4XETA

Fe-cl bound y157f cdo at ph ~7.0 in the presence of azide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 59
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xetA00
2K0GA 4LA3A 5KHIA 2CAVA 2ET7A 2IXJA 2CV6A 3IBMA 2MNGA 5KBFA 1DGWA 3LZZA 1ZNPA 2OZJA 5JSRA 2MHFA 1ZZ6A 2H0VA 3U0ZA 4PIXA 3WW1A 1RUOA 2QVSB 5CADA 5F1RA 2UY8A 4MUVA 2GC0A 3H3ZA 2FQPA 4X6RB 1CAXA 2I45A 3EJKA 5I0SA 2GC2A 2D5FA 3RZZA 2B8MA 2C0ZA 3UKTA 2PHDA 3R6SA 2ETEA 4JTOA 1YFYA 1Q43A 4LTAA 4OLLA 3N4MA 2CAUA 4XF1A 4FAGA 1CAWA 4BHPA 5FPXA 4YYOA 3S7EA 4RD7A 3LA7A 1SQ4A 4N9IA 1EPZA 4JV4A 2WC2A 1RC6A 5BY5A 5T3NA 4FT8A 4J1XA 2IXLA 3I54A 3FE5A 2D5HA 3HT1A 2KXLA 1RTVA 3I7DA 4R52A 4YNIA 5FLHA 5JSOA 4MH0E 4AXOA 1O3QA 1YFWA 3EHKA 3ACLA 1RUNA 4XFBA 3ES4A 3E6CC 1PM7A 1O7FA 2OZ6A 3EBRA 2IXHA 1WLTA 1FI2A 2GAUA 4QGMA 1NZCA 2UYBA 3HIFA 5BXXA 5JAXA 5KHHA 4Z07A 3PLQA 1UIJA 2H6BA 3D0SA 3E97A 1O3TA 3BB6A 3FFQA 5K8SA 3D82A 3ETQA 4ZU4A 5JR7B 2B5HA 2XLGA 1CGPA 2IXKA 3U11A 5E16A 4META 4MX3A 3RYPA 1ZRFA 3PNAA 2MPFA 1DZTA 3NKTA 4I09A 4ZU7A 4OFGA 1VJ2A 1H1MA 3HQXA 2UY9A 4Q29A 2Q4SA 2ZCWA 2EA7A 1QXRA 4NVPA 4JTNA 5I0RA 3DV8A 4IEZA 3S0MA 2BNNA 1G6NA 4GULA 2XHKA 4WVZA 2O1QA 4I2OA 2HJIA 1ZRCA 4XEZA 4LULA 2BNMA 5BPXA 1LB2A 4XFIA 4E2QA 5D1IA 3IDBB 3H8UA 4K8FA 1QXJA 1VP6A 2B9UA 3L2HA 1X8MA 4O9EA 2OA2A 3LA2A 4F8AA 1L3JA 3FJSA 2QJVA 4J1WA 3PVBB 4UBHA 4Q0QA 2XL9A 3NSTA 3U10A 2ET1A 4MZUA 3HT2A 3EO6A 5JCTA 3ES1A 3FX3A 1O5UA 1UW8A 2PAMA 1ZRDA 4IEUA 4MGZE 3WW2A 2PYTA 1DZRA 4YARA 4XF9A 2IC1A 3KCCA 3ROUA 3LWCA 4HSJA 4Q0VA 1ZZ7A 1CAVB 1ZRRA 1ZZCA 4QGLA 3WW3A 3KGZA 3MYXA 4TLFA 1O4TA 1CAUB 4HVOA 3G7DA 1YUDA 2VPVA 1NYWA 1Y9QA 4D7TA 4Q0SA 3H1MA 1SEFA 1I5ZA 5FCCA 1O3RA 3H7YA 1UIKA 1ZVFA 4Z82A 4MGKE 3TNPB 2PFWA 2WFPA 5EFUA 2E9QA 2PTMA 4N9HA 1Y3TA 1LRHA 2Z69A 5BV6A 3WW4A 1UD1A 3H7JA 3E6DA 1OI6A 4HLTA 4I0BA 4QGNA 1J3RA 3OTFA 3ST7A 3LOIA 5E1RA 5FLJA 1O3SA 4XFGA 3O14A 4PIZA 1GQGA 4XF3A 4XFAA 4YRDA 1CAVA 3RPQA 3UKNA 1WA4A 3I59B 4WBBA 5I91A 5J7MA 5JSPA 3GYDA 3CO2A 4IEYA 4ORFA 4YSFA 1RL3A 2Y0OA 3OCPA 3BPZA 2H6CA 4IEPA 1CAUA 4A2UA 4E2GA 3IDCB 2CGPA 4IEOA 5LEJA 3JZVA 1ZZ9A 1CX4A 4EWEA 4Q0PA 2Q0AA 3FWEA 4I3PA 4KU8A 1FT9A 1OD5A 2Q30A 4H7LA 2HKXA 3KGLA 5CU1A 1EY2A 4UXAA 5I0UA 4EROA 1XE7A 3KSCA 4KWKA 3SXWA 4ONUA 5BUVA 1X82A 1GQHA 4IEXA 3M3IA 1I6XA 1ZREA 4HVQA 3M70A 2F4PA 4PIYA 3DN7A 2IXIA 1V70A 4X6QB 3CEWA 2GC3A 2O8QA 3CF6E 2XLFA 4IETA 5FQ0B 2PQQA 4D7SA 1OMIA 4EWDA 3NL1A 1YHFA 5EZWA 1IPJA 3E5UA 3SMHA 4DINB 3TNQA 2EVXA 3BCWA 3I59A 3LA3A 3MPBA 1U12A 3IIAA 5LRRA 3QACA 4QM9A 2QCSB 4EV0A 3H1WA 4E2SA 3H9AA 1NE6A 4UBGA 1VR3A 4O9GA 3NVCA 4XFCA 3H3UA 1OFNA 4AVBA 2QNKA 1LKNA 2ATFA 2BNOA 2QDRA 2IXCA 4L11A 4LEJA 2GH2A 4I01A 3SCFA 2N7GA 1TQ5A 4MGYE 4QMAA 2XL7A 3DKWA 3EQEA 4JVAA 1J1LA 4MV2A 5LRSA 4P9GA 3GBFA 2Q1ZB 4KWLA 1ZZBA 4QX5A 4IEVA 3SCGA 4HN1A 1H1IA 4LA2A 5I8SA 3OD0A 1SFNA 5I93A 3MDPA 1UCXA 1XRUA 2GC1A 3NJZA 4HN0A 1PMIA 1J3QA 5J3UA 1RGSA 3C3VA 4XFFA 4QXKA 1X8EA 5I8YA 5J48A 5FQ0A 1WGPA 3OGJA 4HMZA 3IWZA 4KL1A 1UPIA 2XKOA 5AVPA 3D0JA 5CVRA 1NE4A 2XGXA 3BU7A 2PAKA 5C6CA 2BYVE 4PJYA 3CLPA 1JUHA 3H50A 1ZZ8A 2K9ZA 2GU9A 2VECA 5FDBA 4HVRA 4AQ6A 1EP0A 3DL3A 2EAAA 3NW4A 3RNSA 3ELNA 3SCHA 4BYYA 1YFUA 3ZDSA 2PA7A 3RDIA 3E6BA 2BGCA 4IEQA 2DCTA 4AVAA 4MGIE 3RYRA 1QWRA 1YFXA 1IPKA 1J58A 5KHJA 2UYAA 3BALA 4QM8A 3B02A 1LR5A 4F7ZA 3VHRA 5HI0A 2D40A 4XF0A 3LAGA 4IERA 1J3PA 5I0TA 2XKPA 1X7NA 4I02A 1Q5OA 5LEKA 4IEWA 4LLOA 4KU7A 1DGRA 2Z2SB 4ZU5A 4LUMA 4Q0UA 4FBFA 1FXZA 3SHRA 4HSLA 4HZFA 4FAHA 4XETA 2XLAA 5FLIA 1O5LA 4AQ2A 1XE8A 3FHIB 2GZWA 3E5QA 2OYZA 2ZKLA 1YLLA 4WZCA 3E5XA 2VQAA 3CL1A 4CYDA 1ZX5A 4EWAA 1Q3EA 1HW5A 4I0AA 5KHGA 1YWKA 3FZ3A 3KMHA 2OPKA 4IESA 2PHLA 1NXMA 4LUKA 2PAEA 5I8TA 4XFHA 3RYKA 3OF1A 1EYBA 5KHKA 1CAXB 4XF4A 5FPZA 4B29A 2FMYA 2BEOA 1QY4A 3QOPA 3S7IA 3USSA 2D93A 4BIFA 5C8WA 1J59A 4L2NA 4AVCA 3H1YA 2V09A 1CAWB 2P17A 4R8HA 3MZHA 4HBNA 3CJXA 3UKVA 4BH9A 4KWJA
chains in the Genus database with same CATH superfamily
1QMJA 2XJRA 4LK7A 5FPVA 1PVC3 2VCAA 5FO9B 1T6GC 2O0OA 3T08A 2WLPA 4IGOA 5F5AA 4BQ1A 1POQA 2IXJA 2CV6A 3BKZA 1LHUA 1WMDA 5KBFA 1XU2A 2E63A 2FCVA 1N3PA 3IPVA 3WG4A 1A78A 1NUKA 1SMVA 2F6BA 1ZZ6A 2ZJCA 2JG8A 1H9PA 4AI2A 3RS6A 2PLV1 2GNBA 4A44A 4RHV2 1H4HA 5T5LA 3AZVA 2ZMKA 3WW1A 4AWDA 2Y6HA 3AP4A 5FZAA 3CKHA 2DF7A 1UXXX 5GZEA 1ND3B 4MUVA 3H3ZA 1W6MB 3GF6A 3IIIA 3O0XA 4X6RB 4LXLA 1CAXA 3A22A 1M06G 1LHNA 5C3PA 4XZPA 5L9BA 2OXBA 1XNKA 3RZZA 2C0ZA 3UKTA 3CHXA 1KEXA 2RM21 4JTOA 1PVXA 1XNCA 2JECA 2XVKA 2XBO2 5CZKA 1OPMA 4E9KA 4Q4X3 3N4MA 4LO4B 4SLIA 4FO9A 2HWC2 2CAUA 3AP6A 3K3NA 3MLKA 4Q4V2 1RUF3 4XF1A 4MVTA 5FPXA 1LULA 2BWAA 3S7EA 1JYNA 3IAQA 1FPN3 1SQ4A 3LA7A 4HT1T 4IE4A 1CVNA 5FBZA 1EPZA 1CZTA 1PO13 3ZSJA 4NHXA 5DAXA 2ILMA 1HRI1 2Y38A 3H8OA 1GP4A 3JBG2 2JDUA 2JDHA 3J7NA 3WF1A 1LODA 2KXLA 3ZKUA 4DY5A 1UO9A 2AEZA 2AC1A 4NHKA 4ZZ8A 3B9IA 3HNMA 3T0BA 4E4HA 4GWIA 4AXOA 3TRSB 4ZXKA 1O3QA 3EHKA 1VBA1 3L2YA 5HPOA 1GANA 1R1A2 5IFPA 1J84A 5FTTC 1UMIA 4MLOA 3V0BB 1IG3A 3PU3A 1MEC3 4M4PA 1O7FA 1R64A 