1GMMA

Carbohydrate binding module cbm6 from xylanase u clostridium thermocellum
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
FSKIESEEYNSLKSSTIQTIGTSDGGSGIGYIESGDYLVFNKINFGNGANSFKARVASGADTPTNIQLRLGSPTGTLIGTLTVASTGGWNNYEEKSCSITNTTGQHDLYLVFSGPVNIDYFIFDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CBM6
publication title The Location of the Ligand-Binding Site of Carbohydrate-Binding Modules that Have Evolved from a Common Sequence is not Conserved.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Xylanase
total genus 31
structure length 126
sequence length 126
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gmmA00
1IQDC 1KGYA 3ACHA 5HPOA 1O59A 1J83A 4RYDA 1JZ2A 1JU4A 3LPFA 2QQOA 1UYYA 2ORXA 4P00B 5IFPA 2YB7A 1WKYA 3I3BA 1PX4A 3WNKA 1GOFA 3GGLA 2QQMA 4DXTA 1WCQA 2WZEA 1O8PA 2OKXA 1UX7A 2J1EA 4JKLA 1TVGA 4A4AA 3MV11 4FI9A 3T0BA 2E26A 2JD9A 1DP0A 4CUCA 3WNOA 5IFTA 1L7RA 5C71A 2VTFA 3D3AA 3WNPA 1UY3A 2WO2A 5DN2A 4L0PA 4LPLA 3AC0A 4XVHA 4JKMA 4ZY9A 1UY4A 2Y6JA 1DYOA 2VZTA 2QQKA 3CDZB 4P08A 3THDA 2WAAA 3K4AA 1W9TA 4Z2AA 2ZEZA 3CMGA 2ORZA 3UESA 4LHSA 5IHRA 3NJXA 4XUQA 3I2FA 2QQNA 4W8JA 3C7FA 4QB1A 2WBKA 1GQPA 2JDAA 4OUEA 2CDPA 5G05L 3SEEA 3GXUA 2WO1A 1GU3A 4A6OA 3WF4A 1NUKA 1LNSA 3IDAA 1K3IA 1ULPA 4UOJA 1XNAA 2XOMA 3T2PA 3WNMA 4D8MA 2VCAA 2W3JA 3ETPA 1UWWA 1TG7A 1SHWB 4ET7A 2VR4A 4TTGA 3W5NA 4QDQA 5J1XA 5F7UA 3A22A 3C7GA 4XUOA 1JZ6A 2VZUA 5CYYA 3FHAA 4ARXA 4E8CA 3ACIA 2W95A 4YPJA 3DECA 4XUNA 3WQBA 4DEVA 4A45A 5JR2A 2J1TA 3VD3A 3K75B 3K46A 2VCBA 2W1QA 4ZZ8A 4DXSA 2W1SA 2J1UA 4RN5A 3HN3A 4ZXEA 5DMYA 4UAPA 2X10A 3HNYM 1UY2A 3CQOA 2XQXA 4A42A 1GOHA 1MPXA 3WF3A 3OGVA 2LW8A 2Y64A 2J22A 2XONA 3HJRA 4DXRA 2YC4A 3CIHA 2WYSA 2VZSA 2YFZA 4KI5M 3NQHA 3WF1A 3WNNA 4GWIA 4IUGA 3T08A 4JHZA 1JYVA 3T2QA 2VZ1A 5EJZB 4KMQA 3GDBA 1R64A 3NJVA 1SDDB 2VZRA 5JMOA 4QB6A 3E1F1 3K4ZA 1P8JA 2J1SA 1XC6A 2Y6KA 3SKJE 1SG3A 4CUAA 4QDRA 2Y8KA 2VL4A 2BGPA 3U37A 2ZXQA 3FL7A 2DCKA 4BXSV 4CVUA 2E31A 2VZVA 3OBAA 2J1AA 4ARYA 1US2A 2W94A 3OB8A 2W92A 3MO4A 3WSOA 3HOBA 2QQIA 1CIYA 3ZM8A 1K45A 3C7HA 4QPWA 4JX0A 5A1AA 2Y6HA 4HG6B 1W0NA 4CU6A 3P6BA 5EJ1B 2C26A 2QQJA 3T0AA 3DYMA 3I2GA 5FUIA 2E32A 2QQLA 2Y6LA 1JYWA 3OEAA 5LA2A 5EIYB 2WQ8A 2J1VA 2W46A 2C9KA 2WUHA 1UYZA 1UMHA 4QB2A 4BJ0A 2JE8A 1OD3A 5B4XA 4A41A 2DDUA 1UXXX 3DYOA 3MUY1 2WN3A 4XUPA 5LCWL 1I5PA 2E33A 1F4AA 3I3EA 3NNGA 1PMHX 1JZ7A 4PQQA 5C7GA 4QX1A 2WAOA 3IIIA 2V4VA 1L7QA 2RJ2A 2WABA 3SEPA 2RVAA 2X09A 4OMCA 3T2OA 4OZOA 1DLCA 2VZQA 3K4DA 2EIDA 3VD5A 3SKVA 4BK5A 1F4HA 1YQ2A 1XNTA 4MO3M 3LE0A 4OYUA 1W8NA 2C4XA 2ZEXA 4M4PA 1UY0A 1NKGA 2X05A 2YFUA 2BZDA 2HLEA 3WF0A 4XZUG 2YC2A 3A23A 5DQ0A 3F2ZA 5JUVA 2CDOA 2L9LA 3UETA 1OF3A 2VOTA 3A7QA 5JXGA 1JZ8A 1W99A 2VZOA 3C7OA 2VC9A 1JZ4A 3FHQA 4PT6A 1JZ3A 1CZVA 3LEGA 2J1RA 3OGRA 5LA0A 4XUTA 4MGQA 2RV9A 2R7EB 1GMMA 3HNBM 4DUVA 4XURA 1JU3A 2W1WA 3OEBA 1HN1A 3LEIA 4QX3A 2VCCA 3T09A 4QDSA 2WDBA 4DUXA 4JKKA 3ABZA 4TXWA 3I97A 3CZUA 2VZ3A 4MOAA 4AAXA 4BK4A 2B4KA 4E8DA 1RYYA 2VJXA 3OG2A 2PQSA 3THCA 1JYXA 4AG4A 4P5YA 5IJRA 3ACGA 5CZKA 3W5MA 1PMJX 2BERA 1NAEA 1JYNA 2VMDA 2Z4FA 5IYYA 2W87A 1OT5A 1OH4A 3I2IA 3I2KA 1GOGA 1US3A 2ZEWA 2W47A 2BBAA 1NX9A 2EIBA 1UZ0A 1EUUA 2VMFA 2ID4A 3P1IA 2VM9A 1PX3A 3UNPA 2XHNA 4CU9A 1GUIA 5JXIA 3FN9A 2Y6GA 3NRUA 2BGOA 2W5FA 1GNYA 3J7HA 4LQRA 1CX1A 1H6YA 4DEQA 3EB7A 5I0DA 4BDVB 1JI6A 4QX0A 1O8SA 3I3DA 3PUHA 3MBWA 3HPNA 1UMIA 3CKHA 3VD7A 3IAPA 3ACFA 4LKSA 4MGSA 1UYXA 2VZPA 3LEKA 1W9SA 3HEIA 3WEZA 2LS6A 3DYPA 1UXZA 2ZEYA 1EUTA 4QX2A 4DUWA 3IB3A 2HYXA 1KEXA 4A44A 3MV01 4CUBA 3OGSA 1T2XA 4W50A 3GM8A 1W9WA 2VMEA 5LA1A 4A3ZA 3LPGA 3T0DA 3K77A 4W4ZA 2VMCA 1OF4A 3CZJA 4UI9L 4OMDA 4ZZ5A 3VD9A 2VO5A 5JXJA 2VQTA 2W1UA 3JXSA 1ULOA 2KD7A 3A21A 1K12A 3VDAA 2B9VA 3WF2A 3IAQA 4GWJA 5HXMA 3MUZ1 2DCJA 3HNMA 1K42A 3PUIA 1CZSA 3EYPA 1J84A 5JXHA 2WZ8A 1BHGA 1D7PM 3I2JA 4CU7A 3VD4A 2J7MA 5B4NA 1H6XA 2JKXA 4CU8A 4GZ9A 2EICA 4P02B 5DPNA 2WN2A 1W8OA 3VDCA 4PF1A 1JHJA 4D0QA 2WO3A 1UY1A 5C70A 3C8XA 3BN6A 3LQCA 2W91A 1CZTA 4MADA 4M4RA 4QAWA 1XPWA 3ECQA 5G04L 4KWUA 2YG0A 2QBXA 3BGAA 2W9XA 3I2HA 3WNLA 3C7EA 2VQUA 2V5DA 3VDBA 2V72A 1JZ5A 2EIEA
chains in the Genus database with same CATH superfamily
4LBQB 2GC2A 4AVBA 4AHWA 1IQDC 2EA7A 4XXPA 4DINB 5C9AA 1LU1A 4WM7C 3ZPYA 1RUE3 2RMU3 2XLAA 1O59A 4LTAA 1HXS3 4CE8A 4DPNA 5HPOA 1VJ2A 3H7JA 1D4VB 1J83A 2IVIB 4MX3A 2D93A 2Y34A 1JZ2A 4GMP1 1GNZA 1FXZA 4L92A 4P00B 2YB7A 1JYTA 1C57A 5DUWA 1W2TA 4I02A 5FOJB 2ARAA 2PLV2 5T5PA 4BMEA 3W59A 1WCQA 4PQ9A 1PVC2 3E6BA 4I0BA 1COV3 5FP8A 4HSJA 4FP2A 1IS3A 4B29A 1Q8SA 1MZFA 1S2KA 4FSJA 2DYCA 4A4AA 4YZ5A 1H8TC 3H1MA 2JDYA 3T0BA 4XBQA 1H1MA 1PO21 5DUXA 4J1WA 4CDWC 1F31A 5C8CA 2V4AA 3FUQA 2WWSA 3DXTA 5C71A 1BBT1 3WDXA 2PHFA 2Y0OA 5FWJA 4URTA 3D3AA 3D82A 4DFSA 2WO2A 3FC0A 1W8FA 1XYPA 5A32A 4GH4A 2PA7A 1PK6A 2Q8CA 2OZJA 2Y33A 4LPLA 3HR9A 4OHWA 3M7AA 2FHRA 4XVHA 1KITA 4EN7B 5F3CA 1JH5A 5I0SA 2H0VA 3OY8A 1SLLA 5T5LA 1PNGA 3U4SA 3LKJA 2QQKA 3O5SA 3PL0A 4Q0PA 2LUWA 2ARBA 4YVWB 3UGHA 4BQ3A 3WHTA 1AZDA 5H9SA 2FDKA 5BUVA 1GWKA 2HKXA 2P3YA 5E16A 3PU3A 1UKRA 1W9TA 1LU2A 3CEWA 5FZEA 3CMGA 3O1MA 1QXJA 5I0RA 2ORZA 3MIFA 4LHSA 3WLUA 5E6HA 1D0GA 3NJXA 3I2FA 5IHRA 4FAHA 1MVQA 1GR3A 4M01A 3AVRA 1ZRRA 5FMOS 2QFEA 3KSCA 3H1WA 3VDDB 3RZHA 2ZA9A 3C7FA 1QJU2 4O61A 1LOCA 3WQ7A 1W9YA 4XW3A 1NCQC 4ZU7A 3NW4A 1H0BA 4CEWB 4OUEA 1ZRCA 3KZ4C 1KJRA 4TN7A 3USUB 4GMP0 5FYHA 1DZTA 1FV3A 2A1XA 1AXYA 5G05L 4NE9A 4LITA 2WNVC 3ZR5A 2Q1ZB 1EV12 3ZMNA 4QX5A 1LULA 4WM8A 1NUKA 4OUSA 2BGCA 1LB2A 4YW1A 1RUH1 1SEFA 4UWDA 2W2IA 3UT0A 3ZSKA 5FYUA 2XOMA 4QPIB 2Z69A 2B42B 1ND3C 3WNMA 5C4WA 4IGQA 4D8MA 1HB1A 2W3JA 4LKEA 1TG7A 1Q8OA 3VBFA 2YYOA 2Z42A 1C8M2 3RVHA 3S6PA 2B45X 4X6RB 3HN1A 4M3CA 1UIJA 3LA3A 3RQ0A 1CAWA 4XFGA 3A22A 3MLJA 3LDKA 1DYKA 2VD7A 4O65A 4PIYA 4XUOA 1B35C 2VZUA 5EFUA 4DRVA 3QLQA 4JAAA 4M3CE 4ASKA 2A6XA 1UW8A 2TEPA 3FHAA 3AKSA 2PQQA 1F9KA 1H2NA 3T3YA 4K21A 2W95A 1O4ZA 2G4IA 4UT5A 4XUNA 4LR4A 1RUOA 1Z0HA 1W6QA 2BFUS 4CCEA 4MXWB 1CAVA 2VGDA 3VD3A 2VCBA 4Q0VA 5ANNA 2ZHKA 3AZXA 4ZZ8A 2A75A 2FZ1A 1UZYA 2VU9A 2WFF1 3B3QE 4DXSA 1BQPA 1BVVA 3MLLA 4ZXEA 3WCRA 3QH6A 4NRQA 2X10A 1PZ8A 4HONA 3CQOA 1NG0A 4BB3A 1FT9A 3MLKA 1UAIA 1HQLA 4FPKA 4CDUB 3DPRC 3POIA 4Q1RA 1SCRA 1BJQA 1BEV3 4QM9A 3WF3A 1DQ0A 2HWB2 2Y64A 4EV0A 1F5JA 2KXLA 3LOBA 1RB8G 5CFCA 2XBO3 5CADA 1HJGA 4K8FA 5JOWA 2AREA 3IPVA 4Y1ZA 5FXVA 4XTPA 4LT5A 2R071 3AXEA 2HH9A 3JQWA 1NA1A 2YC4A 2GN3A 1X36A 4YW3A 2VZSA 1R081 3KHCA 3WR0A 4KI5M 3NQHA 5FYYA 3MGUA 4HVRA 4UYBA 2Q1MA 4XJZA 5LK5A 1KS4A 3SH4A 3JBG1 2YV8A 2DWRA 2VW2A 1RVF2 2DV9A 3GZAA 4FPLA 3IT8A 4XAEA 3O1OA 3Q9OA 2EXIA 2E63A 2JICA 3OSDA 4NHKA 3GDBA 5IAVA 1R64A 5IVYA 3T4VA 3UKNA 5JSOA 1HRV1 2JG9C 3A0NA 3WW2A 4XF4A 5JMOA 1FOD1 4XYXA 3E1F1 2J1SA 4GALA 4LKFA 2Y6KA 3KS7A 2CU5A 2VNVA 3SKJE 2PHXA 4YARA 5HCFA 2ZMNA 1BZWA 1SG3A 4CUAA 4G4FA 2VL4A 1QEXA 1KDKA 4IEUA 5FWEA 5IVVA 3D8CA 4AVSA 2VOKA 3CO2A 5KHJA 1G9CA 2ZZQA 1W8UA 1SPPB 1NYWA 4YFZA 2H6BA 2J1AA 4JDMA 1H8TA 2JDZA 2W94A 3OB8A 2UY9A 3MO4A 1R092 4IEZA 1PVXA 1FMD3 2WNUC 5K4LA 1TNFA 3IIAA 4XOGA 4RSUA 2Q8OA 4CDWA 3AVSA 3R4SA 1AR83 2D5HA 4I01A 2VW1A 3L2HA 4TSVA 2WT1A 4HT1T 4LLOA 5GALA 5F32A 2B7YA 1FYUA 1RUG2 1ULCA 1W0NA 3N7KA 4CP2A 1LCLA 1HRI1 1ULGA 1WLWA 3P6BA 4CU6A 3N9PA 2FCTA 5BPXA 4GIQA 1N1TA 2OQ6A 5LEKA 3WG4A 2Y6LA 1G86A 1PMIA 2VULA 3FFQA 2DCYA 5LA2A 5K0UA 1REDA 2J1VA 2WUHA 2ZAHA 1E57A 5GKAC 1UYZA 2UY8A 2P1BA 4AVCA 1X9PA 4BJ0A 5JDBA 3PMSA 5FK8A 4AGVA 5A7PA 4PIZA 1ST8A 2A6VA 2VG9A 2VNOA 4YWAA 3WT3A 1CAXA 2O8OA 3GNEA 3VBUC 4GWNA 5KXCA 2VCMA 3MUY1 4KBZA 1LJ7A 4IESA 4XTMA 4HMZA 4GB32 4QU1A 4AI3A 2ZGMA 5A7QA 3ZXJA 4EQVA 4QKDA 2QE3A 2WWUA 5LZ6A 2ATFA 2R041 3RPQA 1OH3A 2PHWA 2ZGUA 5C7GA 1D4M2 1XNBA 1Q56A 2PHRA 2WAOA 4JQRA 1NCQA 5DZEA 4AI0A 1AR61 1Y7BA 4I3PA 1L7QA 2QTWB 1OHFA 1OFSA 4P9WA 5ERLA 4AEJA 3GBFA 1V70A 2X09A 4UBHA 2WNVA 4Y26A 5JPNB 2JIGA 4CXWA 4GD4A 1OUXA 2WS91 1OA3A 4J25A 4D7TA 4JTOA 2R0FA 1QKQA 1RUI3 4Q8LA 1QXPA 1W6NB 1PGW2 3VD5A 3VHPA 1XNTA 1IS5A 1GANA 3AZYA 4MO3M 4MYEA 4IV1B 1HKDA 1W06A 1MS8A 4YVSB 5KC5A 1ND3A 1H2MA 3OPTA 5AC92 1NLQA 1JN2P 1YIFA 2C4XA 5T50A 4CCLA 5KXBA 2RM23 1MS0A 4K8RB 2YFUA 1QOSA 4QQHA 3PVNA 3RS6A 1STMA 3POSA 4XZUG 2VXJA 2O0OA 2YC2A 3A23A 4Z8BA 4FOVA 2LRPA 1GP5A 3VLBB 1AR73 1XBFA 4K3UA 3F2ZA 3WUDA 5IATA 5KBFA 1OF3A 3LCPA 5DG2A 1B35A 1ONAA 3VL9A 5DDJ3 3KT1A 1H4GA 1RUD3 1IKQA 4Y22A 3PTRB 3ACLA 3PHMA 3OYWB 2FQPA 5BYNA 5A7WB 4KWKA 2GU9A 5A33B 3I8TA 2ERFA 3MI8A 1JUIA 1ND2C 4PT6A 3ES4A 3OGRA 2J1RA 4RS5A 4AGGA 4IL7A 3MEPA 5KHKA 3JZVA 1DG6A 4DMIA 4BPZA 3I3QA 4XABA 4BCUA 5CA6A 4IXLA 4MGQA 4DZGA 5M0TA 4ZONA 1AL0G 1TMF2 4R9AA 5FZHA 2ZZJA 3TN91 3HNBM 5EP9A 4BXFA 1WCKA 3TOJA 3MW4A 1COV1 2JXAA 1JU3A 2RJLA 2W1WA 2ZGQA 5LBFA 1MS4A 4JDNA 5E88A 2ET1A 5D8AA 2WLQA 4DUXA 5F2WA 4A6SA 3C3VA 3CZUA 3WG2A 2GN7A 2VZ3A 4AAXA 3IDEA 1DQ5A 4OI0A 2XVKA 1AJOA 4E8DA 3ZIWA 2UWBA 2YPJA 2C1FA 1SBFA 5CKMA 2X5IB 4P5YA 1WWYA 1Z7S2 3CJIA 5C8CB 4GKYA 3VBHC 3W5MA 1A34A 3T2TA 5FQ0B 1WGPA 4QGMA 1AL23 2D7FA 5F3GA 5FPZA 4CZSA 1DQ2A 2AGSA 1J58A 2VMDA 2Z4FA 5A32B 3TB0A 1BMV2 4MGKE 4AK3A 4Q4V3 1CVNA 2W87A 1IG3A 5FZIA 1U12A 3LA2A 4BQXA 2E6VA 1IPSA 2XUEA 1O7FA 2ZEWA 3OBTA 4BE3A 1IHMA 2ZX2A 2PAMA 3D4KA 1W6PB 1B09A 4ZU5A 1SLCA 2BBAA 1NX9A 3WP6A 4HVOA 4GMP3 2ZMKA 1EUUA 3AMHA 4UFHA 1EYBA 1AYM3 4XDOA 2VUAA 3BODA 1LOEA 3FFZA 5FMCA 1PX3A 4LO7A 2XHNA 3RFRA 1V9U1 3UNPA 5JXIA 3RZKA 2CYFA 5C5TA 1NQDA 3ZPOA 2Y6GA 3HT2A 4LQRA 1CX1A 1GQHA 4UBGA 3HAGA 5FOBB 3ZFFC 5JWPA 1AR92 2ZCWA 1E5IA 3CNAA 2IXLA 4L97A 4Y1VA 1GP6A 1ASJ1 4OHXA 3EB7A 4FPHA 3JUUA 3U1XA 2E9QA 1GZTA 5GLUA 1ZBA1 2ZX4A 3AL6A 1F2NA 2WR9A 2BBVA 1DDLA 4CEYC 3MBWA 3FLTA 2YROA 1NCRB 1ZRDA 1RMU2 2XJRA 1RUE2 3V65A 1A6CA 1W0PA 3ZFGC 1HXS2 1F8VA 2VUCA 2JB4A 4IE6A 1VALA 4JGZB 5FFOC 4D69A 4B4QA 1FX5A 4Y1UA 3Q8FA 4QX2A 5D1IA 3IB3A 1W28A 4NN0A 2HYXA 1VAVA 3MHZA 4N9HA 1F15A 1KEXA 2F17A 3VBUA 4QXCA 3HBZA 2RDNA 3ZKUA 5D2AA 1V6IA 4CUBA 1G9AA 1CAWB 1POV1 1ZZ9A 1WUVA 2QCSB 4LLFA 4W50A 4YW5A 1W9WA 5FKBA 1H8VA 5HV4A 5LA1A 2GNMA 4XEZA 5HCAA 1UCXA 3K77A 1VBC1 4W4ZA 3WDWA 4LO5B 1LENA 4HSLA 5BY5A 5LBEA 3GHMA 3VD9A 3V0AA 1LESA 2F4PA 3Q8BA 3TEYA 1UO9A 1KXGA 1FPN1 1W6QB 3IN9A 1ULOA 3HD8B 4FOYA 1CAVB 4CCKA 4KG8A 4MV2A 4YGEA 1JYIA 1CAUA 2EAAA 4A3XA 3MUZ1 3CBNA 3R6SA 3RI9A 1BEV1 1WW7A 2QJVA 3J7MA 4UW3A 3ZN6A 3MW3A 2P5BA 3R05A 5LRRA 2XBO1 1WA6X 2JDHA 3ZSMA 4CU7A 5F39A 5L7OC 2ZX3A 2J7MA 4XBLA 4HN0A 1RUH3 2JKXA 4MXVA 4CU8A 5AFBA 2EICA 4YW6A 