1GMMA

Carbohydrate binding module cbm6 from xylanase u clostridium thermocellum
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
126
Chain Sequence
FSKIESEEYNSLKSSTIQTIGTSDGGSGIGYIESGDYLVFNKINFGNGANSFKARVASGADTPTNIQLRLGSPTGTLIGTLTVASTGGWNNYEEKSCSITNTTGQHDLYLVFSGPVNIDYFIFDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CBM6
publication title The Location of the Ligand-Binding Site of Carbohydrate-Binding Modules that Have Evolved from a Common Sequence is not Conserved.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Xylanase
total genus 31
structure length 126
sequence length 126
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gmmA00
4XURA 3ACFA 1JZ6A 2BZDA 1O8SA 2Y6HA 3I3DA 3HEIA 3C8XA 1JHJA 1R64A 4PQQA 2WO2A 3WQBA 2B9VA 3LPFA 1GOHA 2ZXQA 1D7PM 3FHAA 5HXMA 1YQ2A 4XUTA 3ABZA 2EIDA 3U37A 4DXTA 1XNAA 1XPWA 3CQOA 1UY1A 2C4XA 3E1F1 4MGQA 5IJRA 2W1SA 2VZSA 3HNYM 3WNPA 3F2ZA 1CZTA 4E8CA 3T0AA 2WZEA 2WABA 4OUEA 4RN5A 2VTFA 1JYNA 1SG3A 1W0NA 2DDUA 2VMCA 3HNMA 4Z2AA 3LEIA 4MADA 2YFUA 5B4XA 2VR4A 3FN9A 2DCJA 5JXJA 3D3AA 3SKVA 2VQUA 4AG4A 5C71A 4BK5A 1DYOA 3HOBA 2RJ2A 1TVGA 5DPNA 3SEEA 4QX3A 1H6XA 3K77A 3NQHA 1GNYA 4ZXEA 3OBAA 2W1WA 4BK4A 2J1RA 4UI9L 1US2A 4ZZ5A 2W1UA 2QQNA 2J1VA 4MO3M 3ZM8A 4XZUG 2C9KA 1NUKA 3JXSA 4OYUA 3ACGA 1IQDC 1LNSA 2Y6KA 1EUUA 1GUIA 4P08A 1NKGA 4HG6B 5JXHA 2VO5A 1O8PA 2Y6LA 3K4DA 2WAAA 1CX1A 3IIIA 3DYOA 3T0DA 2HYXA 1JYWA 4LHSA 5CYYA 5CZKA 1EUTA 4PT6A 2EIEA 2KD7A 3EB7A 4ARYA 3CMGA 3BN6A 4AAXA 3ACHA 3OG2A 3WSOA 1J83A 3WF3A 2HLEA 3BGAA 5FUIA 2X10A 3A22A 1DLCA 3PUIA 1K42A 3UESA 4IUGA 4D0QA 2WN3A 3UETA 2Y64A 4CUCA 2EICA 3WF2A 3NRUA 4CVUA 2J1UA 4TXWA 2YC4A 2CDPA 1UXXX 4ZZ8A 3VD5A 2QQOA 2QQKA 3A7QA 4P02B 3AC0A 1UYXA 2JDAA 1W9WA 4JKLA 3K75B 2VZVA 2W87A 3MUY1 3I2GA 1KGYA 1BHGA 4YPJA 4L0PA 3NNGA 3DYMA 3A21A 1UWWA 3VD7A 1J84A 2RV9A 1OD3A 3T09A 4KWUA 1OH4A 1TG7A 3SEPA 4GZ9A 3P6BA 2JE8A 4LPLA 2YFZA 4MGSA 3VD9A 3W5MA 4JHZA 4W4ZA 2E31A 4CUAA 4GWJA 3T2PA 2BGOA 4BXSV 1UX7A 2QQLA 3HNBM 3K4AA 2XHNA 2WQ8A 3VDBA 3OB8A 5IYYA 1W8NA 5JXGA 3LEKA 2Z4FA 3P1IA 4RYDA 3WEZA 4MOAA 1PX4A 1OF3A 5EJ1B 5LCWL 3WF4A 5DQ0A 5LA2A 5IFPA 2ID4A 3CDZB 3I3EA 3OGSA 4A42A 3IB3A 3VD3A 3NJVA 5I0DA 1ULPA 3WNKA 1UY4A 3I2JA 2QQMA 3J7HA 3WF1A 2V5DA 1UYZA 1ULOA 2YG0A 1OT5A 4ARXA 2W92A 3T2QA 2EIBA 2VZPA 4A41A 2WUHA 2W5FA 4CU7A 2BERA 2R7EB 2C26A 1T2XA 4DEVA 2WN2A 1K12A 4A44A 3OGRA 2ZEYA 1WKYA 3IAPA 4QDQA 2JD9A 3DECA 4P00B 3WNLA 2QQIA 2VCCA 1UYYA 2XONA 2J1TA 1RYYA 3ECQA 1XNTA 3WNOA 1I5PA 4XUNA 1L7RA 4OZOA 2W46A 3C7EA 2VZOA 3MV01 2CDOA 2XOMA 1OF4A 2BGPA 3ACIA 5F7UA 3MUZ1 4KI5M 1K3IA 2Y6JA 1XC6A 2OKXA 4LKSA 3T2OA 1SDDB 4BJ0A 4DXSA 1US3A 2B4KA 1O59A 2W47A 5HPOA 2QBXA 4PF1A 3I2HA 2ZEXA 3LEGA 2VZTA 1W9SA 4QB1A 2JKXA 1UY3A 2X05A 1NX9A 4DUWA 2W94A 4P5YA 2VL4A 4QAWA 3GDBA 3MO4A 4DUVA 1W99A 2J1SA 3MBWA 3C7GA 1JU4A 3ETPA 3WNNA 4UOJA 4OMDA 4QX0A 1UY0A 1UY2A 3MV11 3T08A 2W3JA 3C7OA 2RVAA 1F4HA 2W95A 3VDAA 4A45A 2W91A 2YB7A 3VDCA 2VZRA 3W5NA 2Y6GA 2WZ8A 1UMIA 1KEXA 1GOFA 2J22A 3LQCA 2VM9A 3CIHA 5IHRA 3IAQA 1JZ2A 4XUPA 1CZSA 1JYXA 2VZ1A 2WO1A 2LS6A 4JKMA 1K45A 5C7GA 4TTGA 3I97A 2L9LA 3FHQA 3I3BA 2V72A 1GQPA 3WNMA 4UAPA 4JKKA 1GU3A 1L7QA 1W9TA 3HPNA 4QB6A 1JZ4A 4A4AA 1DP0A 4QPWA 2VMDA 5G05L 4ET7A 1PX3A 1WCQA 2X09A 1PMHX 1CIYA 1JU3A 4W8JA 4M4PA 4OMCA 3C7FA 1JYVA 2J1AA 3CKHA 4D8MA 3I2FA 2ZEZA 2WYSA 4QX2A 3OEAA 4DXRA 3WF0A 4BDVB 2E33A 2BBAA 2J7MA 2WDBA 5G04L 1W8OA 2W1QA 2VJXA 2LW8A 2V4VA 2VCAA 1SHWB 2QQJA 5DN2A 2E32A 4QX1A 5B4NA 1UMHA 3OEBA 3LE0A 5JR2A 3THDA 3EYPA 5LA0A 4KMQA 2Y8KA 2VCBA 3DYPA 4DUXA 5EIYB 2ORXA 1UXZA 4XUOA 3FL7A 2YC2A 3VD4A 3K4ZA 4XUQA 2E26A 2VOTA 3GGLA 3CZUA 1F4AA 1GOGA 2VZ3A 3PUHA 2PQSA 2DCKA 3THCA 4E8DA 1JZ5A 1P8JA 2ZEWA 2VC9A 4QDRA 5J1XA 1JZ7A 3SKJE 2VMFA 5A1AA 2VMEA 1HN1A 2WAOA 4CUBA 1JI6A 4DEQA 3GXUA 5JXIA 4XVHA 5JMOA 1UZ0A 2VZUA 2W9XA 5IFTA 4JX0A 3IDAA 3HJRA 3GM8A 4CU6A 5C70A 5LA1A 1CZVA 1PMJX 4GWIA 2ORZA 3T0BA 4CU8A 2XQXA 3C7HA 1MPXA 3OGVA 1H6YA 3I2IA 2WBKA 3I2KA 3LPGA 5DMYA 5EJZB 3CZJA 3A23A 2J1EA 2WO3A 1JZ3A 3UNPA 4A6OA 4CU9A 4M4RA 4ZY9A 2VZQA 3K46A 4LQRA 4FI9A 1GMMA 1NAEA 3NJXA 2VQTA 4W50A 1JZ8A 5JUVA 3HN3A 4QB2A 4A3ZA 4QDSA
chains in the Genus database with same CATH superfamily
3O0XA 1SQ4A 2GP3A 5LASA 1F9KA 1JZ6A 2QFEA 3FUQA 3USSA 5LEJA 4CDWC 1WCSA 1ZREA 4XOGA 3S30A 3G6JB 2A6YA 4HPKB 5FYHA 4DRVA 1JHJA 1ZZ6A 1JHNA 4HSLA 1Q43A 3PLQA 2W39A 1HRI3 3MIDA 1POV1 3MW3A 1AYM3 2CGPA 3KCYA 3LPFA 2ZXQA 4CEWC 1GANA 1QGLA 2ZA9A 4IEZA 1VB4A 4EV0A 1RUE3 4MUVA 1RUF3 2RS53 1BK1A 3D8CA 4Q4V1 1FPN3 3VZJA 1VBE3 2WLPA 2EIDA 4XDPA 4PJYA 4AE2A 2GMPA 3U37A 5F39A 2VQAA 2XUMA 4AGRA 1C8M1 2GC0A 1XPWA 3C3VA 1UY1A 1ASJ1 4Z07A 2ZAAA 2Q8OA 1ZBE2 2C24A 4U2AA 3GHNA 1TQ5A 1BEV1 2BNMA 4LIUA 3WNPA 3RYRA 1M4WA 1RUH3 1ND3B 2ARCA 2WZEA 5I8YA 2YDEA 5FZOA 2KXLA 5JVVA 5E1RA 5FPBA 2O1QA 2VTFA 3LF7A 1XYOA 3NO8A 4KWJA 4PQ9A 4BQ5A 5BNOA 1JYNA 3I2OA 2Q8DA 3MFCA 4CUGA 3HNMA 4IV1A 3WLUA 2A71A 2UYAA 1GWKA 1HQWA 2OQ7A 3N7LA 4JC1A 5SV5A 1MEC2 2JDPA 4Q0PA 2VR4A 5EXOA 3FN9A 1OA3A 2DCJA 2HEWF 3ZSLA 5IVEA 4AG4A 2A6VA 1VBB2 3ZXJA 3AL5A 3JD72 2Y60A 5FZHA 1TNRA 2VOXA 3KV4A 4P9JA 4AI2A 1TEIA 3IT8A 3OPTA 4NAMA 5F37A 1Y9MA 4Y22B 1ZYBA 1SLAA 2X29A 3SEEA 4M0NA 4CE8A 3AP6A 5BV6A 4YVSA 1HB2A 1GNYA 5FLIA 4C90A 5CEHA 3OBAA 4WVZA 5HCBA 2VXRA 4FT8A 4V2WA 5FYSA 4L97A 3W58A 1OQ1A 3FBYA 3KF3A 3OYWA 3FE5A 1US2A 2D6KA 5FO7B 3RYKA 1PM7A 4MO3M 1FOD3 4CP1A 3U14A 1NA1B 1LHVA 5D8AC 3EJKA 2O14A 3JXSA 2SBAA 2WT1A 5CU1A 2JE9A 1RUI1 1LNSA 1VALA 4YLZA 5DAQA 1C8M2 5D1IA 1JW6A 1ASJ2 2GU9A 1O8PA 2VO5A 2Y6LA 3KT4A 3OPZA 4JVAA 4DRRA 1CX1A 1BEV2 4CEYC 3DYOA 4L92A 1ZM1A 5C5TA 4MGTA 3T0DA 3IMNA 4XC9A 3LOIA 4PT6A 1WD4A 1N3QA 1ZA7A 2QZ2A 2KD7A 4ARYA 3CMGA 3BN6A 2GMMA 1VE0A 4EN8B 5KHHA 4ZKTB 4QMAA 5J7MA 5K0UA 2PHLA 1F15A 3GJBA 4L11A 5DDJ3 2VBBA 2FDGA 4FFIA 2O0OA 1HRV3 2EXIA 4XQWA 3HQUA 2X10A 4R9BA 3OJBA 3PUIA 1ND2A 1FV3A 2JWPA 1V6LA 2QTWB 3UETA 3WF2A 5JI7A 2JB4A 3IIAA 2PAKA 4AI0A 1IOAA 4FO9A 2J1UA 1T6BX 2VNGA 2CDPA 5EPAA 2EALA 2P6HA 4CDQB 5E16A 4NJ4A 5FPXA 1OLQA 4LBLA 3V56A 1BXHA 2QQOA 5DAWA 2A73B 3LKJA 5DG1A 5FZBA 5JLVA 1WMFA 3KV9A 4FOYA 3ITQA 4P5HA 2JDAA 4TLGA 2VPVA 2VZVA 3PL0A 3WINE 1KGYA 3HN1A 4O9GA 4XFHA 1A78A 1RUI2 2F17A 5A7QA 1QJY1 4BQWA 3ATGA 3D82A 5BNNB 4XFCA 4BA6A 2WWUA 5AFBA 3H9AA 3N9LA 1OH4A 3MZHA 1Y9QA 4H3WA 1VMFA 1V9U1 1X9TA 2A3XA 1OOPA 1ULEA 5T5PA 4CP9B 1X50A 1OQEA 1W9YA 1NCQC 1QJX1 4AVCA 4AW7A 2PLV1 3GZUC 4F8AA 4MGSA 4P9IA 3O1PA 1APNA 4Q4W1 1CWPA 4JHZA 1W03A 5FXVA 5H9PA 4EZHA 3TEYA 4OZXA 2YU1A 3CNAA 4GWJA 2K46A 3PDQA 3T2PA 3N9MA 1AR71 2NN8A 2QDRA 3ZFFC 5BXXA 1OPOA 4NRPA 4JDMA 2XHNA 3VDBA 1XOYA 2D7FA 3FJSA 4JQRA 3WDUA 1A6CA 2Z4FA 2OW4A 4CDQA 3PU8A 1PX4A 1ODMA 5LCWL 1TZOA 4K21A 5DZFA 3M1HA 3WDXA 4MV2A 4LA2A 3AP9A 2JDHA 5C3PA 3I3EA 5CNAA 2XVKA 5A7NA 1IKQA 3NJVA 4EWDA 1BVP1 5F3IA 1BVVA 2RS13 4HBNA 1OLME 3ZFEB 4Q4X3 5FP3A 1UY4A 2R30A 4Q27A 3BU0A 3M3CA 1UZVA 2RR13 5GLWA 3J7HA 1K5MC 3V0BB 3WF1A 3ZPOA 1WZXA 1UYZA 4OUSA 5IK5A 1OT5A 3IZOA 2Z2SB 4OHVA 1YJLA 2BPA2 2BERA 3AZVA 4CP9A 3HD8B 2R063 4Y33A 1V9U2 2A70A 4OHXA 2VU9A 1T2XA 1S0GA 2IWGB 4LO7A 1DZTA 1KXGA 1NZCA 1QJX2 2PLV2 2WN2A 1K12A 1PZ9A 4IGPA 5CB7A 1WW6A 1W0OA 4NMIA 4Q4W2 4A44A 4K3UA 5FY1A 2EXJA 2ZEYA 5L7OA 4AFDA 1LGBA 1WKYA 1AR72 4CCMA 5JAXA 4QDQA 4LE4A 2XH6A 4UT5A 3IDCB 2DCYA 4FQZA 4HT1T 3NKGA 3KHBA 3VKMA 4FTSA 1HN0A 2OPWA 5L9BA 3WNLA 3KSCA 4YGBA 4DO0A 2PXJA 2J1TA 4I30A 4GA9A 5LBEA 3WNOA 4AEDC 3N36A 3JUUA 1I5PA 4RS5C 4KNCA 1L7RA 4YW3A 3V0AB 4OZOA 5FP4A 5LRSA 3H50A 4FAGA 1AX0A 3UKNA 3Q8CA 2CDOA 3VB9A 3JB4C 4YW4A 3D6EA 2WZR1 4BLIA 4LHLA 5C9AB 1C8NA 3T30A 1RIRA 4URAA 1DQ2A 3MUZ1 2EAKA 1FAYA 5EV7A 5FYCA 5FZ7A 2OKXA 4LKSA 3OOXA 4LUMA 4S2HA 1PK6A 2JKBA 4QHZA 3TEWA 3CHXA 1JOJA 4XJAA 5JPNB 2ADEA 1SFNA 2WS91 4NN0A 1S0CA 3LDKA 5FRAA 1ND3C 2XB6C 3G7DA 1O59A 3O7OA 4H14A 4JQTA 1Q8SA 1ENQA 3OD4A 1VBD3 4EWEA 5HPOA 4LK7A 5AVAA 3I2HA 3KT7A 2WFF3 4N43A 4JTOA 4DY5A 1O3QA 2ZEXA 3LEGA 1G86A 1AR81 2NMNA 1X8MA 4LMFA 4CCKA 5FP7A 4NE9A 4AHWA 1I5ZA 4WM7A 4P5YA 1VR3A 1LOBA 5FYVA 2GC1A 2ZOEB 1PZ7A 1E57A 4KBBA 1W99A 3T1MA 2VNVA 4A7ZA 5A3UA 5K7PA 3J7MA 3M8LA 3N9NA 3AFGA 5FPZA 1JU4A 2WLQA 1GNZA 3CF6E 4J6GA 3GNEA 3MV11 5FK7A 4ES8A 3NV3A 4GJYA 3JQXA 1SLBA 3ZFGA 4CCCA 5JCTA 2QQPA 3V0AA 3T08A 4FPCA 1YLLA 3C7OA 2AREA 2JECA 2PHWA 2QCSB 3VN4A 3WQ1A 1QJZA 2UWCA 3BVCA 1GZ9A 2HWB1 4HK9A 1QJU1 2VUJA 2W68A 2WZR2 2CNAA 2HWF3 4FFHA 2VZRA 1FV2A 1DYPA 2P3JA 5A6XA 3DXTA 1KEXA 1W2UA 3HWJA 4PI2A 4E9KA 1R1A3 2W52A 5IHRA 4KU7A 2ADDA 2E6VA 1CZSA 1FYUA 5ABJC 2VZ1A 5LWBA 4GMP1 2WS92 4MLOA 4GIQA 1F5JA 4FOVA 3WP5A 1Y4WA 1LOEA 1AYN3 3FHQA 4UFJA 1RUG1 4P9WA 4I2OA 1GQPA 4WVMA 5FY4A 2GMEA 2HWD3 4NHXA 4JKKA 4UAPA 4TN7A 4YVWB 4NHYA 2E53A 4DOUA 1W9TA 4YW5A 1AR82 3KM5A 3HPNA 4D6QA 2HKXA 2QQVA 3GYDA 1QY4A 4XYXA 1HQNA 3OBTA 5CKNA 1DP0A 1YFXA 4HKOA 1IQAA 4QPWA 2VMDA 3ZXFA 5DG2A 1PX3A 1WCQA 1IS6A 1ZBA1 2ET1A 3HVDA 3ZO0B 5BNPB 1AX1A 2CYFA 3AFKA 1HKDA 3C7FA 4D7SA 2JX9A 1LHWA 4DY3A 2O8OA 1UPIA 4DFSA 4AEMA 5FLJA 1O3RA 4E2SA 4QX5A 1DGLA 2ZGQA 4IGQA 3OEAA 1DIWA 1MZFA 4KWLA 4AVBA 4DXRA 5CG9A 2VW1A 4B1MA 2Q0AA 3POGA 3PVNA 2HWB2 3MGUA 4DNYA 5D2AA 2AH2A 2BBAA 5G04L 1AHSA 1W2OA 4DS0A 1QOTA 4Q0QA 4Q0SA 3KQRA 4YG0A 5ERLA 1J58A 3BTXA 4IV3C 5GLUA 4Q8LA 1O6UA 1RUJ3 3E5QA 1SHWB 5FREA 5HCFA 4LJHA 4MG2A 1WCKA 4NWVA 2PMWB 1UOJA 3HMYA 5A80A 4XF0A 3MIEA 1LRHA 5F2SA 4NHLA 3AKQA 3TNPB 3URFA 5FPAA 3THDA 3O1TA 2JG8B 5JZGB 1JBCA 1XNBA 4YVWA 1RUG2 4XF1A 4I3PA 3U07A 1S2KA 5FUNA 2VCBA 1H30A 1MACA 4HKWA 5LBBA 4DUXA 3Q8AA 4RGGA 2ORXA 4WVVA 1OXCA 3VBOB 1UW8A 4XFIA 1UXZA 3D0JA 2VUCA 5FAXA 3H8RA 3RG0A 1H2LA 3WDWA 1B09A 5CG8A 1ONAA 1XNCA 4CDWB 1ZZ8A 2ZGUA 4QGNA 5BNPA 1CVNA 4DQAA 1GSLA 2P4EA 3NL1A 1ZBA2 2VOTA 1OFSA 1F4AA 3AZXA 2C6SA 3WCSA 5AC91 4QM8A 3AJYA 4MHUA 4E4SA 1H2NA 1UAIA 5A1LA 3QCWA 3ACLA 1H1IA 4GJZA 2BU9A 1QMJA 5ANQA 2JG9C 1J3RA 5FY9A 2XG3A 1JZ5A 3T2TA 1JUHA 2PHUA 2ZEWA 3Q9OA 4NAOA 5FZDA 1CAUB 4OUMA 1MR5A 3KV5A 3M2MA 4UFIA 1K5JA 1GV9A 1KFUL 1E5IA 1LKNA 1SLIA 1PM4A 3DPRA 5A1AA 5C4WB 4XAEA 1JI6A 5FY8A 3IM0A 2WRAA 5JXIA 1URXA 4SBVA 4LA3A 2WWJA 4XVHA 4A6SA 2CSGA 4YNIA 4BIOA 2VZUA 3GHMA 4GULA 3HJRA 3GM8A 1OA2A 4XABA 3N9OA 5LA1A 1OC1A 3NKTA 4M3CB 3S5AA 1VLNA 2BOIA 5GJ6A 4Y1YA 2JG8A 2GC2A 2SLIA 2I45A 4EJRA 4LOTA 5KHKA 2RMU3 2VY0A 2VUDA 2XKOA 4P14A 5FZGA 5J96B 1AR91 3VHNA 3J7NA 1CX4A 1XB9A 3LA7A 2YZ4A 1KFXL 1FI2A 1Y7BA 5DMYA 4P9LA 3RJ2X 3CZJA 3A23A 5F1RA 2P2KA 4ASKA 3P3PA 4UF0B 4CDWA 4IEUA 4M4RA 5FWEA 5A32B 