2GMMA 4JRLA 2XQRA 2RS52 4QGMA 4QHZA 1PMJX 1V9U2 2NLRA 4LBKA 2IZWA 1RUH3 5IHRA 1QIQA 2NM1A 1U0AA 1OHFA 3VZLA 3FHQA 5DUVA 4OMCA 1GP6A 2W1SA 1ZBA1 1F31A 3NAPC 3OJBA 2ZGTA 4DUVA 1UIJA 3WQBA 1WBFA 4Q8KA 2ZGMA 2CU5A 1RVF2 4ES8A 1XJAA 3D82A 1JOJA 3ZN6B 3PL0A 1X9TA 3LEKA 3UJOA 4CE8A 4NAMA 4OQ9A 1NCRC 4GWMA 1UL9A 1W9WA 5FXZA 1G9DA 3T4HB 3R4SA 4XDOA 1F4HA 3U11A 4V2VA 3ZX7A 2OT7A 4A7ZA 2CHHA 1JOBA 1DF0A 1S0BA 4OHXA 1W2NA 3I4IA 3PURA 1DZTA 2EF6A 4XOGA 3NNGA 4Z92B 4QKDA 5T50A 4NR1A 3LDBA 4AAXA 1JYXA 1VJ2A 1H1MA 5T55A 4AOCA 2UY9A 3MIEA 1RMU2 4COZA 2EA7A 2ZAHA 2VOVA 3ILNA 2WBKA 4CUAA 2E33A 1E5HA 4U36A 2E7QA 4UW6A 1H2NA 2HWE2 4BQ3A 1PZ7A 5I0RA 4IEZA 2FBEA 1TNRA 1VBB1 2BNNA 3D5OA 4WVZA 4Y20A 5LB6A 4K8RB 4DOUA 1X50A 1ZYBA 2A73B 4Y1XA 5FYHA 1WA6X 4B1LA 1VE0A 4BQWA 3DPRB 4H14A 4JCKA 1F2NA 5KC5A 4P00B 1U5IA 2BNMA 4NN0A 3GXUA 1NQJA 4XFIA 2ZGPA 3NV1A 3IDBB 4K8FA 3ZXKA 5CG8A 1QXJA 2B9UA 3NAPA 4IGPA 4DMIA 2OA2A 1HN1A 1SLCA 1VMJA 5TSWA 2WWJA 1L3JA 1ASJ3 5G04L 3OEAA 3FJSA 1G7YA 3MW2A 2WZ8A 4J1WA 4JQRA 2BGOA 2AH2A 4UF0B 3APBA 4PF1A 1V6KA 4UBHA 1QJU1 4BMEA 4CCMA 1Q8QA 3C7EA 3VDCA 2QQLA 3CJIB 3AB0A 4M3CB 3MGUA 5FUIA 4RR3B 5IVJA 5F5QA 1JU4A 4HL0A 4XJ8A 5IAVA 1XXNA 1AL0G 2WT0A 3ES1A 3R4DB 2XHNA 5FZKA 1JYVA 1DYOA 1PGL2 1UNBA 5A70A 1F5JA 2QQUA 4IEUA 3LGRA 3SH3A 2RM22 3I3EA 4RHV3 5M0TA 3OPWA 2IC1A 4AVTA 5GLWA 4N8MA 1RUJ1 4LNVA 4Q0VA 1ZZ7A 2Q1FA 3O5SA 2VZQA 4WV8A 3FMGA 4CP9B 4M4RA 4QD2A 2NZ9A 1LOBA 5JOYA 3BIWE 3WX5A 5J09A 1PIV1 1W06A 4QGLA 3WW3A 1A34A 2QQIA 4TLFA 3VBFB 2X09A 3W5MA 2PHUA 4FTEA 1UXZA 5EJZB 4B4QA 5LA1A 4TXWA 4DS0A 2XBO3 2VR4A 1NA1B 2DVDA 1D2QA 3ATGA 4EQVA 1W8WA 4ZXEA 2VZPA 2HWC3 4Q4V3 4AVVA 1Y9QA 3GDBA 4FPJA 4XQ4A 3H1MA 4XIOA 4X8PA 3AXDA 1GU3A 1PX3A 2KM2A 1K3IA 1NAEA 5HCBA 1ZVFA 3H7YA 4Z82A 1NCQB 3TNPB 3ZYJB 1IKQA 1LAJA 2PTMA 2JENA 1QJFA 5DG1A 5ACA1 4ARXA 4R9BA 1JU3A 1I3HA 1NG0A 1UD1A 1S0DA 2DURA 2R49A 2RS11 3IMMA 4Q27A 3BVCA 1ACCA 1YNAA 4TSVA 1FNZA 1D4M2 4UW3A 1R081 2WNVB 4L97A 3SISA 3VL8A 4DO0A 2WSUA 4LO6B 1IS6A 3ZYIB 5JWPA 2JIGA 5EYYA 1XYPA 3TN92 1RXGA 3GJBA 4FOYA 1O3SA 1R1A3 1ZBA2 4XFGA 1AYM1 5FY9A 3O14A 4PIZA 4XF3A 4XFAA 2VBBA 3AL6A 2WQ4A 3CZJA 4LHNA 1CAVA 1MACA 2VBDA 3FBYA 3HQRA 4PDWC 1JYCA 4QQLA 5F7UA 5J7MA 3GYDA 3JCIA 4KBBA 4FQ4A 3DXUA 3VDDB 4DEQA 1WMEA 4EN8B 2RS53 3OCPA 4B8EA 1Q8SA 1HV0A 3AYDA 2WR9A 3I3BA 3ZN4A 3FUQA 3F2ZA 1GR3A 1HXS1 3IT8A 3KV9A 3O0WA 3PJYA 3Q8BA 4GXLA 2CY6A 4IE7A 2GP3A 3WCRA 2FDHA 3KM5A 4HK8A 3VKLA 3QBQA 2DCKA 4C1XA 1SLLA 2Q0AA 4GIQA 4KU8A 4QX0A 1FT9A 2Q30A 5FPAA 5DAWA 1FAYA 2BVBA 3KGLA 1EY2A 3ZPYA 2VW0A 1VRH1 2ORZA 2ZGKA 5I0UA 3SXWA 5T5PA 4IEXA 5GLZA 1LCLA 1W8OA 3POJA 4JKMA 5F32A 2Y33A 1WW5A 2EXJA 2JJ6A 5F8PA 3OY8B 1Z78A 1XU1A 5DMYA 1VBB2 5FKCA 4PIYA 2VZ3A 4CEWC 3GZTB 4XC9A 1RUG1 1ULPA 3J9SA 2FDIA 4AEMA 1S55A 2HEWF 2R0FA 5FYIA 2ZGNA 3MW4A 1EAH1 3Q8CA 4PLOA 5EQUA 1OMIA 4D7SA 2A6ZA 1RMU3 5IT6A 1F5FA 3E5UA 3SMHA 1NLSA 3VKMA 4KQ7A 3ZKYA 3TNQA 5C5UA 2HWE3 2ZZJA 5FMDA 1STMA 2EVXA 4CUCA 1U5ZA 2KA3A 4PDWA 3ZFFC 1BLZA 3U4SA 3VD4A 4FOWA 1C5HA 1K12A 2QCSB 4MHRA 4WM7C 5IVVA 4HONA 2P3KA 4OZOA 4LLFA 1VR3A 1UZYA 2VW2A 2FDGA 5FFOC 1DG6A 2QNKA 4UFLA 1LOGA 2VMGA 4L11A 2AGSA 5A7SA 2VXJA 1HQNA 1XC6A 5HCFA 1TQ5A 4FPGA 1CZSA 3ZXAC 3K75B 3SLIA 4QX3A 2TEPA 3LIHA 4BPZA 4JVAA 1J1LA 3ZXFA 1CPNA 3I2HA 3I2OA 4AI8A 3KD4A 4ITCA 1C5IA 2PLV3 4IEVA 3SH5A 2WUHA 2ZMLA 1TVGA 5DZGA 3SCGA 2VULA 2QQVA 1RUE1 3N7MA 1POV0 4P9IA 5A3OA 5HV0A 4CCDA 2WFF1 4LR4A 1RUJ2 2RDRA 1DQ6A 3RZLA 1S2BA 1UKRA 3V56A 2GC1A 2YBSA 4YVWC 5F2WA 1PMIA 3LSDA 4CEWA 4CCNA 1VALA 4IE5A 5I8YA 2CWSA 1NT0A 2P34A 1WGPA 3GBGA 4NROA 5ABJB 2JKBA 1QDOA 2GNMA 2OIIA 5FQ0A 1JZ2A 2RM23 2PHRA 1QGLA 4UFHA 4ET7A 1UPIA 1R1ZA 5FYBA 5FREA 2B42B 3BU7A 3BGAA 4PHZA 5C6CA 3OUIA 1W6NB 4PJYA 2QQPA 3CLPA 3T2QA 5HXMA 2ZHMA 5C71A 5EV7A 5FYUA 1YEWA 3ZFFA 5I0DA 2GU9A 1Y9GA 2VECA 5LY1A 4NRPA 4WM7A 3DL3A 2D3SA 3KT4A 2O14A 3MEPA 1WLCA 2EXHA 1W8HA 2ZAAA 3ELNA 3WF2A 1GZWA 4LKEA 4PQQA 3SCHA 5BNPB 5K0UB 4YM2A 5ACA2 1HRI3 3WF4A 2DCTA 4QHBA 3P3PA 4COVA 4LOSA 3RYRA 1YFXA 4BWOA 1XNAA 4YWAA 4CCEA 4DXTA 3WR0A 5J1XA 5JOZA 1NX9A 4GWNA 3RI9A 3VUOA 3V0AA 1J58A 1UZZA 1HV1A 2VZSA 3T2PA 4CCJA 1R082 1OF4A 2UYAA 3OGVA 5KHJA 3BALA 5LW9A 1JBCA 1AR71 3RZHA 1KS4A 2DVBA 4ISRA 5L73A 1H2LA 1ENXA 4JDOA 2YY1A 5JIAA 4PCRA 3POGA 3ZFGB 5FP7A 1IS4A 4NJ4A 3ZFEB 4CSWA 1KITA 4YZ3A 5B2GB 1VBA3 1AXZA 5DUUA 4A45A 1AYM2 4UOJA 1REFA 1KQRA 3N7LA 1DFQA 3VHRA 2VM9A 3WP4A 4XF0A 3SC7X 4QX2A 2J1VA 4YVWA 4XAAA 1PK6C 1SCRA 4S2GA 3RZGA 2XKPA 5JXJA 5CKMA 4K1ZA 4CXWA 4W50A 1LGNA 1BXHA 4NPRA 3VBHB 2W2IA 3JB4C 1UN1A 4XIKA 5F2SA 3D4KA 5A7OA 1DGRA 3INAA 3PUAA 1VBC1 1ZBA3 1ZBE1 1HDKA 1GKBA 2G9FA 3NNLA 3Q8EA 4GKXA 4TWTA 5DAVA 1WBLA 2AYHA 4LUMA 4Y3OA 5FZFA 1D0GA 5SV8A 3KT7A 3ZSEA 4HSLA 1EUTA 4FVVA 4M3CE 2E31A 2WJSA 3LEGA 5FLIA 2WL1A 1VRH2 1RHI1 1ONAA 2OPWA 1OLMA 4LOTA 2ZX0A 3IPVB 3OGGA 4W4ZA 4CEYC 4WZCA 2WNEA 1LTEA 3E5XA 3NJXA 5LBEA 4C0HA 3RVHA 1BHGA 2JG8B 1ULEA 4NO4A 1Q3EA 3AKRA 2HBTA 2Y6JA 3TOJA 1KDMA 2BDRA 3FZ3A 3KMHA 2ZHNA 4IESA 3N9LA 5I8TA 