5CFCB 1JBCA 1LHUA 3SISA 1BXHA 2OUHA 1W8OA 3M70A 3WY6A 3GJAA 3VDCA 5FZ0A 5GLZA 1YNAA 4LBLA 4DOUA 5FP9A 5C70A 1HW5A 4ZS2A 1UNBA 1V00A 4HLTA 3HQRA 2Y26A 1ULFA 1LEDA 3BN6A 1W8TA 1LKNA 2WA4A 1NLRA 3O0VA 4S2DA 4SLIA 1ND2A 5FO7B 1OD5A 4P14A 3AK0A 2BUKA 4PLNA 5G04L 4AHXA 2CTVA 1JYCA 2V5YA 4LBQD 1ZBE2 2RR12 1JODA 1CWPA 3I2HA 3BU7A 3WNLA 1E5SA 1H1IA 4OHZA 1I5ZA 5IVFA 5BNNB 1QJZA 2V5DA 2V72A 2LROA 4FPJA 4YG3A 1GNYA 4PHZA 1Y43B 1POV0 4N43C 2WFF3 3ZYBA 1KGYA 3ACHA 4CXYA 1ALYA 2O14A 4QXHA 3VGIA 5A6ZA 2VTXJ 1V6LA 4S2GA 2JDPA 4OHVA 3UV9A 5BNPC 4EZ4A 4LIVA 1JU4A 2DUQA 1UYYA 2G19A 5LW9A 2VVFA 2ORXA 4MGZE 4WVMA 1AX0A 1PX4A 3VBHA 2DF7A 1GOFA 1QNYA 4BIFA 2RG4A 4R9BA 1Y3TA 3OCPA 3GGLA 2R073 3BYWA 2C0ZA 1SDWA 4UF0A 5B2GB 4JHTA 4S2FA 1LGNA 1R083 1X8MA 2HWE2 1UX7A 2J1EA 4CA9A 1LGCA 1TVGA 2DVAA 5FZ8A 4RHV1 5FZBA 3TAYA 2ILMA 4URAA 3BTXA 3RYRA 3AP9A 1LTEA 3MICA 4PCRA 4X8NA 1DP0A 5K0UB 3RWNA 5KXDA 1YC61 4Q4X1 1YJLA 2VECA 2NMNA 4Q8KA 3X29B 2GNTA 3VHRA 1DGWX 1HQWA 3WNPA 1UY3A 2XHKA 3M8LA 1FOD3 4XHBA 2IXJA 1GICA 5FY0A 1N1YA 4L0PA 3TNQA 1C4RA 3VHNA 5A3WA 4NHMA 1T6BX 2ADDA 5KWRA 4WZCA 4RQPA 3E5UA 5T3NA 4CYDA 3EO6A 2JG8A 1YEWA 2VZTA 4J1XA 5KHGA 3CDZB 4UFKA 1RHI1 3THDA 3ZFFA 4AHYA 1RGSA 4NPLA 3WUCA 1W39A 2WAAA 2WNOA 1ENRA 4RD7A 3POBA 1VRH2 2CWMA 1W6MB 2ZEZA 2E7QA 4JGYA 2FDGA 2YXSA 4OZXA 1OVPA 4XUQA 2SLIA 2HWF1 1TME3 1NY72 2QQNA 4YSFA 4IEWA 2OA2A 4CEYA 4YW2A 1XNDA 3WCSA 4JCKA 1SLTA 4NIDA 5FPXA 3NWKA 4AZZA 3ZXEA 2D3PA 1LHOA 2JD4A 3FJSA 4Z07A 3ZFGA 2WBKA 3N3HA 1HRI3 4AI2A 1K5MC 5AVPA 5IW0A 1GQPA 5HXVA 5FYCA 1XJAA 3ORJA 1H30A 4I0AA 1YFWA 5J96B 2WO1A 4A7YA 5KXEA 3HQXA 2QNKA 4GJZA 2LTNA 5BNOB 2E51A 5A7OA 3LIGA 2ZAAA 3FZ3A 4FTBA 2EIGA 1RTVA 2XJPA 1X33A 3RJRA 3V56A 3AP7A 1B35B 4CSWA 2YHJA 1S0JA 2PLV1 4KQ7A 4Y22B 3T2PA 3KF5A 3JB8A 1RC6A 3Q8CA 1RITA 1LHNA 4DXZA 3WW3A 4XJ8A 5FZOA 4TTGA 3KV4A 1E5RA 4KNCA 5CIRA 1UU6A 5FPVA 1TZOA 1GNHA 1ZZCA 5FLJA 1UOFA 2IXIA 3H0OA 5JZGB 4RS5B 2RS32 4QDQA 5J1XA 5F7UA 1CX4A 1AR63 4YW7A 4TLFA 5F3EA 2QQVA 4Y5SA 4E27A 4MVTA 1LAJA 4WZFA 2XPJA 4EWAA 4NIGA 1OURA 3DN7A 3ACIA 2FDHA 4YPJA 1LOFC 3N36A 1KFXL 5D8AB 4H7MA 4Q4Y3 5JR2A 1OOPC 4JRAA 2VMGA 4CPBA 3K46A 3ITQA 3K48A 3VBRC 4XZPA 4AAPA 2HWD2 3G7DA 1Q5OA 1X7NA 3U07A 4RN5A 5A7SA 1YYNA 3SC7X 2Q30A 1L7LA 1UY2A 1GQGA 2XQXA 3CJIB 3N9MA 2D97A 4NRMA 4ZU4A 3CHXA 3MIGA 4AEDC 1GOHA 2H6CA 3ROUA 4YM2A 1O5LA 2XG3A 4I09A 4BWOA 2CSGA 2VOVA 4OFGA 4D3WA 3BTZA 2PN5A 4QWNA 2ZACA 1T6GC 5LATA 4AVVA 4CRQA 1DFQA 3V0BB 3ZDVA 2SBAA 2BQPA 4XHXA 3ZOIA 2I45A 4N90A 1H2KA 3AYAA 2R1BA 3IZOA 3ZFEC 3WF1A 1AYM1 5JCTA 2PHUA 3WNNA 2DFCA 4GWIA 5FK7A 1EV11 3NKTA 3T08A 1W05A 3CU7A 1QH7A 4JHZA 4N43A 5FZDA 4F3JA 4FPCA 5DUVA 1CPNA 4CTEA 5IWFA 4KWJA 4XAAA 4LIUA 3MF6A 3NJVA 2RM22 3CLPA 3TN93 4MGTA 1DCSA 2XJVA 1RUC2 1LGBA 4XMAA 2FMDA 4K1ZA 2XR4A 4LUKA 4Y20A 4NIIA 2ZJCA 4PF5A 4MHUA 5C5UA 1VB2A 3PLQA 4XILA 1YI7A 4QDRA 2Y8KA 2HWC3 4PDWC 4N8MA 1WCUA 5DDJ2 3U37A 4L2NA 1AYN1 2DCKA 1VBD1 3K3NA 1QDOA 3N9OA 1I3HA 4YZ1A 3WDTA 2P3JA 3B7MA 3GZUC 4FP3A 2VZVA 4K40A 3HIFA 2CGNA 3AMNA 4ARYA 1WLCA 2W92A 3PURA 1YFXA 3B01A 2E7TA 4LBOA 1OPMA 2BVBA 3HOBA 4YG0A 2WSVA 5LBBA 2MEV3 4AHZA 3U78A 3MYXA 1JOJA 1EPZA 2VOWA 5L9BA 4CUGA 3IKWA 1EAH1 2Y6HA 4HG6B 3RSJA 4W6WA 5CISA 3DYMA 4AWDA 2JB8A 5FUIA 3POFA 2ARXA 2YZ4A 1IGOA 1IG0A 2R32A 2GNBA 4W65A 3N4MA 3UYJA 1PO12 4O9GA 2HBUA 3OGGA 1MR5A 1S0GA 5EIYB 2W46A 1R1ZA 4AYUA 4NO4A 4OI4A 1UMHA 4QPYA 2XB6C 4E9KA 4L99A 2ZHNA 5B4XA 1V9U3 3VN4A 4COWA 3S7EA 3BUCA 3V0AB 3NV2A 2DTWA 4CDQC 5IVJA 1AXZA 5LCWL 1KS5A 5T52A 5JI9A 1NQJA 2OPWA 3FX3A 1AL22 2GMEA 1GSLA 1CAUB 3I59A 3SCFA 3AP6A 4Q4V2 1ASJ3 3ZIXA 1ZBA3 4FO9A 4QQ2A 4PBPA 2XJTA 2UYBA 1RVF1 2RJ2A 2WABA 2D5FA 3KHBA 4HPKA 1GLHA 2AACA 1VAKA 1QIQA 1MEC1 2VXRA 3VB9A 3VBOC 3W21A 3CJXA 2WFPA 1OA2A 3SH3A 4IEQA 4IEVA 2EF6A 1DLCA 2DVFA 3CL1A 2WSUA 4E2QA 4L11A 2ZS6B 3K4DA 2WT2A 3KF3A 3LFIA 2EIDA 5CKNA 3GZEA 3NL1A 3BTYA 5EXOA 5IVBA 1RUJ1 3BTAA 3J7NA 5T55A 4OYUA 1F35A 4XE9A 1I6XA 4DQAA 1M4WA 2QDNA 4QPGC 1S0DA 3ETQA 4GQ7A 4YZ2A 4DO0A 4AQSA 4XIKA 1NKGA 2X05A 3J9SA 2GH2A 4H14A 1DBNA 3O1VA 1POV3 3WF0A 2QQWA 4XF0A 4M0NA 3ZYGA 1CGPA 1MQTA 2DUPA 2UURA 4MLOA 4AVAA 2ZGTA 2CDOA 3F95A 1VBC3 4OVEA 3IDBB 2GDFA 1PO22 3MFAA 5H9PA 1HB3A 1ZZ6A 1BBT2 1FPN3 5GZDA 2ZTNA 1YLLA 1S2EA 3ZN4A 4RGAA 1LOFA 1AVBA 2CAUA 4FPOB 3C7OA 2VC9A 4LBKA 3H8RA 4HFSA 3FHQA 1JZ3A 3EXUA 2YBPA 2GZWA 3U10A 5DAWA 1U5IA 2A6YA 2ZX1A 3VBSC 4CCMA 2GALA 2VY0A 4BQ2A 5SV8A 4XUTA 3O1UA 4QD2A 4D6RA 4C8DA 3P3NA 4DS0A 2P37A 4IEYA 2WZR2 4LOSA 2R7EB 5C3OA 4LA2A 2P2KA 4N53C 4WVMB 4DUVA 4XURA 1VBB3 1HN1A 3LEIA 2VCCA 4AEDA 3UL2A 4MH0E 4B4PA 4GB31 4JKKA 4UF0B 1ACCA 1X9TA 3T30A 4YGDA 4MOAA 2PMWB 4BK4A 4Z82A 3O1TA 2XLFA 1X82A 1XE7A 4FTEA 4FQ4A 4WM7A 1RYYA 1GP4A 1XNCA 4ISRA 4QT6A 5FPAA 3H7YA 1AHSA 1O5UA 2OT7A 3PDQA 5FZ6A 3LIHA 5CFDC 5CZKA 3SLIA 5F5QA 1PMJX 2BERA 1BVP1 2P17A 3PU8A 1LHWA 4G3YC 1ZZBA 4IV3C 5I8TA 3RNSA 3KVAA 5FP3A 3SCGA 3PVBB 3ILRA 5I0TA 1PM4A 5FPUA 1OT5A 1QF3A 3WD5A 1OH4A 1WA4A 4RQPB 1DGRN 1US3A 2JG8B 1UMZA 1W2NA 1QMJA 1AJKA 4QQPA 3ES1A 1TME1 2IZWA 1S4CA 1VMJA 4HZFA 4JGYB 4UW5A 2MNGA 4XF1A 1VBA1 1UZ0A 4P9YA 2VMFA 2VNGA 5LBCA 2JDNA 5JAXA 1VAMA 5FXZA 1AUYA 2UU8A 1QOTA 1REEA 4DEQA 5IK7A 1QQP2 2WINB 1J3QA 2GAUA 4BH9A 5FAXA 4E4ZA 4IETA 2VMIA 4RHV3 4NAMA 4XJAA 4BDVB 1JI6A 2D6OX 5F8PA 4CDXB 1Q8QA 1VBE3 3S5QA 3S5AA 4Y1XA 3MZHA 3PUHA 5FO8B 4Q4X3 1R1A3 1JOBA 1REFA 2XJUA 3WNXA 2WFF2 1DGWA 1UMIA 3CKHA 3VD7A 3IAPA 2JX9A 2IVJA 4LKSA 1Y4WA 3RGBA 5F37A 4YM1A 2RS13 4XACA 3TNPB 3HEIA 2CWSA 2LS6A 3S0MA 1BYHA 1LR5A 2FMYA 3N9NA 4KL1A 3AZWA 1Q3EA 1GKBA 3MPBA 3LD8A 3WQ1A 4CDQA 1IPKA 2EAKA 5HCHA 1RHI3 1MZ6A 4YVWC 2R072 4AE2A 4XF9A 4R4ZA 5J36A 4UFLA 3WVJA 1WD4A 4A7ZA 1U5ZA 3LPGA 4D6SA 1EP0A 1F5FA 1C1LA 4Q4Y1 2BU9A 4ITCA 4NJ4A 2HWF3 4RFT0 2VMCA 3JBG2 2WLPA 4BLJA 3R4DB 4NOTA 1OF4A 3CZJA 1YO8A 4OMDA 1UL9A 2A73B 5FMBA 3SXWA 3VBOA 4RR3B 2C9AA 1OSGA 3VDDC 5CNAA 3IM0A 5FYVA 3VHOA 2KD7A 1IS4A 1HRV2 2AR6A 2RDQA 2AH2A 4C1WA 1WW5A 1FOD2 2B9VA 5BNQA 1XYNA 1ZM1A 3MIBA 4LO6B 5FYSA 3AMPA 4GWJA 4CEWC 2W52A 5KC6A 1G9DA 1Z78A 2VUJA 4RA0A 2D6MA 3N7MA 4Y3OA 2D3SA 3BPSA 3KD4A 3AZVA 3OUIA 5F6LB 4E4SA 1YIPA 1CZSA 2YU1A 4QPGA 2WZ8A 3I2OA 5EQUA 1POQA 4GULA 3NNMA 4F8AA 3B9CA 1D2QA 3BOWA 4AI1A 4ZHNA 2UWAA 2WWJA 5IUQA 4JRLA 3M3EA 4WVWA 4IERA 5DAXA 2PLV3 1J3PA 5DPNA 4QPIC 5FY1A 3ZXLA 2DTYA 4QQLA 5C9AB 1O3TA 4XPVA 1AR91 1CPMA 1JHJA 3N9QA 3OD0A 4LHLA 1TEIA 4YG6A 1D0HA 3ST7A 3PUAA 5F2SA 1H1AA 1HV1A 2DBNA 1OUSA 2P34A 1ZZ8A 2VUDA 3K3OA 4QXBA 1HRI2 1CZTA 4COUA 1ODNA 4QAWA 2GC1A 3DPRA 1MS3A 2Q8DA 1RMU1 3NSTA 3SH5A 2QBXA 3POWA 2RJKA 3PJQA 5FP4A 1PGL1 3TBDA 1QY4A 5FMDA 1YFYA 2VBBA 2HWC1 2QQUA 4QM8A 4MGIE 3H50A 1DQ4A 1S2BA 2ARCA 4N53A 3P3PA 4FQZA 1GZWA 4Y24A 2EIEA 4NHYA 2YU2A 1E5HA 1NLSA 4C91A 5FYZA 1ZX5A 2LALA 1QJX1 5BV6A 5K9YA 4INDA 3ZXKA 2ADEA 2JE7A 2MEV1 1JUHA 2CL2A 4GH4B 2R042 3VZKA 2QQOA 1TQ5A 1PK6B 4DB5A 2BOIA 4EN8B 1BK0A 4CDUC 3RZJA 2Q1FA 3D5OA 3LZZA 2JG9A 3N35A 5EV7A 5IFPA 1WKYA 1UOJA 3IBMA 3I3BA 4FFFA 1ULDA 5TSWA 1AR62 3OY8B 3MFCA 1ZREA 4FFGA 1BK1A 3AFKA 5DZGA 3K51A 2XUMA 5E89A 5JOZA 5I8SA 3SHRA 4DXTA 3QCWA 5IT6A 1O8PA 2WS92 4ASMB 1QGLA 2OKXA 4Y5TA 4YZ4A 2ZGRA 3H42B 2W68A 2WYFA 4XFBA 4C0BA 2R061 1PIV2 3T1MA 1EV13 2JD9A 4CUCA 3WNOA 4BQ1A 2ZPXA 5A80A 1L7RA 5JOXA 1NE4A 2VTFA 1UQXA 2WNUA 1DLLA 4YM3A 1SLIA 4EE2A 2RDSA 5HI0A 4OUMA 5DN2A 2RDRA 3AC0A 4AOCA 4JKMA 4Q5OA 2YUEA 4H55A 4Q4W1 4QKNA 1U0AA 1C8M3 1UY4A 2Y6JA 3HQUA 4JDOA 3LGRA 3AP5A 4WM8B 2ZGSA 1AYN3 5EYXA 1APNA 1VBD3 5FZKA 1QU0A 1YWKA 2RMU2 2A70A 2ENRA 3K4AA 3NNLA 4XFHA 2OQ7A 3J8F1 4HPKB 3WINE 4Z2AA 1NE6A 3E97A 2BFUL 3UESA 4B1MA 5C4WB 1ZBE1 2O1QA 1N1SA 2RR11 2YY1A 3DUIA 3MF9A 1O91A 2GC0A 1IS6A 2DCZA 3VBFB 4Q29A 4MUVA 2Q0AA 3BU0A 3MIEA 2BEOA 3E5QA 3H1YA 4W8JA 4FAGA 1EAH3 4PLOA 4M3CB 4HK8A 4YW4A 1COV2 2JDAA 2UYAA 1G9BA 4H7LA 4QGNA 4QX8A 4QHZA 1GWMA 3JD71 3GXUA 1DGRA 1XB9A 1RINA 2XDVA 4A6OA 1RUF1 4GXLA 5GLTA 3WF4A 2FDIA 5APAA 3FBYA 1MQTB 1V6MA 4IGPA 2NQYA 3OUJA 4YVWA 1CN1A 4HANA 4UOJA 2BP6A 2YC0A 5CG8A 1DZRA 4PLMA 1CJPA 3BKZA 2FZ2A 2AEZA 3FBMA 1ENQA 4IE7A 2JECA 2WZPP 3ZN5A 1ZYBA 2HWE1 2VR4A 3EHKA 4E2SA 4WVZA 2HEVF 5F5IA 1MS1A 4LE4A 2D44A 1VE0A 4QMAA 4Y1YA 1GZCA 1SBEA 4I0WB 1RVF3 2D40A 1VBB1 4CEWA 3USUA 4LEJA 3IPVB 3N7LA 1MEC3 5CYYA 4JV4A 4A2UA 1GZ9A 1NA1B 3E6DA 4XJUA 4P9XA 1ODMA 3DECA 2IXHA 4JVAA 1YJKA 4A45A 1Q8PA 4HVQA 2ZHLA 1RUJ3 3LAGA 4KH9A 3K75B 1QH6A 4EWDA 4IV1C 4AI8A 4QPIA 4YVSC 4B1LA 3DF0A 3DCQA 4WM7B 4H2AA 5DMYA 3KM5A 5FY5A 5FZ7A 1JMUB 4XCAA 1VRH1 4ASLA 4C90A 1W8WA 1BKZA 4XFIA 3NAPC 3OGVA 1ZBA2 2LW8A 2WJSA 4HL0A 2NYYA 1OPOA 1C5IA 4EWEA 2MPFA 3TRSB 4AFAA 1SLBA 5JVVA 3FLPA 3HJRA 1CR7A 4BOWA 2Z2SB 4RL7A 4IE4A 3ZKYA 1LEMA 5GZEA 1WW4A 5BXXA 3ZSEA 4F7ZA 3T1LA 1H8TB 1HN0A 1XSQA 1DQ6A 4R8HA 3JU9A 3KB5A 4IUGA 3BPZA 4CDWB 2YBSA 2I74A 3WV6A 1QJY1 3JB4C 2VZ1A 4LHNA 4KU7A 1CONA 3KV6A 2VZRA 1NXMA 1WBLA 4XFAA 1QOOA 2B9UA 4K20A 4D7SA 1ZA7A 3USSA 3VKOA 2DVBA 5IVCA 1P8JA 4XBNA 4QQOA 1XC6A 4GB33 4LORA 5ACA1 2VE1A 2XL9A 1WLDA 4H3WA 4ZKTB 1VBC2 1VBE1 3B5LB 5FO9B 5LB6A 2B39A 2EXJA 1R1A1 2GC3A 2R49A 3KCXA 2RS31 2ZXQA 2X29A 1IQAA 4YGBA 1FPN2 2FCUA 4Z1VA 4BXSV 4CVUA 4XQWA 2XL7A 1UF2C 2RS11 2X5IC 1CAXB 5DG1A 1QJFA 5C8CC 3FE5A 1OI6A 4BZ4A 2AUYA 3S30A 5K7PA 2ZGOA 2JDMA 3RI8A 1BEV2 3LB9A 4DY5A 4PBOA 1CIYA 2BNNA 2Q8EA 3ZM8A 1VLNA 3WP5A 3C7HA 2XBO2 5LK7B 4JX0A 4MGYE 5A1AA 4AQ2A 1HDKA 2FDFA 4M0HA 2D3RA 5CG9A 4DIQA 1NCQB 1D2SA 1JW6A 2F4LA 3T0AA 5EYYA 3RYKA 3H3UA 2PAEA 2RS51 2OS2A 3UKTA 2E32A 2ZGPA 2WNVB 4O9EA 3ILFA 2DURA 4Q26A 1CQ9A 2ZKNA 3GHNA 2WQ8A 1SZBA 2C9KA 3OF1A 4CXXA 1VBA3 3HVDA 2GSYA 4FFHA 1IKPA 1WLTA 1PHMA 4BLIA 5HBAA 3UGFA 3GCWA 3AB0A 5H9RA 1SPPA 2CGOA 5DAQA 3SNMA 2K0GA 4WVVA 4A41A 1YI9A 1ND3B 2CHHA 2PXJA 1UXXX 3ZSLA 4NRPA 1I5PA 4K7JA 1RJ7A 3TWIA 3W20A 2XLGA 1F4AA 2HYKA 3T4HB 1W90A 1W9FA 2J42A 4TLGA 3RZZA 3I3EA 2R0HA 1PMHX 3W9AA 1JZ7A 1XE0A 1C1FA 1OC1A 4PQQA 3J7LA 5J98B 3VUOA 4QHBA 3IIIA 4LOTA 2V4VA 1HIXA 3M3OA 4OULA 2P3KA 5FZMA 4U2AA 5FZLA 3LEMA 5EZWA 1WMFA 1VRBA 5FCCA 3SEPA 1NCRC 4OMCA 1PVC1 1RUC1 3T2OA 4J6GA 1FMD2 4B7KA 4AL9A 1GYKA 1AR82 1O3RA 1SFNA 4JGZC 4BK5A 1F4HA 1YQ2A 2FCVA 1OQEA 1ZZ7A 2W08A 5FY8A 3LE0A 2XH6A 4EN6B 4LE3A 5L19A 5SV5A 3ON7A 2XQRA 1EY2A 4LK6A 2ZEXA 5ABJC 3BB6A 4JZRA 4M4PA 5T54A 3ZDSA 4E4HA 3CF6E 1WMXA 3EBRA 4HK9A 3WP3A 2JE9A 2HLEA 2P4EA 1J1LA 5L7OA 3DPRB 3ALQA 4NVPA 2G9FA 1TE1B 2E53A 4I30A 2GP3A 5DQ0A 3HWJA 4XC9A 5JUVA 2L9LA 4BQ5A 1OKOA 4Y4RA 5CEHA 2HJIA 2VOTA 3A7QA 2FDJA 5EJ3A 2JJ6A 