4UW4A 3VBFC 1UZZA 1OLQA 5DN2A 1S55A 3H3ZA 1YQ5A 3B00A 1MS3A 3D0SA 5FUPA 3U11A 3UT0A 3AL5A 3WHUA 4E4HA 4IEPA 4MHUA 4AVVA 1HV1A 4BOWA 3ILRA 4K40A 2XVLA 2PAKA 4NIAA 3O1MA 4HLTA 1LAJA 2HYXA 2DFCA 2Q0AA 2VULA 4OQ9A 4RA0A 1ND2A 1XYNA 2J1AA 1WMXA 4LHSA 1AR62 4YW7A 3WUDA 3PMEA 3AC0A 1OMIA 1K3IA 1R093 2JD4A 5I93A 3VZLA 3ACLA 2DFBA 2W5FA 4XMAA 5FZHA 3IKWA 4DO0A 1PX4A 3LEMA 4Q27A 4OMDA 4HANA 1OT5A 1O5UA 1FT9A 4H55A 1W03A 4UF0A 4SBVA 5CB7A 3R4UA 5C3QA 1DDLA 4N53B 1W3VA 1WLTA 3VBUA 2WIIB 2WFF3 2CY6A 3LOIA 1HJFA 1IS4A 1CZSA 3AMPA 2YPDA 4GWIA 4KBBA 1G7YA 4PDWB 2D98A 4I3PA 4QKDA 2DUPA 3U07A 3VB9A 1U0AA 2UWCA 5APAA 2RDNA 3N3HA 3VD9A 4JDMA 4NIDA 4S2GA 3B69A 1NLQA 3EBRA 4ARYA 1ALYA 3KQ4B 4DB5A 5C4WC 1H6XA 3M3QA 3ZXKA 3VZKA 2JECA 4URAA 1WD4A 2CWMA 4YW5A 3VBFA 5C33A 1F5FA 2XQRA 2CV6A 3RGBA 3VDDA 1BBT1 3DEMA 1XQNA 1ZZ6A 1BMV2 4UFJA 3BKZA 4QPWA 1RMU1 3ZSLA 1W99A 2WNEA 3WF2A 1VP6A 2CNAA 3LPFA 5KHGA 3I2GA 1ZRRA 1FPN1 1S1AA 5JVVA 5FP7A 2Y6GA 1GKBA 2DCTA 1NCRB 2WZR3 3CNAA 4RR3A 3ZFGA 4D69A 2ILMA 4CXWA 3MF9A 2I07B 4UFIA 1DQ6A 2RM22 1HRV1 3J4UH 2NQYA 2JE9A 2QQWA 3JQXA 1XBFA 1GV9A 2VOXA 1V9U2 4ES8A 1JZ5A 1V70A 5D8AA 1W0OA 2Z42A 4FXGB 1G9CA 2WS91 4B1LA 2Q30A 1VALA 3N7LA 1XPWA 1IQAA 4CCCA 2QFEA 4CEWB 1H1IA 4KWUA 5FWJA 2JICA 1S2EA 4MV2A 3RWNA 4DEQA 4I02A 1H4GA 1OQDA 1XYPA 2WNUB 3C2UA 4IEUA 4KWLA 1QEXA 5HI0A 5FP4A 4AXOA 2C9KA 1TQ5A 5FXXA 2HWF1 1QJU3 2DCKA 3LA2A 5JAXA 3BYWA 4A3XA 3WP6A 3V0AA 1QOOA 2NP0A 4R9BA 1UPIA 2HWD3 2WA3A 3OBRA 5FY7A 3WT3A 1GU3A 1RHI2 2A73B 4Y22A 3G6JB 3M3CA 1RUC1 4F8AA 3A23A 5GLUA 3ZIWA 3MLLA 3PUHA 1K12A 3ZYGA 3AYAA 5H9RA 5JPNB 3OCPA 5IFTA 2PHDA 4LPLA 4ZY9A 1ZA4A 1LHUA 1LOAA 2ET7A 2JENA 4RFT0 5FK7A 3SCFA 4LOSA 2TEPA 5A3PA 2X10A 3M7AA 3VBHC 2IVIB 1RB8G 3WQBA 