3DYMA 2FHRA 4FP3A 4PT6A 4RGKA 1EAH2 2RDNA 3S57A 1H6YA 2QE3A 1JZ3A 2WA3A 1CAXB 2WWUA 3FFZA 1IOAA 4W6YA 1KGYA 4UW5A 3VD3A 4FPYA 1JUIA 2FMYA 2LTNA 4O61A 4XXPA 4W6WA 5DDJ1 2DU0A 4GH4C 2ZX3A 3USSA 1PK6A 2VUDA 4EN6B 4FPFA 4FOVA 4BK5A 5LZ6A 2R1DA 1GOFA 4JQTA 5CBLA 3CU7A 5FBJA 5FZGA 1K42A 4K40A 1W2AX 3LEMA 2DVFA 3USUA 4IE0A 3AP7A 1LOEA 5C70A 1ZA4A 4UYBA 4AGRA 5L9RA 1S0CA 5FP3A 3KS7A 2Z5WA 3J7HA 5A3UA 3UNPA 2W3JA 4QXBA 2JB4A 4XZUG 1DGWA 1QJU3 4KGQA 4M00A 2D98A 2OZJA 1RUE2 1T6BX 2UURA 5JSRA 4CEYA 3KHCA 2MHFA 3C8XA 2Q8DA 5JIUA 1JYWA 3U0ZA 4R9DA 2JWPA 1ODNA 4C90A 3P3NA 4HK9A 3WNKA 1YC61 1UKGA 4OHVA 3NKGA 4ZKTB 4QB6A 5IVBA 1MVQA 1UWWA 4ARYA 5CADA 4Q4X2 5F1RA 4OZXA 2F17A 3SNMA 2UY8A 5FKBA 1QH7A 3HN3A 1RUF2 2WKKA 3DYPA 3H0OA 1ODMA 4LBQD 3JXSA 2VMCA 2ZPXA 4XAEA 4NMIA 2VCCA 2D6KA 2JE8A 5I0SA 4Q4Y1 1RUJ3 4QX1A 1AXYA 4G9SB 4QKNA 3S5QA 2PHDA 3R6SA 1JODA 5A1LA 3B00A 1PIV3 4GH4A 1I5PA 3K4ZA 3GALA 4QPGC 2XJUA 1CAWA 4BHPA 1JZ5A 3MO4A 1V0AA 4AFAA 4RD7A 3I2IA 5BNNC 2Y6LA 1W04A 4INDA 2WC2A 3ACHA 3OG2A 1UOFA 2W68A 5T3NA 1E5IA 1JH5A 3WDTA 3KLSA 1KXGA 4FT8A 2AR6A 3TEXA 1AR72 2PHTA 2IXLA 3N3HA 1E5RA 2W1WA 3POFA 4QWNA 4AFMA 5ACA3 4LJHA 1SPPA 3ZSLA 2RS13 1WW4A 2B4KA 3FLRA 4YNIA 2CL2A 4UT5A 2QZ3A 2XONA 4YFWA 5JSOA 3FLPA 1YFWA 5A6QA 1R083 3KF3A 2JE9A 3FHAA 5FZOA 4IL7A 4XTMA 5DPNA 5JMCA 3VDBA 3FC0A 4XFBA 3ES4A 4AF9A 4L92A 4WZFA 3E6CC 4WVVA 4Y20B 2CWMA 2IXHA 1VB2A 1WLTA 1ZBE2 1AYM3 2GAUA 4RGGA 1PO21 2UYBA 3HIFA 3VHPA 3A0NA 3OGRA 4NPMA 2C1FA 1X9PA 5KHHA 3BI3A 4DZGA 4E8CA 3MFAA 4YGDA 1HRV1 4AK3A 5FYYA 4GB31 3NAPB 2ARXA 4QPGA 3T2OA 5JR2A 1H8TC 1RHI2 3E97A 1HXS3 2VGDA 1XE0A 3FFQA 3K77A 2B5HA 1REDA 3ZYPA 3LDRA 3ACFA 2JG8C 1N3OA 1AX0A 5BNNA 5GKAC 1BEV1 4YG3A 5FZ7A 1W6QA 3VD7A 4AHWA 4E4ZA 5A3LA 5E16A 4META 3O1TA 4TZDA 1WD4A 1CJPA 3CQOA 2AREA 3RYPA 3X29B 1ZRFA 2P4EA 3E1F1 1OFSA 1RUI1 1BQPA 2YDEA 3PNAA 1S1AA 2WO3A 4CP1A 1SBFA 1VRH3 4FXGB 4D94A 1YCIA 4MADA 1CPMA 1D0HA 3HBZA 5FMOS 2HYKA 5HCAA 4LKDA 3RSJA 3BODA 3GHNA 5T5JA 2BBVA 1SDWA 2BW8A 3B7MA 1HB2A 1H2KA 2WNOA 4IV1C 4Q29A 1Z7S1 2Q4SA 2GMPA 2ZCWA 1QDCA 1YQ6A 4BQ5A 1QXRA 4TN7A 4CPBD 1LU1A 3NMBA 4YW5A 2ARBA 1RUG3 4YZ5A 1D7PM 1BYHA 4URTA 4CA9A 3FL7A 4IE6A 1VAKA 1DGWX 3ABZA 1EAH3 4J25A 4JTNA 4AAPA 4AEDC 3S0MA 1G6NA 2W47A 3AJZA 4QQHA 3ZIWA 5KXEA 1ASJ2 2Y6GA 1JN2P 1VB4A 2ADEA 3N9QA 5C3QA 4C1WA 2VZ1A 3ECQA 5BPXA 2W87A 4Y5TA 3O1PA 1LB2A 1DGLA 4E2QA 1Q8PA 1MS0A 5JXIA 4Y1YA 2R061 1VP6A 2X5IC 1IS3A 4CDWC 5A3PA 2YBPA 1SCSA 3WHUA 1H8TA 1POV1 2DU1A 4FTSA 1XSQA 1HQWA 1OQDA 1TEIA 3T0AA 3AFKA 1MS3A 4FTBA 1LEMA 4YM0A 2YPDA 5FPUA 1O8SA 4XHBA 5EP9A 4CTEA 3NSTA 3AMPA 4B7EA 1YIPA 2ZABA 1UMZA 1UOGA 5GLVA 4COWA 4MZUA 1ND2C 4CDXC 1XSRA 1OD3A 2W08A 1AX2A 1RUE3 5GLUA 1UPSA 1OH4A 5JCTA 1E5SA 2WFF3 3B01A 3I2GA 1FV2A 1UW8A 2VMDA 1ZRDA 4Q26A 1IG0A 1SLTA 4MGZE 2Y6FA 3MIGA 2PYTA 4IV1A 4PI2A 3OBRA 3R4UA 4LE3A 3TYJA 3O1UA 3WG3A 2I07B 3VBOC 3KCCA 4RFT0 3BU0A 3ZSMA 5E6HA 1CAVB 3DUIA 4AEDA 4ASKA 3LQCA 1NY71 3POWA 1L7LA 4CDQC 3AMHA 3BOPA 3DECA 1DGRN 2VZRA 1UY3A 3KGZA 1IPSA 2ARAA 2ZTNA 5FY1A 4FPLA 1OLQA 1ENRA 1CJDA 4YVSA 4YW7A 3GBWA 1ST8A 2LM3A 4A7YA 1VMHA 1G9AA 2VPVA 1KDKA 4MSVA 4V2WA 2EXIA 2D6PA 2R041 2X5IA 3SKVA 4CDWA 2ZHKA 4D7TA 3PUQA 4CP0A 4Q0SA 5FOBB 4YG6A 1SEFA 4F3JA 1SZBA 2Y0IA 2YYOA 1BK0A 4LQRA 5GLTA 2CSGA 5FCCA 5BNOC 1L7QA 1UIKA 4MGKE 2WFPA 1TMF1 3KV6A 1EUUA 1LRHA 3WUCA 5BV6A 5C33A 3BN6A 4NIHA 1AR73 4XUNA 3E6DA 1OI6A 2ZOEB 4Q8LA 1LU2A 2OQ7A 4PBOA 1JZ6A 4G3YC 2K46A 4NIDA 1AXKA 1X33A 1B09A 4HLTA 1ND2A 3KHBA 4IUGA 3W59A 3KCXA 4CDXA 2E32A 1AR61 2RR11 4HPKA 4QGNA 4XBQA 5AC91 1J3RA 3P6BA 5D8AC 4AG4A 4AW7A 1PO22 2JE7A 3OTFA 4V1PA 4DUWA 3NV2A 3NJYA 5FLJA 1W9SA 1S0IA 1HRV2 3VZNA 5JPNB 3VBOA 3WNNA 3BIEA 3OSDA 4HANA 1E57A 2PHWA 1W0PA 1WA4A 5DZFA 1VBE1 5JSPA 2GMEA 4PDWB 1GMMA 3CO2A 4ORFA 4FOQA 5FZEA 1VBC3 4CDQA 1ZBE3 3AKSA 5FZ9A 4JC1A 1RYYA 1BEV2 3N35A 5FAXA 1SLBA 2CGPA 1UMHA 2BFUL 5GZFA 3U14A 5GM0A 5FOJB 2WN2A 3OUHA 4AI3A 5T52A 5F39A 5A3MA 5A1FA 1RUI2 4IEOA 1DQ1A 2BRTA 2P6HA 3ACGA 1OUXA 2IUWA 3IDAA 1ULCA 1GV9A 2F4LA 1RHI3 3M7AA 4GKYA 3WLUA 2Z4FA 1CX4A 4RA0A 5IFTA 3BTAA 4HXCA 3WUDA 3FWEA 4FFHA 4I3PA 1XB9A 2QTWB 4DRRA 5IK8A 3O7OA 3VKOA 2Y8KA 3GHMA 5BNOA 1KD7A 4EROA 1G8WA 4KWKA 4ONUA 1GWKA 4M3CF 1X82A 4NRQA 2W5FA 4NPLA 5DQ0A 3UT0A 4AHYA 4CRQA 2XWBB 1NQDA 3S30A 4HVQA 3M70A 1YQ8A 2BWCA 1I9RA 2F4PA 2ZBJA 2GN3A 2IXIA 4K3UA 4CEWB 2LUWA 1ULGA 5A7PA 3CEWA 1CESA 5FQ0B 4IETA 2XLFA 2FMDA 2VAUA 2BUKA 4ISQA 5D8AA 4QQOA 3A21A 2VO5A 5DDJ3 3C7OA 2P3IA 2VMHA 4RN5A 1MQTC 1YHFA 1IPJA 3W5NA 3UK9A 4NAOA 2R062 2XJSA 2L9LA 4DINB 1JZ7A 1W99A 2QQJA 3I59A 2YUEA 1U12A 1WCKA 3N7KA 3IIAA 4W6XA 5LRRA 3ZFFB 5CFDA 3NNJA 4QM9A 4RS5C 4WM7B 2C9AA 3H9AA 3WT3A 1BMV1 4AHZA 3DKQA 4UBGA 1GZWB 1UYXA 3NVCA 2PLV2 1OFNA 3WXPA 2ZEZA 4AVBA 2MEV1 2BNOA 1YXWA 2QDRA 3AZYA 2DFCA 2VNRA 3SCFA 2WO7A 2PHFA 3M4FA 4MGYE 4LPLA 4QMAA 3DKWA 4YGCA 3V0AB 1TZOA 4YW4A 1AL21 4RQPC 4MGSA 5L7OC 4XE9A 4N7UA 1BK1A 3PHMA 4P9GA 3GBFA 2Q1ZB 4BE3A 4JX0A 2A6VA 2RE9A 1YJLA 3M2MA 5CB7A 4HN1A 1HJGA 