5JXGA 5A6QA 1V6NA 3GF6A 4BQ4A 1UD1A 2TBVA 3AXDA 3J4UH 2VZOA 1QXRA 4LMFA 4OQ8A 2HEYF 2PFWA 2NMOA 3URFA 4CCCA 1W6NA 3PIGA 1CZVA 3N7JA 5LA0A 5IVEA 1NT0A 3NJYA 3R0RA 4YVSA 3AJZA 1UPSA 1S1AA 1MVEA 3LSDA 2EVXA 1QJU1 2JG9B 4IE0A 4QU2A 2FD8A 1S0CA 1S0IA 2TUNA 2CNAA 4RGKA 3OEBA 2EXKA 1G8WA 2C24A 2I07B 4YLZA 3QOPA 5CFCC 1RUI2 1ZVFA 3AKQA 2QZ3A 2BV4A 2MHFA 3DKWA 3NAPA 4LXLA 4XFFA 5K8SA 3I97A 1WMDA 1AR93 2HWF2 1IOAA 4META 4NROA 3SMHA 1YRZA 3ILNA 1LOGA 4UFJA 4I2OA 1LOBA 2GMPA 2VJXA 3C2UA 3OYWA 3OG2A 3AM2A 2ZHMA 4K9SA 4TWTA 5A7WA 3THCA 5BNPA 3GBWA 3PNAA 4AG4A 1JYXA 1XU2A 2D6LX 3POJA 3NVCA 5IJRA 3ACGA 3O1SA 3MIDA 5LWBA 1NAEA 1RMU3 3QBQA 1AR72 2WNUB 2I2SA 5CVRA 3QD6A 1JYNA 1C8M1 2BVVA 2BPA2 1OBNA 1RUD2 2PHLA 3MIHA 5GJ6A 4AXOA 5BNNC 3RMYA 4IDZA 5HV0A 3L2YA 1WCSA 3ZXGA 1GOGA 2VAUA 1VP6A 4AF9A 2W47A 1OXCA 4FOWA 3GCXA 5T5JA 1QJX3 1XYOA 2A6WA 2VVEA 4B4RA 2EIBA 4IEPA 3AMQA 2AENA 2ID4A 4FFIA 2LM3A 2RHPA 2B5HA 3O0XA 3G6JB 2VM9A 5C3RA 1H2LA 3RZMA 1ZRFA 2X5IA 1GUIA 5JPMB 3M3QA 3VBUB 2R30A 4NIHA 1W04A 2KA3A 1O4TA 2WQZC 3FN9A 1UZVA 2BGOA 1HB4A 2VBDA 3FHIB 3J7HA 5FQ0A 2D6PA 1GWLA 3H9AA 5JSPA 5KR7A 3MW2A 1OLQA 4ZS3A 2ET7A 2WT0A 3JCIA 3UKVA 2P6HA 3O0WA 2HWB1 2R063 2BWCA 3H8XA 1I9RA 1O8SA 2D6KA 3I3DA 4HOOA 4O7XA 1RXFA 4P9IA 2XJSA 4B3NA 5K0UC 3HPNA 2WZR1 1W0OA 1W6PA 3WDVA 1IPJA 2WKKA 4MGSA 1JXNA 1TNRA 2VTXA 3L9JT 2ZX0A 2VZPA 4S2HA 4DY3A 1W9SA 3THTA 3WEZA 2CGPA 2A7AA 3DYPA 1DGLA 1UXZA 2DU0A 1EUTA 2ZEYA 2AZ5A 3BALA 3KGZA 1CD3G 3JQXA 3Q8EA 1K5MA 4QGLA 4DUWA 5FR3A 4Q4W3 3ZN6B 3WDYA 3ZYIB 4BISA 2YMZA 5CU1A 5C6CA 1QNWA 2VMHA 4C0HA 1HQNA 1PNFA 4A44A 2QUOA 3OGSA 4GKXA 1W3XA 5JLVA 3J8F3 3OBRA 1L3JA 2VMEA 3GM8A 3NV4A 4CPBD 1X50A 4LUMA 4D94A 5FRAA 1CESA 3B9IA 1ZBE3 2IC1A 1AYM2 2RR13 5FBJA 3KGLA 5FLHA 5FKCA 3O12A 5A6YA 2O8QA 3NV3A 1NZIA 4ZZ5A 1C8NA 1JOPA 3DKQA 3WQ0A 1NCRA 2D6NA 1URXA 5JXJA 3I2DA 2OIIA 1W6OA 4PJYA 1N1VA 2IFRA 3A21A 1K12A 1BLZA 3LFMA 4YFWA 1ND2B 2ZGKA 3VDAA 2IXCA 4QXKA 2WO7A 4JGZA 4XDPA 3RWKX 3U4XA 3JD73 3KWVA 5DAPA 1R091 2DCJA 1UPIA 2DBIA 4PI0A 1OA4A 2ZGLA 3MDPA 4WBBA 3PUIA 2OYZA 5FPLA 1RUF3 1HX6A 5FTTC 4NMIA 5ABJA 1D7PM 4V2WA 3ZX7A 5BNOC 3I2JA 1UZZA 5CAZA 1LODA 1RUG1 3VD4A 5B4NA 1AYN2 1WCDJ 1VBD2 3ATGA 3W58A 3NJZA 2KR2A 3AFGA 3APBA 3O14A 1UN1A 2WN2A 3PMEA 3KV5A 3GALA 1W2AX 3P5BA 1OOPA 3GZTB 1QQP1 3LF7A 2Y6FA 4PF1A 4YRDA 3KQRA 3VBRA 3WOGA 2WO3A 1UY1A 2HWE3 1VR3A 3TYJA 1RXGA 4NUBA 2XVGA 1EAH2 3LQCA 3RDIA 5JZGC 4RS5C 3BI3A 2ZKLA 4COZA 4MADA 4M4RA 3VBHB 5IK4A 2K2SA 4K6BA 3KV9A 4AFBA 4Q2FA 2YG0A 3AL5A 5JSRA 1LOAA 1OQ1A 4QHOA 1HB2A 1WW6A 3C7EA 4LBMA 5A6XA 3AYDA 2OVUA 3ME2A 1D4M1 1S0FA 5D8AC 4GAZA 3TEXA 1JZ5A 1S55A 5IYYA 2Y38A 3M2MA 5FYMA 3ZFEA 1OFNA 4P9JA 1W3VA 4LBNA 2CY6A 5J09A 2VVDA 2QZ2A 4EJRA 3PJYA 1C5HA 5F6KA 5IK8A 1VRH3 3KCYA 4LK7A 1ENXA 4RYDA 5LY2A 3LPFA 4R9CA 3M1HA 3CJIC 2NP0A 1PGW1 2BNOA 5AFEA 5FDBA 4D6QA 1RUH2 1YCIA 5CB7A 4AVTA 1GBGA 3WNKA 1IZ3A 4BYYA 5F5CA 3O7OA 3VKMA 1RJ8A 2NM1A 3NNFA 1WZXA 3DEMA 4GA9A 2QQMA 5AC91 1MEC2 3E6CC 3ZYRA 2XWJB 3ZFFB 1C28A 3FLRA 5A3PA 2WZEA 4PDWA 2NLRA 4JKLA 3ZXAC 5BNNA 1W2UA 4XCBA 1H9WA 3ZR6A 3MV11 4UFMA 4FI9A 4QKFA 1RUJ2 4NIAA 3BVCA 2E26A 4CEYB 4FCAA 1QJY3 2OUJA 3B00A 5IFTA 2JWPA 1AX2A 4XDQA 5FUNA 2XKPA 3O1PA 3ZFGB 3NO8A 2RE9A 1QDCA 5E8AA 5FV3A 4FBFA 1YQ8A 1UZWA 5ACA3 3D6EA 3S7IA 1FNYA 1XU1A 1DHKB 1UX6A 4ZY9A 5FJHA 3IWZA 1DYOA 2G9ZA 4N9IA 4P5HA 2V73A 1M06G 1TMF1 2RS33 3BOPA 4P08A 2H0BA 5GLVA 1XSRA 1NOVA 1SACA 3OPZA 4Z2WA 4FXKB 5FPBA 2JDKA 1KDMA 3EJKA 3PVOA 4L8QA 4Z92B 1DZQA 1OVSA 1HJFA 4ONUA 3NMBA 5FZOB 2QVSB 1O3QA 4AGRA 4AI9A 2B8MA 4JTNA 4TYSA 4XIOA 4LKDA 4N7UA 1FATA 4QB1A 4M00A 4ATEA 3POEA 1S0EA 2DU1A 3U11A 2HWD3 4OHYA 1Z7S1 2CDPA 1R082 2RS53 4Q1PA 4HXCA 3E5XA 3KVBA 3SEEA 4PIXA 1J1TA 1GU3A 3M3IA 3B02A 2VQ0A 4BIOA 1BMV1 2BWAA 1PZ9A 5L7OB 4XFCA 2CAVA 1UKGA 5L9RA 1LNSA 3IDAA 5LASA 1K3IA 5FXWA 1ULPA 4NPRA 5IK5A 1XNKA 3PIJA 4KGQA 1XNAA 1CIWA 2A3YA 3OGJA 1W6MA 3WXPA 3IMNA 2DUOA 2VCAA 2ETEA 2PAKA 4XQ4A 3RZGA 3DV8A 3EQEA 1UWWA 2BTVC 3ETPA 3ZYFA 1SHWB 1YXWA 4ET7A 1QWRA 2XGXA 3KT4A 3AKRA 1NXD1 3SITA 4LNVA 3W5NA 1AX1A 5FZ3A 5KHHA 3WHUA 5LRSA 1PIV1 2A3XA 1XXNA 2Q4SA 3MPPG 5AVAA 2Q5TA 3C7GA 1JZ6A 3GYDA 1KD7A 5L36A 3N9LA 3WW1A 2K9ZA 3RMXA 4CP9A 1SFYA 1PVC3 1RUC3 2E7AA 3OUHA 2WIIB 5GLWA 5C3QA 4ARXA 1ENSA 4DNYA 4E8CA 1TME2 3QH7A 5BNOA 4GWMA 4LJHA 1SLAA 1VBA2 3NAPB 3WQBA 4DEVA 4Y33A 4BU2A 5J7MA 1JS9A 2J1TA 2W1QA 4HKWA 4KGGA 5FZFA 5A3MA 4N43B 2WNEA 2PHDA 5JXHA 2W1SA 2J1UA 4R4XA 1CJDA 4MSVA 3HN3A 2W39A 3INAA 3VBSA 1RUE1 1SFPA 2RMU1 4UAPA 4CCNA 1HXS1 3ZYJB 4ORFA 4EN9B 3HNYM 5BNPB 1VMFA 4QKBA 4A42A 4PI2A 3O1RA 2ZMLA 1MPXA 1SMVA 4KG0A 3AJYA 4Y20B 5JZGA 5C3SA 3FUOA 4SBVA 4ES9A 2J22A 2P3IA 2XJQA 2GP5A 3WG3A 2XONA 3UK9A 5GZFA 3QACA 5DAVA 4DXRA 3S57A 2IXKA 5JIUA 3KMHA 5FMOL 4YGCA 3CIHA 2WYSA 3KQ4B 2YFZA 4W6YA 5A3TA 3ZVXA 5I0UA 1LHVA 4TZDA 5I93A 1PO13 2WRAA 1H9PA 4QX7A 3AMMA 1RL3A 5CFDA 4AFMA 5L9VA 1HLCA 1JYVA 3T2QA 2BJSA 1SQ4A 2OPKA 1A3KA 1DYPA 4IV3A 4KMQA 5EJZB 3AYCA 1QJU3 4OI1A 1SDDB 1WD3A 2JIJA 4M3CF 4OI2A 1Y9MA 3LWCA 4QB6A 3K4ZA 2ZOEB 1KFUL 4NPMA 2WC2A 4FPGA 4Q4Y2 4U36A 4A7KA 5FZ4A 4AR2A 4XJWA 2ZGNA 2BGPA 4LBQA 3U0ZA 1O4YA 1N47A 1PM7A 3FL7A 5DUUA 4MZUA 1OLMA 3V0BA 2QDRA 4FVVA 5FREA 2E31A 1MZ5A 3OBAA 1XE8A 3R4UA 1YFUA 1C3HA 1UIKA 1US2A 3AKTA 3I4IA 2N7GA 1OLME 1ZRIA 3B69A 4ISQA 1MZEA 5C33A 3WSOA 5C3PA 2PTMA 2NZ9A 2QQIA 2DFBA 3VL8A 3VZNA 1UOBA 2VNRA 1K45A 1ZNPA 3IMMA 3WW4A 1FI2A 4QPWA 3I59B 1PGSA 1KJLA 2V09A 5GZGA 1K5MB 1KRIA 3AYEA 5EJ1B 2C26A 2QQJA 3I2GA 4RQPC 3DGTA 4FPEA 2JG8C 4FT8A 1MS9A 4IGOA 5CKQA 2QQLA 3VV1A 1JYWA 1I1EA 3OEAA 4HN1A 5FLIA 2A3WA 4XMIA 3SCHA 2D98A 1N3OA 4RGGA 4JGYC 2JKBA 1AF9A 4QB2A 4AEKA 5L73A 1Y9GA 2JE8A 2XWBB 2DVGA 5LEJA 3TN92 1H4HA 1OD3A 3NNJA 1PO23 5C8WA 2DCTA 3M3CA 1YQ5A 2DDUA 3VZMA 5D21A 5FZ9A 3I3MA 3DYOA 1BBT3 4GJYA 2WN3A 4XUPA 1GFF2 3KT7A 3DXUA 1W6OB 2E33A 2YPDA 1PGL2 3LDBA 5F1RA 4NHLA 4P9GA 1OMIA 2HWC2 3NNGA 1MACA 3K2OA 3ZYPA 4CP1A 4MG2A 2WL1A 1OQDA 2QKDA 4QX1A 1JTZX 2HWB3 5HCBA 3VZOA 2VH9A 4CDXC 3ZLIA 4IE5A 3I54A 2PYTA 4BMBA 5ABJB 2WZR3 2RVAA 2BRTA 2W0XA 1A8MA 3GJBA 1QJX2 4UXAA 5FZ1A 1W2OA 4OZOA 5FXXA 1X8EA 2MEV2 2VZQA 1MS5A 1OLRA 5JMCA 5LA9A 4W6XA 5ISLA 3VDDA 1OOPB 1S0BA 2EXHA 4KU8A 3SKVA 4BQWA 5FY4A 3VBRB 2JENA 4FPYA 4AEMA 3H3ZA 3WX5A 1YQCA 5A1LA 1W8NA 2X53S 3KCCA 1W03A 1NZCA 2AEYA 1DU3D 4K1YA 3ZXFA 3DL3A 1UY0A 4IW3A 5DXDA 4LULA 4CP0A 2GH8A 2BZDA 2BYVE 2OW4A 2VQAA 2YDEA 4AEDB 5A3LA 4AFCA 1FNZA 5I8YA 3UJQA 2BNMA 4IQPA 1UOGA 2G9GA 2R062 3UETA 3LOIA 4UW4A 5H9QA 3TEZA 2NN8A 4V1PA 1V9U2 4XETA 3TEWA 1K5JA 4IEOA 4Q0SA 2Z5WA 5FP7A 2A71A 4FOQA 1J3RA 2KM2A 1XOYA 4RR3C 4AQTA 1JZ8A 2R6QA 1W99A 1A78A 1GV9A 5FBZA 1JZ4A 2IWGB 1BCXA 3ZFEB 2AYHA 3RG0A 3LEGA 5ANQA 1ASJ2 2Y0IA 3UGGA 1R093 1XRUA 1NY71 4Q4W2 4Q0QA 4ZPIA 4HBNA 2RV9A 5F9TA 1RUG3 4HKOA 4DRRA 1Y9QA 1GMMA 3SQOA 3H3LA 2G1MA 3BIWE 4QX3A 3J8F2 4CCDA 3LDRA 3T09A 3ZMOA 3OJBA 4QDSA 2HEWF 2WDBA 4X8PA 3ABZA 4TXWA 1QQP3 4BM8A 3PUQA 5C9AC 4MXWA 1O6UA 2DVDA 4PDWB 2GNDA 3PTYA 1VPHA 2B4KA 2ZABA 5J48A 4Y4YA 3RRDA 5I91A 3KLSA 2PQSA 2R1DA 3OTFA 3POYA 4E2GA 5KHIA 5LY1A 3PUSA 5JIAA 3ENRA 4BA6A 5IAXA 1VMHA 4OCTA 4YM0A 4CDUA 1QHDA 3AX4A 4HETA 4XXAA 3JD72 4EYUA 3V64A 3FMGA 1FMD1 2A5ZA 1FV2A 4E4DX 2Z79A 1AR81 1RUF2 5J37A 1FAYA 4G9SB 1D4M3 5EHDA 3I7DA 5GZCA 3I2IA 5FZGA 3EMRA 1YUDA 4IEXA 3I2KA 4JC1A 5FIXA 4ZXKA 3NV1A 2UWCA 5FZAA 4C1XA 2TNFA 3A0KA 4BHPA 1EPWA 4NHXA 4XJ9A 2VBPA 4LHKA 4LBJA 4WV8A 5A33A 3RYPA 2PHTA 2AC1A 1J59A 5JR7B 3I49A 4GH4C 4YYOA 5DZFA 1PK6C 3P1IA 5FY7A 3JBG3 3PVEA 3ZO0B 1N3PA 4KWLA 3J26N 4CU9A 2HWD1 4FXGB 3OD4A 1VBB2 5AC93 4CDQB 4LO4B 4CCJA 5JOYA 3NRUA 3Q8AA 2W5FA 5EWSA 3WDUA 4Y5Z0 1W8ZA 1H6YA 1HRV3 4NAOA 3RJ2X 3VKLA 1V6JA 3ASIA 5A7NA 3LA7A 4COVA 1G7YA 2WQ4A 2R16A 2BOJA 2CV6A 4AW7A 1V6OA 5I0DA 4NWVA 5JI7A 4V2VA 4QX0A 2QQPA 3BCWA 2VPVA 2XVLA 3ZXDA 4EZHA 3NKGA 3B94A 2BDRA 1OKQA 3LSEA 3VBOB 1V6KA 2K46A 3ZSJA 1ULEA 3D0SA 2B46X 2Y60A 3H8OA 2X8KA 3ACFA 1UU5A 1UYXA 3HMYA 3LEKA 3THPA 1RUI1 1YQ6A 2PELA 1JHNA 3M4FA 4F83A 3VZLA 1G6NA 4COYA 4ATFA 4I3GA 2BW8A 4AFDA 3OBZA 3OOXA 1O3SA 4LA3A 1WMEA 4QPGB 4RFRB 4Q0UA 1TMF3 4WM8C 2RM21 4EN0A 2F6BA 1QJEA 4HKLA 3U75A 3MV01 1UYPA 3AZZA 1T2XA 2WA3A 4BQYA 4NWWA 5A1FA 1YHFA 3FWEA 1PZ7A 5FYTA 4A3ZA 4EROA 3WP4A 1AR71 5FYIA 3HT1A 3A4UA 4CDXA 4CP9B 5T5OA 5C4WC 3T0DA 1DF0A 5EPAA 1Q8VA 4KBBA 4YZ3A 1UU4A 3VZJA 4UI9L 3VBFC 5DDJ1 1QJY2 2VO5A 1RUD1 2IUWA 4L9BA 1LECA 2VQTA 2W1UA 3JXSA 4MHRA 5FYBA 5GM0A 3IDCB 5FJKA 1SBDA 2ES3A 4X6QB 5F3IA 5F5AA 3H8UA 5J3UA 1Z7S3 3WF2A 3RZLA 3IAQA 4N7IA 1LRHA 4UW6A 5FY9A 2GMMA 3VKFC 4AQ6A 4Q27A 3VBSB 5ACA2 5HXMA 2NPIA 3B93A 3HNMA 1A8DA 4RHV2 2C6SA 1K42A 4NR1A 3ELNA 1VBE2 1DIWA 1W8HA 2R043 3EYPA 1J84A 2P6CA 4OLLA 4R52A 4D7YA 1BHGA 1R1A2 4Q4X2 2EALA 2HBTA 1MQTC 1XQNA 4XF3A 4N53B 5CBLA 2YGMA 1GZWB 1H6XA 4ES8A 1Q43A 4GZ9A 1RUNA 5A70A 4P02B 2OXBA 2RS12 2JEMA 5E1RA 1DQ1A 4B7EA 4FTSA 1HV0A 3VKNA 1VB4A 3AKPA 3BIEA 2FBEA 1PO11 2XMLA 3AP4A 1VIWB 4CCOA 2WS93 4D0QA 4IV1A 3ZYHA 2C5DA 1V0AA 1U5YA 4UFIA 3UJOA 3C8XA 4FPFA 4RR3A 2ZBJA 4JQTA 4R9DA 1WBFA 5FUPA 1PIV3 3WG1A 1RHI2 2XXZA 5A3UA 2W91A 2XKOA 3WZ1A 5CFDB 2JDUA 2A6ZA 2YBKA 2VOXA 1SCSA 1XPWA 2RS52 4IV3B 4LO8A 3ECQA 5FZCA 4KWUA 1RIRA 4B8EA 1U5XA 3BGAA 1AL21 4OQ9A 4YNIA 2W9XA 1ZA4A 2IFWA 1KQRA 1NA1C 5A3OA 3U14A 2VQUA 4Q4V1 2OZ6A 4XQDA 1AXKA 1G9FA 2VW0A 3VDBA 3GBGA 1N3QA 2OX0A 3POGA 5A3NA 3OPWA 4P9LA 3D0JA 5DABA 2YGLA 3HBKA 2D43A
chains in the Genus database with same CATH topology