3LKJA 4AI2A 5JZGB 1JYWA 2DCYA 1SLCA 4BLIA 1H2NA 2GMEA 3Q8FA 2ZTNA 5A3LA 1AR83 2ZGTA 3H7JA 1KJLA 3H50A 3LIGA 5LBBA 2QJVA 3ZKYA 2O1QA 1YQCA 3M1HA 5AC91 1RUE2 4AFDA 2FZ1A 4O7XA 3ZOIA 1UNBA 4JAAA 1KDMA 1HN0A 3POEA 5L73A 3I54A 3VBSC 1HJGA 2LTNA 3I3EA 3FHQA 4AR2A 1Z78A 4QWNA 1RC6A 4M3CB 4ATFA 2RJLA 1GZWB 4XFIA 3BALA 4RGKA 3LAGA 3NWKA 4BDVB 3AXEA 1W6MA 4XDOA 4Y5SA 2D6MA 2EALA 5FO8B 4WVMB 4N43A 3K77A 3LEIA 1YHFA 5FPBA 1WZXA 2B45X 2LS6A 4IGQA 3DGTA 2P34A 3DYOA 1GNZA 3K4AA 4Q4W3 2WO3A 1W3XA 3OD4A 3R0RA 2VZOA 1GQPA 3AMMA 4Q4X3 5CU1A 1MR5A 3KV9A 4ZONA 3SH5A 1HB2A 1XRUA 1WD3A 5BNNC 1K5MB 2AREA 4LBOA 4TN7A 4YLZA 3DKQA 4JRAA 3AM2A 1RITA 3L9JT 4EN7B 2RS32 3WP4A 2E32A 3DV8A 2XJUA 1ZRIA 4OHYA 1O4YA 4HN0A 4LHKA 4OI1A 3KHCA 4EJRA 5FO9B 1QXPA 2GC1A 3I49A 4AVAA 2VOTA 1R091 1YLLA 1J84A 1XNTA 3GHNA 2NM1A 1OOPC 4WVZA 3HNBM 3KD4A 1SFYA 1W8HA 3IAPA 4QQPA 4WVWA 2LRPA 2R061 4XVHA 4B7EA 3MFCA 5HXMA 1QJX2 1J58A 3V0BA 3HT2A 3ECQA 4AEDA 4IV1C 4LA2A 2G4IA 1WW4A 3H0OA 3T1LA 4G9SB 1WCSA 1G9DA 1EYBA 4XAEA 1ZYBA 3AZWA 1H2LA 2WFF1 1KXGA 1WW6A 1YUDA 4RD7A 1VB2A 1DQ0A 4LO6B 1BK1A 1D0HA 2HEWF 4NRQA 1S2KA 4AQ6A 5CG8A 3FWEA 1UPSA 1KD7A 1L7RA 1AR72 1BJQA 2EIDA 5BNOC 5CFCC 4FTEA 5CA6A 4Q0UA 4LK7A 1G9BA 5DDJ2 3VZOA 4TYSA 4BCUA 5FREA 3ZPOA 2F4LA 3N9NA 5F2SA 4FPLA 3N9QA 4CA9A 5L19A 3GZAA 4FOYA 5JSPA 3NV2A 1UMZA 2OUJA 3BU7A 2YMZA 2RDQA 3OTFA 2QZ2A 4Y20A 5BNNA 2ZMLA 2GALA 2EXHA 2B8MA 1RUG3 2V72A 4AEKA 2W3JA 4A4AA 4Q8LA 1GSLA 3FFQA 4CVUA 5A33A 1B35C 2W68A 1CAVA 2QQMA 4QMAA 3MPBA 2WZR1 2ES3A 1NCQB 4HKLA 2PLV2 2XOMA 1SBDA 2QQIA 3TB0A 2VNGA 4LUMA 1VBC3 2JIGA 3MIEA 4JGZB 2JG8C 4P9IA 3WZ1A 1PZ8A 4QPIC 3THTA 4WM7B 4UYBA 1Z7S2 3AB0A 1I5PA 1JW6A 3WV6A 5IYYA 4QM8A 1UX6A 5FIXA 1Y9GA 4A42A 3ZX7A 1WMDA 3KCYA 