4XETA

Fe-cl bound y157f cdo at ph ~7.0 in the presence of azide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 59
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xetA00
5KHKA 1O5UA 3EJKA 3ETQA 3TNPB 2ETEA 1ZRCA 1LB2A 4X6QB 4IEYA 4Q0VA 4KWKA 1J3QA 1WGPA 3FZ3A 4OLLA 3FHIB 3LA3A 2XLAA 3H1YA 1ZZ6A 3CLPA 3M70A 5LEJA 5I8SA 1RL3A 1Y3TA 3NKTA 4D7SA 4R8HA 1O3SA 4Q29A 3RPQA 4BHPA 1CAWB 5FCCA 4IESA 3CO2A 1TQ5A 4LLOA 1I5ZA 3LOIA 3E5QA 4O9EA 1J3PA 4HMZA 1NYWA 3SCHA 3E97A 3QACA 3ACLA 1SFNA 4PIYA 3SHRA 3GYDA 4I02A 3N4MA 2Z2SB 4HVRA 2D93A 5FQ0B 3BU7A 5KHGA 4AVAA 2UY9A 1X8EA 2O1QA 1LKNA 4KL1A 3MYXA 5AVPA 3I7DA 4I09A 3H3UA 3U11A 1EP0A 4Z82A 1ZRDA 1CAVB 1FI2A 3L2HA 2DCTA 3IWZA 1Q5OA 1X8MA 3FE5A 5LEKA 3BALA 1O3RA 4FAHA 1YFWA 2PTMA 4QM8A 1CAXA 2H0VA 3UKVA 1YUDA 2GC3A 2GC1A 4J1WA 5BPXA 1RUOA 4KWLA 2ET7A 3G7DA 3BB6A 1RC6A 2OA2A 4XF0A 2CV6A 3MDPA 1J1LA 1ZX5A 1ZZBA 2B8MA 2V09A 3ZDSA 1O3QA 1LR5A 1X7NA 4KU8A 2BYVE 5J3UA 3I59A 1WLTA 1O7FA 3U10A 1YWKA 4F8AA 1EYBA 2BEOA 3S0MA 2XKOA 1GQHA 1NE4A 2Q30A 3CEWA 3H1WA 3HT2A 1DZTA 2FMYA 3CJXA 3FFQA 2K9ZA 3GBFA 2PAMA 1V70A 5C6CA 5HI0A 4WVZA 3D0JA 4HBNA 4QM9A 1OMIA 5E16A 3EO6A 2MNGA 4JV4A 1XE8A 2BNNA 2Q0AA 4MGKE 4LA2A 4MGYE 1QXJA 2O8QA 4MUVA 2UYAA 4ONUA 2QCSB 2MHFA 4ORFA 4YRDA 2CGPA 2B5HA 4Q0UA 3KSCA 1XRUA 3BPZA 4HN1A 1QWRA 5KBFA 1VR3A 1RUNA 3H3ZA 3B02A 3NJZA 2EA7A 5FLHA 4XFAA 4N9HA 4UBHA 3EQEA 4DINB 2CAUA 2ATFA 1ZREA 5JR7B 4QX5A 2F4PA 3H1MA 3KGLA 4IEOA 5BY5A 1ZRFA 3DN7A 2GAUA 3O14A 4I0AA 4A2UA 4JTNA 3WW2A 1J3RA 4E2GA 2IC1A 1CAWA 3QOPA 4PJYA 3ROUA 1GQGA 2BNMA 4HVQA 4HVOA 4LULA 2PYTA 5J48A 4AVBA 2HJIA 3D82A 4QGMA 1PMIA 2QNKA 4WBBA 2IXLA 3UKTA 2PAEA 1OI6A 2GZWA 4IEXA 5FQ0A 4XF9A 1UIKA 2IXKA 1NZCA 3DV8A 4IETA 2GU9A 5JAXA 4EWDA 2XL9A 5JSOA 4BIFA 5I93A 3DL3A 3OD0A 1ZRRA 4XFBA 