1GMMA

Carbohydrate binding module cbm6 from xylanase u clostridium thermocellum
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
FSKIESEEYNSLKSSTIQTIGTSDGGSGIGYIESGDYLVFNKINFGNGANSFKARVASGADTPTNIQLRLGSPTGTLIGTLTVASTGGWNNYEEKSCSITNTTGQHDLYLVFSGPVNIDYFIFDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Xylanase
molecule keywords CBM6
publication title The Location of the Ligand-Binding Site of Carbohydrate-Binding Modules that Have Evolved from a Common Sequence is not Conserved.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 31
structure length 126
sequence length 126
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gmmA00
1UY4A 4XVHA 3NJVA 2WAOA 3CDZB 2VMFA 4QB6A 2ORXA 3ABZA 1WKYA 3K77A 4YPJA 2W9XA 1DYOA 4JX0A 4XUTA 1W8NA 4DUWA 1UYYA 2EIDA 3HPNA 3I3DA 1I5PA 3E1F1 1W9TA 2LW8A 3K46A 2WABA 1O8SA 1O8PA 2VZSA 4MADA 3I2KA 2X09A 2J1TA 5DN2A 4E8DA 1JYXA 3LQCA 1NKGA 3OGVA 1IQDC 4MGQA 3UESA 2VZTA 2ORZA 3PUHA 4XUOA 4CU8A 2DDUA 1JZ4A 3DYMA 3MUZ1 4UOJA 5IFPA 2WUHA 3OGSA 3GM8A 3A7QA 2VZUA 2JDAA 4XUPA 5J1XA 2VC9A 2YB7A 5B4XA 2DCJA 1T2XA 4OZOA 3T0AA 3MV01 3K75B 2VZ3A 4QX1A 4QX3A 1NAEA 3LEKA 2OKXA 1JZ6A 3VDAA 1H6XA 3HNMA 1W99A 1CZSA 4A4AA 2BGPA 3MUY1 2VCCA 5JXGA 3C7FA 2J1AA 2E31A 4ZZ8A 5C70A 4DXRA 3WF3A 1JYVA 3I2JA 3SKVA 3WQBA 3LPGA 1ULPA 1UXXX 3ECQA 3ETPA 2W1UA 2QQLA 1GQPA 1XNAA 5G04L 4P5YA 2WYSA 3D3AA 3THCA 4MOAA 4W50A 4AG4A 2QQNA 1UYXA 4QX0A 3SEEA 2C26A 3HEIA 4RYDA 1OF3A 4L0PA 1H6YA 2HLEA 2WDBA 4OMDA 4A42A 4D8MA 2WO3A 4FI9A 4TTGA 2W1SA 4KWUA 3I2FA 2C4XA 1SDDB 3VD7A 1BHGA 2XQXA 4AAXA 2VM9A 2VO5A 4CUCA 4CVUA 1OF4A 3K4DA 4OYUA 3T2PA 3OB8A 1P8JA 2LS6A 2VQUA 4ZY9A 1L7RA 3NRUA 5DQ0A 3K4AA 1JZ2A 4XUNA 4QDSA 3I2GA 1JZ8A 2BZDA 3HOBA 2J1SA 5JR2A 1OH4A 2WO2A 4W4ZA 3VD3A 1F4AA 3IAPA 2W5FA 3ACIA 1JHJA 4MGSA 1CIYA 1R64A 1L7QA 1YQ2A 2J1UA 3T0BA 1XPWA 3WNNA 3EYPA 2YC4A 1JU4A 3LE0A 3C7GA 3I97A 4BDVB 2Y6LA 3P6BA 2ID4A 1PMHX 3ACGA 3BN6A 2VMCA 4M4RA 5IFTA 2VZVA 2W46A 3WF4A 2XHNA 2KD7A 4W8JA 1ULOA 3T2OA 2W95A 4CU9A 4LKSA 2HYXA 4QX2A 3LEGA 3OEBA 2WN2A 4XURA 4LPLA 3UETA 4M4PA 2C9KA 1US3A 3WNKA 5EJZB 2Y6JA 5LCWL 3A22A 2J7MA 3VDCA 1J84A 4IUGA 2Y6GA 4DEVA 1SG3A 3MV11 4DXSA 4UI9L 2ZEYA 1UY3A 1K45A 5JUVA 5LA1A 3DECA 3BGAA 3K4ZA 2YC2A 1GUIA 2J1VA 3FHQA 3OEAA 1J83A 2JE8A 5LA2A 5C71A 5DPNA 2BGOA 4GZ9A 1DP0A 2QQOA 3MBWA 2WZEA 2RVAA 2EIBA 4JKLA 4LQRA 4BK5A 3W5NA 1UXZA 3VD5A 3VDBA 2ZEZA 4A3ZA 3OGRA 1F4HA 1UY2A 4MO3M 2V72A 3MO4A 3GGLA 2W91A 2V4VA 4JHZA 1K12A 1JYWA 4QAWA 2J22A 3A23A 2XOMA 4DUVA 1TG7A 1EUUA 3PUIA 5CYYA 3WNPA 3W5MA 2QBXA 2W1QA 1NX9A 4A6OA 4A45A 4CU7A 3I2IA 3NJXA 3VD9A 2QQIA 5CZKA 1CZTA 2QQKA 1JZ3A 3FN9A 4Z2AA 4LHSA 1TVGA 4KMQA 2R7EB 4P08A 3IAQA 3SEPA 1UZ0A 2EIEA 2VZQA 4DXTA 3DYPA 2VQTA 2VR4A 1JU3A 3IB3A 4P00B 3WF0A 4ARXA 1XNTA 3HNYM 2E32A 4DUXA 1WCQA 5JXHA 4XUQA 3OG2A 5IJRA 2YG0A 1NUKA 1PX4A 5LA0A 3THDA 3I3EA 4PT6A 3FHAA 4TXWA 4GWIA 3T08A 4RN5A 1K42A 3IDAA 1K3IA 2W92A 3IIIA 1W8OA 2WQ8A 2JKXA 3EB7A 3LPFA 2B9VA 2VCAA 3GXUA 1UY0A 4QDRA 4BK4A 2WN3A 2EICA 3WSOA 3LEIA 5JMOA 1GMMA 1XC6A 3HNBM 3SKJE 5A1AA 3T09A 5EIYB 5HXMA 2VMDA 1GOFA 3C7OA 1UY1A 4A41A 1SHWB 2QQMA 1MPXA 1OT5A 4ET7A 5G05L 4HG6B 3WEZA 3OBAA 2WZ8A 3ACHA 3UNPA 2W47A 2X05A 3WNLA 2ZEWA 2WAAA 4PQQA 1RYYA 3WF2A 3C7HA 5FUIA 3C7EA 2W87A 3WNMA 1UYZA 2W3JA 1O59A 3CIHA 2WBKA 2VL4A 2Y64A 1W0NA 2V5DA 5IHRA 2ZEXA 1JI6A 3F2ZA 1US2A 4KI5M 1GOHA 1UX7A 4QPWA 2J1EA 3JXSA 3NQHA 5B4NA 2BBAA 2VCBA 3WNOA 4E8CA 2DCKA 2X10A 5C7GA 3ZM8A 1UMHA 3J7HA 2W1WA 2YFUA 4QDQA 2Z4FA 2YFZA 4OMCA 1JZ7A 2VZ1A 5EJ1B 1OD3A 2Y8KA 1D7PM 3WF1A 2J1RA 2B4KA 5HPOA 3ACFA 5IYYA 1CZVA 2CDOA 2RJ2A 2XONA 4QB1A 4JKKA 3T2QA 2VMEA 2CDPA 2VTFA 4ZZ5A 4ZXEA 3C8XA 2ZXQA 2E26A 5DMYA 1EUTA 3P1IA 4P02B 3HN3A 2Y6HA 3GDBA 2QQJA 1UWWA 4CUBA 2VZRA 4BJ0A 4OUEA 2VZPA 3FL7A 4BXSV 3A21A 2L9LA 1GU3A 1HN1A 3CMGA 1LNSA 3HJRA 3I2HA 3CZUA 4D0QA 2WO1A 2W94A 4UAPA 5F7UA 1GOGA 1KEXA 1KGYA 3AC0A 4PF1A 3CKHA 3I3BA 2BERA 1W9WA 4DEQA 5I0DA 1PMJX 3NNGA 1JYNA 3U37A 2RV9A 2VZOA 4A44A 2JD9A 2PQSA 3CZJA 1UMIA 4GWJA 2VJXA 1DLCA 4CU6A 3VD4A 4XZUG 4ARYA 1CX1A 4CUAA 2VOTA 4JKMA 3DYOA 2Y6KA 4QB2A 3T0DA 1GNYA 1W9SA 5JXJA 1JZ5A 2E33A 1PX3A 3CQOA 5JXIA
chains in the Genus database with same CATH superfamily
4LITA 4K9SA 1QJEA 1SLIA 3SXWA 1G86A 5APAA 4ZONA 1RUNA 1IKQA 3KF5A 2Y0IA 3K77A 4RS5C 4CCMA 2OQ7A 1S1AA 4NR1A 3WHUA 1YCIA 4AF9A 5ABJB 1DYOA 2WYFA 1VLNA 5CKQA 4LBMA 4CDUC 1MS5A 3AZWA 2CHHA 3H7JA 4BH9A 2WNUA 2BOJA 1QH6A 1W9TA 4FSJA 1S0EA 3GBWA 5T3NA 1W6MB 1LECA 1O8SA 4N53A 1ULEA 1O8PA 2D3RA 1QXJA 2H0BA 1JW6A 1PNFA 3JBG2 5CFDA 4PIZA 3ZYBA 4YW1A 1JYXA 5IT6A 1PO13 1X9PA 4LBNA 3OGVA 2VW2A 4MGQA 3ON7A 1K5MA 2R072 2HYKA 4OHXA 5FMOS 2BOIA 2ORZA 3TN91 4YNIA 5F5CA 4K3UA 1BLZA 2WLPA 4NAOA 4Q26A 4XUOA 1N3PA 1BEV1 2BV4A 1AYM3 1DYPA 1GZTA 1QGLA 2DDUA 1EY2A 4GH4B 4EQVA 3V0BA 1DLLA 2DVBA 4G9SB 4QXKA 3NMBA 1OI6A 2K0GA 3LKJA 2A3WA 1HLCA 1KJLA 1A3KA 1W2UA 4MX3A 3ZDSA 4I02A 4YARA 4YZ3A 3ZSKA 2GC0A 3RYPA 5LBEA 2YGMA 1L3JA 3B9IA 4AVSA 5C3SA 4FPEA 2BEOA 4XJZA 5K4LA 3AX4A 4OZOA 3T0AA 3MV01 5LK5A 3UL2A 3K75B 4IGOA 4RR3B 2NQYA 4P14A 4LBQD 4JC1A 2ATFA 4QX3A 1NAEA 2XH6A 5FXZA 2XKOA 5I8YA 1DQ4A 1MQTC 4A7KA 2JDNA 1WW6A 4CDQA 3OY8A 1W99A 4LNVA 4W6WA 2CNAA 4LKFA 3PURA 4EWAA 3SMHA 5IVEA 1F35A 3BI3A 4XTPA 4W6YA 1JYIA 4FTSA 2MHFA 2KM2A 4NRPA 4EZ4A 4WM7B 5DUVA 2D97A 3VL8A 1AR92 3WF3A 2V09A 1LULA 3AZVA 3B02A 4B29A 3TN93 2SBAA 3CBNA 3EXUA 4ONUA 1YYNA 3WW2A 1N3QA 1PVXA 2JKBA 2FDKA 4FPOB 1BEV3 4JTNA 3TWIA 5M0TA 1UXXX 2HWD1 2TBVA 3ETPA 4BQ4A 2EIGA 1NCRB 1TZOA 3VKMA 5FPUA 5IATA 2G19A 1X33A 2WQZC 3RJRA 4YGDA 2WT0A 5G04L 5C5TA 3BPSA 3CJIC 5LB6A 1UYXA 4HN0A 4LULA 2QE3A 1W6PB 2NYYA 1H6YA 3VBOB 2LALA 5A7OA 3ZSMA 4Z8BA 2HLEA 3MPPG 3I2OA 2JJ6A 2WDBA 2VTXA 3RYRA 4UW4A 4Q1PA 2VULA 1AJOA 4RGKA 4JVAA 3MGUA 4BHPA 2OT7A 2WO3A 1HXS1 1VRBA 4ASLA 2YV8A 3ZXFA 2XDVA 4D7TA 3LAGA 2IUWA 2YBPA 1HRI2 5FIXA 1UAIA 4AAXA 4AVBA 2FCUA 3QBQA 3GZTB 3HIFA 4CUCA 1OF4A 4OYUA 3ILNA 3T2PA 4FPGA 1CWPA 3OB8A 1P8JA 2LS6A 1XYPA 2D93A 4LJHA 1IG0A 2JWPA 3B00A 2W68A 2WNEA 1JZ8A 1BVP1 3RWKX 3ZFEC 1HV1A 3GJAA 3HQRA 3ZMNA 4E4ZA 4YFZA 4QGNA 1HJFA 1SEFA 3HOBA 4F7ZA 2ZOEB 5CNAA 2GNTA 2J1SA 4DY5A 1DF0A 1OH4A 3LIHA 3WDUA 1E57A 2HWD3 1RMU1 2RM22 4W4ZA 3PTRB 3VZNA 3WDWA 5LA9A 3ZXEA 2W5FA 1UL9A 2HEYF 4QQLA 1CIYA 4ATFA 1L7QA 3UJOA 2J1UA 3WVJA 2JG8C 4NHKA 4PF5A 4XFAA 1DGRN 2BVVA 2VUCA 3EYPA 4GWNA 3UKTA 2NMNA 1D4VB 2XJVA 2JDPA 4FPYA 5FOJB 4N7UA 1UIJA 1OQDA 3C7GA 4JAAA 1RUD2 2GNDA 1DIWA 1HXS3 1AR61 3P6BA 4N43A 4XJ9A 4C0BA 3G7DA 4NHMA 4XF3A 1FYUA 4JGYB 1N47A 1REEA 2AGSA 5KC6A 3WQ7A 1NY72 2Z42A 4LBQA 5A3NA 5C9AC 5CG9A 5EP9A 4R8HA 2VZVA 2ZMKA 1GZWB 1FATA 3BODA 2WKKA 4B8EA 2NZ9A 2ZHMA 4JGZA 5FYVA 4BA6A 4QU2A 4IEZA 1RGSA 3JCIA 3TRSB 3O7OA 5FZ8A 5BV6A 2ZHNA 5CEHA 3U0ZA 3BKZA 1KDKA 3VLBB 2FHRA 2HBTA 5DAXA 2WN2A 3OYWB 4LPLA 4HPKA 4M4PA 2C9KA 2QQVA 3LA7A 3W21A 2Y6JA 5KXDA 2D6OX 1Y4WA 3A22A 3VKNA 2ZX1A 3AK0A 2PN5A 1ASJ1 1NT0A 4NPRA 5CKNA 1QWRA 1EV11 4FXKB 1YIFA 4HKOA 1SLLA 4Q29A 3ZFGB 4HT1T 3T1LA 1UU5A 1RMU3 4C0HA 1BMV2 4IEVA 5FTTC 1XXNA 4DEVA 1SG3A 5IAVA 2UYAA 2VU9A 4UT5A 1YJLA 1K45A 3FLTA 5JUVA 3GJBA 4YW7A 2K9ZA 3RZGA 4NIGA 5EJ3A 3SH4A 2EVXA 2G9FA 5J98B 3VBRB 1W90A 1IPSA 4CDXA 1RC6A 2J1VA 1AXYA 2VNGA 5HCHA 1E5HA 2Q8DA 3MI8A 1D4M1 4WBBA 2XPJA 4DB5A 1AR63 5LY2A 2UU8A 4PDWB 4FFGA 5F9TA 2HH9A 2BGOA 3AMMA 1UO9A 5F8PA 3RZMA 1A34A 2P37A 2ZA9A 2AYHA 2R49A 2WZEA 1PX3A 2Y33A 2XJTA 4QHOA 4XFFA 5IVVA 4JKLA 2OA2A 1GLHA 3FHIB 4XFHA 3ZSEA 4BK5A 1RUOA 3WCSA 1C8NA 1WA4A 2JE9A 1RUF1 4AGRA 1X7NA 1UY2A 1YFXA 3FFQA 1U12A 1PK6A 3U11A 4E2SA 3FLPA 3SC7X 1PM4A 1PGW2 1ASJ3 2WNUB 4PIYA 1EV13 4FOWA 1COV2 1CIWA 4IEQA 2ZGUA 3DUIA 2D7FA 2WFF1 4I30A 2WNVA 3T4VA 5BNNC 1RVF1 3RFRA 4DIQA 4D6QA 4XAAA 5CFDB 1WLCA 2VW1A 1QQP2 4A6OA 4CDWA 4LLOA 2XVLA 3VHPA 2JDUA 1SCSA 1EP0A 4YGEA 1NXD1 4BPZA 3SQOA 2WC2A 2IXHA 3HQUA 1JZ3A 3FN9A 1UPSA 2EXHA 5A3LA 1D4M3 4LHSA 2R7EB 3MW3A 3IAQA 3KQRA 5EPAA 4FQZA 1ENQA 2E7TA 2K46A 2XVGA 3V0BB 2D6NA 3MFCA 2PHDA 5JZGB 2VR4A 3IB3A 4ZU5A 3WT3A 5JSOA 3OCPA 4QQPA 3LA3A 2QTWB 2YG0A 4BQ3A 4IW3A 1QMJA 4RA0A 5A7NA 3WW4A 2WZR1 5FK8A 2UWBA 4AVVA 1RUF3 2BRTA 1OMIA 3EO6A 1K42A 3WW1A 2BTVC 1I6XA 3QACA 1PO22 4GXLA 1O6UA 1FV2A 1KD7A 3VDDC 3LPFA 1WUVA 3N9QA 4CUGA 1T6GC 1B35B 1FNZA 4NOTA 4E4HA 3KV4A 4OFGA 5K7PA 1D2SA 2PHXA 4NN0A 3LF7A 5E1RA 5FCCA 1QJFA 2WFF3 3PU3A 1Z7S1 4IDZA 3U1XA 1RVF3 3SKJE 4CCNA 3ITQA 5JVVA 2VW0A 3T09A 2PHWA 1IS6A 1W9FA 5BNOC 2JXAA 4I01A 5EIYB 3IBMA 5A6ZA 5BNPC 2YY1A 2VOKA 1WGPA 2MEV1 2JDMA 3IIAA 3C7OA 1UY1A 5L7OB 1W8WA 3H7YA 1H4GA 1O91A 1X8MA 1SZBA 1DBNA 3N7MA 4DXZA 1LU1A 3POBA 5G05L 1DGRA 3MIHA 3WEZA 1N1VA 1GWKA 4Y33A 3RZJA 1AYM2 5E16A 1MEC1 1UZWA 4C1XA 3MW2A 5FMCA 2EF6A 5FUIA 3C7EA 2W87A 1U5XA 1UYZA 1O59A 2RG4A 1ALYA 2WZR3 4YVWC 5CG8A 5J7MA 1UIKA 3KZ4C 5F2SA 3E5UA 5I8TA 2Y64A 2DFCA 3UYJA 4XFCA 2BQPA 2NPIA 4CEWC 4Y1UA 5JOZA 1ZBE3 4QPGA 5ACA1 3ZFFA 4FFHA 3N9NA 4U36A 4CA9A 4DPNA 3FC0A 3ORJA 2PAKA 5A6YA 4QPGC 3JXSA 1XU2A 1QNYA 3NQHA 2DU0A 3RMYA 4HETA 5CFCB 1Z7S3 2B5HA 3OSDA 4GKXA 4I0AA 4IV3C 1NOVA 1H0BA 4E8CA 4QGMA 3VBSB 4RFRB 1C3HA 1OKQA 5AFEA 3AKPA 3BYWA 3VHNA 2MEV3 2GH8A 2WRAA 4QDQA 4GB31 4DO0A 1JZ7A 5IK4A 1YC61 2VZ1A 3TN92 5FXWA 4HMZA 4COYA 1OD3A 2BFUL 3LD8A 3POEA 4Y24A 5FJKA 1BEV2 5A80A 5HBAA 5I91A 1HB3A 2Y8KA 2Z2SB 4MV2A 1ODNA 1WCDJ 1MEC3 3USUA 1OH3A 1M4WA 1VB2A 2AENA 4LO5B 2J1RA 4KU7A 3J7LA 4LHNA 2WNOA 4LEJA 4I0BA 4Q5OA 3AP4A 3WG4A 3E6BA 5LWBA 4GALA 4CZSA 4JV4A 4JKKA 2R1DA 3KB5A 3KGLA 5DAWA 1RUH1 3T2TA 1SFPA 1LOAA 3D8CA 1AUYA 1G9DA 2KXLA 2E26A 2A75A 2PQQA 1OBNA 2O0OA 2ZTNA 1E5IA 1ENXA 1SDWA 4JHTA 1EUTA 3P1IA 5DDJ1 1GSLA 3GZEA 4YM0A 2Y6HA 3V0AB 2YHJA 4MXWA 3LFMA 5K9YA 2Q1FA 1CAXA 1V9U2 3JD71 4XE9A 4WV8A 4Q4W1 4XDQA 3DPRC 2PMWB 2VOVA 2VZPA 3AXEA 3HR9A 1MR5A 3A21A 3AVRA 4AEJA 3N9PA 1GU3A 2P3KA 4GJZA 5D8AA 4MH0E 3CMGA 3WG3A 3I2HA 1W6QA 2W94A 5A1FA 1YO8A 5T5JA 2P6CA 4I09A 1IKPA 4AZZA 1H30A 2BU9A 1D2QA 4IV1B 2JDHA 4QMAA 4AL9A 3HBKA 1RJ8A 2A6XA 2HWD2 4FOQA 4FP2A 4XIKA 5EZWA 4PF1A 3VZOA 3B5LB 1HDKA 5ABJC 2ENRA 1DGWX 3RYKA 4DOUA 3AMPA 4DRVA 3GCXA 3ZVXA 1AXZA 2AEYA 5I0DA 1V6NA 1ZZ9A 3M70A 4LE4A 4GAZA 4NJ4A 1OHFA 4X6RB 2Q8EA 3WD5A 4BIOA 1AX1A 3MLLA 1UZYA 4UFKA 3QD6A 1RUH3 1VRH1 4RL7A 3LB9A 1HXS2 3NNMA 3AL6A 1UOBA 4FTEA 4Q0UA 1RL3A 3CZJA 3FMGA 3FX3A 5DDJ3 4AEDA 4LA2A 4CEYA 4GWJA 1CD3G 3MEPA 2ZJCA 2R0HA 2HWF1 4HFSA 4OUSA 4XIOA 5HV0A 1ZRIA 5A7QA 1F31A 3JD73 4ORFA 3V64A 1TEIA 1NE6A 2AREA 3DKWA 4Q4W3 4RHV2 4WM8A 2UY8A 5F39A 3IZOA 1GNYA 