1AR93 2XG3A 1LESA 2RJKA 4Y1XA 4NWWA 2KXLA 5LA0A 3VL9A 5LRSA 5LCWL 1SEFA 1RUJ3 3TOJA 4Q0PA 1R1ZA 1QJU1 3BOWA 3NW4A 4YM2A 4BH9A 1MZ6A 3BTYA 2WO7A 1KJRA 2IXIA 1U5IA 3DXTA 3CIHA 2HWD1 3ZMOA 5FZ1A 5CFCA 1X33A 2XVKA 4CP1A 5JOZA 1OI6A 3MO4A 4M0HA 5C5UA 2O8QA 3POYA 1JMUB 1HW5A 4Q4Y2 1RJ7A 1CAXA 5HV0A 1PK6A 3JB8A 5DG1A 3S6PA 4BXSV 3W5MA 2PHXA 1XU2A 3ZXFA 2BWAA 2BP6A 3FX3A 1QJY2 3UGHA 3VKFC 4D7TA 1QNWA 4Y4YA 3OPZA 1CAWB 4ASKA 1OKQA 3BI3A 1RL3A 2Z79A 1H2MA 2D6KA 3MUY1 2BJSA 1HQLA 4AOCA 3DXUA 3HOBA 2XQXA 3MICA 3DYMA 3JUUA 4YM0A 4PBPA 4Z2AA 1AR81 2E7AA 2VQUA 1IOAA 2W1QA 4P5HA 4CUAA 2VZPA 2R042 3KSCA 2UU8A 4K8RB 3UYJA 2OPWA 3K48A 4QB6A 3ZSMA 4WVVA 3RWKX 1HRV2 1ASJ3 1X50A 5J1XA 3K4ZA 4IV3C 4CU7A 4CXYA 3TEZA 2PHFA 1DGRN 3KGLA 1HDKA 1O8PA 1RUI2 3T2OA 1J83A 3ATGA 3H8XA 1K42A 3PHMA 5C4WB 3OPTA 3WP5A 2O0OA 1TMF2 3TEWA 1EAH3 1UYXA 5A1AA 1NOVA 1W8TA 1W9FA 3CF6E 4XABA 2D40A 5JI7A 3ZN5A 3ZXJA 3O1TA 5DZEA 5DG2A 2E31A 4XJZA 4HONA 2HWF2 3T2TA 1V6OA 4ASLA 3UNPA 4Q4W1 2W39A 2YB7A 1GP6A 2QQPA 4Q4X1
chains in the Genus database with same CATH topology
1D4M3 4XBNA 2VUJA 2LM3A 4RQPA 3FLRA 4HVQA 4EN6B 3E97A 5FLHA 4MGKE 1FOD3 3OYWB 5I0TA 4XTPA 4Z92B 4FPKA 1FX5A 2ZZQA 1CIWA 4HMZA 2BNOA 3D82A 1SLLA 2XWJB 2DVGA 4P9XA 5GLZA 5H9PA 3M3IA 2JG9C 2ZGSA 1GYKA 3LWCA 4QT6A 4FVVA 3VBRC 3E6CC 1SLIA 4COZA 2XL7A 2OPKA 1GQHA 5DZGA 5AC92 4P9JA 3I7DA 1C1LA 2D93A 4I0AA 4LO5B 2KA3A 5FQ0B 1IKPA 1W2UA 1VBA3 2VVFA 3WQ0A 1LCLA 4BMEA 4EWAA 1LOGA 2A6ZA 2QZ3A 2EXIA 5F5QA 1YFUA 2AZ5A 1MEC3 1N3QA 3VBHB 2JKBA 3AMQA 1RUG1 4Y26A 4Q2FA 2VVEA 3WOGA 4BPZA 1AL22 4IL7A 4GA9A 3USUB 4FQ4A 5JR7B 4D7YA 1ULCA 1N3PA 4QXKA 4ZU5A 5JLVA 4V1PA 3APBA 4XYXA 1Q8VA 4META 1NXMA 4YVSB 1VBC1 4XHBA 4N9IA 3VBSB 1H9WA 3S30A 2R062 5GZFA 