4XETA

Fe-cl bound y157f cdo at ph ~7.0 in the presence of azide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 59
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xetA00
3FX3A 4BYYA 3RDIA 2PAMA 5BY5A 2V09A 2PHDA 3GBFA 4Z82A 4PJYA 3SHRA 2Q30A 3KGLA 4IETA 3PLQA 4L2NA 1ZRDA 5I8TA 2Z69A 4XEZA 3RNSA 2OA2A 3NW4A 2H6BA 2D5FA 2UYBA 3S0MA 2D40A 3R6SA 3UKTA 1O5LA 1O3TA 1SFNA 1XRUA 3L2HA 1DZTA 5I0UA 1CAWA 3H9AA 4ORFA 1V70A 3IWZA 5I8YA 2ET7A 2OZJA 3E5QA 3SCFA 2K0GA 1J59A 3I54A 3OTFA 5KBFA 3NJZA 2FQPA 5FPXA 3CL1A 3H7JA 3FWEA 4I01A 4JTOA 4O9GA 2IXKA 2P17A 4YRDA 2GH2A 2PHLA 1SQ4A 1EP0A 1H1IA 3U10A 4WBBA 3VHRA 2MHFA 2UYAA 1ZZ6A 3HT1A 4EWAA 2EA7A 4MX3A 1NXMA 2Q1ZB 4HSLA 2PQQA 2B9UA 4K8FA 4QX5A 1DGRA 3KCCA 3HT2A 3EHKA 4LTAA 1ZNPA 1UIKA 3MDPA 1CAWB 4CYDA 1WA4A 1LR5A 1YFYA 4O9EA 3ELNA 3I7DA 2GC2A 5I0TA 1IPJA 1I5ZA 1CAVA 1LRHA 4PIXA 4IEUA 5I8SA 4JTNA 2MNGA 5C8WA 2CAVA 4EROA 4BH9A 4FBFA 4I2OA 3QOPA 5F1RA 5E16A 4BIFA 4XFCA 1FT9A 1O3QA 1VJ2A 3D82A 3WW2A 4IEQA 2Z2SB 5FPZA 2IXJA 2OPKA 4IEYA 3DKWA 2QCSB 4Z07A 4QM9A 3WW3A 2H0VA 3LZZA 3UKVA 3LA3A 4ZU7A 1J3PA 2CAUA 2KXLA 2O1QA 4YNIA 5LEKA 2IXHA 4E2GA 4HLTA 3H1YA 5JCTA 2IXCA 4Q0PA 2QDRA 4IEVA 5KHIA 3SCHA 1CAXA 2PAKA 4LA3A 3U11A 2PA7A 4IEOA 3RYRA 3H8UA 2XLFA 1CX4A 4FAGA 3USSA 1PM7A 4XFGA 3ES4A 3MYXA 1GQHA 3JZVA 5LRSA 1J3QA 2F4PA 1J1LA 2GZWA 1FI2A 3DL3A 1ZRCA 4YARA 4Q29A 1O7FA 3UKNA 5I91A 1EY2A 1XE7A 1VR3A 2D5HA 1YUDA 5CVRA 2PTMA 1NE6A 5JSOA 4EV0A 4LUMA 3EQEA 3FZ3A 5CU1A 2DCTA 4YSFA 2XL7A 2BNOA 2Y0OA 1NE4A 2FMYA 2BYVE 3ACLA 4B29A 2UY8A 4Q0SA 1CAXB 2I45A 2CV6A 2XKPA 4XF4A 4QXKA 4XETA 3U0ZA 1X7NA 1RGSA 1WLTA 2WC2A 1DGWA 4HZFA 3ES1A 4I3PA 2XL9A 4HVOA 3M70A 2XHKA 3G7DA 2CGPA 1TQ5A 1LB2A 3CEWA 3PNAA 3QACA 4MV2A 4IEPA 3CJXA 3RPQA 4YYOA 4FT8A 2BNNA 3BU7A 1QXJA 4IEWA 5LEJA 1Q3EA 1PMIA 3OCPA 4HSJA 4KU7A 5I0RA 1IPKA 2PFWA 4N9HA 2O8QA 2UY9A 1XE8A 1YFWA 4FAHA 1Q5OA 3N4MA 2IC1A 3IIAA 5KHHA 3HIFA 3LA2A 1QWRA 3E6DA 3H1WA 3RYPA 1UPIA 4A2UA 4HN0A 1ZZCA 3PVBB 3S7IA 2ATFA 2IXIA 2QVSB 4LUKA 1CGPA 1ZZ7A 4XFBA 4Q0QA 3D0SA 3E6BA 1O3SA 3E97A 2GC1A 3O14A 5FCCA 3WW4A 2QJVA 1QY4A 5BUVA 5HI0A 1OI6A 1YFUA 4KWLA 3CF6E 1WGPA 1UIJA 4KWKA 3MZHA 1YWKA 4WZCA 4I09A 3BPZA 2N7GA 1NYWA 2B8MA 3H50A 3RZZA 4IESA 4MGZE 2VPVA 2D93A 3H1MA 4IEXA 2EAAA 2GU9A 4HVQA 1VP6A 3DN7A 4MZUA 4LLOA 1ZREA 5LRRA 3BCWA 3E6CC 4OFGA 1RUNA 4DINB 1RUOA 4J1WA 3LWCA 4BHPA 2K9ZA 1YHFA 4QGLA 4AVBA 1RL3A 5FLHA 4META 4MGKE 5J7MA 4F8AA 1FXZA 4HMZA 2EVXA 3OGJA 4XFHA 1X8EA 4I0AA 2Q0AA 4IEZA 1O5UA 3MPBA 3SCGA 1RTVA 4EWEA 4Q0VA 5E1RA 1EPZA 4PIYA 2ZCWA 1YLLA 1Q43A 1L3JA 4PIZA 5BPXA 5K8SA 3FHIB 1H1MA 4WVZA 2GC0A 3NL1A 1X82A 3DV8A 2C0ZA 1OD5A 2H6CA 1Y9QA 3GYDA 3NSTA 4MGIE 3EJKA 1O4TA 4AXOA 1JUHA 1G6NA 4XF0A 2ETEA 4Q0UA 3RYKA 4HN1A 1O3RA 4IERA 1ZRFA 1ZX5A 3HQXA 4HBNA 3D0JA 3I59A 2GC3A 3FFQA 3H3ZA 3NKTA 3FJSA 4LULA 1EYBA 3IDCB 2MPFA 4RD7A 1RC6A 4XF1A 4R8HA 4I0BA 2QNKA 2OZ6A 1OFNA 3FE5A 2HJIA 4JV4A 5JAXA 1ZVFA 1UCXA 1CAUB 3OF1A 3LOIA 4MGYE 2GAUA 4LA2A 4LEJA 3OD0A 5BV6A 1Y3TA 4EWDA 3S7EA 2XLAA 3LAGA 1HW5A 3TNQA 5JSPA 4H7LA 2B5HA 3LA7A 1UD1A 2XGXA 2ZKLA 3ZDSA 4MUVA 1SEFA 5I93A 5J3UA 1J3RA 1UW8A 5C6CA 2WFPA 2XKOA 3I59B 4TLFA 4QGNA 2E9QA 5JR7B 3H3UA 5EFUA 3ST7A 4XFFA 4UBGA 4E2SA 3WW1A 5J48A 4X6QB 3ROUA 3KSCA 4KWJA 5D1IA 5KHGA 4MH0E 3B02A 4J1XA 1ZRRA 3TNPB 3CO2A 4JVAA 3H7YA 4KL1A 4ONUA 5I0SA 3M3IA 4QGMA 5BXXA 1ZZ8A 1GQGA 1LKNA 3KGZA 4P9GA 1YFXA 1ZZ9A 2IXLA 2BEOA 4XF9A 3SMHA 5KHKA 5JSRA 4AQ6A 5FDBA 4D7TA 5KHJA 4ZU4A 1J58A 4R52A 2PAEA 5AVPA 3ETQA 1ZZBA 1NZCA 2HKXA 4QMAA 4AVAA 5FQ0A 4X6RB 4NVPA 2PYTA 4OLLA 2XLGA 5T3NA 4XFIA 5FLIA 1X8MA 3SXWA 3E5UA 2BGCA 1QXRA 2ET1A 3EBRA 4XF3A 3IDBB 3BB6A 4D7SA 1CAVB 3KMHA 1OMIA 4UXAA 4N9IA 1U12A 4QM8A 5FLJA 2Q4SA 3CLPA 2VECA 4F7ZA 2BNMA 4XFAA 4UBHA 4AQ2A 3C3VA 4AVCA 1CAUA 4L11A 3IBMA 2OYZA 1I6XA 3E5XA 4ZU5A 3BALA 4KU8A 4I02A 5EZWA 3NVCA 5FQ0B 4GULA 1DZRA 4HVRA 5CADA 3EO6A 4E2QA 2VQAA
chains in the Genus database with same CATH superfamily
2ADDA 3B5LB 1PVC3 3MHZA 2ZGLA 5A7WB 5BY5A 3U1XA 2VCAA 5IK4A 3ZFGB 4A44A 5DG1A 2DVAA 2GNBA 4PJYA 1ZBA3 4NPMA 3SHRA 5FZ1A 4ASMB 2Q30A 3VBUC 5FK8A 4BK4A 1JZ7A 3PLQA 1HQNA 1PNGA 1ZRDA 4IXLA 2Z69A 1UYXA 2WYFA 1RIRA 2R7EB 1GP4A 4NE9A 3B01A 2XJVA 3VHPA 4Y5SA 2D40A 3ZIXA 5DZGA 2XJRA 4QPGC 3S57A 1FAYA 3TB0A 5JVVA 4BB3A 3O1TA 4XILA 4N7UA 1XRUA 4LBNA 4CCOA 1VAKA 3L2HA 5IVBA 1J83A 1DZTA 4GMP1 5I0UA 5KC5A 2YHJA 4NIGA 1RHI1 1JZ8A 1XU1A 5FZOA 3WNOA 2IWGB 4FOVA 2JG9B 2FHRA 1AR83 3SCFA 2J1RA 3S5AA 3E1F1 1LOEA 1FV3A 3VB9A 3H8XA 1W8UA 1OLQA 5A3LA 1W3XA 3AL5A 3KV9A 4DIQA 3I3MA 1JHJA 2HWF2 1GZ9A 4MSVA 4H14A 4MXWB 4YRDA 1W8WA 5KXEA 1W2OA 5A6XA 1S55A 3FBMA 3HOBA 5IVFA 1LOBA 2BGOA 2VC9A 1ZA7A 1RUF3 2NMNA 5A6ZA 4CRQA 1UXZA 3VHRA 2UYAA 2E6VA 4P9IA 4ARYA 1C1FA 2WYSA 3N7MA 2QQUA 4JRLA 4MX3A 3Q8BA 1NXMA 3IAQA 3WQBA 4D69A 3PMSA 3MGUA 4QPYA 1APNA 3PHMA 5FJHA 5FK7A 3EHKA 4K20A 1ZNPA 3M3EA 4LTAA 4Q26A 3WLUA 3O0WA 4CYDA 3UNPA 1Q8VA 3WOGA 3KVBA 1LR5A 4JGYA 3O0XA 4FFHA 3I7DA 4Q4W2 3O12A 2B9VA 5BNPC 1I5ZA 1DCSA 3AMMA 