1IQDC 1KGYA 3ACHA 5HPOA 1O59A 1J83A 4RYDA 1JZ2A 1JU4A 3LPFA 2QQOA 1UYYA 2ORXA 4P00B 5IFPA 2YB7A 1WKYA 3I3BA 1PX4A 3WNKA 1GOFA 3GGLA 2QQMA 4DXTA 1WCQA 2WZEA 1O8PA 2OKXA 1UX7A 2J1EA 4JKLA 1TVGA 4A4AA 3MV11 4FI9A 3T0BA 2E26A 2JD9A 1DP0A 4CUCA 3WNOA 5IFTA 1L7RA 5C71A 2VTFA 3D3AA 3WNPA 1UY3A 2WO2A 5DN2A 4L0PA 4LPLA 3AC0A 4XVHA 4JKMA 4ZY9A 1UY4A 2Y6JA 1DYOA 2VZTA 2QQKA 3CDZB 4P08A 3THDA 2WAAA 3K4AA 1W9TA 4Z2AA 2ZEZA 3CMGA 2ORZA 3UESA 4LHSA 5IHRA 3NJXA 4XUQA 3I2FA 2QQNA 4W8JA 3C7FA 4QB1A 2WBKA 1GQPA 2JDAA 4OUEA 2CDPA 5G05L 3SEEA 3GXUA 2WO1A 1GU3A 4A6OA 3WF4A 1NUKA 1LNSA 3IDAA 1K3IA 1ULPA 4UOJA 1XNAA 2XOMA 3T2PA 3WNMA 4D8MA 2VCAA 2W3JA 3ETPA 1UWWA 1TG7A 1SHWB 4ET7A 2VR4A 4TTGA 3W5NA 4QDQA 5J1XA 5F7UA 3A22A 3C7GA 4XUOA 1JZ6A 2VZUA 5CYYA 3FHAA 4ARXA 4E8CA 3ACIA 2W95A 4YPJA 3DECA 4XUNA 3WQBA 4DEVA 4A45A 5JR2A 2J1TA 3VD3A 3K75B 3K46A 2VCBA 2W1QA 4ZZ8A 4DXSA 2W1SA 2J1UA 4RN5A 3HN3A 4ZXEA 5DMYA 4UAPA 2X10A 3HNYM 1UY2A 3CQOA 2XQXA 4A42A 1GOHA 1MPXA 3WF3A 3OGVA 2LW8A 2Y64A 2J22A 2XONA 3HJRA 4DXRA 2YC4A 3CIHA 2WYSA 2VZSA 2YFZA 4KI5M 3NQHA 3WF1A 3WNNA 4GWIA 4IUGA 3T08A 4JHZA 1JYVA 3T2QA 2VZ1A 5EJZB 4KMQA 3GDBA 1R64A 3NJVA 1SDDB 2VZRA 5JMOA 4QB6A 3E1F1 3K4ZA 1P8JA 2J1SA 1XC6A 2Y6KA 3SKJE 1SG3A 4CUAA 4QDRA 2Y8KA 2VL4A 2BGPA 3U37A 2ZXQA 3FL7A 2DCKA 4BXSV 4CVUA 2E31A 2VZVA 3OBAA 2J1AA 4ARYA 1US2A 2W94A 3OB8A 2W92A 3MO4A 3WSOA 3HOBA 2QQIA 1CIYA 3ZM8A 1K45A 3C7HA 4QPWA 4JX0A 5A1AA 2Y6HA 4HG6B 1W0NA 4CU6A 3P6BA 5EJ1B 2C26A 2QQJA 3T0AA 3DYMA 3I2GA 5FUIA 2E32A 2QQLA 2Y6LA 1JYWA 3OEAA 5LA2A 5EIYB 2WQ8A 2J1VA 2W46A 2C9KA 2WUHA 1UYZA 1UMHA 4QB2A 4BJ0A 2JE8A 1OD3A 5B4XA 4A41A 2DDUA 1UXXX 3DYOA 3MUY1 2WN3A 4XUPA 5LCWL 1I5PA 2E33A 1F4AA 3I3EA 3NNGA 1PMHX 1JZ7A 4PQQA 5C7GA 4QX1A 2WAOA 3IIIA 2V4VA 1L7QA 2RJ2A 2WABA 3SEPA 2RVAA 2X09A 4OMCA 3T2OA 4OZOA 1DLCA 2VZQA 3K4DA 2EIDA 3VD5A 3SKVA 4BK5A 1F4HA 1YQ2A 1XNTA 4MO3M 3LE0A 4OYUA 1W8NA 2C4XA 2ZEXA 4M4PA 1UY0A 1NKGA 2X05A 2YFUA 2BZDA 2HLEA 3WF0A 4XZUG 2YC2A 3A23A 5DQ0A 3F2ZA 5JUVA 2CDOA 2L9LA 3UETA 1OF3A 2VOTA 3A7QA 5JXGA 1JZ8A 1W99A 2VZOA 3C7OA 2VC9A 1JZ4A 3FHQA 4PT6A 1JZ3A 1CZVA 3LEGA 2J1RA 3OGRA 5LA0A 4XUTA 4MGQA 2RV9A 2R7EB 1GMMA 3HNBM 4DUVA 4XURA 1JU3A 2W1WA 3OEBA 1HN1A 3LEIA 4QX3A 2VCCA 3T09A 4QDSA 2WDBA 4DUXA 4JKKA 3ABZA 4TXWA 3I97A 3CZUA 2VZ3A 4MOAA 4AAXA 4BK4A 2B4KA 4E8DA 1RYYA 2VJXA 3OG2A 2PQSA 3THCA 1JYXA 4AG4A 4P5YA 5IJRA 3ACGA 5CZKA 3W5MA 1PMJX 2BERA 1NAEA 1JYNA 2VMDA 2Z4FA 5IYYA 2W87A 1OT5A 1OH4A 3I2IA 3I2KA 1GOGA 1US3A 2ZEWA 2W47A 2BBAA 1NX9A 2EIBA 1UZ0A 1EUUA 2VMFA 2ID4A 3P1IA 2VM9A 1PX3A 3UNPA 2XHNA 4CU9A 1GUIA 5JXIA 3FN9A 2Y6GA 3NRUA 2BGOA 2W5FA 1GNYA 3J7HA 4LQRA 1CX1A 1H6YA 4DEQA 3EB7A 5I0DA 4BDVB 1JI6A 4QX0A 1O8SA 3I3DA 3PUHA 3MBWA 3HPNA 1UMIA 3CKHA 3VD7A 3IAPA 3ACFA 4LKSA 4MGSA 1UYXA 2VZPA 3LEKA 1W9SA 3HEIA 3WEZA 2LS6A 3DYPA 1UXZA 2ZEYA 1EUTA 4QX2A 4DUWA 3IB3A 2HYXA 1KEXA 4A44A 3MV01 4CUBA 3OGSA 1T2XA 4W50A 3GM8A 1W9WA 2VMEA 5LA1A 4A3ZA 3LPGA 3T0DA 3K77A 4W4ZA 2VMCA 1OF4A 3CZJA 4UI9L 4OMDA 4ZZ5A 3VD9A 2VO5A 5JXJA 2VQTA 2W1UA 3JXSA 1ULOA 2KD7A 3A21A 1K12A 3VDAA 2B9VA 3WF2A 3IAQA 4GWJA 5HXMA 3MUZ1 2DCJA 3HNMA 1K42A 3PUIA 1CZSA 3EYPA 1J84A 5JXHA 2WZ8A 1BHGA 1D7PM 3I2JA 4CU7A 3VD4A 2J7MA 5B4NA 1H6XA 2JKXA 4CU8A 4GZ9A 2EICA 4P02B 5DPNA 2WN2A 1W8OA 3VDCA 4PF1A 1JHJA 4D0QA 2WO3A 1UY1A 5C70A 3C8XA 3BN6A 3LQCA 2W91A 1CZTA 4MADA 4M4RA 4QAWA 1XPWA 3ECQA 5G04L 4KWUA 2YG0A 2QBXA 3BGAA 2W9XA 3I2HA 3WNLA 3C7EA 2VQUA 2V5DA 3VDBA 2V72A 1JZ5A 2EIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQD C;  1KGY A;  3ACH A;  5HPO A;  1O59 A;  1J83 A;  4RYD A;  1JZ2 A;  1JU4 A;  3LPF A;  2QQO A;  1UYY A;  2ORX A;  4P00 B;  5IFP A;  2YB7 A;  1WKY A;  3I3B A;  1PX4 A;  3WNK A;  1GOF A;  3GGL A;  2QQM A;  4DXT A;  1WCQ A;  2WZE A;  1O8P A;  2OKX A;  1UX7 A;  2J1E A;  4JKL A;  1TVG A;  4A4A A;  3MV1 1;  4FI9 A;  3T0B A;  2E26 A;  2JD9 A;  1DP0 A;  4CUC A;  3WNO A;  5IFT A;  1L7R A;  5C71 A;  2VTF A;  3D3A A;  3WNP A;  1UY3 A;  2WO2 A;  5DN2 A;  4L0P A;  4LPL A;  3AC0 A;  4XVH A;  4JKM A;  4ZY9 A;  1UY4 A;  2Y6J A;  1DYO A;  2VZT A;  2QQK A;  3CDZ B;  4P08 A;  3THD A;  2WAA A;  3K4A A;  1W9T A;  4Z2A A;  2ZEZ A;  3CMG A;  2ORZ A;  3UES A;  4LHS A;  5IHR A;  3NJX A;  4XUQ A;  3I2F A;  2QQN A;  4W8J A;  3C7F A;  4QB1 A;  2WBK A;  1GQP A;  2JDA A;  4OUE A;  2CDP A;  5G05 L;  3SEE A;  3GXU A;  2WO1 A;  1GU3 A;  4A6O A;  3WF4 A;  1NUK A;  1LNS A;  3IDA A;  1K3I A;  1ULP A;  4UOJ A;  1XNA A;  2XOM A;  3T2P A;  3WNM A;  4D8M A;  2VCA A;  2W3J A;  3ETP A;  1UWW A;  1TG7 A;  1SHW B;  4ET7 A;  2VR4 A;  4TTG A;  3W5N A;  4QDQ A;  5J1X A;  5F7U A;  3A22 A;  3C7G A;  4XUO A;  1JZ6 A;  2VZU A;  5CYY A;  3FHA A;  4ARX A;  4E8C A;  3ACI A;  2W95 A;  4YPJ A;  3DEC A;  4XUN A;  3WQB A;  4DEV A;  4A45 A;  5JR2 A;  2J1T A;  3VD3 A;  3K75 B;  3K46 A;  2VCB A;  2W1Q A;  4ZZ8 A;  4DXS A;  2W1S A;  2J1U A;  4RN5 A;  3HN3 A;  4ZXE A;  5DMY A;  4UAP A;  2X10 A;  3HNY M;  1UY2 A;  3CQO A;  2XQX A;  4A42 A;  1GOH A;  1MPX A;  3WF3 A;  3OGV A;  2LW8 A;  2Y64 A;  2J22 A;  2XON A;  3HJR A;  4DXR A;  2YC4 A;  3CIH A;  2WYS A;  2VZS A;  2YFZ A;  4KI5 M;  3NQH A;  3WF1 A;  3WNN A;  4GWI A;  4IUG A;  3T08 A;  4JHZ A;  1JYV A;  3T2Q A;  2VZ1 A;  5EJZ B;  4KMQ A;  3GDB A;  1R64 A;  3NJV A;  1SDD B;  2VZR A;  5JMO A;  4QB6 A;  3E1F 1;  3K4Z A;  1P8J A;  2J1S A;  1XC6 A;  2Y6K A;  3SKJ E;  1SG3 A;  4CUA A;  4QDR A;  2Y8K A;  2VL4 A;  2BGP A;  3U37 A;  2ZXQ A;  3FL7 A;  2DCK A;  4BXS V;  4CVU A;  2E31 A;  2VZV A;  3OBA A;  2J1A A;  4ARY A;  1US2 A;  2W94 A;  3OB8 A;  2W92 A;  3MO4 A;  3WSO A;  3HOB A;  2QQI A;  1CIY A;  3ZM8 A;  1K45 A;  3C7H A;  4QPW A;  4JX0 A;  5A1A A;  2Y6H A;  4HG6 B;  1W0N A;  4CU6 A;  3P6B A;  5EJ1 B;  2C26 A;  2QQJ A;  3T0A A;  3DYM A;  3I2G A;  5FUI A;  2E32 A;  2QQL A;  2Y6L A;  1JYW A;  3OEA A;  5LA2 A;  5EIY B;  2WQ8 A;  2J1V A;  2W46 A;  2C9K A;  2WUH A;  1UYZ A;  1UMH A;  4QB2 A;  4BJ0 A;  2JE8 A;  1OD3 A;  5B4X A;  4A41 A;  2DDU A;  1UXX X;  3DYO A;  3MUY 1;  2WN3 A;  4XUP A;  5LCW L;  1I5P A;  2E33 A;  1F4A A;  3I3E A;  3NNG A;  1PMH X;  1JZ7 A;  4PQQ A;  5C7G A;  4QX1 A;  2WAO A;  3III A;  2V4V A;  1L7Q A;  2RJ2 A;  2WAB A;  3SEP A;  2RVA A;  2X09 A;  4OMC A;  3T2O A;  4OZO A;  1DLC A;  2VZQ A;  3K4D A;  2EID A;  3VD5 A;  3SKV A;  4BK5 A;  1F4H A;  1YQ2 A;  1XNT A;  4MO3 M;  3LE0 A;  4OYU A;  1W8N A;  2C4X A;  2ZEX A;  4M4P A;  1UY0 A;  1NKG A;  2X05 A;  2YFU A;  2BZD A;  2HLE A;  3WF0 A;  4XZU G;  2YC2 A;  3A23 A;  5DQ0 A;  3F2Z A;  5JUV A;  2CDO A;  2L9L A;  3UET A;  1OF3 A;  2VOT A;  3A7Q A;  5JXG A;  1JZ8 A;  1W99 A;  2VZO A;  3C7O A;  2VC9 A;  1JZ4 A;  3FHQ A;  4PT6 A;  1JZ3 A;  1CZV A;  3LEG A;  2J1R A;  3OGR A;  5LA0 A;  4XUT A;  4MGQ A;  2RV9 A;  2R7E B;  1GMM A;  3HNB M;  4DUV A;  4XUR A;  1JU3 A;  2W1W A;  3OEB A;  1HN1 A;  3LEI A;  4QX3 A;  2VCC A;  3T09 A;  4QDS A;  2WDB A;  4DUX A;  4JKK A;  3ABZ A;  4TXW A;  3I97 A;  3CZU A;  2VZ3 A;  4MOA A;  4AAX A;  4BK4 A;  2B4K A;  4E8D A;  1RYY A;  2VJX A;  3OG2 A;  2PQS A;  3THC A;  1JYX A;  4AG4 A;  4P5Y A;  5IJR A;  3ACG A;  5CZK A;  3W5M A;  1PMJ X;  2BER A;  1NAE A;  1JYN A;  2VMD A;  2Z4F A;  5IYY A;  2W87 A;  1OT5 A;  1OH4 A;  3I2I A;  3I2K A;  1GOG A;  1US3 A;  2ZEW A;  2W47 A;  2BBA A;  1NX9 A;  2EIB A;  1UZ0 A;  1EUU A;  2VMF A;  2ID4 A;  3P1I A;  2VM9 A;  1PX3 A;  3UNP A;  2XHN A;  4CU9 A;  1GUI A;  5JXI A;  3FN9 A;  2Y6G A;  3NRU A;  2BGO A;  2W5F A;  1GNY A;  3J7H A;  4LQR A;  1CX1 A;  1H6Y A;  4DEQ A;  3EB7 A;  5I0D A;  4BDV B;  1JI6 A;  4QX0 A;  1O8S A;  3I3D A;  3PUH A;  3MBW A;  3HPN A;  1UMI A;  3CKH A;  3VD7 A;  3IAP A;  3ACF A;  4LKS A;  4MGS A;  1UYX A;  2VZP A;  3LEK A;  1W9S A;  3HEI A;  3WEZ A;  2LS6 A;  3DYP A;  1UXZ A;  2ZEY A;  1EUT A;  4QX2 A;  4DUW A;  3IB3 A;  2HYX A;  1KEX A;  4A44 A;  3MV0 1;  4CUB A;  3OGS A;  1T2X A;  4W50 A;  3GM8 A;  1W9W A;  2VME A;  5LA1 A;  4A3Z A;  3LPG A;  3T0D A;  3K77 A;  4W4Z A;  2VMC A;  1OF4 A;  3CZJ A;  4UI9 L;  4OMD A;  4ZZ5 A;  3VD9 A;  2VO5 A;  5JXJ A;  2VQT A;  2W1U A;  3JXS A;  1ULO A;  2KD7 A;  3A21 A;  1K12 A;  3VDA A;  2B9V A;  3WF2 A;  3IAQ A;  4GWJ A;  5HXM A;  3MUZ 1;  2DCJ A;  3HNM A;  1K42 A;  3PUI A;  1CZS A;  3EYP A;  1J84 A;  5JXH A;  2WZ8 A;  1BHG A;  1D7P M;  3I2J A;  4CU7 A;  3VD4 A;  2J7M A;  5B4N A;  1H6X A;  2JKX A;  4CU8 A;  4GZ9 A;  2EIC A;  4P02 B;  5DPN A;  2WN2 A;  1W8O A;  3VDC A;  4PF1 A;  1JHJ A;  4D0Q A;  2WO3 A;  1UY1 A;  5C70 A;  3C8X A;  3BN6 A;  3LQC A;  2W91 A;  1CZT A;  4MAD A;  4M4R A;  4QAW A;  1XPW A;  3ECQ A;  5G04 L;  4KWU A;  2YG0 A;  2QBX A;  3BGA A;  2W9X A;  3I2H A;  3WNL A;  3C7E A;  2VQU A;  2V5D A;  3VDB A;  2V72 A;  1JZ5 A;  2EIE A; 
#chains in the Genus database with same CATH topology
 4LBQ B;  2GC2 A;  4AVB A;  4AHW A;  1IQD C;  2EA7 A;  4XXP A;  4DIN B;  5C9A A;  1LU1 A;  4WM7 C;  3ZPY A;  1RUE 3;  2RMU 3;  2XLA A;  1O59 A;  4LTA A;  1HXS 3;  4CE8 A;  4DPN A;  5HPO A;  1VJ2 A;  3H7J A;  1D4V B;  1J83 A;  2IVI B;  4MX3 A;  2D93 A;  2Y34 A;  1JZ2 A;  4GMP 1;  1GNZ A;  1FXZ A;  4L92 A;  4P00 B;  2YB7 A;  1JYT A;  1C57 A;  5DUW A;  1W2T A;  4I02 A;  5FOJ B;  2ARA A;  2PLV 2;  5T5P A;  4BME A;  3W59 A;  1WCQ A;  4PQ9 A;  1PVC 2;  3E6B A;  4I0B A;  1COV 3;  5FP8 A;  4HSJ A;  4FP2 A;  1IS3 A;  4B29 A;  1Q8S A;  1MZF A;  1S2K A;  4FSJ A;  2DYC A;  4A4A A;  4YZ5 A;  1H8T C;  3H1M A;  2JDY A;  3T0B A;  4XBQ A;  1H1M A;  1PO2 1;  5DUX A;  4J1W A;  4CDW C;  1F31 A;  5C8C A;  2V4A A;  3FUQ A;  2WWS A;  3DXT A;  5C71 A;  1BBT 1;  3WDX A;  2PHF A;  2Y0O A;  5FWJ A;  4URT A;  3D3A A;  3D82 A;  4DFS A;  2WO2 A;  3FC0 A;  1W8F A;  1XYP A;  5A32 A;  4GH4 A;  2PA7 A;  1PK6 A;  2Q8C A;  2OZJ A;  2Y33 A;  4LPL A;  3HR9 A;  4OHW A;  3M7A A;  2FHR A;  4XVH A;  1KIT A;  4EN7 B;  5F3C A;  1JH5 A;  5I0S A;  2H0V A;  3OY8 A;  1SLL A;  5T5L A;  1PNG A;  3U4S A;  3LKJ A;  2QQK A;  3O5S A;  3PL0 A;  4Q0P A;  2LUW A;  2ARB A;  4YVW B;  3UGH A;  4BQ3 A;  3WHT A;  1AZD A;  5H9S A;  2FDK A;  5BUV A;  1GWK A;  2HKX A;  2P3Y A;  5E16 A;  3PU3 A;  1UKR A;  1W9T A;  1LU2 A;  3CEW A;  5FZE A;  3CMG A;  3O1M A;  1QXJ A;  5I0R A;  2ORZ A;  3MIF A;  4LHS A;  3WLU A;  5E6H A;  1D0G A;  3NJX A;  3I2F A;  5IHR A;  4FAH A;  1MVQ A;  1GR3 A;  4M01 A;  3AVR A;  1ZRR A;  5FMO S;  2QFE A;  3KSC A;  3H1W A;  3VDD B;  3RZH A;  2ZA9 A;  3C7F A;  1QJU 2;  4O61 A;  1LOC A;  3WQ7 A;  1W9Y A;  4XW3 A;  1NCQ C;  4ZU7 A;  3NW4 A;  1H0B A;  4CEW B;  4OUE A;  1ZRC A;  3KZ4 C;  1KJR A;  4TN7 A;  3USU B;  4GMP 0;  5FYH A;  1DZT A;  1FV3 A;  2A1X A;  1AXY A;  5G05 L;  4NE9 A;  4LIT A;  2WNV C;  3ZR5 A;  2Q1Z B;  1EV1 2;  3ZMN A;  4QX5 A;  1LUL A;  4WM8 A;  1NUK A;  4OUS A;  2BGC A;  1LB2 A;  4YW1 A;  1RUH 1;  1SEF A;  4UWD A;  2W2I A;  3UT0 A;  3ZSK A;  5FYU A;  2XOM A;  4QPI B;  2Z69 A;  2B42 B;  1ND3 C;  3WNM A;  5C4W A;  4IGQ A;  4D8M A;  1HB1 A;  2W3J A;  4LKE A;  1TG7 A;  1Q8O A;  3VBF A;  2YYO A;  2Z42 A;  1C8M 2;  3RVH A;  3S6P A;  2B45 X;  4X6R B;  3HN1 A;  4M3C A;  1UIJ A;  3LA3 A;  3RQ0 A;  1CAW A;  4XFG A;  3A22 A;  3MLJ A;  3LDK A;  1DYK A;  2VD7 A;  4O65 A;  4PIY A;  4XUO A;  1B35 C;  2VZU A;  5EFU A;  4DRV A;  3QLQ A;  4JAA A;  4M3C E;  4ASK A;  2A6X A;  1UW8 A;  2TEP A;  3FHA A;  3AKS A;  2PQQ A;  1F9K A;  1H2N A;  3T3Y A;  4K21 A;  2W95 A;  1O4Z A;  2G4I A;  4UT5 A;  4XUN A;  4LR4 A;  