4Z2WA 1E57A 4NHKA 3PVNA 4GXLA 2OVUA 2VECA 1A3KA 1AR91 4L2NA 2W08A 4BE3A 1LOFC 1ENXA 1S0FA 1LEDA 1MVQA 1RUJ1 2WL1A 4PIYA 4AE2A 4J1XA 1H1MA 4RL7A 4DRVA 4QM9A 1UL9A 1CR7A 2UYBA 4HT1T 4AG4A 4KU7A 4XFGA 3WW2A 4HK9A 4E2GA 3KCXA 4FT8A 4K3UA 2AUYA 1T6GC 3KQRA 4F83A 3FZ3A 4LBLA 2VQ0A 3NAPB 2RR13 2QDRA 3WINE 4YM1A 1LTEA 1OOPB 1WLCA 1XU1A 4Z07A 4IV1B 4HL0A 2P37A 4L92A 4Q0SA 1GBGA 2D3PA 2VOVA 5AVAA 1ASJ1 4LE4A 3KT7A 1ULDA 1UU5A 1RTVA 4XEZA 1Y9QA 5BNOB 2XKPA 2K9ZA 2B42B 2R073 1EAH1 2WLPA 3AKPA 1RUD2 1S2BA 4AI0A 1ZZ9A 2RS13 1G9AA 4XF0A 1PM7A 4GH4A 5ABJC 5JWPA 2ZOEB 3HMYA 3AYEA 3MIGA 1FI2A 1AL0G 3HN1A 3WDYA 1A8DA 3FMGA 1D4M1 4ISRA 4Q26A 1AX1A 2DVDA 4MGIE 5BNPC 1FOD1 1WMEA 2D6NA 5T5JA 5BV6A 1VIWB 4N90A 1B35B 1W6PB 2BYVE 3L2YA 3INAA 1VB4A 2K2SA 1QXRA 4ITCA 2XBO3 1Q8SA 3TN92 2XPJA 3PVBB 4K1ZA 3IWZA 2JG8B 1ZVFA 5CNAA 2SLIA 1D2QA 3RRDA 1QMJA 4NPRA 4JVAA 2D6LX 1AR82 3N7KA 1DBNA 2PHUA 5F6KA 4QQ2A 4X8PA 3QOPA 4FSJA 1OQEA 1LGBA 5H9QA 4XETA 2WJSA 4PBOA 4J1WA 2D6PA 4XF1A 3NV3A 4LA3A 1UKGA 4KG0A 5EYYA 4MYEA 4O9EA 1QXJA 1H1AA 3ETQA 5C8WA 4PDWA 4CEYA 2VVDA 3MGUA 1VBA1 4UW3A 4AF9A 2BVBA 2PN5A 4QQHA 4UBGA 5FCCA 2DURA 3NSTA 5ABJA 1AF9A 3OGJA 4NOTA 2ZS6B 4Q4W2 1MEC1 3ZYRA 3VV1A 4IEOA 4JRLA 3WD5A 3ZXDA 3FUQA 1G9FA 3R05A 3KMHA 4M01A 5FOBB 2YUEA 4YVWA 3KM5A 1U5ZA 3MFAA 2XB6C 1M06G 4GALA 2G9GA 5LK5A 3GALA 4Q29A 3WG1A 4IV3B 2LUWA 2GNDA 1AXZA 5FDBA 2HWB2 3ZN6B 3IM0A 1ZRDA 3ZSKA 2KM2A 4AHZA 4LLOA 1C8NA 2XHKA 3DPRC 1O5LA 5HCFA 2I2SA 4NN0A 5T5LA 4XILA 1NQJA 3WQ7A 4K21A 1CESA 4I0WB 4LBJA 4C1XA 1KFUL 3CL1A 5FRAA 1YJLA 3RMYA 5KXDA 4XZPA 1QH7A 1SDWA 2BPA2 2Z2SB 2WFPA 5JSOA 1HRI2 2DU1A 4ZXKA 3WUCA 1GZCA 4B3NA 1CONA 4O9GA 2GMPA 4KWKA 3ZDSA 3DL3A 4LULA 4EN8B 2RR11 4LEJA 2PHRA 2PHTA 5GALA 1R1A3 1VLNA 