5B4XA 1CAVA 3AYCA 3D5OA 3ITQA 1TNRA 5HV4A 4NRPA 4XYXA 1SLAA 3T08A 2BPA2 1RUI1 2CAVA 2P37A 1WA6X 3OB8A 3VBFA 2UWCA 5CFCA 2DVBA 1HXS1 2R1DA 2Y60A 3IMMA 4I2OA 5TSWA 1F5JA 2QQWA 2LRPA 4BIFA 4G3YC 3RJ2X 1TG7A 2Z5WA 1WLDA 3VKOA 1S2BA 3ZPYA 1O3QA 4Y20A 4AGGA 1HIXA 1AL23 5L9VA 3KF3A 1UMZA 5FPZA 5FBZA 1RB8G 1GNYA 4IEYA 2XXZA 1TME2 3WHTA 3WW3A 1QXPA 3RJRA 1ND3B 3RI9A 4CDQA 2P3JA 2ZS6B 3LA3A 3QH7A 3IMNA 1O8SA 3K4ZA 3VBSA 2WKKA 1F4AA 4YW5A 4YNIA 1W9FA 4E2GA 2VTXJ 3POBA 4HLTA 1SLIA 5C4WA 3N9QA 4BA6A 1PGW1 1KFUL 3DPRB 4JGYB 1N3QA 2VQUA 3PDQA 4IEVA 3U78A 5KHIA 2HEVF 4QPIC 3U11A 5LATA 5L36A 2QQKA 2TBVA 3J7HA 5EXOA 4Y5TA 1YQCA 5A33A 4AAPA 4BQ4A 3NV4A 2YFUA 2XJUA 5A1LA 2Y26A 3VBFB 5DZFA 1MS3A 1YJLA 2VM9A 3WR0A 3DL3A 1ZRCA 1SMVA 1XYPA 4E9KA 2Q8OA 5I0RA 2HEYF 3ZKYA 5CKQA 3UKNA 5BNOA 5I91A 1EY2A 4NOTA 4COVA 3VLBB 1VR3A 1NOVA 1N1YA 2X53S 2Y0IA 1H6XA 2ARCA 4UF0A 4XUTA 1VMJA 4I0WB 2VXJA 3VBSB 1WKYA 4DZGA 4AEMA 4W8JA 3ACIA 2V73A 2XL7A 5HCFA 3AVSA 5C4WB 2F6BA 3V0BB 5T5LA 4IV3C 3ACLA 1NE4A 2FMYA 3MLLA 3PIGA 1C3HA 4Q0SA 2ZX2A 4AFAA 3G6JB 2WSUA 3WNKA 4CXWA 2I45A 2W9XA 4D94A 3MIDA 4OI0A 1AR92 3LDKA 1G7YA 1PO23 1PX3A 3CIHA 4XETA 3HJRA 1H4GA 3CJIC 4ZHNA 4BZ4A 1RGSA 2WC2A 1ULDA 2AACA 3BTZA 3GZTB 4I3PA 1HJGA 3ES1A 3WHUA 4AHWA 1SFYA 1NLRA 1RHI2 1AXZA 5FO9B 2DVGA 3BI3A 4CDWC 2HWD2 1SLBA 4NPRA 3WD5A 2AEYA 4AFBA 4CCEA 1LOCA 1H1AA 2WT2A 3PJQA 4E4DX 3WF2A 5BNOB 4AHXA 3DYMA 2BFUS 4FFGA 2DBNA 3MV01 4IEPA 1OLMA 3A7QA 1OPOA 1LCLA 1VBB3 1RVF1 3CJXA 4QAWA 5T55A 3NWKA 5F7UA 4XAEA 4WM7A 3BU7A 5IK7A 4WM8C 3AKSA 4W65A 2B4KA 2W5FA 1AYM2 3WNPA 4AAXA 1RUE3 3AP7A 1PMIA 1ASJ3 1ST8A 1ZBE3 2P6HA 3OCPA 1QJU3 4HSJA 4OMDA 5FPAA 3VHOA 2A75A 1TMF1 2PFWA 2RS51 5FFOC 4E4ZA 2ORZA 4GZ9A 1AR73 4XZPA 5IFTA 4GB33 4LLFA 2RS31 4ZZ5A 4SBVA 1EUUA 2CGOA 2VUCA 1AL0G 2CSGA 2ZGNA 4XUPA 4FAHA 2VH9A 1Q5OA 4RQPC 1GP6A 3N4MA 4U36A 3KQ4B 5BNNA 3K4DA 1DDLA 1Q8PA 5KHHA 1GSLA 4KGQA 2X05A 1PK6B 3ZPOA 1B09A 1QWRA 2X10A 3H1WA 4R9BA 2XUMA 3RMXA 1GZTA 5LA0A 4A2UA 4AR2A 2YBKA 4HN0A 2Y6LA 3WF4A 1UOFA 3S7IA 1GU3A 1OVPA 2WZR1 1JI6A 4M4RA 4LUKA 2DCZA 4WZFA 5J1XA 3J4UH 2VW1A 2FDIA 3TAYA 1SPPB 3NNJA 1D7PM 1Z0HA 2VVEA 1O3SA 3O14A 1RUI2 2WNEA 3MLJA 1ZA4A 3TBDA 3DEMA 1HXS2 5J96B 1QY4A 5BUVA 3ZXEA 1OI6A 3VL8A 1XNKA 2NN8A 4NAMA 3RSJA 1NQDA 1BEV1 3GNEA 5FP3A 1UIJA 5IHRA 3MUZ1 5ERLA 1W0OA 2DCJA 1N3OA 2D7FA 1MQTA 2AUYA 2VMDA 1KQRA 4E8CA 4XPVA 2E7QA 4KBZA 4XACA 1W90A 2ILMA 4Q4Y1 1V6KA 2V5YA 4RHV3 3K2OA 4LOSA 4RS5B 2SBAA 3LD8A 4JDOA 3BTXA 1R1A2 3KT1A 3JD73 1BYHA 2R071 1IQAA 3I3QA 4CP1A 4PDWA 3EXUA 1PO21 3MF6A 1AJOA 1V0AA 1QIQA 1KJLA 3MIBA 2EAAA 2WWJA 3GF6A 3ZX7A 2XG3A 4CE8A 2V4AA 4GH4A 2JDAA 1BXHA 3DN7A 3ZMOA 4WVVA 3WNNA 2P6CA 3AXEA 1V9U3 1ZREA 3KB5A 3MI8A 2JIGA 1OURA 1ULPA 3AKRA 3KVAA 3N9MA 3A4UA 5FY7A 1R091 4DINB 1UZ0A 4DQAA 5FZAA 1KJRA 4S2GA 3T2OA 3WUDA 2D3PA 1VBB1 4W6XA 4LBLA 3WDUA 4META 5JXGA 1MQTB 3AL6A 3LFIA 2BOJA 5J7MA 3IZOA 1REFA 3NJXA 4X8PA 1LOAA 5A3TA 4F8AA 3V0AB 5FR3A 3P6BA 4LBQD 4XAAA 1SZBA 3VZMA 3JBG3 5LZ6A 5C71A 1HB2A 2QQLA 2WA3A 3P3PA 1X8EA 4IEZA 1W0NA 4XXPA 4YZ2A 5LY1A 2R063 1PVXA 5FOBB 4EJRA 4A45A 1RTVA 1X9TA 2DWRA 5FXVA 3VBOA 5E1RA 3U37A 4CP2A 2EICA 2X5IC 4CA9A 2ZZJA 2ZCWA 4QDRA 4A6OA 4COUA 4PIZA 1VAVA 4K21A 2A73B 5LW9A 1EAH2 1H1MA 2DBIA 1IS6A 2VQ0A 4B4QA 4G4FA 3VBHC 2YC2A 3J7LA 4GH4B 5ACA1 5FZ9A 2A1XA 3UT0A 5FMCA 3DV8A 1CONA 1EV13 4Q4X3 1UF2C 2R6QA 3JU9A 3LEGA 3W5MA 4QKNA 3SQOA 4O61A 3NSTA 1W0PA 4Y1VA 2FZ2A 1J1TA 1CWPA 1FPN1 3MPPG 4DOUA 1VBD2 4NROA 4YW4A 5JXJA 4NHYA 1XYNA 2JDPA 2ETEA 4Q0UA 4OHWA 1NLSA 3I2FA 4HN1A 1PGL2 5FZDA 2PQSA 5EPAA 2QUOA 2ZGQA 2C9KA 3D0JA 4NIIA 3I59A 2ZXQA 4XJ8A 1QJZA 1RVF2 2W46A 5LA2A 4YGEA 2HYXA 3HBKA 4RD7A 3OPTA 1RC6A 4R8HA 1QQP3 4I0BA 4URAA 3IAPA 1NCRA 5J09A 3VBOB 2TNFA 2ZHKA 1QDOA 2ZEWA 1CAUB 1DLCA 1VBE1 2QZ3A 4GWNA 2XPJA 2WLQA 1TMF2 2RS52 4BQ5A 4LA2A 1IS4A 1QDCA 3RG0A 2W47A 2RS32 3RI8A 4LO4B 1ZM1A 3I3BA 1L7LA 3ZYHA 1SBFA 4TN7A 3MEPA 3ZFFA 1JYXA 4EWDA 4XQDA 5GM0A 5JSPA 2Y6KA 2W1UA 2B5HA 4YM2A 1HRV1 1IZ3A 4FVVA 4RGGA 4QB6A 3RFRA 4HFSA 4BOWA 2Y8KA 4MUVA 4NHLA 4D3WA 4HL0A 2A70A 4N53A 1J3RA 1JU3A 4GMP0 3L2YA 4FPFA 4Q2FA 3GCXA 1DF0A 3GDBA 4AQTA 5FWJA 3I59B 2A6XA 1F35A 2D6NA 2DU0A 4QGNA 1WUVA 2X8KA 1W2TA 2UURA 2VZPA 4WV8A 5F6LB 4OHXA 3BN6A 5DAXA 2W92A 5EFUA 1NCRB 2XUEA 3OBTA 4JGYC 4UBGA 5FUPA 4DRVA 3V56A 5J48A 1JZ2A 5FZ6A 3ZSJA 1KDKA 3FLTA 1GOHA 2G1MA 3FUQA 4KL1A 1D4M1 1K3IA 4CXYA 5FZ0A 3AKTA 1GWLA 2VMEA 2YZ4A 1Q8QA 5FYBA 2BJSA 2IXLA 3NJVA 5DUVA 1OOPA 3SMHA 3UJOA 1FMD1 3VBFC 3ZSEA 5CFCC 1US3A 2RE9A 1XNCA 1UWWA 2JDMA 3ACGA 3GZUC 1KFXL 5CKMA 5FMBA 4AGRA 5BNQA 4ZU4A 4R52A 5AVPA 4INDA 3ETQA 1ZZBA 1Z7S1 2RM22 2UWAA 3VKLA 3T0DA 2WFF1 1O91A 4YW7A 4N53B 2VCBA 3FHAA 3OEBA 3ZO0B 3CKHA 4CDQC 1TEIA 4DMIA 2WN2A 4XFIA 3VBSC 4YW2A 3Q8EA 1COV1 3SEEA 3VD4A 1X8MA 5C4WC 1AX1A 3R0RA 3E5UA 1VMFA 4YG3A 3C2UA 2RDRA 3FFZA 1AJKA 2ET1A 2ZAHA 3TEXA 4Y22A 2VUJA 1UZVA 4XBNA 2R49A 1QJX1 4AG4A 4LBMA 1AR63 4N9IA 1S0GA 4URTA 5FLJA 4A7ZA 2JD9A 4A6SA 4ZONA 4AEKA 3CLPA 1OOPB 2HBUA 3PUIA 4GIQA 