1RUO A;  1Z0H A;  1W6Q A;  2BFU S;  4CCE A;  4MXW B;  1CAV A;  2VGD A;  3VD3 A;  2VCB A;  4Q0V A;  5ANN A;  2ZHK A;  3AZX A;  4ZZ8 A;  2A75 A;  2FZ1 A;  1UZY A;  2VU9 A;  2WFF 1;  3B3Q E;  4DXS A;  1BQP A;  1BVV A;  3MLL A;  4ZXE A;  3WCR A;  3QH6 A;  4NRQ A;  2X10 A;  1PZ8 A;  4HON A;  3CQO A;  1NG0 A;  4BB3 A;  1FT9 A;  3MLK A;  1UAI A;  1HQL A;  4FPK A;  4CDU B;  3DPR C;  3POI A;  4Q1R A;  1SCR A;  1BJQ A;  1BEV 3;  4QM9 A;  3WF3 A;  1DQ0 A;  2HWB 2;  2Y64 A;  4EV0 A;  1F5J A;  2KXL A;  3LOB A;  1RB8 G;  5CFC A;  2XBO 3;  5CAD A;  1HJG A;  4K8F A;  5JOW A;  2ARE A;  3IPV A;  4Y1Z A;  5FXV A;  4XTP A;  4LT5 A;  2R07 1;  3AXE A;  2HH9 A;  3JQW A;  1NA1 A;  2YC4 A;  2GN3 A;  1X36 A;  4YW3 A;  2VZS A;  1R08 1;  3KHC A;  3WR0 A;  4KI5 M;  3NQH A;  5FYY A;  3MGU A;  4HVR A;  4UYB A;  2Q1M A;  4XJZ A;  5LK5 A;  1KS4 A;  3SH4 A;  3JBG 1;  2YV8 A;  2DWR A;  2VW2 A;  1RVF 2;  2DV9 A;  3GZA A;  4FPL A;  3IT8 A;  4XAE A;  3O1O A;  3Q9O A;  2EXI A;  2E63 A;  2JIC A;  3OSD A;  4NHK A;  3GDB A;  5IAV A;  1R64 A;  5IVY A;  3T4V A;  3UKN A;  5JSO A;  1HRV 1;  2JG9 C;  3A0N A;  3WW2 A;  4XF4 A;  5JMO A;  1FOD 1;  4XYX A;  3E1F 1;  2J1S A;  4GAL A;  4LKF A;  2Y6K A;  3KS7 A;  2CU5 A;  2VNV A;  3SKJ E;  2PHX A;  4YAR A;  5HCF A;  2ZMN A;  1BZW A;  1SG3 A;  4CUA A;  4G4F A;  2VL4 A;  1QEX A;  1KDK A;  4IEU A;  5FWE A;  5IVV A;  3D8C A;  4AVS A;  2VOK A;  3CO2 A;  5KHJ A;  1G9C A;  2ZZQ A;  1W8U A;  1SPP B;  1NYW A;  4YFZ A;  2H6B A;  2J1A A;  4JDM A;  1H8T A;  2JDZ A;  2W94 A;  3OB8 A;  2UY9 A;  3MO4 A;  1R09 2;  4IEZ A;  1PVX A;  1FMD 3;  2WNU C;  5K4L A;  1TNF A;  3IIA A;  4XOG A;  4RSU A;  2Q8O A;  4CDW A;  3AVS A;  3R4S A;  1AR8 3;  2D5H A;  4I01 A;  2VW1 A;  3L2H A;  4TSV A;  2WT1 A;  4HT1 T;  4LLO A;  5GAL A;  5F32 A;  2B7Y A;  1FYU A;  1RUG 2;  1ULC A;  1W0N A;  3N7K A;  4CP2 A;  1LCL A;  1HRI 1;  1ULG A;  1WLW A;  3P6B A;  4CU6 A;  3N9P A;  2FCT A;  5BPX A;  4GIQ A;  1N1T A;  2OQ6 A;  5LEK A;  3WG4 A;  2Y6L A;  1G86 A;  1PMI A;  2VUL A;  3FFQ A;  2DCY A;  5LA2 A;  5K0U A;  1RED A;  2J1V A;  2WUH A;  2ZAH A;  1E57 A;  5GKA C;  1UYZ A;  2UY8 A;  2P1B A;  4AVC A;  1X9P A;  4BJ0 A;  5JDB A;  3PMS A;  5FK8 A;  4AGV A;  5A7P A;  4PIZ A;  1ST8 A;  2A6V A;  2VG9 A;  2VNO A;  4YWA A;  3WT3 A;  1CAX A;  2O8O A;  3GNE A;  3VBU C;  4GWN A;  5KXC A;  2VCM A;  3MUY 1;  4KBZ A;  1LJ7 A;  4IES A;  4XTM A;  4HMZ A;  4GB3 2;  4QU1 A;  4AI3 A;  2ZGM A;  5A7Q A;  3ZXJ A;  4EQV A;  4QKD A;  2QE3 A;  2WWU A;  5LZ6 A;  2ATF A;  2R04 1;  3RPQ A;  1OH3 A;  2PHW A;  2ZGU A;  5C7G A;  1D4M 2;  1XNB A;  1Q56 A;  2PHR A;  2WAO A;  4JQR A;  1NCQ A;  5DZE A;  4AI0 A;  1AR6 1;  1Y7B A;  4I3P A;  1L7Q A;  2QTW B;  1OHF A;  1OFS A;  4P9W A;  5ERL A;  4AEJ A;  3GBF A;  1V70 A;  2X09 A;  4UBH A;  2WNV A;  4Y26 A;  5JPN B;  2JIG A;  4CXW A;  4GD4 A;  1OUX A;  2WS9 1;  1OA3 A;  4J25 A;  4D7T A;  4JTO A;  2R0F A;  1QKQ A;  1RUI 3;  4Q8L A;  1QXP A;  1W6N B;  1PGW 2;  3VD5 A;  3VHP A;  1XNT A;  1IS5 A;  1GAN A;  3AZY A;  4MO3 M;  4MYE A;  4IV1 B;  1HKD A;  1W06 A;  1MS8 A;  4YVS B;  5KC5 A;  1ND3 A;  1H2M A;  3OPT A;  5AC9 2;  1NLQ A;  1JN2 P;  1YIF A;  2C4X A;  5T50 A;  4CCL A;  5KXB A;  2RM2 3;  1MS0 A;  4K8R B;  2YFU A;  1QOS A;  4QQH A;  3PVN A;  3RS6 A;  1STM A;  3POS A;  4XZU G;  2VXJ A;  2O0O A;  2YC2 A;  3A23 A;  4Z8B A;  4FOV A;  2LRP A;  1GP5 A;  3VLB B;  1AR7 3;  1XBF A;  4K3U A;  3F2Z A;  3WUD A;  5IAT A;  5KBF A;  1OF3 A;  3LCP A;  5DG2 A;  1B35 A;  1ONA A;  3VL9 A;  5DDJ 3;  3KT1 A;  1H4G A;  1RUD 3;  1IKQ A;  4Y22 A;  3PTR B;  3ACL A;  3PHM A;  3OYW B;  2FQP A;  5BYN A;  5A7W B;  4KWK A;  2GU9 A;  5A33 B;  3I8T A;  2ERF A;  3MI8 A;  1JUI A;  1ND2 C;  4PT6 A;  3ES4 A;  3OGR A;  2J1R A;  4RS5 A;  4AGG A;  4IL7 A;  3MEP A;  5KHK A;  3JZV A;  1DG6 A;  4DMI A;  4BPZ A;  3I3Q A;  4XAB A;  4BCU A;  5CA6 A;  4IXL A;  4MGQ A;  4DZG A;  5M0T A;  4ZON A;  1AL0 G;  1TMF 2;  4R9A A;  5FZH A;  2ZZJ A;  3TN9 1;  3HNB M;  5EP9 A;  4BXF A;  1WCK A;  3TOJ A;  3MW4 A;  1COV 1;  2JXA A;  1JU3 A;  2RJL A;  2W1W A;  2ZGQ A;  5LBF A;  1MS4 A;  4JDN A;  5E88 A;  2ET1 A;  5D8A A;  2WLQ A;  4DUX A;  5F2W A;  4A6S A;  3C3V A;  3CZU A;  3WG2 A;  2GN7 A;  2VZ3 A;  4AAX A;  3IDE A;  1DQ5 A;  4OI0 A;  2XVK A;  1AJO A;  4E8D A;  3ZIW A;  2UWB A;  2YPJ A;  2C1F A;  1SBF A;  5CKM A;  2X5I B;  4P5Y A;  1WWY A;  1Z7S 2;  3CJI A;  5C8C B;  4GKY A;  3VBH C;  3W5M A;  1A34 A;  3T2T A;  5FQ0 B;  1WGP A;  4QGM A;  1AL2 3;  2D7F A;  5F3G A;  5FPZ A;  4CZS A;  1DQ2 A;  2AGS A;  1J58 A;  2VMD A;  2Z4F A;  5A32 B;  3TB0 A;  1BMV 2;  4MGK E;  4AK3 A;  4Q4V 3;  1CVN A;  2W87 A;  1IG3 A;  5FZI A;  1U12 A;  3LA2 A;  4BQX A;  2E6V A;  1IPS A;  2XUE A;  1O7F A;  2ZEW A;  3OBT A;  4BE3 A;  1IHM A;  2ZX2 A;  2PAM A;  3D4K A;  1W6P B;  1B09 A;  4ZU5 A;  1SLC A;  2BBA A;  1NX9 A;  3WP6 A;  4HVO A;  4GMP 3;  2ZMK A;  1EUU A;  3AMH A;  4UFH A;  1EYB A;  1AYM 3;  4XDO A;  2VUA A;  3BOD A;  1LOE A;  3FFZ A;  5FMC A;  1PX3 A;  4LO7 A;  2XHN A;  3RFR A;  1V9U 1;  3UNP A;  5JXI A;  3RZK A;  2CYF A;  5C5T A;  1NQD A;  3ZPO A;  2Y6G A;  3HT2 A;  4LQR A;  1CX1 A;  1GQH A;  4UBG A;  3HAG A;  5FOB B;  3ZFF C;  5JWP A;  1AR9 2;  2ZCW A;  1E5I A;  3CNA A;  2IXL A;  4L97 A;  4Y1V A;  1GP6 A;  1ASJ 1;  4OHX A;  3EB7 A;  4FPH A;  3JUU A;  3U1X A;  2E9Q A;  1GZT A;  5GLU A;  1ZBA 1;  2ZX4 A;  3AL6 A;  1F2N A;  2WR9 A;  2BBV A;  1DDL A;  4CEY C;  3MBW A;  3FLT A;  2YRO A;  1NCR B;  1ZRD A;  1RMU 2;  2XJR A;  1RUE 2;  3V65 A;  1A6C A;  1W0P A;  3ZFG C;  1HXS 2;  1F8V A;  2VUC A;  2JB4 A;  4IE6 A;  1VAL A;  4JGZ B;  5FFO C;  4D69 A;  4B4Q A;  1FX5 A;  4Y1U A;  3Q8F A;  4QX2 A;  5D1I A;  3IB3 A;  1W28 A;  4NN0 A;  2HYX A;  1VAV A;  3MHZ A;  4N9H A;  1F15 A;  1KEX A;  2F17 A;  3VBU A;  4QXC A;  3HBZ A;  2RDN A;  3ZKU A;  5D2A A;  1V6I A;  4CUB A;  1G9A A;  1CAW B;  1POV 1;  1ZZ9 A;  1WUV A;  2QCS B;  4LLF A;  4W50 A;  4YW5 A;  1W9W A;  5FKB A;  1H8V A;  5HV4 A;  5LA1 A;  2GNM A;  4XEZ A;  5HCA A;  1UCX A;  3K77 A;  1VBC 1;  4W4Z A;  3WDW A;  4LO5 B;  1LEN A;  4HSL A;  5BY5 A;  5LBE A;  3GHM A;  3VD9 A;  3V0A A;  1LES A;  2F4P A;  3Q8B A;  3TEY A;  1UO9 A;  1KXG A;  1FPN 1;  1W6Q B;  3IN9 A;  1ULO A;  3HD8 B;  4FOY A;  1CAV B;  4CCK A;  4KG8 A;  4MV2 A;  4YGE A;  1JYI A;  1CAU A;  2EAA A;  4A3X A;  3MUZ 1;  3CBN A;  3R6S A;  3RI9 A;  1BEV 1;  1WW7 A;  2QJV A;  3J7M A;  4UW3 A;  3ZN6 A;  3MW3 A;  2P5B A;  3R05 A;  5LRR A;  2XBO 1;  1WA6 X;  2JDH A;  3ZSM A;  4CU7 A;  5F39 A;  5L7O C;  2ZX3 A;  2J7M A;  4XBL A;  4HN0 A;  1RUH 3;  2JKX A;  4MXV A;  4CU8 A;  5AFB A;  2EIC A;  4YW6 A;  5CFC B;  1JBC A;  1LHU A;  3SIS A;  1BXH A;  2OUH A;  1W8O A;  3M70 A;  3WY6 A;  3GJA A;  3VDC A;  5FZ0 A;  5GLZ A;  1YNA A;  4LBL A;  4DOU A;  5FP9 A;  5C70 A;  1HW5 A;  4ZS2 A;  1UNB A;  1V00 A;  4HLT A;  3HQR A;  2Y26 A;  1ULF A;  1LED A;  3BN6 A;  1W8T A;  1LKN A;  2WA4 A;  1NLR A;  3O0V A;  4S2D A;  4SLI A;  1ND2 A;  5FO7 B;  1OD5 A;  4P14 A;  3AK0 A;  2BUK A;  4PLN A;  5G04 L;  4AHX A;  2CTV A;  1JYC A;  2V5Y A;  4LBQ D;  1ZBE 2;  2RR1 2;  1JOD A;  1CWP A;  3I2H A;  3BU7 A;  3WNL A;  1E5S A;  1H1I A;  4OHZ A;  1I5Z A;  5IVF A;  5BNN B;  1QJZ A;  2V5D A;  2V72 A;  2LRO A;  4FPJ A;  4YG3 A;  1GNY A;  4PHZ A;  1Y43 B;  1POV 0;  4N43 C;  2WFF 3;  3ZYB A;  1KGY A;  3ACH A;  4CXY A;  1ALY A;  2O14 A;  4QXH A;  3VGI A;  5A6Z A;  2VTX J;  1V6L A;  4S2G A;  2JDP A;  4OHV A;  3UV9 A;  5BNP C;  4EZ4 A;  4LIV A;  1JU4 A;  2DUQ A;  1UYY A;  2G19 A;  5LW9 A;  2VVF A;  2ORX A;  4MGZ E;  4WVM A;  1AX0 A;  1PX4 A;  3VBH A;  2DF7 A;  1GOF A;  1QNY A;  4BIF A;  2RG4 A;  4R9B A;  1Y3T A;  3OCP A;  3GGL A;  2R07 3;  3BYW A;  2C0Z A;  1SDW A;  4UF0 A;  5B2G B;  4JHT A;  4S2F A;  1LGN A;  1R08 3;  1X8M A;  2HWE 2;  1UX7 A;  2J1E A;  4CA9 A;  1LGC A;  1TVG A;  2DVA A;  5FZ8 A;  4RHV 1;  5FZB A;  3TAY A;  2ILM A;  4URA A;  3BTX A;  3RYR A;  3AP9 A;  1LTE A;  3MIC A;  4PCR A;  4X8N A;  1DP0 A;  5K0U B;  3RWN A;  5KXD A;  1YC6 1;  4Q4X 1;  1YJL A;  2VEC A;  2NMN A;  4Q8K A;  3X29 B;  2GNT A;  3VHR A;  1DGW X;  1HQW A;  3WNP A;  1UY3 A;  2XHK A;  3M8L A;  1FOD 3;  4XHB A;  2IXJ A;  1GIC A;  5FY0 A;  1N1Y A;  4L0P A;  3TNQ A;  1C4R A;  3VHN A;  5A3W A;  4NHM A;  1T6B X;  2ADD A;  5KWR A;  4WZC A;  4RQP A;  3E5U A;  5T3N A;  4CYD A;  3EO6 A;  2JG8 A;  1YEW A;  2VZT A;  4J1X A;  5KHG A;  3CDZ B;  4UFK A;  1RHI 1;  3THD A;  3ZFF A;  4AHY A;  1RGS A;  4NPL A;  3WUC A;  1W39 A;  2WAA A;  2WNO A;  1ENR A;  4RD7 A;  3POB A;  1VRH 2;  2CWM A;  1W6M B;  2ZEZ A;  2E7Q A;  4JGY A;  2FDG A;  2YXS A;  4OZX A;  1OVP A;  4XUQ A;  2SLI A;  2HWF 1;  1TME 3;  1NY7 2;  2QQN A;  4YSF A;  4IEW A;  2OA2 A;  4CEY A;  4YW2 A;  1XND A;  3WCS A;  4JCK A;  1SLT A;  4NID A;  5FPX A;  3NWK A;  4AZZ A;  3ZXE A;  2D3P A;  1LHO A;  2JD4 A;  3FJS A;  4Z07 A;  3ZFG A;  2WBK A;  3N3H A;  1HRI 3;  4AI2 A;  1K5M C;  5AVP A;  5IW0 A;  1GQP A;  5HXV A;  5FYC A;  1XJA A;  3ORJ A;  1H30 A;  4I0A A;  1YFW A;  5J96 B;  2WO1 A;  4A7Y A;  5KXE A;  3HQX A;  2QNK A;  4GJZ A;  2LTN A;  5BNO B;  2E51 A;  5A7O A;  3LIG A;  2ZAA A;  3FZ3 A;  4FTB A;  2EIG A;  1RTV A;  2XJP A;  1X33 A;  3RJR A;  3V56 A;  3AP7 A;  1B35 B;  4CSW A;  2YHJ A;  1S0J A;  2PLV 1;  4KQ7 A;  4Y22 B;  3T2P A;  3KF5 A;  3JB8 A;  1RC6 A;  3Q8C A;  1RIT A;  1LHN A;  4DXZ A;  3WW3 A;  4XJ8 A;  5FZO A;  4TTG A;  3KV4 A;  1E5R A;  4KNC A;  5CIR A;  1UU6 A;  5FPV A;  1TZO A;  1GNH A;  1ZZC A;  5FLJ A;  1UOF A;  2IXI A;  3H0O A;  5JZG B;  4RS5 B;  2RS3 2;  4QDQ A;  5J1X A;  5F7U A;  1CX4 A;  1AR6 3;  4YW7 A;  4TLF A;  5F3E A;  2QQV A;  4Y5S A;  4E27 A;  4MVT A;  1LAJ A;  4WZF A;  2XPJ A;  4EWA A;  4NIG A;  1OUR A;  3DN7 A;  3ACI A;  2FDH A;  4YPJ A;  1LOF C;  3N36 A;  1KFX L;  5D8A B;  4H7M A;  4Q4Y 3;  5JR2 A;  1OOP C;  4JRA A;  2VMG A;  4CPB A;  3K46 A;  3ITQ A;  3K48 A;  3VBR C;  4XZP A;  4AAP A;  2HWD 2;  3G7D A;  1Q5O A;  1X7N A;  3U07 A;  4RN5 A;  5A7S A;  1YYN A;  3SC7 X;  2Q30 A;  1L7L A;  1UY2 A;  1GQG A;  2XQX A;  3CJI B;  3N9M A;  2D97 A;  4NRM A;  4ZU4 A;  3CHX A;  3MIG A;  4AED C;  1GOH A;  2H6C A;  3ROU A;  4YM2 A;  1O5L A;  2XG3 A;  4I09 A;  4BWO A;  2CSG A;  2VOV A;  4OFG A;  4D3W A;  3BTZ A;  2PN5 A;  4QWN A;  2ZAC A;  1T6G C;  5LAT A;  4AVV A;  4CRQ A;  1DFQ A;  3V0B B;  3ZDV A;  2SBA A;  