2JG9B 1RUG2 2VW1A 3AKTA 3MYXA 1O91A 3ME2A 2WSVA 3VBRB 3JCIA 1YXWA 2CWSA 5K8SA 1ND2C 4QGLA 1BEV2 2ZA9A 1IGOA 1Q56A 4OZXA 5EYXA 5ACA3 2W0XA 3RZZA 2VMHA 1VBC2 4FPCA 1VJ2A 4OLLA 5E89A 3NVCA 3VKNA 2RMU2 3AKSA 1PMIA 2AGSA 1DYPA 4YG6A 2PAEA 2ZGLA 3E6BA 3DPRA 4CDWC 2R071 1AR92 4FOQA 3AFGA 4FAGA 2C1FA 2GNBA 2ZGRA 4QPGA 1X8EA 3VBUC 1L3JA 2RS11 1RUJ2 4DINB 4EN9B 5BNQA 1WBFA 2QNKA 1ONAA 1JYCA 5F9TA 4IEQA 2WT0A 1G8WA 3AJYA 4QHBA 2CAVA 4MSVA 3VUOA 2F6BA 1LECA 3I59B 5CFDA 4LHNA 4YGBA 3SISA 3VDDC 5K9YA 5KHJA 2XBO1 4I2OA 3MIDA 4XIOA 4H7MA 1S0BA 1TE1B 3UJOA 3AP4A 4I01A 3UKVA 4AVTA 2Y26A 3S7EA 2VMIA 3ZFGC 4RR3C 4XF9A 1ASJ2 1C28A 3TRSB 1F2NA 4M0NA 3WDWA 1PGL2 4YZ5A 1AYN2 1HXS2 1QQP2 5L7OA 5D8AC 2D44A 4HSJA 4CDWA 1EAH2 3D5OA 1HLCA 4I3GA 1COV3 2WNVB 1JHNA 4IEYA 4K6BA 1R082 4AGVA 1QDCA 2HKXA 3RI9A 4XOGA 2XWBB 1GZ9A 2ZBJA 2CGPA 1JUHA 1XXNA 3U10A 3OD0A 1CN1A 1ZRFA 1FNZA 1KFXL 5J7MA 3FLPA 2HWE2 3ELNA 4AFCA 4HETA 4LHLA 3WG3A 4OHZA 3AZVA 4H3WA 3FE5A 3KGZA 3TAYA 2VUAA 1CPNA 2X5IA 4MGYE 5FBZA 2XGXA 4YW2A 1MACA 1S0JA 4GB33 1S0DA 4YZ4A 3WY6A 3MIBA 1VRH2 2ZKLA 5K0UA 3KS7A 2QKDA 1EPWA 2UURA 4YNIA 1Y43B 2EAKA 2YC0A 2Q1ZB 4URTA 1H9PA 1URXA 2RS52 5FLJA 1SCSA 3B3QE 1FXZA 2DUOA 3WDXA 1UU6A 2ZX4A 4B7KA 4UBHA 2VW2A 4WM8A 3GBWA 1BXHA 4N43C 4K20A 1NA1B 5I0RA 4P9WA 2ZZJA 1MEC2 3M70A 3WR0A 4NHLA 3ZMNA 1R1A1 4C1WA 1ZZCA 1FV3A 3VKMA 1M4WA 5KHKA 3RG0A 2E7TA 1OA2A 2ZHMA 3AP7A 3LB9A 1RUH2 1QNYA 3BIWE 2RE9A 5J96B 1PO12 2VOKA 2BUKA 4J6GA 5ACA1 1C4RA 4X6RB 4HPKA 1O3TA 4WV8A 2A3YA 3ZFFA 3UJQA 1G6NA 4AEDC 1H8TB 2XJVA 5C8CC 3D0JA 2BNMA 4UW5A 3POSA 4GKYA 1N1TA 3T1MA 2R1BA 1AX2A 4IESA 2GC2A 1UW8A 4PLNA 2A3WA 1B09A 3H8UA 2HEYF 4XJ8A 5CIRA 3WCSA 4FBFA 4DMIA 4QX5A 5CG9A 2GC3A 2CL2A 3GHMA 1FYUA 1XNDA 2ET1A 