3OOXA 3GALA 3WSOA 4Z2WA 1S1AA 4DUXA 3C7GA 4F7ZA 5F3CA 4BQ3A 4BCUA 4UBHA 2XBO3 3OBZA 3AB0A 5IW0A 2GALA 4Q8LA 4LHNA 1OUSA 1I6XA 4R9CA 4EE2A 4XHXA 5BNOC 3ZLIA 3AP6A 1HB4A 1RUD2 5IAVA 4OZOA 3GXUA 4HVRA 4XUQA 5ACA2 5CADA 1VBA1 1BJQA 1NAEA 1F8VA 1AF9A 5FZIA 1IOAA 3FX3A 4BYYA 5FZ7A 2D6KA 2R041 2V09A 3B9CA 2PHDA 3QBQA 3OGVA 4L99A 4Z82A 5EP9A 5FRAA 1FPN2 4BQ2A 4MGTA 3QH6A 1V6JA 2RS11 2VOWA 5A3OA 3WXPA 4XUNA 4Y5Z0 2HYKA 4IETA 4ES9A 3ZM8A 4XJZA 4L2NA 2VZTA 2IUWA 4Y22B 4NN0A 3O7OA 1JZ3A 4IGQA 1YQ2A 5FMOL 4LITA 2H6BA 1MS1A 3LEMA 3P5BA 2WUHA 3WP6A 5GLTA 2VMCA 3ZXDA 3S0MA 3GHNA 4HT1T 1O3TA 1RUG3 2ZGSA 1PO13 1WD4A 1DBNA 2ZA9A 5IK8A 1CX1A 1SG3A 3LKJA 3KV5A 2ZKNA 3ZYJB 1CPMA 1T6GC 2CTVA 2V72A 3H9AA 4ORFA 4WM8A 1WMXA 3ZSLA 3IWZA 2ET7A 1POQA 2VBBA 5D8AA 2QFEA 5H9RA 1SHWB 3I54A 3W9AA 1VBE2 4PF1A 4CU9A 5KBFA 3NJZA 3VDBA 1AYN2 4P9JA 5FPXA 3ETPA 1UYZA 5C7GA 1QKQA 3N7JA 2G4IA 3R4DB 2RJ2A 1GNHA 1YQ6A 4FPJA 1V00A 4FI9A 1YC61 4JTOA 2P17A 2OXBA 4WM7C 4MXVA 1SQ4A 1VPHA 1W6OA 2K46A 4FPLA 5A32A 4UOJA 3SH5A 1HRV2 1NT0A 2JXAA 4LBOA 3RMYA 1ZZ6A 1RXFA 4EWAA 1QEXA 2E51A 3LE0A 5IVCA 5FY0A 2PQQA 1A3KA 1BVP1 1OPMA 4GAZA 5L73A 3UGHA 1YRZA 2OVUA 5FTTC 1XSRA 5F5QA 4HONA 4LKDA 1MEC2 1N1SA 3I2KA 5BNNC 3WP4A 5JI9A 1GICA 1UIKA 2G19A 3MDPA 4OQ8A 5L19A 3O1OA 4UFKA 4M3CE 1WA4A 5FIXA 3TYJA 1DG6A 1GLHA 5D8AB 5F2WA 4EZ4A 3UV9A 1BBT3 3AP4A 5T54A 3ECQA 4AI2A 2IVJA 4QB2A 4QHBA 4YGBA 3Q8FA 4PIXA 5JMCA 1D4M2 1A34A 2VNRA 2XBO1 3KM5A 1JU4A 5I8SA 2TEPA 4JTNA 4BDVB 1RUC2 1F2NA 2GH8A 4IV1A 1YQ8A 1LOFA 5F5IA 4BH9A 1CESA 2NLRA 4FXKB 4RR3A 1JTZX 1H30A 2ZX0A 4FBFA 4XJ9A 5FZ4A 5FUNA 4QD2A 4LO8A 5A32B 4XUOA 1AR93 1H8TA 1ENSA 1CZVA 3LIGA 5JXIA 2YROA 1RJ7A 1VJ2A 1MQTC 2BOIA 1W6MA 2PN5A 2WFF2 5C3PA 3KD4A 1MZFA 4N7IA 4XTMA 5C9AA 1E5SA 5I0DA 4QM9A 1W6NA 4WVMB 5FYZA 3LZZA 2HWD3 4AZZA 2RDNA 2YG0A 4ZU7A 1XQNA 4OHYA 1J3PA 1R083 2CAUA 2O1QA 1COV2 3Q9OA 4QXHA 4XURA 3ZFGA 4N43B 1JOBA 4BPZA 2QQJA 4PDWC 3PU3A 4Y33A 5CA6A 2JE8A 3BU0A 4IGOA 4FO9A 2Q1MA 3H1YA 5ANNA 1H9WA 3WY6A 2CY6A 2IXCA 1NLQA 2F4LA 3X29B 4K40A 3SCHA 4LA3A 4IEOA 3M3CA 4NHXA 1C28A 3J9SA 4GH4C 2BV4A 3H8UA 2XLFA 4FAGA 4ZPIA 3USSA 3BOPA 4CCLA 1XJAA 3WQ0A 3OSDA 4AI3A 5LBFA 1OA3A 3ZN6A 3I3EA 3PUHA 2A3WA 1QH6A 5CBLA 3A22A 1ALYA 2JG9A 2WL1A 1W9YA 1J3QA 1CJPA 1PMHX 2GP3A 4MLOA 1QJY3 1OHFA 3NNFA 1H8TB 4Y1YA 2WNVB 2GP5A 1O7FA 2PHWA 2DVDA 2WO2A 4CCCA 3AK0A 1W6MB 4ES8A 1XE7A 5A7OA 4E4SA 2D5HA 1YUDA 2PTMA 3I97A 4XQ4A 5C9AB 3B3QE 5A7PA 3RZHA 2BBVA 4EV0A 3BIEA 4LUMA 1VBA2 2VZVA 3I2DA 1W6NB 4KBBA 2A71A 5JZGA 1UYYA 4UI9L 1KS5A 4MXWA 1JHNA 4DO0A 3MIGA 1NX9A 3PUQA 4YSFA 2GDFA 3RGBA 1XNDA 2BNOA 1RUH1 2HWC3 3VBOC 1MS0A 2RS12 4FOQA 1UMIA 3ENRA 1LGBA 2JG8B 2UY8A 2RDSA 3OJBA 2ENRA 1MS8A 3WDVA 5F8PA 5A6YA 1TNFA 2TUNA 1QH7A 2E31A 1UZZA 2CU5A 3WCSA 2VCMA 2HWB3 1IKQA 1WLCA 1K5JA 4O65A 1QNWA 2A7AA 4RYDA 1AX0A 2Y38A 4K3UA 4RGKA 4CUBA 4Q4V3 3ZXKA 2QTWB 3F2ZA 3ZN6B 4NUBA 4OUMA 4B4RA 1P8JA 4CP9A 4PHZA 1DHKB 1MZ5A 4FPYA 4MOAA 5CEHA 4JAAA 5FY8A 1FOD3 3CEWA 3DECA 3POGA 5F2SA 3HVDA 5LBCA 2JKXA 4B7KA 4OMCA 1R1A3 5F3EA 3ASIA 1H2MA 3AZVA 4Y4YA 3WQ7A 2RR11 5FOJB 2FDFA 2YU1A 3N35A 2PLV1 3RPQA 3T30A 1C8M3 4KI5M 5JZGB 4FT8A 2BNNA 3MLKA 1G9CA 1RMU2 4BJ0A 4LNVA 1GOFA 1NCRC 2WIIB 5LK7B 2DUPA 3N36A 4KNCA 5CG8A 2SLIA 3AJYA 4KU7A 3ORJA 2Y6HA 1IQDC 1IPKA 1LOGA 5D2AA 1WW6A 3T1MA 3ZDVA 2UY9A 1HRI1 1G8WA 1ND3A 2VZ3A 1YFWA 3WCRA 3A0NA 2OIIA 3LB9A 3ZFFC 3K75B 4ZY9A 1GZWB 4ET7A 1PIV1 1DQ6A 5A3WA 4B8EA 4GQ7A 2C9AA 2DTYA 3VZJA 1XSQA 2WQ4A 1YO8A 4AHYA 3DPRA 4CP9B 4QX0A 2J1UA 1LHVA 3CBNA 1SCSA 1ZZCA 2D43A 3PVNA 1H2KA 2ATFA 2IXIA 1LHWA 2OW4A 5H9PA 4N53C 3TN91 2QVSB 2YXSA 1ZZ7A 1CGPA 4XFBA 5FZGA 3D0SA 2B45X 3DXUA 4PLOA 4XABA 1I3HA 3VZNA 1CD3G 1GKBA 1YJKA 2PXJA 1OH3A 2XJQA 3I2IA 1UOGA 2QJVA 4A3ZA 1JS9A 1SLCA 1EAH3 3W58A 1RUJ1 4KWLA 3CF6E 1WCDJ 1WGPA 1KITA 3MZHA 1PVC1 1SDDB 2AGSA 4RL7A 1JOPA 1UY3A 3O0VA 4CPBA 1W9TA 1ZBA1 3M7AA 4LBQB 1GMMA 4PI2A 5EYYA 3U75A 1VBD3 1NYWA 1LENA 2VG9A 1X33A 1OOPC 2VMFA 3NO8A 4BQWA 1L7QA 3TEYA 5ISLA 4XVHA 3ILNA 2VW2A 3LF7A 3V0BA 1ULFA 4OHZA 3RQ0A 1KDMA 4NMIA 1OLRA 1CN1A 4A41A 3H50A 1DYOA 4XMIA 3VHNA 2D98A 1YI9A 3POYA 4GKYA 1XC6A 3AMNA 4IESA 4F83A 2D93A 3VDDB 2W91A 1UN1A 2WNOA 4IEXA 2FDKA 3TOJA 2GU9A 1AR81 1QU0A 1VP6A 3T3YA 3B94A 3AFGA 4LLOA 4JKLA 4A42A 3SEPA 2EIDA 4IL7A 1S2KA 3A0KA 3BCWA 3E6CC 1RUNA 5JPNB 2YC4A 2C5DA 2W3JA 5GLUA 3BYWA 3LWCA 3AYAA 4Q1RA 1ODMA 1ONAA 4OI1A 4LO5B 5HCHA 1RL3A 3BVCA 3ON7A 3ZXLA 5JR2A 3MIFA 3V65A 5A80A 1M4WA 3M8LA 1Q56A 1YEWA 3LPGA 1W9SA 1RUF1 1RYYA 1UX6A 4UW5A 5FV3A 1FXZA 1T2XA 4HMZA 5CAZA 3U07A 5BYNA 4RFRB 4XFHA 2Q0AA 1LTEA 1O5UA 4IDZA 2OT7A 2G9ZA 3BIWE 3MPBA 5FYUA 1LODA 1RUH2 2HWE3 5JWPA 1W05A 2VZOA 1MS4A 1PZ9A 5F5CA 1XNTA 4LOTA 2WNUA 4E4HA 3MFAA 1YLLA 2QE3A 3RS6A 1Q43A 1W6PA 4IE6A 4ZKTB 5DUXA 4YVSB 5FREA 5BPXA 5GJ6A 3HAGA 3O1RA 1JZ4A 3B9IA 3WDWA 4C1WA 5ABJA 4GALA 5JIUA 4LORA 3DCQA 3J8F3 5T52A 1H6YA 2E32A 4ASLA 2C0ZA 1OD5A 2H6CA 1Y9QA 1IS5A 1QHDA 1NCQB 4AI8A 3GYDA 1PK6A 4CUCA 4MGIE 1UL9A 3JXSA 4PCRA 5F37A 3NAPB 