5F5AA 3D0JA 4UW3A 1GNZA 3S57A 1V6JA 4XC9A 1CR7A 1JYWA 5LEJA 2A70A 4LO6B 4XVHA 5FPBA 4QU1A 5JDBA 1QJY1 2YBKA 2E9QA 2WAOA 4AFAA 4EN7B 3ABZA 2ZAAA 2I45A 3OJBA 1REDA 4FP3A 3VV1A 2JIGA 1RMU2 5C8CA 1HQLA 1LOBA 2LRPA 4JX0A 2XUEA 1UYYA 2DCZA 4RR3C 3ZN4A 4UWDA 4B7KA 3WR0A 3O1MA 4N7IA 3HPNA 3AKQA 4CPBA 1C8M1 1NZIA 4N90A 4IQPA 1H8TA 2W39A 4XHBA 2IWGB 3ZN5A 1BCXA 1OQ1A 3NNFA 4EYUA 3K46A 1FX5A 3KV5A 1VR3A 1JN2P 4XDPA 1ZZBA 1PIV1 3O1RA 4IE7A 1LCLA 2VZSA 4QPIB 1VRH3 1S4CA 3I2KA 1H1AA 3PL0A 2J1TA 3M3QA 5DN2A 2XLAA 1AR62 1VMJA 4UF0B 2R6QA 4WM7C 1NKGA 1CJDA 5HXVA 4CCJA 3SISA 4KWLA 4SBVA 2QZ2A 1HX6A 3THPA 3ZN6B 2VZTA 2HWF3 1W0PA 2ZS6B 2UY9A 3J4UH 1S2EA 4R9BA 1ND3A 4UXAA 1Q8PA 2LTNA 1V6LA 2WUHA 5EQUA 4V2WA 3GM8A 1BK1A 3ZYHA 4GULA 2JDAA 4TLFA 2ZGSA 4XUPA 1LHOA 3KVAA 5E8AA 2IFRA 2VC9A 5J1XA 1QJY3 4LOTA 2JB4A 1ASJ2 1NLSA 3VBOC 1EV12 1T2XA 2RMU2 4BYYA 2A73B 4GMP0 4Z1VA 5IW0A 3WV6A 3N9OA 4QX1A 4XDOA 3NWKA 1WLTA 3L2HA 3OF1A 5F3GA 3VHOA 4AGGA 5FMBA 4EN0A 4ISRA 5A7WA 5IUQA 5IVCA 5F37A 1WCUA 2OKXA 1F2NA 1C8M3 1ENRA 2VXRA 5LEKA 2VBDA 3AYEA 2XB6C 5FPLA 5SV5A 3VZKA 3S5AA 1ULFA 2ZGRA 4Y1XA 5IAXA 4EZHA 1CPMA 3SCGA 4D6RA 1AR82 4LR4A 3LSDA 2VNVA 1CVNA 1D4M2 3OD0A 5C3PA 4LBOA 3O12A 1X8EA 5FZOA 5L9BA 2BGPA 3FLRA 1LHWA 5JLVA 5C4WA 4WVMB 3I59A 5GZEA 2JG9A 2E31A 2VOXA 4ZZ8A 4DXRA 1DU3D 1LOFC 1S0GA 3DGTA 1JYVA 2B39A 1XOYA 2JB8A 4YZ5A 4BQ2A 2D44A 3CU7A 3KM5A 1KITA 5FOBB 3WQBA 5F3IA 2AUYA 2XXZA 4AHWA 4TN7A 3LPGA 1BZWA 2C1FA 2A6WA 2IXKA 2ZMNA 3WQ0A 4R4XA 4OI0A 2W1UA 3H1YA 5GM0A 1JMUB 2XJSA 1RHI1 1RUF2 2VD7A 5LZ6A 2RE9A 3NAPA 4KWJA 3O0VA 3THCA 4MOAA 4YG6A 2PHFA 1Y7BA 2Z79A 5HCAA 3DKQA 1TMF1 4QX0A 2VECA 5DUXA 5C3RA 2RS51 1OF3A 2KA3A 4RYDA 4ZS2A 2ZKNA 5C8WA 4BWOA 1W0OA 3JZVA 5F5QA 1UW8A 4J1WA 3PVNA 5DABA 2WFF2 2ZZQA 1RVF2 1TNRA 4S2FA 4TTGA 1WLWA 3I2FA 1Q43A 1XE8A 3WXPA 2ZX3A 3OGGA 5CB7A 1RXFA 1YFWA 1WA6X 1O7FA 2VO5A 2WSVA 5CBLA 2Q30A 1OFSA 2GALA 1VBC1 4COUA 4CVUA 1VMFA 3K4DA 1ND2B 1ZRFA 4ATEA 4ZKTB 1GP6A 4LORA 2B42B 3NRUA 3U10A 2XWBB 4OI4A 4PLNA 3VBHB 3I2GA 5FZBA 2RS31 3TEWA 3KWVA 4FPCA 1LHVA 2WA4A 3AMHA 2GNMA 1OOPA 5FYUA 1DHKB 3LDKA 2V4AA 4BE3A 5K0UC 1S2BA 5JR2A 2WO2A 3ZFGC 3OOXA 4SLIA 4HK8A 4Y4RA 1N1YA 2WJSA 4RGGA 2WZR2 4JRAA 4MGYE 3U14A 5B2GB 1RHI3 4RS5A 5LBBA 1WW4A 1R64A 4YGCA 5TSWA 4LO4B 1G9FA 3WP6A 1XPWA 3NJZA 1C4RA 1QOTA 2PXJA 1QJX3 4BQ1A 5GZDA 1TMF3 4AQTA 2ZGOA 4HLTA 5FREA 2RS53 2RDNA 4OUMA 4RSUA 4XETA 2UURA 4I3PA 1JUHA 1UN1A 4AI3A 2Y34A 2D98A 4A7ZA 4Y5SA 4IE4A 1RUE2 4Y20B 4BDVB 3ELNA 1LB2A 1Z7S2 4F83A 2Y0OA 4WZFA 3O1SA 2ID4A 2GMMA 1YNAA 1PMHX 3ACGA 3AMNA 3BN6A 3M3CA 3B3QE 4MXVA 4PDWC 4RQPB 5FQ0B 2VMCA 4R9AA 4QX8A 4CCEA 2AACA 4PCRA 2W46A 2MEV2 3WF4A 1OC1A 2XHNA 4CU9A 1ULOA 4D3WA 1VBC3 3CJXA 1QDCA 4HVQA 3FFZA 4LKSA 2NP0A 2HYXA 4CRQA 3LEGA 1W8TA 4FFIA 5FMOL 4XURA 1MEC2 5A7SA 4UFMA 4X6QB 3UETA 2VBBA 4EN8B 2RS33 4YVSC 4FO9A 4UYBA 5FZCA 3WNKA 1AHSA 1CESA 3IN9A 5EJZB 5KXBA 5GZGA 1WCKA 3VN4A 4XCAA 2J7MA 1FT9A 4AW7A 1IGOA 1NCQB 1SBEA 3UKNA 1LR5A 3WHTA 1PVC1 5DZFA 4BQ5A 3BOWA 1J84A 4FAHA 5FO7B 4AQ2A 4IUGA 1SLBA 3NO8A 1UF2C 4DXSA 5J96B 1SCRA 2ZCWA 1LEDA 3LFIA 5FYCA 4QT6A 3PJYA 5FZ3A 5GLUA 4CP9A 2HWB1 3M1HA 5ACA2 1EAH1 4LIUA 5LA1A 3WOGA 1ZRDA 1GFF2 5FZIA 1I3HA 4AEDB 1Y3TA 1MQTA 1U5ZA 3FBYA 3K4ZA 2YC2A 1R081 2RR12 1GUIA 3AJZA 3MIFA 4QXBA 2GMEA 2OPWA 3ME2A 1O3QA 2XG3A 5FP9A 3ZR5A 5T50A 1QXRA 3H1MA 3D0SA 4RFT0 1PGL1 3WW3A 4COVA 3ILRA 3LIGA 5KHGA 4XFIA 2C9AA 1RITA 4XJ8A 2A6YA 5FY4A 5GKAC 3KT4A 3VBUC 4B1LA 5I0SA 5JZGC 3APBA 4GB32 1SFNA 2MNGA 2RVAA 1S0FA 4H7MA 5KXEA 5T52A 3RZKA 3VD5A 5CAZA 2XWJB 4Q27A 4PBPA 3LDBA 4YM2A 4QGLA 3I8TA 3H42B 1RUI1 4MO3M 4QHZA 2V72A 1WWYA 4QPYA 2GH2A 3GGLA 1G9CA 1OQEA 3CJIA 3PIGA 1N3OA 1B35C 1K12A 4NWWA 5L36A 1PVC3 4QAWA 2J22A 3A23A 5F32A 1T6BX 4B4RA 4PLMA 2CAVA 1MZ6A 5L9VA 1RUH2 2ZACA 3R4SA 1ZA7A 1DZQA 3WNPA 3W5MA 4PQ9A 3JB8A 3KGZA 1NX9A 2P6HA 2HWB3 5FZKA 1EAH3 1LOGA 3S7IA 5C6CA 4OHYA 3N9MA 5DDJ2 3I2IA 3Q9OA 3NJXA 3VD9A 1UPIA 5A33B 3M4FA 4NPMA 2BP6A 1R083 1CZTA 4URTA 5CZKA 5C3OA 1KRIA 5JWPA 5L7OC 3LCPA 4Z2AA 4COWA 3WX5A 2G1MA 2BWAA 1QH7A 3JD72 1TVGA 4XTMA 4Y22B 1AL21 2N7GA 4Q4W2 2P4EA 4AR2A 1SFYA 3RZHA 2KR2A 2VNOA 1UZ0A 2EIEA 4DNYA 3POYA 2VZQA 3N35A 2Q8CA 3AP6A 3JQXA 3M3OA 4QKFA 4DXTA 4YFWA 1CAUA 2TEPA 4FCAA 4MLOA 4X8NA 2E32A 3ZFEA 4XUQA 3MIDA 1UU6A 1LGNA 2OUJA 1BBT1 2XL7A 2BJSA 2ARCA 3E5XA 4HXCA 3SCHA 4PT6A 3OD4A 4QQHA 1Q5OA 4AFMA 1OUXA 1W8OA 2WQ8A 3ENRA 4HSLA 1RUI3 3N7KA 1OXCA 3EB7A 2X5IC 5D1IA 1NA1B 2JG8A 2YU2A 1CAWB 1O3TA 2IVJA 4U2AA 3GXUA 1YEWA 3FE5A 2QNKA 1XE7A 4LTAA 2RHPA 4QX7A 2D6KA 1JUIA 2X53S 3ROUA 2JICA 4IEYA 1VRH2 4QWNA 5ANNA 3ZXJA 5CFCC 3POGA 1CAVA 3RPQA 4PJYA 1YWKA 3AVSA 3TEZA 3VBSC 4NMIA 5C4WB 4DMIA 1XB9A 1HN0A 1W39A 2VMDA 4K21A 1GOFA 4IEUA 4B1MA 5FYHA 1CQ9A 5C9AA 1SHWB 4CP2A 2QQMA 2HWF2 1MPXA 4CCDA 1RIRA 3RWNA 1C57A 4ET7A 1MVQA 3T30A 1AL23 1VAKA 4HG6B 1AXKA 1PMIA 2WZ8A 2UWCA 2W47A 1MS0A 1SMVA 1YQ5A 3AJYA 4KBZA 2X05A 3WNLA 4O65A 4P9GA 4XJWA 5EYYA 1UU4A 2XBO1 4Y3OA 3IPVB 1NXMA 3WF2A 2P3YA 1YFUA 2Q1ZB 4DRRA 3LOBA 2V73A 1BBT3 5A1LA 1QJY2 4IEXA 1TME1 3X29B 1XRUA 4KG8A 1DQ0A 1TQ5A 2EXKA 3CIHA 2WBKA 5FYSA 3PVBB 5AVPA 3ZYGA 5F3CA 3E97A 1W0NA 4CYDA 2V5DA 3QH6A 1S0BA 2P3IA 2ZEXA 1WMEA 3F2ZA 4GIQA 1SLAA 2BUKA 1PZ9A 4Z07A 5FZ4A 5GZFA 4IXLA 2JX9A 4KQ7A 1W04A 2J1EA 1NG0A 4BQXA 1PIV2 2VMGA 3ZIXA 1XSQA 4R9CA 2QUOA 1OURA 4Y1ZA 1ZRRA 2YDEA 3OGJA 4KGGA 5FKBA 1MVEA 5A7PA 4JZRA 1RUG1 3WY6A 4JDMA 4E4SA 2FDGA 3KQ4B 3MYXA 3OBTA 1Y9GA 4NIAA 4IGQA 3ZM8A 1VBD1 1UQXA 1WD4A 5I0TA 2WO7A 3PMEA 2PHUA 1YI9A 2NN8A 2EAAA 2IZWA 2WWJA 4IV1C 5EFUA 1D7PM 3UGGA 2BDRA 2AEZA 3ZYRA 1CAXB 3WF1A 5BXXA 4AHXA 1NQDA 2ZGMA 3S7EA 2XBO3 3ACFA 1CZVA 2B7YA 3S0MA 2OS2A 2ZX4A 4CDUB 2CDOA 2RJ2A 3R4DB 1DZRA 2XONA 4J6GA 4R9DA 3WZ1A 2D43A 3D5OA 4ASMB 5DXDA 1TME3 3B01A 2EALA 3H0OA 5E6HA 2VUJA 4D69A 4ZZ5A 5A6QA 4O9GA 3GF6A 5FUPA 3VBFC 2A6VA 3ZO0B 5BNNA 2PHRA 4BLIA 1J3RA 3RZLA 3VZMA 4N53B 4P02B 3VHRA 4BQWA 3HN3A 1IOAA 5EXOA 3P3PA 4KH9A 4TLGA 2A6ZA 4ES9A 1UWWA 4CUBA 3TAYA 2HWC2 5J3UA 1CJPA 4OUEA 2DWRA 4EWDA 5KBFA 4BXSV 1RUG3 5FZ0A 2PLV1 1O3SA 3IDEA 2JEMA 1K5MB 5CADA 5FZMA 2I74A 1HN1A 1Q8SA 2NMOA 1W6NA 1ZVFA 2BGCA 1VBD3 2D6MA 3E6DA 3CZUA 3ES4A 2F6BA 4P9JA 3O1OA 1HJGA 3ZSJA 5BUVA 4UAPA 5E88A 5F7UA 3ZPYA 1KEXA 4H55A 1ONAA 3PVOA 2Z69A 2GP5A 3OPWA 2OYZA 1GV9A 3GBGA 3NV2A 4GD4A 4XW3A 1SPPA 3POWA 2R16A 2DUOA 1RHI2 1XJAA 3CKHA 1FXZA 3BUCA 1QJU1 2VG9A 1V6IA 2DUQA 3VDDA 2C6SA 4CP9B 2ES3A 4CE8A 2P5BA 5FRAA 2B8MA 4R4ZA 5CVRA 3O1PA 1MQTB 3CLPA 4QKNA 1G9BA 1A78A 2XR4A 3J7MA 1ZBE1 2MPFA 4DZGA 4AI9A 1ULGA 2DURA 2DBNA 2FMYA 3NJYA 4QM8A 5FV3A 1ENSA 2P2KA 1QY4A 2P34A 2VZOA 2Y6FA 3LWCA 1E5SA 3BOPA 4FOVA 2FDIA 4FAGA 4CDQB 1HRV1 1UMIA 5A33A 5BNOA 3OY8B 5DG2A 1WMFA 4DQAA 3VD4A 4P9XA 2JDYA 4J1XA 5BNPA 3B69A 1A8DA 2YYOA 4AI1A 1VBC2 2ZGLA 1JOPA 4Q1RA 1PO12 3GNEA 3S6PA 2PLV3 3T0DA 3HBZA 3B93A 5JXJA 1KFXL 2RJKA 2ZZJA 1MS8A 3H3LA 4BB3A 1QU0A 4HONA 4KWKA 5FZ7A 5GZCA 3NKTA 5JXIA 3IDCB 3QCWA 2R061 1UY4A 3I2DA 3NJVA 4BM8A 2CSGA 3ASIA 3ZXLA 2VMFA 5KXCA 1IQAA 2HWE1 2ZKLA 4YPJA 4EN9B 2GC3A 3MDPA 1EPZA 4YVWA 4XUTA 4DUWA 3NNLA 3OUJA 5FP8A 4IGPA 5FO8B 1LU2A 5GLTA 3PLQA 1QJU3 3QH7A 4XABA 3E1F1 4AFBA 4C91A 4S2DA 4CEWA 3AP7A 5DAQA 2LW8A 4ZHNA 2YXSA 3WP5A 4N8MA 1DCSA 5T5LA 1LJ7A 4NE9A 2R32A 3HQXA 1LRHA 1W03A 3M3EA 1G8WA 3MHZA 3UV9A 4MADA 4FXGB 1HW5A 1CN1A 4Q2FA 4M3CE 2I2SA 5DZEA 3M3IA 2Z5WA 4IV3A 1HRV3 1DQ5A 3LQCA 1O3RA 2PTMA 5K0UB 3UESA 5F1RA 1C1FA 2YBSA 2GNBA 3TEXA 3PUHA 1CGPA 3AZXA 4AE2A 1S2KA 1TNFA 1XNKA 4B4PA 1R1ZA 3HVDA 4E9KA 5FJHA 1JZ4A 3DYMA 1CPNA 2CGPA 2GMPA 1APNA 3OGSA 1U5YA 3DCQA 4KL1A 5DUUA 1OLQA 3A7QA 1QDOA 4ES8A 1Q8VA 5BPXA 2VZUA 4AK3A 2R063 4WZCA 3UGFA 3ZKYA 1XQNA 1MZFA 5FFOC 3KLSA 2DCJA 2K2SA 1PVC2 5FWEA 1W8ZA 1WBLA 2HWE3 1G7YA 3NKGA 2VZ3A 4KU8A 3EMRA 2ARAA 4L2NA 2W52A 4YW5A 4B4QA 2XJRA 5T54A 3J9SA 3LEKA 5I0RA 2Q0AA 1MS3A 3AFKA 4AFCA 3NW4A 1AYN1 2HWB2 3V65A 4AHZA 4FPHA 4B3NA 2VQAA 5EHDA 3NV3A 3HNMA 2YU1A 1R082 2A1XA 5C9AB 4N43B 3RI8A 1W6OA 5IVJA 1ULDA 1ND2C 4YSFA 5JPNB 1QNWA 3W58A 4LBQB 2D5FA 3MUY1 2DVFA 2VCCA 5FYBA 5JXGA 1PGL2 3DPRA 3C7FA 4M3CA 2BW8A 2J1AA 3VBHC 5C70A 3BTAA 4JGZB 1RINA 1LGBA 1WLDA 4MUVA 5A3UA 3NV4A 1C28A 3SKVA 1HB4A 2R0FA 5A32A 3TYJA 5ERLA 1LTEA 1D0HA 2CAUA 2D3PA 1ULPA 4MGTA 3ZXKA 5HI0A 3AP9A 3RZZA 4HPKB 2RDSA 3ZKUA 3MZHA 3AL5A 2QZ3A 4P5YA 1H2KA 3D3AA 2QCSB 3OPZA 3LDRA 1RUI2 1AL0G 4Q4Y1 4W50A 1YFYA 4AFDA 5ABJA 3SEEA 5FWJA 2CY6A 1C1LA 4LO7A 3KSCA 5LY1A 3U75A 4ZU7A 4LT5A 1UZVA 2ET1A 4A3XA 3I54A 4XF1A 4E27A 3JB4C 1RUJ1 1W6MA 4D8MA 3EBRA 4FI9A 4Q8LA 2ARBA 5D21A 1GZ9A 5L19A 4KWUA 4XPVA 3VUOA 1SDDB 1RB8G 3M8LA 2FDJA 1AYN3 4CDXB 1GBGA 4RQPC 1V6KA 3KCYA 1O5LA 4OHZA 3N36A 4PI2A 1YUDA 3WLUA 5IVYA 3VGIA 2WT2A 2CWMA 2XJPA 3VZJA 2CYFA 4ZY9A 1R1A1 1L7RA 1AL22 3DV8A 5DQ0A 3H8RA 5FP3A 1LENA 1JZ2A 4XUNA 1V6OA 3AZZA 5I8SA 3WP4A 2OXBA 2FCVA 2E63A 2DVGA 3WNXA 2P17A 2R30A 3U78A 3MIEA 2Y26A 4LK6A 1W8FA 4GH4C 4N9IA 2O1QA 2ILMA 1RXGA 4WVWA 4CDUA 1NCQC 2VGDA 4EWEA 1BVVA 1IPJA 1IPKA 3K2OA 5DG1A 3VD3A 4XMAA 2GN3A 3IAPA 3ACIA 1JHJA 4MGSA 1PK6B 4H2AA 1AX0A 1BYHA 3W20A 3T0BA 4XQ4A 2JDZA 2WS91 1KXGA 4Q4Y3 4NROA 4NIDA 2GN7A 4RR3A 3PU8A 4HBNA 2YC4A 5JI7A 1JU4A 3FJSA 1EPWA 2WNVB 5KHHA 3ZYFA 5FY5A 4A2UA 1OSGA 1C5HA 1RUJ3 3I97A 5FZ1A 4BLJA 3WINE 2ZGTA 3TNQA 4CDWB 2H6CA 3Q8CA 2D6PA 2VPVA 4MGZE 4HANA 4XMIA 4UBHA 4D7YA 1ZBA1 2WSUA 4N9HA 4V1PA 5FPZA 3SNMA 2CGOA 3PUSA 4AVCA 2OW4A 1UNBA 4M0NA 1C5IA 4WM7A 1GP4A 1QEXA 1WMDA 2PA7A 4CP0A 2W95A 3U4XA 4GWMA 3VL9A 3O1TA 3POJA 1KJRA 1YQCA 1VB4A 1MS1A 1R1A3 2BPA2 2ZHLA 3KT1A 2RJLA 3THTA 1SPPB 4AQSA 3ZSLA 4YG3A 2XBO2 1UZZA 5JR7B 1W2TA 4XJUA 2ZAHA 3J8F1 4JCKA 1NCRC 1W06A 3VDDB 5HCBA 4QKDA 1XSRA 1XNCA 4Z82A 1W6PA 4PHZA 4NPLA 1BXHA 3VBOA 3JQWA 2Y6GA 2XQRA 2XGXA 4E2QA 2ZEYA 5HV4A 3E6CC 2WS93 1UY3A 4HZFA 2P3JA 5F6LB 5IVBA 5FYMA 3AM2A 3NV1A 1H9PA 2WWUA 3BGAA 3BU7A 4CXWA 1VE0A 4Z92B 3POIA 5BNPB 5FUNA 1J83A 2JE8A 4Y1YA 1SACA 5LA2A 2YC0A 1FAYA 1DFQA 4CP1A 1POV1 2VNRA 4MSVA 1G6NA 2P1BA 1ZBA3 4LMFA 3VKFC 4TZDA 2A5ZA 2BNNA 4IERA 3R05A 1FPN1 3ZOIA 4H3WA 3RVHA 1LEMA 2QQOA 3HN1A 4BQYA 1H8VA 1VBD2 5L73A 1GWLA 1LOFA 3AMQA 2E6VA 5EYXA 2D40A 1O4TA 1ZYBA 4LQRA 2AH2A 1OPOA 1FOD1 4P9WA 3T1MA 4D7SA 3M2MA 1UXZA 3VDBA 3MIBA 1RUC1 1WCSA 2ETEA 5FZDA 1NE4A 5A6XA 1UKGA 3DXTA 5KHKA 2VVDA 1QJZA 4OI1A 3TBDA 1ODMA 2W91A 3J8F3 2BVBA 4JHZA 4K1YA 4LXLA 4Q4V1 1BK0A 1KS5A 4HVOA 4OCTA 1WZXA 1QJX1 1VBE1 2XOMA 5DAVA 2H0VA 1TG7A 2B9UA 3KV6A 1EUUA 1R091 4QPGB 3IT8A 5CYYA 3ZFFB 2VMIA 4GJYA 