3GZTB 1IZ3A 4ZY9A 1VRH3 3AYEA 3BOWA 3K46A 5AC92 4LQRA 4CEWA 3A0KA 2D98A 1H0BA 1UL9A 4AGVA 1D4M1 4LTAA 1CAUA 3N35A 4LBNA 1VP6A 4WZCA 5D8AB 4PCRA 1RMU1 1UOGA 4TSVA 3AKPA 4QPGC 3ACFA 2DVGA 2BZDA 3AP7A 3SCHA 5J09A 3I59B 5LEKA 1TME2 1H9WA 4QPIB 3I3DA 4PBPA 3JU9A 4BXFA 4CZSA 2ZMLA 2CGOA 2OQ6A 1D2SA 1FMD1 2E51A 2C5DA 2WO2A 4LKFA 3VDDC 2Z42A 3WQBA 3KCCA 4Z8BA 1GOHA 2FHRA 1XSRA 3FHAA 3MI8A 1H2MA 2DCZA 1S2BA 4RD7A 3RVHA 4K9SA 2RG4A 3Q8EA 1YQ2A 1IPJA 3ABZA 2XPJA 2IXKA 1QHDA 3JZVA 4PLMA 1AXZA 1JMUB 2YGMA 2ZMNA 5J36A 2RS31 2FDIA 3CQOA 1PO11 4H2AA 3B9CA 5FZ8A 4AVVA 1SDWA 1AR92 2ZKLA 3HNYM 3RI9A 3W21A 1XE7A 1CZTA 2PHRA 3E5XA 2FCVA 1VAVA 4I0BA 4I0WB 4LO4B 4MGZE 4O9EA 5CKMA 5F5AA 5F3EA 3T0AA 5FKBA 3UYJA 1KD7A 1WUVA 2OUHA 3D5OA 3ZMNA 4OUEA 4RN5A 4UF0A 1PHMA 1KITA 1ZA4A 5FMOS 4YGEA 2VMCA 1HX6A 1NY71 3RWKX 5I91A 3K2OA 4KBZA 3LOBA 2XL9A 1JS9A 1SBFA 2ZGLA 3NAPB 4COWA 3MDPA 1ZZBA 4YZ4A 5C3QA 1IS5A 1PIV3 3SKVA 2AYHA 2VQUA 4JV4A 2DUPA 1D4M2 5T5OA 1YJKA 3LSDA 4HK8A 5LA9A 2RJ2A 1EAH3 5HCAA 1AL21 5FZFA 3SNMA 3H7JA 2VG9A 2WNVB 2ZZJA 5FZKA 4ZXEA 2PFWA 3VV1A 1FNZA 4JGYB 4CEYA 2TNFA 2W1WA 2XJSA 1GFF2 4LKEA 2Z69A 4HVOA 5LK5A 1D0GA 1FMD2 4ZZ5A 3JB8A 2VQ0A 2QQNA 1D2QA 1IG3A 1J59A 1OVPA 2C9KA 2R042 1QDCA 1NUKA 2VGDA 4MXWB 4RR3C 1VMJA 2WSVA 2A3WA 1UIKA 4BWOA 4QT6A 1MS3A 3PJYA 1EUUA 1YXWA 3RNSA 1D4VB 3NNJA 3FFZA 3RGBA 3WP3A 5BYNA 3PIGA 1BMV1 4CDUC 2RS32 2TBVA 1PO12 4AFCA 4L99A 4QU2A 1OKOA 3VKLA 2H6BA 4XQDA 4LKDA 2ZAHA 3EXUA 3P5BA 3TAYA 2HYXA 3AKTA 3HQRA 3C2UA 1CJPA 1EUTA 5CYYA 2DF7A 4LBKA 3AP4A 3E6BA 4A2UA 3EB7A 1ZBE3 2N7GA 1JTZX 1LGNA 4XPVA 2ZKNA 1U0AA 4NR1A 3NNMA 3ZLIA 1NY72 4LOSA 3O1MA 2XQRA 1VMHA 3KQ4B 4XQ4A 4YZ3A 2VMGA 4AFAA 4PDWB 2OYZA 3DCQA 4NIGA 2VBDA 1LHNA 3BGAA 3IMMA 4GB31 5F5IA 3WG3A 1H8VA 1A3KA 2IXIA 1NXD1 3QBQA 3OUIA 3FHIB 3POFA 2R6QA 4D0QA 5FPLA 3AMMA 4AVSA 1MEC3 2RDRA 2H0VA 1ZRCA 5J3UA 1UMZA 1JYTA 3O1SA 4ASLA 1WGPA 1K5MB 1AL22 3AP5A 4TXWA 4CVUA 1LTEA 2P1BA 1UXXX 1Y3TA 4BYYA 1G9CA 1VBB3 4PLNA 5CISA 4E4HA 1XYPA 2TUNA 2YPJA 2CL2A 3A7QA 4XMIA 1SLCA 1DZRA 2OA2A 1NCQA 4HFSA 5HXVA 4XBQA 4MYEA 4RA0A 1H9PA 2RHPA 1SFYA 3K75B 5KXDA 1OUSA 4C1XA 4RGKA 4UW4A 1J3QA 4LORA 1N1TA 1RXFA 1BHGA 4NHMA 5FZIA 5FZEA 3ZFFA 5DUWA 4Q0UA 1UOBA 3V65A 1XU1A 5CFDB 1BMV2 4C1WA 2VE1A 1V6OA 1J84A 2RV9A 1LOGA 5GALA 1OD3A 1UU4A 2RJLA 5FIXA 3T09A 4BQXA 4KWUA 3ETQA 3RDIA 3VBOC 1H4HA 1NCRC 3FLPA 4Q4V3 1W6OB 3I2DA 3WHTA 1I1EA 2DFBA 4ASMB 1HV1A 2W2IA 2PHXA 5CA6A 3AM2A 4AEDB 4FPKA 2YFZA 4LPLA 1ASJ3 4RS5B 4CCLA 2B39A 1W8FA 2EIGA 3ZXAC 1BEV3 1LODA 4UFKA 2P6CA 2OX0A 3WG1A 3UL2A 3S57A 3DV8A 4I01A 3VZOA 1UX7A 3ZYJB 3ELNA 2X5IC 4E4DX 2QQLA 4GB32 3HNBM 2HWC3 3H8UA 1C5HA 3FWEA 3OB8A 1LOAA 5C4WC 2DYCA 5FZAA 2WZPP 5LY2A 1JYCA 2Q1MA 4FOWA 4XJZA 1YRZA 3O5SA 1UX6A 3WEZA 2P3KA 4YGDA 3ZIWA 1C57A 3OY8B 5FYUA 4D6SA 5FMBA 4V1PA 3WF4A 2R071 3HBKA 4ISQA 5DQ0A 4BISA 5A3WA 5A6ZA 4BCUA 2ID4A 4IEOA 4K1YA 4B8EA 2GC3A 2XDVA 3FX3A 4R4XA 2NPIA 1FATA 4JTNA 1AF9A 2ZABA 3ZSEA 3PJQA 4NUBA 3W9AA 5F8PA 5I0DA 5IT6A 1W3XA 3WNKA 1PO21 1UIJA 5J98B 3S6PA 3EMRA 3ZN4A 5CBLA 1ULOA 1RVF1 2YG0A 2F6BA 5A7SA 5J37A 1ZVFA 5GZGA 5JI9A 3H8XA 2W5FA 4D7YA 2ZX3A 4JGZC 4NIAA 3UGGA 2EF6A 2R7EB 2XGXA 1DG6A 3T4VA 5EYYA 4RS5A 4AEDA 4YZ1A 2P5BA 1RUE1 2RS51 4HPKA 5JIUA 1FPN1 3N4MA 1F5FA 3VUOA 4ZU5A 5FQ0B 4D94A 4XBLA 2UY9A 1POV0 4BQ1A 4JDOA 5JOWA 3BKZA 4KG0A 1H8TC 1J1TA 1REDA 2Y0IA 3IAPA 3NW4A 4META 2D3RA 1XJAA 3VHRA 3DECA 5JR7B 4ORFA 4Y20B 2QQIA 3ZFEC 2XONA 5F3GA 2Y26A 3ECQA 5IVCA 3AMPA 5CVRA 3FC0A 2DUQA 3MYXA 4QPIC 5ABJB 3WDYA 2XWBB 3ZR6A 2ZGSA 3ON7A 1CR7A 1GP4A 1ND3A 2BW8A 2WNEA 2X8KA 4CP0A 3RZMA 2A6XA 1V6JA 2R072 4LHNA 3NV1A 4D3WA 1NLRA 2QVSB 2MNGA 1YIFA 4KI5M 2A1XA 1XC6A 2IVJA 1PO22 4FFGA 1QOSA 1QXPA 2ARXA 4G4FA 4MH0E 4PIZA 1N1YA 1AL0G 1VIWB 1UKRA 1RVF2 1UNBA 2D43A 2GSYA 3ZXKA 2P3IA 1CAWB 4DXSA 1QJFA 1DYKA 4Y22A 1S55A 4I0AA 3RZZA 2QBXA 1ZZ9A 4CYDA 5BY5A 3K48A 4W6XA 3ZOIA 1Q8OA 1QJY3 3M4FA 5FMCA 1RUE2 1VBC1 2RS52 1W9SA 2Z79A 1V6IA 5FQ0A 1FPN2 3INAA 2JKXA 1UY3A 2BVBA 1BZWA 3NAPC 1DBNA 4G9SB 1V9U3 3KS7A 4QHOA 4IGOA 3GDBA 1PNGA 4F83A 4DUVA 1NA1A 4QQPA 4AHYA 4NRMA 4AGGA 4CPBA 1O3TA 2PLV3 2K2SA 3SCFA 3WP4A 4IV3B 3BTAA 4Q4W3 1LESA 2FDFA 4KQ7A 1UY0A 4LLFA 2LRPA 2LALA 2WNVC 5ABJA 2OPKA 2I74A 1SCSA 3LA2A 3POIA 4S2DA 4JGYC 3FUOA 3MHZA 5KHGA 1JN2P 4HKLA 1EP0A 3VDAA 1GZCA 1CGPA 3PMEA 5FYYA 3KGZA 1G9DA 1DLLA 1WCUA 3SHRA 1VAMA 2YPDA 5LRRA 1OD5A 4INDA 3W5NA 4UBGA 1RB8G 2WT0A 1IKPA 1UMIA 3N7KA 2ERFA 1KRIA 3WV6A 1O4ZA 4XUPA 3V64A 5DZEA 2VECA 1YUDA 4LHKA 5A3PA 2WO1A 4Q1RA 1N3PA 2LS6A 4JKMA 3UJQA 5I8TA 1UU6A 2D6LX 5CFCC 2L9LA 1D0HA 4GH4B 5I0TA 2YU2A 1WBFA 4BQ3A 3I3BA 3MW2A 4QD2A 5GZCA 2A5ZA 1OA4A 2YYOA 3WNMA 4YW1A 2JG9B 2ZX2A 4QB6A 3USUB 2WINB 4NWWA 1VBC2 4QQOA 2AEZA 5HCHA 1DDLA 3AKRA 2CU5A 4PDWC 3RI8A 3OTFA 1V0AA 1GQGA 3ES1A 3SC7X 4ET7A 5A33B 5L19A 2X09A 1PMHX 1QNWA 2CGNA 2XMLA 2ZHLA 5FK8A 1W2TA 4IV3A 2B9UA 2I2SA 4BIFA 5F6KA 3S5QA 4FPOB 4M4PA 4YM0A 1AZDA 1NE6A 3ZYPA 1GWMA 3QD6A 1HXS1 2BEOA 3KD4A 4D8MA 3I2FA 5BNNA 4UYBA 1VBA3 5T55A 1VAKA 4R9DA 1RGSA 4QKFA 4XXPA 4Y24A 4ZONA 4QX2A 1LOFC 1QU0A 3WQ0A 5C6CA 5DDJ2 3T1LA 3WF0A 4XHXA 4XILA 4X6QB 2GNMA 1H4GA 2WDBA 3NJZA 1W8OA 2W08A 3ALQA 2VJXA 5FZLA 1SEFA 3SMHA 4BH9A 3PHMA 1QKQA 2E7TA 3H7YA 3WUCA 5KR7A 4S2GA 5DN2A 4QX1A 3VBHC 5CFDC 1E5HA 3OBRA 3K51A 3LDRA 3NV4A 2DU1A 1JXNA 5FY7A 3GBFA 3NWKA 4Q8KA 4O7XA 3BTZA 3GCXA 3LWCA 2Z5WA 3CO2A 1H2KA 3SH3A 3OGJA 5FR3A 1LENA 3GJAA 3QH7A 1R083 5K8SA 5K4LA 3DYPA 4EWAA 1KDMA 2WS93 2ZS6B 2RR11 2WIIB 5IVVA 1JOPA 1BBT3 3SLIA 3TBDA 2HEYF 5A33A 4QPGB 2AUYA 1NZIA 4XUOA 2DCTA 4XIKA 2YC2A 3AZWA 1LECA 2VTXJ 3SCGA 2UYBA 4ISRA 4AI9A 3JBG1 1GOGA 3KGLA 2R061 5IVBA 2F4LA 1O3SA 2R0FA 2DCKA 3VDDB 2YGLA 4R4ZA 4YYOA 2QE3A 4N53C 1HXS2 2R1DA 1NYWA 1F31A 2YBPA 3NJYA 1DGWA 1WCDJ 4QU1A 2XJUA 3CU7A 1M06G 1S1AA 3SKJE 5IW0A 4XJ8A 4CUBA 2K0GA 2VNRA 2HWE1 3GXUA 4IXLA 3PUAA 1W6PB 3ILRA 3RZKA 4AZZA 1YI7A 3POBA 5FP8A 5JMOA 4DZGA 5IVFA 1SFPA 2D3SA 2W9XA 5FCCA 4JDNA 2HWB3 2B45X 4OLLA 4P9YA 1QJU3 1STMA 1IGOA 1CZVA 1OFNA 5LB6A 1PMJX 2WSUA 3PVOA 5C8CB 3ZKUA 1WLDA 1UQXA 5FZ9A 4PLOA 2ORZA 1NT0A 3ZYGA 5IK8A 1COV3 3C7HA 2MHFA 3OF1A 2AC1A 4XFGA 3SITA 5JOYA 5A3OA 1IPSA 1H6YA 3I2IA 4HMZA 3VBUB 3SISA 5JPMB 3VBFC 1W6QB 4PBOA 3F95A 5GLTA 3ZMOA 3E97A 2V09A 2BUKA 4GMP3 1NLQA 5EJZB 3S0MA 5K0UC 1GP5A 1REFA 4HANA 2IXLA 2RR12 4QPGA 5JIAA 4IE5A 5C9AA 1QNYA 1ZZCA 1RUG3 4CU9A 1AJKA 2D44A 2OIIA 2ATFA 1WW4A 4RSUA 1AR61 5KXEA 4GWNA 5JMCA 4KGGA 1VBD1 4BZ4A 3JBG2 3VDDA 3AZZA 2R062 3VGIA 3IBMA 3ZDVA 5L73A 3R4UA 4FI9A 4HVRA 1GYKA 1NAEA 2YUEA 3AYCA 2VULA 3NJXA 4RR3B 1N1VA 2EXKA 2E7QA 2YY1A 4HLTA 4JCKA 5ANNA 1JZ8A 1RUD3 1ZBA3 4RHV1 1W6MB 1YQCA 2PHDA 4QDSA 2PAEA 4TYSA 2ZTNA 3ROUA 3OUHA 4LK6A 4XURA 4OQ8A 3BIEA 3M70A 5F5CA 5FZMA 4CDUB 1O8SA 1W8HA 3OCPA 2Y6HA 3HEIA 1CAVB 2HWE2 1CD3G 3O0VA 4QGLA 3DL3A 2JICA 2BFUL 3BODA 3CJXA 4PQQA 1WMEA 2GH2A 3P3NA 4RQPB 3HBZA 2GALA 4GKYA 4OHWA 3ZN5A 3LCPA 4ZU4A 4N7IA 1W0PA 5HXMA 3RQ0A 4UFHA 4OFGA 5E88A 1SBEA 5FBZA 5FPVA 1SACA 2DBIA 1FT9A 5DUVA 4DXTA 5LBCA 1XNAA 1OOPC 2VH9A 4HSJA 2ZGRA 2BV4A 4MX3A 4AAPA 2WNUB 4MGQA 4PIYA 1V6MA 2WFPA 2VZSA 4N9IA 4AOCA 3R05A 4HETA 5FOJB 1RUC1 1YYNA 2WABA 1MS9A 3AVRA 4J1XA 3TYJA 4YM2A 3UT0A 5A6QA 2ZHKA 2FQPA 1G9BA 4FPYA 3MLJA 3MPBA 3LEIA 3B01A 1QH7A 4MADA 2AENA 1W06A 2YFUA 1AYN1 1AR62 1OBNA 2D6MA 2CWSA 2HBTA 1VBD2 5C5UA 3OGGA 2HWD1 4S2FA 2XBO3 4BMEA 1VPHA 4IE0A 3J8F1 4IW3A 3D3AA 4GMP0 5JXJA 4RR3A 4V2VA 2ZHNA 3THTA 2FDJA 2IXHA 3MLLA 3WNXA 4BOWA 1W6MA 4WM8C 2RM23 5E89A 1MZ6A 4BK5A 1W28A 1DYOA 3HOBA 4CXXA 5CADA 4RHV2 2WA3A 4GQ7A 1C1LA 1LR5A 1TVGA 1MVEA 5DPNA 3AK0A 3E6DA 4AR2A 4CDUA 5AC93 1H6XA 3UKTA 3NQHA 1VJ2A 1CAVA 3NNLA 4AWDA 1IS4A 1DU3D 2GDFA 3ZXEA 4ES9A 2DWRA 3BIWE 2J1RA 1NCRB 4UI9L 2OZJA 1PVC3 1X82A 3Q8BA 4ONUA 2J1VA 3M3EA 3UGHA 3ZM8A 2ETEA 2JEMA 2OT7A 2XJVA 4NOTA 1SLTA 3ZYIB 4BB3A 4BHPA 1HIXA 5J48A 3AXDA 4GH4C 2VMHA 1BJQA 4OYUA 1DGWX 5GZFA 3VKOA 5FZ3A 1IQDC 2W0XA 1ENXA 3O12A 4JAAA 4XTPA 1NKGA 3ZYHA 4QXCA 2X5IB 2BBVA 3S7IA 5DXDA 2MEV3 1Q8QA 1CPMA 3TN91 4AL9A 3ILFA 1UOFA 4E2GA 4DMIA 1GICA 5L7OC 1RUC2 4LHSA 5E8AA 4Z2WA 2EIEA 1JH5A 1TME1 1EV13 2QQWA 5F32A 1WMXA 1RINA 1CAXB 4C0HA 2PELA 4YW7A 5GZEA 3X29B 5JSOA 4R9AA 2UURA 5H9RA 3OG2A 2Q1ZB 1J83A 1AYN2 5KHIA 5KWRA 5F3CA 1KS4A 2HLEA 2HWD2 2P3YA 3AMHA 5FUIA 5FZ0A 3ZXGA 4QKNA 2PHTA 3FLRA 3J8F2 5FO9B 1DLCA 4QX7A 2ZGNA 5T5JA 4IUGA 1FX5A 5FYTA 3I3QA 5JZGA 2Y64A 4CUCA 4R9CA 1J1LA 3NV2A 3NRUA 1W6NB 2YC4A 5FYMA 3BPSA 3N3HA 3WCRA 1RJ8A 2FBEA 1Z7S1 2VNOA 4ZZ8A 3VBOA 5FYIA 1NCRA 1X7NA 2QJVA 4JGZB 4ZU7A 5C3SA 2VD7A 4P02B 1RMU3 2VOVA 5KBFA 1UYXA 4WVWA 1PK6C 3MF9A 4MZUA 1W9WA 4KH9A 1W2NA 4FPLA 3M3OA 1ZX5A 1BLZA 3BYWA 4MVTA 3MUY1 3I2GA 2AEYA 4Y1ZA 3KVAA 4Z82A 4L0PA 1Q5OA 3OPWA 1H8TB 4QX8A 3WX5A 2XJTA 1R091 3M3QA 5C4WA 3O1UA 2ILMA 3J4UH 1ACCA 2CTVA 4I02A 4R8HA 3TN92 1Q3EA 2JB8A 1NG0A 3Q8FA 3R4SA 2JENA 4P9GA 5FKCA 4GZ9A 2ZJCA 4WM7C 3SEPA 3P6BA 1QQP1 3UGFA 3QH6A 1U5XA 1CAXA 1W2AX 3ASIA 4K8RB 4MGKE 3VD9A 1BKZA 3W5MA 1LHOA 4UFMA 3DEMA 1UYPA 4YG3A 2UY8A 4ZS2A 4JRLA 2DV9A 1NQDA 3H1YA 2R041 1XRUA 3APBA 4M3CA 1DF0A 2Y6FA 1OUXA 1REEA 5ACA1 5BUVA 3FBMA 1ULDA 2V5YA 2DU0A 2WQ8A 4BU2A 1SPPB 5K9YA 1RL3A 1DGRN 3VKNA 5JXGA 2WQZC 3HT1A 3U4SA 3AMNA 1W3VA 3KB5A 5FZCA 4AQTA 2DVAA 2GN7A 3K3NA 3P1IA 3WG4A 4RYDA 4MOAA 3U10A 2IXJA 1OF3A 2ZX0A 3GCWA 5EJ1B 5HV0A 1BCXA 1Z7S2 1C3HA 5I0RA 4JGZA 4FTEA 1IPKA 3NSTA 2WYFA 4HONA 5IFPA 2WT2A 1W8WA 2WA4A 4XCAA 5KC6A 3CDZB 3QLQA 3SH4A 3OGSA 4NIIA 4A42A 3DUIA 1AL23 1DQ1A 3IB3A 4GXLA 3VD3A 5A32A 3B69A 3CJIB 5C8CC 4B29A 1ULPA 4Q2FA 1UZYA 5C33A 4XFBA 1EPZA 4QQLA 5H9QA 2QQMA 1J3PA 5B2GB 4H55A 2YMZA 4LO6B 2V5DA 3RWNA 3VBUC 4ARXA 2W92A 3HAGA 2VZPA 3ES4A 5D8AA 2WKKA 1YQ5A 1R092 2JDUA 2WUHA 4PI0A 1V00A 5DABA 4LULA 3ZFEA 3ENRA 3WD5A 2ZPXA 2ZX4A 3ZPYA 4NPRA 1WLCA 1X33A 2VOKA 2C26A 3I59A 3JQWA 4AXOA 4QPIA 1QQP2 2ZGTA 4FPEA 2FZ2A 1YWKA 3GZEA 4YM1A 2XR4A 1QH6A 1KDKA 3NMBA 4O61A 1RJ7A 3PURA 4QGMA 3BTYA 3RFRA 2JDNA 4WBBA 4XHBA 5FXXA 1S2EA 4AI8A 5ACA2 2B5HA 5JSPA 5L9VA 4LEJA 4GD4A 5C8WA 4N7UA 5CKQA 4LUKA 4UW6A 1XNDA 1XSQA 1RYYA 1XYNA 5LBFA 4WV8A 3BI3A 1ULGA 3I49A 2BGCA 5A70A 4UW5A 4GB33 4XUNA 5LZ6A 3DN7A 4CPBD 1TMF1 1X9PA 3L2YA 2LROA 2BYVE 3C7EA 4NRQA 5CFCB 4RQPC 1NE4A 1JODA 5AVPA 1F2NA 2XOMA 4K1ZA 2BGPA 2NP0A 1CONA 1PIV1 4EE2A 1HB1A 2XJRA 2OXBA 5DAVA 5EHDA 2FDHA 1K3IA 3N7MA 3RRDA 1CJDA 2YHJA 3NAPA 2G9ZA 1Z0HA 1I6XA 1SDDB 3CL1A 1RHI1 2WNUC 4LBMA 1V70A 2Q1FA 3HR9A 2R49A 4BJ0A 2G4IA 3WDTA 1US3A 2B4KA 5DAPA 