2BQP A;  4XHX A;  3ZOI A;  2I45 A;  4N90 A;  1H2K A;  3AYA A;  2R1B A;  3IZO A;  3ZFE C;  3WF1 A;  1AYM 1;  5JCT A;  2PHU A;  3WNN A;  2DFC A;  4GWI A;  5FK7 A;  1EV1 1;  3NKT A;  3T08 A;  1W05 A;  3CU7 A;  1QH7 A;  4JHZ A;  4N43 A;  5FZD A;  4F3J A;  4FPC A;  5DUV A;  1CPN A;  4CTE A;  5IWF A;  4KWJ A;  4XAA A;  4LIU A;  3MF6 A;  3NJV A;  2RM2 2;  3CLP A;  3TN9 3;  4MGT A;  1DCS A;  2XJV A;  1RUC 2;  1LGB A;  4XMA A;  2FMD A;  4K1Z A;  2XR4 A;  4LUK A;  4Y20 A;  4NII A;  2ZJC A;  4PF5 A;  4MHU A;  5C5U A;  1VB2 A;  3PLQ A;  4XIL A;  1YI7 A;  4QDR A;  2Y8K A;  2HWC 3;  4PDW C;  4N8M A;  1WCU A;  5DDJ 2;  3U37 A;  4L2N A;  1AYN 1;  2DCK A;  1VBD 1;  3K3N A;  1QDO A;  3N9O A;  1I3H A;  4YZ1 A;  3WDT A;  2P3J A;  3B7M A;  3GZU C;  4FP3 A;  2VZV A;  4K40 A;  3HIF A;  2CGN A;  3AMN A;  4ARY A;  1WLC A;  2W92 A;  3PUR A;  1YFX A;  3B01 A;  2E7T A;  4LBO A;  1OPM A;  2BVB A;  3HOB A;  4YG0 A;  2WSV A;  5LBB A;  2MEV 3;  4AHZ A;  3U78 A;  3MYX A;  1JOJ A;  1EPZ A;  2VOW A;  5L9B A;  4CUG A;  3IKW A;  1EAH 1;  2Y6H A;  4HG6 B;  3RSJ A;  4W6W A;  5CIS A;  3DYM A;  4AWD A;  2JB8 A;  5FUI A;  3POF A;  2ARX A;  2YZ4 A;  1IGO A;  1IG0 A;  2R32 A;  2GNB A;  4W65 A;  3N4M A;  3UYJ A;  1PO1 2;  4O9G A;  2HBU A;  3OGG A;  1MR5 A;  1S0G A;  5EIY B;  2W46 A;  1R1Z A;  4AYU A;  4NO4 A;  4OI4 A;  1UMH A;  4QPY A;  2XB6 C;  4E9K A;  4L99 A;  2ZHN A;  5B4X A;  1V9U 3;  3VN4 A;  4COW A;  3S7E A;  3BUC A;  3V0A B;  3NV2 A;  2DTW A;  4CDQ C;  5IVJ A;  1AXZ A;  5LCW L;  1KS5 A;  5T52 A;  5JI9 A;  1NQJ A;  2OPW A;  3FX3 A;  1AL2 2;  2GME A;  1GSL A;  1CAU B;  3I59 A;  3SCF A;  3AP6 A;  4Q4V 2;  1ASJ 3;  3ZIX A;  1ZBA 3;  4FO9 A;  4QQ2 A;  4PBP A;  2XJT A;  2UYB A;  1RVF 1;  2RJ2 A;  2WAB A;  2D5F A;  3KHB A;  4HPK A;  1GLH A;  2AAC A;  1VAK A;  1QIQ A;  1MEC 1;  2VXR A;  3VB9 A;  3VBO C;  3W21 A;  3CJX A;  2WFP A;  1OA2 A;  3SH3 A;  4IEQ A;  4IEV A;  2EF6 A;  1DLC A;  2DVF A;  3CL1 A;  2WSU A;  4E2Q A;  4L11 A;  2ZS6 B;  3K4D A;  2WT2 A;  3KF3 A;  3LFI A;  2EID A;  5CKN A;  3GZE A;  3NL1 A;  3BTY A;  5EXO A;  5IVB A;  1RUJ 1;  3BTA A;  3J7N A;  5T55 A;  4OYU A;  1F35 A;  4XE9 A;  1I6X A;  4DQA A;  1M4W A;  2QDN A;  4QPG C;  1S0D A;  3ETQ A;  4GQ7 A;  4YZ2 A;  4DO0 A;  4AQS A;  4XIK A;  1NKG A;  2X05 A;  3J9S A;  2GH2 A;  4H14 A;  1DBN A;  3O1V A;  1POV 3;  3WF0 A;  2QQW A;  4XF0 A;  4M0N A;  3ZYG A;  1CGP A;  1MQT A;  2DUP A;  2UUR A;  4MLO A;  4AVA A;  2ZGT A;  2CDO A;  3F95 A;  1VBC 3;  4OVE A;  3IDB B;  2GDF A;  1PO2 2;  3MFA A;  5H9P A;  1HB3 A;  1ZZ6 A;  1BBT 2;  1FPN 3;  5GZD A;  2ZTN A;  1YLL A;  1S2E A;  3ZN4 A;  4RGA A;  1LOF A;  1AVB A;  2CAU A;  4FPO B;  3C7O A;  2VC9 A;  4LBK A;  3H8R A;  4HFS A;  3FHQ A;  1JZ3 A;  3EXU A;  2YBP A;  2GZW A;  3U10 A;  5DAW A;  1U5I A;  2A6Y A;  2ZX1 A;  3VBS C;  4CCM A;  2GAL A;  2VY0 A;  4BQ2 A;  5SV8 A;  4XUT A;  3O1U A;  4QD2 A;  4D6R A;  4C8D A;  3P3N A;  4DS0 A;  2P37 A;  4IEY A;  2WZR 2;  4LOS A;  2R7E B;  5C3O A;  4LA2 A;  2P2K A;  4N53 C;  4WVM B;  4DUV A;  4XUR A;  1VBB 3;  1HN1 A;  3LEI A;  2VCC A;  4AED A;  3UL2 A;  4MH0 E;  4B4P A;  4GB3 1;  4JKK A;  4UF0 B;  1ACC A;  1X9T A;  3T30 A;  4YGD A;  4MOA A;  2PMW B;  4BK4 A;  4Z82 A;  3O1T A;  2XLF A;  1X82 A;  1XE7 A;  4FTE A;  4FQ4 A;  4WM7 A;  1RYY A;  1GP4 A;  1XNC A;  4ISR A;  4QT6 A;  5FPA A;  3H7Y A;  1AHS A;  1O5U A;  2OT7 A;  3PDQ A;  5FZ6 A;  3LIH A;  5CFD C;  5CZK A;  3SLI A;  5F5Q A;  1PMJ X;  2BER A;  1BVP 1;  2P17 A;  3PU8 A;  1LHW A;  4G3Y C;  1ZZB A;  4IV3 C;  5I8T A;  3RNS A;  3KVA A;  5FP3 A;  3SCG A;  3PVB B;  3ILR A;  5I0T A;  1PM4 A;  5FPU A;  1OT5 A;  1QF3 A;  3WD5 A;  1OH4 A;  1WA4 A;  4RQP B;  1DGR N;  1US3 A;  2JG8 B;  1UMZ A;  1W2N A;  1QMJ A;  1AJK A;  4QQP A;  3ES1 A;  1TME 1;  2IZW A;  1S4C A;  1VMJ A;  4HZF A;  4JGY B;  4UW5 A;  2MNG A;  4XF1 A;  1VBA 1;  1UZ0 A;  4P9Y A;  2VMF A;  2VNG A;  5LBC A;  2JDN A;  5JAX A;  1VAM A;  5FXZ A;  1AUY A;  2UU8 A;  1QOT A;  1REE A;  4DEQ A;  5IK7 A;  1QQP 2;  2WIN B;  1J3Q A;  2GAU A;  4BH9 A;  5FAX A;  4E4Z A;  4IET A;  2VMI A;  4RHV 3;  4NAM A;  4XJA A;  4BDV B;  1JI6 A;  2D6O X;  5F8P A;  4CDX B;  1Q8Q A;  1VBE 3;  3S5Q A;  3S5A A;  4Y1X A;  3MZH A;  3PUH A;  5FO8 B;  4Q4X 3;  1R1A 3;  1JOB A;  1REF A;  2XJU A;  3WNX A;  2WFF 2;  1DGW A;  1UMI A;  3CKH A;  3VD7 A;  3IAP A;  2JX9 A;  2IVJ A;  4LKS A;  1Y4W A;  3RGB A;  5F37 A;  4YM1 A;  2RS1 3;  4XAC A;  3TNP B;  3HEI A;  2CWS A;  2LS6 A;  3S0M A;  1BYH A;  1LR5 A;  2FMY A;  3N9N A;  4KL1 A;  3AZW A;  1Q3E A;  1GKB A;  3MPB A;  3LD8 A;  3WQ1 A;  4CDQ A;  1IPK A;  2EAK A;  5HCH A;  1RHI 3;  1MZ6 A;  4YVW C;  2R07 2;  4AE2 A;  4XF9 A;  4R4Z A;  5J36 A;  4UFL A;  3WVJ A;  1WD4 A;  4A7Z A;  1U5Z A;  3LPG A;  4D6S A;  1EP0 A;  1F5F A;  1C1L A;  4Q4Y 1;  2BU9 A;  4ITC A;  4NJ4 A;  2HWF 3;  4RFT 0;  2VMC A;  3JBG 2;  2WLP A;  4BLJ A;  3R4D B;  4NOT A;  1OF4 A;  3CZJ A;  1YO8 A;  4OMD A;  1UL9 A;  2A73 B;  5FMB A;  3SXW A;  3VBO A;  4RR3 B;  2C9A A;  1OSG A;  3VDD C;  5CNA A;  3IM0 A;  5FYV A;  3VHO A;  2KD7 A;  1IS4 A;  1HRV 2;  2AR6 A;  2RDQ A;  2AH2 A;  4C1W A;  1WW5 A;  1FOD 2;  2B9V A;  5BNQ A;  1XYN A;  1ZM1 A;  3MIB A;  4LO6 B;  5FYS A;  3AMP A;  4GWJ A;  4CEW C;  2W52 A;  5KC6 A;  1G9D A;  1Z78 A;  2VUJ A;  4RA0 A;  2D6M A;  3N7M A;  4Y3O A;  2D3S A;  3BPS A;  3KD4 A;  3AZV A;  3OUI A;  5F6L B;  4E4S A;  1YIP A;  1CZS A;  2YU1 A;  4QPG A;  2WZ8 A;  3I2O A;  5EQU A;  1POQ A;  4GUL A;  3NNM A;  4F8A A;  3B9C A;  1D2Q A;  3BOW A;  4AI1 A;  4ZHN A;  2UWA A;  2WWJ A;  5IUQ A;  4JRL A;  3M3E A;  4WVW A;  4IER A;  5DAX A;  2PLV 3;  1J3P A;  5DPN A;  4QPI C;  5FY1 A;  3ZXL A;  2DTY A;  4QQL A;  5C9A B;  1O3T A;  4XPV A;  1AR9 1;  1CPM A;  1JHJ A;  3N9Q A;  3OD0 A;  4LHL A;  1TEI A;  4YG6 A;  1D0H A;  3ST7 A;  3PUA A;  5F2S A;  1H1A A;  1HV1 A;  2DBN A;  1OUS A;  2P34 A;  1ZZ8 A;  2VUD A;  3K3O A;  4QXB A;  1HRI 2;  1CZT A;  4COU A;  1ODN A;  4QAW A;  2GC1 A;  3DPR A;  1MS3 A;  2Q8D A;  1RMU 1;  3NST A;  3SH5 A;  2QBX A;  3POW A;  2RJK A;  3PJQ A;  5FP4 A;  1PGL 1;  3TBD A;  1QY4 A;  5FMD A;  1YFY A;  2VBB A;  2HWC 1;  2QQU A;  4QM8 A;  4MGI E;  3H50 A;  1DQ4 A;  1S2B A;  2ARC A;  4N53 A;  3P3P A;  4FQZ A;  1GZW A;  4Y24 A;  2EIE A;  4NHY A;  2YU2 A;  1E5H A;  1NLS A;  4C91 A;  5FYZ A;  1ZX5 A;  2LAL A;  1QJX 1;  5BV6 A;  5K9Y A;  4IND A;  3ZXK A;  2ADE A;  2JE7 A;  2MEV 1;  1JUH A;  2CL2 A;  4GH4 B;  2R04 2;  3VZK A;  2QQO A;  1TQ5 A;  1PK6 B;  4DB5 A;  2BOI A;  4EN8 B;  1BK0 A;  4CDU C;  3RZJ A;  2Q1F A;  3D5O A;  3LZZ A;  2JG9 A;  3N35 A;  5EV7 A;  5IFP A;  1WKY A;  1UOJ A;  3IBM A;  3I3B A;  4FFF A;  1ULD A;  5TSW A;  1AR6 2;  3OY8 B;  3MFC A;  1ZRE A;  4FFG A;  1BK1 A;  3AFK A;  5DZG A;  3K51 A;  2XUM A;  5E89 A;  5JOZ A;  5I8S A;  3SHR A;  4DXT A;  3QCW A;  5IT6 A;  1O8P A;  2WS9 2;  4ASM B;  1QGL A;  2OKX A;  4Y5T A;  4YZ4 A;  2ZGR A;  3H42 B;  2W68 A;  2WYF A;  4XFB A;  4C0B A;  2R06 1;  1PIV 2;  3T1M A;  1EV1 3;  2JD9 A;  4CUC A;  3WNO A;  4BQ1 A;  2ZPX A;  5A80 A;  1L7R A;  5JOX A;  1NE4 A;  2VTF A;  1UQX A;  2WNU A;  1DLL A;  4YM3 A;  1SLI A;  4EE2 A;  2RDS A;  5HI0 A;  4OUM A;  5DN2 A;  2RDR A;  3AC0 A;  4AOC A;  4JKM A;  4Q5O A;  2YUE A;  4H55 A;  4Q4W 1;  4QKN A;  1U0A A;  1C8M 3;  1UY4 A;  2Y6J A;  3HQU A;  4JDO A;  3LGR A;  3AP5 A;  4WM8 B;  2ZGS A;  1AYN 3;  5EYX A;  1APN A;  1VBD 3;  5FZK A;  1QU0 A;  1YWK A;  2RMU 2;  2A70 A;  2ENR A;  3K4A A;  3NNL A;  4XFH A;  2OQ7 A;  3J8F 1;  4HPK B;  3WIN E;  4Z2A A;  1NE6 A;  3E97 A;  2BFU L;  3UES A;  4B1M A;  5C4W B;  1ZBE 1;  2O1Q A;  1N1S A;  2RR1 1;  2YY1 A;  3DUI A;  3MF9 A;  1O91 A;  2GC0 A;  1IS6 A;  2DCZ A;  3VBF B;  4Q29 A;  4MUV A;  2Q0A A;  3BU0 A;  3MIE A;  2BEO A;  3E5Q A;  3H1Y A;  4W8J A;  4FAG A;  1EAH 3;  4PLO A;  4M3C B;  4HK8 A;  4YW4 A;  1COV 2;  2JDA A;  2UYA A;  1G9B A;  4H7L A;  4QGN A;  4QX8 A;  4QHZ A;  1GWM A;  3JD7 1;  3GXU A;  1DGR A;  1XB9 A;  1RIN A;  2XDV A;  4A6O A;  1RUF 1;  4GXL A;  5GLT A;  3WF4 A;  2FDI A;  5APA A;  3FBY A;  1MQT B;  1V6M A;  4IGP A;  2NQY A;  3OUJ A;  4YVW A;  1CN1 A;  4HAN A;  4UOJ A;  2BP6 A;  2YC0 A;  5CG8 A;  1DZR A;  4PLM A;  1CJP A;  3BKZ A;  2FZ2 A;  2AEZ A;  3FBM A;  1ENQ A;  4IE7 A;  2JEC A;  2WZP P;  3ZN5 A;  1ZYB A;  2HWE 1;  2VR4 A;  3EHK A;  4E2S A;  4WVZ A;  2HEV F;  5F5I A;  1MS1 A;  4LE4 A;  2D44 A;  1VE0 A;  4QMA A;  4Y1Y A;  1GZC A;  1SBE A;  4I0W B;  1RVF 3;  2D40 A;  1VBB 1;  4CEW A;  3USU A;  4LEJ A;  3IPV B;  3N7L A;  1MEC 3;  5CYY A;  4JV4 A;  4A2U A;  1GZ9 A;  1NA1 B;  3E6D A;  4XJU A;  4P9X A;  1ODM A;  3DEC A;  2IXH A;  4JVA A;  1YJK A;  4A45 A;  1Q8P A;  4HVQ A;  2ZHL A;  1RUJ 3;  3LAG A;  4KH9 A;  3K75 B;  1QH6 A;  4EWD A;  4IV1 C;  4AI8 A;  4QPI A;  4YVS C;  4B1L A;  3DF0 A;  3DCQ A;  4WM7 B;  4H2A A;  5DMY A;  3KM5 A;  5FY5 A;  5FZ7 A;  1JMU B;  4XCA A;  1VRH 1;  4ASL A;  4C90 A;  1W8W A;  1BKZ A;  4XFI A;  3NAP C;  3OGV A;  1ZBA 2;  2LW8 A;  2WJS A;  4HL0 A;  2NYY A;  1OPO A;  1C5I A;  4EWE A;  2MPF A;  3TRS B;  4AFA A;  1SLB A;  5JVV A;  3FLP A;  3HJR A;  1CR7 A;  4BOW A;  2Z2S B;  4RL7 A;  4IE4 A;  3ZKY A;  1LEM A;  5GZE A;  1WW4 A;  5BXX A;  3ZSE A;  4F7Z A;  3T1L A;  1H8T B;  1HN0 A;  1XSQ A;  1DQ6 A;  4R8H A;  3JU9 A;  3KB5 A;  4IUG A;  3BPZ A;  4CDW B;  2YBS A;  2I74 A;  3WV6 A;  1QJY 1;  3JB4 C;  2VZ1 A;  4LHN A;  4KU7 A;  1CON A;  3KV6 A;  2VZR A;  1NXM A;  1WBL A;  4XFA A;  1QOO A;  2B9U A;  4K20 A;  4D7S A;  1ZA7 A;  3USS A;  3VKO A;  2DVB A;  5IVC A;  1P8J A;  4XBN A;  4QQO A;  1XC6 A;  4GB3 3;  4LOR A;  5ACA 1;  2VE1 A;  2XL9 A;  1WLD A;  4H3W A;  4ZKT B;  1VBC 2;  1VBE 1;  3B5L B;  5FO9 B;  5LB6 A;  2B39 A;  2EXJ A;  1R1A 1;  2GC3 A;  2R49 A;  3KCX A;  2RS3 1;  2ZXQ A;  2X29 A;  1IQA A;  4YGB A;  1FPN 2;  2FCU A;  4Z1V A;  4BXS V;  4CVU A;  4XQW A;  2XL7 A;  1UF2 C;  2RS1 1;  2X5I C;  1CAX B;  5DG1 A;  1QJF A;  5C8C C;  3FE5 A;  1OI6 A;  4BZ4 A;  2AUY A;  3S30 A;  5K7P A;  2ZGO A;  2JDM A;  3RI8 A;  1BEV 2;  3LB9 A;  4DY5 A;  4PBO A;  1CIY A;  2BNN A;  2Q8E A;  3ZM8 A;  1VLN A;  3WP5 A;  3C7H A;  2XBO 2;  5LK7 B;  4JX0 A;  4MGY E;  5A1A A;  4AQ2 A;  1HDK A;  2FDF A;  4M0H A;  2D3R A;  5CG9 A;  4DIQ A;  1NCQ B;  1D2S A;  1JW6 A;  2F4L A;  3T0A A;  5EYY A;  3RYK A;  3H3U A;  2PAE A;  2RS5 1;  2OS2 A;  3UKT A;  2E32 A;  2ZGP