1UKRA 3E5QA 2W1QA 4RGAA 5FPXA 3ZPOA 4X8PA 1ZRCA 3RDIA 4CU7A 5GLWA 2GZWA 2WR9A 1NYWA 2G9ZA 3N7JA 5JPMB 3PUQA 2ZBJA 4IETA 4P5HA 1N1TA 5IK8A 2QQKA 5J36A 2WA3A 4HN1A 2D3SA 1GZWA 3KV9A 4JGYC 5CIRA 4JDNA 3UJQA 1ZA4A 1IS5A 4P08A 3SEPA 1POV3 3UKVA 3BU0A 3D4KA 4LBKA 2SLIA 4OHWA 3T4HB 4CCOA 2PLV2 1FPN3 3URFA 3O1VA 1UMZA 3KF3A 2VQTA 3OYWA 1JU3A 4P00B 1XNTA 1JYTA 1WCQA 5JXHA 4NHYA 2PAMA 2XL9A 3OG2A 5EV7A 1LAJA 3USUB 2GSYA 1FOD3 1OVPA 5LA0A 3THDA 3I3EA 5K0UA 1DGWA 4XBQA 3FHAA 1OVSA 2IC1A 2XUMA 1HQNA 1RUC3 4GWIA 4RN5A 4TXWA 4XBLA 3IDAA 3ZFGA 2W92A 3H9AA 1WD3A 3IIIA 3OPTA 4BXFA 1LESA 4YGBA 3VZLA 2VCAA 1GICA 1QJU2 4K20A 5I93A 5FYZA 1OA2A 1QQP3 5BY5A 2CWSA 1JBCA 3NVCA 4MGKE 4Q4V3 5JAXA 2LM3A 3A4UA 3WQ1A 5A3OA 2PFWA 2UWAA 1VBE3 1LGCA 3WP3A 2EICA 1JODA 1PZ8A 1R093 1ZBE2 2GAUA 3LEIA 4AEKA 5JMOA 2R041 2LROA 4G4FA 3R4UA 3VBRC 4C1WA 1POQA 4EJRA 3GHMA 4MXWB 4BOWA 4PDWA 1HRV2 3DEMA 1YLLA 2OZ6A 2VXJA 1SQ4A 2XLGA 2UYBA 1VBA1 5LW9A 2QDRA 4YZ4A 1L7LA 2WQ4A 3KD4A 3PNAA 5D8AB 5GLZA 4UW6A 3EHKA 3ACHA 4FOYA 4HOOA 2JE7A 4W65A 1W6QB 2F17A 1B09A 4PQQA 3ZR6A 4B7EA 1GANA 2CL2A 4Y4YA 4ZPIA 1PO23 4OZXA 4YVSA 3ZYPA 1F15A 2R062 4XAEA 4MHRA 1W05A 3WNMA 2R1BA 4FVVA 2HWE2 4NHLA 5T5PA 4LKDA 5AFBA 1AF9A 2VH9A 5FZHA 2WNUC 4DS0A 5FXVA 2XKPA 4Q8KA 4OULA 5D2AA 1JI6A 1OLME 3K51A 3PDQA 4YW6A 4Z2WA 4N53C 5F5IA 4PIXA 4XCBA 4Y5TA 5GALA 3U07A 5CFDC 1DQ6A 5CU1A 5KC5A 4JQTA 2R043 2W0XA 3T3YA 2GC1A 4XJAA 5B4NA 4CEYB 3LEMA 3RS6A 5IVFA 4H14A 2DCKA 5DAPA 1AR71 2XVKA 3HAGA 4W6XA 1K5MC 4LK7A 2AC1A 1OA3A 2IFWA 2VOWA 2X8KA 4IEPA 4WM8B 1VMHA 3IMMA 4J25A 3J7HA 2YFUA 1MZEA 2WLQA 1VBA3 3NNJA 1ST8A 4OMCA 5JZGA 1BKZA 4XXPA 1ZREA 3VBUA 2OQ6A 5LK7B 2ZABA 4IEWA 3KMHA 3N7LA 4I2OA 3KVBA 2ARXA 5A3WA 2WZPP 2ERFA 5L9RA 5IYYA 3PUAA 4JRLA 3ZYJB 2ZX0A 3D82A 4YM1A 3AP5A 4HK9A 1OD5A 5FLIA 4D94A 5C8CB 1S0IA 4QXHA 1B35A 3T2QA 2VMEA 2CDPA 3BB6A 3O14A 2VTFA 2EA7A 4MVTA 4ZXKA 4ZXEA 1AJKA 2RDQA 3AKSA 2OPKA 5FKCA 3AZYA 1H8TB 5LATA 3H3UA 1V9U1 1VJ2A 1J3QA 2DYCA 5DMYA 1VBB1 1F8VA 2O14A 5FP7A 3B94A 1AYN2 1UOGA 4CDQC 2EXIA 1OLMA 2QJVA 5KR7A 4JDOA 2VY0A 5IK7A 3H8OA 4LOSA 1IZ3A 5HCFA 2VZRA 2DFBA 1LHUA 3C2UA 5L7OA 2Q5TA 4MZUA 3RG0A 3UT0A 4BJ0A 4DY3A 3FL7A 2HJIA 1AVBA 5J37A 2L9LA 4META 5H9QA 1HB1A 1F9KA 1AR73 1J58A 3G6JB 4NO4A 4NWVA 1HIXA 5CA6A 3A0NA 1LNSA 1ZZ6A 1OUSA 1S0JA 3H50A 3HJRA 3WDVA 1W9YA 4D0QA 2WO1A 4XILA 1GOGA 1ND3B 4HKWA 1QIQA 2Q4SA 2WT1A 1KGYA 2FQPA 3AC0A 4PLOA 4Y26A 4NIHA 4LBJA 5F2WA 5FZAA 2XHKA 3OBZA 2ZX2A 5JOXA 2PHLA 3I3BA 5FZFA 3SH3A 2BERA 3AKRA 4Q4Y2 3J26N 4DEQA 1PMJX 2YGLA 4XACA 2ZPXA 2X5IA 3NNGA 4IE5A 4MG2A 1XU1A 1H2NA 2W2IA 5FY0A 4PI0A 1UOJA 1YXWA 4O9EA 5A3TA 1YJKA 3U37A 4RD7A 2A71A 5FAXA 1KS4A 5A7WB 3O5SA 1RUJ2 1X9TA 3PMSA 1XBFA 4XYXA 3S5QA 3Q8FA 5GLVA 1V9U3 1ZX5A 2CU5A 4A44A 4RHV1 1VBB3 5CFCA 1SBDA 1LODA 1V0AA 3I49A 2VJXA 1DDLA 2FZ1A 3VBSA 3OTFA 5C33A 4P9YA 5KHIA 1RTVA 1GKBA 3AXDA 1W2OA 1CX1A 5FZOB 1FNYA 2DUPA 2VOTA 3TOJA 4JKMA 3GCWA 3SCFA 4AEMA 3I59B 3BTXA 1R1A2 2O8QA 2JG9B 2Y6KA 4AYUA 2QFEA 4FPFA 3FWEA 4UFLA 4AXOA 1XYOA 3KT7A 1GQPA 4Y5Z0 1O4ZA 2Q8OA 4C8DA 1SBFA 4G3YC 4NIIA 3MFAA 4Q4X1 1JYCA 2G4IA 3CDZB 4QB6A 2ORXA 3IKWA 4YLZA 5A3PA 4ASKA 1WKYA 3NAPB 3WDYA 2W9XA 1HB2A 2GDFA 2WL1A 4LKEA 5FY9A 3RGBA 1W8NA 2EIDA 2NLRA 2WS92 3I3DA 1I5PA 2PYTA 4LUMA 5FZEA 1W2AX 2WABA 2YPDA 5CKMA 5FR3A 3KHBA 4OI2A 3PJQA 5FBZA 4L8QA 3V0AA 4K1ZA 4N43C 2X09A 4F8AA 1C8M2 2VE1A 3D6EA 1PHMA 1KFUL 1IS4A 4BISA 4E8DA 4RHV3 1QXPA 4K7JA 4FPKA 1MS9A 1MZ5A 1ZBA2 4NUBA 2E7QA 3WDXA 4LIVA 2C0ZA 3AYDA 1IQDC 3H8UA 3HT2A 4JGZC 4LHKA 1ZNPA 3IWZA 4M00A 5DUWA 3KHCA 3POFA 4CU8A 2QQUA 4YYOA 1VAMA 2YUEA 1A8MA 3I4IA 1FV3A 4L99A 3MUZ1 1OLRA 4CCCA 4UOJA 1XE0A 4IV1A 5IFPA 2RMU1 1QOSA 3HWJA 1OOPB 5FYTA 4YZ1A 1AX2A 2HEWF 4MGIE 3FUQA 3RNSA 1Y9QA 4AI2A 3AB0A 2BNMA 4H7LA 4Q4X3 3J8F2 2YB7A 4EV0A 1FI2A 5B4XA 1TE1B 1JOJA 4RS5B 3Q8BA 4IL7A 1M06G 5JSRA 1URXA 3DF0A 5T5OA 4XBNA 3ZX7A 2FCTA 4EN6B 4URAA 1AR81 3SLIA 2AR6A 3JUUA 4XF4A 3VBFA 3J7NA 5FZGA 1GNHA 1K5JA 3INAA 3LA2A 1HKDA 2E7AA 4CDXC 5C3QA 1FMD1 4NHXA 3VDAA 1H6XA 3MW4A 1JZ6A 4HL0A 3DL3A 1YQ8A 1J3PA 1CZSA 2GC2A 2RS11 3ACLA 4XOGA 3M7AA 4YG0A 2F4PA 4UFHA 4A4AA 4DFSA 1U5IA 2ZGQA 3MIGA 5J09A 1VPHA 2QDNA 3Q8EA 5SV8A 2QQPA 1J1TA 2A3YA 5AVAA 1HQWA 3MF6A 1FPN2 5AC91 3BTZA 3H1WA 4D6SA 3I2JA 3LOIA 2CTVA 1KDMA 5H9PA 5BYNA 1WW7A 4XZPA 5BNQA 4YVSB 1G9AA 2I07B 1H4HA 2CV6A 1FOD2 1YHFA 3ECQA 3ZYIB 3CHXA 2VMHA 3SHRA 2QQLA 1LKNA 1VAVA 1GYKA 1RUC2 1PM7A 3R6SA 2RMU3 1XNAA 4AGVA 1PK6C 4FQ4A 2WYSA 1UOFA 5FXXA 4AG4A 4XF9A 2QQNA 5IWFA 2C26A 3HEIA 5EWSA 1RJ7A 4L0PA 2J42A 3AFGA 3ZXDA 4OMDA 4Q4V2 4AVAA 1QF3A 1MACA 2VAUA 2WNVC 4A42A 3WUCA 4LA3A 4TWTA 1QJX2 1VBE2 1TMF2 5FO9B 5JOYA 1R092 1AR83 1IHMA 2RS52 4QPIA 4CDWC 2W1SA 2VVFA 4QQOA 1E5RA 2C4XA 3VD7A 1BHGA 2XQXA 1LOEA 4NRQA 1BJQA 1FMD3 1ZZCA 2ET7A 4QPIC 2VM9A 4UF0A 2A3XA 5ISLA 1UD1A 2ZGNA 2RS13 1UCXA 3O0XA 1GZCA 1U0AA 3ZN6A 2VQUA 3WUDA 2BBVA 3VBUB 3K4AA 4AI0A 4XFBA 1Z0HA 5GJ6A 3W9AA 4QDSA 2WIIB 4ZU4A 1STMA 1NLQA 2B45X 5LBCA 5AC93 2OUHA 2BZDA 2DCYA 1ULCA 3KS7A 1UYPA 1JH5A 3BALA 4FT8A 1Q8OA 1S0DA 2DU1A 2XMLA 4WVVA 4E2GA 2JECA 2F4LA 4XQDA 2XJQA 4K8FA 2RS32 4MHUA 1Q3EA 1F4AA 2QVSB 3OUIA 4GQ7A 3V56A 4Q0PA 1YQ2A 3CJIB 5A70A 3R0RA 1F5JA 3VB9A 1RUE1 3WNNA 4AVTA 4YWAA 3POSA 4XFGA 1ZM1A 4YW3A 1DQ1A 4GKYA 1XNBA 3I7DA 3K3OA 1I5ZA 3LE0A 3JBG1 4L9BA 1REFA 2ZGPA 3ZXGA 4FBFA 4FPJA 3U4SA 4R52A 2Y6LA 4KG0A 3L9JT 3VKLA 1ZZ7A 3O1UA 2BNOA 1S55A 2R042 3MLKA 4FPLA 2ADDA 3BPZA 3GZAA 3FUOA 1J1LA 2DVDA 4M4RA 1V6MA 3KCXA 2R071 1V00A 4WVMA 3N3HA 3N9LA 4QXCA 5IFTA 4QHBA 2DV9A 1VIWB 2IXJA 2KD7A 4W8JA 5F3EA 3T2OA 1YRZA 1VBA2 2OZJA 2H6BA 4QX2A 5FZ9A 4V2VA 5JIAA 3OEBA 3MPBA 2JD4A 1SLCA 1CAUB 3UK9A 1DQ2A 3ZFEB 1US3A 3ZLIA 4YW4A 5LCWL 5DZGA 3QOPA 2E51A 5FLJA 3GHNA 3HMYA 2X5IB 4GA9A 2CGNA 2E53A 3VDCA 1GWMA 1Z78A 1YIPA 2JENA 3ILFA 3AYCA 4O61A 3MV11 2RR11 4UI9L 2X29A 4YW2A 2JG8B 4OQ8A 1DZTA 2LUWA 3ZFFC 4AOCA 4YZ2A 5JI9A 1RUE3 2VUAA 3OBRA 4M0HA 5KWRA 3DECA 4YRDA 3PTYA 3I3MA 4ITCA 2FDFA 2GP3A 2VBPA 3FHQA 5FBJA 1CAVB 3JBG3 3OEAA 4LHLA 5T55A 4CTEA 2WINB 3O0WA 4LUKA 2C5DA 5C71A 4MYEA 1EAH2 2GU9A 3L2YA 1Y9MA 2XJUA 1ND2A 4NRMA 4FFFA 5DPNA 3TEYA 2QQWA 2NM1A 2OVUA 4QKBA 1OA4A 4BU2A 5JIUA 2VQ0A 4LBLA 1AR91 2BFUS 4GZ9A 1DP0A 1AR72 4S2HA 4E4DX 4IESA 1OKOA 1VP6A 2R073 3VBHA 3MBWA 1HV0A 2DCTA 4JTOA 4CPBD 1X82A 1F5FA 1PZ7A 1XNDA 2EIBA 3CL1A 5LBFA 5ANQA 5KHJA 3C3VA 4CSWA 5FYIA 5FDBA 3W5NA 4KNCA 2ZEZA 1J59A 4A3ZA 4IE0A 1DGLA 1JHNA 3OGRA 3CO2A 1F4HA 3Q8AA 5FPVA 3MO4A 4KBBA 5E89A 3HD8B 1H1IA 2V4VA 3FZ3A 2PHTA 5ACA3 3CNAA 5A3MA 4PBOA 2DBIA 2VVEA 2W08A 2OIIA 1W2NA 3PUIA 4JQRA 2RR13 1KQRA 1LOCA 4CCKA 2QBXA 1QHDA 4Q0QA 4Y20A 5LRRA 2PAEA 4XXAA 1VBB2 4A45A 3H3ZA 1HRI1 5JOWA 2DVAA 2PELA 1MS4A 2QQIA 4RQPA 4P9LA 5FQ0A 4QX5A 2A7AA 3GBFA 4LO8A 4BMBA 2IXIA 4XQWA 3WG2A 4KMQA 4L97A 2ZHKA 3RI9A 4GB33 5D8AC 2Y38A 4YM3A 1H2LA 2FD8A 1AR93 3HT1A 3GALA 2DTWA 2IXCA 4L11A 2FBEA 5FLHA 3DYPA 2B46X 4ARXA 3WF0A 4DUXA 3HNYM 5JMCA 3NSTA 4OVEA 5IJRA 3B9CA 4GH4A 2D5HA 1NUKA 1PX4A 2RM21 4BZ4A 2FMDA 3BCWA 3BVCA 3F95A 3T08A 1NCQA 2YROA 3BIEA 2FDHA 1PGSA 1W8HA 3ST7A 1D0GA 1K3IA 3PIJA 1V70A 2JKXA 1W3XA 1BBT2 2B9VA 1CONA 3VBFB 1UY0A 4K40A 1H9WA 1H1MA 4QDRA 3ZXAC 1OFNA 4Q0VA 4BK4A 5JSPA 2WN3A 1Q56A 1RUD1 4AWDA 1A6CA 3P5BA 4AHYA 5BNNB 3DXUA 1GR3A 3WSOA 3QLQA 1GMMA 1XC6A 3HNBM 4IEOA 2YMZA 3ALQA 1GQGA 2O8OA 4UW5A 4Q0SA 4AEDC 5A1AA 4CEYC 1NY71 2ZMLA 4WVZA 2YPJA 3K48A 4C90A 1HRI3 5HXMA 2Y60A 3H8XA 4XEZA 2JIJA 4QM9A 3AKTA 4WM8C 4A41A 5FY8A 3WDTA 4HVRA 1OT5A 4OHVA 1WBFA 4FTBA 2V5YA 4OQ9A 3OBAA 2VCMA 3CF6E 1W6NB 3ETQA 3UNPA 2ZEWA 4F3JA 3PVEA 4BIFA 2WAAA 4NVPA 3SITA 1DYKA 3S30A 1NLRA 1ZZ8A 2VUDA 4I3GA 1RYYA 1DG6A 4LLFA 5LRSA 1X36A 3C7HA 1W8UA 4Q4X2 2IXLA 3TNPB 2W3JA 5C8CC 2RM23 1BMV1 1NCRA 4XHXA 3A0KA 1YI7A 1WMXA 2VL4A 5LASA 1H8TC 4XF0A 3SH5A 4TYSA 1JXNA 1POV0 5IHRA 1TME2 3MF9A 2XLFA 1US2A 4KI5M 1QKQA 1GOHA 3VKOA 3W59A 3RRDA 2FZ2A 3JU9A 1UX7A 1WW5A 4Y1VA 4QPWA 1NQJA 2G9GA 1EYBA 1RUD3 4AQ6A 5FK7A 3GYDA 5H9SA 1GP5A 3B7MA 1YQ6A 1I1EA 1ACCA 1XYNA 2OX0A 2BBAA 2VCBA 3MICA 5FZLA 4Y22A 3UGHA 3WNOA 5BNOB 2X10A 5C7GA 3P3NA 4K6BA 1IS3A 5K8SA 1UMHA 3ES1A 1LHNA 3ATGA 3ZIWA 3AYAA 2IVIB 4CCLA 2EAKA 2W1WA 2Z4FA 2YFZA 2TNFA 4QQ2A 5EJ1B 1VALA 1RUG2 1ND3C 2Q1MA 4UBGA 1O4YA 1NZCA 2AZ5A 4INDA 3KCCA 4UFIA 1UX6A 5FY1A 4HSJA 3WCRA 4TSVA 4M3CF 3I3QA 4EROA 5FY7A 2B4KA 5HPOA 2EXJA 4BMEA 5FMDA 2C24A 3LGRA 3NL1A 1PGW1 3BTYA 1COV1 4CXXA 3LSEA 4QB1A 1NA1A 3RSJA 4YVWB 1CAWA 4LE3A 3RMXA 1W3VA 1X50A 1QOOA 3C8XA 2HKXA 5FPAA 2ZXQA 4BCUA 1NA1C 2BWCA 1PIV3 1QQP1 4CEWB 5F6KA 3RQ0A 2HWC1 4OLLA 3EQEA 4NAMA 2ZGKA 1FMD2 2WWSA 3GDBA 3ZDVA 4GMP1 2QQJA 5I0UA 4ZS3A 2YZ4A 4IE6A 3LZZA 4A6SA 2QKDA 2RS12 2ADEA 3OUHA 4IV3B 4I0WB 5FZ6A 5C4WC 3IDBB 1I9RA 4JGYA 2JG9C 4K8RB 5C5UA 5J48A 3EJKA 4HKLA 4P9IA 3DN7A 2VTXJ 5FP4A 4DUVA 5AC92 5JCTA 1PNGA 1JOBA 2JDKA 1O5UA 1OPMA 1AZDA 4UFJA 3IPVA 3CEWA 1JS9A 4AI8A 3NAPC 2DTYA 1PO21 3PHMA 2D6LX 1SLTA 3RJ2X 4EE2A 5CISA 1W9WA 1GQHA 1BQPA 3BIWE 1W28A 1COV3 5H9RA 2TUNA 3WG1A 5IK5A 4O7XA 1JYNA 2BYVE 4AAPA 3IMNA 1S0CA 3ZMOA 4DINB 1N1SA 4ISQA 4S2GA 2DF7A 4A7YA 2RV9A 3TB0A 3K3NA 2JD9A 2HWC3 1PO11 2PQSA 4CXYA 3MLJA 4M01A 1IG3A 3FBMA 3VBRA 1DLCA 4CU6A 1W6OB 4XZUG 2HBUA 1JTZX 1Q8QA 4ARYA 2RDRA 2WFPA 4GMP3 3USSA 4CUAA 4KGQA 3IM0A 3DPRB 4M3CB 3DYOA 5FYYA 4COZA 3N4MA 1AYM1 4QD2A 3GZUC 4L92A 4QB2A 1W9SA 1Y43B 1CX4A 1JZ5A 2HEVF 2E33A 5A32B 1OOPC 3CQOA 1H2MA
chains in the Genus database with same CATH topology