2VTXA 1ZRIA 1B35C 4PF1A 2WNVA 3BALA 3HIFA 3O14A 3PNAA 2NYYA 3ZYRA 4B1LA 2I07B 5FP9A 1O4TA 1ZRFA 4JGYA 4YW6A 2VZTA 1S0FA 3PIJA 3JD73 1I3HA 2YBKA 3LIHA 4U36A 3A4UA 2W94A 2VL4A 4QAWA 4FPHA 4UWDA 4MXWA 2A6WA 2J1SA 3MBWA 2BTVC 1SLLA 3EO6A 4LE3A 4ZPIA 1ENSA 1PNFA 3KZ4C 4NIHA 3IDBB 3WNNA 4LO8A 3PUQA 4UOJA 3KWVA 4JRAA 2WC2A 5F5QA 3VBHB 1POV3 2C9AA 2B46X 1BYHA 4EQVA 2BDRA 4HN0A 3MLKA 2CAVA 1TMF2 3R6SA 2A3YA 4FAHA 3LAGA 2GNDA 5FZOB 1V6NA 2MPFA 4YARA 4LLOA 1C8M3 1PIV2 2YB7A 4YFWA 3WP6A 5BNOB 5KHJA 5IATA 5F6LB 2Y6GA 2WZ8A 2GN3A 5A3LA 2IFWA 4HXCA 2C0ZA 2QUOA 4IEXA 4IV1B 3U78A 4OHYA 4PDWA 2J22A 3LQCA 4LBOA 1C1FA 2KA3A 4Q4Y1 3IAQA 1EAH2 1JZ2A 1RTVA 3VHPA 3VZNA 2CWMA 4EYUA 1JYXA 1FNYA 1W05A 1RHI2 5FY0A 1X8EA 1V6KA 4CDXC 4E4ZA 2XJPA 4PF5A 4URTA 4BQYA 4TTGA 2HBUA 2VCMA 5FMDA 1K5MA 2FZ1A 4BQ2A 1C28A 2V72A 1E5RA 1HB3A 3H3UA 5GLZA 4N53B 4TWTA 1XE8A 4OI2A 4X6RB 3VBSC 4YVSB 5IUQA 1RVF3 1H1AA 1L7QA 3B02A 1LOFA 2V4AA 4M00A 1W90A 1JZ4A 1S0JA 2G1MA 4XFAA 1OMIA 5G05L 4B4PA 4YZ2A 3JCIA 2G9FA 3K3OA 3WVJA 3OYWB 1UZZA 5F9TA 4IQPA 3IPVB 4LBQB 3KMHA 1CIYA 1SZBA 4KGQA 1JU3A 1LAJA 4W8JA 4OMCA 4BE3A 2ZX1A 1LULA 2J1AA 2JIGA 2NZ9A 2AZ5A 5CFDA 1G7YA 3CKHA 1N47A 3VBHA 3WZ1A 3H1WA 1GWLA 3GBGA 3L9JT 5I0UA 4FQ4A 4AHXA 2ZEZA 3AXEA 1CN1A 5IVYA 3WOGA 1W6OA 3MIBA 2IC1A 1HRI1 1GZWB 1AYM1 1S0BA 4Y4RA 1RUI3 4PIXA 1XU2A 5EQUA 4EROA 4BDVB 3FFQA 3V0BA 2J7MA 2HWC1 1TNFA 2W1QA 1RUF1 3VBFB 1VBE1 4IESA 2K9ZA 2V4VA 4AFMA 2ZZQA 5K0UB 4FTBA 2XXZA 2JDYA 4Q4Y2 1JUIA 1MQTC 1EYBA 2E32A 1CQ9A 4LITA 1UMHA 5T3NA 4R52A 5LW9A 4YM3A 3OEBA 1F35A 3KF5A 1RUH1 5JR2A 1QOOA 2VVFA 1OHFA 1QIQA 4QXHA 1ND2B 4KMQA 4EN7B 4W6YA 4N53A 3PVBB 3OY8A 3QOPA 1G9FA 2XL7A 4MGIE 1WA4A 1BK0A 1MZEA 1RITA 2IUWA 2XVGA 2GZWA 3AZYA 4FVVA 1W8TA 1G6NA 4NPMA 4XIOA 4IEPA 2P37A 2A7AA 3ST7A 1UO9A 2B7YA 3BU7A 1NXMA 1UU5A 4XEZA 1ST8A 3IPVA 2VVDA 4KWKA 4LBQA 4B3NA 5FOBB 1O4YA 5L36A 1OI6A 4W6WA 4Y5SA 2Q8CA 1OKQA 2NQYA 3B7MA 3K4ZA 2NMOA 4OVEA 4XF9A 4EN9B 3A0NA 1VBC3 1S0EA 4Q4V2 3PUHA 4AEKA 2PQSA 2D97A 4H7LA 4AVAA 1PGL1 1LJ7A 2BOJA 1YEWA 4QHBA 2FMYA 2BNOA 2PTMA 1EPWA 1P8JA 2VC9A 1MS8A 3RZHA 1EY2A 3WQ7A 1JZ7A 1GZWA 1OLMA 2OS2A 2VMFA 1POQA 2Q5TA 5FV3A 2VMEA 1HRI2 1S0DA 2WAOA 1AYM2 1FOD1 3PU3A 4GALA 3TRSB 1OOPB 3ZKYA 3CJIC 4D69A 3VBFA 1BQPA 2OUJA 2HWC2 2R16A 1RUF2 4DIQA 5GZDA 1VBE2 1UZ0A 1LGCA 4N9HA 3RPQA 2ZGPA 1WD3A 4JX0A 4OI4A 3ZSKA 1QJX3 1O7FA 1N3OA 4XF4A 4Y20A 1LEMA 5KC5A 4LR4A 1RUH2 3PUSA 4TLFA 3S7EA 3LA3A 4CU8A 3WW4A 3T3YA 4XXAA 2QDNA 4YWAA 1AR73 3OGVA 4H7MA 4XAAA 3THPA 5FLHA 4OCTA 4YRDA 3I2KA 1YQ8A 5DDJ1 4WM8B 1O5LA 4XE9A 4F7ZA 1IHMA 3GBWA 1WWYA 1HRV1 2J1EA 2WO3A 3AJZA 3VBRC 5IAXA 3FLTA 2CV6A 2XHKA 1HDKA 4ATEA 4OHZA 5FXWA 3TB0A 4FPGA 2VZQA 1WLWA 1MZ5A 4P9XA 4NROA 5JOXA 1DHKB 5FFOC 4FP3A 1GMMA 1PGL2 1UZWA 1CAWA 2DURA 3BPZA 1ULFA 2VQTA 5JUVA 3M3IA 3HN3A 4QB2A 3RMXA 4QM9A 4Q5OA 3TEZA 3AMQA 2VXJA 3ME2A 3POJA 3WW1A 4AI3A 2O8QA 1HXS3 1FOD2 3RZJA 3VKFC 4M01A 2BRTA 5FXZA 1QDOA 3HQXA 1C4RA 4NPLA 5HI0A 3C8XA 2DFCA 2XJQA 1HJFA 5FYZA 5IK7A 2XUEA 1O5UA 3ZVXA 2TEPA 1R64A 4XDOA 3HT2A 5L7OB 3WDVA 2B9VA 3POEA 1D7PM 2E63A 5DUXA 3LEMA 3O1OA 1ULCA 2PQQA 2ZCWA 3AKSA 4COZA 2QQUA 4XUTA 5M0TA 4B4QA 3VZMA 4FCAA 3RS6A 4FOQA 3VL8A 2IXCA 4J25A 2C4XA 3E1F1 3ZIXA 5IJRA 2AACA 2W1SA 2GH8A 1QWRA 1YCIA 3AL6A 3F2ZA 4WM8A 5IAVA 3VZLA 3UKVA 2E7AA 4K6BA 4E8CA 1YFWA 3NVCA 4XDQA 1MS4A 1LU2A 1MS5A 1SG3A 1U5IA 1HRV2 1W0NA 1PVXA 1IS3A 2DDUA 3VLBB 5KXBA 4Z2AA 4BPZA 3PTYA 5DAXA 3O0WA 1KQRA 3LD8A 1Q8PA 5FJHA 5B4XA 5FPUA 2DTYA 5A6YA 2WZR3 1QJY2 1PK6B 3N9PA 3LDBA 4K7JA 5BPXA 4DXZA 2LM3A 1W04A 5DUUA 4OQ9A 4GH4A 5C71A 4AFBA 4COVA 3U0ZA 4Q29A 3U4XA 3JBG3 1LCLA 4CCOA 5JOZA 4LNVA 4QX3A 2JG9A 3K77A 5BNOC 1GBGA 1DGRA 4N43B 2RS11 3USUA 4RFRB 4FBFA 4O65A 4Q4X1 2BQPA 4IV1C 3WXPA 4XFFA 4BK4A 3MPPG 3M7AA 1YIPA 4LT5A 4B4RA 1ZZ7A 4IDZA 2W1UA 3L2HA 4WM7B 2G9GA 2QZ3A 4RL7A 1VBA1 2D6NA 4XZUG 5A3TA 1Y43B 2BJSA 3B93A 3H3ZA 3OSDA 1HV0A 4XF3A 3ZN6B 4IE6A 4G3YC 3ZXLA 1AR83 2BFUS 2HWE3 1KJRA 3W20A 4AHZA 4AEJA 3I54A 1L7LA 4IEWA 3ACGA 5CAZA 2Y6KA 1AJOA 2JIJA 1GUIA 4P08A 2EXHA 1UCXA 5APAA 3B9IA 2VOWA 1AVBA 4YVSC 3WT3A 4HG6B 1RUNA 5JXHA 1W9FA 1U12A 3ZFGB 3K4DA 2DBNA 2WAAA 1LU1A 3D4KA 2GNBA 3IIIA 1N1SA 4XJUA 1OLRA 1WLTA 5FYBA 4B7EA 2HJIA 2ZGMA 3D0SA 1JYWA 5CZKA 4FSJA 1R1ZA 2BNNA 2VW0A 5L9RA 3R4DB 2VW2A 3ACHA 4AAXA 5C3OA 1NOVA 4CTEA 3B5LB 3WSOA 1NQJA 1YQ6A 1CESA 2WQ4A 3ZDSA 1LB2A 4C0BA 3GZAA 2NM1A 3OD0A 3WF3A 1R081 3PMSA 5GKAC 3H3LA 3ZYBA 2XLAA 5E6HA 3A22A 2UWBA 1K42A 1GQHA 4UFLA 3UESA 2FD8A 2UU8A 2WN3A 4FP2A 5A3NA 3H8OA 1AR63 1BBT1 2EICA 5A3MA 4MSVA 4QQHA 4CXWA 3ZR5A 4WVMB 4LXLA 1XBFA 4AVTA 3ZXDA 2RS12 4K8FA 4Q4X2 3VD5A 2QQKA 1GLHA 4AQ2A 2YXSA 4RHV3 2BWAA 2EA7A 3AC0A 3DF0A 4NO4A 5LK7B 3BB6A 5BNQA 2ZMKA 3ZN6A 1VBA2 4JKLA 4E27A 3N7JA 5A1FA 1ND2C 2W87A 3ZSMA 1JYIA 1W39A 1U5ZA 2PAMA 3LGRA 4YW2A 2WFF1 1AX2A 1GKBA 4YPJA 3NNGA 3ZYFA 3DYMA 3A21A 1UWWA 3VD7A 4IEVA 2CY6A 3LB9A 4OI0A 4I09A 2E9QA 1HB4A 2J42A 2AGSA 1TG7A 2D6OX 3PTRB 2PA7A 2LTNA 4L2NA 1HLCA 1WW7A 1W6PA 4L8QA 1AXYA 1G8WA 1L3JA 1Y9GA 2JE8A 1ZRDA 1NA1C 3CLPA 2BWCA 3RZGA 1OURA 5IVJA 4XW3A 4W4ZA 1PMIA 2E31A 4CSWA 4A3XA 4D6RA 4Q0VA 4CUAA 1COV1 1RUOA 3IN9A 1RUC3 2BGOA 4BXSV 5LATA 4EN0A 4Y1XA 3FZ3A 4UBHA 5EYXA 5C8CA 1R082 2PYTA 3K4AA 3POSA 2WL1A 4YGCA 2A75A 1OSGA 5FUPA 5IYYA 1W8NA 2VUAA 4AF9A 2JDMA 1BBT2 3LEKA 3QACA 3WW3A 5HBAA 2HWF1 3VBUA 2VAUA 1W6QA 1OH3A 3J8F3 2A6ZA 2ARBA 3MIFA 5A7PA 1R1A1 3SQOA 2G19A 2B42B 5LA2A 4Y1UA 2ET7A 4AK3A 2YV8A 3BCWA 2IFRA 4XMAA 1B35B 1XXNA 1S0IA 4XTMA 4QKBA 2JD4A 3MFAA 3WW2A 4YFZA 4EZ4A 4BLJA 1RUD1 1UN1A 4J1WA 1X36A 2YC0A 3I2JA 3B94A 1WW5A 3KVBA 2VVEA 4CCEA 2WFF2 3J7LA 1XNKA 2X53S 3J9SA 4OULA 3U75A 4MHRA 2VBPA 1QXJA 2D6PA 2EIBA 2XLGA 3T2QA 4A41A 4CDQC 4CP2A 5KXCA 4ITCA 3GF6A 2P17A 4CU7A 4K20A 3DGTA 2D5FA 5JDBA 1O91A 4RGAA 1YC61 4OI1A 5FWJA 3DPRB 2RJKA 1QJU2 3ILNA 1H1MA 2Q8EA 4Z1VA 2DVBA 4DEVA 1OQDA 3VHOA 1DQ6A 4JZRA 3OGRA 4RQPA 5A7OA 3TN93 1DQ0A 3EHKA 4AYUA 3BOPA 1COV2 4LBJA 5AFEA 5JSRA 2QKDA 1Z78A 3MICA 1HQLA 1MS0A 4FXGB 4IEYA 2JD9A 4SLIA 1TME3 3BUCA 5BNNC 4P00B 2RDNA 2PHFA 3RYPA 4EN6B 5EP9A 3E6CC 2VCCA 1UYYA 3SH5A 1HJGA 2XKPA 3UV9A 1SBDA 1XNTA 2WNUA 1SCRA 4JHTA 5GLVA 1WA6X 2HWF2 1GZTA 4HL0A 4CDXB 2DVDA 1A8MA 1Q56A 1RUJ1 2W46A 4HOOA 3TWIA 4A7KA 1G9AA 4QXBA 2VZOA 1R1A2 3MV01 4Y3OA 4CXYA 1B35A 2XBO1 3AX4A 1OF4A 3ACIA 1E5SA 3AB0A 5F7UA 2YROA 1UPSA 2WWSA 3VBSB 4HVQA 1DZQA 4N8MA 1QEXA 1AR93 1A8DA 2PN5A 2WO7A 2RM21 3RJRA 1Z7S3 5JWPA 1RUD2 2Y6JA 4HZFA 3AYDA 4DPNA 3CEWA 3T2OA 3W59A 1YI9A 5I0SA 3R0RA 3N9QA 4N90A 5HV4A 4ZHNA 4CEWB 4D7TA 1ENRA 2RE9A 2BVVA 4LO5B 3TNQA 2VMIA 4XACA 1LHUA 4CRQA 2W47A 1MS1A 5F2WA 1PVC1 4QXKA 4XCBA 2Y0OA 2WNOA 2ZGKA 4CCDA 4Y4YA 4C8DA 3WUDA 1TE1B 2XLFA 1D4M3 1R093 4QB1A 2CHHA 2X05A 1NX9A 5CIRA 2WR9A 5EFUA 4DUWA 3SXWA 4CCNA 2Q4SA 4Y26A 4PHZA 5T54A 3I8TA 3MO4A 3CBNA 3NNFA 1QQP3 1SMVA 1LOCA 2MEV1 3C7GA 3UJOA 1QXRA 4GWMA 1IG0A 2HH9A 3ETPA 1YFYA 2V73A 4FXKB 4Y1VA 3MEPA 2XWJB 1FMD3 1UY2A 1EV11 2Y34A 1MQTB 2X5IA 3I4IA 4OMDA 4QX0A 4CDXA 4N43C 3WR0A 2R043 1OVSA 2W3JA 5EZWA 5ACA3 1DQ5A 2HEVF 2RVAA 3FMGA 1RUJ2 4UXAA 1F4HA 1CIWA 3AYAA 2W95A 5FO8B 3KHCA 2XBO2 4IERA 2W91A 3VBSA 4A45A 5TSWA 3LIGA 2RS33 5FZ6A 1C5IA 4W65A 1PO13 4XZPA 3VDCA 4L9BA 4KL1A 3KT1A 3MF6A 2RM22 1GOFA 2RMU1 2JXAA 2VM9A 3CIHA 5FJKA 3O1RA 3MIHA 4BM8A 2JE7A 3OUJA 3EQEA 2HYKA 5A7WB 3ZFGC 4Z92B 1HW5A 1DQ4A 1K45A 3AVSA 5FTTC 5C7GA 3I97A 2H6CA 2ES3A 1W6NA 5T5LA 1PVC2 2UWAA 5EWSA 4QQ2A 5D21A 1YNAA 5C9AC 2LUWA 4AQSA 1FXZA 1GU3A 1VRH1 1UD1A 2ZHMA 2NLRA 4CEYB 4C91A 1PGW1 4BMBA 4A4AA 5T50A 2DUOA 3E5UA 2D40A 3DXUA 2D3PA 4Y5Z0 3H1MA 2FCUA 3B3QE 3WG2A 1ALYA 2JJ6A 4XBNA 2MEV2 4NVPA 4IE4A 3J26N 4GAZA 1I9RA 3I7DA 2KR2A 3KCXA 3POWA 4M3CF 1H8TA 1KS5A 1MQTA 5A7WA 4IEQA 3KV6A 3IKWA 1JYVA 3DKWA 1EV12 1YO8A 4LBQD 5C3RA 1Q8VA 4FPFA 3OBZA 5GM0A 2WYSA 4ZXKA 4IE7A 1WMDA 3RSJA 4X8PA 2C1FA 5FY5A 1T6GC 4QKDA 3I3MA 3RZLA 3DKQA 3LFMA 3B00A 4NIDA 1DFQA 2E33A 3UK9A 3O1VA 3KLSA 1GR3A 4RFT0 2LW8A 3VL9A 1TMF3 2DVFA 2VCAA 2YBSA 5T52A 1XE0A 1XQNA 3MIGA 4MGYE 1UKGA 2RMU2 1MVQA 2ZBJA 2R0HA 2QQJA 2WJSA 5IK4A 2JDKA 1ODNA 2JDZA 2FCTA 3VBRB 4NHKA 5B4NA 3IDEA 1SPPA 4GKXA 4AQ6A 3LE0A 3LSEA 3EYPA 3WHUA 4ATFA 1W8UA 2B8MA 3POYA 5LA0A 5FDBA 2QNKA 2Y8KA 2D93A 1RMU2 2F4PA 1S4CA 3GALA 4AI1A 2EVXA 2IZWA 1RC6A 4Q26A 4CA9A 1RHI3 3LFIA 1PZ8A 2GAUA 4Q1PA 2R32A 4FFFA 5EIYB 1VRH2 3U11A 1PGW2 5FBJA 3VZKA 5EJ3A 4YZ5A 3CJIA 4KU8A 4ZS3A 4UW3A 1F8VA 1AXKA 1KJLA 1NCQB 2P34A 2Q30A 3FL7A 4LIVA 3VD4A 4MXVA 4XUQA 2R1BA 4A7YA 2E26A 1AUYA 2ZACA 2ZGOA 3GGLA 3CZUA 4XJ9A 4F3JA 4YSFA 1EAH1 2VZ3A 3WY6A 5LY1A 1NLSA 4IETA 3ORJA 3THCA 4E8DA 5IWFA 4YVWC 3ZFFB 4DB5A 4CCJA 4K40A 4QDRA 5J1XA 3IWZA 2XVLA 3T4HB 2EAAA 3H0OA 3TOJA 3ZX7A 2FMDA 1WBLA 4E2QA 1CPNA 1HN1A 1LEDA 3H42B 2GNTA 1UF2C 4M3CE 4QWNA 4X8NA 4BQ4A 4DEQA 1ZNPA 4KG8A 5BNPC 4WZFA 4DINB 2GP5A 3U1XA 3RMYA 1GNHA 1QF3A 3TEXA 4B7KA 5ISLA 5IFTA 4TZDA 3IDAA 4Y5TA 4COUA 1RXGA 3VBRA 4CU6A 5C70A 1U5YA 5FZ1A 1GP6A 5FZ4A 2KM2A 2RDSA 2Y33A 4GWIA 1W8ZA 1OPMA 2DTWA 2Y38A 1VRBA 4XJWA 2FDKA 3T0BA 3DPRC 2XQXA 4Q4Y3 4XETA 1ZBE1 1MPXA 5DZGA 2RDQA 1VB2A 5FMOL 2WBKA 5CFCA 1YHFA 3LPGA 5I93A 4HN1A 5SV8A 4I3GA 4COYA 1JZ3A 5H9SA 3UNPA 1ZRRA 4A6OA 2AR6A 4IL7A 2H0BA 3ZSJA 1MEC1 4YG6A 4QPYA 1JOBA 5I8SA 2JG8C 2BP6A 2R073 5JZGC 2D5HA 1PGSA 2ARAA 4FPJA 1DCSA 2IVIB 1QJEA 3LZZA 3EBRA 1VBB1 3PVEA 3JD71 4W50A 3MW4A 4M0HA 1A34A 2OVUA 2CAUA 1PO23 4A3ZA 2OZ6A 1YFUA 2ENRA
chains in the Genus database with same CATH topology