1BK0A 2PHXA 4AEJA 3JQXA 2KD7A 4MGQA 4IGPA 1G6NA 2Y33A 1I5PA 1ULCA 4K8RB 1ZRFA 3EMRA 1ZX5A 3HQXA 4ZXKA 3THPA 2LROA 1SPPA 5DAVA 3LOBA 2D6OX 2D3RA 1BK1A 2RR12 1D2SA 2BP6A 2PLV2 3VD9A 3FJSA 5GZFA 1OQDA 2WABA 1AL21 1EYBA 4LULA 1US2A 2RM23 3MIHA 5CKNA 2O0OA 5D8AC 1U5YA 1WZXA 5JAXA 4R9DA 5C3RA 4KMQA 2CDPA 2WNUB 3H8RA 2VOKA 1W6PB 5IJRA 1F15A 3WDTA 5HCAA 1PZ8A 2E63A 4OUEA 2GAUA 3UJQA 5ABJB 2ZMLA 1HRI2 2NPIA 1UY2A 4RS5A 5KXCA 1QF3A 3VDAA 4QDQA 1FATA 1PIV2 2DUOA 1W9WA 1Y9GA 1WW4A 3LAGA 5HXVA 1GR3A 4J6GA 1HW5A 2ZGTA 5A3UA 5C8CA 2J1EA 4EQVA 1O6UA 1BVVA 1SFPA 5EYXA 5IT6A 1UX7A 5A3MA 4DS0A 3OBAA 5DDJ3 2ZKLA 3ZDSA 5I93A 2E7TA 3TN92 1DIWA 1MR5A 4F3JA 2WR9A 3UETA 4CCDA 2WFPA 4YWAA 5C5UA 4BLJA 2E9QA 1W03A 2CGNA 4LBKA 4AK3A 4K6BA 4YVWB 1H8VA 4Z2AA 1OD3A 5FZ8A 4BQXA 2W08A 4XFFA 1VRH3 2BWCA 1RUD3 1RUJ2 2BW8A 1E5IA 5EJ1B 3THDA 3KSCA 4KWJA 2YY1A 3OUIA 4MH0E 1A8DA 2AENA 1QOSA 4DY3A 4XBLA 1ZRRA 2VJXA 1ZBA2 5J36A 2HWE1 3CO2A 4JVAA 5I0SA 3V0AA 3M3IA 4QGMA 1ZZ8A 2WS93 3R05A 2JKBA 2OS2A 1ZZ9A 4FPOB 2BEOA 3HBZA 3POIA 1LOFC 4IV1C 2VBDA 5JSRA 1FV2A 3ILFA 4EN6B 4JGZA 2E26A 4RR3C 5FDBA 2GNMA 4QT6A 2RMU3 5KHJA 5K4LA 5C8CB 1PGW2 1LJ7A 1LAJA 5F6KA 3CNAA 1H8TC 2PAEA 1HQLA 2BGPA 2WQZC 3MICA 3ZOIA 1CR7A 2A6YA 2GMMA 1PNFA 2J7MA 4C91A 1LEDA 1LGNA 2J42A 3OUJA 1W8NA 3P1IA 5C9AC 1Q8OA 1AR82 1X36A 4YFZA 5LASA 5JLVA 4OLLA 1I1EA 4K1ZA 1UPSA 5T3NA 2EIEA 2G9FA 4YZ5A 1WCUA 2KA3A 4S2DA 4V2VA 2B46X 4HOOA 1T6BX 2AH2A 1DYPA 3AM2A 3ZFGC 3IDEA 4CZSA 4R4ZA 4D7YA 3ZYIB 4MG2A 5AC93 1AYN3 3WNXA 2J22A 4RA0A 2GN7A 1BQPA 5CFDA 2A6VA 2P34A 4P08A 1GZCA 2EIGA 3BB6A 2XONA 2YFZA 3N7KA 3VBRA 4LE3A 3THTA 4UXAA 3GJBA 5T5OA 1RUE1 1VBC3 1RUF2 2ZGKA 3GGLA 4FOYA 4QM8A 1ZBE1 1ASJ1 4C1XA 3S30A 1QJU1 3IB3A 2FDJA 4R9AA 3HEIA 2ZJCA 4NPLA 2ZHNA 3EYPA 1AR71 4JGZB 4GB31 1ACCA 2FBEA 3C7OA 3NV3A 2JG9C 4AFCA 2VECA 3POWA 2BNMA 2JENA 4JDNA 5LA9A 2YUEA 2VNVA 5FWEA 4AQ2A 1H9PA 1CAUA 2A5ZA 4CDUA 5FAXA 2JB8A 4ZU5A 3E5XA 4AEDB 3W20A 4KU8A 4I02A 1VAMA 4Y1UA 4Z8BA 2A3XA 3AYEA 1ENQA 4LKSA 3VZOA 2VVFA 1V6MA 3EO6A 4IUGA 3WG1A 4LQRA 5DDJ1 2KM2A 1HN0A 1JODA 5JI7A 4AVTA 5DMYA 5GLVA 5JZGC 3L9JT 1HKDA 2VMGA 3MW4A 1NA1A 2PAMA 2ZACA 5EJZB 1I9RA 2WAAA 3GBFA 3RDIA 5IFPA 3SISA 1H0BA 4XJWA 1LU1A 1R64A 3POJA 4W4ZA 5C3QA 4ASKA 2CHHA 3KGLA 2BZDA 5CFDB 2JB4A 3ZYBA 4XEZA 3RNSA 3FLPA 1RUC3 1WCQA 2OA2A 3VBRB 3NW4A 1C8NA 3OUHA 4P9LA 1VRH1 5DN2A 1KGYA 2D5FA 3LSDA 2J1SA 1UAIA 3RWKX 3S6PA 3SH4A 2ID4A 3SKJE 4CEWB 2BFUL 1SFNA 3DXTA 2WQ8A 1AL22 2GMPA 1CAWA 3DYPA 2CNAA 3LIHA 5I8YA 1K5MB 1E5HA 4RHV1 2OZJA 3E5QA 4LXLA 1S0IA 2QQMA 4XOGA 4AVSA 3OGSA 1OQ1A 2XWJB 5FZ3A 4CDUB 2Z79A 1U5IA 3JD71 2FQPA 2EF6A 1SLLA 3LDRA 3NV1A 4XIKA 1YQ5A 3CL1A 5H9SA 1MVQA 4BM8A 3FWEA 3ACHA 1OXCA 1B35A 4XJUA 4I01A 4O9GA 1GANA 1POV3 2XH6A 4TYSA 4C0BA 5IATA 1NA1B 2GH2A 1EPWA 2PHLA 3JB4C 4MHRA 3OGGA 3KT7A 3WF3A 2PHFA 1V9U1 3W5NA 1H1IA 1KEXA 2ZTNA 3HQRA 3T2QA 4CVUA 2XQXA 4WBBA 3A21A 3VBUB 2ZOEB 4AI0A 2DTWA 4L92A 3VL9A 1W99A 1LESA 2WZR2 5E8AA 2JE7A 2W68A 5E6HA 5AC91 1W6QB 2EA7A 3D6EA 5HCBA 2P1BA 3RWNA 4HSLA 2FD8A 1ND3C 4H55A 4QX5A 1MVEA 5FP4A 1R1ZA 4QQPA 5A6QA 1AXKA 2MEV3 4QKBA 1CAWB 5FZMA 3INAA 3DPRC 2ZX3A 1O4ZA 3IN9A 1OA4A 3K51A 4MYEA 1L7RA 1BEV2 3JBG1 5KC6A 5I0TA 3KQRA 1XNBA 2R061 3OYWB 3U4SA 5K0UB 4LK7A 4P5HA 1SACA 1QOTA 1C5IA 1LRHA 4Q4Y2 4GD4A 2VULA 4IEUA 5JOYA 1TVGA 3AZZA 4W50A 1B35B 2C26A 1JYTA 4NHKA 3SC7X 4EROA 1UOJA 2NQYA 2D6LX 2R072 3ZVXA 5F1RA 2JD4A 1MZ6A 1PO22 1EV11 1S0JA 4PBOA 2JIJA 4Q4X1 4YG6A 3UESA 1DQ2A 4K1YA 4DEQA 1W3VA 4QU2A 4RN5A 5T5JA 1WMFA 3TWIA 3NNLA 4IEQA 4KGGA 3ZR5A 5B2GB 3WG2A 2YC0A 2H0VA 4ZS2A 4ISRA 3UKVA 1MZEA 4P9WA 2KXLA 1R092 2WT1A 2O14A 5LEKA 1DQ1A 4QX7A 3ZXFA 2X29A 4C90A 2QQOA 5JCTA 1VBB2 3CU7A 3ME2A 5DAWA 5IVYA 1QGLA 2QDRA 3FN9A 1QQP1 1D0GA 5LBEA 2WZEA 2HWF3 3UGFA 2WAOA 1RUE2 1QJEA 1CX4A 2VOXA 5DQ0A 1RMU3 1PM7A 1ZBE2 1ASJ2 5FYHA 2VZRA 1QJU2 3GBWA 2V4VA 4BLIA 3MYXA 4YW6A 2W87A 4V2WA 3BKZA 2ZEZA 4DXZA 5F39A 1AR72 4GB32 3CDZB 1UQXA 5EJ3A 3NAPC 3T4VA 1MPXA 3FLRA 2Q8EA 1UKRA 3JZVA 3SITA 5LRSA 2F4PA 2BVVA 3M3OA 1FI2A 4AGVA 1J84A 2VZQA 4UW3A 2QBXA 5DZEA 1DQ4A 4PQQA 2JJ6A 1PX4A 1H4HA 1VE0A 4RFT0 4LKEA 2XHNA 1IG0A 5CVRA 1K45A 4ZXEA 5HV0A 3HNMA 4AF9A 1D0HA 1H2LA 2C24A 3EB7A 3FZ3A 1JXNA 3IDAA 4N8MA 5FZKA 4Q4W3 3HPNA 2DCTA 2WDBA 1JYIA 3UK9A 1KS4A 2CWMA 3N7LA 4Y26A 3T0AA 2Y0OA 4NRMA 2W94A 2WNUC 5GLZA 1GV9A 3PURA 3VD3A 5FJKA 4MHUA 1JW6A 5C33A 4FTEA 2XKPA 4UWDA 4XF4A 2ZGUA 5FZBA 4M3CA 5ABJC 4QXKA 4FPKA 3DUIA 3LPFA 5KWRA 4HANA 1IKPA 1X7NA 3ZN5A 2Q8CA 5E89A 2EXJA 2ZX4A 1DGWA 1PK6C 1NZIA 2LALA 3K77A 1WBFA 4HZFA 5M0TA 2XL9A 1UZYA 2DFBA 4HVOA 2CYFA 2XHKA 2ZZQA 3N9NA 4XDQA 4B3NA 4CTEA 2CGPA 4RHV2 3V64A 4LR4A 4OULA 1TME3 1JOJA 4KH9A 4P5YA 3JD72 5CYYA 2BUKA 1NKGA 3AJZA 4QHOA 4ATEA 4DB5A 1ULEA 4OYUA 1AX2A 4TTGA 3IPVB 4YPJA 4BWOA 4OZXA 1JH5A 1QXJA 1PZ7A 2BVBA 2YYOA 5CG9A 5LEJA 2HH9A 1V9U2 4Q8KA 4XHBA 1Q3EA 5DABA 1LU2A 2HLEA 1AVBA 1OQEA 1PM4A 5GZCA 3K3OA 4LT5A 4CCNA 4N9HA 5FYCA 5AFBA 2NYYA 2NP0A 4M3CB 1W04A 1XE8A 1JUIA 4WVMA 4Z92B 4H7MA 4RS5C 