1UY4A 4XVHA 3NJVA 2WAOA 3CDZB 2VMFA 4QB6A 2ORXA 3ABZA 1WKYA 3K77A 4YPJA 2W9XA 1DYOA 4JX0A 4XUTA 1W8NA 4DUWA 1UYYA 2EIDA 3HPNA 3I3DA 1I5PA 3E1F1 1W9TA 2LW8A 3K46A 2WABA 1O8SA 1O8PA 2VZSA 4MADA 3I2KA 2X09A 2J1TA 5DN2A 4E8DA 1JYXA 3LQCA 1NKGA 3OGVA 1IQDC 4MGQA 3UESA 2VZTA 2ORZA 3PUHA 4XUOA 4CU8A 2DDUA 1JZ4A 3DYMA 3MUZ1 4UOJA 5IFPA 2WUHA 3OGSA 3GM8A 3A7QA 2VZUA 2JDAA 4XUPA 5J1XA 2VC9A 2YB7A 5B4XA 2DCJA 1T2XA 4OZOA 3T0AA 3MV01 3K75B 2VZ3A 4QX1A 4QX3A 1NAEA 3LEKA 2OKXA 1JZ6A 3VDAA 1H6XA 3HNMA 1W99A 1CZSA 4A4AA 2BGPA 3MUY1 2VCCA 5JXGA 3C7FA 2J1AA 2E31A 4ZZ8A 5C70A 4DXRA 3WF3A 1JYVA 3I2JA 3SKVA 3WQBA 3LPGA 1ULPA 1UXXX 3ECQA 3ETPA 2W1UA 2QQLA 1GQPA 1XNAA 5G04L 4P5YA 2WYSA 3D3AA 3THCA 4MOAA 4W50A 4AG4A 2QQNA 1UYXA 4QX0A 3SEEA 2C26A 3HEIA 4RYDA 1OF3A 4L0PA 1H6YA 2HLEA 2WDBA 4OMDA 4A42A 4D8MA 2WO3A 4FI9A 4TTGA 2W1SA 4KWUA 3I2FA 2C4XA 1SDDB 3VD7A 1BHGA 2XQXA 4AAXA 2VM9A 2VO5A 4CUCA 4CVUA 1OF4A 3K4DA 4OYUA 3T2PA 3OB8A 1P8JA 2LS6A 2VQUA 4ZY9A 1L7RA 3NRUA 5DQ0A 3K4AA 1JZ2A 4XUNA 4QDSA 3I2GA 1JZ8A 2BZDA 3HOBA 2J1SA 5JR2A 1OH4A 2WO2A 4W4ZA 3VD3A 1F4AA 3IAPA 2W5FA 3ACIA 1JHJA 4MGSA 1CIYA 1R64A 1L7QA 1YQ2A 2J1UA 3T0BA 1XPWA 3WNNA 3EYPA 2YC4A 1JU4A 3LE0A 3C7GA 3I97A 4BDVB 2Y6LA 3P6BA 2ID4A 1PMHX 3ACGA 3BN6A 2VMCA 4M4RA 5IFTA 2VZVA 2W46A 3WF4A 2XHNA 2KD7A 4W8JA 1ULOA 3T2OA 2W95A 4CU9A 4LKSA 2HYXA 4QX2A 3LEGA 3OEBA 2WN2A 4XURA 4LPLA 3UETA 4M4PA 2C9KA 1US3A 3WNKA 5EJZB 2Y6JA 5LCWL 3A22A 2J7MA 3VDCA 1J84A 4IUGA 2Y6GA 4DEVA 1SG3A 3MV11 4DXSA 4UI9L 2ZEYA 1UY3A 1K45A 5JUVA 5LA1A 3DECA 3BGAA 3K4ZA 2YC2A 1GUIA 2J1VA 3FHQA 3OEAA 1J83A 2JE8A 5LA2A 5C71A 5DPNA 2BGOA 4GZ9A 1DP0A 2QQOA 3MBWA 2WZEA 2RVAA 2EIBA 4JKLA 4LQRA 4BK5A 3W5NA 1UXZA 3VD5A 3VDBA 2ZEZA 4A3ZA 3OGRA 1F4HA 1UY2A 4MO3M 2V72A 3MO4A 3GGLA 2W91A 2V4VA 4JHZA 1K12A 1JYWA 4QAWA 2J22A 3A23A 2XOMA 4DUVA 1TG7A 1EUUA 3PUIA 5CYYA 3WNPA 3W5MA 2QBXA 2W1QA 1NX9A 4A6OA 4A45A 4CU7A 3I2IA 3NJXA 3VD9A 2QQIA 5CZKA 1CZTA 2QQKA 1JZ3A 3FN9A 4Z2AA 4LHSA 1TVGA 4KMQA 2R7EB 4P08A 3IAQA 3SEPA 1UZ0A 2EIEA 2VZQA 4DXTA 3DYPA 2VQTA 2VR4A 1JU3A 3IB3A 4P00B 3WF0A 4ARXA 1XNTA 3HNYM 2E32A 4DUXA 1WCQA 5JXHA 4XUQA 3OG2A 5IJRA 2YG0A 1NUKA 1PX4A 5LA0A 3THDA 3I3EA 4PT6A 3FHAA 4TXWA 4GWIA 3T08A 4RN5A 1K42A 3IDAA 1K3IA 2W92A 3IIIA 1W8OA 2WQ8A 2JKXA 3EB7A 3LPFA 2B9VA 2VCAA 3GXUA 1UY0A 4QDRA 4BK4A 2WN3A 2EICA 3WSOA 3LEIA 5JMOA 1GMMA 1XC6A 3HNBM 3SKJE 5A1AA 3T09A 5EIYB 5HXMA 2VMDA 1GOFA 3C7OA 1UY1A 4A41A 1SHWB 2QQMA 1MPXA 1OT5A 4ET7A 5G05L 4HG6B 3WEZA 3OBAA 2WZ8A 3ACHA 3UNPA 2W47A 2X05A 3WNLA 2ZEWA 2WAAA 4PQQA 1RYYA 3WF2A 3C7HA 5FUIA 3C7EA 2W87A 3WNMA 1UYZA 2W3JA 1O59A 3CIHA 2WBKA 2VL4A 2Y64A 1W0NA 2V5DA 5IHRA 2ZEXA 1JI6A 3F2ZA 1US2A 4KI5M 1GOHA 1UX7A 4QPWA 2J1EA 3JXSA 3NQHA 5B4NA 2BBAA 2VCBA 3WNOA 4E8CA 2DCKA 2X10A 5C7GA 3ZM8A 1UMHA 3J7HA 2W1WA 2YFUA 4QDQA 2Z4FA 2YFZA 4OMCA 1JZ7A 2VZ1A 5EJ1B 1OD3A 2Y8KA 1D7PM 3WF1A 2J1RA 2B4KA 5HPOA 3ACFA 5IYYA 1CZVA 2CDOA 2RJ2A 2XONA 4QB1A 4JKKA 3T2QA 2VMEA 2CDPA 2VTFA 4ZZ5A 4ZXEA 3C8XA 2ZXQA 2E26A 5DMYA 1EUTA 3P1IA 4P02B 3HN3A 2Y6HA 3GDBA 2QQJA 1UWWA 4CUBA 2VZRA 4BJ0A 4OUEA 2VZPA 3FL7A 4BXSV 3A21A 2L9LA 1GU3A 1HN1A 3CMGA 1LNSA 3HJRA 3I2HA 3CZUA 4D0QA 2WO1A 2W94A 4UAPA 5F7UA 1GOGA 1KEXA 1KGYA 3AC0A 4PF1A 3CKHA 3I3BA 2BERA 1W9WA 4DEQA 5I0DA 1PMJX 3NNGA 1JYNA 3U37A 2RV9A 2VZOA 4A44A 2JD9A 2PQSA 3CZJA 1UMIA 4GWJA 2VJXA 1DLCA 4CU6A 3VD4A 4XZUG 4ARYA 1CX1A 4CUAA 2VOTA 4JKMA 3DYOA 2Y6KA 4QB2A 3T0DA 1GNYA 1W9SA 5JXJA 1JZ5A 2E33A 1PX3A 3CQOA 5JXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UY4 A;  4XVH A;  3NJV A;  2WAO A;  3CDZ B;  2VMF A;  4QB6 A;  2ORX A;  3ABZ A;  1WKY A;  3K77 A;  4YPJ A;  2W9X A;  1DYO A;  4JX0 A;  4XUT A;  1W8N A;  4DUW A;  1UYY A;  2EID A;  3HPN A;  3I3D A;  1I5P A;  3E1F 1;  1W9T A;  2LW8 A;  3K46 A;  2WAB A;  1O8S A;  1O8P A;  2VZS A;  4MAD A;  3I2K A;  2X09 A;  2J1T A;  5DN2 A;  4E8D A;  1JYX A;  3LQC A;  1NKG A;  3OGV A;  1IQD C;  4MGQ A;  3UES A;  2VZT A;  2ORZ A;  3PUH A;  4XUO A;  4CU8 A;  2DDU A;  1JZ4 A;  3DYM A;  3MUZ 1;  4UOJ A;  5IFP A;  2WUH A;  3OGS A;  3GM8 A;  3A7Q A;  2VZU A;  2JDA A;  4XUP A;  5J1X A;  2VC9 A;  2YB7 A;  5B4X A;  2DCJ A;  1T2X A;  4OZO A;  3T0A A;  3MV0 1;  3K75 B;  2VZ3 A;  4QX1 A;  4QX3 A;  1NAE A;  3LEK A;  2OKX A;  1JZ6 A;  3VDA A;  1H6X A;  3HNM A;  1W99 A;  1CZS A;  4A4A A;  2BGP A;  3MUY 1;  2VCC A;  5JXG A;  3C7F A;  2J1A A;  2E31 A;  4ZZ8 A;  5C70 A;  4DXR A;  3WF3 A;  1JYV A;  3I2J A;  3SKV A;  3WQB A;  3LPG A;  1ULP A;  1UXX X;  3ECQ A;  3ETP A;  2W1U A;  2QQL A;  1GQP A;  1XNA A;  5G04 L;  4P5Y A;  2WYS A;  3D3A A;  3THC A;  4MOA A;  4W50 A;  4AG4 A;  2QQN A;  1UYX A;  4QX0 A;  3SEE A;  2C26 A;  3HEI A;  4RYD A;  1OF3 A;  4L0P A;  1H6Y A;  2HLE A;  2WDB A;  4OMD A;  4A42 A;  4D8M A;  2WO3 A;  4FI9 A;  4TTG A;  2W1S A;  4KWU A;  3I2F A;  2C4X A;  1SDD B;  3VD7 A;  1BHG A;  2XQX A;  4AAX A;  2VM9 A;  2VO5 A;  4CUC A;  4CVU A;  1OF4 A;  3K4D A;  4OYU A;  3T2P A;  3OB8 A;  1P8J A;  2LS6 A;  2VQU A;  4ZY9 A;  1L7R A;  3NRU A;  5DQ0 A;  3K4A A;  1JZ2 A;  4XUN A;  4QDS A;  3I2G A;  1JZ8 A;  2BZD A;  3HOB A;  2J1S A;  5JR2 A;  1OH4 A;  2WO2 A;  4W4Z A;  3VD3 A;  1F4A A;  3IAP A;  2W5F A;  3ACI A;  1JHJ A;  4MGS A;  1CIY A;  1R64 A;  1L7Q A;  1YQ2 A;  2J1U A;  3T0B A;  1XPW A;  3WNN A;  3EYP A;  2YC4 A;  1JU4 A;  3LE0 A;  3C7G A;  3I97 A;  4BDV B;  2Y6L A;  3P6B A;  2ID4 A;  1PMH X;  3ACG A;  3BN6 A;  2VMC A;  4M4R A;  5IFT A;  2VZV A;  2W46 A;  3WF4 A;  2XHN A;  2KD7 A;  4W8J A;  1ULO A;  3T2O A;  2W95 A;  4CU9 A;  4LKS A;  2HYX A;  4QX2 A;  3LEG A;  3OEB A;  2WN2 A;  4XUR A;  4LPL A;  3UET A;  4M4P A;  2C9K A;  1US3 A;  3WNK A;  5EJZ B;  2Y6J A;  5LCW L;  3A22 A;  2J7M A;  3VDC A;  1J84 A;  4IUG A;  2Y6G A;  4DEV A;  1SG3 A;  3MV1 1;  4DXS A;  4UI9 L;  2ZEY A;  1UY3 A;  1K45 A;  5JUV A;  5LA1 A;  3DEC A;  3BGA A;  3K4Z A;  2YC2 A;  1GUI A;  2J1V A;  3FHQ A;  3OEA A;  1J83 A;  2JE8 A;  5LA2 A;  5C71 A;  5DPN A;  2BGO A;  4GZ9 A;  1DP0 A;  2QQO A;  3MBW A;  2WZE A;  2RVA A;  2EIB A;  4JKL A;  4LQR A;  4BK5 A;  3W5N A;  1UXZ A;  3VD5 A;  3VDB A;  2ZEZ A;  4A3Z A;  3OGR A;  1F4H A;  1UY2 A;  4MO3 M;  2V72 A;  3MO4 A;  3GGL A;  2W91 A;  2V4V A;  4JHZ A;  1K12 A;  1JYW A;  4QAW A;  2J22 A;  3A23 A;  2XOM A;  4DUV A;  1TG7 A;  1EUU A;  3PUI A;  5CYY A;  3WNP A;  3W5M A;  2QBX A;  2W1Q A;  1NX9 A;  4A6O A;  4A45 A;  4CU7 A;  3I2I A;  3NJX A;  3VD9 A;  2QQI A;  5CZK A;  1CZT A;  2QQK A;  1JZ3 A;  3FN9 A;  4Z2A A;  4LHS A;  1TVG A;  4KMQ A;  2R7E B;  4P08 A;  3IAQ A;  3SEP A;  1UZ0 A;  2EIE A;  2VZQ A;  4DXT A;  3DYP A;  2VQT A;  2VR4 A;  1JU3 A;  3IB3 A;  4P00 B;  3WF0 A;  4ARX A;  1XNT A;  3HNY M;  2E32 A;  4DUX A;  1WCQ A;  5JXH A;  4XUQ A;  3OG2 A;  5IJR A;  2YG0 A;  1NUK A;  1PX4 A;  5LA0 A;  3THD A;  3I3E A;  4PT6 A;  3FHA A;  4TXW A;  4GWI A;  3T08 A;  4RN5 A;  1K42 A;  3IDA A;  1K3I A;  2W92 A;  3III A;  1W8O A;  2WQ8 A;  2JKX A;  3EB7 A;  3LPF A;  2B9V A;  2VCA A;  3GXU A;  1UY0 A;  4QDR A;  4BK4 A;  2WN3 A;  2EIC A;  3WSO A;  3LEI A;  5JMO A;  1GMM A;  1XC6 A;  3HNB M;  3SKJ E;  5A1A A;  3T09 A;  5EIY B;  5HXM A;  2VMD A;  1GOF A;  3C7O A;  1UY1 A;  4A41 A;  1SHW B;  2QQM A;  1MPX A;  1OT5 A;  4ET7 A;  5G05 L;  4HG6 B;  3WEZ A;  3OBA A;  2WZ8 A;  3ACH A;  3UNP A;  2W47 A;  2X05 A;  3WNL A;  2ZEW A;  2WAA A;  4PQQ A;  1RYY A;  3WF2 A;  3C7H A;  5FUI A;  3C7E A;  2W87 A;  3WNM A;  1UYZ A;  2W3J A;  1O59 A;  3CIH A;  2WBK A;  2VL4 A;  2Y64 A;  1W0N A;  2V5D A;  5IHR A;  2ZEX A;  1JI6 A;  3F2Z A;  1US2 A;  4KI5 M;  1GOH A;  1UX7 A;  4QPW A;  2J1E A;  3JXS A;  3NQH A;  5B4N A;  2BBA A;  2VCB A;  3WNO A;  4E8C A;  2DCK A;  2X10 A;  5C7G A;  3ZM8 A;  1UMH A;  3J7H A;  2W1W A;  2YFU A;  4QDQ A;  2Z4F A;  2YFZ A;  4OMC A;  1JZ7 A;  2VZ1 A;  5EJ1 B;  1OD3 A;  2Y8K A;  1D7P M;  3WF1 A;  2J1R A;  2B4K A;  5HPO A;  3ACF A;  5IYY A;  1CZV A;  2CDO A;  2RJ2 A;  2XON A;  4QB1 A;  4JKK A;  3T2Q A;  2VME A;  2CDP A;  2VTF A;  4ZZ5 A;  4ZXE A;  3C8X A;  2ZXQ A;  2E26 A;  5DMY A;  1EUT A;  3P1I A;  4P02 B;  3HN3 A;  2Y6H A;  3GDB A;  2QQJ A;  1UWW A;  4CUB A;  2VZR A;  4BJ0 A;  4OUE A;  2VZP A;  3FL7 A;  4BXS V;  3A21 A;  2L9L A;  1GU3 A;  1HN1 A;  3CMG A;  1LNS A;  3HJR A;  3I2H A;  3CZU A;  4D0Q A;  2WO1 A;  2W94 A;  4UAP A;  5F7U A;  1GOG A;  1KEX A;  1KGY A;  3AC0 A;  4PF1 A;  3CKH A;  3I3B A;  2BER A;  1W9W A;  4DEQ A;  5I0D A;  1PMJ X;  3NNG A;  1JYN A;  3U37 A;  2RV9 A;  2VZO A;  4A44 A;  2JD9 A;  2PQS A;  3CZJ A;  1UMI A;  4GWJ A;  2VJX A;  1DLC A;  4CU6 A;  3VD4 A;  4XZU G;  4ARY A;  1CX1 A;  4CUA A;  2VOT A;  4JKM A;  3DYO A;  2Y6K A;  4QB2 A;  3T0D A;  1GNY A;  1W9S A;  5JXJ A;  1JZ5 A;  2E33 A;  1PX3 A;  3CQO A;  5JXI A; 
#chains in the Genus database with same CATH topology
 4LIT A;  4K9S A;  1QJE A;  1SLI A;  3SXW A;  1G86 A;  5APA A;  4ZON A;  1RUN A;  1IKQ A;  3KF5 A;  2Y0I A;  3K77 A;  4RS5 C;  4CCM A;  2OQ7 A;  1S1A A;  4NR1 A;  3WHU A;  1YCI A;  4AF9 A;  5ABJ B;  1DYO A;  2WYF A;  1VLN A;  5CKQ A;  4LBM A;  4CDU C;  1MS5 A;  3AZW A;  2CHH A;  3H7J A;  4BH9 A;  2WNU A;  2BOJ A;  1QH6 A;  1W9T A;  4FSJ A;  1S0E A;  3GBW A;  5T3N A;  1W6M B;  1LEC A;  1O8S A;  4N53 A;  1ULE A;  1O8P A;  2D3R A;  1QXJ A;  2H0B A;  1JW6 A;  1PNF A;  3JBG 2;  5CFD A;  4PIZ A;  3ZYB A;  4YW1 A;  1JYX A;  5IT6 A;  1PO1 3;  1X9P A;  4LBN A;  3OGV A;  2VW2 A;  4MGQ A;  3ON7 A;  1K5M A;  2R07 2;  2HYK A;  4OHX A;  5FMO S;  2BOI A;  2ORZ A;  3TN9 1;  4YNI A;  5F5C A;  4K3U A;  1BLZ A;  2WLP A;  4NAO A;  4Q26 A;  4XUO A;  1N3P A;  1BEV 1;  2BV4 A;  1AYM 3;  1DYP A;  1GZT A;  1QGL A;  2DDU A;  1EY2 A;  4GH4 B;  4EQV A;  3V0B A;  1DLL A;  2DVB A;  4G9S B;  4QXK A;  3NMB A;  1OI6 A;  2K0G A;  3LKJ A;  2A3W A;  1HLC A;  1KJL A;  1A3K A;  1W2U A;  4MX3 A;  3ZDS A;  4I02 A;  4YAR A;  4YZ3 A;  3ZSK A;  2GC0 A;  3RYP A;  5LBE A;  2YGM A;  1L3J A;  3B9I A;  4AVS A;  5C3S A;  4FPE A;  2BEO A;  4XJZ A;  5K4L A;  3AX4 A;  4OZO A;  3T0A A;  3MV0 1;  5LK5 A;  3UL2 A;  3K75 B;  4IGO A;  4RR3 B;  2NQY A;  4P14 A;  4LBQ D;  4JC1 A;  2ATF A;  4QX3 A;  1NAE A;  2XH6 A;  5FXZ A;  2XKO A;  5I8Y A;  1DQ4 A;  1MQT C;  4A7K A;  2JDN A;  1WW6 A;  4CDQ A;  3OY8 A;  1W99 A;  4LNV A;  4W6W A;  2CNA A;  4LKF A;  3PUR A;  4EWA A;  3SMH A;  5IVE A;  1F35 A;  3BI3 A;  4XTP A;  4W6Y A;  1JYI A;  4FTS A;  2MHF A;  2KM2 A;  4NRP A;  4EZ4 A;  4WM7 B;  5DUV A;  2D97 A;  3VL8 A;  1AR9 2;  3WF3 A;  2V09 A;  1LUL A;  3AZV A;  3B02 A;  4B29 A;  3TN9 3;  2SBA A;  3CBN A;  3EXU A;  4ONU A;  1YYN A;  3WW2 A;  1N3Q A;  1PVX A;  2JKB A;  2FDK A;  4FPO B;  1BEV 3;  4JTN A;  3TWI A;  5M0T A;  1UXX X;  2HWD 1;  2TBV A;  3ETP A;  4BQ4 A;  2EIG A;  1NCR B;  1TZO A;  3VKM A;  5FPU A;  5IAT A;  2G19 A;  1X33 A;  2WQZ C;  3RJR A;  4YGD A;  2WT0 A;  5G04 L;  5C5T A;  3BPS A;  3CJI C;  5LB6 A;  1UYX A;  4HN0 A;  4LUL A;  2QE3 A;  1W6P B;  2NYY A;  1H6Y A;  3VBO B;  2LAL A;  5A7O A;  3ZSM A;  4Z8B A;  2HLE A;  3MPP G;  3I2O A;  2JJ6 A;  2WDB A;  2VTX A;  3RYR A;  4UW4 A;  4Q1P A;  2VUL A;  1AJO A;  4RGK A;  4JVA A;  3MGU A;  4BHP A;  2OT7 A;  2WO3 A;  1HXS 1;  1VRB A;  4ASL A;  2YV8 A;  3ZXF A;  2XDV A;  4D7T A;  3LAG A;  2IUW A;  2YBP A;  1HRI 2;  5FIX A;  1UAI A;  4AAX A;  4AVB A;  2FCU A;  3QBQ A;  3GZT B;  3HIF A;  4CUC A;  1OF4 A;  4OYU A;  3ILN A;  3T2P A;  4FPG A;  1CWP A;  3OB8 A;  1P8J A;  2LS6 