4XURA 3ACFA 1JZ6A 2BZDA 1O8SA 2Y6HA 3I3DA 3HEIA 3C8XA 1JHJA 1R64A 4PQQA 2WO2A 3WQBA 2B9VA 3LPFA 1GOHA 2ZXQA 1D7PM 3FHAA 5HXMA 1YQ2A 4XUTA 3ABZA 2EIDA 3U37A 4DXTA 1XNAA 1XPWA 3CQOA 1UY1A 2C4XA 3E1F1 4MGQA 5IJRA 2W1SA 2VZSA 3HNYM 3WNPA 3F2ZA 1CZTA 4E8CA 3T0AA 2WZEA 2WABA 4OUEA 4RN5A 2VTFA 1JYNA 1SG3A 1W0NA 2DDUA 2VMCA 3HNMA 4Z2AA 3LEIA 4MADA 2YFUA 5B4XA 2VR4A 3FN9A 2DCJA 5JXJA 3D3AA 3SKVA 2VQUA 4AG4A 5C71A 4BK5A 1DYOA 3HOBA 2RJ2A 1TVGA 5DPNA 3SEEA 4QX3A 1H6XA 3K77A 3NQHA 1GNYA 4ZXEA 3OBAA 2W1WA 4BK4A 2J1RA 4UI9L 1US2A 4ZZ5A 2W1UA 2QQNA 2J1VA 4MO3M 3ZM8A 4XZUG 2C9KA 1NUKA 3JXSA 4OYUA 3ACGA 1IQDC 1LNSA 2Y6KA 1EUUA 1GUIA 4P08A 1NKGA 4HG6B 5JXHA 2VO5A 1O8PA 2Y6LA 3K4DA 2WAAA 1CX1A 3IIIA 3DYOA 3T0DA 2HYXA 1JYWA 4LHSA 5CYYA 5CZKA 1EUTA 4PT6A 2EIEA 2KD7A 3EB7A 4ARYA 3CMGA 3BN6A 4AAXA 3ACHA 3OG2A 3WSOA 1J83A 3WF3A 2HLEA 3BGAA 5FUIA 2X10A 3A22A 1DLCA 3PUIA 1K42A 3UESA 4IUGA 4D0QA 2WN3A 3UETA 2Y64A 4CUCA 2EICA 3WF2A 3NRUA 4CVUA 2J1UA 4TXWA 2YC4A 2CDPA 1UXXX 4ZZ8A 3VD5A 2QQOA 2QQKA 3A7QA 4P02B 3AC0A 1UYXA 2JDAA 1W9WA 4JKLA 3K75B 2VZVA 2W87A 3MUY1 3I2GA 1KGYA 1BHGA 4YPJA 4L0PA 3NNGA 3DYMA 3A21A 1UWWA 3VD7A 1J84A 2RV9A 1OD3A 3T09A 4KWUA 1OH4A 1TG7A 3SEPA 4GZ9A 3P6BA 2JE8A 4LPLA 2YFZA 4MGSA 3VD9A 3W5MA 4JHZA 4W4ZA 2E31A 4CUAA 4GWJA 3T2PA 2BGOA 4BXSV 1UX7A 2QQLA 3HNBM 3K4AA 2XHNA 2WQ8A 3VDBA 3OB8A 5IYYA 1W8NA 5JXGA 3LEKA 2Z4FA 3P1IA 4RYDA 3WEZA 4MOAA 1PX4A 1OF3A 5EJ1B 5LCWL 3WF4A 5DQ0A 5LA2A 5IFPA 2ID4A 3CDZB 3I3EA 3OGSA 4A42A 3IB3A 3VD3A 3NJVA 5I0DA 1ULPA 3WNKA 1UY4A 3I2JA 2QQMA 3J7HA 3WF1A 2V5DA 1UYZA 1ULOA 2YG0A 1OT5A 4ARXA 2W92A 3T2QA 2EIBA 2VZPA 4A41A 2WUHA 2W5FA 4CU7A 2BERA 2R7EB 2C26A 1T2XA 4DEVA 2WN2A 1K12A 4A44A 3OGRA 2ZEYA 1WKYA 3IAPA 4QDQA 2JD9A 3DECA 4P00B 3WNLA 2QQIA 2VCCA 1UYYA 2XONA 2J1TA 1RYYA 3ECQA 1XNTA 3WNOA 1I5PA 4XUNA 1L7RA 4OZOA 2W46A 3C7EA 2VZOA 3MV01 2CDOA 2XOMA 1OF4A 2BGPA 3ACIA 5F7UA 3MUZ1 4KI5M 1K3IA 2Y6JA 1XC6A 2OKXA 4LKSA 3T2OA 1SDDB 4BJ0A 4DXSA 1US3A 2B4KA 1O59A 2W47A 5HPOA 2QBXA 4PF1A 3I2HA 2ZEXA 3LEGA 2VZTA 1W9SA 4QB1A 2JKXA 1UY3A 2X05A 1NX9A 4DUWA 2W94A 4P5YA 2VL4A 4QAWA 3GDBA 3MO4A 4DUVA 1W99A 2J1SA 3MBWA 3C7GA 1JU4A 3ETPA 3WNNA 4UOJA 4OMDA 4QX0A 1UY0A 1UY2A 3MV11 3T08A 2W3JA 3C7OA 2RVAA 1F4HA 2W95A 3VDAA 4A45A 2W91A 2YB7A 3VDCA 2VZRA 3W5NA 2Y6GA 2WZ8A 1UMIA 1KEXA 1GOFA 2J22A 3LQCA 2VM9A 3CIHA 5IHRA 3IAQA 1JZ2A 4XUPA 1CZSA 1JYXA 2VZ1A 2WO1A 2LS6A 4JKMA 1K45A 5C7GA 4TTGA 3I97A 2L9LA 3FHQA 3I3BA 2V72A 1GQPA 3WNMA 4UAPA 4JKKA 1GU3A 1L7QA 1W9TA 3HPNA 4QB6A 1JZ4A 4A4AA 1DP0A 4QPWA 2VMDA 5G05L 4ET7A 1PX3A 1WCQA 2X09A 1PMHX 1CIYA 1JU3A 4W8JA 4M4PA 4OMCA 3C7FA 1JYVA 2J1AA 3CKHA 4D8MA 3I2FA 2ZEZA 2WYSA 4QX2A 3OEAA 4DXRA 3WF0A 4BDVB 2E33A 2BBAA 2J7MA 2WDBA 5G04L 1W8OA 2W1QA 2VJXA 2LW8A 2V4VA 2VCAA 1SHWB 2QQJA 5DN2A 2E32A 4QX1A 5B4NA 1UMHA 3OEBA 3LE0A 5JR2A 3THDA 3EYPA 5LA0A 4KMQA 2Y8KA 2VCBA 3DYPA 4DUXA 5EIYB 2ORXA 1UXZA 4XUOA 3FL7A 2YC2A 3VD4A 3K4ZA 4XUQA 2E26A 2VOTA 3GGLA 3CZUA 1F4AA 1GOGA 2VZ3A 3PUHA 2PQSA 2DCKA 3THCA 4E8DA 1JZ5A 1P8JA 2ZEWA 2VC9A 4QDRA 5J1XA 1JZ7A 3SKJE 2VMFA 5A1AA 2VMEA 1HN1A 2WAOA 4CUBA 1JI6A 4DEQA 3GXUA 5JXIA 4XVHA 5JMOA 1UZ0A 2VZUA 2W9XA 5IFTA 4JX0A 3IDAA 3HJRA 3GM8A 4CU6A 5C70A 5LA1A 1CZVA 1PMJX 4GWIA 2ORZA 3T0BA 4CU8A 2XQXA 3C7HA 1MPXA 3OGVA 1H6YA 3I2IA 2WBKA 3I2KA 3LPGA 5DMYA 5EJZB 3CZJA 3A23A 2J1EA 2WO3A 1JZ3A 3UNPA 4A6OA 4CU9A 4M4RA 4ZY9A 2VZQA 3K46A 4LQRA 4FI9A 1GMMA 1NAEA 3NJXA 2VQTA 4W50A 1JZ8A 5JUVA 3HN3A 4QB2A 4A3ZA 4QDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUR A;  3ACF A;  1JZ6 A;  2BZD A;  1O8S A;  2Y6H A;  3I3D A;  3HEI A;  3C8X A;  1JHJ A;  1R64 A;  4PQQ A;  2WO2 A;  3WQB A;  2B9V A;  3LPF A;  1GOH A;  2ZXQ A;  1D7P M;  3FHA A;  5HXM A;  1YQ2 A;  4XUT A;  3ABZ A;  2EID A;  3U37 A;  4DXT A;  1XNA A;  1XPW A;  3CQO A;  1UY1 A;  2C4X A;  3E1F 1;  4MGQ A;  5IJR A;  2W1S A;  2VZS A;  3HNY M;  3WNP A;  3F2Z A;  1CZT A;  4E8C A;  3T0A A;  2WZE A;  2WAB A;  4OUE A;  4RN5 A;  2VTF A;  1JYN A;  1SG3 A;  1W0N A;  2DDU A;  2VMC A;  3HNM A;  4Z2A A;  3LEI A;  4MAD A;  2YFU A;  5B4X A;  2VR4 A;  3FN9 A;  2DCJ A;  5JXJ A;  3D3A A;  3SKV A;  2VQU A;  4AG4 A;  5C71 A;  4BK5 A;  1DYO A;  3HOB A;  2RJ2 A;  1TVG A;  5DPN A;  3SEE A;  4QX3 A;  1H6X A;  3K77 A;  3NQH A;  1GNY A;  4ZXE A;  3OBA A;  2W1W A;  4BK4 A;  2J1R A;  4UI9 L;  1US2 A;  4ZZ5 A;  2W1U A;  2QQN A;  2J1V A;  4MO3 M;  3ZM8 A;  4XZU G;  2C9K A;  1NUK A;  3JXS A;  4OYU A;  3ACG A;  1IQD C;  1LNS A;  2Y6K A;  1EUU A;  1GUI A;  4P08 A;  1NKG A;  4HG6 B;  5JXH A;  2VO5 A;  1O8P A;  2Y6L A;  3K4D A;  2WAA A;  1CX1 A;  3III A;  3DYO A;  3T0D A;  2HYX A;  1JYW A;  4LHS A;  5CYY A;  5CZK A;  1EUT A;  4PT6 A;  2EIE A;  2KD7 A;  3EB7 A;  4ARY A;  3CMG A;  3BN6 A;  4AAX A;  3ACH A;  3OG2 A;  3WSO A;  1J83 A;  3WF3 A;  2HLE A;  3BGA A;  5FUI A;  2X10 A;  3A22 A;  1DLC A;  3PUI A;  1K42 A;  3UES A;  4IUG A;  4D0Q A;  2WN3 A;  3UET A;  2Y64 A;  4CUC A;  2EIC A;  3WF2 A;  3NRU A;  4CVU A;  2J1U A;  4TXW A;  2YC4 A;  2CDP A;  1UXX X;  4ZZ8 A;  3VD5 A;  2QQO A;  2QQK A;  3A7Q A;  4P02 B;  3AC0 A;  1UYX A;  2JDA A;  1W9W A;  4JKL A;  3K75 B;  2VZV A;  2W87 A;  3MUY 1;  3I2G A;  1KGY A;  1BHG A;  4YPJ A;  4L0P A;  3NNG A;  3DYM A;  3A21 A;  1UWW A;  3VD7 A;  1J84 A;  2RV9 A;  1OD3 A;  3T09 A;  4KWU A;  1OH4 A;  1TG7 A;  3SEP A;  4GZ9 A;  3P6B A;  2JE8 A;  4LPL A;  2YFZ A;  4MGS A;  3VD9 A;  3W5M A;  4JHZ A;  4W4Z A;  2E31 A;  4CUA A;  4GWJ A;  3T2P A;  2BGO A;  4BXS V;  1UX7 A;  2QQL A;  3HNB M;  3K4A A;  2XHN A;  2WQ8 A;  3VDB A;  3OB8 A;  5IYY A;  1W8N A;  5JXG A;  3LEK A;  2Z4F A;  3P1I A;  4RYD A;  3WEZ A;  4MOA A;  1PX4 A;  1OF3 A;  5EJ1 B;  5LCW L;  3WF4 A;  5DQ0 A;  5LA2 A;  5IFP A;  2ID4 A;  3CDZ B;  3I3E A;  3OGS A;  4A42 A;  3IB3 A;  3VD3 A;  3NJV A;  5I0D A;  1ULP A;  3WNK A;  1UY4 A;  3I2J A;  2QQM A;  3J7H A;  3WF1 A;  2V5D A;  1UYZ A;  1ULO A;  2YG0 A;  1OT5 A;  4ARX A;  2W92 A;  3T2Q A;  2EIB A;  2VZP A;  4A41 A;  2WUH A;  2W5F A;  4CU7 A;  2BER A;  2R7E B;  2C26 A;  1T2X A;  4DEV A;  2WN2 A;  1K12 A;  4A44 A;  3OGR A;  2ZEY A;  1WKY A;  3IAP A;  4QDQ A;  2JD9 A;  3DEC A;  4P00 B;  3WNL A;  2QQI A;  2VCC A;  1UYY A;  2XON A;  2J1T A;  1RYY A;  3ECQ A;  1XNT A;  3WNO A;  1I5P A;  4XUN A;  1L7R A;  4OZO A;  2W46 A;  3C7E A;  2VZO A;  3MV0 1;  2CDO A;  2XOM A;  1OF4 A;  2BGP A;  3ACI A;  5F7U A;  3MUZ 1;  4KI5 M;  1K3I A;  2Y6J A;  1XC6 A;  2OKX A;  4LKS A;  3T2O A;  1SDD B;  4BJ0 A;  4DXS A;  1US3 A;  2B4K A;  1O59 A;  2W47 A;  5HPO A;  2QBX A;  4PF1 A;  3I2H A;  2ZEX A;  3LEG A;  2VZT A;  1W9S A;  4QB1 A;  2JKX A;  1UY3 A;  2X05 A;  1NX9 A;  4DUW A;  2W94 A;  4P5Y A;  2VL4 A;  4QAW A;  3GDB A;  3MO4 A;  4DUV A;  1W99 A;  2J1S A;  3MBW A;  3C7G A;  1JU4 A;  3ETP A;  3WNN A;  4UOJ A;  4OMD A;  4QX0 A;  1UY0 A;  1UY2 A;  3MV1 1;  3T08 A;  2W3J A;  3C7O A;  2RVA A;  1F4H A;  2W95 A;  3VDA A;  4A45 A;  2W91 A;  2YB7 A;  3VDC A;  2VZR A;  3W5N A;  2Y6G A;  2WZ8 A;  1UMI A;  1KEX A;  1GOF A;  2J22 A;  3LQC A;  2VM9 A;  3CIH A;  5IHR A;  3IAQ A;  1JZ2 A;  4XUP A;  1CZS A;  1JYX A;  2VZ1 A;  2WO1 A;  2LS6 A;  4JKM A;  1K45 A;  5C7G A;  4TTG A;  3I97 A;  2L9L A;  3FHQ A;  3I3B A;  2V72 A;  1GQP A;  3WNM A;  4UAP A;  4JKK A;  1GU3 A;  1L7Q A;  1W9T A;  3HPN A;  4QB6 A;  1JZ4 A;  4A4A A;  1DP0 A;  4QPW A;  2VMD A;  5G05 L;  4ET7 A;  1PX3 A;  1WCQ A;  2X09 A;  1PMH X;  1CIY A;  1JU3 A;  4W8J A;  4M4P A;  4OMC A;  3C7F A;  1JYV A;  2J1A A;  3CKH A;  4D8M A;  3I2F A;  2ZEZ A;  2WYS A;  4QX2 A;  3OEA A;  4DXR A;  3WF0 A;  4BDV B;  2E33 A;  2BBA A;  2J7M A;  2WDB A;  5G04 L;  1W8O A;  2W1Q A;  2VJX A;  2LW8 A;  2V4V A;  2VCA A;  1SHW B;  2QQJ A;  5DN2 A;  2E32 A;  4QX1 A;  5B4N A;  1UMH A;  3OEB A;  3LE0 A;  5JR2 A;  3THD A;  3EYP A;  5LA0 A;  4KMQ A;  2Y8K A;  2VCB A;  3DYP A;  4DUX A;  5EIY B;  2ORX A;  1UXZ A;  4XUO A;  3FL7 A;  2YC2 A;  3VD4 A;  3K4Z A;  4XUQ A;  2E26 A;  2VOT A;  3GGL A;  3CZU A;  1F4A A;  1GOG A;  2VZ3 A;  3PUH A;  2PQS A;  2DCK A;  3THC A;  4E8D A;  1JZ5 A;  1P8J A;  2ZEW A;  2VC9 A;  4QDR A;  5J1X A;  1JZ7 A;  3SKJ E;  2VMF A;  5A1A A;  2VME A;  1HN1 A;  2WAO A;  4CUB A;  1JI6 A;  4DEQ A;  3GXU A;  5JXI A;  4XVH A;  5JMO A;  1UZ0 A;  2VZU A;  2W9X A;  5IFT A;  4JX0 A;  3IDA A;  3HJR A;  3GM8 A;  4CU6 A;  5C70 A;  5LA1 A;  1CZV A;  1PMJ X;  4GWI A;  2ORZ A;  3T0B A;  4CU8 A;  2XQX A;  3C7H A;  1MPX A;  3OGV A;  1H6Y A;  3I2I A;  2WBK A;  3I2K A;  3LPG A;  5DMY A;  5EJZ B;  3CZJ A;  3A23 A;  2J1E A;  2WO3 A;  1JZ3 A;  3UNP A;  4A6O A;  4CU9 A;  4M4R A;  4ZY9 A;  2VZQ A;  3K46 A;  4LQR A;  4FI9 A;  1GMM A;  1NAE A;  3NJX A;  2VQT A;  4W50 A;  1JZ8 A;  5JUV A;  3HN3 A;  4QB2 A;  4A3Z A;  4QDS A; 
#chains in the Genus database with same CATH topology
 3O0X A;  1SQ4 A;  2GP3 A;  5LAS A;  1F9K A;  1JZ6 A;  2QFE A;  3FUQ A;  3USS A;  5LEJ A;  4CDW C;  1WCS A;  1ZRE A;  4XOG A;  3S30 A;  3G6J B;  2A6Y A;  4HPK B;  5FYH A;  4DRV A;  1JHJ A;  1ZZ6 A;  1JHN A;  4HSL A;  1Q43 A;  3PLQ A;  2W39 A;  1HRI 3;  3MID A;  1POV 1;  3MW3 A;  1AYM 3;  2CGP A;  3KCY A;  3LPF A;  2ZXQ A;  4CEW C;  1GAN A;  1QGL A;  2ZA9 A;  4IEZ A;  1VB4 A;  4EV0 A;  1RUE 3;  4MUV A;  1RUF 3;  2RS5 3;  1BK1 A;  3D8C A;  4Q4V 1;  1FPN 3;  3VZJ A;  1VBE 3;  2WLP A;  2EID A;  4XDP A;  4PJY A;  4AE2 A;  2GMP A;  3U37 A;  5F39 A;  2VQA A;  2XUM A;  4AGR A;  1C8M 1;  2GC0 A;  1XPW A;  3C3V A;  1UY1 A;  1ASJ 1;  4Z07 A;  2ZAA A;  2Q8O A;  1ZBE 2;  2C24 A;  4U2A A;  3GHN A;  1TQ5 A;  1BEV 1;  2BNM A;  4LIU A;  3WNP A;  3RYR A;  1M4W A;  1RUH 3;  1ND3 B;  2ARC A;  2WZE A;  5I8Y A;  2YDE A;  5FZO A;  2KXL A;  5JVV A;  5E1R A;  5FPB A;  2O1Q A;  2VTF A;  3LF7 A;  1XYO A;  3NO8 A;  4KWJ A;  4PQ9 A;  4BQ5 A;  5BNO A;  1JYN A;  3I2O A;  2Q8D A;  3MFC A;  4CUG A;  3HNM A;  4IV1 A;  3WLU A;  2A71 A;  2UYA A;  1GWK A;  1HQW A;  2OQ7 A;  3N7L A;  4JC1 A;  5SV5 A;  1MEC 2;  2JDP A;  4Q0P A;  2VR4 A;  5EXO A;  3FN9 A;  1OA3 A;  2DCJ A;  2HEW F;  3ZSL A;  5IVE A;  4AG4 A;  2A6V A;  1VBB 2;  3ZXJ A;  3AL5 A;  3JD7 2;  2Y60 A;  5FZH A;  1TNR A;  2VOX A;  3KV4 A;  4P9J A;  4AI2 A;  1TEI A;  3IT8 A;  3OPT A;  4NAM A;  5F37 A;  1Y9M A;  4Y22 B;  1ZYB A;  1SLA A;  2X29 A;  3SEE A;  4M0N A;  4CE8 A;  3AP6 A;  5BV6 A;  4YVS A;  1HB2 A;  1GNY A;  5FLI A;  4C90 A;  5CEH A;  3OBA A;  4WVZ A;  5HCB A;  2VXR A;  4FT8 A;  4V2W A;  5FYS A;  4L97 A;  3W58 A;  1OQ1 A;  3FBY A;  3KF3 A;  3OYW A;  3FE5 A;  1US2 A;  2D6K A;  5FO7 B;  3RYK A;  1PM7 A;  4MO3 M;  1FOD 3;  4CP1 A;  3U14 A;  1NA1 B;  1LHV A;  5D8A C;  3EJK A;  2O14 A;  3JXS A;  2SBA A;  2WT1 A;  5CU1 A;  2JE9 A;  1RUI 1;  1LNS A;  1VAL A;  4YLZ A;  5DAQ A;  1C8M 2;  5D1I A;  1JW6 A;  1ASJ 2;  2GU9 A;  1O8P A;  2VO5 A;  2Y6L A;  3KT4 A;  3OPZ A;  4JVA A;  4DRR A;  1CX1 A;  1BEV 2;  4CEY C;  3DYO A;  4L92 A;  1ZM1 A;  5C5T A;  4MGT A;  3T0D A;  3IMN A;  4XC9 A;  3LOI A;  4PT6 A;  1WD4 A;  1N3Q A;  1ZA7 A;  2QZ2 A;  2KD7 A;  4ARY A;  3CMG A;  3BN6 A;  2GMM A;  1VE0 A;  4EN8 B;  5KHH A;  4ZKT B;  4QMA A;  5J7M A;  5K0U A;  2PHL A;  1F15 A;  3GJB A;  4L11 A;  5DDJ 3;  2VBB A;  2FDG A;  4FFI A;  2O0O A;  1HRV 3;  2EXI A;  4XQW A;  3HQU A;  2X10 A;  4R9B A;  3OJB A;  3PUI A;  1ND2 A;  1FV3 A;  2JWP A;  1V6L A;  2QTW B;  3UET A;  3WF2 A;  5JI7 A;  2JB4 A;  3IIA A;  2PAK A;  4AI0 A;  1IOA A;  4FO9 A;  2J1U A;  1T6B X;  