4A3ZA 1W39A 2E51A 1SLAA 2HWB1 5I8SA 3ME2A 1EV11 3OD0A 1SFNA 5C3SA 4K20A 4AI9A 3JQXA 2G1MA 2EICA 4SBVA 4ZHNA 4QPIC 4YVWB 4OHZA 2AACA 1V6IA 3VZJA 1VPHA 4Q4Y3 5A7WA 2JG9C 3C7FA 4EN9B 2VD7A 3OGJA 2JD9A 1GZTA 1UZ0A 4QT6A 2CYFA 2WO1A 3URFA 2H0BA 2VOXA 3VHOA 1UOJA 1WZXA 1IGOA 1MQTA 1HRI2 1QEXA 2V73A 3AZZA 5AVPA 3W58A 5CVRA 5CFDB 1NE4A 1ZA7A 2DTYA 3IM0A 4XABA 3J4UH 2R042 3VN4A 3AX4A 2C6SA 3GZAA 4LBQA 5A3WA 3VZOA 2Y34A 1V00A 1AYN1 2WSVA 5FDBA 4NIGA 2CDPA 3MHZA 3POSA 4OHWA 2WS91 4RS5A 1C4RA 4GJZA 1V6JA 1F4AA 3J7LA 2BVVA 1DHKB 3DEMA 3CNAA 4BYYA 4IXLA 4TTGA 1YFUA 1JS9A 2VZTA 3MUZ1 3VBSC 1VBA2 3KV5A 4FPKA 4IEQA 5B4NA 1LOAA 2YROA 3BYWA 2NMNA 2JD4A 4OUMA 2JICA 3RWNA 3I2KA 5J98B 2KD7A 3J8F1 1WLWA 4Y1VA 4YW2A 5H9RA 1RITA 2RR12 4RQPA 1AR62 5AC92 1OLRA 3T1LA 5L7OA 2ZX2A 4P9YA 3NO8A 2OUHA 1UZWA 2ZGUA 4AE2A 2WRAA 5FZ0A 1QJX1 2OQ6A 2JDZA 3B02A 1W0NA 3WNXA 4F7ZA 3PDQA 3DYOA 1AJKA 1VBE2 5E88A 5CYYA 1J3PA 4QPIA 1PK6B 2AZ5A 2QQWA 4R4ZA 2G9GA 2JG9A 2JX9A 1PO23 3THTA 4BXFA 1Q5OA 1RJ8A 2PHXA 2Q5TA 1W6PA 3B93A 4KU7A 4BQ4A 1HRV3 3LB9A 2B9VA 5FV3A 3Q9OA 1OKQA 3USUB 1YIFA 4GB33 4MXWA 4ZU5A 4LK6A 2HLEA 4FBFA 1FXZA 2XJVA 4KBZA 2W92A 4AVSA 3LPGA 3AMQA 2VTXJ 2RHPA 4AQ2A 1BEV3 3FHIB 3ALQA 4HOOA 3Q8AA 3V65A 4CEYB 3MBWA 3VBSA 5JMOA 2VQAA 1RUI3 3GZUC 3CL1A 2Y6KA 1DIWA 1W8NA 3VDAA 4MGQA 3HPNA 4MXVA 5KHGA 1HW5A 1N47A 3AP5A 4I0AA 1K5MC 5FYCA 2WLQA 5J37A 5FZ8A 4BB3A 4Q4W1 3HBKA 4LUKA 1HN0A 2PAEA 3RJRA 2QQKA 2YU2A 1Z7S3 5FYZA 1RINA 1JHNA 5KHKA 4JGZC 1KRIA 2Y26A 2EAKA 2J1EA 1IZ3A 4B29A 5KC6A 4QB2A 1F8VA 5JZGC 1COV1 1QY4A 3A4UA 2WZPP 1CONA 2D3RA 2D97A 3CBNA 4GH4B 4EYUA 2AUYA 5C8WA 2R6QA 1UF2C 4E8DA 1BMV2 2XR4A 5CKQA 4WVWA 3Q8FA 1CIYA 1CAWB 1W2UA 4P5HA 2JXAA 3MZHA 4CPBA 4HBNA 1QJU2 1XYOA 3POBA 2ZX1A 3M3OA 2MEV2 3UKVA 4AGVA 2R063 1D2SA 3JU9A 4Q1PA 4XMAA 5FWEA 4BQ2A 5F3CA 4AEKA 2K0GA 1POV3 4AFBA 3ZPOA 3D3AA 1AL22 2CAVA 5IK4A 3ASIA 4LO8A 2ET7A 2RDSA 4DEVA 1BVVA 3IN9A 1APNA 4S2HA 1S2EA 2ZMNA 2MNGA 1W9TA 2YFUA 4EJRA 4DY3A 3WQ0A 1SPPB 3A7QA 3AC0A 3D8CA 1OA2A 1ULDA 3HOBA 1XNBA 2BFUS 2ID4A 1KFUL 2HWB2 3AVSA 1DYPA 1EV12 2K2SA 4NHMA 3VZKA 4LO7A 3MLLA 3KCYA 1K5MA 1OBNA 5EHDA 2VMIA 4Y4YA 2XXZA 1PIV2 4NWVA 4JGYC 5FZOB 4A41A 1A8MA 1QOTA 4N43C 5DXDA 3KV4A 4D3WA 4XJ9A 4XUOA 2XOMA 3WF3A 2WA4A 1CQ9A 5CFDC 4L0PA 2GC2A 4JGZA 1FMD1 2XJPA 4XQDA 2D5FA 5DUXA 4AEJA 2B8MA 3DCQA 4YG0A 1GICA 4PQ9A 2FDFA 1AYN2 2RS31 5JZGA 5FPBA 1LHVA 2XJTA 3AFGA 4LTAA 4BZ4A 3U75A 1NXD1 5A3TA 1PX4A 2QQMA 2ZGLA 4YGBA 1IQDC 5C4WA 4QPGB 4GALA 1UU5A 1SDDB 3HD8B 4BLJA 1OT5A 4FAGA 4UFJA 2ZKNA 4M0HA 4ASLA 4YYOA 2RS12 4DPNA 5BNNB 2R043 4JV4A 2J42A 1L7RA 3J8F2 1W6QB 2LROA 4QQPA 1FX5A 1TME1 3PVNA 5LBCA 1GYKA 4C91A 4DRVA 3NJVA 1HIXA 1WMFA 2W1UA 4J1XA 4ZS3A 3GNEA 2VUCA 1QOSA 2CTVA 3I54A 2A3XA 2W95A 1TMF3 1SLIA 1QOOA 1W2TA 2DTWA 2FDJA 4UW4A 2QZ2A 4XBLA 2P6CA 3IMNA 1JXNA 5F5CA 1UYZA 1RTVA 3VV1A 3I7DA 4R52A 4R9CA 5FLHA 5IW0A 5CFCC 1TG7A 2JDYA 3IAPA 3VB9A 1LJ7A 1S4CA 1VMFA 1AR63 2RR13 3ACLA 5AC93 1OVSA 4JGYA 2D43A 1GNYA 4N43A 1B35C 1AJOA 1HXS2 1PM7A 2WO2A 3OGSA 2OZ6A 2D3PA 2ZGSA 1A8DA 4XHXA 3NNMA 3ZMOA 2B39A 2WAAA 3AP9A 4LT5A 1S0GA 3AXEA 2YBKA 5BXXA 1VBE3 3M3EA 5JAXA 2YC2A 3P5BA 3HR9A 4Q5OA 4B4RA 2EXKA 2FD8A 4Z07A 2P1BA 2A1XA 3ZR6A 3UL2A 3PLQA 4FFFA 2XWJB 4Y22A 1OA3A 4QX7A 2IFRA 2W1QA 4RFRB 2R7EB 5DAPA 3HMYA 4XQWA 3D0SA 5FXXA 1H8TB 3BB6A 3WV6A 1O3TA 4N53C 1UY2A 2WINB 4Y33A 4F83A 4Z1VA 3POIA 4ZU4A 5JR7B 4QXCA 3W9AA 3SH4A 4JAAA 1ALYA 4EN0A 4GMP3 5CKNA 1CGPA 3HNBM 3VKNA 2YG0A 3HAGA 2VZOA 4K6BA 4MOAA 4IV3A 4CXXA 1G9BA 1RUG2 5C9AA 3KT1A 2WQ8A 4H2AA 4XCAA 3ZVXA 1G86A 2VUAA 1QQP1 3NKTA 3IKWA 1KJRA 4OFGA 3BTXA 2RJLA 1DQ2A 4AZZA 1F15A 4U2AA 1COV2 2VUJA 4IV1B 5FIXA 5CFCA 1C1LA 5KWRA 2DUOA 4NVPA 4QHOA 3WDXA 3AZWA 3DV8A 1DP0A 3ACIA 1LOFC 4AEDB 1B35A 2XHKA 1CIWA 2O1QA 4K7JA 1F9KA 5A80A 1BKZA 5GZCA 3AMMA 2HJIA 1V6MA 4QPWA 4XJZA 4YVSB 1ZRCA 4XEZA 4LULA 4TYSA 5CNAA 1OLME 2WNUC 1K45A 1WW6A 2W52A 5D1IA 2IWGB 2DCJA 2V4AA 1RXFA 2X29A 3HNYM 3NQHA 4NHYA 1X8MA 4O9EA 5EWSA 2X5IB 4AI1A 4CDWB 4DNYA 3LA2A 3S6PA 4O65A 4F8AA 3T4VA 4N53A 2DVAA 1MZEA 2LW8A 2MEV3 2TUNA 3ZYRA 2QJVA 2WFF2 3VLBB 2JEMA 3K48A 4KWUA 3WP3A 3GM8A 3HVDA 3ZYGA 2XL9A 3VD5A 1AL23 2VNVA 3QH6A 5E89A 3UGFA 2WAOA 3UJQA 2PQSA 5JOXA 1GQPA 2D7FA 2VVFA 5C5TA 2ET1A 4KI5M 5FZBA 2QBXA 1TE1B 3N9OA 2NMOA 4WM8B 3PVOA 4LIUA 3HT2A 1ND2B 4J6GA 4CDXB 3EO6A 2W91A 4B7KA 4HPKB 3FX3A 1O5UA 2Q8OA 1FMD2 3ILRA 5BNQA 2HWB3 5IVEA 2A6YA 1EV13 1NOVA 3GCWA 5GALA 1DZRA 5SV5A 2RS32 3MUY1 1CZVA 1C8M1 2VQ0A 3I2FA 4FPOB 4E4DX 3O1OA 3VBOB 4HSJA 4JZRA 1ZRRA 2WWSA 3MV01 5FXWA 1SBDA 5FP4A 4YFZA 1DYKA 4FXKB 1LOFA 3AK0A 4FQZA 3THDA 5C8CC 3T1MA 2J22A 4CDUC 4CDQB 5DN2A 1VBD1 5LA9A 4IGQA 4I30A 1O4TA 4FFGA 4QB1A 4QDSA 4HVOA 4K9SA 1SG3A 1UU6A 1TME2 2JDMA 1AYN3 2B7YA 2QDNA 3H3LA 3LEIA 2WNUA 4LMFA 3THPA 4QDRA 1YUDA 4CZSA 1W6OA 4LBLA 3UGGA 2WS93 4KNCA 2XUEA 2DUQA 2YC0A 1ENSA 4ATFA 3ZXEA 2DDUA 5FYMA 1I5ZA 4XJUA 5FY8A 2C9KA 2X8KA 4M0NA 1O3RA 5BNOB 2PFWA 5EFUA 5F9TA 3J8F3 2Z69A 5EXOA 3WW4A 4NRMA 3H7JA 3LFMA 5A6XA 