A;  1XYP A;  2D93 A;  4LJH A;  1IG0 A;  2JWP A;  3B00 A;  2W68 A;  2WNE A;  1JZ8 A;  1BVP 1;  3RWK X;  3ZFE C;  1HV1 A;  3GJA A;  3HQR A;  3ZMN A;  4E4Z A;  4YFZ A;  4QGN A;  1HJF A;  1SEF A;  3HOB A;  4F7Z A;  2ZOE B;  5CNA A;  2GNT A;  2J1S A;  4DY5 A;  1DF0 A;  1OH4 A;  3LIH A;  3WDU A;  1E57 A;  2HWD 3;  1RMU 1;  2RM2 2;  4W4Z A;  3PTR B;  3VZN A;  3WDW A;  5LA9 A;  3ZXE A;  2W5F A;  1UL9 A;  2HEY F;  4QQL A;  1CIY A;  4ATF A;  1L7Q A;  3UJO A;  2J1U A;  3WVJ A;  2JG8 C;  4NHK A;  4PF5 A;  4XFA A;  1DGR N;  2BVV A;  2VUC A;  3EYP A;  4GWN A;  3UKT A;  2NMN A;  1D4V B;  2XJV A;  2JDP A;  4FPY A;  5FOJ B;  4N7U A;  1UIJ A;  1OQD A;  3C7G A;  4JAA A;  1RUD 2;  2GND A;  1DIW A;  1HXS 3;  1AR6 1;  3P6B A;  4N43 A;  4XJ9 A;  4C0B A;  3G7D A;  4NHM A;  4XF3 A;  1FYU A;  4JGY B;  1N47 A;  1REE A;  2AGS A;  5KC6 A;  3WQ7 A;  1NY7 2;  2Z42 A;  4LBQ A;  5A3N A;  5C9A C;  5CG9 A;  5EP9 A;  4R8H A;  2VZV A;  2ZMK A;  1GZW B;  1FAT A;  3BOD A;  2WKK A;  4B8E A;  2NZ9 A;  2ZHM A;  4JGZ A;  5FYV A;  4BA6 A;  4QU2 A;  4IEZ A;  1RGS A;  3JCI A;  3TRS B;  3O7O A;  5FZ8 A;  5BV6 A;  2ZHN A;  5CEH A;  3U0Z A;  3BKZ A;  1KDK A;  3VLB B;  2FHR A;  2HBT A;  5DAX A;  2WN2 A;  3OYW B;  4LPL A;  4HPK A;  4M4P A;  2C9K A;  2QQV A;  3LA7 A;  3W21 A;  2Y6J A;  5KXD A;  2D6O X;  1Y4W A;  3A22 A;  3VKN A;  2ZX1 A;  3AK0 A;  2PN5 A;  1ASJ 1;  1NT0 A;  4NPR A;  5CKN A;  1QWR A;  1EV1 1;  4FXK B;  1YIF A;  4HKO A;  1SLL A;  4Q29 A;  3ZFG B;  4HT1 T;  3T1L A;  1UU5 A;  1RMU 3;  4C0H A;  1BMV 2;  4IEV A;  5FTT C;  1XXN A;  4DEV A;  1SG3 A;  5IAV A;  2UYA A;  2VU9 A;  4UT5 A;  1YJL A;  1K45 A;  3FLT A;  5JUV A;  3GJB A;  4YW7 A;  2K9Z A;  3RZG A;  4NIG A;  5EJ3 A;  3SH4 A;  2EVX A;  2G9F A;  5J98 B;  3VBR B;  1W90 A;  1IPS A;  4CDX A;  1RC6 A;  2J1V A;  1AXY A;  2VNG A;  5HCH A;  1E5H A;  2Q8D A;  3MI8 A;  1D4M 1;  4WBB A;  2XPJ A;  4DB5 A;  1AR6 3;  5LY2 A;  2UU8 A;  4PDW B;  4FFG A;  5F9T A;  2HH9 A;  2BGO A;  3AMM A;  1UO9 A;  5F8P A;  3RZM A;  1A34 A;  2P37 A;  2ZA9 A;  2AYH A;  2R49 A;  2WZE A;  1PX3 A;  2Y33 A;  2XJT A;  4QHO A;  4XFF A;  5IVV A;  4JKL A;  2OA2 A;  1GLH A;  3FHI B;  4XFH A;  3ZSE A;  4BK5 A;  1RUO A;  3WCS A;  1C8N A;  1WA4 A;  2JE9 A;  1RUF 1;  4AGR A;  1X7N A;  1UY2 A;  1YFX A;  3FFQ A;  1U12 A;  1PK6 A;  3U11 A;  4E2S A;  3FLP A;  3SC7 X;  1PM4 A;  1PGW 2;  1ASJ 3;  2WNU B;  4PIY A;  1EV1 3;  4FOW A;  1COV 2;  1CIW A;  4IEQ A;  2ZGU A;  3DUI A;  2D7F A;  2WFF 1;  4I30 A;  2WNV A;  3T4V A;  5BNN C;  1RVF 1;  3RFR A;  4DIQ A;  4D6Q A;  4XAA A;  5CFD B;  1WLC A;  2VW1 A;  1QQP 2;  4A6O A;  4CDW A;  4LLO A;  2XVL A;  3VHP A;  2JDU A;  1SCS A;  1EP0 A;  4YGE A;  1NXD 1;  4BPZ A;  3SQO A;  2WC2 A;  2IXH A;  3HQU A;  1JZ3 A;  3FN9 A;  1UPS A;  2EXH A;  5A3L A;  1D4M 3;  4LHS A;  2R7E B;  3MW3 A;  3IAQ A;  3KQR A;  5EPA A;  4FQZ A;  1ENQ A;  2E7T A;  2K46 A;  2XVG A;  3V0B B;  2D6N A;  3MFC A;  2PHD A;  5JZG B;  2VR4 A;  3IB3 A;  4ZU5 A;  3WT3 A;  5JSO A;  3OCP A;  4QQP A;  3LA3 A;  2QTW B;  2YG0 A;  4BQ3 A;  4IW3 A;  1QMJ A;  4RA0 A;  5A7N A;  3WW4 A;  2WZR 1;  5FK8 A;  2UWB A;  4AVV A;  1RUF 3;  2BRT A;  1OMI A;  3EO6 A;  1K42 A;  3WW1 A;  2BTV C;  1I6X A;  3QAC A;  1PO2 2;  4GXL A;  1O6U A;  1FV2 A;  1KD7 A;  3VDD C;  3LPF A;  1WUV A;  3N9Q A;  4CUG A;  1T6G C;  1B35 B;  1FNZ A;  4NOT A;  4E4H A;  3KV4 A;  4OFG A;  5K7P A;  1D2S A;  2PHX A;  4NN0 A;  3LF7 A;  5E1R A;  5FCC A;  1QJF A;  2WFF 3;  3PU3 A;  1Z7S 1;  4IDZ A;  3U1X A;  1RVF 3;  3SKJ E;  4CCN A;  3ITQ A;  5JVV A;  2VW0 A;  3T09 A;  2PHW A;  1IS6 A;  1W9F A;  5BNO C;  2JXA A;  4I01 A;  5EIY B;  3IBM A;  5A6Z A;  5BNP C;  2YY1 A;  2VOK A;  1WGP A;  2MEV 1;  2JDM A;  3IIA A;  3C7O A;  1UY1 A;  5L7O B;  1W8W A;  3H7Y A;  1H4G A;  1O91 A;  1X8M A;  1SZB A;  1DBN A;  3N7M A;  4DXZ A;  1LU1 A;  3POB A;  5G05 L;  1DGR A;  3MIH A;  3WEZ A;  1N1V A;  1GWK A;  4Y33 A;  3RZJ A;  1AYM 2;  5E16 A;  1MEC 1;  1UZW A;  4C1X A;  3MW2 A;  5FMC A;  2EF6 A;  5FUI A;  3C7E A;  2W87 A;  1U5X A;  1UYZ A;  1O59 A;  2RG4 A;  1ALY A;  2WZR 3;  4YVW C;  5CG8 A;  5J7M A;  1UIK A;  3KZ4 C;  5F2S A;  3E5U A;  5I8T A;  2Y64 A;  2DFC A;  3UYJ A;  4XFC A;  2BQP A;  2NPI A;  4CEW C;  4Y1U A;  5JOZ A;  1ZBE 3;  4QPG A;  5ACA 1;  3ZFF A;  4FFH A;  3N9N A;  4U36 A;  4CA9 A;  4DPN A;  3FC0 A;  3ORJ A;  2PAK A;  5A6Y A;  4QPG C;  3JXS A;  1XU2 A;  1QNY A;  3NQH A;  2DU0 A;  3RMY A;  4HET A;  5CFC B;  1Z7S 3;  2B5H A;  3OSD A;  4GKX A;  4I0A A;  4IV3 C;  1NOV A;  1H0B A;  4E8C A;  4QGM A;  3VBS B;  4RFR B;  1C3H A;  1OKQ A;  5AFE A;  3AKP A;  3BYW A;  3VHN A;  2MEV 3;  2GH8 A;  2WRA A;  4QDQ A;  4GB3 1;  4DO0 A;  1JZ7 A;  5IK4 A;  1YC6 1;  2VZ1 A;  3TN9 2;  5FXW A;  4HMZ A;  4COY A;  1OD3 A;  2BFU L;  3LD8 A;  3POE A;  4Y24 A;  5FJK A;  1BEV 2;  5A80 A;  5HBA A;  5I91 A;  1HB3 A;  2Y8K A;  2Z2S B;  4MV2 A;  1ODN A;  1WCD J;  1MEC 3;  3USU A;  1OH3 A;  1M4W A;  1VB2 A;  2AEN A;  4LO5 B;  2J1R A;  4KU7 A;  3J7L A;  4LHN A;  2WNO A;  4LEJ A;  4I0B A;  4Q5O A;  3AP4 A;  3WG4 A;  3E6B A;  5LWB A;  4GAL A;  4CZS A;  4JV4 A;  4JKK A;  2R1D A;  3KB5 A;  3KGL A;  5DAW A;  1RUH 1;  3T2T A;  1SFP A;  1LOA A;  3D8C A;  1AUY A;  1G9D A;  2KXL A;  2E26 A;  2A75 A;  2PQQ A;  1OBN A;  2O0O A;  2ZTN A;  1E5I A;  1ENX A;  1SDW A;  4JHT A;  1EUT A;  3P1I A;  5DDJ 1;  1GSL A;  3GZE A;  4YM0 A;  2Y6H A;  3V0A B;  2YHJ A;  4MXW A;  3LFM A;  5K9Y A;  2Q1F A;  1CAX A;  1V9U 2;  3JD7 1;  4XE9 A;  4WV8 A;  4Q4W 1;  4XDQ A;  3DPR C;  2PMW B;  2VOV A;  2VZP A;  3AXE A;  3HR9 A;  1MR5 A;  3A21 A;  3AVR A;  4AEJ A;  3N9P A;  1GU3 A;  2P3K A;  4GJZ A;  5D8A A;  4MH0 E;  3CMG A;  3WG3 A;  3I2H A;  1W6Q A;  2W94 A;  5A1F A;  1YO8 A;  5T5J A;  2P6C A;  4I09 A;  1IKP A;  4AZZ A;  1H30 A;  2BU9 A;  1D2Q A;  4IV1 B;  2JDH A;  4QMA A;  4AL9 A;  3HBK A;  1RJ8 A;  2A6X A;  2HWD 2;  4FOQ A;  4FP2 A;  4XIK A;  5EZW A;  4PF1 A;  3VZO A;  3B5L B;  1HDK A;  5ABJ C;  2ENR A;  1DGW X;  3RYK A;  4DOU A;  3AMP A;  4DRV A;  3GCX A;  3ZVX A;  1AXZ A;  2AEY A;  5I0D A;  1V6N A;  1ZZ9 A;  3M70 A;  4LE4 A;  4GAZ A;  4NJ4 A;  1OHF A;  4X6R B;  2Q8E A;  3WD5 A;  4BIO A;  1AX1 A;  3MLL A;  1UZY A;  4UFK A;  3QD6 A;  1RUH 3;  1VRH 1;  4RL7 A;  3LB9 A;  1HXS 2;  3NNM A;  3AL6 A;  1UOB A;  4FTE A;  4Q0U A;  1RL3 A;  3CZJ A;  3FMG A;  3FX3 A;  5DDJ 3;  4AED A;  4LA2 A;  4CEY A;  4GWJ A;  1CD3 G;  3MEP A;  2ZJC A;  2R0H A;  2HWF 1;  4HFS A;  4OUS A;  4XIO A;  5HV0 A;  1ZRI A;  5A7Q A;  1F31 A;  3JD7 3;  4ORF A;  3V64 A;  1TEI A;  1NE6 A;  2ARE A;  3DKW A;  4Q4W 3;  4RHV 2;  4WM8 A;  2UY8 A;  5F39 A;  3IZO A;  1GNY A;  5F5A A;  3D0J A;  4UW3 A;  1GNZ A;  3S57 A;  1V6J A;  4XC9 A;  1CR7 A;  1JYW A;  5LEJ A;  2A70 A;  4LO6 B;  4XVH A;  5FPB A;  4QU1 A;  5JDB A;  1QJY 1;  2YBK A;  2E9Q A;  2WAO A;  4AFA A;  4EN7 B;  3ABZ A;  2ZAA A;  2I45 A;  3OJB A;  1RED A;  4FP3 A;  3VV1 A;  2JIG A;  1RMU 2;  5C8C A;  1HQL A;  1LOB A;  2LRP A;  4JX0 A;  2XUE A;  1UYY A;  2DCZ A;  4RR3 C;  3ZN4 A;  4UWD A;  4B7K A;  3WR0 A;  3O1M A;  4N7I A;  3HPN A;  3AKQ A;  4CPB A;  1C8M 1;  1NZI A;  4N90 A;  4IQP A;  1H8T A;  2W39 A;  4XHB A;  2IWG B;  3ZN5 A;  1BCX A;  1OQ1 A;  3NNF A;  4EYU A;  3K46 A;  1FX5 A;  3KV5 A;  1VR3 A;  1JN2 P;  4XDP A;  1ZZB A;  1PIV 1;  3O1R A;  4IE7 A;  1LCL A;  2VZS A;  4QPI B;  1VRH 3;  1S4C A;  3I2K A;  1H1A A;  3PL0 A;  2J1T A;  3M3Q A;  5DN2 A;  2XLA A;  1AR6 2;  1VMJ A;  4UF0 B;  2R6Q A;  4WM7 C;  1NKG A;  1CJD A;  5HXV A;  4CCJ A;  3SIS A;  4KWL A;  4SBV A;  2QZ2 A;  1HX6 A;  3THP A;  3ZN6 B;  2VZT A;  2HWF 3;  1W0P A;  2ZS6 B;  2UY9 A;  3J4U H;  1S2E A;  4R9B A;  1ND3 A;  4UXA A;  1Q8P A;  2LTN A;  1V6L A;  2WUH A;  5EQU A;  4V2W A;  3GM8 A;  1BK1 A;  3ZYH A;  4GUL A;  2JDA A;  4TLF A;  2ZGS A;  4XUP A;  1LHO A;  3KVA A;  5E8A A;  2IFR A;  2VC9 A;  5J1X A;  1QJY 3;  4LOT A;  2JB4 A;  1ASJ 2;  1NLS A;  3VBO C;  1EV1 2;  1T2X A;  2RMU 2;  4BYY A;  2A73 B;  4GMP 0;  4Z1V A;  5IW0 A;  3WV6 A;  3N9O A;  4QX1 A;  4XDO A;  3NWK A;  1WLT A;  3L2H A;  3OF1 A;  5F3G A;  3VHO A;  4AGG A;  5FMB A;  4EN0 A;  4ISR A;  5A7W A;  5IUQ A;  5IVC A;  5F37 A;  1WCU A;  2OKX A;  1F2N A;  1C8M 3;  1ENR A;  2VXR A;  5LEK A;  2VBD A;  3AYE A;  2XB6 C;  5FPL A;  5SV5 A;  3VZK A;  3S5A A;  1ULF A;  2ZGR A;  4Y1X A;  5IAX A;  4EZH A;  1CPM A;  3SCG A;  4D6R A;  1AR8 2;  4LR4 A;  3LSD A;  2VNV A;  1CVN A;  1D4M 2;  3OD0 A;  5C3P A;  4LBO A;  3O12 A;  1X8E A;  5FZO A;  5L9B A;  2BGP A;  3FLR A;  1LHW A;  5JLV A;  5C4W A;  4WVM B;  3I59 A;  5GZE A;  2JG9 A;  2E31 A;  2VOX A;  4ZZ8 A;  4DXR A;  1DU3 D;  1LOF C;  1S0G A;  3DGT A;  1JYV A;  2B39 A;  1XOY A;  2JB8 A;  4YZ5 A;  4BQ2 A;  2D44 A;  3CU7 A;  3KM5 A;  1KIT A;  5FOB B;  3WQB A;  5F3I A;  2AUY A;  2XXZ A;  4AHW A;  4TN7 A;  3LPG A;  1BZW A;  2C1F A;  2A6W A;  2IXK A;  2ZMN A;  3WQ0 A;  4R4X A;  4OI0 A;  2W1U A;  3H1Y A;  5GM0 A;  1JMU B;  2XJS A;  1RHI 1;  1RUF 2;  2VD7 A;  5LZ6 A;  2RE9 A;  3NAP A;  4KWJ A;  3O0V A;  3THC A;  4MOA A;  4YG6 A;  2PHF A;  1Y7B A;  2Z79 A;  5HCA A;  3DKQ A;  1TMF 1;  4QX0 A;  2VEC A;  5DUX A;  5C3R A;  2RS5 1;  1OF3 A;  2KA3 A;  4RYD A;  4ZS2 A;  2ZKN A;  5C8W A;  4BWO A;  1W0O A;  3JZV A;  5F5Q A;  1UW8 A;  4J1W A;  3PVN A;  5DAB A;  2WFF 2;  2ZZQ A;  1RVF 2;  1TNR A;  4S2F A;  4TTG A;  1WLW A;  3I2F A;  1Q43 A;  1XE8 A;  3WXP A;  2ZX3 A;  3OGG A;  5CB7 A;  1RXF A;  1YFW A;  1WA6 X;  1O7F A;  2VO5 A;  2WSV A;  5CBL A;  2Q30 A;  1OFS A;  2GAL A;  1VBC 1;  4COU A;  4CVU A;  1VMF A;  3K4D A;  1ND2 B;  1ZRF A;  4ATE A;  4ZKT B;  1GP6 A;  4LOR A;  2B42 B;  3NRU A;  3U10 A;  2XWB B;  4OI4 A;  4PLN A;  3VBH B;  3I2G A;  5FZB A;  2RS3 1;  3TEW A;  3KWV A;  4FPC A;  1LHV A;  2WA4 A;  3AMH A;  2GNM A;  1OOP A;  5FYU A;  1DHK B;  3LDK A;  2V4A A;  4BE3 A;  5K0U C;  1S2B A;  5JR2 A;  2WO2 A;  3ZFG C;  3OOX A;  4SLI A;  4HK8 A;  4Y4R A;  1N1Y A;  2WJS A;  4RGG A;  2WZR 2;  4JRA A;  4MGY E;  3U14 A;  5B2G B;  1RHI 3;  4RS5 A;  5LBB A;  1WW4 A;  1R64 A;  4YGC A;  5TSW A;  4LO4 B;  1G9F A;  3WP6 A;  1XPW A;  3NJZ A;  1C4R A;  1QOT A;  2PXJ A;  1QJX 3;  4BQ1 A;  5GZD A;  1TMF 3;  4AQT A;  2ZGO A;  4HLT A;  5FRE A;  2RS5 3;  2RDN A;  4OUM A;  4RSU A;  4XET A;  2UUR A;  4I3P A;  1JUH A;  1UN1 A;  4AI3 A;  2Y34 A;  2D98 A;  4A7Z A;  4Y5S A;  4IE4 A;  1RUE 2;  4Y20 B;  4BDV