2VNG A;  2CDP A;  5EPA A;  2EAL A;  2P6H A;  4CDQ B;  5E16 A;  4NJ4 A;  5FPX A;  1OLQ A;  4LBL A;  3V56 A;  1BXH A;  2QQO A;  5DAW A;  2A73 B;  3LKJ A;  5DG1 A;  5FZB A;  5JLV A;  1WMF A;  3KV9 A;  4FOY A;  3ITQ A;  4P5H A;  2JDA A;  4TLG A;  2VPV A;  2VZV A;  3PL0 A;  3WIN E;  1KGY A;  3HN1 A;  4O9G A;  4XFH A;  1A78 A;  1RUI 2;  2F17 A;  5A7Q A;  1QJY 1;  4BQW A;  3ATG A;  3D82 A;  5BNN B;  4XFC A;  4BA6 A;  2WWU A;  5AFB A;  3H9A A;  3N9L A;  1OH4 A;  3MZH A;  1Y9Q A;  4H3W A;  1VMF A;  1V9U 1;  1X9T A;  2A3X A;  1OOP A;  1ULE A;  5T5P A;  4CP9 B;  1X50 A;  1OQE A;  1W9Y A;  1NCQ C;  1QJX 1;  4AVC A;  4AW7 A;  2PLV 1;  3GZU C;  4F8A A;  4MGS A;  4P9I A;  3O1P A;  1APN A;  4Q4W 1;  1CWP A;  4JHZ A;  1W03 A;  5FXV A;  5H9P A;  4EZH A;  3TEY A;  4OZX A;  2YU1 A;  3CNA A;  4GWJ A;  2K46 A;  3PDQ A;  3T2P A;  3N9M A;  1AR7 1;  2NN8 A;  2QDR A;  3ZFF C;  5BXX A;  1OPO A;  4NRP A;  4JDM A;  2XHN A;  3VDB A;  1XOY A;  2D7F A;  3FJS A;  4JQR A;  3WDU A;  1A6C A;  2Z4F A;  2OW4 A;  4CDQ A;  3PU8 A;  1PX4 A;  1ODM A;  5LCW L;  1TZO A;  4K21 A;  5DZF A;  3M1H A;  3WDX A;  4MV2 A;  4LA2 A;  3AP9 A;  2JDH A;  5C3P A;  3I3E A;  5CNA A;  2XVK A;  5A7N A;  1IKQ A;  3NJV A;  4EWD A;  1BVP 1;  5F3I A;  1BVV A;  2RS1 3;  4HBN A;  1OLM E;  3ZFE B;  4Q4X 3;  5FP3 A;  1UY4 A;  2R30 A;  4Q27 A;  3BU0 A;  3M3C A;  1UZV A;  2RR1 3;  5GLW A;  3J7H A;  1K5M C;  3V0B B;  3WF1 A;  3ZPO A;  1WZX A;  1UYZ A;  4OUS A;  5IK5 A;  1OT5 A;  3IZO A;  2Z2S B;  4OHV A;  1YJL A;  2BPA 2;  2BER A;  3AZV A;  4CP9 A;  3HD8 B;  2R06 3;  4Y33 A;  1V9U 2;  2A70 A;  4OHX A;  2VU9 A;  1T2X A;  1S0G A;  2IWG B;  4LO7 A;  1DZT A;  1KXG A;  1NZC A;  1QJX 2;  2PLV 2;  2WN2 A;  1K12 A;  1PZ9 A;  4IGP A;  5CB7 A;  1WW6 A;  1W0O A;  4NMI A;  4Q4W 2;  4A44 A;  4K3U A;  5FY1 A;  2EXJ A;  2ZEY A;  5L7O A;  4AFD A;  1LGB A;  1WKY A;  1AR7 2;  4CCM A;  5JAX A;  4QDQ A;  4LE4 A;  2XH6 A;  4UT5 A;  3IDC B;  2DCY A;  4FQZ A;  4HT1 T;  3NKG A;  3KHB A;  3VKM A;  4FTS A;  1HN0 A;  2OPW A;  5L9B A;  3WNL A;  3KSC A;  4YGB A;  4DO0 A;  2PXJ A;  2J1T A;  4I30 A;  4GA9 A;  5LBE A;  3WNO A;  4AED C;  3N36 A;  3JUU A;  1I5P A;  4RS5 C;  4KNC A;  1L7R A;  4YW3 A;  3V0A B;  4OZO A;  5FP4 A;  5LRS A;  3H50 A;  4FAG A;  1AX0 A;  3UKN A;  3Q8C A;  2CDO A;  3VB9 A;  3JB4 C;  4YW4 A;  3D6E A;  2WZR 1;  4BLI A;  4LHL A;  5C9A B;  1C8N A;  3T30 A;  1RIR A;  4URA A;  1DQ2 A;  3MUZ 1;  2EAK A;  1FAY A;  5EV7 A;  5FYC A;  5FZ7 A;  2OKX A;  4LKS A;  3OOX A;  4LUM A;  4S2H A;  1PK6 A;  2JKB A;  4QHZ A;  3TEW A;  3CHX A;  1JOJ A;  4XJA A;  5JPN B;  2ADE A;  1SFN A;  2WS9 1;  4NN0 A;  1S0C A;  3LDK A;  5FRA A;  1ND3 C;  2XB6 C;  3G7D A;  1O59 A;  3O7O A;  4H14 A;  4JQT A;  1Q8S A;  1ENQ A;  3OD4 A;  1VBD 3;  4EWE A;  5HPO A;  4LK7 A;  5AVA A;  3I2H A;  3KT7 A;  2WFF 3;  4N43 A;  4JTO A;  4DY5 A;  1O3Q A;  2ZEX A;  3LEG A;  1G86 A;  1AR8 1;  2NMN A;  1X8M A;  4LMF A;  4CCK A;  5FP7 A;  4NE9 A;  4AHW A;  1I5Z A;  4WM7 A;  4P5Y A;  1VR3 A;  1LOB A;  5FYV A;  2GC1 A;  2ZOE B;  1PZ7 A;  1E57 A;  4KBB A;  1W99 A;  3T1M A;  2VNV A;  4A7Z A;  5A3U A;  5K7P A;  3J7M A;  3M8L A;  3N9N A;  3AFG A;  5FPZ A;  1JU4 A;  2WLQ A;  1GNZ A;  3CF6 E;  4J6G A;  3GNE A;  3MV1 1;  5FK7 A;  4ES8 A;  3NV3 A;  4GJY A;  3JQX A;  1SLB A;  3ZFG A;  4CCC A;  5JCT A;  2QQP A;  3V0A A;  3T08 A;  4FPC A;  1YLL A;  3C7O A;  2ARE A;  2JEC A;  2PHW A;  2QCS B;  3VN4 A;  3WQ1 A;  1QJZ A;  2UWC A;  3BVC A;  1GZ9 A;  2HWB 1;  4HK9 A;  1QJU 1;  2VUJ A;  2W68 A;  2WZR 2;  2CNA A;  2HWF 3;  4FFH A;  2VZR A;  1FV2 A;  1DYP A;  2P3J A;  5A6X A;  3DXT A;  1KEX A;  1W2U A;  3HWJ A;  4PI2 A;  4E9K A;  1R1A 3;  2W52 A;  5IHR A;  4KU7 A;  2ADD A;  2E6V A;  1CZS A;  1FYU A;  5ABJ C;  2VZ1 A;  5LWB A;  4GMP 1;  2WS9 2;  4MLO A;  4GIQ A;  1F5J A;  4FOV A;  3WP5 A;  1Y4W A;  1LOE A;  1AYN 3;  3FHQ A;  4UFJ A;  1RUG 1;  4P9W A;  4I2O A;  1GQP A;  4WVM A;  5FY4 A;  2GME A;  2HWD 3;  4NHX A;  4JKK A;  4UAP A;  4TN7 A;  4YVW B;  4NHY A;  2E53 A;  4DOU A;  1W9T A;  4YW5 A;  1AR8 2;  3KM5 A;  3HPN A;  4D6Q A;  2HKX A;  2QQV A;  3GYD A;  1QY4 A;  4XYX A;  1HQN A;  3OBT A;  5CKN A;  1DP0 A;  1YFX A;  4HKO A;  1IQA A;  4QPW A;  2VMD A;  3ZXF A;  5DG2 A;  1PX3 A;  1WCQ A;  1IS6 A;  1ZBA 1;  2ET1 A;  3HVD A;  3ZO0 B;  5BNP B;  1AX1 A;  2CYF A;  3AFK A;  1HKD A;  3C7F A;  4D7S A;  2JX9 A;  1LHW A;  4DY3 A;  2O8O A;  1UPI A;  4DFS A;  4AEM A;  5FLJ A;  1O3R A;  4E2S A;  4QX5 A;  1DGL A;  2ZGQ A;  4IGQ A;  3OEA A;  1DIW A;  1MZF A;  4KWL A;  4AVB A;  4DXR A;  5CG9 A;  2VW1 A;  4B1M A;  2Q0A A;  3POG A;  3PVN A;  2HWB 2;  3MGU A;  4DNY A;  5D2A A;  2AH2 A;  2BBA A;  5G04 L;  1AHS A;  1W2O A;  4DS0 A;  1QOT A;  4Q0Q A;  4Q0S A;  3KQR A;  4YG0 A;  5ERL A;  1J58 A;  3BTX A;  4IV3 C;  5GLU A;  4Q8L A;  1O6U A;  1RUJ 3;  3E5Q A;  1SHW B;  5FRE A;  5HCF A;  4LJH A;  4MG2 A;  1WCK A;  4NWV A;  2PMW B;  1UOJ A;  3HMY A;  5A80 A;  4XF0 A;  3MIE A;  1LRH A;  5F2S A;  4NHL A;  3AKQ A;  3TNP B;  3URF A;  5FPA A;  3THD A;  3O1T A;  2JG8 B;  5JZG B;  1JBC A;  1XNB A;  4YVW A;  1RUG 2;  4XF1 A;  4I3P A;  3U07 A;  1S2K A;  5FUN A;  2VCB A;  1H30 A;  1MAC A;  4HKW A;  5LBB A;  4DUX A;  3Q8A A;  4RGG A;  2ORX A;  4WVV A;  1OXC A;  3VBO B;  1UW8 A;  4XFI A;  1UXZ A;  3D0J A;  2VUC A;  5FAX A;  3H8R A;  3RG0 A;  1H2L A;  3WDW A;  1B09 A;  5CG8 A;  1ONA A;  1XNC A;  4CDW B;  1ZZ8 A;  2ZGU A;  4QGN A;  5BNP A;  1CVN A;  4DQA A;  1GSL A;  2P4E A;  3NL1 A;  1ZBA 2;  2VOT A;  1OFS A;  1F4A A;  3AZX A;  2C6S A;  3WCS A;  5AC9 1;  4QM8 A;  3AJY A;  4MHU A;  4E4S A;  1H2N A;  1UAI A;  5A1L A;  3QCW A;  3ACL A;  1H1I A;  4GJZ A;  2BU9 A;  1QMJ A;  5ANQ A;  2JG9 C;  1J3R A;  5FY9 A;  2XG3 A;  1JZ5 A;  3T2T A;  1JUH A;  2PHU A;  2ZEW A;  3Q9O A;  4NAO A;  5FZD A;  1CAU B;  4OUM A;  1MR5 A;  3KV5 A;  3M2M A;  4UFI A;  1K5J A;  1GV9 A;  1KFU L;  1E5I A;  1LKN A;  1SLI A;  1PM4 A;  3DPR A;  5A1A A;  5C4W B;  4XAE A;  1JI6 A;  5FY8 A;  3IM0 A;  2WRA A;  5JXI A;  1URX A;  4SBV A;  4LA3 A;  2WWJ A;  4XVH A;  4A6S A;  2CSG A;  4YNI A;  4BIO A;  2VZU A;  3GHM A;  4GUL A;  3HJR A;  3GM8 A;  1OA2 A;  4XAB A;  3N9O A;  5LA1 A;  1OC1 A;  3NKT A;  4M3C B;  3S5A A;  1VLN A;  2BOI A;  5GJ6 A;  4Y1Y A;  2JG8 A;  2GC2 A;  2SLI A;  2I45 A;  4EJR A;  4LOT A;  5KHK A;  2RMU 3;  2VY0 A;  2VUD A;  2XKO A;  4P14 A;  5FZG A;  5J96 B;  1AR9 1;  3VHN A;  3J7N A;  1CX4 A;  1XB9 A;  3LA7 A;  2YZ4 A;  1KFX L;  1FI2 A;  1Y7B A;  5DMY A;  4P9L A;  3RJ2 X;  3CZJ A;  3A23 A;  5F1R A;  2P2K A;  4ASK A;  3P3P A;  4UF0 B;  4CDW A;  4IEU A;  4M4R A;  5FWE A;  5A32 B;  3GZT B;  1IZ3 A;  4ZY9 A;  1VRH 3;  3AYE A;  3BOW A;  3K46 A;  5AC9 2;  4LQR A;  4CEW A;  3A0K A;  2D98 A;  1H0B A;  1UL9 A;  4AGV A;  1D4M 1;  4LTA A;  1CAU A;  3N35 A;  4LBN A;  1VP6 A;  4WZC A;  5D8A B;  4PCR A;  1RMU 1;  1UOG A;  4TSV A;  3AKP A;  4QPG C;  3ACF A;  2DVG A;  2BZD A;  3AP7 A;  3SCH A;  5J09 A;  3I59 B;  5LEK A;  1TME 2;  1H9W A;  4QPI B;  3I3D A;  4PBP A;  3JU9 A;  4BXF A;  4CZS A;  2ZML A;  2CGO A;  2OQ6 A;  1D2S A;  1FMD 1;  2E51 A;  2C5D A;  2WO2 A;  4LKF A;  3VDD C;  2Z42 A;  3WQB A;  3KCC A;  4Z8B A;  1GOH A;  2FHR A;  1XSR A;  3FHA A;  3MI8 A;  1H2M A;  2DCZ A;  1S2B A;  4RD7 A;  3RVH A;  4K9S A;  2RG4 A;  3Q8E A;  1YQ2 A;  1IPJ A;  3ABZ A;  2XPJ A;  2IXK A;  1QHD A;  3JZV A;  4PLM A;  1AXZ A;  1JMU B;  2YGM A;  2ZMN A;  5J36 A;  2RS3 1;  2FDI A;  3CQO A;  1PO1 1;  4H2A A;  3B9C A;  5FZ8 A;  4AVV A;  1SDW A;  1AR9 2;  2ZKL A;  3HNY M;  3RI9 A;  3W21 A;  1XE7 A;  1CZT A;  2PHR A;  3E5X A;  2FCV A;  1VAV A;  4I0B A;  4I0W B;  4LO4 B;  4MGZ E;  4O9E A;  5CKM A;  5F5A A;  5F3E A;  3T0A A;  5FKB A;  3UYJ A;  1KD7 A;  1WUV A;  2OUH A;  3D5O A;  3ZMN A;  4OUE A;  4RN5 A;  4UF0 A;  1PHM A;  1KIT A;  1ZA4 A;  5FMO S;  4YGE A;  2VMC A;  1HX6 A;  1NY7 1;  3RWK X;  5I91 A;  3K2O A;  4KBZ A;  3LOB A;  2XL9 A;  1JS9 A;  1SBF A;  2ZGL A;  3NAP B;  4COW A;  3MDP A;  1ZZB A;  4YZ4 A;  5C3Q A;  1IS5 A;  1PIV 3;  3SKV A;  2AYH A;  2VQU A;  4JV4 A;  2DUP A;  1D4M 2;  5T5O A;  1YJK A;  3LSD A;  4HK8 A;  5LA9 A;  2RJ2 A;  1EAH 3;  5HCA A;  1AL2 1;  5FZF A;  3SNM A;  3H7J A;  2VG9 A;  2WNV B;  2ZZJ A;  5FZK A;  4ZXE A;  2PFW A;  3VV1 A;  1FNZ A;  4JGY B;  4CEY A;  2TNF A;  2W1W A;  2XJS A;  1GFF 2;  4LKE A;  2Z69 A;  4HVO A;  5LK5 A;  1D0G A;  1FMD 2;  4ZZ5 A;  3JB8 A;  2VQ0 A;  2QQN A;  1D2Q A;  1IG3 A;  1J59 A;  1OVP A;  2C9K A;  2R04 2;  1QDC A;  1NUK A;  2VGD A;  4MXW B;  4RR3 C;  1VMJ A;  2WSV A;  2A3W A;  1UIK A;  4BWO A;  4QT6 A;  1MS3 A;  3PJY A;  1EUU A;  1YXW A;  3RNS A;  1D4V B;  3NNJ A;  3FFZ A;  3RGB A;  3WP3 A;  5BYN A;  3PIG A;  1BMV 1;  4CDU C;  2RS3 2;  2TBV A;  1PO1 2;  4AFC A;  4L99 A;  4QU2 A;  1OKO A;  3VKL A;  2H6B A;  4XQD A;  4LKD A;  2ZAH A;  3EXU A;  3P5B A;  3TAY A;  2HYX A;  3AKT A;  3HQR A;  3C2U A;  1CJP A;  1EUT A;  5CYY A;  2DF7 A;  4LBK A;  3AP4 A;  3E6B A;  4A2U A;  3EB7 A;  1ZBE 3;  2N7G A;  1JTZ X;  1LGN A;  4XPV A;  2ZKN A;  1U0A A;  4NR1 A;  3NNM A;  3ZLI A;  1NY7 2;  4LOS A;  3O1M A;  2XQR A;  1VMH A;  3KQ4 B;  4XQ4 A;  4YZ3 A;  2VMG A;  4AFA A;  4PDW B;  2OYZ A;  3DCQ A;  4NIG A;  2VBD A;  1LHN A;  3BGA A;  3IMM A;  4GB3 1;  5F5I A;  3WG3 A;  1H8V A;  1A3K A;  2IXI A;  1NXD 1;  3QBQ A;  3OUI A;  3FHI B;  3POF A;  2R6Q A;  4D0Q A;  5FPL A;  3AMM A;  4AVS A;  1MEC 3;  2RDR A;  2H0V A;  1ZRC A;  5J3U A;  1UMZ A;  1JYT A;  3O1S A;  4ASL A;  1WGP A;  1K5M B;  1AL2 2;  3AP5 A;  4TXW A;  4CVU A;  1LTE A;  2P1B A;  1UXX X;  1Y3T A;  4BYY A;  1G9C A;  1VBB 3;  4PLN A;  5CIS A;  4E4H A;  1XYP A;  2TUN A;  2YPJ A;  2CL2 A;  3A7Q A;  4XMI A;  1SLC A;  1DZR A;  2OA2 A;  1NCQ A;  4HFS A;  5HXV A;  4XBQ A;  4MYE A;  4RA0 A;  1H9P A;  2RHP A;  1SFY A;  3K75 B;  5KXD A;  1OUS A;  4C1X A;  4RGK A;  4UW4 A;  1J3Q A;  4LOR A;  1N1T A;  1RXF A;  1BHG A;  4NHM A;  5FZI A;  5FZE A;  3ZFF A;  5DUW A;  4Q0U A;  1UOB A;  3V65 A;  1XU1 A;  5CFD B;  1BMV 2;  4C1W A;  2VE1 A;  1V6O A;  1J84 A;  2RV9 A;  1LOG A;  5GAL A;  1OD3 A;  1UU4 A;  2RJL A;  5FIX A;  3T09 A;  4BQX A;  4KWU A;  3ETQ A;  3RDI A;  3VBO C;  1H4H A;  1NCR C;  3FLP A;  4Q4V 3;  1W6O B;  3I2D A;  3WHT A;  1I1E A;  2DFB A;  4ASM B;  1HV1 A;  2W2I A;  2PHX A;  5CA6 A;  3AM2 A;  4AED B;  4FPK A;  2YFZ A;  4LPL A;  1ASJ 3;  4RS5 B;  4CCL A;  