5FLJA 2IXCA 3ES1A 4QGNA 4FAGA 4MZUA 1G6NA 4FBFA 1DGWA 2BGCA 1DZRA 1UW8A 3BCWA 5FPXA 1CAUB 3E5XA 5J7MA 1Y9QA 3LA7A 2EVXA 4O9GA 2D40A 1SQ4A 1YHFA 3LZZA 1ZZCA 3FX3A 3H8UA 4IEWA 5I91A 4I3PA 4I2OA 3KCCA 2HKXA 4PIZA 2QDRA 3LA2A 4XFIA 5BV6A 3LAGA 4R52A 4AVCA 1QXRA 4XFFA 4MH0E 3C3VA 2QJVA 4MX3A 4GULA 4F7ZA 2OZ6A 4HSLA 4CYDA 5C8WA 4EV0A 1O5LA 3NL1A 2PA7A 2PFWA 1VP6A 4EWAA 1NXMA 2Q4SA 3OGJA 1OD5A 4QXKA 4E2SA 4K8FA 4HZFA 3ST7A 3RZZA 4B29A 3KGZA 3H7YA 3DKWA 3PVBB 4FT8A 4IERA 2Q1ZB 3HQXA 5KHHA 4Q0PA 2N7GA 3RDIA 2PHLA 5JCTA 2QVSB 3E6CC 3WW4A 3NVCA 4EWEA 3EBRA 3NW4A 3D0SA 3WW1A 4YSFA 1SEFA 3OCPA 3USSA 2XL7A 4IEQA 5BUVA 2D5HA 5I0TA 4KU7A 4L11A 1UCXA 4ZU7A 5LRSA 4I0BA 5FDBA 3H50A 2XGXA 3RYRA 4J1XA 3FWEA 1RTVA 1CGPA 4I01A 4UBGA 3SCFA 4OFGA 1FT9A 1L3JA 3WW3A 3RNSA 4QMAA 2IXIA 3OTFA 2E9QA 3OF1A 4YNIA 4Q0SA 3CL1A 4YARA 1IPJA 2I45A 4UXAA 4LUKA 1DGRA 4LTAA 5FLIA 3S7IA 1CX4A 2H6CA 3FJSA 1WA4A 3MPBA 4NVPA 2GC0A 1H1MA 4XETA 1UIJA 2D5FA 3ELNA 4IEZA 5CVRA 1OFNA 3TNQA 2VPVA 4LA3A 1EPZA 4HLTA 4YYOA 2WFPA 2XLFA 2OZJA 3RYPA 2OPKA 1PM7A 1Q3EA 3ES4A 3E6BA 1UD1A 5E1RA 2PQQA 2OYZA 1I6XA 5F1RA 1CAVA 1YLLA 4P9GA 4H7LA 3MZHA 1IPKA 3SCGA 2MPFA 2XKPA 1CAUA 4LEJA 4ZU5A 3KMHA 5K8SA 1UPIA 3HT1A 1ZNPA 2WC2A 4HN0A 2IXHA 2K0GA 4X6RB 4XFCA 1YFXA 4XFGA 3HIFA 5EZWA 3IIAA 2GC2A 1J58A 3M3IA 4XF1A 3IDBB 5CADA 3JZVA 3UKNA 3IDCB 3E6DA 3RYKA 4PIXA 4QGLA 4AQ6A 4IEPA 1QY4A 2Z69A 4LUMA 2ET1A 3R6SA 3H7JA 5EFUA 4AQ2A 4TLFA 5D1IA 5I0RA 4JVAA 3EHKA 4ZU4A 2UY8A 3IBMA 4BYYA 4BH9A 2XLGA 5KHIA 4RD7A 5I8YA 3I54A 3PNAA 4WZCA 4XF4A 4MV2A 1ZZ9A 3VHRA 4MGZE 2PAKA 3PLQA 4KWJA 1CAXB 4XF3A 2IXJA 2VQAA 2ZKLA 4IEUA 1ZZ8A 2ZCWA 5I8TA 4JTOA 3U0ZA 4EROA 1H1IA 4HSJA 4D7TA 4XFHA 1J59A 2XHKA 1HW5A 2C0ZA 4Z07A 5CU1A 5LRRA 5JSRA 5FPZA 3I59B 1YFYA 4META 1RGSA 2FQPA 2Y0OA 2KXLA 