4BQYA 2V72A 4PLMA 1QJX3 3MPPG 5H9SA 3JBG1 4FFIA 4OI2A 4KMQA 1VBC2 2XG3A 2HWF1 1LHOA 5LCWL 3K46A 4CCKA 1GNHA 3EMRA 5D8AB 1J1TA 4JDNA 4N7IA 4XTPA 1HX6A 5E1RA 4UFIA 2A3YA 4Y4RA 1SACA 2DFBA 1GQGA 5A6ZA 3VBUC 4RL7A 3UKNA 4PBPA 3I59B 4WBBA 5JDBA 4QAWA 2AENA 5FP8A 5IK7A 5C8CA 4YSFA 1RL3A 2UU8A 4H7MA 3RZJA 4CDUA 4QQ2A 3BPZA 5F3EA 3OYWA 1CAUA 3RWKX 3KWVA 2VCMA 4OULA 3IDCB 4CCCA 1UOBA 3UESA 3MFCA 1YQCA 2TNFA 1V9U1 4QXHA 1NZIA 3ILFA 3N36A 1BCXA 1H4GA 4DIQA 5J96B 3M8LA 2A5ZA 1QQP2 1OXCA 1QU0A 4BJ0A 2VOKA 4DFSA 2XMLA 1YJKA 2JDPA 1OD5A 4W8JA 4CXYA 1MZFA 5C7GA 3PJQA 1FV3A 5CU1A 2EALA 2OS2A 4UXAA 3VBRC 3G6JB 1RVF1 1XE7A 3I3DA 3KSCA 5DDJ2 3O1RA 4XBNA 4FPHA 4Q4W3 5C3OA 1GQHA 1LOCA 1CN1A 2WN3A 5AVAA 5LATA 3ZDVA 2WZR1 1I6XA 1YRZA 3K4AA 2BOIA 2QFEA 4G4FA 3WHTA 3OBTA 2BP6A 1V70A 1US3A 5A7WB 2GC3A 3CF6E 4YVSC 2PQQA 1R091 3ZLIA 1UY1A 1COV3 5LBFA 3NL1A 5JOWA 1MQTB 1WD3A 5EPAA 4LKFA 4JRAA 4Z2WA 4Q2FA 4K1YA 3MPBA 3BCWA 4XW3A 3VBUA 3SQOA 2VQTA 2P3YA 4D7YA 1AX1A 4LBQB 4YZ1A 3QACA 5FY7A 4EV0A 4XUTA 2DV9A 4RS5B 2D6OX 3AVRA 5IWFA 4BLIA 4YRDA 2QQOA 1SHWB 3RGBA 1W9FA 1DBNA 1PGW1 4R9AA 1UX6A 4COYA 1LESA 1NKGA 2UWAA 2WZEA 4XFCA 3T0DA 3H3UA 4S2DA 2XH6A 3I3QA 3ZIXA 2ATFA 1GUIA 1OVPA 2VZUA 2GH2A 4LEJA 2BJSA 3WSOA 3WZ1A 2N7GA 4L9BA 2ZX4A 1LECA 1MS4A 2R071 2RG4A 4WM8C 2XL7A 3AYEA 3WP5A 4E4SA 1US2A 3NWKA 3EQEA 4RQPB 5L7OB 2WQZC 4Q4Y2 5A33A 2D6MA 2W0XA 1AZDA 3EB7A 5FZ6A 2NN8A 2P37A 1ZZBA 4QX5A 3VBRA 1C8M2 1WCDJ 1H1IA 5DAQA 4GZ9A 3WY6A 3B69A 5FK8A 1IS5A 1OOPC 2YGMA 1BBT1 3PIGA 3MDPA 5I93A 1UCXA 5IVCA 3ZYBA 4JHZA 1PNGA 4HN0A 1QH6A 3CZUA 2D44A 3C3VA 2VBPA 4QPIB 4QXKA 1X8EA 1FMD3 1V6NA 1VBD2 2UWCA 3JD71 4LKSA 3N7JA 2JG9B 3ZMNA 4XYXA 4ES9A 2E53A 4NHLA 3WNMA 1OA4A 2W46A 2ADDA 3IWZA 1QNYA 3MIDA 2RS33 3POYA 1W6PB 2E26A 2XKOA 1N1TA 2CGOA 4KL1A 4QKFA 3D0JA 1JYIA 1PGL1 4YW1A 2XGXA 2X10A 4P9LA 3VL9A 2GNTA 2JIJA 3O0VA 3PU8A 2BYVE 4MXWB 1FNYA 3H50A 1ZZ8A 1N1YA 3H8RA 2OKXA 5GJ6A 4AQ6A 4CU7A 5L19A 2EAAA 1LENA 1CX1A 1Q8VA 1TME3 1XQNA 3ZDSA 3E6BA 1Y7BA 3VBSB 1UX7A 4AFDA 3O1SA 1GWLA 2HWD1 2R1BA 4MGIE 1QWRA 1Y4WA 2ZGRA 4R4XA 2NP0A 4X8NA 4BMBA 4H55A 3C7HA 3R0RA 4WM8A 4NIAA 2VTFA 3WDYA 3KQRA 4UI9L 4ZZ5A 4QU2A 2HWF2 2YPJA 3K4DA 3WNLA 4YM1A 4QKBA 2NPIA 1W9YA 1DDLA 5G05L 1LR5A 3WG2A 1YYNA 4GB32 5F5IA 5EIYB 1LGCA 1OOPA 2D40A 2ZGQA 3LAGA 3SITA 3J7MA 2YZ4A 4BISA 3N9MA 4IERA 3TEYA 2VW1A 2VOTA 2B46X 3JUUA 1X7NA 4XCBA 2Q8CA 4DXSA 3KB5A 1DLLA 2VH9A 5LEKA 2TBVA 1D4M1 2E7AA 3S5AA 5CA6A 4DXRA 4QU1A 1QJY1 2BU9A 2ERFA 1MS1A 1AF9A 2Z2SB 1CR7A 5DUWA 1HQLA 3K2OA 2GSYA 2VMFA 3SHRA 3QH7A 3TN91 1O4ZA 1Y43B 2EIGA 2A6XA 2LALA 3KVBA 4AI0A 4HZFA 1WCUA 4FAHA 4XETA 3CIHA 4YZ2A 2ARCA 1O5LA 2WABA 1WMXA 1XE8A 3UV9A 1Z7S2 2SLIA 3E5QA 4IW3A 3VHNA 4I3GA 4XURA 3AJYA 2ZXQA 4AL9A 4N90A 2WZR2 3IB3A 5FK7A 2OX0A 5T54A 4CYDA 4BK4A 4EWAA 4LO5B 1HKDA 4Y1ZA 3ZOIA 1QQP3 1K5MB 1U5YA 2ZEXA 5APAA 2OPKA 3AMNA 1QNWA 3DGTA 4Z2AA 1XNDA 3UETA 1IQAA 2VZVA 3EXUA 4BQXA 4D6SA 1O4YA 1PGSA 1R092 4FSJA 4XFHA 4BCUA 3RYKA 4LBJA 4P08A 1QXPA 2V5DA 4MHUA 4XF4A 2RJKA 1SBEA 1ZM1A 2WYFA 4JGZB 3NV3A 4UAPA 5FPZA 4Y1UA 2JKXA 1OQEA 3ZN5A 2BV4A 2BEOA 5EJ3A 1OURA 5L36A 5JZGB 3ZR5A 5IVFA 4L2NA 4M01A 5DZEA 4AVCA 2ZEWA 2V09A 5C4WB 1PGW2 1S0FA 4WVMA 2VE1A 2Z42A 3WQ1A 4QDQA 2A7AA 1V6OA 1YI7A 2RVAA 2V4VA 1H30A 1UAIA 3WQ7A 1WCSA 4BA6A 4KWJA 2J7MA 1FOD1 1H2MA 2CNAA 3CDZB 1ENQA 2R072 2DCYA 4NWWA 4LA3A 5F3IA 1GBGA 2VL4A 5AFBA 5KHIA 1MPXA 2YXSA 4DB5A 2BGPA 3MI8A 1OSGA 3T09A 1H9WA 3IBMA 1RUC1 2ZS6B 5A32A 1XPWA 1MS5A 3LZZA 1ZNPA 2R16A 4OHYA 3ZM8A 2GP5A 1REEA 1O8PA 1W8FA 5IUQA 2H0VA 3IDEA 5GZGA 1BBT2 5B4XA 1NCRA 1QF3A 3PUIA 5FZ3A 5FY5A 5LBBA 4CCOA 2VXRA 4P9XA 4PIXA 1NY72 2GNDA 4LHLA 2I2SA 5FXVA 4EZHA 1RUOA 4D6RA 2OW4A 2QVSB 3JD72 4JGYB 1ND3C 2BZDA 3B3QE 2GC0A 1HB4A 4N43B 4GAZA 2FQPA 2WIIB 4Y26A 1SFPA 3WD5A 5CG9A 2YGLA 1C8M3 4MYEA 2ZEYA 4BOWA 2I45A 2VVDA 3EJKA 3PMSA 1H1AA 1NLRA 3HN1A 3OB8A 3ZSKA 1M4WA 3I2JA 4GQ7A 4B3NA 1XNTA 1IKPA 2ETEA 4FCAA 1YFYA 1H8VA 2IVJA 1C57A 3VKFC 1Q43A 4NUBA 4OLLA 2ZHLA 4CU8A 2O8OA 1VBD3 4Y22B 1IHMA 2V5YA 3M3QA 4LBMA 1TMF2 3MV11 1XOYA 4YZ4A 4UFMA 2BPA2 1BVP1 4AGGA 5FY4A 1DLCA 2EIEA 2HWD2 5ERLA 4N9IA 1N3QA 1ULOA 1RC6A 4HG6B 5BY5A 2ES3A 4IV3B 3TBDA 2G9ZA 3PTRB 4A3XA 5IAXA 1UQXA 4PI0A 2BERA 1JHJA 3AZXA 5C9AB 3FE5A 2D5HA 3HT1A 2J1UA 3QCWA 4JKKA 1AHSA 2G4IA 1MR5A 2GH8A 4FPCA 3ORJA 1OC1A 4L8QA 5JVVA 1PNFA 4HETA 5FZIA 2FCUA 3WG1A 1WW7A 1LHWA 5FPLA 4MH0E 5CFCB 1GP5A 3LFIA 2FDKA 3JBG3 3VD9A 1W0OA 1S0EA 2Z79A 1RUNA 2HWF3 5KXBA 5HCHA 1OPOA 3RG0A 1ND3A 3WNOA 5JUVA 1C8NA 3TEZA 1W6MA 3LIGA 1B35B 2C5DA 3EBRA 2BQPA 1QJY2 1FI2A 4IDZA 1NZCA 2RJ2A 3BOWA 1PMHX 2PN5A 1P8JA 2LS6A 4DQAA 4YGEA 2C26A 2YV8A 1WKYA 3UYJA 4OI4A 2H6BA 3ZXDA 3U07A 4XILA 5K8SA 3BUCA 2YU1A 3ETQA 4N53B 3I8TA 4XJWA 1V9U3 2ZA9A 3H42B 2XLGA 3KVAA 3MICA 5FYSA 5H9PA 1GWMA 2UWBA 5F37A 1H6XA 4D69A 3B5LB 2IXKA 4BXSV 4MX3A 3K51A 3WINE 3KZ4C 3JQWA 3CMGA 1URXA 3HQUA 3I3MA 3J26N 1F35A 2YMZA 3LSEA 1YQ5A 1RVF3 2MPFA 1N1SA 1OUSA 4I09A 5FJKA 4OUEA 2VVEA 4ZU7A 4P5YA 1OKOA 2FZ2A 