2B39 A;  1W8F A;  2EIG A;  3ZXA C;  1BEV 3;  1LOD A;  4UFK A;  2P6C A;  2OX0 A;  3WG1 A;  3UL2 A;  3S57 A;  3DV8 A;  4I01 A;  3VZO A;  1UX7 A;  3ZYJ B;  3ELN A;  2X5I C;  4E4D X;  2QQL A;  4GB3 2;  3HNB M;  2HWC 3;  3H8U A;  1C5H A;  3FWE A;  3OB8 A;  1LOA A;  5C4W C;  2DYC A;  5FZA A;  2WZP P;  5LY2 A;  1JYC A;  2Q1M A;  4FOW A;  4XJZ A;  1YRZ A;  3O5S A;  1UX6 A;  3WEZ A;  2P3K A;  4YGD A;  3ZIW A;  1C57 A;  3OY8 B;  5FYU A;  4D6S A;  5FMB A;  4V1P A;  3WF4 A;  2R07 1;  3HBK A;  4ISQ A;  5DQ0 A;  4BIS A;  5A3W A;  5A6Z A;  4BCU A;  2ID4 A;  4IEO A;  4K1Y A;  4B8E A;  2GC3 A;  2XDV A;  3FX3 A;  4R4X A;  2NPI A;  1FAT A;  4JTN A;  1AF9 A;  2ZAB A;  3ZSE A;  3PJQ A;  4NUB A;  3W9A A;  5F8P A;  5I0D A;  5IT6 A;  1W3X A;  3WNK A;  1PO2 1;  1UIJ A;  5J98 B;  3S6P A;  3EMR A;  3ZN4 A;  5CBL A;  1ULO A;  1RVF 1;  2YG0 A;  2F6B A;  5A7S A;  5J37 A;  1ZVF A;  5GZG A;  5JI9 A;  3H8X A;  2W5F A;  4D7Y A;  2ZX3 A;  4JGZ C;  4NIA A;  3UGG A;  2EF6 A;  2R7E B;  2XGX A;  1DG6 A;  3T4V A;  5EYY A;  4RS5 A;  4AED A;  4YZ1 A;  2P5B A;  1RUE 1;  2RS5 1;  4HPK A;  5JIU A;  1FPN 1;  3N4M A;  1F5F A;  3VUO A;  4ZU5 A;  5FQ0 B;  4D94 A;  4XBL A;  2UY9 A;  1POV 0;  4BQ1 A;  4JDO A;  5JOW A;  3BKZ A;  4KG0 A;  1H8T C;  1J1T A;  1RED A;  2Y0I A;  3IAP A;  3NW4 A;  4MET A;  2D3R A;  1XJA A;  3VHR A;  3DEC A;  5JR7 B;  4ORF A;  4Y20 B;  2QQI A;  3ZFE C;  2XON A;  5F3G A;  2Y26 A;  3ECQ A;  5IVC A;  3AMP A;  5CVR A;  3FC0 A;  2DUQ A;  3MYX A;  4QPI C;  5ABJ B;  3WDY A;  2XWB B;  3ZR6 A;  2ZGS A;  3ON7 A;  1CR7 A;  1GP4 A;  1ND3 A;  2BW8 A;  2WNE A;  2X8K A;  4CP0 A;  3RZM A;  2A6X A;  1V6J A;  2R07 2;  4LHN A;  3NV1 A;  4D3W A;  1NLR A;  2QVS B;  2MNG A;  1YIF A;  4KI5 M;  2A1X A;  1XC6 A;  2IVJ A;  1PO2 2;  4FFG A;  1QOS A;  1QXP A;  2ARX A;  4G4F A;  4MH0 E;  4PIZ A;  1N1Y A;  1AL0 G;  1VIW B;  1UKR A;  1RVF 2;  1UNB A;  2D43 A;  2GSY A;  3ZXK A;  2P3I A;  1CAW B;  4DXS A;  1QJF A;  1DYK A;  4Y22 A;  1S55 A;  4I0A A;  3RZZ A;  2QBX A;  1ZZ9 A;  4CYD A;  5BY5 A;  3K48 A;  4W6X A;  3ZOI A;  1Q8O A;  1QJY 3;  3M4F A;  5FMC A;  1RUE 2;  1VBC 1;  2RS5 2;  1W9S A;  2Z79 A;  1V6I A;  5FQ0 A;  1FPN 2;  3INA A;  2JKX A;  1UY3 A;  2BVB A;  1BZW A;  3NAP C;  1DBN A;  4G9S B;  1V9U 3;  3KS7 A;  4QHO A;  4IGO A;  3GDB A;  1PNG A;  4F83 A;  4DUV A;  1NA1 A;  4QQP A;  4AHY A;  4NRM A;  4AGG A;  4CPB A;  1O3T A;  2PLV 3;  2K2S A;  3SCF A;  3WP4 A;  4IV3 B;  3BTA A;  4Q4W 3;  1LES A;  2FDF A;  4KQ7 A;  1UY0 A;  4LLF A;  2LRP A;  2LAL A;  2WNV C;  5ABJ A;  2OPK A;  2I74 A;  1SCS A;  3LA2 A;  3POI A;  4S2D A;  4JGY C;  3FUO A;  3MHZ A;  5KHG A;  1JN2 P;  4HKL A;  1EP0 A;  3VDA A;  1GZC A;  1CGP A;  3PME A;  5FYY A;  3KGZ A;  1G9D A;  1DLL A;  1WCU A;  3SHR A;  1VAM A;  2YPD A;  5LRR A;  1OD5 A;  4IND A;  3W5N A;  4UBG A;  1RB8 G;  2WT0 A;  1IKP A;  1UMI A;  3N7K A;  2ERF A;  1KRI A;  3WV6 A;  1O4Z A;  4XUP A;  3V64 A;  5DZE A;  2VEC A;  1YUD A;  4LHK A;  5A3P A;  2WO1 A;  4Q1R A;  1N3P A;  2LS6 A;  4JKM A;  3UJQ A;  5I8T A;  1UU6 A;  2D6L X;  5CFC C;  2L9L A;  1D0H A;  4GH4 B;  5I0T A;  2YU2 A;  1WBF A;  4BQ3 A;  3I3B A;  3MW2 A;  4QD2 A;  5GZC A;  2A5Z A;  1OA4 A;  2YYO A;  3WNM A;  4YW1 A;  2JG9 B;  2ZX2 A;  4QB6 A;  3USU B;  2WIN B;  4NWW A;  1VBC 2;  4QQO A;  2AEZ A;  5HCH A;  1DDL A;  3AKR A;  2CU5 A;  4PDW C;  3RI8 A;  3OTF A;  1V0A A;  1GQG A;  3ES1 A;  3SC7 X;  4ET7 A;  5A33 B;  5L19 A;  2X09 A;  1PMH X;  1QNW A;  2CGN A;  2XML A;  2ZHL A;  5FK8 A;  1W2T A;  4IV3 A;  2B9U A;  2I2S A;  4BIF A;  5F6K A;  3S5Q A;  4FPO B;  4M4P A;  4YM0 A;  1AZD A;  1NE6 A;  3ZYP A;  1GWM A;  3QD6 A;  1HXS 1;  2BEO A;  3KD4 A;  4D8M A;  3I2F A;  5BNN A;  4UYB A;  1VBA 3;  5T55 A;  1VAK A;  4R9D A;  1RGS A;  4QKF A;  4XXP A;  4Y24 A;  4ZON A;  4QX2 A;  1LOF C;  1QU0 A;  3WQ0 A;  5C6C A;  5DDJ 2;  3T1L A;  3WF0 A;  4XHX A;  4XIL A;  4X6Q B;  2GNM A;  1H4G A;  2WDB A;  3NJZ A;  1W8O A;  2W08 A;  3ALQ A;  2VJX A;  5FZL A;  1SEF A;  3SMH A;  4BH9 A;  3PHM A;  1QKQ A;  2E7T A;  3H7Y A;  3WUC A;  5KR7 A;  4S2G A;  5DN2 A;  4QX1 A;  3VBH C;  5CFD C;  1E5H A;  3OBR A;  3K51 A;  3LDR A;  3NV4 A;  2DU1 A;  1JXN A;  5FY7 A;  3GBF A;  3NWK A;  4Q8K A;  4O7X A;  3BTZ A;  3GCX A;  3LWC A;  2Z5W A;  3CO2 A;  1H2K A;  3SH3 A;  3OGJ A;  5FR3 A;  1LEN A;  3GJA A;  3QH7 A;  1R08 3;  5K8S A;  5K4L A;  3DYP A;  4EWA A;  1KDM A;  2WS9 3;  2ZS6 B;  2RR1 1;  2WII B;  5IVV A;  1JOP A;  1BBT 3;  3SLI A;  3TBD A;  2HEY F;  5A33 A;  4QPG B;  2AUY A;  1NZI A;  4XUO A;  2DCT A;  4XIK A;  2YC2 A;  3AZW A;  1LEC A;  2VTX J;  3SCG A;  2UYB A;  4ISR A;  4AI9 A;  3JBG 1;  1GOG A;  3KGL A;  2R06 1;  5IVB A;  2F4L A;  1O3S A;  2R0F A;  2DCK A;  3VDD B;  2YGL A;  4R4Z A;  4YYO A;  2QE3 A;  4N53 C;  1HXS 2;  2R1D A;  1NYW A;  1F31 A;  2YBP A;  3NJY A;  1DGW A;  1WCD J;  4QU1 A;  2XJU A;  3CU7 A;  1M06 G;  1S1A A;  3SKJ E;  5IW0 A;  4XJ8 A;  4CUB A;  2K0G A;  2VNR A;  2HWE 1;  3GXU A;  4IXL A;  3PUA A;  1W6P B;  3ILR A;  3RZK A;  4AZZ A;  1YI7 A;  3POB A;  5FP8 A;  5JMO A;  4DZG A;  5IVF A;  1SFP A;  2D3S A;  2W9X A;  5FCC A;  4JDN A;  2HWB 3;  2B45 X;  4OLL A;  4P9Y A;  1QJU 3;  1STM A;  1IGO A;  1CZV A;  1OFN A;  5LB6 A;  1PMJ X;  2WSU A;  3PVO A;  5C8C B;  3ZKU A;  1WLD A;  1UQX A;  5FZ9 A;  4PLO A;  2ORZ A;  1NT0 A;  3ZYG A;  5IK8 A;  1COV 3;  3C7H A;  2MHF A;  3OF1 A;  2AC1 A;  4XFG A;  3SIT A;  5JOY A;  5A3O A;  1IPS A;  1H6Y A;  3I2I A;  4HMZ A;  3VBU B;  3SIS A;  5JPM B;  3VBF C;  1W6Q B;  4PBO A;  3F95 A;  5GLT A;  3ZMO A;  3E97 A;  2V09 A;  2BUK A;  4GMP 3;  1NLQ A;  5EJZ B;  3S0M A;  5K0U C;  1GP5 A;  1REF A;  4HAN A;  2IXL A;  2RR1 2;  4QPG A;  5JIA A;  4IE5 A;  5C9A A;  1QNY A;  1ZZC A;  1RUG 3;  4CU9 A;  1AJK A;  2D44 A;  2OII A;  2ATF A;  1WW4 A;  4RSU A;  1AR6 1;  5KXE A;  4GWN A;  5JMC A;  4KGG A;  1VBD 1;  4BZ4 A;  3JBG 2;  3VDD A;  3AZZ A;  2R06 2;  3VGI A;  3IBM A;  3ZDV A;  5L73 A;  3R4U A;  4FI9 A;  4HVR A;  1GYK A;  1NAE A;  2YUE A;  3AYC A;  2VUL A;  3NJX A;  4RR3 B;  1N1V A;  2EXK A;  2E7Q A;  2YY1 A;  4HLT A;  4JCK A;  5ANN A;  1JZ8 A;  1RUD 3;  1ZBA 3;  4RHV 1;  1W6M B;  1YQC A;  2PHD A;  4QDS A;  2PAE A;  4TYS A;  2ZTN A;  3ROU A;  3OUH A;  4LK6 A;  4XUR A;  4OQ8 A;  3BIE A;  3M70 A;  5F5C A;  5FZM A;  4CDU B;  1O8S A;  1W8H A;  3OCP A;  2Y6H A;  3HEI A;  1CAV B;  2HWE 2;  1CD3 G;  3O0V A;  4QGL A;  3DL3 A;  2JIC A;  2BFU L;  3BOD A;  3CJX A;  4PQQ A;  1WME A;  2GH2 A;  3P3N A;  4RQP B;  3HBZ A;  2GAL A;  4GKY A;  4OHW A;  3ZN5 A;  3LCP A;  4ZU4 A;  4N7I A;  1W0P A;  5HXM A;  3RQ0 A;  4UFH A;  4OFG A;  5E88 A;  1SBE A;  5FBZ A;  5FPV A;  1SAC A;  2DBI A;  1FT9 A;  5DUV A;  4DXT A;  5LBC A;  1XNA A;  1OOP C;  2VH9 A;  4HSJ A;  2ZGR A;  2BV4 A;  4MX3 A;  4AAP A;  2WNU B;  4MGQ A;  4PIY A;  1V6M A;  2WFP A;  2VZS A;  4N9I A;  4AOC A;  3R05 A;  4HET A;  5FOJ B;  1RUC 1;  1YYN A;  2WAB A;  1MS9 A;  3AVR A;  4J1X A;  3TYJ A;  4YM2 A;  3UT0 A;  5A6Q A;  2ZHK A;  2FQP A;  1G9B A;  4FPY A;  3MLJ A;  3MPB A;  3LEI A;  3B01 A;  1QH7 A;  4MAD A;  2AEN A;  1W06 A;  2YFU A;  1AYN 1;  1AR6 2;  1OBN A;  2D6M A;  2CWS A;  2HBT A;  1VBD 2;  5C5U A;  3OGG A;  2HWD 1;  4S2F A;  2XBO 3;  4BME A;  1VPH A;  4IE0 A;  3J8F 1;  4IW3 A;  3D3A A;  4GMP 0;  5JXJ A;  4RR3 A;  4V2V A;  2ZHN A;  3THT A;  2FDJ A;  2IXH A;  3MLL A;  3WNX A;  4BOW A;  1W6M A;  4WM8 C;  2RM2 3;  5E89 A;  1MZ6 A;  4BK5 A;  1W28 A;  1DYO A;  3HOB A;  4CXX A;  5CAD A;  4RHV 2;  2WA3 A;  4GQ7 A;  1C1L A;  1LR5 A;  1TVG A;  1MVE A;  5DPN A;  3AK0 A;  3E6D A;  4AR2 A;  4CDU A;  5AC9 3;  1H6X A;  3UKT A;  3NQH A;  1VJ2 A;  1CAV A;  3NNL A;  4AWD A;  1IS4 A;  1DU3 D;  2GDF A;  3ZXE A;  4ES9 A;  2DWR A;  3BIW E;  2J1R A;  1NCR B;  4UI9 L;  2OZJ A;  1PVC 3;  1X82 A;  3Q8B A;  4ONU A;  2J1V A;  3M3E A;  3UGH A;  3ZM8 A;  2ETE A;  2JEM A;  2OT7 A;  2XJV A;  4NOT A;  1SLT A;  3ZYI B;  4BB3 A;  4BHP A;  1HIX A;  5J48 A;  3AXD A;  4GH4 C;  2VMH A;  1BJQ A;  4OYU A;  1DGW X;  5GZF A;  3VKO A;  5FZ3 A;  1IQD C;  2W0X A;  1ENX A;  3O12 A;  4JAA A;  4XTP A;  1NKG A;  3ZYH A;  4QXC A;  2X5I B;  2BBV A;  3S7I A;  5DXD A;  2MEV 3;  1Q8Q A;  1CPM A;  3TN9 1;  4AL9 A;  3ILF A;  1UOF A;  4E2G A;  4DMI A;  1GIC A;  5L7O C;  1RUC 2;  4LHS A;  5E8A A;  4Z2W A;  2EIE A;  1JH5 A;  1TME 1;  1EV1 3;  2QQW A;  5F32 A;  1WMX A;  1RIN A;  1CAX B;  4C0H A;  2PEL A;  4YW7 A;  5GZE A;  3X29 B;  5JSO A;  4R9A A;  2UUR A;  5H9R A;  3OG2 A;  2Q1Z B;  1J83 A;  1AYN 2;  5KHI A;  5KWR A;  5F3C A;  1KS4 A;  2HLE A;  2HWD 2;  2P3Y A;  3AMH A;  5FUI A;  5FZ0 A;  3ZXG A;  4QKN A;  2PHT A;  3FLR A;  3J8F 2;  5FO9 B;  1DLC A;  4QX7 A;  2ZGN A;  5T5J A;  4IUG A;  1FX5 A;  5FYT A;  3I3Q A;  5JZG A;  2Y64 A;  4CUC A;  4R9C A;  1J1L A;  3NV2 A;  3NRU A;  1W6N B;  2YC4 A;  5FYM A;  3BPS A;  3N3H A;  3WCR A;  1RJ8 A;  2FBE A;  1Z7S 1;  2VNO A;  4ZZ8 A;  3VBO A;  5FYI A;  1NCR A;  1X7N A;  2QJV A;  4JGZ B;  4ZU7 A;  5C3S A;  2VD7 A;  4P02 B;  1RMU 3;  2VOV A;  5KBF A;  1UYX A;  4WVW A;  1PK6 C;  3MF9 A;  4MZU A;  1W9W A;  4KH9 A;  1W2N A;  4FPL A;  3M3O A;  1ZX5 A;  1BLZ A;  3BYW A;  4MVT A;  3MUY 1;  3I2G A;  2AEY A;  4Y1Z A;  3KVA A;  4Z82 A;  4L0P A;  1Q5O A;  3OPW A;  1H8T B;  4QX8 A;  3WX5 A;  2XJT A;  1R09 1;  3M3Q A;  5C4W A;  3O1U A;  2ILM A;  3J4U H;  1ACC A;  2CTV A;  4I02 A;  4R8H A;  3TN9 2;  1Q3E A;  2JB8 A;  1NG0 A;  3Q8F A;  3R4S A;  2JEN A;  4P9G A;  5FKC A;  4GZ9 A;  2ZJC A;  4WM7 C;  3SEP A;  3P6B A;  1QQP 1;  3UGF A;  3QH6 A;  1U5X A;  1CAX A;  1W2A X;  3ASI A;  4K8R B;  4MGK E;  3VD9 A;  1BKZ A;  3W5M A;  1LHO A;  4UFM A;  3DEM A;  1UYP A;  4YG3 A;  2UY8 A;  4ZS2 A;  4JRL A;  2DV9 A;  1NQD A;  3H1Y A;  2R04 1;  1XRU A;  3APB A;  4M3C A;  1DF0 A;  2Y6F A;  1OUX A;  1REE A;  5ACA 1;  5BUV A;  3FBM A;  1ULD A;  2V5Y A;  2DU0 A;  2WQ8 A;  4BU2 A;  1SPP B;  5K9Y A;  1RL3 A;  1DGR N;  3VKN A;  5JXG A;  2WQZ C;  3HT1 A;  3U4S A;  3AMN A;  1W3V A;  3KB5 A;  5FZC A;  4AQT A;  2DVA A;  2GN7 A;  3K3N A;  3P1I A;  3WG4 A;  4RYD A;  4MOA A;  3U10 A;  2IXJ A;  1OF3 A;  2ZX0 A;  3GCW A;  5EJ1 B;  5HV0 A;  1BCX A;  1Z7S 2;  1C3H A;  5I0R A;  4JGZ A;  4FTE A;  1IPK A;  3NST A;  2WYF A;  4HON A;  5IFP A;  2WT2 A;  1W8W A;  2WA4 A;  4XCA A;  5KC6 A;  3CDZ B;  3QLQ A;  3SH4 A;  3OGS A;  4NII A;  4A42 A;  3DUI A;  1AL2 3;  1DQ1 A;  3IB3 A;  