2VECA 5I0UA 4AXOA 1LRHA 1Q43A 2GH2A 4N9IA 3S7EA 3LWCA 4MGIE 1O3TA 2PHDA 3H9AA 5KHJA 3SXWA 4IEVA 1ZVFA 4XEZA 4L2NA 3E5UA 1O4TA 1EY2A 5BXXA 1VJ2A 4E2QA 1JUHA 5T3NA 2B9UA 3SMHA 1ZZ7A 1FXZA 2BNOA 2H6BA 3CF6E 4Q0QA 1U12A 5I0SA 3NSTA 2P17A 1X82A 2UYBA 1XE7A 2CAVA 5JSPA 1YFUA 1NE6A 2EAAA
chains in the Genus database with same CATH superfamily
3K4ZA 3M3QA 1DZQA 1O5UA 1WA6X 2D6NA 2DVFA 2NM1A 2ZX3A 3J26N 3VL8A 2GP3A 4KGGA 2ETEA 1ZRCA 1D2QA 1H8VA 2HWE3 3D5OA 4INDA 5HXVA 1MQTA 4FPHA 4GMP0 5F8PA 3IT8A 2JD4A 5FZ9A 4KBBA 3POYA 4GKXA 3FZ3A 3A22A 4G9SB 4EN9B 1SBFA 2VVDA 3LA3A 3P5BA 4OHWA 2EIEA 2VZ1A 4QHBA 3V56A 2P3IA 3CIHA 5I8SA 1T6BX 1Y3TA 4Q8KA 1CPNA 4Z92B 2W1UA 4FXGB 4N8MA 3NKTA 4Y33A 1AR63 3LEGA 2B7YA 5C7GA 4YG0A 1PGSA 5DUVA 1HV0A 2WSUA 4Y24A 2NMOA 4Y1ZA 4OYUA 3ZYBA 3SH4A 2WJSA 5ABJA 4SBVA 1TQ5A 4IW3A 5FZOA 3U07A 1HKDA 1UQXA 3MUY1 4QX7A 1GOGA 4Q4V2 4QKDA 2DF7A 5FYBA 1OPOA 3E97A 1CD3G 1TNRA 1VIWB 1B09A 2C1FA 3ACLA 1H2LA 3HPNA 3PHMA 3MO4A 1SFNA 3FC0A 1DFQA 1GKBA 2HWF2 3SHRA 2IVJA 5IK8A 4RQPC 1IKQA 4UFJA 3MGUA 4HVRA 2VCBA 1LNSA 2NLRA 2VU9A 3I2DA 2B9VA 5DPNA 2UY9A 4ARYA 5AFEA 2AEYA 3UYJA 1LKNA 3I3QA 4KL1A 2WFF1 4Y1YA 4C1XA 5FOBB 3H3UA 1P8JA 3T1LA 2OUHA 4Z82A 1HB4A 2DFBA 2WSVA 5H9RA 1FMD1 2YPDA 1FOD1 4Q4Y3 2D3RA 3IWZA 3VBFA 3IB3A 5LA0A 4C1WA 1JYXA 1YQ8A 1HLCA 4QX0A 3ZFEB 1O3RA 1W05A 4GAZA 2JG9B 2OPWA 2FDJA 1IHMA 1RUJ3 2PTMA 4NRPA 4IUGA 3S5QA 1RVF2 5CA6A 3O12A 3O1RA 4HXCA 4Q4V1 2GC3A 3VD3A 1F8VA 1VBB3 1CZTA 2ZAHA 4LLFA 4KWLA 3G7DA 5C8CA 2HWF1 1RC6A 2OA2A 2XOMA 3B94A 3ZFFA 4OULA 5FFOC 1K5JA 1F5FA 2CYFA 1S0EA 5DABA 5EV7A 3ZDSA 1O8PA 1LR5A 2AREA 3I59A 1OD3A 4UW4A 1O7FA 3HBKA 3N7LA 3PIGA 4D69A 4ZS3A 1AYN2 1CIYA 1DZTA 5JOYA 3FFQA 3S57A 2K9ZA 4B7KA 4QDRA 2XBO2 3WF0A 5FYTA 3OGVA 1VBA3 1HIXA 2QTWB 3KZ4C 3QLQA 2WDBA 4PI0A 