B;  3ELN A;  1LB2 A;  1Z7S 2;  4F83 A;  2Y0O A;  4WZF A;  3O1S A;  2ID4 A;  2GMM A;  1YNA A;  1PMH X;  3ACG A;  3AMN A;  3BN6 A;  3M3C A;  3B3Q E;  4MXV A;  4PDW C;  4RQP B;  5FQ0 B;  2VMC A;  4R9A A;  4QX8 A;  4CCE A;  2AAC A;  4PCR A;  2W46 A;  2MEV 2;  3WF4 A;  1OC1 A;  2XHN A;  4CU9 A;  1ULO A;  4D3W A;  1VBC 3;  3CJX A;  1QDC A;  4HVQ A;  3FFZ A;  4LKS A;  2NP0 A;  2HYX A;  4CRQ A;  3LEG A;  1W8T A;  4FFI A;  5FMO L;  4XUR A;  1MEC 2;  5A7S A;  4UFM A;  4X6Q B;  3UET A;  2VBB A;  4EN8 B;  2RS3 3;  4YVS C;  4FO9 A;  4UYB A;  5FZC A;  3WNK A;  1AHS A;  1CES A;  3IN9 A;  5EJZ B;  5KXB A;  5GZG A;  1WCK A;  3VN4 A;  4XCA A;  2J7M A;  1FT9 A;  4AW7 A;  1IGO A;  1NCQ B;  1SBE A;  3UKN A;  1LR5 A;  3WHT A;  1PVC 1;  5DZF A;  4BQ5 A;  3BOW A;  1J84 A;  4FAH A;  5FO7 B;  4AQ2 A;  4IUG A;  1SLB A;  3NO8 A;  1UF2 C;  4DXS A;  5J96 B;  1SCR A;  2ZCW A;  1LED A;  3LFI A;  5FYC A;  4QT6 A;  3PJY A;  5FZ3 A;  5GLU A;  4CP9 A;  2HWB 1;  3M1H A;  5ACA 2;  1EAH 1;  4LIU A;  5LA1 A;  3WOG A;  1ZRD A;  1GFF 2;  5FZI A;  1I3H A;  4AED B;  1Y3T A;  1MQT A;  1U5Z A;  3FBY A;  3K4Z A;  2YC2 A;  1R08 1;  2RR1 2;  1GUI A;  3AJZ A;  3MIF A;  4QXB A;  2GME A;  2OPW A;  3ME2 A;  1O3Q A;  2XG3 A;  5FP9 A;  3ZR5 A;  5T50 A;  1QXR A;  3H1M A;  3D0S A;  4RFT 0;  1PGL 1;  3WW3 A;  4COV A;  3ILR A;  3LIG A;  5KHG A;  4XFI A;  2C9A A;  1RIT A;  4XJ8 A;  2A6Y A;  5FY4 A;  5GKA C;  3KT4 A;  3VBU C;  4B1L A;  5I0S A;  5JZG C;  3APB A;  4GB3 2;  1SFN A;  2MNG A;  2RVA A;  1S0F A;  4H7M A;  5KXE A;  5T52 A;  3RZK A;  3VD5 A;  5CAZ A;  2XWJ B;  4Q27 A;  4PBP A;  3LDB A;  4YM2 A;  4QGL A;  3I8T A;  3H42 B;  1RUI 1;  4MO3 M;  4QHZ A;  2V72 A;  1WWY A;  4QPY A;  2GH2 A;  3GGL A;  1G9C A;  1OQE A;  3CJI A;  3PIG A;  1N3O A;  1B35 C;  1K12 A;  4NWW A;  5L36 A;  1PVC 3;  4QAW A;  2J22 A;  3A23 A;  5F32 A;  1T6B X;  4B4R A;  4PLM A;  2CAV A;  1MZ6 A;  5L9V A;  1RUH 2;  2ZAC A;  3R4S A;  1ZA7 A;  1DZQ A;  3WNP A;  3W5M A;  4PQ9 A;  3JB8 A;  3KGZ A;  1NX9 A;  2P6H A;  2HWB 3;  5FZK A;  1EAH 3;  1LOG A;  3S7I A;  5C6C A;  4OHY A;  3N9M A;  5DDJ 2;  3I2I A;  3Q9O A;  3NJX A;  3VD9 A;  1UPI A;  5A33 B;  3M4F A;  4NPM A;  2BP6 A;  1R08 3;  1CZT A;  4URT A;  5CZK A;  5C3O A;  1KRI A;  5JWP A;  5L7O C;  3LCP A;  4Z2A A;  4COW A;  3WX5 A;  2G1M A;  2BWA A;  1QH7 A;  3JD7 2;  1TVG A;  4XTM A;  4Y22 B;  1AL2 1;  2N7G A;  4Q4W 2;  2P4E A;  4AR2 A;  1SFY A;  3RZH A;  2KR2 A;  2VNO A;  1UZ0 A;  2EIE A;  4DNY A;  3POY A;  2VZQ A;  3N35 A;  2Q8C A;  3AP6 A;  3JQX A;  3M3O A;  4QKF A;  4DXT A;  4YFW A;  1CAU A;  2TEP A;  4FCA A;  4MLO A;  4X8N A;  2E32 A;  3ZFE A;  4XUQ A;  3MID A;  1UU6 A;  1LGN A;  2OUJ A;  1BBT 1;  2XL7 A;  2BJS A;  2ARC A;  3E5X A;  4HXC A;  3SCH A;  4PT6 A;  3OD4 A;  4QQH A;  1Q5O A;  4AFM A;  1OUX A;  1W8O A;  2WQ8 A;  3ENR A;  4HSL A;  1RUI 3;  3N7K A;  1OXC A;  3EB7 A;  2X5I C;  5D1I A;  1NA1 B;  2JG8 A;  2YU2 A;  1CAW B;  1O3T A;  2IVJ A;  4U2A A;  3GXU A;  1YEW A;  3FE5 A;  2QNK A;  1XE7 A;  4LTA A;  2RHP A;  4QX7 A;  2D6K A;  1JUI A;  2X53 S;  3ROU A;  2JIC A;  4IEY A;  1VRH 2;  4QWN A;  5ANN A;  3ZXJ A;  5CFC C;  3POG A;  1CAV A;  3RPQ A;  4PJY A;  1YWK A;  3AVS A;  3TEZ A;  3VBS C;  4NMI A;  5C4W B;  4DMI A;  1XB9 A;  1HN0 A;  1W39 A;  2VMD A;  4K21 A;  1GOF A;  4IEU A;  4B1M A;  5FYH A;  1CQ9 A;  5C9A A;  1SHW B;  4CP2 A;  2QQM A;  2HWF 2;  1MPX A;  4CCD A;  1RIR A;  3RWN A;  1C57 A;  4ET7 A;  1MVQ A;  3T30 A;  1AL2 3;  1VAK A;  4HG6 B;  1AXK A;  1PMI A;  2WZ8 A;  2UWC A;  2W47 A;  1MS0 A;  1SMV A;  1YQ5 A;  3AJY A;  4KBZ A;  2X05 A;  3WNL A;  4O65 A;  4P9G A;  4XJW A;  5EYY A;  1UU4 A;  2XBO 1;  4Y3O A;  3IPV B;  1NXM A;  3WF2 A;  2P3Y A;  1YFU A;  2Q1Z B;  4DRR A;  3LOB A;  2V73 A;  1BBT 3;  5A1L A;  1QJY 2;  4IEX A;  1TME 1;  3X29 B;  1XRU A;  4KG8 A;  1DQ0 A;  1TQ5 A;  2EXK A;  3CIH A;  2WBK A;  5FYS A;  3PVB B;  5AVP A;  3ZYG A;  5F3C A;  3E97 A;  1W0N A;  4CYD A;  2V5D A;  3QH6 A;  1S0B A;  2P3I A;  2ZEX A;  1WME A;  3F2Z A;  4GIQ A;  1SLA A;  2BUK A;  1PZ9 A;  4Z07 A;  5FZ4 A;  5GZF A;  4IXL A;  2JX9 A;  4KQ7 A;  1W04 A;  2J1E A;  1NG0 A;  4BQX A;  1PIV 2;  2VMG A;  3ZIX A;  1XSQ A;  4R9C A;  2QUO A;  1OUR A;  4Y1Z A;  1ZRR A;  2YDE A;  3OGJ A;  4KGG A;  5FKB A;  1MVE A;  5A7P A;  4JZR A;  1RUG 1;  3WY6 A;  4JDM A;  4E4S A;  2FDG A;  3KQ4 B;  3MYX A;  3OBT A;  1Y9G A;  4NIA A;  4IGQ A;  3ZM8 A;  1VBD 1;  1UQX A;  1WD4 A;  5I0T A;  2WO7 A;  3PME A;  2PHU A;  1YI9 A;  2NN8 A;  2EAA A;  2IZW A;  2WWJ A;  4IV1 C;  5EFU A;  1D7P M;  3UGG A;  2BDR A;  2AEZ A;  3ZYR A;  1CAX B;  3WF1 A;  5BXX A;  4AHX A;  1NQD A;  2ZGM A;  3S7E A;  2XBO 3;  3ACF A;  1CZV A;  2B7Y A;  3S0M A;  2OS2 A;  2ZX4 A;  4CDU B;  2CDO A;  2RJ2 A;  3R4D B;  1DZR A;  2XON A;  4J6G A;  4R9D A;  3WZ1 A;  2D43 A;  3D5O A;  4ASM B;  5DXD A;  1TME 3;  3B01 A;  2EAL A;  3H0O A;  5E6H A;  2VUJ A;  4D69 A;  4ZZ5 A;  5A6Q A;  4O9G A;  3GF6 A;  5FUP A;  3VBF C;  2A6V A;  3ZO0 B;  5BNN A;  2PHR A;  4BLI A;  1J3R A;  3RZL A;  3VZM A;  4N53 B;  4P02 B;  3VHR A;  4BQW A;  3HN3 A;  1IOA A;  5EXO A;  3P3P A;  4KH9 A;  4TLG A;  2A6Z A;  4ES9 A;  1UWW A;  4CUB A;  3TAY A;  2HWC 2;  5J3U A;  1CJP A;  4OUE A;  2DWR A;  4EWD A;  5KBF A;  4BXS V;  1RUG 3;  5FZ0 A;  2PLV 1;  1O3S A;  3IDE A;  2JEM A;  1K5M B;  5CAD A;  5FZM A;  2I74 A;  1HN1 A;  1Q8S A;  2NMO A;  1W6N A;  1ZVF A;  2BGC A;  1VBD 3;  2D6M A;  3E6D A;  3CZU A;  3ES4 A;  2F6B A;  4P9J A;  3O1O A;  1HJG A;  3ZSJ A;  5BUV A;  4UAP A;  5E88 A;  5F7U A;  3ZPY A;  1KEX A;  4H55 A;  1ONA A;  3PVO A;  2Z69 A;  2GP5 A;  3OPW A;  2OYZ A;  1GV9 A;  3GBG A;  3NV2 A;  4GD4 A;  4XW3 A;  1SPP A;  3POW A;  2R16 A;  2DUO A;  1RHI 2;  1XJA A;  3CKH A;  1FXZ A;  3BUC A;  1QJU 1;  2VG9 A;  1V6I A;  2DUQ A;  3VDD A;  2C6S A;  4CP9 B;  2ES3 A;  4CE8 A;  2P5B A;  5FRA A;  2B8M A;  4R4Z A;  5CVR A;  3O1P A;  1MQT B;  3CLP A;  4QKN A;  1G9B A;  1A78 A;  2XR4 A;  3J7M A;  1ZBE 1;  2MPF A;  4DZG A;  4AI9 A;  1ULG A;  2DUR A;  2DBN A;  2FMY A;  3NJY A;  4QM8 A;  5FV3 A;  1ENS A;  2P2K A;  1QY4 A;  2P34 A;  2VZO A;  2Y6F A;  3LWC A;  1E5S A;  3BOP A;  4FOV A;  2FDI A;  4FAG A;  4CDQ B;  1HRV 1;  1UMI A;  5A33 A;  5BNO A;  3OY8 B;  5DG2 A;  1WMF A;  4DQA A;  3VD4 A;  4P9X A;  2JDY A;  4J1X A;  5BNP A;  3B69 A;  1A8D A;  2YYO A;  4AI1 A;  1VBC 2;  2ZGL A;  1JOP A;  4Q1R A;  1PO1 2;  3GNE A;  3S6P A;  2PLV 3;  3T0D A;  3HBZ A;  3B93 A;  5JXJ A;  1KFX L;  2RJK A;  2ZZJ A;  1MS8 A;  3H3L A;  4BB3 A;  1QU0 A;  4HON A;  4KWK A;  5FZ7 A;  5GZC A;  3NKT A;  5JXI A;  3IDC B;  3QCW A;  2R06 1;  1UY4 A;  3I2D A;  3NJV A;  4BM8 A;  2CSG A;  3ASI A;  3ZXL A;  2VMF A;  5KXC A;  1IQA A;  2HWE 1;  2ZKL A;  4YPJ A;  4EN9 B;  2GC3 A;  3MDP A;  1EPZ A;  4YVW A;  4XUT A;  4DUW A;  3NNL A;  3OUJ A;  5FP8 A;  4IGP A;  5FO8 B;  1LU2 A;  5GLT A;  3PLQ A;  1QJU 3;  3QH7 A;  4XAB A;  3E1F 1;  4AFB A;  4C91 A;  4S2D A;  4CEW A;  3AP7 A;  5DAQ A;  2LW8 A;  4ZHN A;  2YXS A;  3WP5 A;  4N8M A;  1DCS A;  5T5L A;  1LJ7 A;  4NE9 A;  2R32 A;  3HQX A;  1LRH A;  1W03 A;  3M3E A;  1G8W A;  3MHZ A;  3UV9 A;  4MAD A;  4FXG B;  1HW5 A;  1CN1 A;  4Q2F A;  4M3C E;  2I2S A;  5DZE A;  3M3I A;  2Z5W A;  4IV3 A;  1HRV 3;  1DQ5 A;  3LQC A;  1O3R A;  2PTM A;  5K0U B;  3UES A;  5F1R A;  1C1F A;  2YBS A;  2GNB A;  3TEX A;  3PUH A;  1CGP A;  3AZX A;  4AE2 A;  1S2K A;  1TNF A;  1XNK A;  4B4P A;  1R1Z A;  3HVD A;  4E9K A;  5FJH A;  1JZ4 A;  3DYM A;  1CPN A;  2CGP A;  2GMP A;  1APN A;  3OGS A;  1U5Y A;  3DCQ A;  4KL1 A;  5DUU A;  1OLQ A;  3A7Q A;  1QDO A;  4ES8 A;  1Q8V A;  5BPX A;  2VZU A;  4AK3 A;  2R06 3;  4WZC A;  3UGF A;  3ZKY A;  1XQN A;  1MZF A;  5FFO C;  3KLS A;  2DCJ A;  2K2S A;  1PVC 2;  5FWE A;  1W8Z A;  1WBL A;  2HWE 3;  1G7Y A;  3NKG A;  2VZ3 A;  4KU8 A;  3EMR A;  2ARA A;  4L2N A;  2W52 A;  4YW5 A;  4B4Q A;  2XJR A;  5T54 A;  3J9S A;  3LEK A;  5I0R A;  2Q0A A;  1MS3 A;  3AFK A;  4AFC A;  3NW4 A;  1AYN 1;  2HWB 2;  3V65 A;  4AHZ A;  4FPH A;  4B3N A;  2VQA A;  5EHD A;  3NV3 A;  3HNM A;  2YU1 A;  1R08 2;  2A1X A;  5C9A B;  4N43 B;  3RI8 A;  1W6O A;  5IVJ A;  1ULD A;  1ND2 C;  4YSF A;  5JPN B;  1QNW A;  3W58 A;  4LBQ B;  2D5F A;  3MUY 1;  2DVF A;  2VCC A;  5FYB A;  5JXG A;  1PGL 2;  3DPR A;  3C7F A;  4M3C A;  2BW8 A;  2J1A A;  3VBH C;  5C70 A;  3BTA A;  4JGZ B;  1RIN A;  1LGB A;  1WLD A;  4MUV A;  5A3U A;  3NV4 A;  1C28 A;  3SKV A;  1HB4 A;  2R0F A;  5A32 A;  3TYJ A;  5ERL A;  1LTE A;  1D0H A;  2CAU A;  2D3P A;  1ULP A;  4MGT A;  3ZXK A;  5HI0 A;  3AP9 A;  3RZZ A;  4HPK B;  2RDS A;  3ZKU A;  3MZH A;  3AL5 A;  2QZ3 A;  4P5Y A;  1H2K A;  3D3A A;  2QCS B;  3OPZ A;  3LDR A;  1RUI 2;  1AL0 G;  4Q4Y 1;  4W50 A;  1YFY A;  4AFD A;  5ABJ A;  3SEE A;  5FWJ A;  2CY6 A;  1C1L A;  4LO7 A;  3KSC A;  5LY1 A;  3U75 A;  4ZU7 A;  4LT5 A;  1UZV A;  2ET1 A;  4A3X A;  3I54 A;  4XF1 A;  4E27 A;  3JB4 C;  1RUJ 1;  1W6M A;  4D8M A;  3EBR A;  4FI9 A;  4Q8L A;  2ARB A;  5D21 A;  1GZ9 A;  5L19 A;  4KWU A;  4XPV A;  3VUO A;  1SDD B;  1RB8 G;  3M8L A;  2FDJ A;  1AYN 3;  4CDX B;  1GBG A;  4RQP C;  1V6K A;  3KCY A;  1O5L A;  4OHZ A;  3N36 A;  4PI2 A;  1YUD A;  3WLU A;  5IVY A;  3VGI A;  2WT2 A;  2CWM A;  2XJP A;  3VZJ A;  2CYF A;  4ZY9 A;  1R1A 1;  1L7R A;  1AL2 2;  3DV8 A;  5DQ0 A;  3H8R A;  5FP3 A;  1LEN A;  1JZ2 A;  4XUN A;  1V6O A;  3AZZ A;  5I8S A;  3WP4 A;  2OXB A;  2FCV A;  2E63 A;  2DVG A;  3WNX A;  2P17 A;  2R30 A;  3U78 A;  3MIE A;  2Y26 A;  4LK6 A;  1W8F A;  4GH4 C;  4N9I A;  2O1Q A;  2ILM A;  1RXG A;  4WVW A;  4CDU A;  1NCQ C;  2VGD A;  4EWE A;  1BVV A;  1IPJ A;  1IPK A;  3K2O A;  5DG1 A;  3VD3 A;  4XMA A;  2GN3 A;  3IAP A;  3ACI A;  1JHJ A;  4MGS A;  1PK6 B;  4H2A A;  1AX0 A;  1BYH A;  3W20 A;  3T0B A;  4XQ4 A;  2JDZ A;  2WS9 1;  1KXG A;  4Q4Y 3;  4NRO A;  4NID A;  2GN7 A;  4RR3 A;  3PU8 A;  4HBN A;  2YC4 A;  5JI7 A;  1JU4 A;  3FJS A;  1EPW A;  2WNV B;  5KHH A;  3ZYF A;  5FY5 A;  4A2U A;  1OSG A;  1C5H A;  1RUJ 3;  3I97 A;  5FZ1 A;  4BLJ A;  3WIN E;  2ZGT A;  3TNQ A;  4CDW B;  2H6C A;  3Q8C A;  2D6P A;  2VPV A;  4MGZ E;  4HAN A;  4XMI A;  4UBH A;  4D7Y A;  1ZBA 1;  2WSU A;  4N9H A;  4V1P A;  5FPZ A;  3SNM A;  2CGO A;  3PUS A;  4AVC A;  2OW4 A;  1UNB A;  4M0N A;  1C5I A;  4WM7 A;  1GP4 A;  1QEX A;  1WMD A;  2PA7 A;  4CP0 A;  2W95 A;  3U4X A;  4GWM A;  3VL9 A;  3O1T A;  