4AQTA 2ZGKA 5BXXA 2NMNA 3ZO0B 2XLGA 4P9YA 3SCGA 4YGCA 4K7JA 3DUIA 1PIV3 1J3PA 2EXKA 5T52A 5L36A 4PCRA 3ST7A 3A0KA 1XNCA 2MEV2 4F7ZA 4BYYA 5FLIA 3MEPA 5IK7A 4M00A 1IKQA 1LGNA 2HJIA 4XJ9A 1JH5A 4YZ3A 2DTYA 3VZJA 2YYOA 4YG3A 2YGMA 1AX0A 1XE7A 1VBD3 3ES4A 1RVF3 1WCDJ 4FPEA 5C8CA 1PO22 1LGCA 4RS5A 2IXLA 1COV1 2RS12 2ZGNA 1SQ4A 5FOJB 2B9UA 4FQZA 5A32B 4R9DA 5KC5A 2Q8OA 1DG6A 4C0BA 2O8OA 4C0HA 4XBLA 1ZZBA 5DZFA 1ND2B 2P3KA 1PK6C 5C9AB 1ND3A 4S2HA 3AZYA 2YHJA 2VW0A 2DU0A 1LU2A 2GZWA 3H3UA 4HN1A 1C3HA 4IXLA 2A6YA 1O4ZA 1C57A 1CX4A 4GB31 3ZSEA 1W0PA 1MZEA 1REDA 1VBE3 4DPNA 1YJKA 2AENA 4XFBA 4XQWA 1GANA 3CEWA 3VLBB 3VBUB 2R30A 1J3RA 3JD73 1HQWA 1PGW1 2ZGPA 4FTBA 1YIPA 1DLLA 1DZRA 2H6BA 3J9SA 2VG9A 5J3UA 4I09A 4XF4A 2B39A 2GSYA 4XMIA 3EXUA 3RNSA 4AK3A 1DQ1A 4Q0VA 1UCXA 1KRIA 4K8FA 3VBFB 1N3OA 2OW4A 3NL1A 3IPVA 1N1SA 4Z1VA 1I1EA 1EV13 2ZMNA 5IT6A 4Q4V3 3LZZA 3O7OA 3NAPA 4RQPC 3BOPA 1QOSA 4LO4B 2HWC3 1W6OA 4AEMA 1LHWA 3ZFGB 4RR3B 4CTEA 5IK4A 3PMSA 1BBT2 5KHIA 1KQRA 1PNGA 4E2SA 4LO8A 1RMU2 1YCIA 4HVRA 4XJUA 4E2QA 2FMDA 3VZMA 3HQXA 5LRRA 3WHTA 1FPN2 1GFF2 4TLFA 2XH6A 3MLJA 1POV3 2GNMA 4IETA 3WW1A 3A0NA 3KLSA 2E63A 4ORFA 3IT8A 2EVXA 1QJZA 4D94A 3AKQA 3ZFEA 1CD3G 3MDPA 1WUVA 3ZVXA 4DQAA 1QKQA 4HBNA 4JC1A 4RGAA 2WS92 1JYIA 1AYM3 1BVP1 2MNGA 2JX9A 4Y22B 3SH3A 3VBOA 3V65A 4XIKA 3IDEA 1DFQA 4INDA 1PIV1 5FPXA 5FAXA 1AR63 3V64A 3KT1A 5T5PA 1CAUA 3RPQA 1AZDA 1RUC2 2UWBA 1PNFA 2WC2A 1UZYA 3ZN4A 1G86A 4AHXA 4YARA 4CDXA 3KT4A 2UWAA 3AK0A 4XFCA 5JIAA 4K1YA 1VBD1 3O14A 3MW3A 1AXYA 3PNAA 1S0IA 4FXKB 1RVF1 3E5QA 3EO6A 1Y7BA 1SLBA 1FMD3 3QD6A 3AP9A 1ZNPA 1W6MB 1SLAA 2H0VA 2TBVA 3N36A 4L99A 4YM3A 5SV5A 1OFSA 4MH0E 2A7AA 3KCCA 4FOVA 1W6NA 2CTVA 3JBG3 3WW4A 5KXCA 4PIZA 1O3SA 4R8HA 