A;  2WNV B;  4O9E A;  3ILF A;  2DUR A;  4Q26 A;  1CQ9 A;  2ZKN A;  3GHN A;  2WQ8 A;  1SZB A;  2C9K A;  3OF1 A;  4CXX A;  1VBA 3;  3HVD A;  2GSY A;  4FFH A;  1IKP A;  1WLT A;  1PHM A;  4BLI A;  5HBA A;  3UGF A;  3GCW A;  3AB0 A;  5H9R A;  1SPP A;  2CGO A;  5DAQ A;  3SNM A;  2K0G A;  4WVV A;  4A41 A;  1YI9 A;  1ND3 B;  2CHH A;  2PXJ A;  1UXX X;  3ZSL A;  4NRP A;  1I5P A;  4K7J A;  1RJ7 A;  3TWI A;  3W20 A;  2XLG A;  1F4A A;  2HYK A;  3T4H B;  1W90 A;  1W9F A;  2J42 A;  4TLG A;  3RZZ A;  3I3E A;  2R0H A;  1PMH X;  3W9A A;  1JZ7 A;  1XE0 A;  1C1F A;  1OC1 A;  4PQQ A;  3J7L A;  5J98 B;  3VUO A;  4QHB A;  3III A;  4LOT A;  2V4V A;  1HIX A;  3M3O A;  4OUL A;  2P3K A;  5FZM A;  4U2A A;  5FZL A;  3LEM A;  5EZW A;  1WMF A;  1VRB A;  5FCC A;  3SEP A;  1NCR C;  4OMC A;  1PVC 1;  1RUC 1;  3T2O A;  4J6G A;  1FMD 2;  4B7K A;  4AL9 A;  1GYK A;  1AR8 2;  1O3R A;  1SFN A;  4JGZ C;  4BK5 A;  1F4H A;  1YQ2 A;  2FCV A;  1OQE A;  1ZZ7 A;  2W08 A;  5FY8 A;  3LE0 A;  2XH6 A;  4EN6 B;  4LE3 A;  5L19 A;  5SV5 A;  3ON7 A;  2XQR A;  1EY2 A;  4LK6 A;  2ZEX A;  5ABJ C;  3BB6 A;  4JZR A;  4M4P A;  5T54 A;  3ZDS A;  4E4H A;  3CF6 E;  1WMX A;  3EBR A;  4HK9 A;  3WP3 A;  2JE9 A;  2HLE A;  2P4E A;  1J1L A;  5L7O A;  3DPR B;  3ALQ A;  4NVP A;  2G9F A;  1TE1 B;  2E53 A;  4I30 A;  2GP3 A;  5DQ0 A;  3HWJ A;  4XC9 A;  5JUV A;  2L9L A;  4BQ5 A;  1OKO A;  4Y4R A;  5CEH A;  2HJI A;  2VOT A;  3A7Q A;  2FDJ A;  5EJ3 A;  2JJ6 A;  5JXG A;  5A6Q A;  1V6N A;  3GF6 A;  4BQ4 A;  1UD1 A;  2TBV A;  3AXD A;  3J4U H;  2VZO A;  1QXR A;  4LMF A;  4OQ8 A;  2HEY F;  2PFW A;  2NMO A;  3URF A;  4CCC A;  1W6N A;  3PIG A;  1CZV A;  3N7J A;  5LA0 A;  5IVE A;  1NT0 A;  3NJY A;  3R0R A;  4YVS A;  3AJZ A;  1UPS A;  1S1A A;  1MVE A;  3LSD A;  2EVX A;  1QJU 1;  2JG9 B;  4IE0 A;  4QU2 A;  2FD8 A;  1S0C A;  1S0I A;  2TUN A;  2CNA A;  4RGK A;  3OEB A;  2EXK A;  1G8W A;  2C24 A;  2I07 B;  4YLZ A;  3QOP A;  5CFC C;  1RUI 2;  1ZVF A;  3AKQ A;  2QZ3 A;  2BV4 A;  2MHF A;  3DKW A;  3NAP A;  4LXL A;  4XFF A;  5K8S A;  3I97 A;  1WMD A;  1AR9 3;  2HWF 2;  1IOA A;  4MET A;  4NRO A;  3SMH A;  1YRZ A;  3ILN A;  1LOG A;  4UFJ A;  4I2O A;  1LOB A;  2GMP A;  2VJX A;  3C2U A;  3OYW A;  3OG2 A;  3AM2 A;  2ZHM A;  4K9S A;  4TWT A;  5A7W A;  3THC A;  5BNP A;  3GBW A;  3PNA A;  4AG4 A;  1JYX A;  1XU2 A;  2D6L X;  3POJ A;  3NVC A;  5IJR A;  3ACG A;  3O1S A;  3MID A;  5LWB A;  1NAE A;  1RMU 3;  3QBQ A;  1AR7 2;  2WNU B;  2I2S A;  5CVR A;  3QD6 A;  1JYN A;  1C8M 1;  2BVV A;  2BPA 2;  1OBN A;  1RUD 2;  2PHL A;  3MIH A;  5GJ6 A;  4AXO A;  5BNN C;  3RMY A;  4IDZ A;  5HV0 A;  3L2Y A;  1WCS A;  3ZXG A;  1GOG A;  2VAU A;  1VP6 A;  4AF9 A;  2W47 A;  1OXC A;  4FOW A;  3GCX A;  5T5J A;  1QJX 3;  1XYO A;  2A6W A;  2VVE A;  4B4R A;  2EIB A;  4IEP A;  3AMQ A;  2AEN A;  2ID4 A;  4FFI A;  2LM3 A;  2RHP A;  2B5H A;  3O0X A;  3G6J B;  2VM9 A;  5C3R A;  1H2L A;  3RZM A;  1ZRF A;  2X5I A;  1GUI A;  5JPM B;  3M3Q A;  3VBU B;  2R30 A;  4NIH A;  1W04 A;  2KA3 A;  1O4T A;  2WQZ C;  3FN9 A;  1UZV A;  2BGO A;  1HB4 A;  2VBD A;  3FHI B;  3J7H A;  5FQ0 A;  2D6P A;  1GWL A;  3H9A A;  5JSP A;  5KR7 A;  3MW2 A;  1OLQ A;  4ZS3 A;  2ET7 A;  2WT0 A;  3JCI A;  3UKV A;  2P6H A;  3O0W A;  2HWB 1;  2R06 3;  2BWC A;  3H8X A;  1I9R A;  1O8S A;  2D6K A;  3I3D A;  4HOO A;  4O7X A;  1RXF A;  4P9I A;  2XJS A;  4B3N A;  5K0U C;  3HPN A;  2WZR 1;  1W0O A;  1W6P A;  3WDV A;  1IPJ A;  2WKK A;  4MGS A;  1JXN A;  1TNR A;  2VTX A;  3L9J T;  2ZX0 A;  2VZP A;  4S2H A;  4DY3 A;  1W9S A;  3THT A;  3WEZ A;  2CGP A;  2A7A A;  3DYP A;  1DGL A;  1UXZ A;  2DU0 A;  1EUT A;  2ZEY A;  2AZ5 A;  3BAL A;  3KGZ A;  1CD3 G;  3JQX A;  3Q8E A;  1K5M A;  4QGL A;  4DUW A;  5FR3 A;  4Q4W 3;  3ZN6 B;  3WDY A;  3ZYI B;  4BIS A;  2YMZ A;  5CU1 A;  5C6C A;  1QNW A;  2VMH A;  4C0H A;  1HQN A;  1PNF A;  4A44 A;  2QUO A;  3OGS A;  4GKX A;  1W3X A;  5JLV A;  3J8F 3;  3OBR A;  1L3J A;  2VME A;  3GM8 A;  3NV4 A;  4CPB D;  1X50 A;  4LUM A;  4D94 A;  5FRA A;  1CES A;  3B9I A;  1ZBE 3;  2IC1 A;  1AYM 2;  2RR1 3;  5FBJ A;  3KGL A;  5FLH A;  5FKC A;  3O12 A;  5A6Y A;  2O8Q A;  3NV3 A;  1NZI A;  4ZZ5 A;  1C8N A;  1JOP A;  3DKQ A;  3WQ0 A;  1NCR A;  2D6N A;  1URX A;  5JXJ A;  3I2D A;  2OII A;  1W6O A;  4PJY A;  1N1V A;  2IFR A;  3A21 A;  1K12 A;  1BLZ A;  3LFM A;  4YFW A;  1ND2 B;  2ZGK A;  3VDA A;  2IXC A;  4QXK A;  2WO7 A;  4JGZ A;  4XDP A;  3RWK X;  3U4X A;  3JD7 3;  3KWV A;  5DAP A;  1R09 1;  2DCJ A;  1UPI A;  2DBI A;  4PI0 A;  1OA4 A;  2ZGL A;  3MDP A;  4WBB A;  3PUI A;  2OYZ A;  5FPL A;  1RUF 3;  1HX6 A;  5FTT C;  4NMI A;  5ABJ A;  1D7P M;  4V2W A;  3ZX7 A;  5BNO C;  3I2J A;  1UZZ A;  5CAZ A;  1LOD A;  1RUG 1;  3VD4 A;  5B4N A;  1AYN 2;  1WCD J;  1VBD 2;  3ATG A;  3W58 A;  3NJZ A;  2KR2 A;  3AFG A;  3APB A;  3O14 A;  1UN1 A;  2WN2 A;  3PME A;  3KV5 A;  3GAL A;  1W2A X;  3P5B A;  1OOP A;  3GZT B;  1QQP 1;  3LF7 A;  2Y6F A;  4PF1 A;  4YRD A;  3KQR A;  3VBR A;  3WOG A;  2WO3 A;  1UY1 A;  2HWE 3;  1VR3 A;  3TYJ A;  1RXG A;  4NUB A;  2XVG A;  1EAH 2;  3LQC A;  3RDI A;  5JZG C;  4RS5 C;  3BI3 A;  2ZKL A;  4COZ A;  4MAD A;  4M4R A;  3VBH B;  5IK4 A;  2K2S A;  4K6B A;  3KV9 A;  4AFB A;  4Q2F A;  2YG0 A;  3AL5 A;  5JSR A;  1LOA A;  1OQ1 A;  4QHO A;  1HB2 A;  1WW6 A;  3C7E A;  4LBM A;  5A6X A;  3AYD A;  2OVU A;  3ME2 A;  1D4M 1;  1S0F A;  5D8A C;  4GAZ A;  3TEX A;  1JZ5 A;  1S55 A;  5IYY A;  2Y38 A;  3M2M A;  5FYM A;  3ZFE A;  1OFN A;  4P9J A;  1W3V A;  4LBN A;  2CY6 A;  5J09 A;  2VVD A;  2QZ2 A;  4EJR A;  3PJY A;  1C5H A;  5F6K A;  5IK8 A;  1VRH 3;  3KCY A;  4LK7 A;  1ENX A;  4RYD A;  5LY2 A;  3LPF A;  4R9C A;  3M1H A;  3CJI C;  2NP0 A;  1PGW 1;  2BNO A;  5AFE A;  5FDB A;  4D6Q A;  1RUH 2;  1YCI A;  5CB7 A;  4AVT A;  1GBG A;  3WNK A;  1IZ3 A;  4BYY A;  5F5C A;  3O7O A;  3VKM A;  1RJ8 A;  2NM1 A;  3NNF A;  1WZX A;  3DEM A;  4GA9 A;  2QQM A;  5AC9 1;  1MEC 2;  3E6C C;  3ZYR A;  2XWJ B;  3ZFF B;  1C28 A;  3FLR A;  5A3P A;  2WZE A;  4PDW A;  2NLR A;  4JKL A;  3ZXA C;  5BNN A;  1W2U A;  4XCB A;  1H9W A;  3ZR6 A;  3MV1 1;  4UFM A;  4FI9 A;  4QKF A;  1RUJ 2;  4NIA A;  3BVC A;  2E26 A;  4CEY B;  4FCA A;  1QJY 3;  2OUJ A;  3B00 A;  5IFT A;  2JWP A;  1AX2 A;  4XDQ A;  5FUN A;  2XKP A;  3O1P A;  3ZFG B;  3NO8 A;  2RE9 A;  1QDC A;  5E8A A;  5FV3 A;  4FBF A;  1YQ8 A;  1UZW A;  5ACA 3;  3D6E A;  3S7I A;  1FNY A;  1XU1 A;  1DHK B;  1UX6 A;  4ZY9 A;  5FJH A;  3IWZ A;  1DYO A;  2G9Z A;  4N9I A;  4P5H A;  2V73 A;  1M06 G;  1TMF 1;  2RS3 3;  3BOP A;  4P08 A;  2H0B A;  5GLV A;  1XSR A;  1NOV A;  1SAC A;  3OPZ A;  4Z2W A;  4FXK B;  5FPB A;  2JDK A;  1KDM A;  3EJK A;  3PVO A;  4L8Q A;  4Z92 B;  1DZQ A;  1OVS A;  1HJF A;  4ONU A;  3NMB A;  5FZO B;  2QVS B;  1O3Q A;  4AGR A;  4AI9 A;  2B8M A;  4JTN A;  4TYS A;  4XIO A;  4LKD A;  4N7U A;  1FAT A;  4QB1 A;  4M00 A;  4ATE A;  3POE A;  1S0E A;  2DU1 A;  3U11 A;  2HWD 3;  4OHY A;  1Z7S 1;  2CDP A;  1R08 2;  2RS5 3;  4Q1P A;  4HXC A;  3E5X A;  3KVB A;  3SEE A;  4PIX A;  1J1T A;  1GU3 A;  3M3I A;  3B02 A;  2VQ0 A;  4BIO A;  1BMV 1;  2BWA A;  1PZ9 A;  5L7O B;  4XFC A;  2CAV A;  1UKG A;  5L9R A;  1LNS A;  3IDA A;  5LAS A;  1K3I A;  5FXW A;  1ULP A;  4NPR A;  5IK5 A;  1XNK A;  3PIJ A;  4KGQ A;  1XNA A;  1CIW A;  2A3Y A;  3OGJ A;  1W6M A;  3WXP A;  3IMN A;  2DUO A;  2VCA A;  2ETE A;  2PAK A;  4XQ4 A;  3RZG A;  3DV8 A;  3EQE A;  1UWW A;  2BTV C;  3ETP A;  3ZYF A;  1SHW B;  1YXW A;  4ET7 A;  1QWR A;  2XGX A;  3KT4 A;  3AKR A;  1NXD 1;  3SIT A;  4LNV A;  3W5N A;  1AX1 A;  5FZ3 A;  5KHH A;  3WHU A;  5LRS A;  1PIV 1;  2A3X A;  1XXN A;  2Q4S A;  3MPP G;  5AVA A;  2Q5T A;  3C7G A;  1JZ6 A;  3GYD A;  1KD7 A;  5L36 A;  3N9L A;  3WW1 A;  2K9Z A;  3RMX A;  4CP9 A;  1SFY A;  1PVC 3;  1RUC 3;  2E7A A;  3OUH A;  2WII B;  5GLW A;  5C3Q A;  4ARX A;  1ENS A;  4DNY A;  4E8C A;  1TME 2;  3QH7 A;  5BNO A;  4GWM A;  4LJH A;  1SLA A;  1VBA 2;  3NAP B;  3WQB A;  4DEV A;  4Y33 A;  4BU2 A;  5J7M A;  1JS9 A;  2J1T A;  2W1Q A;  4HKW A;  4KGG A;  5FZF A;  5A3M A;  4N43 B;  2WNE A;  2PHD A;  5JXH A;  2W1S A;  2J1U A;  4R4X A;  1CJD A;  4MSV A;  3HN3 A;  2W39 A;  3INA A;  3VBS A;  1RUE 1;  1SFP A;  2RMU 1;  4UAP A;  4CCN A;  1HXS 1;  3ZYJ B;  4ORF A;  4EN9 B;  3HNY M;  5BNP B;  1VMF A;  4QKB A;  4A42 A;  4PI2 A;  3O1R A;  2ZML A;  1MPX A;  1SMV A;  4KG0 A;  3AJY A;  4Y20 B;  5JZG A;  5C3S A;  3FUO A;  4SBV A;  4ES9 A;  2J22 A;  2P3I A;  2XJQ A;  2GP5 A;  3WG3 A;  2XON A;  3UK9 A;  5GZF A;  3QAC A;  5DAV A;  4DXR A;  3S57 A;  2IXK A;  5JIU A;  3KMH A;  5FMO L;  4YGC A;  3CIH A;  2WYS A;  3KQ4 B;  2YFZ A;  4W6Y A;  5A3T A;  3ZVX A;  5I0U A;  1LHV A;  4TZD A;  5I93 A;  1PO1 3;  2WRA A;  1H9P A;  4QX7 A;  3AMM A;  1RL3 A;  5CFD A;  4AFM A;  5L9V A;  1HLC A;  1JYV A;  3T2Q A;  2BJS A;  1SQ4 A;  2OPK A;  1A3K A;  1DYP A;  4IV3 A;  4KMQ A;  5EJZ B;  3AYC A;  1QJU 3;  4OI1 A;  1SDD B;  1WD3 A;  2JIJ A;  4M3C F;  4OI2 A;  1Y9M A;  3LWC A;  4QB6 A;  3K4Z A;  2ZOE B;  1KFU L;  4NPM A;  2WC2 A;  4FPG A;  4Q4Y 2;  4U36 A;  4A7K A;  5FZ4 A;  4AR2 A;  4XJW A;  2ZGN A;  2BGP A;  4LBQ A;  3U0Z A;  1O4Y A;  1N47 A;  1PM7 A;  3FL7 A;  5DUU A;  4MZU A;  1OLM A;  3V0B A;  2QDR A;  4FVV A;  5FRE A;  2E31 A;  1MZ5 A;  3OBA A;  1XE8 A;  3R4U A;  1YFU A;  1C3H A;  1UIK A;  1US2 A;  3AKT A;  3I4I A;  2N7G A;  1OLM E;  1ZRI A;  3B69 A;  4ISQ A;  1MZE A;  5C33 A;  3WSO A;  5C3P A;  2PTM A;  2NZ9 A;  2QQI A;  2DFB A;  3VL8 A;  3VZN A;  1UOB A;  2VNR A;  1K45 A;  1ZNP A;  3IMM A;  3WW4 A;  1FI2 A;  4QPW A;  3I59 B;  1PGS A;  1KJL A;  2V09 A;  5GZG A;  1K5M B;  1KRI A;  3AYE A;  5EJ1 B;  2C26 A;  2QQJ A;  3I2G A;  4RQP C;  3DGT A;  4FPE A;  2JG8 C;  4FT8 A;  1MS9 A;  4IGO A;  5CKQ A;  2QQL A;  3VV1 A;  1JYW A;  1I1E A;  3OEA A;  4HN1 A;  5FLI A;  2A3W A;  4XMI A;  3SCH A;  2D98 A;  1N3O A;  4RGG A;  4JGY C;  2JKB A;  1AF9 A;  4QB2 A;  4AEK A;  5L73 A;  1Y9G A;  2JE8 A;  2XWB B;  2DVG A;  5LEJ A;  3TN9 2;  1H4H A;  1OD3 A;  3NNJ A;  1PO2 3;  5C8W A;  2DCT A;  3M3C A;  1YQ5 A;  2DDU A;  3VZM A;  5D21 A;  5FZ9 A;  3I3M A;  3DYO A;  1BBT 3;  4GJY A;  2WN3 A;  4XUP A;  1GFF 2;  3KT7 A;  3DXU A;  1W6O B;  2E33 A;  2YPD A;  1PGL 2;  3LDB A;  5F1R A;  4NHL A;  4P9G A;  1OMI A;  2HWC 2;  3NNG A;  1MAC A;  3K2O A;  3ZYP A;  4CP1 A;  4MG2 A;  2WL1 A;  1OQD A;  2QKD A;  4QX1 A;  1JTZ X;  2HWB 3;  