4GXL A;  3VD3 A;  5A32 A;  3B69 A;  3CJI B;  5C8C C;  4B29 A;  1ULP A;  4Q2F A;  1UZY A;  5C33 A;  4XFB A;  1EPZ A;  4QQL A;  5H9Q A;  2QQM A;  1J3P A;  5B2G B;  4H55 A;  2YMZ A;  4LO6 B;  2V5D A;  3RWN A;  3VBU C;  4ARX A;  2W92 A;  3HAG A;  2VZP A;  3ES4 A;  5D8A A;  2WKK A;  1YQ5 A;  1R09 2;  2JDU A;  2WUH A;  4PI0 A;  1V00 A;  5DAB A;  4LUL A;  3ZFE A;  3ENR A;  3WD5 A;  2ZPX A;  2ZX4 A;  3ZPY A;  4NPR A;  1WLC A;  1X33 A;  2VOK A;  2C26 A;  3I59 A;  3JQW A;  4AXO A;  4QPI A;  1QQP 2;  2ZGT A;  4FPE A;  2FZ2 A;  1YWK A;  3GZE A;  4YM1 A;  2XR4 A;  1QH6 A;  1KDK A;  3NMB A;  4O61 A;  1RJ7 A;  3PUR A;  4QGM A;  3BTY A;  3RFR A;  2JDN A;  4WBB A;  4XHB A;  5FXX A;  1S2E A;  4AI8 A;  5ACA 2;  2B5H A;  5JSP A;  5L9V A;  4LEJ A;  4GD4 A;  5C8W A;  4N7U A;  5CKQ A;  4LUK A;  4UW6 A;  1XND A;  1XSQ A;  1RYY A;  1XYN A;  5LBF A;  4WV8 A;  3BI3 A;  1ULG A;  3I49 A;  2BGC A;  5A70 A;  4UW5 A;  4GB3 3;  4XUN A;  5LZ6 A;  3DN7 A;  4CPB D;  1TMF 1;  1X9P A;  3L2Y A;  2LRO A;  2BYV E;  3C7E A;  4NRQ A;  5CFC B;  4RQP C;  1NE4 A;  1JOD A;  5AVP A;  1F2N A;  2XOM A;  4K1Z A;  2BGP A;  2NP0 A;  1CON A;  1PIV 1;  4EE2 A;  1HB1 A;  2XJR A;  2OXB A;  5DAV A;  5EHD A;  2FDH A;  1K3I A;  3N7M A;  3RRD A;  1CJD A;  2YHJ A;  3NAP A;  2G9Z A;  1Z0H A;  1I6X A;  1SDD B;  3CL1 A;  1RHI 1;  2WNU C;  4LBM A;  1V70 A;  2Q1F A;  3HR9 A;  2R49 A;  4BJ0 A;  2G4I A;  3WDT A;  1US3 A;  2B4K A;  5DAP A;  2VTX A;  1ZRI A;  1B35 C;  4PF1 A;  2WNV A;  3BAL A;  3HIF A;  3O14 A;  3PNA A;  2NYY A;  3ZYR A;  4B1L A;  2I07 B;  5FP9 A;  1O4T A;  1ZRF A;  4JGY A;  4YW6 A;  2VZT A;  1S0F A;  3PIJ A;  3JD7 3;  1I3H A;  2YBK A;  3LIH A;  4U36 A;  3A4U A;  2W94 A;  2VL4 A;  4QAW A;  4FPH A;  4UWD A;  4MXW A;  2A6W A;  2J1S A;  3MBW A;  2BTV C;  1SLL A;  3EO6 A;  4LE3 A;  4ZPI A;  1ENS A;  1PNF A;  3KZ4 C;  4NIH A;  3IDB B;  3WNN A;  4LO8 A;  3PUQ A;  4UOJ A;  3KWV A;  4JRA A;  2WC2 A;  5F5Q A;  3VBH B;  1POV 3;  2C9A A;  2B46 X;  1BYH A;  4EQV A;  2BDR A;  4HN0 A;  3MLK A;  2CAV A;  1TMF 2;  3R6S A;  2A3Y A;  4FAH A;  3LAG A;  2GND A;  5FZO B;  1V6N A;  2MPF A;  4YAR A;  4LLO A;  1C8M 3;  1PIV 2;  2YB7 A;  4YFW A;  3WP6 A;  5BNO B;  5KHJ A;  5IAT A;  5F6L B;  2Y6G A;  2WZ8 A;  2GN3 A;  5A3L A;  2IFW A;  4HXC A;  2C0Z A;  2QUO A;  4IEX A;  4IV1 B;  3U78 A;  4OHY A;  4PDW A;  2J22 A;  3LQC A;  4LBO A;  1C1F A;  2KA3 A;  4Q4Y 1;  3IAQ A;  1EAH 2;  1JZ2 A;  1RTV A;  3VHP A;  3VZN A;  2CWM A;  4EYU A;  1JYX A;  1FNY A;  1W05 A;  1RHI 2;  5FY0 A;  1X8E A;  1V6K A;  4CDX C;  4E4Z A;  2XJP A;  4PF5 A;  4URT A;  4BQY A;  4TTG A;  2HBU A;  2VCM A;  5FMD A;  1K5M A;  2FZ1 A;  4BQ2 A;  1C28 A;  2V72 A;  1E5R A;  1HB3 A;  3H3U A;  5GLZ A;  4N53 B;  4TWT A;  1XE8 A;  4OI2 A;  4X6R B;  3VBS C;  4YVS B;  5IUQ A;  1RVF 3;  1H1A A;  1L7Q A;  3B02 A;  1LOF A;  2V4A A;  4M00 A;  1W90 A;  1JZ4 A;  1S0J A;  2G1M A;  4XFA A;  1OMI A;  5G05 L;  4B4P A;  4YZ2 A;  3JCI A;  2G9F A;  3K3O A;  3WVJ A;  3OYW B;  1UZZ A;  5F9T A;  4IQP A;  3IPV B;  4LBQ B;  3KMH A;  1CIY A;  1SZB A;  4KGQ A;  1JU3 A;  1LAJ A;  4W8J A;  4OMC A;  4BE3 A;  2ZX1 A;  1LUL A;  2J1A A;  2JIG A;  2NZ9 A;  2AZ5 A;  5CFD A;  1G7Y A;  3CKH A;  1N47 A;  3VBH A;  3WZ1 A;  3H1W A;  1GWL A;  3GBG A;  3L9J T;  5I0U A;  4FQ4 A;  4AHX A;  2ZEZ A;  3AXE A;  1CN1 A;  5IVY A;  3WOG A;  1W6O A;  3MIB A;  2IC1 A;  1HRI 1;  1GZW B;  1AYM 1;  1S0B A;  4Y4R A;  1RUI 3;  4PIX A;  1XU2 A;  5EQU A;  4ERO A;  4BDV B;  3FFQ A;  3V0B A;  2J7M A;  2HWC 1;  1TNF A;  2W1Q A;  1RUF 1;  3VBF B;  1VBE 1;  4IES A;  2K9Z A;  2V4V A;  4AFM A;  2ZZQ A;  5K0U B;  4FTB A;  2XXZ A;  2JDY A;  4Q4Y 2;  1JUI A;  1MQT C;  1EYB A;  2E32 A;  1CQ9 A;  4LIT A;  1UMH A;  5T3N A;  4R52 A;  5LW9 A;  4YM3 A;  3OEB A;  1F35 A;  3KF5 A;  1RUH 1;  5JR2 A;  1QOO A;  2VVF A;  1OHF A;  1QIQ A;  4QXH A;  1ND2 B;  4KMQ A;  4EN7 B;  4W6Y A;  4N53 A;  3PVB B;  3OY8 A;  3QOP A;  1G9F A;  2XL7 A;  4MGI E;  1WA4 A;  1BK0 A;  1MZE A;  1RIT A;  2IUW A;  2XVG A;  2GZW A;  3AZY A;  4FVV A;  1W8T A;  1G6N A;  4NPM A;  4XIO A;  4IEP A;  2P37 A;  2A7A A;  3ST7 A;  1UO9 A;  2B7Y A;  3BU7 A;  1NXM A;  1UU5 A;  4XEZ A;  1ST8 A;  3IPV A;  2VVD A;  4KWK A;  4LBQ A;  4B3N A;  5FOB B;  1O4Y A;  5L36 A;  1OI6 A;  4W6W A;  4Y5S A;  2Q8C A;  1OKQ A;  2NQY A;  3B7M A;  3K4Z A;  2NMO A;  4OVE A;  4XF9 A;  4EN9 B;  3A0N A;  1VBC 3;  1S0E A;  4Q4V 2;  3PUH A;  4AEK A;  2PQS A;  2D97 A;  4H7L A;  4AVA A;  1PGL 1;  1LJ7 A;  2BOJ A;  1YEW A;  4QHB A;  2FMY A;  2BNO A;  2PTM A;  1EPW A;  1P8J A;  2VC9 A;  1MS8 A;  3RZH A;  1EY2 A;  3WQ7 A;  1JZ7 A;  1GZW A;  1OLM A;  2OS2 A;  2VMF A;  1POQ A;  2Q5T A;  5FV3 A;  2VME A;  1HRI 2;  1S0D A;  2WAO A;  1AYM 2;  1FOD 1;  3PU3 A;  4GAL A;  3TRS B;  1OOP B;  3ZKY A;  3CJI C;  4D69 A;  3VBF A;  1BQP A;  2OUJ A;  2HWC 2;  2R16 A;  1RUF 2;  4DIQ A;  5GZD A;  1VBE 2;  1UZ0 A;  1LGC A;  4N9H A;  3RPQ A;  2ZGP A;  1WD3 A;  4JX0 A;  4OI4 A;  3ZSK A;  1QJX 3;  1O7F A;  1N3O A;  4XF4 A;  4Y20 A;  1LEM A;  5KC5 A;  4LR4 A;  1RUH 2;  3PUS A;  4TLF A;  3S7E A;  3LA3 A;  4CU8 A;  3WW4 A;  3T3Y A;  4XXA A;  2QDN A;  4YWA A;  1AR7 3;  3OGV A;  4H7M A;  4XAA A;  3THP A;  5FLH A;  4OCT A;  4YRD A;  3I2K A;  1YQ8 A;  5DDJ 1;  4WM8 B;  1O5L A;  4XE9 A;  4F7Z A;  1IHM A;  3GBW A;  1WWY A;  1HRV 1;  2J1E A;  2WO3 A;  3AJZ A;  3VBR C;  5IAX A;  3FLT A;  2CV6 A;  2XHK A;  1HDK A;  4ATE A;  4OHZ A;  5FXW A;  3TB0 A;  4FPG A;  2VZQ A;  1WLW A;  1MZ5 A;  4P9X A;  4NRO A;  5JOX A;  1DHK B;  5FFO C;  4FP3 A;  1GMM A;  1PGL 2;  1UZW A;  1CAW A;  2DUR A;  3BPZ A;  1ULF A;  2VQT A;  5JUV A;  3M3I A;  3HN3 A;  4QB2 A;  3RMX A;  4QM9 A;  4Q5O A;  3TEZ A;  3AMQ A;  2VXJ A;  3ME2 A;  3POJ A;  3WW1 A;  4AI3 A;  2O8Q A;  1HXS 3;  1FOD 2;  3RZJ A;  3VKF C;  4M01 A;  2BRT A;  5FXZ A;  1QDO A;  3HQX A;  1C4R A;  4NPL A;  5HI0 A;  3C8X A;  2DFC A;  2XJQ A;  1HJF A;  5FYZ A;  5IK7 A;  2XUE A;  1O5U A;  3ZVX A;  2TEP A;  1R64 A;  4XDO A;  3HT2 A;  5L7O B;  3WDV A;  2B9V A;  3POE A;  1D7P M;  2E63 A;  5DUX A;  3LEM A;  3O1O A;  1ULC A;  2PQQ A;  2ZCW A;  3AKS A;  4COZ A;  2QQU A;  4XUT A;  5M0T A;  4B4Q A;  3VZM A;  4FCA A;  3RS6 A;  4FOQ A;  3VL8 A;  2IXC A;  4J25 A;  2C4X A;  3E1F 1;  3ZIX A;  5IJR A;  2AAC A;  2W1S A;  2GH8 A;  1QWR A;  1YCI A;  3AL6 A;  3F2Z A;  4WM8 A;  5IAV A;  3VZL A;  3UKV A;  2E7A A;  4K6B A;  4E8C A;  1YFW A;  3NVC A;  4XDQ A;  1MS4 A;  1LU2 A;  1MS5 A;  1SG3 A;  1U5I A;  1HRV 2;  1W0N A;  1PVX A;  1IS3 A;  2DDU A;  3VLB B;  5KXB A;  4Z2A A;  4BPZ A;  3PTY A;  5DAX A;  3O0W A;  1KQR A;  3LD8 A;  1Q8P A;  5FJH A;  5B4X A;  5FPU A;  2DTY A;  5A6Y A;  2WZR 3;  1QJY 2;  1PK6 B;  3N9P A;  3LDB A;  4K7J A;  5BPX A;  4DXZ A;  2LM3 A;  1W04 A;  5DUU A;  4OQ9 A;  4GH4 A;  5C71 A;  4AFB A;  4COV A;  3U0Z A;  4Q29 A;  3U4X A;  3JBG 3;  1LCL A;  4CCO A;  5JOZ A;  4LNV A;  4QX3 A;  2JG9 A;  3K77 A;  5BNO C;  1GBG A;  1DGR A;  4N43 B;  2RS1 1;  3USU A;  4RFR B;  4FBF A;  4O65 A;  4Q4X 1;  2BQP A;  4IV1 C;  3WXP A;  4XFF A;  4BK4 A;  3MPP G;  3M7A A;  1YIP A;  4LT5 A;  4B4R A;  1ZZ7 A;  4IDZ A;  2W1U A;  3L2H A;  4WM7 B;  2G9G A;  2QZ3 A;  4RL7 A;  1VBA 1;  2D6N A;  4XZU G;  5A3T A;  1Y43 B;  2BJS A;  3B93 A;  3H3Z A;  3OSD A;  1HV0 A;  4XF3 A;  3ZN6 B;  4IE6 A;  4G3Y C;  3ZXL A;  1AR8 3;  2BFU S;  2HWE 3;  1KJR A;  3W20 A;  4AHZ A;  4AEJ A;  3I54 A;  1L7L A;  4IEW A;  3ACG A;  5CAZ A;  2Y6K A;  1AJO A;  2JIJ A;  1GUI A;  4P08 A;  2EXH A;  1UCX A;  5APA A;  3B9I A;  2VOW A;  1AVB A;  4YVS C;  3WT3 A;  4HG6 B;  1RUN A;  5JXH A;  1W9F A;  1U12 A;  3ZFG B;  3K4D A;  2DBN A;  2WAA A;  1LU1 A;  3D4K A;  2GNB A;  3III A;  1N1S A;  4XJU A;  1OLR A;  1WLT A;  5FYB A;  4B7E A;  2HJI A;  2ZGM A;  3D0S A;  1JYW A;  5CZK A;  4FSJ A;  1R1Z A;  2BNN A;  2VW0 A;  5L9R A;  3R4D B;  2VW2 A;  3ACH A;  4AAX A;  5C3O A;  1NOV A;  4CTE A;  3B5L B;  3WSO A;  1NQJ A;  1YQ6 A;  1CES A;  2WQ4 A;  3ZDS A;  1LB2 A;  4C0B A;  3GZA A;  2NM1 A;  3OD0 A;  3WF3 A;  1R08 1;  3PMS A;  5GKA C;  3H3L A;  3ZYB A;  2XLA A;  5E6H A;  3A22 A;  2UWB A;  1K42 A;  1GQH A;  4UFL A;  3UES A;  2FD8 A;  2UU8 A;  2WN3 A;  4FP2 A;  5A3N A;  3H8O A;  1AR6 3;  1BBT 1;  2EIC A;  5A3M A;  4MSV A;  4QQH A;  4CXW A;  3ZR5 A;  4WVM B;  4LXL A;  1XBF A;  4AVT A;  3ZXD A;  2RS1 2;  4K8F A;  4Q4X 2;  3VD5 A;  2QQK A;  1GLH A;  4AQ2 A;  2YXS A;  4RHV 3;  2BWA A;  2EA7 A;  3AC0 A;  3DF0 A;  4NO4 A;  5LK7 B;  3BB6 A;  5BNQ A;  2ZMK A;  3ZN6 A;  1VBA 2;  4JKL A;  4E27 A;  3N7J A;  5A1F A;  1ND2 C;  2W87 A;  3ZSM A;  1JYI A;  1W39 A;  1U5Z A;  2PAM A;  3LGR A;  4YW2 A;  2WFF 1;  1AX2 A;  1GKB A;  4YPJ A;  3NNG A;  3ZYF A;  3DYM A;  3A21 A;  1UWW A;  3VD7 A;  4IEV A;  2CY6 A;  3LB9 A;  4OI0 A;  4I09 A;  2E9Q A;  1HB4 A;  2J42 A;  2AGS A;  1TG7 A;  2D6O X;  3PTR B;  2PA7 A;  2LTN A;  4L2N A;  1HLC A;  1WW7 A;  1W6P A;  4L8Q A;  1AXY A;  1G8W A;  1L3J A;  1Y9G A;  2JE8 A;  1ZRD A;  1NA1 C;  3CLP A;  2BWC A;  3RZG A;  1OUR A;  5IVJ A;  4XW3 A;  4W4Z A;  1PMI A;  2E31 A;  4CSW A;  4A3X A;  4D6R A;  4Q0V A;  4CUA A;  1COV 1;  1RUO A;  3IN9 A;  1RUC 3;  2BGO A;  4BXS V;  5LAT A;  4EN0 A;  4Y1X A;  3FZ3 A;  4UBH A;  5EYX A;  5C8C A;  1R08 2;  2PYT A;  3K4A A;  3POS A;  2WL1 A;  4YGC A;  2A75 A;  1OSG A;  5FUP A;  5IYY A;  1W8N A;  2VUA A;  4AF9 A;  2JDM A;  1BBT 2;  3LEK A;  3QAC A;  3WW3 A;  5HBA A;  2HWF 1;  3VBU A;  2VAU A;  1W6Q A;  1OH3 A;  3J8F 3;  2A6Z A;  2ARB A;  3MIF A;  5A7P A;  1R1A 1;  3SQO A;  2G19 A;  2B42 B;  5LA2 A;  4Y1U A;  2ET7 A;  4AK3 A;  2YV8 A;  3BCW A;  2IFR A;  4XMA A;  1B35 B;  1XXN A;  1S0I A;  4XTM A;  4QKB A;  2JD4 A;  3MFA A;  3WW2 A;  4YFZ A;  4EZ4 A;  4BLJ A;  1RUD 1;  1UN1 A;  4J1W A;  1X36 A;  2YC0 A;  3I2J A;  3B94 A;  1WW5 A;  3KVB A;  2VVE A;  4CCE A;  2WFF 2;  3J7L A;  1XNK A;  2X53 S;  3J9S A;  4OUL A;  3U75 A;  4MHR A;  2VBP A;  1QXJ A;  2D6P A;  2EIB A;  2XLG A;  3T2Q A;  4A41 A;  4CDQ C;  4CP2 A;  5KXC A;  4ITC A;  3GF6 A;  2P17 A;  4CU7 A;  4K20 A;  3DGT A;  2D5F A;  5JDB A;  1O91 A;  4RGA A;  1YC6 1;  4OI1 A;  5FWJ A;  3DPR B;  2RJK A;  1QJU 2;  3ILN A;  1H1M A;  2Q8E A;  4Z1V A;  2DVB A;  4DEV A;  1OQD A;  3VHO A;  1DQ6 A;  4JZR A;  3OGR A;  4RQP A;  5A7O A;  3TN9 3;  1DQ0 A;  3EHK A;  4AYU A;  3BOP A;  1COV 2;  4LBJ A;  5AFE A;  5JSR A;  2QKD A;  1Z78 A;  3MIC