4LE4A 2I07B 4HK8A 4JKLA 5IYYA 4QM9A 1DCSA 4D0QA 2XB6C 4P5YA 2MNGA 4N43B 4JV4A 3ZMNA 4MGKE 3U4SA 4LHLA 2VQTA 3OY8B 1GWMA 2O8QA 3MHZA 2C9AA 4ORFA 4QPGA 4CDWB 4M3CA 3GM8A 1VMFA 3KHCA 5A3LA 1UZZA 3BTAA 1XBFA 4NRQA 1XRUA 2AYHA 1SLBA 4QHOA 4HONA 5EQUA 4UAPA 1AYN1 3ALQA 3AL6A 1LECA 1BK0A 2EA7A 3VKFC 3NV4A 3SEPA 4V2VA 1H2NA 1R083 2V73A 2XBO1 3T08A 2J1TA 1LEMA 4DINB 2JXAA 5GJ6A 5JR7B 2VMEA 4NIGA 5FYZA 2F4PA 1W06A 2Y26A 1RUI2 1XJAA 3PTRB 1FX5A 1PO13 4LHKA 3TOJA 4RGGA 5CYYA 4COYA 2ZEXA 1ZRFA 2GAUA 5FXWA 4I0AA 1QH6A 3JB8A 4BK4A 1XSRA 3HQRA 4V1PA 1U5IA 3WHUA 2R073 4JTNA 2YPJA 4LO4B 2IC1A 2P1BA 4QX2A 1PMHX 3HMYA 3AYAA 3MLJA 2R061 1VPHA 4N53B 4H55A 5IUQA 3QD6A 4GKYA 4UYBA 3T30A 4AHYA 4JDOA 2NZ9A 1S0FA 4CE8A 1KGYA 2HBUA 4YVWB 2CSGA 2WT1A 4GXLA 2X29A 2ZGUA 4RFT0 3VZJA 3ZDVA 2RVAA 5FRAA 5FZ7A 4JDMA 4AVBA 1CX1A 3D82A 2XXZA 2PAEA 4GWIA 2VTXJ 4YVSB 2QE3A 3NAPA 3WXPA 5FQ0A 3G6JB 3W20A 4K9SA 1JHJA 2JDYA 2VXJA 2WQZC 3PVNA 1YC61 2IXKA 1ZYBA 1AL0G 3DV8A 2VOXA 4QU2A 1DQ4A 3B9CA 4BLJA 2PLV1 5JAXA 1JZ2A 3BI3A 2WT0A 4C0HA 1AJOA 2JG8A 3KF5A 5F6LB 3N9PA 1ZRRA 1HQNA 3UETA 1MS8A 1GU3A 4KH9A 2XPJA 2A73B 4RR3A 2BGCA 3LEKA 3HN1A 2ARCA 1Z7S3 1QQP3 3VKOA 4ZONA 2X5IA 1HB3A 4OMCA 1C5HA 1NCQB 2IWGB 2ENRA 2HYKA 3POBA 4FTBA 1T6GC 1NCRA 1QJZA 4LBLA 2WNVA 3V0BB 1CJPA 1Y9QA 1L7QA 3WV6A 3AP9A 3FHAA 1MS1A 5C3SA 2TBVA 5J37A 1SQ4A 4UT5A 4HPKA 1PHMA 5AC93 3LZZA 1YIFA 2E33A 3USUA 5GZFA 4K7JA 4HT1T 1QJU2 1XSQA 4QX3A 3ZFGA 1PVC2 4IEWA 4BA6A 2YBSA 1D0GA 1VBE2 4I3PA 4CP9A 4QKFA 2ZA9A 3NJXA 4WM7A 2RE9A 3LA2A 2WNUC 3HBZA 3B01A 4IV3A 4FPKA 4LOTA 2ZS6B 3EXUA 1AL23 3LAGA 3CNAA 3WUDA 2W47A 2NPIA 2VZOA 4MX3A 4MGTA 1V9U2 2VMGA 1B35B 5FUIA 5A7WB 1JODA 5A6YA 2ADEA 3TN91 1PO23 2ARBA 4A6OA 2VNOA 1GYKA 3AP6A 1XNAA 5C8WA 1KJRA 1O5LA 2DVGA 2VOVA 1W28A 3V0AA 2PFWA 