3RMXA 2RMU1 5FRAA 2SBAA 2WZR3 3WP6A 1AR81 5FMCA 4L99A 5JI7A 2ENRA 3HQXA 1GZCA 2E6VA 3OOXA 5A6YA 2XDVA 1RUD1 2BTVC 1Q56A 1VRBA 3MIHA 1PZ9A 1Q8OA 3OBZA 4MO3M 1PHMA 3V0BA 3PUSA 5C4WC 1R093 4HFSA 2RDQA 1AR91 2W9XA 4GULA 4BM8A 3BTYA 2R32A 1GLHA 5HBAA 1GNZA 2CGNA 4I2OA 1PM4A 3DPRC 3FBMA 1FOD2 4BU2A 3BPSA 2OUJA 4HKLA 3ZXJA 4OQ8A 5D21A 1MVEA 3B9CA 1CWPA 2WNUB 1W6OB 2XJQA 3H8UA 4XXAA 4XUQA 3AYCA 4S2FA 1W3VA 3L2HA 1DZQA 1RUC2 5C3RA 4MG2A 1JW6A 1PVC1 3WOGA 3M1HA 5IVYA 2PXJA 4OCTA 3OEBA 4EZ4A 3P1IA 3ZN6A 4IQPA 5FP9A 1FATA 2VG9A 3PVBB 2R073 3O1MA 2YFZA 4JKLA 3GJAA 4Q0QA 1W03A 2Y64A 3CJIC 4Q1RA 4XACA 3U10A 1V6LA 2P3JA 1UY0A 1MS9A 3MLJA 4XMIA 3RQ0A 4RR3C 1DU3D 3BTZA 4HKOA 2FZ1A 2WYSA 5KXCA 2A75A 1C1FA 3JB8A 2PAMA 2IFWA 3SKJE 1BBT3 2YHJA 3TWIA 3WW2A 5CISA 1GFF2 3AM2A 3MIFA 1HB1A 4XF9A 4YARA 5JXGA 4KH9A 3ROUA 2J1RA 4KGGA 3LWCA 4OI0A 3JD73 4QPYA 2WS92 2DWRA 5H9QA 5FZCA 3AKPA 2W94A 1ZZCA 5C8CB 3MYXA 4NE9A 3VBFC 4CDUB 3VZMA 4Q4X1 3DPRA 3OYWB 4K21A 2C24A 1CAUB 3U4XA 3RZMA 1RUF1 2XVLA 2AEYA 3GCXA 2QUOA 4Y5Z0 5FJHA 1NA1C 4IV3C 3G7DA 1UZVA 3KQ4B 1YI9A 3L9JT 2J1AA 4AR2A 4C0BA 3FN9A 1FPN1 1WLDA 4GJYA 5C9AC 1NYWA 2JB8A 3TEWA 1PO11 1QKQA 1MS8A 4YW6A 2DYCA 3MF6A 1VAVA 1HLCA 2EIDA 3WCSA 3F95A 1QJX2 4ATEA 2XUMA 1AVBA 3ZXLA 1I1EA 1NCQC 1BJQA 2DUPA 2HWD3 5FMOL 4ZY9A 4UF0A 3N9PA 1JI6A 2E9QA 3N9NA 4N9HA 5FYVA 5HV4A 1Y3TA 4YW3A 5FMBA 5FYTA 3U37A 5EYXA 3U78A 4A7KA 3CJIA 2VU9A 4M3CA 4GA9A 3TB0A 3QD6A 4RR3A 2W39A 3THCA 2JDAA 3ZO0B 2WNVC 2XVGA 5LA0A 1MZ5A 2VMEA 3HJRA 3C2UA 4I0BA 4UWDA 2A3WA 2VC9A 3FUOA 4NOTA 4JDMA 1JZ4A 2JDNA 3V64A 3ST7A 2YC4A 2DCZA 1Z0HA 2IVIB 4GMP1 3LOIA 1MEC1 4FI9A 5FZLA 4W65A 1W05A 4A6SA 4B4PA 4C8DA 1RUH1 4P02B 4DUXA 1CD3G 1NLQA 4LIVA 3RPQA 3VBUB 4CP9A 3VDDC 5I91A 4LHKA 1D4M3 2J1TA 5KXDA 1C28A 3PMEA 4IEYA 1WUVA 1O6UA 3R05A 4JHTA 4QX8A 3WEZA 1QJY3 4GD4A 2Y0OA 3VBFA 2H6CA 5FUPA 2GALA 4IEPA 1A6CA 1ULFA 1W3XA 4LE4A 4P14A 1C3HA 5F6LB 2Q8EA 3UGHA 4A2UA 3TN93 4E2GA 3RZKA 4Q4W2 1NA1A 4CUBA 4YLZA 5LEJA 2X05A 3LE0A 1JZ8A 3JZVA 3LF7A 2R30A 1ZZ9A 1A3KA 3W20A 5FR3A 4EWEA 3WNPA 4Q0PA 4LHSA 4AQTA 1TNFA 2RMU2 1VLNA 4H7LA 1AR82 5KR7A 2HKXA 5F3GA 5A33B 1NCQA 4NIIA 3QLQA 2HYXA 4MGTA 3RI8A 5L9VA 1OF3A 2ORXA 3VBRB 1RUD2 3DXTA 5BUVA 3LPFA 3M3IA 2YB7A 1ZREA 2Y60A 3W21A 1AR92 2HEVF 2R0HA 3DN7A 5ANNA 3ZYHA 3H8XA 2I74A 4CP2A 4X6QB 2WNVA 1W28A 4ASMB 2O8QA 1ZRIA 2BOJA 2PMWB 2VCBA 4GMP0 4Y5SA 4EWDA 4RSUA 5IYYA 3B94A 5EZWA 2RV9A 5T5OA 4FP2A 2D6NA 2WT2A 5CIRA 1AUYA 1T2XA 4OI1A 3RRDA 1VBB3 3LA3A 1PVC2 4ZS2A 1LNSA 3VDDA 2HBUA 3H1WA 1Y9MA 4E2SA 2NQYA 1FOD3 1W8UA 3K3OA 3ENRA 3LOBA 4TLGA 5CAZA 1NE6A 1W2OA 2VY0A 4O9GA 4PF5A 5FZHA 3WDVA 2HEYF 1ASJ1 1D4VB 1KFXL 1RIRA 3GGLA 1LKNA 1GZ9A 3LKJA 2IXCA 1VIWB 4I01A 4Z8BA 1RUC3 1VAMA 3PVEA 5JPMB 1UYPA 5LASA 4MV2A 5LRSA 2XPJA 1JTZX 4KWLA 2A70A 3RMYA 1O91A 3GZEA 1G9CA 5FO7B 2G19A 2LRPA 2DBNA 4LA2A 1KS5A 2OVUA 3ON7A 3OY8A 2A6WA 3EYPA 4Y24A 1OOPB 3SEPA 4AFCA 5IATA 1DQ5A 1XRUA 3LDKA 3NJZA 3OD4A 1J3QA 4RHV1 3ITQA 1DQ4A 1RGSA 1S2KA 3MW3A 5J3UA 5A7QA 5ABJC 5J48A 1W8TA 4A4AA 1GOHA 1GSLA 3DF0A 3OUJA 4ZPIA 3AKTA 4YM3A 4D6QA 2DBIA 3NRUA 2VNOA 4B1MA 4HMZA 4UFKA 3SEEA 5FZ1A 2VNGA 4I0WB 4KG0A 1H0BA 1LEDA 2J1SA 4HKWA 3NV4A 1FPN2 3NNFA 5DABA 3HWJA 2EIBA 2P2KA 2PAKA 3I97A 1PO12 5FY0A 4A42A 1YQ2A 4A6OA 4AHXA 1LGBA 1JUHA 4EN7B 1K5JA 5D2AA 5LY2A 3T3YA 1XBFA 2K9ZA 3TAYA 2XBO1 5GZDA 4HVRA 4LITA 3I2DA 5LWBA 1EP0A 1WCQA 3AL5A 3NW4A 2HWC1 4Q4V1 3RNSA 1X36A 4LBOA 4PLNA 4URAA 5BNPC 1JYTA 1YO8A 4KG8A 5F6KA 1EPWA 5K4LA 2PA7A 3ETPA 4GWJA 4OMDA 4LBNA 5IJRA 3RDIA 5CEHA 2BGCA 5ISLA 5LK7B 4AVAA 1G9FA 2GN7A 1QJZA 1IPKA 3AKQA 2C4XA 5FO8B 1WWYA 1DCSA 3IZOA 3LCPA 2E7TA 2CDOA 5AFEA 5JLVA 4OYUA 4QM8A 4CU6A 1N1VA 1HB3A 1QJEA 2P5BA 4XPVA 5E8AA 3ZFEC 3ZFGC 3WDWA 3PIJA 1DQ0A 1MEC2 2GDFA 4P9JA 1HJFA 1JMUB 1SFYA 1MZ6A 5A7NA 3I49A 2VOWA 5FZ4A 4P9WA 1RUH2 5HI0A 2D6LX 3ZXGA 3POEA 5A1AA 5I0TA 3OPZA 1R1A1 2Q1MA 5EJ1B 2NYYA 5J36A 4CUGA 5ABJA 5JXHA 3AYAA 4RYDA 3VBHC 5A3NA 4I02A 1RJ7A 2KR2A 4XVHA 4WVMB 3PTYA 4XDPA 4IEWA 4LLOA 4XUPA 5FZDA 3U1XA 3VGIA 3OBAA 4COUA 5K0UC 2RS51 4DXZA 3O1VA 4OVEA 3A0KA 2XB6C 5BYNA 1W6NA 4O7XA 4LORA 1JOPA 1QHDA 4Q0UA 4CCLA 1BZWA 2PELA 3O12A 2BBAA 2VTXA 3WDUA 5DG2A 2FCTA 2XLAA 1U5XA 4XFFA 3M3CA 5A32B 5K7PA 5BNPA 5JI9A 1J83A 2GZWA 4XJAA 3WVJA 4YPJA 2ZZQA 2OYZA 1KJLA 2ZKLA 1YLLA 3ZYFA 4BIOA 2A71A 2QQNA 5IK5A 3KF5A 3WF0A 1ZX5A 1RB8G 3D6EA 5LA2A 1NCRB 1UU4A 1YWKA 4CU9A 3T2TA 4FPEA 1PZ8A 2PHLA 2RMU3 1NXMA 5ANQA 1AR83 2VQUA 1W8ZA 1UY4A 5HXVA 1FYUA 2WDBA 4AYUA 4ZONA 4CVUA 1O59A 3RFRA 2JDKA 3FLTA 3ZFGA 3ZFEA 1RUD3 3MF9A 3OF1A 4EE2A 1EYBA 2HH9A 5LK5A 1OQ1A 3OPTA 2WT1A 4AQSA 1OH3A 2B45X 3T30A 4BDVB 1UYYA 2XQXA 2ZGOA 1AR93 1S0JA 1XYNA 5K9YA 4H3WA 3QOPA 1RMU1 3S7IA 5FZMA 2D93A 3LD8A 2X53S 4BIFA 5FUNA 4D0QA 1J59A 1GOGA 3C7GA 4OUSA 3H1YA 4E27A 3MIBA 2HWE1 3RJ2X 5FWJA 3VBHA 3A23A 2ZACA 4RGAA 2P17A 4R8HA 1W90A 2DVGA 3PUHA 3CJXA 4BH9A 4XDQA 5K0UA 2QKDA 4D8MA 3HEIA 2VJXA
chains in the Genus database with same CATH topology