2W1WA 2E7AA 1MACA 1DGLA 2P3YA 4BMBA 4C8DA 3AMQA 2IC1A 1AR61 4N43A 1GFF2 2VQTA 1UYPA 3HIFA 2QZ2A 4GKXA 5C8CC 3LA2A 4PLMA 5LCWL 3E6DA 3RYPA 1UPIA 3JBG2 4P02B 3KV6A 4FPCA 2QKDA 4XXAA 3KHBA 3PVBB 4Y4RA 1H2NA 2R062 3PVOA 4UW4A 4HKOA 3O5SA 1CJDA 2P4EA 4A4AA 2JDNA 4TLGA 2WA4A 2PHTA 3H42B 3E6BA 2Q8DA 5K7PA 2GC1A 3E97A 3MW2A 2EAKA 1RINA 1FMD2 3WW4A 4M0NA 5FP7A 4A3XA 1LECA 4YZ4A 5T5PA 5HI0A 3KHCA 1A8MA 4DPNA 1WD3A 5L9RA 4QPWA 1M06G 2WNVA 1Z7S2 4HK9A 3ACFA 4KWKA 1U5XA 4P9XA 5FO7B 5F5AA 3PL0A 4XJAA 4TZDA 1YI7A 1YWKA 2QQIA 4WZCA 3D4KA 4I09A 3LGRA 1LHUA 2ZX1A 1RHI3 1ZYBA 5G05L 5DUUA 4PF5A 3WQ1A 4N90A 2R0HA 3R4SA 1VRBA 4JGZC 4UFLA 1REEA 2VMIA 2B8MA 1JYVA 1RUG1 2JG8A 1PO11 4AHZA 2LW8A 2BU9A 4QU1A 1XOYA 2VNGA 1Y43B 2WINB 3WG3A 2JDZA 4AWDA 2LM3A 2VPVA 5FO8B 1QJX2 1QQP2 2PMWB 4HVQA 3KZ4C 4MZUA 4IE4A 4QQOA 1AYM3 1TME1 4COYA 4GWJA 2NZ9A 5LRRA 1BZWA 3MO4A 4XDPA 2P3KA 1RUOA 2RV9A 2BTVC 2CDOA 2RJKA 2NMOA 5FPUA 4DNYA 2FZ1A 3FC0A 5CFDC 4QGLA 2OQ7A 4I3GA 4AVBA 2EALA 5LBBA 4LHKA 2RDQA 5FLHA 2VMHA 5FY5A 3VBRC 4D8MA 3MBWA 2ARBA 1CIYA 3M3QA 3SNMA 4FP2A 2ADEA 5FZHA 4CEWC 4Q5OA 4JDMA 1C4RA 4CUAA 3O1SA 3CHXA 1U5ZA 3LQCA 1DU3D 2R042 1S4CA 5LA1A 4IE7A 2W1QA 4D6RA 4EZHA 1DFQA 2YGLA 5KR7A 2VUAA 1AZDA 2JECA 5JOWA 5J37A 4CDUC 2Q1FA 3HNBM 1AHSA 1L3JA 1LHOA 1RUI3 5A7SA 3FHIB 4WVZA 1HXS3 2VL4A 1Q8SA 3J26N 3NL1A 1X82A 1BBT1 1BCXA 1X50A 3BGAA 3M2MA 2HBTA 1GZWA 5HXMA 1S0BA 1DP0A 4BQYA 1NA1C 1A78A 1YNAA 1N47A 3EJKA 5FKCA 4QQ2A 3FHQA 4UFJA 2J1AA 3APBA 3LCPA 5SV8A 4AXOA 4XF0A 3AVRA 1W2UA 3RYKA 3LDBA 4FQZA 4ZS3A 4FFIA 4DXTA 2RJLA 4LIUA 4DEVA 2AYHA 1G9AA 2JWPA 3WINE 3PUSA 4YGDA 3LEIA 4H3WA 1K42A 1AR91 2OUJA 2XWBB 5FY4A 2ZABA 2GC3A 3FFQA 1EUTA 2VNOA 3H3ZA 4KG8A 4QWNA 4XCBA 4BK5A 1WCKA 4BXFA 2MPFA 3IDCB 1BMV1 2ZGPA 4M3CF 4XF1A 3ZKUA 2XJSA 4Y3OA 4CP0A 2VR4A 2HWD1 1N3PA 3POSA 1MS9A 1ZVFA 1D2QA 1R081 2X5IB 4NWWA 4TSVA 1OA2A 1UCXA 1WW7A 2VGDA 5IVJA 5K0UC 5DAQA 4QQLA 3FL7A 3LOIA 4LBQA 4MGYE 4AYUA 1VMHA 3VV1A 5LB6A 1DLLA 3HNYM 3VGIA 4SLIA 1S2EA 1ND2A 3AX4A 3VBHB 1B35C 2Z42A 3WNLA 3WDXA 2ZGMA 3NV2A 1IS3A 1AR62 1JYWA 1KRIA 2GMEA 4FPEA 2XLAA 3S7EA 5FKBA 3K3NA 3TNQA 1ULGA 3JQWA 1SBDA 2A6ZA 1AYM1 2IFRA 3PU8A 1CQ9A 3TEWA 1CVNA 3LA7A 4JCKA 5GZDA 3VDDA 3VKMA 4DFSA 1SEFA 2R16A 5FYYA 1UW8A 1QJY1 2XBO2 3AXDA 3ZMNA 4S2FA 4OCTA 1O59A 4HPKA 1G86A 4TLFA 3O1VA 1JBCA 1NQJA 2AEZA 1W8FA 5JR7B 4QB1A 2B42B 3I49A 5DUWA 1W8OA 3I4IA 4W6YA 2Y34A 5DXDA 5FZEA 3ST7A 4CXXA 5FZOB 5E88A 4E2SA 3WW1A 1HDKA 4FOWA 3ROUA 4ARXA 3NNGA 4LBJA 4E27A 1X9PA 5GLWA 2HWC1 1UNBA 4ONUA 3H7YA 2JDUA 3U14A 5BXXA 5C5TA 1ND2B 1PHMA 3I8TA 3KGZA 4P9GA 1YFXA 4MADA 4XF9A 5A1AA 5KHKA 2Z4FA 4MVTA 4YM0A 5FXWA 2VCCA 2VY0A 2D97A 2I07B 4D7TA 5IK5A 4NIDA 1W2AX 2HWB1 3MF9A 4O7XA 4Q27A 4Y1ZA 1RUG2 2YDEA 1PO12 4Q4V1 5FXXA 1NZCA 2HKXA 3LEKA 4YVSA 4DRRA 4CEYA 1RVF3 5H9QA 5FQ0A 4X6RB 4HG6B 4JHTA 4NVPA 2PYTA 2C1FA 4EN8B 1F31A 2YPJA 3IT8A 3USUA 4AE2A 5DAPA 4HPKB 1NCQA 3FMGA 3QD6A 1FOD1 4QX3A 5FZCA 1IPSA 5FLIA 3UYJA 3KWVA 5FZLA 3OBRA 3SLIA 1R1A1 5KXDA 2D6PA 3NAPA 2A3YA 1GNZA 5GALA 1TMF3 2BGCA 2RS53 1HX6A 4FQ4A 4QKDA 1BLZA 2F17A 2RS33 4XF3A 3ZXJA 3ZSMA 1C8M1 5CB7A 2DCYA 3N3HA 3I3DA 3NJYA 5FPBA 2AR6A 3P3NA 5F3IA 1Y4WA 1CAVB 4JKKA 1YYNA 5EWSA 5IWFA 2ZBJA 4OI4A 1CZTA 1IHMA 3WV6A 4AQSA 4L97A 5CFCB 3S5QA 3T09A 4FSJA 3RVHA 2WZR3 4XFAA 4CU7A 4NJ4A 1NG0A 1OBNA 2BWAA 3C3VA 4L11A 3ALQA 3MV11 4AVCA 4UAPA 2OYZA 4Y20B 1D4VB 3BALA 3WNMA 4BISA 4CEYB 4NIAA 5FQ0B 2VZSA 4CCMA 4EN9B 4GULA 1DZRA 3HR9A 4LHSA 4B4PA 3D8CA 3H3LA 1VALA 3USUB 4E2QA 1BBT2 1DZQA 2VQAA 3KCXA 4YM1A 1BEV3 4CDQB 3J7NA 3LSEA 3RRDA 5FXZA 4FCAA 1W8HA 1GWMA 4CCJA 3ZFEA 4YFWA 4XW3A 4B7EA 3FUOA 4Q4Y3 1DGWX 1G9FA 5I8TA 1GBGA 3AZWA 4GXLA 1EAH1 2UWBA 2VOVA 4DUWA 2UYBA 2R073 3R6SA 4DY5A 5A33B 2J1TA 4W6WA 1O5LA 3UKTA 2ZAAA 4OUSA 4YVWA 1NUKA 4XMAA 1BMV2 1POV0 2KR2A 4YZ3A 2BDRA 4ISQA 3AKQA 5A7QA 1V70A 1VBD1 2FMDA 2K0GA 1J59A 1R082 4D0QA 3OTFA 1UY4A 3A23A 4M00A 3AMHA 1WCSA 4PI0A 1PGL1 2ZHLA 3BPSA 1R093 3H7JA 3NRUA 5L7OA 1W2NA 4UF0B 2FCTA 2IXKA 3IM0A 4JQRA 1HV0A 1OC1A 1XXNA 4BE3A 4P14A 3R4UA 2UU8A 4GWIA 3OPWA 1XE0A 5FPVA 1EP0A 3T1LA 3ZFEB 3U10A 3ZXGA 5F3GA 4A7YA 2P3IA 3Q8CA 1SCRA 2MHFA 2E33A 1Y9MA 1UU4A 4NO4A 4HKLA 2XQRA 1CPNA 4U2AA 3F95A 3HT1A 4COWA 3B69A 2ZEYA 1VB4A 3WP5A 2Q1ZB 1QJY2 2B9UA 1UU6A 1YIFA 2ZGRA 3K48A 4K8FA 1DGRA 2BRTA 1ENXA 3KCCA 3T0BA 3HT2A 4N43C 3NQHA 1N1VA 4I30A 4L0PA 5JOZA 3RZMA 1HN1A 2IVIB 4UYBA 2Y6GA 4M0HA 4O9EA 1YFYA 3ELNA 2GC2A 1PVC2 5ACA3 2CWSA 3J7MA 3KT4A 1IPJA 1OUXA 4QX1A 2DV9A 2DU1A 3AYDA 4HK8A 5FY9A 2HWC2 4FPGA 2D3SA 2WT0A 1LGCA 4XC9A 2W52A 5LK5A 1FPN3 4PBPA 3W59A 4YM3A 1ODNA 1TZOA 4ITCA 5L7OB 2MNGA 5C8WA 4YG0A 4P9YA 3OY8A 2YBPA 4QQHA 3T2PA 3VDCA 5JXHA 3QOPA 3HD8B 1HLCA 2VZUA 3J8F1 2W0XA 2HWB2 3KLSA 1FYUA 3OPZA 4WM7B 2XJTA 5E16A 5AVAA 2AC1A 2WNVC 4XFCA 3TEZA 4D6QA 1FT9A 1OLME 4LIVA 4Q4V2 4AEDA 3ZR6A 5JMOA 5FYTA 3D82A 3WW2A 4XQWA 2BERA 3C7FA 1SBEA 4QKFA 1XYOA 2LUWA 3C7HA 2Z2SB 1JN2P 2IXJA 5FMDA 5L9BA 3MW3A 2OPKA 3LFMA 3DKWA 2QCSB 4HETA 4Z07A 2ZEXA 1PGSA 