3POJ A;  1KJR A;  1YQC A;  1VB4 A;  1MS1 A;  1R1A 3;  2BPA 2;  2ZHL A;  3KT1 A;  2RJL A;  3THT A;  1SPP B;  4AQS A;  3ZSL A;  4YG3 A;  2XBO 2;  1UZZ A;  5JR7 B;  1W2T A;  4XJU A;  2ZAH A;  3J8F 1;  4JCK A;  1NCR C;  1W06 A;  3VDD B;  5HCB A;  4QKD A;  1XSR A;  1XNC A;  4Z82 A;  1W6P A;  4PHZ A;  4NPL A;  1BXH A;  3VBO A;  3JQW A;  2Y6G A;  2XQR A;  2XGX A;  4E2Q A;  2ZEY A;  5HV4 A;  3E6C C;  2WS9 3;  1UY3 A;  4HZF A;  2P3J A;  5F6L B;  5IVB A;  5FYM A;  3AM2 A;  3NV1 A;  1H9P A;  2WWU A;  3BGA A;  3BU7 A;  4CXW A;  1VE0 A;  4Z92 B;  3POI A;  5BNP B;  5FUN A;  1J83 A;  2JE8 A;  4Y1Y A;  1SAC A;  5LA2 A;  2YC0 A;  1FAY A;  1DFQ A;  4CP1 A;  1POV 1;  2VNR A;  4MSV A;  1G6N A;  2P1B A;  1ZBA 3;  4LMF A;  3VKF C;  4TZD A;  2A5Z A;  2BNN A;  4IER A;  3R05 A;  1FPN 1;  3ZOI A;  4H3W A;  3RVH A;  1LEM A;  2QQO A;  3HN1 A;  4BQY A;  1H8V A;  1VBD 2;  5L73 A;  1GWL A;  1LOF A;  3AMQ A;  2E6V A;  5EYX A;  2D40 A;  1O4T A;  1ZYB A;  4LQR A;  2AH2 A;  1OPO A;  1FOD 1;  4P9W A;  3T1M A;  4D7S A;  3M2M A;  1UXZ A;  3VDB A;  3MIB A;  1RUC 1;  1WCS A;  2ETE A;  5FZD A;  1NE4 A;  5A6X A;  1UKG A;  3DXT A;  5KHK A;  2VVD A;  1QJZ A;  4OI1 A;  3TBD A;  1ODM A;  2W91 A;  3J8F 3;  2BVB A;  4JHZ A;  4K1Y A;  4LXL A;  4Q4V 1;  1BK0 A;  1KS5 A;  4HVO A;  4OCT A;  1WZX A;  1QJX 1;  1VBE 1;  2XOM A;  5DAV A;  2H0V A;  1TG7 A;  2B9U A;  3KV6 A;  1EUU A;  1R09 1;  4QPG B;  3IT8 A;  5CYY A;  3ZFF B;  2VMI A;  4GJY A;  1UKR A;  3E5Q A;  2W1Q A;  4RGA A;  5FPX A;  3ZPO A;  4X8P A;  1ZRC A;  3RDI A;  4CU7 A;  5GLW A;  2GZW A;  2WR9 A;  1NYW A;  2G9Z A;  3N7J A;  5JPM B;  3PUQ A;  2ZBJ A;  4IET A;  4P5H A;  1N1T A;  5IK8 A;  2QQK A;  5J36 A;  2WA3 A;  4HN1 A;  2D3S A;  1GZW A;  3KV9 A;  4JGY C;  5CIR A;  4JDN A;  3UJQ A;  1ZA4 A;  1IS5 A;  4P08 A;  3SEP A;  1POV 3;  3UKV A;  3BU0 A;  3D4K A;  4LBK A;  2SLI A;  4OHW A;  3T4H B;  4CCO A;  2PLV 2;  1FPN 3;  3URF A;  3O1V A;  1UMZ A;  3KF3 A;  2VQT A;  3OYW A;  1JU3 A;  4P00 B;  1XNT A;  1JYT A;  1WCQ A;  5JXH A;  4NHY A;  2PAM A;  2XL9 A;  3OG2 A;  5EV7 A;  1LAJ A;  3USU B;  2GSY A;  1FOD 3;  1OVP A;  5LA0 A;  3THD A;  3I3E A;  5K0U A;  1DGW A;  4XBQ A;  3FHA A;  1OVS A;  2IC1 A;  2XUM A;  1HQN A;  1RUC 3;  4GWI A;  4RN5 A;  4TXW A;  4XBL A;  3IDA A;  3ZFG A;  2W92 A;  3H9A A;  1WD3 A;  3III A;  3OPT A;  4BXF A;  1LES A;  4YGB A;  3VZL A;  2VCA A;  1GIC A;  1QJU 2;  4K20 A;  5I93 A;  5FYZ A;  1OA2 A;  1QQP 3;  5BY5 A;  2CWS A;  1JBC A;  3NVC A;  4MGK E;  4Q4V 3;  5JAX A;  2LM3 A;  3A4U A;  3WQ1 A;  5A3O A;  2PFW A;  2UWA A;  1VBE 3;  1LGC A;  3WP3 A;  2EIC A;  1JOD A;  1PZ8 A;  1R09 3;  1ZBE 2;  2GAU A;  3LEI A;  4AEK A;  5JMO A;  2R04 1;  2LRO A;  4G4F A;  3R4U A;  3VBR C;  4C1W A;  1POQ A;  4EJR A;  3GHM A;  4MXW B;  4BOW A;  4PDW A;  1HRV 2;  3DEM A;  1YLL A;  2OZ6 A;  2VXJ A;  1SQ4 A;  2XLG A;  2UYB A;  1VBA 1;  5LW9 A;  2QDR A;  4YZ4 A;  1L7L A;  2WQ4 A;  3KD4 A;  3PNA A;  5D8A B;  5GLZ A;  4UW6 A;  3EHK A;  3ACH A;  4FOY A;  4HOO A;  2JE7 A;  4W65 A;  1W6Q B;  2F17 A;  1B09 A;  4PQQ A;  3ZR6 A;  4B7E A;  1GAN A;  2CL2 A;  4Y4Y A;  4ZPI A;  1PO2 3;  4OZX A;  4YVS A;  3ZYP A;  1F15 A;  2R06 2;  4XAE A;  4MHR A;  1W05 A;  3WNM A;  2R1B A;  4FVV A;  2HWE 2;  4NHL A;  5T5P A;  4LKD A;  5AFB A;  1AF9 A;  2VH9 A;  5FZH A;  2WNU C;  4DS0 A;  5FXV A;  2XKP A;  4Q8K A;  4OUL A;  5D2A A;  1JI6 A;  1OLM E;  3K51 A;  3PDQ A;  4YW6 A;  4Z2W A;  4N53 C;  5F5I A;  4PIX A;  4XCB A;  4Y5T A;  5GAL A;  3U07 A;  5CFD C;  1DQ6 A;  5CU1 A;  5KC5 A;  4JQT A;  2R04 3;  2W0X A;  3T3Y A;  2GC1 A;  4XJA A;  5B4N A;  4CEY B;  3LEM A;  3RS6 A;  5IVF A;  4H14 A;  2DCK A;  5DAP A;  1AR7 1;  2XVK A;  3HAG A;  4W6X A;  1K5M C;  4LK7 A;  2AC1 A;  1OA3 A;  2IFW A;  2VOW A;  2X8K A;  4IEP A;  4WM8 B;  1VMH A;  3IMM A;  4J25 A;  3J7H A;  2YFU A;  1MZE A;  2WLQ A;  1VBA 3;  3NNJ A;  1ST8 A;  4OMC A;  5JZG A;  1BKZ A;  4XXP A;  1ZRE A;  3VBU A;  2OQ6 A;  5LK7 B;  2ZAB A;  4IEW A;  3KMH A;  3N7L A;  4I2O A;  3KVB A;  2ARX A;  5A3W A;  2WZP P;  2ERF A;  5L9R A;  5IYY A;  3PUA A;  4JRL A;  3ZYJ B;  2ZX0 A;  3D82 A;  4YM1 A;  3AP5 A;  4HK9 A;  1OD5 A;  5FLI A;  4D94 A;  5C8C B;  1S0I A;  4QXH A;  1B35 A;  3T2Q A;  2VME A;  2CDP A;  3BB6 A;  3O14 A;  2VTF A;  2EA7 A;  4MVT A;  4ZXK A;  4ZXE A;  1AJK A;  2RDQ A;  3AKS A;  2OPK A;  5FKC A;  3AZY A;  1H8T B;  5LAT A;  3H3U A;  1V9U 1;  1VJ2 A;  1J3Q A;  2DYC A;  5DMY A;  1VBB 1;  1F8V A;  2O14 A;  5FP7 A;  3B94 A;  1AYN 2;  1UOG A;  4CDQ C;  2EXI A;  1OLM A;  2QJV A;  5KR7 A;  4JDO A;  2VY0 A;  5IK7 A;  3H8O A;  4LOS A;  1IZ3 A;  5HCF A;  2VZR A;  2DFB A;  1LHU A;  3C2U A;  5L7O A;  2Q5T A;  4MZU A;  3RG0 A;  3UT0 A;  4BJ0 A;  4DY3 A;  3FL7 A;  2HJI A;  1AVB A;  5J37 A;  2L9L A;  4MET A;  5H9Q A;  1HB1 A;  1F9K A;  1AR7 3;  1J58 A;  3G6J B;  4NO4 A;  4NWV A;  1HIX A;  5CA6 A;  3A0N A;  1LNS A;  1ZZ6 A;  1OUS A;  1S0J A;  3H50 A;  3HJR A;  3WDV A;  1W9Y A;  4D0Q A;  2WO1 A;  4XIL A;  1GOG A;  1ND3 B;  4HKW A;  1QIQ A;  2Q4S A;  2WT1 A;  1KGY A;  2FQP A;  3AC0 A;  4PLO A;  4Y26 A;  4NIH A;  4LBJ A;  5F2W A;  5FZA A;  2XHK A;  3OBZ A;  2ZX2 A;  5JOX A;  2PHL A;  3I3B A;  5FZF A;  3SH3 A;  2BER A;  3AKR A;  4Q4Y 2;  3J26 N;  4DEQ A;  1PMJ X;  2YGL A;  4XAC A;  2ZPX A;  2X5I A;  3NNG A;  4IE5 A;  4MG2 A;  1XU1 A;  1H2N A;  2W2I A;  5FY0 A;  4PI0 A;  1UOJ A;  1YXW A;  4O9E A;  5A3T A;  1YJK A;  3U37 A;  4RD7 A;  2A71 A;  5FAX A;  1KS4 A;  5A7W B;  3O5S A;  1RUJ 2;  1X9T A;  3PMS A;  1XBF A;  4XYX A;  3S5Q A;  3Q8F A;  5GLV A;  1V9U 3;  1ZX5 A;  2CU5 A;  4A44 A;  4RHV 1;  1VBB 3;  5CFC A;  1SBD A;  1LOD A;  1V0A A;  3I49 A;  2VJX A;  1DDL A;  2FZ1 A;  3VBS A;  3OTF A;  5C33 A;  4P9Y A;  5KHI A;  1RTV A;  1GKB A;  3AXD A;  1W2O A;  1CX1 A;  5FZO B;  1FNY A;  2DUP A;  2VOT A;  3TOJ A;  4JKM A;  3GCW A;  3SCF A;  4AEM A;  3I59 B;  3BTX A;  1R1A 2;  2O8Q A;  2JG9 B;  2Y6K A;  4AYU A;  2QFE A;  4FPF A;  3FWE A;  4UFL A;  4AXO A;  1XYO A;  3KT7 A;  1GQP A;  4Y5Z 0;  1O4Z A;  2Q8O A;  4C8D A;  1SBF A;  4G3Y C;  4NII A;  3MFA A;  4Q4X 1;  1JYC A;  2G4I A;  3CDZ B;  4QB6 A;  2ORX A;  3IKW A;  4YLZ A;  5A3P A;  4ASK A;  1WKY A;  3NAP B;  3WDY A;  2W9X A;  1HB2 A;  2GDF A;  2WL1 A;  4LKE A;  5FY9 A;  3RGB A;  1W8N A;  2EID A;  2NLR A;  2WS9 2;  3I3D A;  1I5P A;  2PYT A;  4LUM A;  5FZE A;  1W2A X;  2WAB A;  2YPD A;  5CKM A;  5FR3 A;  3KHB A;  4OI2 A;  3PJQ A;  5FBZ A;  4L8Q A;  3V0A A;  4K1Z A;  4N43 C;  2X09 A;  4F8A A;  1C8M 2;  2VE1 A;  3D6E A;  1PHM A;  1KFU L;  1IS4 A;  4BIS A;  4E8D A;  4RHV 3;  1QXP A;  4K7J A;  4FPK A;  1MS9 A;  1MZ5 A;  1ZBA 2;  4NUB A;  2E7Q A;  3WDX A;  4LIV A;  2C0Z A;  3AYD A;  1IQD C;  3H8U A;  3HT2 A;  4JGZ C;  4LHK A;  1ZNP A;  3IWZ A;  4M00 A;  5DUW A;  3KHC A;  3POF A;  4CU8 A;  2QQU A;  4YYO A;  1VAM A;  2YUE A;  1A8M A;  3I4I A;  1FV3 A;  4L99 A;  3MUZ 1;  1OLR A;  4CCC A;  4UOJ A;  1XE0 A;  4IV1 A;  5IFP A;  2RMU 1;  1QOS A;  3HWJ A;  1OOP B;  5FYT A;  4YZ1 A;  1AX2 A;  2HEW F;  4MGI E;  3FUQ A;  3RNS A;  1Y9Q A;  4AI2 A;  3AB0 A;  2BNM A;  4H7L A;  4Q4X 3;  3J8F 2;  2YB7 A;  4EV0 A;  1FI2 A;  5B4X A;  1TE1 B;  1JOJ A;  4RS5 B;  3Q8B A;  4IL7 A;  1M06 G;  5JSR A;  1URX A;  3DF0 A;  5T5O A;  4XBN A;  3ZX7 A;  2FCT A;  4EN6 B;  4URA A;  1AR8 1;  3SLI A;  2AR6 A;  3JUU A;  4XF4 A;  3VBF A;  3J7N A;  5FZG A;  1GNH A;  1K5J A;  3INA A;  3LA2 A;  1HKD A;  2E7A A;  4CDX C;  5C3Q A;  1FMD 1;  4NHX A;  3VDA A;  1H6X A;  3MW4 A;  1JZ6 A;  4HL0 A;  3DL3 A;  1YQ8 A;  1J3P A;  1CZS A;  2GC2 A;  2RS1 1;  3ACL A;  4XOG A;  3M7A A;  4YG0 A;  2F4P A;  4UFH A;  4A4A A;  4DFS A;  1U5I A;  2ZGQ A;  3MIG A;  5J09 A;  1VPH A;  2QDN A;  3Q8E A;  5SV8 A;  2QQP A;  1J1T A;  2A3Y A;  5AVA A;  1HQW A;  3MF6 A;  1FPN 2;  5AC9 1;  3BTZ A;  3H1W A;  4D6S A;  3I2J A;  3LOI A;  2CTV A;  1KDM A;  5H9P A;  5BYN A;  1WW7 A;  4XZP A;  5BNQ A;  4YVS B;  1G9A A;  2I07 B;  1H4H A;  2CV6 A;  1FOD 2;  1YHF A;  3ECQ A;  3ZYI B;  3CHX A;  2VMH A;  3SHR A;  2QQL A;  1LKN A;  1VAV A;  1GYK A;  1RUC 2;  1PM7 A;  3R6S A;  2RMU 3;  1XNA A;  4AGV A;  1PK6 C;  4FQ4 A;  2WYS A;  1UOF A;  5FXX A;  4AG4 A;  4XF9 A;  2QQN A;  5IWF A;  2C26 A;  3HEI A;  5EWS A;  1RJ7 A;  4L0P A;  2J42 A;  3AFG A;  3ZXD A;  4OMD A;  4Q4V 2;  4AVA A;  1QF3 A;  1MAC A;  2VAU A;  2WNV C;  4A42 A;  3WUC A;  4LA3 A;  4TWT A;  1QJX 2;  1VBE 2;  1TMF 2;  5FO9 B;  5JOY A;  1R09 2;  1AR8 3;  1IHM A;  2RS5 2;  4QPI A;  4CDW C;  2W1S A;  2VVF A;  4QQO A;  1E5R A;  2C4X A;  3VD7 A;  1BHG A;  2XQX A;  1LOE A;  4NRQ A;  1BJQ A;  1FMD 3;  1ZZC A;  2ET7 A;  4QPI C;  2VM9 A;  4UF0 A;  2A3X A;  5ISL A;  1UD1 A;  2ZGN A;  2RS1 3;  1UCX A;  3O0X A;  1GZC A;  1U0A A;  3ZN6 A;  2VQU A;  3WUD A;  2BBV A;  3VBU B;  3K4A A;  4AI0 A;  4XFB A;  1Z0H A;  5GJ6 A;  3W9A A;  4QDS A;  2WII B;  4ZU4 A;  1STM A;  1NLQ A;  2B45 X;  5LBC A;  5AC9 3;  2OUH A;  2BZD A;  2DCY A;  1ULC A;  3KS7 A;  1UYP A;  1JH5 A;  3BAL A;  4FT8 A;  1Q8O A;  1S0D A;  2DU1 A;  2XML A;  4WVV A;  4E2G A;  2JEC A;  2F4L A;  4XQD A;  2XJQ A;  4K8F A;  2RS3 2;  4MHU A;  1Q3E A;  1F4A A;  2QVS B;  3OUI A;  4GQ7 A;  3V56 A;  4Q0P A;  1YQ2 A;  3CJI B;  5A70 A;  3R0R A;  1F5J A;  3VB9 A;  1RUE 1;  3WNN A;  4AVT A;  4YWA A;  3POS A;  4XFG A;  1ZM1 A;  4YW3 A;  1DQ1 A;  4GKY A;  1XNB A;  3I7D A;  3K3O A;  1I5Z A;  3LE0 A;  3JBG 1;  4L9B A;  1REF A;  2ZGP A;  3ZXG A;  4FBF A;  4FPJ A;  3U4S A;  4R52 A;  2Y6L A;  4KG0 A;  3L9J T;  3VKL A;  1ZZ7 A;  3O1U A;  2BNO A;  1S55 A;  2R04 2;  3MLK A;  4FPL A;  2ADD A;  3BPZ A;  3GZA A;  3FUO A;  1J1L A;  2DVD A;  4M4R A;  1V6M A;  3KCX A;  2R07 1;  1V00 A;  4WVM A;  3N3H A;  3N9L A;  4QXC A;  5IFT A;  4QHB A;  2DV9 A;  1VIW B;  2IXJ A;  2KD7 A;  4W8J A;  5F3E A;  3T2O A;  1YRZ A;  1VBA 2;  2OZJ A;  2H6B A;  4QX2 A;  5FZ9 A;  4V2V A;  5JIA A;  3OEB A;  3MPB A;  2JD4 A;  1SLC A;  1CAU B;  3UK9 A;  1DQ2 A;  3ZFE B;  1US3 A;  3ZLI A;  4YW4 A;  5LCW L;  5DZG A;  3QOP A;  2E51 A;  5FLJ A;  3GHN A;  3HMY A;  2X5I B;  4GA9 A;  2CGN A;  2E53 A;  3VDC A;  1GWM A;  1Z78 A;  1YIP A;  2JEN A;  3ILF A;  3AYC A;  4O61 A;  3MV1 1;  2RR1 1;  4UI9 L;  2X29 A;  4YW2 A;  2JG8 B;  4OQ8 A;  1DZT A;  2LUW A;  3ZFF C;  4AOC A;  4YZ2 A;  5JI9 A;  1RUE 3;  2VUA A;  3OBR A;  4M0H A;  5KWR A;  3DEC A;  4YRD A;  3PTY A;  3I3M A;  4ITC A;  2FDF A;  