5HCB A;  3VZO A;  2VH9 A;  4CDX C;  3ZLI A;  4IE5 A;  3I54 A;  2PYT A;  4BMB A;  5ABJ B;  2WZR 3;  2RVA A;  2BRT A;  2W0X A;  1A8M A;  3GJB A;  1QJX 2;  4UXA A;  5FZ1 A;  1W2O A;  4OZO A;  5FXX A;  1X8E A;  2MEV 2;  2VZQ A;  1MS5 A;  1OLR A;  5JMC A;  5LA9 A;  4W6X A;  5ISL A;  3VDD A;  1OOP B;  1S0B A;  2EXH A;  4KU8 A;  3SKV A;  4BQW A;  5FY4 A;  3VBR B;  2JEN A;  4FPY A;  4AEM A;  3H3Z A;  3WX5 A;  1YQC A;  5A1L A;  1W8N A;  2X53 S;  3KCC A;  1W03 A;  1NZC A;  2AEY A;  1DU3 D;  4K1Y A;  3ZXF A;  3DL3 A;  1UY0 A;  4IW3 A;  5DXD A;  4LUL A;  4CP0 A;  2GH8 A;  2BZD A;  2BYV E;  2OW4 A;  2VQA A;  2YDE A;  4AED B;  5A3L A;  4AFC A;  1FNZ A;  5I8Y A;  3UJQ A;  2BNM A;  4IQP A;  1UOG A;  2G9G A;  2R06 2;  3UET A;  3LOI A;  4UW4 A;  5H9Q A;  3TEZ A;  2NN8 A;  4V1P A;  1V9U 2;  4XET A;  3TEW A;  1K5J A;  4IEO A;  4Q0S A;  2Z5W A;  5FP7 A;  2A71 A;  4FOQ A;  1J3R A;  2KM2 A;  1XOY A;  4RR3 C;  4AQT A;  1JZ8 A;  2R6Q A;  1W99 A;  1A78 A;  1GV9 A;  5FBZ A;  1JZ4 A;  2IWG B;  1BCX A;  3ZFE B;  2AYH A;  3RG0 A;  3LEG A;  5ANQ A;  1ASJ 2;  2Y0I A;  3UGG A;  1R09 3;  1XRU A;  1NY7 1;  4Q4W 2;  4Q0Q A;  4ZPI A;  4HBN A;  2RV9 A;  5F9T A;  1RUG 3;  4HKO A;  4DRR A;  1Y9Q A;  1GMM A;  3SQO A;  3H3L A;  2G1M A;  3BIW E;  4QX3 A;  3J8F 2;  4CCD A;  3LDR A;  3T09 A;  3ZMO A;  3OJB A;  4QDS A;  2HEW F;  2WDB A;  4X8P A;  3ABZ A;  4TXW A;  1QQP 3;  4BM8 A;  3PUQ A;  5C9A C;  4MXW A;  1O6U A;  2DVD A;  4PDW B;  2GND A;  3PTY A;  1VPH A;  2B4K A;  2ZAB A;  5J48 A;  4Y4Y A;  3RRD A;  5I91 A;  3KLS A;  2PQS A;  2R1D A;  3OTF A;  3POY A;  4E2G A;  5KHI A;  5LY1 A;  3PUS A;  5JIA A;  3ENR A;  4BA6 A;  5IAX A;  1VMH A;  4OCT A;  4YM0 A;  4CDU A;  1QHD A;  3AX4 A;  4HET A;  4XXA A;  3JD7 2;  4EYU A;  3V64 A;  3FMG A;  1FMD 1;  2A5Z A;  1FV2 A;  4E4D X;  2Z79 A;  1AR8 1;  1RUF 2;  5J37 A;  1FAY A;  4G9S B;  1D4M 3;  5EHD A;  3I7D A;  5GZC A;  3I2I A;  5FZG A;  3EMR A;  1YUD A;  4IEX A;  3I2K A;  4JC1 A;  5FIX A;  4ZXK A;  3NV1 A;  2UWC A;  5FZA A;  4C1X A;  2TNF A;  3A0K A;  4BHP A;  1EPW A;  4NHX A;  4XJ9 A;  2VBP A;  4LHK A;  4LBJ A;  4WV8 A;  5A33 A;  3RYP A;  2PHT A;  2AC1 A;  1J59 A;  5JR7 B;  3I49 A;  4GH4 C;  4YYO A;  5DZF A;  1PK6 C;  3P1I A;  5FY7 A;  3JBG 3;  3PVE A;  3ZO0 B;  1N3P A;  4KWL A;  3J26 N;  4CU9 A;  2HWD 1;  4FXG B;  3OD4 A;  1VBB 2;  5AC9 3;  4CDQ B;  4LO4 B;  4CCJ A;  5JOY A;  3NRU A;  3Q8A A;  2W5F A;  5EWS A;  3WDU A;  4Y5Z 0;  1W8Z A;  1H6Y A;  1HRV 3;  4NAO A;  3RJ2 X;  3VKL A;  1V6J A;  3ASI A;  5A7N A;  3LA7 A;  4COV A;  1G7Y A;  2WQ4 A;  2R16 A;  2BOJ A;  2CV6 A;  4AW7 A;  1V6O A;  5I0D A;  4NWV A;  5JI7 A;  4V2V A;  4QX0 A;  2QQP A;  3BCW A;  2VPV A;  2XVL A;  3ZXD A;  4EZH A;  3NKG A;  3B94 A;  2BDR A;  1OKQ A;  3LSE A;  3VBO B;  1V6K A;  2K46 A;  3ZSJ A;  1ULE A;  3D0S A;  2B46 X;  2Y60 A;  3H8O A;  2X8K A;  3ACF A;  1UU5 A;  1UYX A;  3HMY A;  3LEK A;  3THP A;  1RUI 1;  1YQ6 A;  2PEL A;  1JHN A;  3M4F A;  4F83 A;  3VZL A;  1G6N A;  4COY A;  4ATF A;  4I3G A;  2BW8 A;  4AFD A;  3OBZ A;  3OOX A;  1O3S A;  4LA3 A;  1WME A;  4QPG B;  4RFR B;  4Q0U A;  1TMF 3;  4WM8 C;  2RM2 1;  4EN0 A;  2F6B A;  1QJE A;  4HKL A;  3U75 A;  3MV0 1;  1UYP A;  3AZZ A;  1T2X A;  2WA3 A;  4BQY A;  4NWW A;  5A1F A;  1YHF A;  3FWE A;  1PZ7 A;  5FYT A;  4A3Z A;  4ERO A;  3WP4 A;  1AR7 1;  5FYI A;  3HT1 A;  3A4U A;  4CDX A;  4CP9 B;  5T5O A;  5C4W C;  3T0D A;  1DF0 A;  5EPA A;  1Q8V A;  4KBB A;  4YZ3 A;  1UU4 A;  3VZJ A;  4UI9 L;  3VBF C;  5DDJ 1;  1QJY 2;  2VO5 A;  1RUD 1;  2IUW A;  4L9B A;  1LEC A;  2VQT A;  2W1U A;  3JXS A;  4MHR A;  5FYB A;  5GM0 A;  3IDC B;  5FJK A;  1SBD A;  2ES3 A;  4X6Q B;  5F3I A;  5F5A A;  3H8U A;  5J3U A;  1Z7S 3;  3WF2 A;  3RZL A;  3IAQ A;  4N7I A;  1LRH A;  4UW6 A;  5FY9 A;  2GMM A;  3VKF C;  4AQ6 A;  4Q27 A;  3VBS B;  5ACA 2;  5HXM A;  2NPI A;  3B93 A;  3HNM A;  1A8D A;  4RHV 2;  2C6S A;  1K42 A;  4NR1 A;  3ELN A;  1VBE 2;  1DIW A;  1W8H A;  2R04 3;  3EYP A;  1J84 A;  2P6C A;  4OLL A;  4R52 A;  4D7Y A;  1BHG A;  1R1A 2;  4Q4X 2;  2EAL A;  2HBT A;  1MQT C;  1XQN A;  4XF3 A;  4N53 B;  5CBL A;  2YGM A;  1GZW B;  1H6X A;  4ES8 A;  1Q43 A;  4GZ9 A;  1RUN A;  5A70 A;  4P02 B;  2OXB A;  2RS1 2;  2JEM A;  5E1R A;  1DQ1 A;  4B7E A;  4FTS A;  1HV0 A;  3VKN A;  1VB4 A;  3AKP A;  3BIE A;  2FBE A;  1PO1 1;  2XML A;  3AP4 A;  1VIW B;  4CCO A;  2WS9 3;  4D0Q A;  4IV1 A;  3ZYH A;  2C5D A;  1V0A A;  1U5Y A;  4UFI A;  3UJO A;  3C8X A;  4FPF A;  4RR3 A;  2ZBJ A;  4JQT A;  4R9D A;  1WBF A;  5FUP A;  1PIV 3;  3WG1 A;  1RHI 2;  2XXZ A;  5A3U A;  2W91 A;  2XKO A;  3WZ1 A;  5CFD B;  2JDU A;  2A6Z A;  2YBK A;  2VOX A;  1SCS A;  1XPW A;  2RS5 2;  4IV3 B;  4LO8 A;  3ECQ A;  5FZC A;  4KWU A;  1RIR A;  4B8E A;  1U5X A;  3BGA A;  1AL2 1;  4OQ9 A;  4YNI A;  2W9X A;  1ZA4 A;  2IFW A;  1KQR A;  1NA1 C;  5A3O A;  3U14 A;  2VQU A;  4Q4V 1;  2OZ6 A;  4XQD A;  1AXK A;  1G9F A;  2VW0 A;  3VDB A;  3GBG A;  1N3Q A;  2OX0 A;  3POG A;  5A3N A;  3OPW A;  4P9L A;  3D0J A;  5DAB A;  2YGL A;  3HBK A;  2D43 A; 
#chains in the Genus database with same CATH homology
 1IQD C;  1KGY A;  3ACH A;  5HPO A;  1O59 A;  1J83 A;  4RYD A;  1JZ2 A;  1JU4 A;  3LPF A;  2QQO A;  1UYY A;  2ORX A;  4P00 B;  5IFP A;  2YB7 A;  1WKY A;  3I3B A;  1PX4 A;  3WNK A;  1GOF A;  3GGL A;  2QQM A;  4DXT A;  1WCQ A;  2WZE A;  1O8P A;  2OKX A;  1UX7 A;  2J1E A;  4JKL A;  1TVG A;  4A4A A;  3MV1 1;  4FI9 A;  3T0B A;  2E26 A;  2JD9 A;  1DP0 A;  4CUC A;  3WNO A;  5IFT A;  1L7R A;  5C71 A;  2VTF A;  3D3A A;  3WNP A;  1UY3 A;  2WO2 A;  5DN2 A;  4L0P A;  4LPL A;  3AC0 A;  4XVH A;  4JKM A;  4ZY9 A;  1UY4 A;  2Y6J A;  1DYO A;  2VZT A;  2QQK A;  3CDZ B;  4P08 A;  3THD A;  2WAA A;  3K4A A;  1W9T A;  4Z2A A;  2ZEZ A;  3CMG A;  2ORZ A;  3UES A;  4LHS A;  5IHR A;  3NJX A;  4XUQ A;  3I2F A;  2QQN A;  4W8J A;  3C7F A;  4QB1 A;  2WBK A;  1GQP A;  2JDA A;  4OUE A;  2CDP A;  5G05 L;  3SEE A;  3GXU A;  2WO1 A;  1GU3 A;  4A6O A;  3WF4 A;  1NUK A;  1LNS A;  3IDA A;  1K3I A;  1ULP A;  4UOJ A;  1XNA A;  2XOM A;  3T2P A;  3WNM A;  4D8M A;  2VCA A;  2W3J A;  3ETP A;  1UWW A;  1TG7 A;  1SHW B;  4ET7 A;  2VR4 A;  4TTG A;  3W5N A;  4QDQ A;  5J1X A;  5F7U A;  3A22 A;  3C7G A;  4XUO A;  1JZ6 A;  2VZU A;  5CYY A;  3FHA A;  4ARX A;  4E8C A;  3ACI A;  2W95 A;  4YPJ A;  3DEC A;  4XUN A;  3WQB A;  4DEV A;  4A45 A;  5JR2 A;  2J1T A;  3VD3 A;  3K75 B;  3K46 A;  2VCB A;  2W1Q A;  4ZZ8 A;  4DXS A;  2W1S A;  2J1U A;  4RN5 A;  3HN3 A;  4ZXE A;  5DMY A;  4UAP A;  2X10 A;  3HNY M;  1UY2 A;  3CQO A;  2XQX A;  4A42 A;  1GOH A;  1MPX A;  3WF3 A;  3OGV A;  2LW8 A;  2Y64 A;  2J22 A;  2XON A;  3HJR A;  4DXR A;  2YC4 A;  3CIH A;  2WYS A;  2VZS A;  2YFZ A;  4KI5 M;  3NQH A;  3WF1 A;  3WNN A;  4GWI A;  4IUG A;  3T08 A;  4JHZ A;  1JYV A;  3T2Q A;  2VZ1 A;  5EJZ B;  4KMQ A;  3GDB A;  1R64 A;  3NJV A;  1SDD B;  2VZR A;  5JMO A;  4QB6 A;  3E1F 1;  3K4Z A;  1P8J A;  2J1S A;  1XC6 A;  2Y6K A;  3SKJ E;  1SG3 A;  4CUA A;  4QDR A;  2Y8K A;  2VL4 A;  2BGP A;  3U37 A;  2ZXQ A;  3FL7 A;  2DCK A;  4BXS V;  4CVU A;  2E31 A;  2VZV A;  3OBA A;  2J1A A;  4ARY A;  1US2 A;  2W94 A;  3OB8 A;  2W92 A;  3MO4 A;  3WSO A;  3HOB A;  2QQI A;  1CIY A;  3ZM8 A;  1K45 A;  3C7H A;  4QPW A;  4JX0 A;  5A1A A;  2Y6H A;  4HG6 B;  1W0N A;  4CU6 A;  3P6B A;  5EJ1 B;  2C26 A;  2QQJ A;  3T0A A;  3DYM A;  3I2G A;  5FUI A;  2E32 A;  2QQL A;  2Y6L A;  1JYW A;  3OEA A;  5LA2 A;  5EIY B;  2WQ8 A;  2J1V A;  2W46 A;  2C9K A;  2WUH A;  1UYZ A;  1UMH A;  4QB2 A;  4BJ0 A;  2JE8 A;  1OD3 A;  5B4X A;  4A41 A;  2DDU A;  1UXX X;  3DYO A;  3MUY 1;  2WN3 A;  4XUP A;  5LCW L;  1I5P A;  2E33 A;  1F4A A;  3I3E A;  3NNG A;  1PMH X;  1JZ7 A;  4PQQ A;  5C7G A;  4QX1 A;  2WAO A;  3III A;  2V4V A;  1L7Q A;  2RJ2 A;  2WAB A;  3SEP A;  2RVA A;  2X09 A;  4OMC A;  3T2O A;  4OZO A;  1DLC A;  2VZQ A;  3K4D A;  2EID A;  3VD5 A;  3SKV A;  4BK5 A;  1F4H A;  1YQ2 A;  1XNT A;  4MO3 M;  3LE0 A;  4OYU A;  1W8N A;  2C4X A;  2ZEX A;  4M4P A;  1UY0 A;  1NKG A;  2X05 A;  2YFU A;  2BZD A;  2HLE A;  3WF0 A;  4XZU G;  2YC2 A;  3A23 A;  5DQ0 A;  3F2Z A;  5JUV A;  2CDO A;  2L9L A;  3UET A;  1OF3 A;  2VOT A;  3A7Q A;  5JXG A;  1JZ8 A;  1W99 A;  2VZO A;  3C7O A;  2VC9 A;  1JZ4 A;  3FHQ A;  4PT6 A;  1JZ3 A;  1CZV A;  3LEG A;  2J1R A;  3OGR A;  5LA0 A;  4XUT A;  4MGQ A;  2RV9 A;  2R7E B;  1GMM A;  3HNB M;  4DUV A;  4XUR A;  1JU3 A;  2W1W A;  3OEB A;  1HN1 A;  3LEI A;  4QX3 A;  2VCC A;  3T09 A;  4QDS A;  2WDB A;  4DUX A;  4JKK A;  3ABZ A;  4TXW A;  3I97 A;  3CZU A;  2VZ3 A;  4MOA A;  4AAX A;  4BK4 A;  2B4K A;  4E8D A;  1RYY A;  2VJX A;  3OG2 A;  2PQS A;  3THC A;  1JYX A;  4AG4 A;  4P5Y A;  5IJR A;  3ACG A;  5CZK A;  3W5M A;  1PMJ X;  2BER A;  1NAE A;  1JYN A;  2VMD A;  2Z4F A;  5IYY A;  2W87 A;  1OT5 A;  1OH4 A;  3I2I A;  3I2K A;  1GOG A;  1US3 A;  2ZEW A;  2W47 A;  2BBA A;  1NX9 A;  2EIB A;  1UZ0 A;  1EUU A;  2VMF A;  2ID4 A;  3P1I A;  2VM9 A;  1PX3 A;  3UNP A;  2XHN A;  4CU9 A;  1GUI A;  5JXI A;  3FN9 A;  2Y6G A;  3NRU A;  2BGO A;  2W5F A;  1GNY A;  3J7H A;  4LQR A;  1CX1 A;  1H6Y A;  4DEQ A;  3EB7 A;  5I0D A;  4BDV B;  1JI6 A;  4QX0 A;  1O8S A;  3I3D A;  3PUH A;  3MBW A;  3HPN A;  1UMI A;  3CKH A;  3VD7 A;  3IAP A;  3ACF A;  4LKS A;  4MGS A;  1UYX A;  2VZP A;  3LEK A;  1W9S A;  3HEI A;  3WEZ A;  2LS6 A;  3DYP A;  1UXZ A;  2ZEY A;  1EUT A;  4QX2 A;  4DUW A;  3IB3 A;  2HYX A;  1KEX A;  4A44 A;  3MV0 1;  4CUB A;  3OGS A;  1T2X A;  4W50 A;  3GM8 A;  1W9W A;  2VME A;  5LA1 A;  4A3Z A;  3LPG A;  3T0D A;  3K77 A;  4W4Z A;  2VMC A;  1OF4 A;  3CZJ A;  4UI9 L;  4OMD A;  4ZZ5 A;  3VD9 A;  2VO5 A;  5JXJ A;  2VQT A;  2W1U A;  3JXS A;  1ULO A;  2KD7 A;  3A21 A;  1K12 A;  3VDA A;  2B9V A;  3WF2 A;  3IAQ A;  4GWJ A;  5HXM A;  3MUZ 1;  2DCJ A;  3HNM A;  1K42 A;  3PUI A;  1CZS A;  3EYP A;  1J84 A;  5JXH A;  2WZ8 A;  1BHG A;  1D7P M;  3I2J A;  4CU7 A;  3VD4 A;  2J7M A;  5B4N A;  1H6X A;  2JKX A;  4CU8 A;  4GZ9 A;  2EIC A;  4P02 B;  5DPN A;  2WN2 A;  1W8O A;  3VDC A;  4PF1 A;  1JHJ A;  4D0Q A;  2WO3 A;  1UY1 A;  5C70 A;  3C8X A;  3BN6 A;  3LQC A;  2W91 A;  1CZT A;  4MAD A;  4M4R A;  4QAW A;  1XPW A;  3ECQ A;  5G04 L;  4KWU A;  2YG0 A;  2QBX A;  3BGA A;  2W9X A;  3I2H A;  3WNL A;  3C7E A;  2VQU A;  2V5D A;  3VDB A;  2V72 A;  1JZ5 A;  2EIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...