4H2AA 4Q1PA 5G04L 1FOD2 2IFWA 2JICA 3OGRA 1WBLA 1VBE3 3AZXA 5FBJA 5BNNB 2DCKA 2IXHA 4K9SA 5AFEA 2JG8C 3UGGA 4CU8A 2XR4A 1KD7A 3W21A 2VW0A 1OVSA 1C8M2 4Q0PA 1GWKA 2RM21 1CAXA 5LWBA 2PAKA 2YB7A 3CZUA 1S0FA 2PA7A 3AP9A 4XE9A 3RYRA 3BOWA 4OI2A 3AP5A 1WMEA 1BHGA 3I2OA 3MIEA 4CEWA 4BQ1A 4XFGA 3ES4A 5CNAA 5K9YA 4DUVA 1HRV3 1XNAA 1REDA 3WF0A 2G9GA 1GQHA 2H0BA 2D44A 2V5DA 3OY8B 1JMUB 1OSGA 1K5MA 4FP3A 3I2JA 4AL9A 1J1LA 5C3SA 2GZWA 4YARA 2DURA 1O4YA 3DF0A 2EXIA 4Q29A 2OQ6A 1BKZA 4RGAA 1MEC3 2VO5A 1WLWA 4PT6A 3SH3A 1NE6A 5JSOA 1E5RA 2WWUA 4CDXA 3EQEA 3K4AA 1VLNA 4FPHA 2WLPA 5HPOA 1ENRA 5CU1A 3PMEA 1V6IA 1O8PA 1GP5A 2DUQA 4FTBA 3ZSKA 1UOBA 3K46A 4PDWB 1W8TA 3VBUA 2BYVE 3VKFC 1D4M3 4B29A 2DFCA 2ORXA 4FTSA 3NMBA 3DYOA 3AMPA 4OQ9A 1CAXB 4NRQA 2VBPA 5IVEA 1HB3A 1W6QA 2XDVA 4JX0A 1FMD3 2FCVA 2CV6A 3UL2A 4ATFA 5IAXA 3BTYA 5A3PA 1RUD1 4C0HA 4Y24A 1FNZA 1GOGA 3WDYA 3ZYPA 2WRAA 4QPGA 3U0ZA 1V6OA 2PHRA 3ATGA 1WLTA 4Z1VA 1Z7S3 5EQUA 1UZWA 2I74A 2WFF3 3Q8AA 1YCIA 3M70A 3PVEA 5A3NA 2WS91 4QXBA 3G7DA 1TQ5A 4DXRA 1W06A 1LB2A 4M4PA 2GN3A 3OYWA 1F9KA 1C5HA 5K0UA 2RMU1 3KCYA 5FMOS 4XZUG 3WEZA 3PNAA 1COV3 1WW5A 4CPBD 3IIIA 4JRAA 3QACA 4GWMA 4CDXB 4MV2A 5FYSA 1G9BA 3HMYA 4AFDA 4COZA 3IKWA 4YYOA 1SLTA 1LHNA 4IEWA 4LPLA 1YXWA 4LO6B 1QJX3 3URFA 1XBFA 4LKFA 2ZPXA 4YGCA 2WO7A 2WWSA 1JZ6A 2RG4A 1AYN1 5DG2A 2O8QA 1OKOA 4YW1A 2ARAA 1ND2C 3WUCA 3PJYA 2XB6C 4HKWA 3GZEA 4QPGB 1PMJX 3O1PA 4MO3M 1IG3A 3IIAA 5LY2A 2EIBA 1VBC1 5EIYB 2VXRA 3ZN4A 1RJ8A 1E57A 4X8NA 1N1TA 2QDNA 1DQ5A 5JOXA 2CL2A 1DGRN 2WO1A 3VDDC 2RVAA 5A7NA 1VBA3 5BNPA 2HWE2 4LE4A 2LTNA 2R043 3ABZA 4R4XA 2X09A 4Q0QA 2HEWF 2QQPA 2RS13 1AXYA 1UXXX 1LEMA 3NNMA 5SV5A 4JC1A 4LJHA 5FCCA 1S0CA 1JYNA 1MEC1 1FNYA 1QMJA 1V6NA 3VN4A 2WO3A 3J8F2 4QX8A 4OHVA 1XU2A 1YFUA 3B7MA 4UFHA 5A1FA 3MUY1 2GSYA 2VVDA 1UY1A 4Y1XA 4CSWA 2R32A 2ZGOA 1UO9A 4UFMA 5GZGA 2ERFA 4PLNA 1Z78A 4L9BA 4WVWA 3BPZA 3THCA 4JHZA 3PTYA 1Y7BA 2N7GA 4UFIA 2C4XA 5FYIA 5FUIA 1RUC1 2JDHA 2XVGA 2VTXA 2J1VA 4AW7A 2YPDA 3TRSB 3VKNA 2YU2A 3ZFFB 1AUYA 1OT5A 3WG4A 2XJPA 2W1SA 3T2TA 2B39A 1GYKA 1FX5A 5JUVA 2BBAA 3AC0A 4QHZA 1XB9A 4YVSC 1W39A 3RZZA 4MGZE 4B1MA 5BNPB 4RSUA 4QPIA 4CEYC 3H1MA 2XVKA 3C8XA 5F9TA 4AVVA 4K7JA 1VB2A 4DXSA 3M4FA 5EV7A 2VAUA 3HN3A 3OD4A 3PUAA 1NY71 3C7EA 3GCWA 5IYYA 1NCQC 5FP9A 4OFGA 2VOTA 2AZ5A 5FYMA 2GNDA 2I2SA 2P2KA 4J1WA 2XOMA 2Y64A 4BHPA 2K9ZA 3AKPA 1YHFA 1POV1 4AI1A 2W2IA 4QX2A 4MGKE 2Q5TA 2ZHMA 4YZ1A 2VUDA 2BQPA 1ULOA 1UY0A 1OF3A 2EVXA 5DDJ2 1XPWA 5C70A 3IPVA 3OGJA 2B7YA 4I0AA 4JKMA 5CISA 3JCIA 3SCGA 4EWEA 4Q0VA 5J98B 4TWTA 5T50A 4E8DA 4NHMA 1EPZA 2VE1A 4PIYA 4IV3A 1JYCA 2JE9A 3O1UA 5KXBA 4EN0A 5FPLA 2MEV1 2Y6FA 1GUIA 5FYVA 5D21A 2OKXA 4QPIB 4NIHA 5K8SA 5B4NA 5JPMB 1HQWA 1VRH2 1ZRIA 2QQVA 1OFSA 2GC0A 4AFMA 4B1LA 3JUUA 1HJFA 1UKGA 1WMDA 3CJIA 4S2HA 4UW6A 2PELA 5APAA 1JZ5A 3PIJA 4LK6A 3MFCA 2E53A 1O4TA 4CUGA 1F5FA 2WS92 3M1HA 4GJZA 3ZFEC 4CDWA 1JUHA 5GZEA 4GA9A 3CMGA 3BODA 2IZWA 1O3RA 1KXGA 2RMU2 4IERA 5EHDA 2O8OA 4IE0A 4P00B 4HBNA 4CU6A 4OVEA 2WBKA 3NKTA 1QJFA 2WZ8A 5JDBA 4YVWC 3I2GA 5A70A 4BIOA 3H0OA 2ES3A 1S0EA 3WVJA 2QNKA 1DQ0A 1OFNA 2JX9A 2OUHA 2OZ6A 3FE5A 2HJIA 4JV4A 2FDGA 4IV3B 3VD5A 3N9PA 3RZGA 2EXHA 2FCUA 1RITA 1U0AA 2NM1A 3WP3A 4EN7B 3OF1A 4TXWA 5AC92 3ILRA 5HBAA 4L8QA 3N9LA 5FP8A 4KWUA 4LEJA 4D6SA 3VUOA 3OD0A 4PQ9A 5BV6A 5L7OC 1Y3TA 4V1PA 4MGSA 3WT3A 4KQ7A 4BMEA 1OF4A 4RQPA 2VU9A 3CJIB 2HWF1 4QDSA 5FZFA 1CIWA 1VBC2 2A6WA 2YBSA 1RMU1 3ZIWA 1C1LA 4CDWB 1IGOA 1F4HA 3FBYA 3B00A 3OEAA 2P5BA 4H7LA 1QNYA 1LNSA 3BUCA 2WN3A 1UD1A 2XMLA 2XGXA 1NXD1 2WJSA 4NR1A 2YV8A 3B93A 5J3UA 4LO7A 5C6CA 1RUH3 2XKOA 2LS6A 1DYKA 2ARXA 3GM8A 4XBQA 5F32A 5ANQA 4LHLA 1HV1A 4FXGB 4NAOA 4HXCA 3H3UA 1A6CA 3WZ1A 4XCAA 4WM8B 1SDWA 1EV12 4Q4X2 2YGMA 3VZLA 4CCKA 4BU2A 5CZKA 1URXA 4Q4W1 4X6QB 5D1IA 1OH4A 5IUQA 4NWVA 5KHGA 1QOOA 3B02A 3I2HA 4UT5A 5FY1A 2VZ1A 3JB8A 4J1XA 5DPNA 2DYCA 3TNPB 3CZJA 4GMP3 3GZAA 4KG0A 3PTRB 3KV4A 3HQUA 1S0DA 4YLZA 1GQGA 1LKNA 1YIPA 1MS5A 2JDKA 2GNTA 4YW3A 4RQPB 3KF5A 4AQ6A 3GBGA 4ZZ8A 2DF7A 3DKQA 1W6OB 3ZYFA 1J58A 1CZSA 1V6LA 4AEDC 2RR13 4QMAA 4EYUA 1RXGA 3DGTA 4AOCA 4AVAA 2PLV3 3RZJA 2AREA 4QXCA 2ZMNA 4JQTA 2W95A 1W28A 5GKAC 2W39A 3ZYGA 3GHMA 3RZKA 1K12A 1NY72 2XLGA 4XDOA 2R30A 1G9DA 1C57A 3POEA 4IQPA 1TE1B 3D3AA 5CIRA 2FDHA 5A7WA 3KS7A 2RHPA 3NKGA 4IW3A 3VD7A 4FFFA 3SXWA 3SKVA 3WX5A 5C3OA 1QXRA 2WSVA 2VTFA 3EBRA 1UMHA 3RZLA 4LMFA 2DDUA 1HRI3 1UU5A 3IDBB 2L9LA 3T4HB 2YMZA 4D7SA 3HWJA 1STMA 3CQOA 4AI9A 5IVVA 2ZMKA 1WWYA 1PIV3 1VIWB 3KMHA 1OMIA 2XVLA 2R1BA 3BTAA 3AZYA 1U12A 3H8OA 3POFA 2OPWA 3HN1A 3QLQA 2QQNA 1GQPA 2Q4SA 3AFKA 1OKQA 4IV1B 2K2SA 4IE5A 5JIAA 4A7KA 2JDYA 3VZKA 4XIOA 1K5MC 1W8ZA 2C6SA 2PHUA 3N9OA 4GJYA 4J25A 4RR3B 3TN93 2X5IA 4G9SB 4XTPA 1HB1A 3QCWA 2JEMA 3OG2A 3IBMA 3WF1A 4BXSV 2MEV2 2EXKA 2R0FA 3ZXAC 2Y6JA 2DVFA 3GJAA 5EZWA 3NVCA 4JZRA 3O1MA 3VBHA 2VD7A 3ZYRA 4CDXC 2OX0A 1LULA 3U4XA 4M01A 2WZPP 2D6MA 1RUJ3
chains in the Genus database with same CATH topology