2GP3 A;  2VBP A;  3FHQ A;  5FBJ A;  1CAV B;  3JBG 3;  3OEA A;  4LHL A;  5T55 A;  4CTE A;  2WIN B;  3O0W A;  4LUK A;  2C5D A;  5C71 A;  4MYE A;  1EAH 2;  2GU9 A;  3L2Y A;  1Y9M A;  2XJU A;  1ND2 A;  4NRM A;  4FFF A;  5DPN A;  3TEY A;  2QQW A;  2NM1 A;  2OVU A;  4QKB A;  1OA4 A;  4BU2 A;  5JIU A;  2VQ0 A;  4LBL A;  1AR9 1;  2BFU S;  4GZ9 A;  1DP0 A;  1AR7 2;  4S2H A;  4E4D X;  4IES A;  1OKO A;  1VP6 A;  2R07 3;  3VBH A;  3MBW A;  1HV0 A;  2DCT A;  4JTO A;  4CPB D;  1X82 A;  1F5F A;  1PZ7 A;  1XND A;  2EIB A;  3CL1 A;  5LBF A;  5ANQ A;  5KHJ A;  3C3V A;  4CSW A;  5FYI A;  5FDB A;  3W5N A;  4KNC A;  2ZEZ A;  1J59 A;  4A3Z A;  4IE0 A;  1DGL A;  1JHN A;  3OGR A;  3CO2 A;  1F4H A;  3Q8A A;  5FPV A;  3MO4 A;  4KBB A;  5E89 A;  3HD8 B;  1H1I A;  2V4V A;  3FZ3 A;  2PHT A;  5ACA 3;  3CNA A;  5A3M A;  4PBO A;  2DBI A;  2VVE A;  2W08 A;  2OII A;  1W2N A;  3PUI A;  4JQR A;  2RR1 3;  1KQR A;  1LOC A;  4CCK A;  2QBX A;  1QHD A;  4Q0Q A;  4Y20 A;  5LRR A;  2PAE A;  4XXA A;  1VBB 2;  4A45 A;  3H3Z A;  1HRI 1;  5JOW A;  2DVA A;  2PEL A;  1MS4 A;  2QQI A;  4RQP A;  4P9L A;  5FQ0 A;  4QX5 A;  2A7A A;  3GBF A;  4LO8 A;  4BMB A;  2IXI A;  4XQW A;  3WG2 A;  4KMQ A;  4L97 A;  2ZHK A;  3RI9 A;  4GB3 3;  5D8A C;  2Y38 A;  4YM3 A;  1H2L A;  2FD8 A;  1AR9 3;  3HT1 A;  3GAL A;  2DTW A;  2IXC A;  4L11 A;  2FBE A;  5FLH A;  3DYP A;  2B46 X;  4ARX A;  3WF0 A;  4DUX A;  3HNY M;  5JMC A;  3NST A;  4OVE A;  5IJR A;  3B9C A;  4GH4 A;  2D5H A;  1NUK A;  1PX4 A;  2RM2 1;  4BZ4 A;  2FMD A;  3BCW A;  3BVC A;  3F95 A;  3T08 A;  1NCQ A;  2YRO A;  3BIE A;  2FDH A;  1PGS A;  1W8H A;  3ST7 A;  1D0G A;  1K3I A;  3PIJ A;  1V70 A;  2JKX A;  1W3X A;  1BBT 2;  2B9V A;  1CON A;  3VBF B;  1UY0 A;  4K40 A;  1H9W A;  1H1M A;  4QDR A;  3ZXA C;  1OFN A;  4Q0V A;  4BK4 A;  5JSP A;  2WN3 A;  1Q56 A;  1RUD 1;  4AWD A;  1A6C A;  3P5B A;  4AHY A;  5BNN B;  3DXU A;  1GR3 A;  3WSO A;  3QLQ A;  1GMM A;  1XC6 A;  3HNB M;  4IEO A;  2YMZ A;  3ALQ A;  1GQG A;  2O8O A;  4UW5 A;  4Q0S A;  4AED C;  5A1A A;  4CEY C;  1NY7 1;  2ZML A;  4WVZ A;  2YPJ A;  3K48 A;  4C90 A;  1HRI 3;  5HXM A;  2Y60 A;  3H8X A;  4XEZ A;  2JIJ A;  4QM9 A;  3AKT A;  4WM8 C;  4A41 A;  5FY8 A;  3WDT A;  4HVR A;  1OT5 A;  4OHV A;  1WBF A;  4FTB A;  2V5Y A;  4OQ9 A;  3OBA A;  2VCM A;  3CF6 E;  1W6N B;  3ETQ A;  3UNP A;  2ZEW A;  4F3J A;  3PVE A;  4BIF A;  2WAA A;  4NVP A;  3SIT A;  1DYK A;  3S30 A;  1NLR A;  1ZZ8 A;  2VUD A;  4I3G A;  1RYY A;  1DG6 A;  4LLF A;  5LRS A;  1X36 A;  3C7H A;  1W8U A;  4Q4X 2;  2IXL A;  3TNP B;  2W3J A;  5C8C C;  2RM2 3;  1BMV 1;  1NCR A;  4XHX A;  3A0K A;  1YI7 A;  1WMX A;  2VL4 A;  5LAS A;  1H8T C;  4XF0 A;  3SH5 A;  4TYS A;  1JXN A;  1POV 0;  5IHR A;  1TME 2;  3MF9 A;  2XLF A;  1US2 A;  4KI5 M;  1QKQ A;  1GOH A;  3VKO A;  3W59 A;  3RRD A;  2FZ2 A;  3JU9 A;  1UX7 A;  1WW5 A;  4Y1V A;  4QPW A;  1NQJ A;  2G9G A;  1EYB A;  1RUD 3;  4AQ6 A;  5FK7 A;  3GYD A;  5H9S A;  1GP5 A;  3B7M A;  1YQ6 A;  1I1E A;  1ACC A;  1XYN A;  2OX0 A;  2BBA A;  2VCB A;  3MIC A;  5FZL A;  4Y22 A;  3UGH A;  3WNO A;  5BNO B;  2X10 A;  5C7G A;  3P3N A;  4K6B A;  1IS3 A;  5K8S A;  1UMH A;  3ES1 A;  1LHN A;  3ATG A;  3ZIW A;  3AYA A;  2IVI B;  4CCL A;  2EAK A;  2W1W A;  2Z4F A;  2YFZ A;  2TNF A;  4QQ2 A;  5EJ1 B;  1VAL A;  1RUG 2;  1ND3 C;  2Q1M A;  4UBG A;  1O4Y A;  1NZC A;  2AZ5 A;  4IND A;  3KCC A;  4UFI A;  1UX6 A;  5FY1 A;  4HSJ A;  3WCR A;  4TSV A;  4M3C F;  3I3Q A;  4ERO A;  5FY7 A;  2B4K A;  5HPO A;  2EXJ A;  4BME A;  5FMD A;  2C24 A;  3LGR A;  3NL1 A;  1PGW 1;  3BTY A;  1COV 1;  4CXX A;  3LSE A;  4QB1 A;  1NA1 A;  3RSJ A;  4YVW B;  1CAW A;  4LE3 A;  3RMX A;  1W3V A;  1X50 A;  1QOO A;  3C8X A;  2HKX A;  5FPA A;  2ZXQ A;  4BCU A;  1NA1 C;  2BWC A;  1PIV 3;  1QQP 1;  4CEW B;  5F6K A;  3RQ0 A;  2HWC 1;  4OLL A;  3EQE A;  4NAM A;  2ZGK A;  1FMD 2;  2WWS A;  3GDB A;  3ZDV A;  4GMP 1;  2QQJ A;  5I0U A;  4ZS3 A;  2YZ4 A;  4IE6 A;  3LZZ A;  4A6S A;  2QKD A;  2RS1 2;  2ADE A;  3OUH A;  4IV3 B;  4I0W B;  5FZ6 A;  5C4W C;  3IDB B;  1I9R A;  4JGY A;  2JG9 C;  4K8R B;  5C5U A;  5J48 A;  3EJK A;  4HKL A;  4P9I A;  3DN7 A;  2VTX J;  5FP4 A;  4DUV A;  5AC9 2;  5JCT A;  1PNG A;  1JOB A;  2JDK A;  1O5U A;  1OPM A;  1AZD A;  4UFJ A;  3IPV A;  3CEW A;  1JS9 A;  4AI8 A;  3NAP C;  2DTY A;  1PO2 1;  3PHM A;  2D6L X;  1SLT A;  3RJ2 X;  4EE2 A;  5CIS A;  1W9W A;  1GQH A;  1BQP A;  3BIW E;  1W28 A;  1COV 3;  5H9R A;  2TUN A;  3WG1 A;  5IK5 A;  4O7X A;  1JYN A;  2BYV E;  4AAP A;  3IMN A;  1S0C A;  3ZMO A;  4DIN B;  1N1S A;  4ISQ A;  4S2G A;  2DF7 A;  4A7Y A;  2RV9 A;  3TB0 A;  3K3N A;  2JD9 A;  2HWC 3;  1PO1 1;  2PQS A;  4CXY A;  3MLJ A;  4M01 A;  1IG3 A;  3FBM A;  3VBR A;  1DLC A;  4CU6 A;  1W6O B;  4XZU G;  2HBU A;  1JTZ X;  1Q8Q A;  4ARY A;  2RDR A;  2WFP A;  4GMP 3;  3USS A;  4CUA A;  4KGQ A;  3IM0 A;  3DPR B;  4M3C B;  3DYO A;  5FYY A;  4COZ A;  3N4M A;  1AYM 1;  4QD2 A;  3GZU C;  4L92 A;  4QB2 A;  1W9S A;  1Y43 B;  1CX4 A;  1JZ5 A;  2HEV F;  2E33 A;  5A32 B;  1OOP C;  3CQO A;  1H2M A; 
#chains in the Genus database with same CATH homology
 1UY4 A;  4XVH A;  3NJV A;  2WAO A;  3CDZ B;  2VMF A;  4QB6 A;  2ORX A;  3ABZ A;  1WKY A;  3K77 A;  4YPJ A;  2W9X A;  1DYO A;  4JX0 A;  4XUT A;  1W8N A;  4DUW A;  1UYY A;  2EID A;  3HPN A;  3I3D A;  1I5P A;  3E1F 1;  1W9T A;  2LW8 A;  3K46 A;  2WAB A;  1O8S A;  1O8P A;  2VZS A;  4MAD A;  3I2K A;  2X09 A;  2J1T A;  5DN2 A;  4E8D A;  1JYX A;  3LQC A;  1NKG A;  3OGV A;  1IQD C;  4MGQ A;  3UES A;  2VZT A;  2ORZ A;  3PUH A;  4XUO A;  4CU8 A;  2DDU A;  1JZ4 A;  3DYM A;  3MUZ 1;  4UOJ A;  5IFP A;  2WUH A;  3OGS A;  3GM8 A;  3A7Q A;  2VZU A;  2JDA A;  4XUP A;  5J1X A;  2VC9 A;  2YB7 A;  5B4X A;  2DCJ A;  1T2X A;  4OZO A;  3T0A A;  3MV0 1;  3K75 B;  2VZ3 A;  4QX1 A;  4QX3 A;  1NAE A;  3LEK A;  2OKX A;  1JZ6 A;  3VDA A;  1H6X A;  3HNM A;  1W99 A;  1CZS A;  4A4A A;  2BGP A;  3MUY 1;  2VCC A;  5JXG A;  3C7F A;  2J1A A;  2E31 A;  4ZZ8 A;  5C70 A;  4DXR A;  3WF3 A;  1JYV A;  3I2J A;  3SKV A;  3WQB A;  3LPG A;  1ULP A;  1UXX X;  3ECQ A;  3ETP A;  2W1U A;  2QQL A;  1GQP A;  1XNA A;  5G04 L;  4P5Y A;  2WYS A;  3D3A A;  3THC A;  4MOA A;  4W50 A;  4AG4 A;  2QQN A;  1UYX A;  4QX0 A;  3SEE A;  2C26 A;  3HEI A;  4RYD A;  1OF3 A;  4L0P A;  1H6Y A;  2HLE A;  2WDB A;  4OMD A;  4A42 A;  4D8M A;  2WO3 A;  4FI9 A;  4TTG A;  2W1S A;  4KWU A;  3I2F A;  2C4X A;  1SDD B;  3VD7 A;  1BHG A;  2XQX A;  4AAX A;  2VM9 A;  2VO5 A;  4CUC A;  4CVU A;  1OF4 A;  3K4D A;  4OYU A;  3T2P A;  3OB8 A;  1P8J A;  2LS6 A;  2VQU A;  4ZY9 A;  1L7R A;  3NRU A;  5DQ0 A;  3K4A A;  1JZ2 A;  4XUN A;  4QDS A;  3I2G A;  1JZ8 A;  2BZD A;  3HOB A;  2J1S A;  5JR2 A;  1OH4 A;  2WO2 A;  4W4Z A;  3VD3 A;  1F4A A;  3IAP A;  2W5F A;  3ACI A;  1JHJ A;  4MGS A;  1CIY A;  1R64 A;  1L7Q A;  1YQ2 A;  2J1U A;  3T0B A;  1XPW A;  3WNN A;  3EYP A;  2YC4 A;  1JU4 A;  3LE0 A;  3C7G A;  3I97 A;  4BDV B;  2Y6L A;  3P6B A;  2ID4 A;  1PMH X;  3ACG A;  3BN6 A;  2VMC A;  4M4R A;  5IFT A;  2VZV A;  2W46 A;  3WF4 A;  2XHN A;  2KD7 A;  4W8J A;  1ULO A;  3T2O A;  2W95 A;  4CU9 A;  4LKS A;  2HYX A;  4QX2 A;  3LEG A;  3OEB A;  2WN2 A;  4XUR A;  4LPL A;  3UET A;  4M4P A;  2C9K A;  1US3 A;  3WNK A;  5EJZ B;  2Y6J A;  5LCW L;  3A22 A;  2J7M A;  3VDC A;  1J84 A;  4IUG A;  2Y6G A;  4DEV A;  1SG3 A;  3MV1 1;  4DXS A;  4UI9 L;  2ZEY A;  1UY3 A;  1K45 A;  5JUV A;  5LA1 A;  3DEC A;  3BGA A;  3K4Z A;  2YC2 A;  1GUI A;  2J1V A;  3FHQ A;  3OEA A;  1J83 A;  2JE8 A;  5LA2 A;  5C71 A;  5DPN A;  2BGO A;  4GZ9 A;  1DP0 A;  2QQO A;  3MBW A;  2WZE A;  2RVA A;  2EIB A;  4JKL A;  4LQR A;  4BK5 A;  3W5N A;  1UXZ A;  3VD5 A;  3VDB A;  2ZEZ A;  4A3Z A;  3OGR A;  1F4H A;  1UY2 A;  4MO3 M;  2V72 A;  3MO4 A;  3GGL A;  2W91 A;  2V4V A;  4JHZ A;  1K12 A;  1JYW A;  4QAW A;  2J22 A;  3A23 A;  2XOM A;  4DUV A;  1TG7 A;  1EUU A;  3PUI A;  5CYY A;  3WNP A;  3W5M A;  2QBX A;  2W1Q A;  1NX9 A;  4A6O A;  4A45 A;  4CU7 A;  3I2I A;  3NJX A;  3VD9 A;  2QQI A;  5CZK A;  1CZT A;  2QQK A;  1JZ3 A;  3FN9 A;  4Z2A A;  4LHS A;  1TVG A;  4KMQ A;  2R7E B;  4P08 A;  3IAQ A;  3SEP A;  1UZ0 A;  2EIE A;  2VZQ A;  4DXT A;  3DYP A;  2VQT A;  2VR4 A;  1JU3 A;  3IB3 A;  4P00 B;  3WF0 A;  4ARX A;  1XNT A;  3HNY M;  2E32 A;  4DUX A;  1WCQ A;  5JXH A;  4XUQ A;  3OG2 A;  5IJR A;  2YG0 A;  1NUK A;  1PX4 A;  5LA0 A;  3THD A;  3I3E A;  4PT6 A;  3FHA A;  4TXW A;  4GWI A;  3T08 A;  4RN5 A;  1K42 A;  3IDA A;  1K3I A;  2W92 A;  3III A;  1W8O A;  2WQ8 A;  2JKX A;  3EB7 A;  3LPF A;  2B9V A;  2VCA A;  3GXU A;  1UY0 A;  4QDR A;  4BK4 A;  2WN3 A;  2EIC A;  3WSO A;  3LEI A;  5JMO A;  1GMM A;  1XC6 A;  3HNB M;  3SKJ E;  5A1A A;  3T09 A;  5EIY B;  5HXM A;  2VMD A;  1GOF A;  3C7O A;  1UY1 A;  4A41 A;  1SHW B;  2QQM A;  1MPX A;  1OT5 A;  4ET7 A;  5G05 L;  4HG6 B;  3WEZ A;  3OBA A;  2WZ8 A;  3ACH A;  3UNP A;  2W47 A;  2X05 A;  3WNL A;  2ZEW A;  2WAA A;  4PQQ A;  1RYY A;  3WF2 A;  3C7H A;  5FUI A;  3C7E A;  2W87 A;  3WNM A;  1UYZ A;  2W3J A;  1O59 A;  3CIH A;  2WBK A;  2VL4 A;  2Y64 A;  1W0N A;  2V5D A;  5IHR A;  2ZEX A;  1JI6 A;  3F2Z A;  1US2 A;  4KI5 M;  1GOH A;  1UX7 A;  4QPW A;  2J1E A;  3JXS A;  3NQH A;  5B4N A;  2BBA A;  2VCB A;  3WNO A;  4E8C A;  2DCK A;  2X10 A;  5C7G A;  3ZM8 A;  1UMH A;  3J7H A;  2W1W A;  2YFU A;  4QDQ A;  2Z4F A;  2YFZ A;  4OMC A;  1JZ7 A;  2VZ1 A;  5EJ1 B;  1OD3 A;  2Y8K A;  1D7P M;  3WF1 A;  2J1R A;  2B4K A;  5HPO A;  3ACF A;  5IYY A;  1CZV A;  2CDO A;  2RJ2 A;  2XON A;  4QB1 A;  4JKK A;  3T2Q A;  2VME A;  2CDP A;  2VTF A;  4ZZ5 A;  4ZXE A;  3C8X A;  2ZXQ A;  2E26 A;  5DMY A;  1EUT A;  3P1I A;  4P02 B;  3HN3 A;  2Y6H A;  3GDB A;  2QQJ A;  1UWW A;  4CUB A;  2VZR A;  4BJ0 A;  4OUE A;  2VZP A;  3FL7 A;  4BXS V;  3A21 A;  2L9L A;  1GU3 A;  1HN1 A;  3CMG A;  1LNS A;  3HJR A;  3I2H A;  3CZU A;  4D0Q A;  2WO1 A;  2W94 A;  4UAP A;  5F7U A;  1GOG A;  1KEX A;  1KGY A;  3AC0 A;  4PF1 A;  3CKH A;  3I3B A;  2BER A;  1W9W A;  4DEQ A;  5I0D A;  1PMJ X;  3NNG A;  1JYN A;  3U37 A;  2RV9 A;  2VZO A;  4A44 A;  2JD9 A;  2PQS A;  3CZJ A;  1UMI A;  4GWJ A;  2VJX A;  1DLC A;  4CU6 A;  3VD4 A;  4XZU G;  4ARY A;  1CX1 A;  4CUA A;  2VOT A;  4JKM A;  3DYO A;  2Y6K A;  4QB2 A;  3T0D A;  1GNY A;  1W9S A;  5JXJ A;  1JZ5 A;  2E33 A;  1PX3 A;  3CQO A;  5JXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...