1E57A 2IFWA 4CCKA 5LA1A 5BNNA 2JICA 3WP5A 1OD5A 2DFCA 4Z8BA 1OLRA 1X9PA 1YQ5A 2ARXA 3CJIC 3WY6A 4E2SA 3VBRA 2MEV2 5FMBA 2J1EA 3ST7A 1PVC1 4CP1A 1VBE1 1W6QB 3MUZ1 5CNAA 2RS33 3T0AA 1JTZX 3WP3A 2HWE2 4M00A 2E31A 1CJDA 3ILRA 3OGRA 3WNXA 2XH6A 2GMPA 2Z79A 2PHLA 1NAEA 2A3XA 5IVJA 3FHQA 3OBAA 4QAWA 4P9JA 3RZLA 1TE1B 1YRZA 1GOFA 2X53S 1V9U1 3H3LA 3WW4A 4XURA 4BQ4A 1C5IA 2E7TA 2QKDA 1UOGA 3NVCA 4RS5A 2V5YA 4Y5SA 3EBRA 5H9QA 3VD7A 4D94A 5J36A 1ZBE1 3D0SA 1XOYA 2VXRA 1UOBA 3WW1A 2RG4A 2X8KA 1ULPA 1W6NB 3LIHA 5APAA 2BBAA 2OKXA 1YNAA 1YO8A 4KU7A 1QXPA 1UCXA 1HB2A 5LRSA 2AACA 4QWNA 1PZ9A 4NHKA 3KD4A 1JH5A 5GALA 1U5ZA 2VZ3A 1E5SA 1GLHA 4COVA 4XBLA 3B69A 1NA1C 2ERFA 2VZQA 1TZOA 2ARAA 4UBGA 3TEXA 1CGPA 2MEV1 4OFGA 4AEDB 5ACA2 3WW3A 1PK6C 1W6PB 1W0OA 1D4VB 1WLWA 2ZEZA 5IATA 2CL2A 2E9QA 4CVUA 3DPRC 1DQ1A 1YJLA 2HWE1 2JB8A 1SPPA 3BVCA 1UZYA 3TEWA 1XYOA 2I45A 2FZ1A 2YC4A 2JDPA 3C7FA 4LUKA 4UXAA 1YXWA 5D8AB 3ZKUA 1W0NA 3J7MA 5C3OA 2WLQA 3LSEA 4U36A 1UZ0A 3LEMA 4IXLA 1HJGA 4NVPA 1OLMA 1Q8SA 5HCHA 3TNQA 5CVRA 5D21A 3MICA 4LA3A 2CDPA 3ZIXA 4IV1A 4XXPA 4Q4X3 2WFPA 4CDQA 5DAXA 1GNHA 2Y34A 4CCCA 3CKHA 4QB1A 2P3JA 3E6BA 1UD1A 2KD7A 3MBWA 2DVAA 2F17A 3T0BA 4M0NA 2OYZA 2RJKA 1RUJ2 1NX9A 1I6XA 1JOJA 4XCAA 2Y0IA 2YGLA 4Y22A 4YPJA 3I8TA 2MPFA 4CU9A 2ZMKA 4B8EA 2C6SA 2WRAA 4LEJA 1OKOA 1T2XA 2VZSA 4KMQA 4LHSA 3ZFEA 5FPVA 2JG9A 3KMHA 5FK8A 1A3KA 5CFDA 5K8SA 1MS5A 3MF9A 2Z4FA 4GQ7A 2UURA 2AGSA 4LKFA 3HNMA 1HDKA 1V6LA 4DUXA 2CTVA 1E5IA 4WVVA 2UU8A 1YFXA 4YW4A 1UMZA 5LBBA 3HIFA 2R6QA 4AEKA 3DUIA 1OT5A 3VBUA 1RB8G 1IG0A 3C8XA 1NLSA 3NV1A 4OQ9A 4F83A 3VDCA 5ABJB 1LOFA 2EAKA 5FZOB 3U75A 3TEYA 4FQZA 5JPNB 3NNGA 2DBIA 3IDCB 4JQRA 1ULOA 3ZXGA 2Q1FA 2FDIA 2FDGA 4COWA 3E6DA 5F5IA 5JOZA 4PIXA 2OX0A 4IEPA 4KG0A 3MLLA 3KV4A 1W03A 1POV1 4NIHA 