3B5LB 1PVC3 2ZGLA 5BY5A 5IK4A 3ZFGB 5DG1A 2DVAA 2GNBA 4PJYA 1ZBA3 4ASMB 3SHRA 2Q30A 3VBUC 3PLQA 1HQNA 1PNGA 1ZRDA 4IXLA 2Z69A 1RIRA 3B01A 2XJVA 3VHPA 2D40A 3ZIXA 5DZGA 2XJRA 4QPGC 1FAYA 3TB0A 5JVVA 4XILA 4N7UA 1XRUA 4LBNA 1VAKA 3L2HA 1DZTA 4GMP1 5I0UA 5KC5A 2YHJA 1RHI1 1XU1A 2IWGB 4FOVA 2JG9B 2FHRA 1AR83 3SCFA 1LOEA 1FV3A 1OLQA 5A3LA 2HWF2 1GZ9A 4MSVA 4H14A 4MXWB 4YRDA 5KXEA 1S55A 3FBMA 1LOBA 1RUF3 2NMNA 4CRQA 3VHRA 2UYAA 2E6VA 4P9IA 1C1FA 3N7MA 4JRLA 4MX3A 1NXMA 4D69A 3PMSA 3MGUA 4QPYA 1APNA 3PHMA 3EHKA 4K20A 1ZNPA 3M3EA 4LTAA 4Q26A 3WLUA 3O0WA 4CYDA 1Q8VA 3WOGA 1LR5A 4JGYA 3O0XA 3I7DA 4Q4W2 3O12A 5BNPC 1I5ZA 3AMMA 1CAVA 3AYCA 3D5OA 1TNRA 4XYXA 1SLAA 2BPA2 1RUI1 2CAVA 2P37A 3VBFA 2UWCA 5CFCA 2DVBA 1HXS1 2R1DA 4I2OA 5TSWA 1F5JA 4BIFA 4G3YC 3RJ2X 3VKOA 2Z5WA 1WLDA 1O3QA 1S2BA 3ZPYA 4Y20A 4AGGA 1HIXA 1AL23 1UMZA 5FPZA 5FBZA 1RB8G 4IEYA 3WHTA 1TME2 3WW3A 1QXPA 3RJRA 1ND3B 3RI9A 4CDQA 2P3JA 2ZS6B 3LA3A 3QH7A 3IMNA 3VBSA 2WKKA 4YW5A 4YNIA 4E2GA 4HLTA 5C4WA 1SLIA 4BA6A 1PGW1 1KFUL 3DPRB 4JGYB 1N3QA 4IEVA 5KHIA 2HEVF 4QPIC 3U11A 5L36A 2TBVA 5EXOA 5A33A 3NV4A 2XJUA 2Y26A 3VBFB 5DZFA 1MS3A 1YJLA 3WR0A 3DL3A 1ZRCA 1SMVA 1XYPA 4E9KA 2Q8OA 2HEYF 3UKNA 5BNOA 5I91A 1EY2A 4NOTA 4COVA 3VLBB 1VR3A 1NOVA 1N1YA 2X53S 2Y0IA 4I0WB 3VBSB 4DZGA 4AEMA 2V73A 2XL7A 5HCFA 5C4WB 2F6BA 3V0BB 5T5LA 4IV3C 3ACLA 1NE4A 2FMYA 3MLLA 1C3HA 4Q0SA 2ZX2A 4AFAA 3G6JB 2WSUA 2I45A 4D94A 3MIDA 4OI0A 1AR92 1G7YA 1PO23 4XETA 1H4GA 3CJIC 4BZ4A 1RGSA 2WC2A 1ULDA 3GZTB 4I3PA 3ES1A 3WHUA 4AHWA 1SFYA 1NLRA 1RHI2 1AXZA 5FO9B 2DVGA 4CDWC 2HWD2 1SLBA 4NPRA 3WD5A 4AFBA 1LOCA 1H1AA 2WT2A 3PJQA 4E4DX 5BNOB 4AHXA 2BFUS 4IEPA 3CJXA 1OPOA 1LCLA 1VBB3 1RVF1 5T55A 3NWKA 4WM7A 3BU7A 5IK7A 4WM8C 3AKSA 4W65A 1AYM2 1RUE3 3AP7A 1PMIA 1ASJ3 1ZBE3 3OCPA 4HSJA 5I0RA 1QJU3 3VHOA 2A75A 1TMF1 2PFWA 2RS51 5FFOC 4E4ZA 1AR73 4XZPA 4GB33 4LLFA 2RS31 4SBVA 2CGOA 2ZGNA 1AL0G 4FAHA 2VH9A 1Q5OA 4RQPC 3N4MA 4U36A 5BNNA 1DDLA 1Q8PA 5KHHA 1GSLA 4KGQA 1PK6B 1B09A 1QWRA 3H1WA 4R9BA 2XUMA 3RMXA 4A2UA 4HN0A 3S7IA 2WZR1 4LUKA 2DCZA 4WZFA 3J4UH 2VW1A 3TAYA 1Z0HA 2VVEA 1O3SA 3O14A 1RUI2 2WNEA 3MLJA 1ZA4A 3TBDA 1HXS2 5J96B 1QY4A 5BUVA 3ZXEA 1OI6A 3VL8A 2NN8A 1XNKA 3RSJA 1NQDA 1BEV1 3GNEA 1UIJA 1W0OA 2DCJA 1N3OA 2D7FA 1MQTA 2AUYA 1KQRA 4XPVA 2E7QA 2ILMA 4Q4Y1 1V6KA 2V5YA 4RHV3 4RS5B 2SBAA 4JDOA 1R1A2 3KT1A 3JD73 1BYHA 2R071 1IQAA 4CP1A 4PDWA 3EXUA 1PO21 3MF6A 1AJOA 1KJLA 3MIBA 2EAAA 3GF6A 3ZX7A 2XG3A 4GH4A 3ZMOA 1BXHA 3DN7A 4WVVA 3AXEA 1V9U3 1ZREA 3KB5A 3MI8A 3AKRA 3A4UA 1R091 4DINB 4DQAA 1KJRA 4S2GA 3WUDA 2D3PA 1VBB1 4W6XA 4LBLA 3WDUA 4META 1MQTB 5J7MA 1REFA 4X8PA 1LOAA 4F8AA 3V0AB 4LBQD 3VZMA 3JBG3 4YZ2A 2WA3A 3P3PA 1X8EA 4IEZA 4XXPA 2R063 1PVXA 5FOBB 4EJRA 1RTVA 2DWRA 3VBOA 5E1RA 4CP2A 2X5IC 2ZZJA 2ZCWA 4COUA 4PIZA 1VAVA 4K21A 2A73B 1EAH2 1H1MA 1IS6A 2VQ0A 4B4QA 4G4FA 3VBHC 4GH4B 5ACA1 3DV8A 1CONA 1EV13 4Q4X3 2R6QA 1UF2C 3JU9A 3NSTA 1W0PA 4Y1VA 2FZ2A 1J1TA 1FPN1 3MPPG 4DOUA 1VBD2 4YW4A 1XYNA 2ETEA 4Q0UA 4OHWA 1NLSA 4HN1A 1PGL2 2QUOA 2ZGQA 3D0JA 3I59A 4XJ8A 1QJZA 1RVF2 4YGEA 4RD7A 1RC6A 4R8HA 1QQP3 4I0BA 1NCRA 5J09A 3VBOB 2TNFA 2ZHKA 1QDOA 1CAUB 1VBE1 2QZ3A 4GWNA 2XPJA 2WLQA 1TMF2 2RS52 4LA2A 1IS4A 1QDCA 3RG0A 2RS32 3RI8A 4LO4B 1ZM1A 1SBFA 3MEPA 3ZFFA 4EWDA 4XQDA 5GM0A 5JSPA 2B5HA 4YM2A 1HRV1 1IZ3A 4FVVA 4RGGA 4HFSA 4BOWA 4MUVA 4NHLA 4D3WA 4HL0A 2A70A 4N53A 1J3RA 4GMP0 3L2YA 4FPFA 4Q2FA 4AQTA 1DF0A 3I59B 2A6XA 2D6NA 2DU0A 4QGNA 1WUVA 2X8KA 2UURA 5F6LB 4WV8A 4OHXA 5EFUA 5JIUA 5IK8A 1NCRB 4JGYC 3OBTA 4UBGA 4DRVA 3V56A 5J48A 3ZSJA 1KDKA 3FLTA 3FUQA 4KL1A 1D4M1 3AKTA 2YZ4A 1Q8QA 2IXLA 5DUVA 3SMHA 1OOPA 3UJOA 1FMD1 3VBFC 3ZSEA 5CFCC 2RE9A 1XNCA 3GZUC 1KFXL 4AGRA 5BNQA 4ZU4A 4R52A 5AVPA 4INDA 3ETQA 1ZZBA 1Z7S1 2RM22 2UWAA 3VKLA 2WFF1 1O91A 4N53B 3ZO0B 4CDQC 1TEIA 4DMIA 3VBSC 4XFIA 4YW2A 1COV1 1X8MA 5C4WC 1AX1A 3R0RA 3E5UA 4YG3A 3C2UA 3FFZA 1AJKA 2ET1A 2ZAHA 4Y22A 2VUJA 4XBNA 2R49A 1QJX1 4AG4A 4LBMA 1AR63 4N9IA 1S0GA 4URTA 5FLJA 4A7ZA 4AEKA 3CLPA 1OOPB 4GIQA 3GALA 4Z2WA 1S1AA 4F7ZA 4BCUA 4UBHA 2XBO3 3AB0A 2GALA 4Q8LA 4LHNA 1I6XA 4R9CA 5BNOC 4XHXA 3AP6A 1RUD2 4HVRA 5ACA2 5CADA 1VBA1 1BJQA 1F8VA 1AF9A 1IOAA 3FX3A 4BYYA 2D6KA 2R041 2V09A 3B9CA 2PHDA 3QBQA 4L99A 4Z82A 5FRAA 1FPN2 3QH6A 1V6JA 2RS11 2VOWA 3WXPA 4Y5Z0 4ES9A 2HYKA 4IETA 4XJZA 4L2NA 4Y22B 4NN0A 3O7OA 5FMOL 3WP6A 2H6BA 1MS1A 3S0MA 3ZXDA 5GLTA 3GHNA 4HT1T 1O3TA 1RUG3 2ZGSA 1PO13 1WD4A 1DBNA 2ZA9A 3LKJA 2ZKNA 3ZYJB 1CPMA 1T6GC 2CTVA 3H9AA 4WM8A 4ORFA 3ZSLA 3IWZA 2ET7A 5D8AA 2QFEA 5H9RA 3I54A 3W9AA 1VBE2 5KBFA 3NJZA 1AYN2 4P9JA 5FPXA 1QKQA 3N7JA 2G4IA 3R4DB 4JTOA 1GNHA 4FPJA 1V00A 2P17A 4WM7C 4MXVA 1SQ4A 1W6OA 4FPLA 5A32A 3SH5A 1HRV2 2JXAA 4LBOA 3RMYA 1ZZ6A 4EWAA 2E51A 2PQQA 1A3KA 1BVP1 1OPMA 5L73A 1YRZA 2OVUA 5FTTC 5F5QA 1MEC2 1N1SA 5BNNC 3WP4A 5JI9A 1GICA 1UIKA 3MDPA 5L19A 4M3CE 1WA4A 3TYJA 1DG6A 1GLHA 5D8AB 3UV9A 1BBT3 3AP4A 5T54A 3ECQA 4AI2A 4QHBA 4YGBA 4PIXA 5JMCA 1D4M2 2VNRA 2XBO1 3KM5A 5I8SA 2TEPA 4JTNA 1RUC2 1F2NA 2GH8A 4IV1A 1LOFA 4BH9A 1CESA 2NLRA 