A;  1HQL A;  1MS0 A;  4FXG B;  4IEY A;  2JD9 A;  4SLI A;  1TME 3;  3BUC A;  5BNN C;  4P00 B;  2RDN A;  2PHF A;  3RYP A;  4EN6 B;  5EP9 A;  3E6C C;  2VCC A;  1UYY A;  3SH5 A;  1HJG A;  2XKP A;  3UV9 A;  1SBD A;  1XNT A;  2WNU A;  1SCR A;  4JHT A;  5GLV A;  1WA6 X;  2HWF 2;  1GZT A;  4HL0 A;  4CDX B;  2DVD A;  1A8M A;  1Q56 A;  1RUJ 1;  2W46 A;  4HOO A;  3TWI A;  4A7K A;  1G9A A;  4QXB A;  2VZO A;  1R1A 2;  3MV0 1;  4Y3O A;  4CXY A;  1B35 A;  2XBO 1;  3AX4 A;  1OF4 A;  3ACI A;  1E5S A;  3AB0 A;  5F7U A;  2YRO A;  1UPS A;  2WWS A;  3VBS B;  4HVQ A;  1DZQ A;  4N8M A;  1QEX A;  1AR9 3;  1A8D A;  2PN5 A;  2WO7 A;  2RM2 1;  3RJR A;  1Z7S 3;  5JWP A;  1RUD 2;  2Y6J A;  4HZF A;  3AYD A;  4DPN A;  3CEW A;  3T2O A;  3W59 A;  1YI9 A;  5I0S A;  3R0R A;  3N9Q A;  4N90 A;  5HV4 A;  4ZHN A;  4CEW B;  4D7T A;  1ENR A;  2RE9 A;  2BVV A;  4LO5 B;  3TNQ A;  2VMI A;  4XAC A;  1LHU A;  4CRQ A;  2W47 A;  1MS1 A;  5F2W A;  1PVC 1;  4QXK A;  4XCB A;  2Y0O A;  2WNO A;  2ZGK A;  4CCD A;  4Y4Y A;  4C8D A;  3WUD A;  1TE1 B;  2XLF A;  1D4M 3;  1R09 3;  4QB1 A;  2CHH A;  2X05 A;  1NX9 A;  5CIR A;  2WR9 A;  5EFU A;  4DUW A;  3SXW A;  4CCN A;  2Q4S A;  4Y26 A;  4PHZ A;  5T54 A;  3I8T A;  3MO4 A;  3CBN A;  3NNF A;  1QQP 3;  1SMV A;  1LOC A;  2MEV 1;  3C7G A;  3UJO A;  1QXR A;  4GWM A;  1IG0 A;  2HH9 A;  3ETP A;  1YFY A;  2V73 A;  4FXK B;  4Y1V A;  3MEP A;  2XWJ B;  1FMD 3;  1UY2 A;  1EV1 1;  2Y34 A;  1MQT B;  2X5I A;  3I4I A;  4OMD A;  4QX0 A;  4CDX A;  4N43 C;  3WR0 A;  2R04 3;  1OVS A;  2W3J A;  5EZW A;  5ACA 3;  1DQ5 A;  2HEV F;  2RVA A;  3FMG A;  1RUJ 2;  4UXA A;  1F4H A;  1CIW A;  3AYA A;  2W95 A;  5FO8 B;  3KHC A;  2XBO 2;  4IER A;  2W91 A;  3VBS A;  4A45 A;  5TSW A;  3LIG A;  2RS3 3;  5FZ6 A;  1C5I A;  4W65 A;  1PO1 3;  4XZP A;  3VDC A;  4L9B A;  4KL1 A;  3KT1 A;  3MF6 A;  2RM2 2;  1GOF A;  2RMU 1;  2JXA A;  2VM9 A;  3CIH A;  5FJK A;  3O1R A;  3MIH A;  4BM8 A;  2JE7 A;  3OUJ A;  3EQE A;  2HYK A;  5A7W B;  3ZFG C;  4Z92 B;  1HW5 A;  1DQ4 A;  1K45 A;  3AVS A;  5FTT C;  5C7G A;  3I97 A;  2H6C A;  2ES3 A;  1W6N A;  5T5L A;  1PVC 2;  2UWA A;  5EWS A;  4QQ2 A;  5D21 A;  1YNA A;  5C9A C;  2LUW A;  4AQS A;  1FXZ A;  1GU3 A;  1VRH 1;  1UD1 A;  2ZHM A;  2NLR A;  4CEY B;  4C91 A;  1PGW 1;  4BMB A;  4A4A A;  5T50 A;  2DUO A;  3E5U A;  2D40 A;  3DXU A;  2D3P A;  4Y5Z 0;  3H1M A;  2FCU A;  3B3Q E;  3WG2 A;  1ALY A;  2JJ6 A;  4XBN A;  2MEV 2;  4NVP A;  4IE4 A;  3J26 N;  4GAZ A;  1I9R A;  3I7D A;  2KR2 A;  3KCX A;  3POW A;  4M3C F;  1H8T A;  1KS5 A;  1MQT A;  5A7W A;  4IEQ A;  3KV6 A;  3IKW A;  1JYV A;  3DKW A;  1EV1 2;  1YO8 A;  4LBQ D;  5C3R A;  1Q8V A;  4FPF A;  3OBZ A;  5GM0 A;  2WYS A;  4ZXK A;  4IE7 A;  1WMD A;  3RSJ A;  4X8P A;  2C1F A;  5FY5 A;  1T6G C;  4QKD A;  3I3M A;  3RZL A;  3DKQ A;  3LFM A;  3B00 A;  4NID A;  1DFQ A;  2E33 A;  3UK9 A;  3O1V A;  3KLS A;  1GR3 A;  4RFT 0;  2LW8 A;  3VL9 A;  1TMF 3;  2DVF A;  2VCA A;  2YBS A;  5T52 A;  1XE0 A;  1XQN A;  3MIG A;  4MGY E;  1UKG A;  2RMU 2;  1MVQ A;  2ZBJ A;  2R0H A;  2QQJ A;  2WJS A;  5IK4 A;  2JDK A;  1ODN A;  2JDZ A;  2FCT A;  3VBR B;  4NHK A;  5B4N A;  3IDE A;  1SPP A;  4GKX A;  4AQ6 A;  3LE0 A;  3LSE A;  3EYP A;  3WHU A;  4ATF A;  1W8U A;  2B8M A;  3POY A;  5LA0 A;  5FDB A;  2QNK A;  2Y8K A;  2D93 A;  1RMU 2;  2F4P A;  1S4C A;  3GAL A;  4AI1 A;  2EVX A;  2IZW A;  1RC6 A;  4Q26 A;  4CA9 A;  1RHI 3;  3LFI A;  1PZ8 A;  2GAU A;  4Q1P A;  2R32 A;  4FFF A;  5EIY B;  1VRH 2;  3U11 A;  1PGW 2;  5FBJ A;  3VZK A;  5EJ3 A;  4YZ5 A;  3CJI A;  4KU8 A;  4ZS3 A;  4UW3 A;  1F8V A;  1AXK A;  1KJL A;  1NCQ B;  2P34 A;  2Q30 A;  3FL7 A;  4LIV A;  3VD4 A;  4MXV A;  4XUQ A;  2R1B A;  4A7Y A;  2E26 A;  1AUY A;  2ZAC A;  2ZGO A;  3GGL A;  3CZU A;  4XJ9 A;  4F3J A;  4YSF A;  1EAH 1;  2VZ3 A;  3WY6 A;  5LY1 A;  1NLS A;  4IET A;  3ORJ A;  3THC A;  4E8D A;  5IWF A;  4YVW C;  3ZFF B;  4DB5 A;  4CCJ A;  4K40 A;  4QDR A;  5J1X A;  3IWZ A;  2XVL A;  3T4H B;  2EAA A;  3H0O A;  3TOJ A;  3ZX7 A;  2FMD A;  1WBL A;  4E2Q A;  1CPN A;  1HN1 A;  1LED A;  3H42 B;  2GNT A;  1UF2 C;  4M3C E;  4QWN A;  4X8N A;  4BQ4 A;  4DEQ A;  1ZNP A;  4KG8 A;  5BNP C;  4WZF A;  4DIN B;  2GP5 A;  3U1X A;  3RMY A;  1GNH A;  1QF3 A;  3TEX A;  4B7K A;  5ISL A;  5IFT A;  4TZD A;  3IDA A;  4Y5T A;  4COU A;  1RXG A;  3VBR A;  4CU6 A;  5C70 A;  1U5Y A;  5FZ1 A;  1GP6 A;  5FZ4 A;  2KM2 A;  2RDS A;  2Y33 A;  4GWI A;  1W8Z A;  1OPM A;  2DTW A;  2Y38 A;  1VRB A;  4XJW A;  2FDK A;  3T0B A;  3DPR C;  2XQX A;  4Q4Y 3;  4XET A;  1ZBE 1;  1MPX A;  5DZG A;  2RDQ A;  1VB2 A;  5FMO L;  2WBK A;  5CFC A;  1YHF A;  3LPG A;  5I93 A;  4HN1 A;  5SV8 A;  4I3G A;  4COY A;  1JZ3 A;  5H9S A;  3UNP A;  1ZRR A;  4A6O A;  2AR6 A;  4IL7 A;  2H0B A;  3ZSJ A;  1MEC 1;  4YG6 A;  4QPY A;  1JOB A;  5I8S A;  2JG8 C;  2BP6 A;  2R07 3;  5JZG C;  2D5H A;  1PGS A;  2ARA A;  4FPJ A;  1DCS A;  2IVI B;  1QJE A;  3LZZ A;  3EBR A;  1VBB 1;  3PVE A;  3JD7 1;  4W50 A;  3MW4 A;  4M0H A;  1A34 A;  2OVU A;  2CAU A;  1PO2 3;  4A3Z A;  2OZ6 A;  1YFU A;  2ENR A; 
#chains in the Genus database with same CATH homology
 4XUR A;  3ACF A;  1JZ6 A;  2BZD A;  1O8S A;  2Y6H A;  3I3D A;  3HEI A;  3C8X A;  1JHJ A;  1R64 A;  4PQQ A;  2WO2 A;  3WQB A;  2B9V A;  3LPF A;  1GOH A;  2ZXQ A;  1D7P M;  3FHA A;  5HXM A;  1YQ2 A;  4XUT A;  3ABZ A;  2EID A;  3U37 A;  4DXT A;  1XNA A;  1XPW A;  3CQO A;  1UY1 A;  2C4X A;  3E1F 1;  4MGQ A;  5IJR A;  2W1S A;  2VZS A;  3HNY M;  3WNP A;  3F2Z A;  1CZT A;  4E8C A;  3T0A A;  2WZE A;  2WAB A;  4OUE A;  4RN5 A;  2VTF A;  1JYN A;  1SG3 A;  1W0N A;  2DDU A;  2VMC A;  3HNM A;  4Z2A A;  3LEI A;  4MAD A;  2YFU A;  5B4X A;  2VR4 A;  3FN9 A;  2DCJ A;  5JXJ A;  3D3A A;  3SKV A;  2VQU A;  4AG4 A;  5C71 A;  4BK5 A;  1DYO A;  3HOB A;  2RJ2 A;  1TVG A;  5DPN A;  3SEE A;  4QX3 A;  1H6X A;  3K77 A;  3NQH A;  1GNY A;  4ZXE A;  3OBA A;  2W1W A;  4BK4 A;  2J1R A;  4UI9 L;  1US2 A;  4ZZ5 A;  2W1U A;  2QQN A;  2J1V A;  4MO3 M;  3ZM8 A;  4XZU G;  2C9K A;  1NUK A;  3JXS A;  4OYU A;  3ACG A;  1IQD C;  1LNS A;  2Y6K A;  1EUU A;  1GUI A;  4P08 A;  1NKG A;  4HG6 B;  5JXH A;  2VO5 A;  1O8P A;  2Y6L A;  3K4D A;  2WAA A;  1CX1 A;  3III A;  3DYO A;  3T0D A;  2HYX A;  1JYW A;  4LHS A;  5CYY A;  5CZK A;  1EUT A;  4PT6 A;  2EIE A;  2KD7 A;  3EB7 A;  4ARY A;  3CMG A;  3BN6 A;  4AAX A;  3ACH A;  3OG2 A;  3WSO A;  1J83 A;  3WF3 A;  2HLE A;  3BGA A;  5FUI A;  2X10 A;  3A22 A;  1DLC A;  3PUI A;  1K42 A;  3UES A;  4IUG A;  4D0Q A;  2WN3 A;  3UET A;  2Y64 A;  4CUC A;  2EIC A;  3WF2 A;  3NRU A;  4CVU A;  2J1U A;  4TXW A;  2YC4 A;  2CDP A;  1UXX X;  4ZZ8 A;  3VD5 A;  2QQO A;  2QQK A;  3A7Q A;  4P02 B;  3AC0 A;  1UYX A;  2JDA A;  1W9W A;  4JKL A;  3K75 B;  2VZV A;  2W87 A;  3MUY 1;  3I2G A;  1KGY A;  1BHG A;  4YPJ A;  4L0P A;  3NNG A;  3DYM A;  3A21 A;  1UWW A;  3VD7 A;  1J84 A;  2RV9 A;  1OD3 A;  3T09 A;  4KWU A;  1OH4 A;  1TG7 A;  3SEP A;  4GZ9 A;  3P6B A;  2JE8 A;  4LPL A;  2YFZ A;  4MGS A;  3VD9 A;  3W5M A;  4JHZ A;  4W4Z A;  2E31 A;  4CUA A;  4GWJ A;  3T2P A;  2BGO A;  4BXS V;  1UX7 A;  2QQL A;  3HNB M;  3K4A A;  2XHN A;  2WQ8 A;  3VDB A;  3OB8 A;  5IYY A;  1W8N A;  5JXG A;  3LEK A;  2Z4F A;  3P1I A;  4RYD A;  3WEZ A;  4MOA A;  1PX4 A;  1OF3 A;  5EJ1 B;  5LCW L;  3WF4 A;  5DQ0 A;  5LA2 A;  5IFP A;  2ID4 A;  3CDZ B;  3I3E A;  3OGS A;  4A42 A;  3IB3 A;  3VD3 A;  3NJV A;  5I0D A;  1ULP A;  3WNK A;  1UY4 A;  3I2J A;  2QQM A;  3J7H A;  3WF1 A;  2V5D A;  1UYZ A;  1ULO A;  2YG0 A;  1OT5 A;  4ARX A;  2W92 A;  3T2Q A;  2EIB A;  2VZP A;  4A41 A;  2WUH A;  2W5F A;  4CU7 A;  2BER A;  2R7E B;  2C26 A;  1T2X A;  4DEV A;  2WN2 A;  1K12 A;  4A44 A;  3OGR A;  2ZEY A;  1WKY A;  3IAP A;  4QDQ A;  2JD9 A;  3DEC A;  4P00 B;  3WNL A;  2QQI A;  2VCC A;  1UYY A;  2XON A;  2J1T A;  1RYY A;  3ECQ A;  1XNT A;  3WNO A;  1I5P A;  4XUN A;  1L7R A;  4OZO A;  2W46 A;  3C7E A;  2VZO A;  3MV0 1;  2CDO A;  2XOM A;  1OF4 A;  2BGP A;  3ACI A;  5F7U A;  3MUZ 1;  4KI5 M;  1K3I A;  2Y6J A;  1XC6 A;  2OKX A;  4LKS A;  3T2O A;  1SDD B;  4BJ0 A;  4DXS A;  1US3 A;  2B4K A;  1O59 A;  2W47 A;  5HPO A;  2QBX A;  4PF1 A;  3I2H A;  2ZEX A;  3LEG A;  2VZT A;  1W9S A;  4QB1 A;  2JKX A;  1UY3 A;  2X05 A;  1NX9 A;  4DUW A;  2W94 A;  4P5Y A;  2VL4 A;  4QAW A;  3GDB A;  3MO4 A;  4DUV A;  1W99 A;  2J1S A;  3MBW A;  3C7G A;  1JU4 A;  3ETP A;  3WNN A;  4UOJ A;  4OMD A;  4QX0 A;  1UY0 A;  1UY2 A;  3MV1 1;  3T08 A;  2W3J A;  3C7O A;  2RVA A;  1F4H A;  2W95 A;  3VDA A;  4A45 A;  2W91 A;  2YB7 A;  3VDC A;  2VZR A;  3W5N A;  2Y6G A;  2WZ8 A;  1UMI A;  1KEX A;  1GOF A;  2J22 A;  3LQC A;  2VM9 A;  3CIH A;  5IHR A;  3IAQ A;  1JZ2 A;  4XUP A;  1CZS A;  1JYX A;  2VZ1 A;  2WO1 A;  2LS6 A;  4JKM A;  1K45 A;  5C7G A;  4TTG A;  3I97 A;  2L9L A;  3FHQ A;  3I3B A;  2V72 A;  1GQP A;  3WNM A;  4UAP A;  4JKK A;  1GU3 A;  1L7Q A;  1W9T A;  3HPN A;  4QB6 A;  1JZ4 A;  4A4A A;  1DP0 A;  4QPW A;  2VMD A;  5G05 L;  4ET7 A;  1PX3 A;  1WCQ A;  2X09 A;  1PMH X;  1CIY A;  1JU3 A;  4W8J A;  4M4P A;  4OMC A;  3C7F A;  1JYV A;  2J1A A;  3CKH A;  4D8M A;  3I2F A;  2ZEZ A;  2WYS A;  4QX2 A;  3OEA A;  4DXR A;  3WF0 A;  4BDV B;  2E33 A;  2BBA A;  2J7M A;  2WDB A;  5G04 L;  1W8O A;  2W1Q A;  2VJX A;  2LW8 A;  2V4V A;  2VCA A;  1SHW B;  2QQJ A;  5DN2 A;  2E32 A;  4QX1 A;  5B4N A;  1UMH A;  3OEB A;  3LE0 A;  5JR2 A;  3THD A;  3EYP A;  5LA0 A;  4KMQ A;  2Y8K A;  2VCB A;  3DYP A;  4DUX A;  5EIY B;  2ORX A;  1UXZ A;  4XUO A;  3FL7 A;  2YC2 A;  3VD4 A;  3K4Z A;  4XUQ A;  2E26 A;  2VOT A;  3GGL A;  3CZU A;  1F4A A;  1GOG A;  2VZ3 A;  3PUH A;  2PQS A;  2DCK A;  3THC A;  4E8D A;  1JZ5 A;  1P8J A;  2ZEW A;  2VC9 A;  4QDR A;  5J1X A;  1JZ7 A;  3SKJ E;  2VMF A;  5A1A A;  2VME A;  1HN1 A;  2WAO A;  4CUB A;  1JI6 A;  4DEQ A;  3GXU A;  5JXI A;  4XVH A;  5JMO A;  1UZ0 A;  2VZU A;  2W9X A;  5IFT A;  4JX0 A;  3IDA A;  3HJR A;  3GM8 A;  4CU6 A;  5C70 A;  5LA1 A;  1CZV A;  1PMJ X;  4GWI A;  2ORZ A;  3T0B A;  4CU8 A;  2XQX A;  3C7H A;  1MPX A;  3OGV A;  1H6Y A;  3I2I A;  2WBK A;  3I2K A;  3LPG A;  5DMY A;  5EJZ B;  3CZJ A;  3A23 A;  2J1E A;  2WO3 A;  1JZ3 A;  3UNP A;  4A6O A;  4CU9 A;  4M4R A;  4ZY9 A;  2VZQ A;  3K46 A;  4LQR A;  4FI9 A;  1GMM A;  1NAE A;  3NJX A;  2VQT A;  4W50 A;  1JZ8 A;  5JUV A;  3HN3 A;  4QB2 A;  4A3Z A;  4QDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...