4BQ1A 4NWVA 1YRZA 4KG8A 4MXVA 5AVPA 4BWOA 3WG2A 2A6VA 4MXWA 4XE9A 1X36A 2YROA 4P9LA 1IS6A 1U5YA 4UW6A 1YWKA 4IQPA 1YI9A 4L11A 4ZU7A 1MQTA 2B7YA 2X8KA 2OZJA 2ZCWA 1ULFA 3I4IA 4AHWA 4CDUA 2R0FA 1NQDA 5T50A 3RYRA 4CDQA 3ROUA 1VAKA 3MI8A 4FOWA 1I3HA 3V0BB 2GC0A 1VBE1 4AEDB 3SCHA 3L2HA 4MGZE 3HD8B 1KS5A 3N7JA 3HR9A 3OY8A 1IS3A 5A3MA 2GAUA 4MX3A 1R092 4W6YA 3JD71 1SACA 2CGOA 3QBQA 2XJQA 2G9FA 4FPHA 2ZAHA 2WKKA 3TBDA 1SLTA 2D6OX 4YG0A 1NLRA 4MUVA 2FMYA 2WFF2 1D4VB 3D6EA 1RHI3 2UY8A 3B02A 4GH4C 5BUVA 2JDZA 3WVJA 1V6JA 3RJRA 1EV11 2DV9A 3ASIA 4Q4V1 4E27A 5I91A 1EY2A 4Y20B 5BNNB 4OULA 1O3RA 1JN2P 1I9RA 3B9CA 3MZHA 4CP0A 2PYTA 2HWC1 3M3OA 1CAVB 2DWRA 3CU7A 4BHPA 1ENRA 3IIAA 4HFSA 4EWEA 3WDTA 1W6QA 3EJKA 1RUF3 1OFNA 4X8NA 3R6SA 1GLHA 2SBAA 2Z5WA 4LNVA 3CJIA 2UY9A 1SBEA 2WZR2 1WLDA 1DGWA 1POV1 1SFNA 4Q8KA 5IK8A 4B29A 3K51A 4FAHA 3SH4A 3P3PA 5CVRA 1ZZ7A 2WQZC 1OHFA 3GBGA 4PDWC 5CFCB 4FPJA 4M3CE 3FUOA 3VZNA 4CEYC 2R6QA 1AYM1 4TWTA 4B4QA 4E4ZA 5HCAA 4ATEA 3H1WA 1CAXB 2YPJA 3BCWA 5CBLA 4XDQA 5I93A 4JGYA 5IK5A 4DNYA 1DQ5A 1QJU2 1JBCA 1U5XA 3M3EA 4R52A 1NE6A 2ZX1A 1AR61 4G4FA 2HWD2 3MIHA 2NMOA 5I0UA 3NKTA 3O0VA 4YVWC 3J8F3 4E4DX 2GH8A 2D3SA 1RINA 5JOWA 2YGLA 1V6IA 4XW3A 1V6KA 4QPIB 2P3JA 1WA4A 1FMD1 4NHMA 1AR73 1CGPA 5D1IA 4N53A 4AFAA 3JBG1 4FPFA 4XQ4A 5GZCA 4MZUA 2OZ6A 4AI1A 4RQPB 4YYOA 2D5FA 1BMV1 3TWIA 4DXZA 5KC6A 2IXKA 3AP6A 1UIKA 3GBFA 3QH6A 1AHSA 2VY0A 2PLV3 4Q4X2 1Q3EA 1GR3A 3ZXEA 2D7FA 4H14A 2E53A 3WDUA 2P2KA 4Y5Z0 5HBAA 4UXAA 1WGPA 3A4UA 4JQRA 4PLMA 5EZWA 1LR5A 1BCXA 3NV4A 1Z7S3 4M3CF 1OPMA 3ES1A 1NCRA 4FPOB 4BMBA 4FCAA 1DIWA 5GM0A 1VBD2 3B7MA 1N1YA 5T54A 5EV7A 5J98B 4GMP3 4LO7A 3TNPB 4XTMA 4X6QB 1LU1A 4LBQB 4COYA 5F1RA 2CGNA 4QPGC 2D3RA 4GWNA 3ENRA 1IZ3A