4FXKB 4RR3A 1JTZX 1H30A 2ZX0A 4FBFA 4XJ9A 4QD2A 4LO8A 5A32B 1AR93 1H8TA 1ENSA 2YROA 1RJ7A 1VJ2A 1MQTC 2PN5A 1W6MA 2WFF2 3KD4A 1MZFA 4N7IA 4XTMA 5C9AA 4QM9A 1W6NA 4WVMB 3LZZA 2HWD3 4OHYA 4ZU7A 1XQNA 1J3PA 1R083 2CAUA 2O1QA 1COV2 3Q9OA 3ZFGA 4N43B 4BPZA 5CA6A 4PDWC 4FO9A 2Q1MA 3H1YA 1H9WA 3WY6A 2CY6A 2IXCA 3X29B 4K40A 3SCHA 4LA3A 4IEOA 3M3CA 1C28A 3J9SA 4GH4C 3H8UA 2XLFA 4FAGA 3USSA 3BOPA 3WQ0A 4AI3A 1OA3A 3ZN6A 2A3WA 1QH6A 5CBLA 1ALYA 2JG9A 2WL1A 1J3QA 1CJPA 4MLOA 1QJY3 1OHFA 1H8TB 4Y1YA 2WNVB 1O7FA 2PHWA 2DVDA 3AK0A 1W6MB 4ES8A 1XE7A 4E4SA 2D5HA 1YUDA 2PTMA 4XQ4A 5C9AB 3B3QE 2BBVA 4EV0A 4LUMA 1VBA2 3I2DA 1W6NB 4KBBA 2A71A 5JZGA 1KS5A 4MXWA 1JHNA 3MIGA 4YSFA 2GDFA 1XNDA 2BNOA 1RUH1 2HWC3 3VBOC 1MS0A 2RS12 4FOQA 3ENRA 1LGBA 2JG8B 2UY8A 3OJBA 2ENRA 1MS8A 3WDVA 1TNFA 2TUNA 1QH7A 1UZZA 3WCSA 2HWB3 1IKQA 1WLCA 1QNWA 2A7AA 1AX0A 2Y38A 4K3UA 4Q4V3 3ZXKA 3ZN6B 4OUMA 4B4RA 1DHKB 1MZ5A 4FPYA 4JAAA 1FOD3 3CEWA 4B7KA 1R1A3 3ASIA 1H2MA 3AZVA 4Y4YA 3WQ7A 2RR11 5FOJB 3N35A 2PLV1 3RPQA 5JZGB 1C8M3 4FT8A 2BNNA 3MLKA 1G9CA 1RMU2 4LNVA 1NCRC 2WIIB 5LK7B 2DUPA 3N36A 4KNCA 5CG8A 2SLIA 3AJYA 4KU7A 1IPKA 1LOGA 1WW6A 3T1MA 2UY9A 1HRI1 1G8WA 1ND3A 1YFWA 3WCRA 3A0NA 2OIIA 3LB9A 3ZFFC 1GZWB 1PIV1 1DQ6A 4B8EA 4GQ7A 2C9AA 2DTYA 3VZJA 2WQ4A 1YO8A 4AHYA 3DPRA 1LHVA 3PVNA 1SCSA 1ZZCA 2D43A 1H2KA 2ATFA 2IXIA 1LHWA 2OW4A 5H9PA 4N53C 3TN91 2QVSB 2YXSA 1ZZ7A 1CGPA 4XFBA 3D0SA 2B45X 4PLOA 1I3HA 3VZNA 1CD3G 1GKBA 1YJKA 2XJQA 2QJVA 1SLCA 1EAH3 3W58A 1RUJ1 4KWLA 3CF6E 1WCDJ 1WGPA 1KITA 3MZHA 1PVC1 2AGSA 4RL7A 3O0VA 1ZBA1 3M7AA 4LBQB 5EYYA 1VBD3 1NYWA 1LENA 2VG9A 1X33A 1OOPC 3NO8A 3ILNA 2VW2A 3V0BA 1ULFA 4OHZA 3RQ0A 1KDMA 1OLRA 1CN1A 3H50A 3VHNA 4XMIA 2D98A 1YI9A 3POYA 4GKYA 3AMNA 4IESA 4F83A 2D93A 3VDDB 1UN1A 4IEXA 3TOJA 2GU9A 1AR81 1QU0A 1VP6A 3B94A 3AFGA 4LLOA 4IL7A 1S2KA 3A0KA 3BCWA 3E6CC 1RUNA 5JPNB 2C5DA 5GLUA 3LWCA 3AYAA 4Q1RA 1ONAA 4OI1A 4LO5B 1RL3A 3ZXLA 3MIFA 3V65A 1M4WA 3M8LA 1Q56A 1RUF1 4UW5A 1UX6A 1FXZA 4HMZA 5CAZA 3U07A 5BYNA 4XFHA 2Q0AA 1LTEA 1O5UA 3BIWE 3MPBA 1LODA 1RUH2 2HWE3 5JWPA 1MS4A 1PZ9A 2WNUA 3MFAA 1YLLA 2QE3A 3RS6A 1Q43A 1W6PA 4ZKTB 5DUXA 4YVSB 5FREA 5BPXA 5GJ6A 3HAGA 3B9IA 3WDWA 4C1WA 5ABJA 4GALA 3J8F3 5T52A 4ASLA 2C0ZA 1OD5A 2H6CA 1IS5A 1QHDA 1Y9QA 1NCQB 4AI8A 3GYDA 1PK6A 4MGIE 1UL9A 4PCRA 3NAPB 2PHXA 4AEJA 3JQXA 1G6NA 1ULCA 1ZRFA 1ZX5A 3HQXA 4ZXKA 3THPA 3LOBA 2D6OX 2D3RA 1BK1A 2RR12 1D2SA 2PLV2 3FJSA 5GZFA 1OQDA 4LULA 1AL21 1EYBA 2RM23 3MIHA 2O0OA 5D8AC 1U5YA 5JAXA 4R9DA 2WNUB 2VOKA 1W6PB 3WDTA 5HCAA 1PZ8A 2E63A 2GAUA 3UJQA 5ABJB 2ZMLA 1HRI2 2NPIA 4RS5A 5KXCA 1QF3A 1FATA 1PIV2 2DUOA 1WW4A 3LAGA 5HXVA 1GR3A 4J6GA 1HW5A 2ZGTA 5C8CA 1BVVA 5EYXA 5IT6A 5A3MA 4DS0A 5DDJ3 2ZKLA 3ZDSA 5I93A 2E7TA 3TN92 1DIWA 1MR5A 4F3JA 2WFPA 4BLJA 2E9QA 2CGNA 4LBKA 4AK3A 4K6BA 4YVWB 1H8VA 2W08A 4XFFA 1VRH3 2BWCA 1RUD3 1RUJ2 2BW8A 3KSCA 4KWJA 2YY1A 4MH0E 1A8DA 2AENA 1QOSA 4DY3A 4XBLA 1ZRRA 1ZBA2 5J36A 2HWE1 3CO2A 4JVAA 5I0SA 3V0AA 3M3IA 4QGMA 1ZZ8A 2WS93 3R05A 2JKBA 1ZZ9A 4FPOB 2BEOA 3HBZA 4IV1C 1LOFC 5JSRA 1FV2A 3ILFA 4EN6B 4JGZA 4RR3C 5FDBA 2GNMA 4QT6A 2RMU3 5KHJA 5C8CB 1PGW2 1LJ7A 5F6KA 3CNAA 1H8TC 2PAEA 1HQLA 2WQZC 3MICA 1CR7A 2A6YA 2GMMA 1PNFA 4C91A 1LEDA 1LGNA 5C9AC 1Q8OA 1AR82 1X36A 4YFZA 5JLVA 4OLLA 1I1EA 4K1ZA 1UPSA 5T3NA 2G9FA 4YZ5A 2KA3A 4S2DA 2B46X 2AH2A 1DYPA 3AM2A 3ZFGC 3IDEA 4CZSA 4R4ZA 4D7YA 3ZYIB 5AC93 1AYN3 3WNXA 4RA0A 2GN7A 1BQPA 5CFDA 2A6VA 2P34A 1GZCA 2EIGA 3BB6A 3VBRA 3N7KA 4LE3A 3THTA 4UXAA 5T5OA 1RUE1 1VBC3 1RUF2 2ZGKA 4FOYA 4QM8A 1ZBE1 1ASJ1 4C1XA 3S30A 1QJU1 4R9AA 2ZJCA 2ZHNA 1AR71 4JGZB 4GB31 2FBEA 3NV3A 2JG9C 4AFCA 2VECA 3POWA 2BNMA 2JENA 4JDNA 2YUEA 4AQ2A 1H9PA 1CAUA 2A5ZA 4CDUA 5FAXA 4ZU5A 3E5XA 4AEDB 4KU8A 4I02A 1VAMA 4Y1UA 4Z8BA 2A3XA 3AYEA 1ENQA 3VZOA 2VVFA 1V6MA 3EO6A 3WG1A 5DDJ1 5JI7A 2KM2A 4AVTA 5JZGC 5GLVA 3L9JT 1HKDA 2VMGA 3MW4A 1NA1A 2PAMA 2ZACA 3RDIA 1I9RA 3GBFA 3SISA 1H0BA 4XJWA 1LU1A 3KGLA 5CFDB 4XEZA 3RNSA 3FLPA 1RUC3 3VBRB 2OA2A 3NW4A 1C8NA 4P9LA 1VRH1 2D5FA 3LSDA 1UAIA 3S6PA 3SH4A 4CEWB 2BFUL 1SFNA 1AL22 2GMPA 1CAWA 2CNAA 5I8YA 1K5MB 4RHV1 4XOGA 2OZJA 3E5QA 4AVSA 1S0IA 1OQ1A 2XWJB 4CDUB 2Z79A 1U5IA 3JD71 2FQPA 2EF6A 1SLLA 3NV1A 4XIKA 3CL1A 5H9SA 1MVQA 4BM8A 3FWEA 4XJUA 1B35A 4I01A 4O9GA 1GANA 1POV3 2XH6A 4TYSA 4C0BA 1NA1B 2GH2A 1EPWA 2PHLA 3JB4C 3OGGA 3KT7A 2PHFA 1V9U1 1H1IA 2ZTNA 4WBBA 3VBUB 4AI0A 2ZOEB 2DTWA 4L92A 3VL9A 1LESA 2WZR2 5E8AA 2JE7A 2W68A 5AC91 1W6QB 2EA7A 3D6EA 5HCBA 3RWNA 4HSLA 1ND3C 4H55A 4QX5A 1MVEA 1R1ZA 4QQPA 1AXKA 2MEV3 1CAWB 3INAA 3DPRC 2ZX3A 1O4ZA 3IN9A 1OA4A 3K51A 4MYEA 1BEV2 3JBG1 5KC6A 5I0TA 3KQRA 1XNBA 2R061 3OYWB 5K0UB 4P5HA 1SACA 1QOTA 1C5IA 1LRHA 4Q4Y2 2VULA 4IEUA 5JOYA 3AZZA 1B35B 4NHKA 4EROA 2NQYA 2D6LX 2R072 3ZVXA 5F1RA 2JD4A 1MZ6A 1PO22 1EV11 1S0JA 4PBOA 4Q4X1 4YG6A 1DQ2A 4K1YA 4QU2A 5T5JA 1WMFA 3TWIA 4IEQA 4KGGA 5B2GB 3WG2A 2YC0A 2H0VA 4ISRA 3UKVA 1MZEA 4P9WA 2KXLA 1R092 2WT1A 5LEKA 1DQ1A 3ZXFA 2X29A 4C90A 5JCTA 1VBB2 3CU7A 3ME2A 1QGLA 2QDRA 1QQP1 1D0GA