1QMJA 2XJRA 5FO9B 1PVC3 1T6GC 2O0OA 2WLPA 4BQ1A 2IXJA 2CV6A 1LHUA 1WMDA 5KBFA 1XU2A 2E63A 1N3PA 3IPVA 3WG4A 1A78A 2F6BA 1SMVA 1ZZ6A 2ZJCA 2JG8A 1H9PA 4AI2A 3RS6A 2PLV1 2GNBA 4RHV2 1H4HA 5T5LA 3AZVA 2ZMKA 3WW1A 4AWDA 3AP4A 2DF7A 5GZEA 1ND3B 4MUVA 3H3ZA 1W6MB 3GF6A 3O0XA 4X6RB 1CAXA 1M06G 1LHNA 4XZPA 3RZZA 1XNKA 3UKTA 2C0ZA 2RM21 4JTOA 1PVXA 1XNCA 2JECA 2XVKA 2XBO2 1OPMA 4E9KA 4Q4X3 3N4MA 4LO4B 4SLIA 4FO9A 2HWC2 2CAUA 3AP6A 3MLKA 4Q4V2 4XF1A 1RUF3 4MVTA 5FPXA 1LULA 2BWAA 3S7EA 3LA7A 1FPN3 1SQ4A 4HT1T 1CVNA 5FBZA 1EPZA 1PO13 3ZSJA 2ILMA 1HRI1 2Y38A 3JBG2 1LODA 2KXLA 4DY5A 4NHKA 3B9IA 4AXOA 3TRSB 4ZXKA 1O3QA 3EHKA 1VBA1 3L2YA 1GANA 1R1A2 5FTTC 4MLOA 3V0BB 1MEC3 1O7FA 2GMMA 4JRLA 2RS52 4QGMA 1V9U2 2NLRA 4LBKA 2IZWA 1RUH3 2NM1A 1U0AA 1OHFA 3VZLA 5DUVA 1ZBA1 1F31A 3NAPC 3OJBA 2ZGTA 1UIJA 1WBFA 4Q8KA 2ZGMA 1RVF2 4ES8A 3D82A 1JOJA 3ZN6B 3UJOA 1NCRC 4GWMA 1UL9A 1G9DA 3R4SA 3U11A 3ZX7A 4A7ZA 1S0BA 1DF0A 4OHXA 3I4IA 1DZTA 2EF6A 4XOGA 4Z92B 5T50A 4NR1A 1VJ2A 1H1MA 5T55A 2UY9A 3MIEA 1RMU2 4COZA 2EA7A 2ZAHA 2VOVA 3ILNA 4U36A 2E7QA 4UW6A 1H2NA 2HWE2 1PZ7A 5I0RA 4IEZA 2FBEA 1TNRA 1VBB1 2BNNA 3D5OA 4WVZA 4Y20A 4DOUA 1X50A 1ZYBA 2A73B 4Y1XA 3DPRB 4H14A 4JCKA 1F2NA 5KC5A 1U5IA 2BNMA 4NN0A 1NQJA 4XFIA 2ZGPA 3NV1A 3IDBB 4K8FA 3ZXKA 5CG8A 1QXJA 2B9UA 3NAPA 4DMIA 2OA2A 1SLCA 5TSWA 1L3JA 1ASJ3 3FJSA 1G7YA 3MW2A 4J1WA 4JQRA 2AH2A 3APBA 1V6KA 4UBHA 1QJU1 4BMEA 1Q8QA 3CJIB 3AB0A 4M3CB 3MGUA 4RR3B 5F5QA 4HL0A 4XJ8A 1XXNA 1AL0G 2WT0A 3ES1A 3R4DB 1PGL2 1F5JA 4IEUA 3LGRA 3SH3A 2RM22 4RHV3 2IC1A 4AVTA 5GLWA 1RUJ1 4LNVA 4Q0VA 1ZZ7A 4WV8A 3O5SA 3FMGA 4QD2A 2NZ9A 1LOBA 5JOYA 3BIWE 3WX5A 5J09A 1PIV1 4QGLA 3WW3A 4TLFA 3VBFB 2PHUA 4FTEA 4B4QA 4DS0A 2XBO3 1NA1B 2DVDA 1D2QA 3ATGA 2HWC3 4Q4V3 4AVVA 1Y9QA 4FPJA 4XQ4A 3H1MA 4XIOA 4X8PA 3AXDA 2KM2A 5HCBA 1ZVFA 3H7YA 4Z82A 1NCQB 3TNPB 3ZYJB 1IKQA 2PTMA 2JENA 5DG1A 5ACA1 4R9BA 1I3HA 1NG0A 1UD1A 1S0DA 2DURA 2R49A 2RS11 4Q27A 1YNAA 4TSVA 1FNZA 1D4M2 4UW3A 1R081 2WNVB 4L97A 3SISA 3VL8A 2WSUA 4LO6B 1IS6A 3ZYIB 5JWPA 5EYYA 1XYPA 3TN92 4FOYA 1O3SA 1R1A3 1ZBA2 4XFGA 1AYM1 3O14A 4PIZA 4XF3A 4XFAA 2WQ4A 4LHNA 4YRDA 1CAVA 1MACA 3FBYA 4PDWC 4QQLA 5J7MA 1JYCA 3GYDA 3JCIA 4KBBA 4FQ4A 3VDDB 1WMEA 4EN8B 2RS53 3OCPA 4B8EA 1Q8SA 1HV0A 3AYDA 3ZN4A 3FUQA 3O0WA 1GR3A 1HXS1 3IT8A 3PJYA 4GXLA 2CY6A 3WCRA 3KM5A 4HK8A 3VKLA 3QBQA 2DCKA 4C1XA 1SLLA 2Q0AA 4GIQA 4KU8A 1FT9A 2Q30A 1FAYA 2BVBA 3KGLA 1EY2A 3ZPYA 2VW0A 1VRH1 2ZGKA 5I0UA 3SXWA 5T5PA 4IEXA 5GLZA 1LCLA 1WW5A 2EXJA 2JJ6A 3OY8B 1Z78A 1XU1A 1VBB2 4PIYA 4CEWC 3GZTB 1RUG1 3J9SA 4AEMA 1S55A 2HEWF 2R0FA 2ZGNA 3MW4A 1EAH1 4PLOA 4D7SA 1OMIA 5IT6A 2A6ZA 1RMU3 1F5FA 3E5UA 3SMHA 1NLSA 3VKMA 4KQ7A 3TNQA 2HWE3 2ZZJA 2EVXA 1U5ZA 2KA3A 4PDWA 3ZFFC 4FOWA 1C5HA 2QCSB 4WM7C 2P3KA 4LLFA 1VR3A 1UZYA 2VW2A 5FFOC 1DG6A 2QNKA 1LOGA 2VMGA 4L11A 2AGSA 1HQNA 5HCFA 1TQ5A 4FPGA 3ZXAC 3SLIA 2TEPA 4BPZA 4JVAA 1J1LA 3ZXFA 1CPNA 4AI8A 3KD4A 4ITCA 1C5IA 2PLV3 4IEVA 3SH5A 2ZMLA 5DZGA 5L36A 3SCGA 2VULA 3N7MA 1RUE1 4P9IA 1POV0 2WFF1 4LR4A 1RUJ2 1DQ6A 1S2BA 1UKRA 3V56A 2GC1A 4YVWC 1PMIA 3LSDA 4CEWA 1VALA 5I8YA 2CWSA 2P34A 1WGPA 3GBGA 5ABJB 5FQ0A 2JKBA 1QDOA 2GNMA 2OIIA 2RM23 2PHRA 1QGLA 1UPIA 1R1ZA 5FREA 2B42B 3BU7A 5C6CA 1W6NB 4PJYA 2QQPA 3CLPA 2ZHMA 5EV7A 3ZFFA 2GU9A 2VECA 4WM7A 3DL3A 2D3SA 3KT4A 3MEPA 1WLCA 2EXHA 2ZAAA 3ELNA 1GZWA 3SCHA 5BNPB 4YM2A 5ACA2 1HRI3 2DCTA 4QHBA 3P3PA 4COVA 3RYRA 1YFXA 4BWOA 5JOZA 3VUOA 3WR0A 4GWNA 3RI9A 3V0AA 1J58A 1UZZA 1HV1A 5KHJA 1R082 2UYAA 3BALA 1JBCA 1AR71 1KS4A 2DVBA 4ISRA 5L73A 1H2LA 1ENXA 4JDOA 2YY1A 5JIAA 4PCRA 3ZFGB 3ZFEB 1IS4A 5B2GB 1KITA 4YZ3A 1VBA3 1AXZA 5DUUA 1AYM2 1REFA 1KQRA 3N7LA 1DFQA 3VHRA 3WP4A 4XF0A 4YVWA 1PK6C 1SCRA 4S2GA 2XKPA 4K1ZA 1LGNA 1BXHA 4NPRA 3VBHB 3JB4C 1UN1A 4XIKA 3D4KA 1DGRA 3INAA 5CFDA 1VBC1 1ZBA3 1ZBE1 1HDKA 1GKBA 2G9FA 4GKXA 4TWTA 5K0UB 1WBLA 2AYHA 4LUMA 1D0GA 5SV8A 3KT7A 3ZSEA 4HSLA 4FVVA 4M3CE 2WJSA 5FLIA 2WL1A 1VRH2 1RHI1 1ONAA 2ZX0A 3IPVB 3OGGA 4CEYC 4WZCA 2WNEA 1LTEA 3E5XA 4C0HA 2JG8B 1ULEA 4NO4A 1Q3EA 3AKRA 3TOJA 1KDMA 3FZ3A 3KMHA 2ZHNA 4IESA 5I8TA 2FHRA 4FP3A 1EAH2 2QE3A 2WA3A 1CAXB 3FFZA 1IOAA 4W6YA 4UW5A 4FPYA 1JUIA 2FMYA 2LTNA 4XXPA 5DDJ1 4W6WA 2DU0A 4GH4C 2ZX3A 3USSA 1PK6A 4EN6B 4FPFA 4FOVA 2R1DA 5CBLA 3CU7A 4K40A 2DVFA 3USUA 3AP7A 1LOEA 1ZA4A 4AGRA 1S0CA 3KS7A 2Z5WA 1DGWA 1QJU3 4KGQA 4M00A 2D98A 2OZJA 1RUE2 2UURA 5JSRA 4CEYA 2MHFA 5JIUA 3U0ZA 4R9DA 4C90A 3P3NA 4HK9A 1UKGA 4OHVA 3NKGA 4ZKTB 1MVQA 5CADA 4Q4X2 5F1RA 4OZXA 3SNMA 2UY8A 1QH7A 1RUF2 2WKKA 3H0OA 4LBQD 2ZPXA 2D6KA 5I0SA 4Q4Y1 1RUJ3 1AXYA 4G9SB 2PHDA 3R6SA 3B00A 1PIV3 4GH4A 3GALA 4QPGC 2XJUA 1CAWA 4BHPA 4AFAA 4RD7A 5BNNC 4INDA 2WC2A 2W68A 5T3NA 3WDTA 1JH5A 3KLSA 1KXGA 4FT8A 2AR6A 1AR72 2PHTA 2IXLA 3N3HA 4AFMA 5ACA3 3ZSLA 2RS13 1WW4A 3FLRA 4YNIA 2CL2A 2QZ3A 4YFWA 5JSOA 3FLPA 1YFWA 1R083 2JE9A 4IL7A 4XTMA 5JMCA 3FC0A 4XFBA 3ES4A 4AF9A 4L92A 4WZFA 3E6CC 4WVVA 4Y20B 2CWMA 2IXHA 1VB2A 1WLTA 1ZBE2 1AYM3 2GAUA 4RGGA 1PO21 2UYBA 3HIFA 3VHPA 3A0NA 2C1FA 5KHHA 4DZGA 3MFAA 4YGDA 1HRV1 4AK3A 4GB31 3NAPB 2ARXA 4QPGA 1H8TC 1RHI2 3E97A 1HXS3 2VGDA 3FFQA 2B5HA 1REDA 3ZYPA 2JG8C 1N3OA 1AX0A 5BNNA 5GKAC 1BEV1 4YG3A 1W6QA 4AHWA 4E4ZA 5A3LA 5E16A 4META 4TZDA 1WD4A 1CJPA 3X29B 2AREA 3RYPA 1ZRFA 4CP1A 1OFSA 1RUI1 1BQPA 2YDEA 3PNAA 1S1AA 1SBFA 1VRH3 4FXGB 4D94A 1YCIA 1CPMA 1D0HA 3HBZA 5FMOS 2HYKA 5HCAA 3RSJA 3BODA 3GHNA 5T5JA 2BBVA 1SDWA 2BW8A 3B7MA 1H2KA 4IV1C 4Q29A 1Z7S1 2Q4SA 2GMPA 2ZCWA 1QDCA 1QXRA 1LU1A 4YW5A 2ARBA 1RUG3 4YZ5A 1BYHA 4URTA 4JTNA 1VAKA 1DGWX 1EAH3 4AEDC 3S0MA 1G6NA 3AJZA 3ZIWA 4QQHA 5KXEA 1ASJ2 1JN2P 1VB4A 4C1WA 3ECQA 5BPXA 1LB2A 1DGLA 4E2QA 1Q8PA 1MS0A 4Y1YA 2R061 1VP6A 2X5IC 1IS3A 4CDWC 3WHUA 1SCSA 1H8TA 1POV1 2DU1A 4FTSA 1HQWA 1OQDA 1TEIA 3AFKA 1MS3A 4FTBA 1LEMA 4YM0A 4XHBA 4CTEA 3NSTA 3AMPA 4B7EA 1YIPA 2ZABA 1UMZA 4COWA 5GLVA 4MZUA 1ND2C 4CDXC 2W08A 5GLUA 1AX2A 1RUE3 1UPSA 5JCTA 2WFF3 3B01A 1FV2A 1UW8A 1ZRDA 4Q26A 1SLTA 4MGZE 3MIGA 2PYTA 4IV1A 3OBRA 3R4UA 4LE3A 3TYJA 3WG3A 2I07B 3VBOC 3KCCA 4RFT0 3ZSMA 1CAVB 3DUIA 4AEDA 1NY71 3POWA 4CDQC 3AMHA 3BOPA 1DGRN 3KGZA 2ZTNA 4FPLA 1OLQA 1ENRA 1CJDA 4YVSA 3GBWA 2LM3A 4A7YA 1G9AA 2VPVA 1KDKA 4MSVA 2EXIA 2D6PA 2R041 2X5IA 4CDWA 2ZHKA 4D7TA 4CP0A 4Q0SA 5FOBB 4YG6A 1SEFA 4F3JA 2Y0IA 2YYOA 5GLTA 5FCCA 5BNOC 1UIKA 4MGKE 2WFPA 1TMF1 1LRHA 3WUCA 5BV6A 5C33A 1AR73 3E6DA 1OI6A 2ZOEB 4Q8LA 1LU2A 4PBOA 4G3YC 1AXKA 1X33A 1B09A 4HLTA 1ND2A 4CDXA 3W59A 3KCXA 4XBQA 1AR61 2RR11 4HPKA 4QGNA 5AC91 1J3RA 4AG4A 5D8AC 4AW7A 1PO22 2JE7A 3OTFA 4V1PA 3NV2A 5FLJA 5JPNB 1S0IA 1HRV2 3VZNA 3VBOA 4HANA 1E57A 2PHWA 1W0PA 1WA4A 5DZFA 1VBE1 5JSPA 2GMEA 4PDWB 3CO2A 4ORFA 4FOQA 1VBC3 4CDQA 1ZBE3 3AKSA 4JC1A 1BEV2 3N35A 5FAXA 1SLBA 2CGPA 5GZFA 2BFUL 5FOJB 5GM0A 4AI3A 5T52A 5A3MA 1RUI2 4IEOA 1DQ1A 4GMP1 3WLUA 3M7AA 1ULCA 1GV9A 1RHI3 4GKYA 1CX4A 4RA0A 3BTAA 3WUDA 3FWEA 4I3PA 4DRRA 5IK8A 3O7OA 3VKOA 3GHMA 5BNOA 1KD7A 4EROA 1G8WA 4KWKA 4ONUA 4M3CF 1X82A 4AHYA 4CRQA 2XWBB 1NQDA 3S30A 4HVQA 3M70A 2BWCA 1I9RA 2F4PA 2ZBJA 2GN3A 2IXIA 4K3UA 4CEWB 2LUWA 1ULGA 3CEWA 1CESA 5FQ0B 4IETA 2XLFA 2FMDA 4ISQA 2BUKA 5D8AA 4QQOA 5DDJ3 2P3IA 2VMHA 1MQTC 1YHFA 1IPJA 3UK9A 4DINB 2R062 2XJSA 3I59A 2YUEA 1U12A 1WCKA 3N7KA 3IIAA 4W6XA 5LRRA 3ZFFB 4QM9A 4RS5C 4WM7B 2C9AA 3H9AA 3WT3A 1BMV1 4AHZA 4UBGA 1GZWB 3NVCA 2PLV2 1OFNA 3WXPA 4AVBA 2MEV1 2BNOA 1YXWA 2QDRA 3AZYA 2DFCA 2VNRA 3SCFA 2PHFA 3M4FA 4MGYE 4QMAA 3DKWA 4YGCA 3V0AB 4YW4A 1AL21 4RQPC 5L7OC 4XE9A 4N7UA 1BK1A 3PHMA 4P9GA 3GBFA 2Q1ZB 4BE3A 2A6VA 2RE9A 1YJLA 3M2MA 5CB7A 4HN1A 1W39A 2E51A 1SLAA 2HWB1 5I8SA 3ME2A 1EV11 3OD0A 1SFNA 4K20A 3JQXA 4SBVA 4QPIC 4YVWB 4OHZA 1V6IA 3VZJA 4Q4Y3 4EN9B 2JG9C 3OGJA 4QT6A 3URFA 2CYFA 2H0BA 2VOXA 3VHOA 1IGOA 1MQTA 1HRI2 2V73A 3AZZA 5AVPA 3W58A 5CVRA 5CFDB 1NE4A 2DTYA 3IM0A 3J4UH 2R042 3VN4A 3AX4A 3GZAA 4LBQA 3VZOA 1V00A 1AYN1 2WSVA 5FDBA 3POSA 4OHWA 2WS91 4RS5A 1C4RA 1V6JA 2BVVA 1DHKB 4BYYA 3CNAA 4IXLA 1YFUA 3VBSC 1VBA2 4FPKA 4IEQA 1LOAA 2YROA 2NMNA 2JD4A 4OUMA 2JICA 3RWNA 5J98B 3J8F1 1WLWA 4Y1VA 4YW2A 5H9RA 1RITA 2RR12 4RQPA 1AR62 5AC92 1OLRA 3T1LA 5L7OA 2ZX2A 4P9YA 3NO8A 2OUHA 2ZGUA 4AE2A 1QJX1 2JDZA 3B02A 3WNXA 4F7ZA 1AJKA 1VBE2 5E88A 1J3PA 4QPIA 1PK6B 2AZ5A 4R4ZA 2G9GA 2JG9A 2JX9A 1PO23 3THTA 1Q5OA 1RJ8A 2PHXA 2Q5TA 1W6PA 3B93A 4KU7A 1HRV3 3LB9A 3Q9OA 1OKQA 3USUB 1YIFA 4GB33 4MXWA 4ZU5A 4FBFA 1FXZA 2XJVA 4AVSA 3AMQA 2RHPA 4AQ2A 1BEV3 3FHIB 3ALQA 3V65A 4CEYB 3VBSA 2VQAA 1RUI3 3GZUC 3CL1A 1DIWA 4MXVA 5KHGA 1HW5A 1N47A 3AP5A 4I0AA 1K5MC 5J37A 2WLQA 4Q4W1 4LUKA 2PAEA 3RJRA 1Z7S3 1RINA 1JHNA 5KHKA 4JGZC 1KRIA 2Y26A 2EAKA 1IZ3A 4B29A 5KC6A 1F8VA 5JZGC 1COV1 1QY4A 3A4UA 2WZPP 1CONA 2D3RA 2D97A 4GH4B 5C8WA 2AUYA 2R6QA 1UF2C 1BMV2 4WVWA 4P5HA 1CAWB 1W2UA 2JXAA 3MZHA 4HBNA 1QJU2 1XYOA 2ZX1A 3M3OA 2MEV2 3UKVA 4AGVA 2R063 1D2SA 3JU9A 4Q1PA 4XMAA 4AEKA 2K0GA 1POV3 4AFBA 1AL22 2CAVA 5IK4A 3ASIA 4LO8A 2ET7A 1BVVA 3IN9A 1APNA 4S2HA 2ZMNA 2MNGA 4EJRA 4DY3A 3WQ0A 3D8CA 1OA2A 1ULDA 1XNBA 2BFUS 1KFUL 2HWB2 1DYPA 1EV12 2K2SA 4NHMA 3VZKA 4LO7A 3MLLA 3KCYA 1K5MA 2VMIA 4Y4YA 1PIV2 4NWVA 4JGYC 1A8MA 1QOTA 4N43C 5DXDA 4D3WA 4XJ9A 2WA4A 1CQ9A 5CFDC 2GC2A 4JGZA 1FMD1 2XJPA 4XQDA 2D5FA 5DUXA 4AEJA 2B8MA 4YG0A 1GICA 4PQ9A 1AYN2 2RS31 5JZGA 1LHVA 2XJTA 3AFGA 4LTAA 4BZ4A 1NXD1 2ZGLA 4YGBA 5C4WA 4BLJA 4QPGB 4GALA 1UU5A 3HD8B 4FAGA 2ZKNA 4M0HA 4ASLA 4YYOA 2RS12 4DPNA 5BNNB 2R043 4JV4A 3J8F2 1W6QB 4QQPA 4C91A 1FX5A 1TME1 3PVNA 4DRVA 1GYKA 1HIXA 1WMFA 4J1XA 3GNEA 1QOSA 2CTVA 3I54A 2A3XA 1TMF3 1SLIA 1QOOA 2DTWA 4UW4A 4XBLA 2QZ2A 3IMNA 1JXNA 1RTVA 3VV1A 3I7DA 4R52A 4R9CA 5FLHA 5CFCC 1LJ7A 1AR63 2RR13 3ACLA 5AC93 4JGYA 2D43A 4N43A 1B35C 1AJOA 1HXS2 1PM7A 2OZ6A 2D3PA 2ZGSA 1A8DA 4XHXA 3ZMOA 2B39A 3AP9A 4LT5A 1S0GA 3AXEA 5BXXA 5JAXA 1VBE3 3M3EA 4B4RA 3HR9A 2EXKA 4Z07A 3UL2A 3PLQA 4Y22A 2XWJB 1OA3A 2IFRA 3HMYA 4XQWA 3D0SA 3WV6A 1H8TB 3BB6A 1O3TA 4N53C 2WINB 4Z1VA 4F83A 4ZU4A 5JR7B 3W9AA 3SH4A 4JAAA 1ALYA 4EN0A 4GMP3 1CGPA 3VKNA 3HAGA 4K6BA 4IV3A 1G9BA 1RUG2 5C9AA 3KT1A 3ZVXA 1G86A 2VUAA 1QQP1 3NKTA 3IKWA 1KJRA 4OFGA 2RJLA 1DQ2A 4U2AA 1COV2