1RUJ1 5LATA 1GZWA 3OUHA 4QX8A 1GFF2 2PQSA 4XUOA 1D4M2 4AEMA 3N7MA 1S2EA 5D1IA 4YW2A 5I0RA 2JDNA 4OI1A 1VBB1 2C26A 3VBHA 3URFA 4CDXA 4PHZA 4XDPA 5T5OA 2BGOA 2QQWA 2Y6JA 3EHKA 2KM2A 3IBMA 1OOPA 3UK9A 4BYYA 2XLGA 2FCVA 3I97A 4XQWA 5KHIA 2B46X 4RD7A 4Q26A 3I54A 3J8F3 1DIWA 3ZOIA 2VOWA 5BUVA 2DUOA 2Y38A 3OY8A 1W6OA 4XDOA 3VDDA 3C7EA 2W39A 1XNCA 2VNRA 3VHRA 3PLQA 3WNPA 4KWJA 1QJY2 5FPLA 4CDWA 4ET7A 3KF3A 2D3SA 4MXWA 4Y5Z0 2IXJA 2VTXA 4QKNA 2BTVC 2VQAA 2ZKLA 2ZKNA 3PUQA 5JXHA 5L9VA 3OGSA 4JTOA 4LK7A 4M01A 1VBC2 3NNLA 4TLGA 4Y20A 3VN4A 4EROA 5C9AA 5FY0A 1GP4A 3ZFFB 4MLOA 1H1IA 1RVF3 3KCXA 5KR7A 4H2AA 1W8OA 4COUA 1J59A 4A44A 1HW5A 2XMLA 5FPUA 4XUQA 2R7EB 3I59B 1YFYA 2QQVA 5I0UA 2FQPA 2Y0OA 3AYDA 2CWMA 3N35A 5L73A 2FDFA 3ZYJB 4DPNA 3CHXA 4XQ4A 4AR2A 2BGPA 2OQ7A 1RUH2 2XJVA 3FUOA 3O1UA 1O3TA 1EUUA 2VL4A 1C4RA 4MGIE 4PF5A 5SV8A 2Q8CA 4L97A 5A32A 1OC1A 4IEVA 1ZVFA 3TWIA 3K75B 5F2WA 3PVEA 1SLTA 1JMUB 2WWSA 4QXBA 3E5UA 2Y33A 1EY2A 3M3EA 5BXXA 1VJ2A 3O7OA 5T50A 1O59A 3L2YA 5DZGA 1AYN3 1QJY1 4YM2A 3GBWA 1ZZ7A 4HETA 1N1SA 1FXZA 1JYWA 2XBO3 3DF0A 2YU1A 1WBLA 1OKQA 3AFKA 5F39A 3ZVXA 1VBC1 1GSLA 5JUVA 1JOPA 2FMDA 1YIPA 4Q0QA 2W2IA 1QGLA 5FYSA 1SBDA 3RRDA 3THPA 1ONAA 2VGDA 3NSTA 4QPGB 4BJ0A 1KFUL 1ULFA 3Q8FA 4LO8A 4YZ5A 2WBKA 3E1F1 4BPZA 1XC6A 2GP5A 2EAAA 2X10A 3K46A 3T4VA 1UAIA 5KHKA 1UY3A 3NNJA 3ETQA 1XPWA 2ZABA 3TNPB 1S2BA 3K3NA 3WCRA 4ASKA 1SZBA 2DCJA 1CIWA 1H9PA 3Q8EA 2WIIB 3OB8A 2AZ5A 4IEYA 4Q0VA 1HQLA 1LU1A 4FFIA 3RI9A 5F7UA 2D6OX 1QQP2 1WGPA 2G9GA 4OLLA 3FHIB 4TWTA 3KVBA 1CR7A 4NE9A 1NG0A 3LGRA 4O65A 1JZ6A 5HPOA 2XLAA 2CDOA 1FV2A 1MQTC 1S1AA 3GZAA 1LGNA 3H1YA 4GH4A 4AGRA 5L7OA 5LEJA 2JJ6A 1RL3A 1TVGA 5IAXA 3CU7A 1Y9GA 4JKMA 4CEYB 1LOBA 4YFZA 4CEWC 2WO2A 2X05A 3TEZA 4NRMA 1BHGA 1J1TA 2W92A 4KI5M 4D7SA 2LS6A 5C4WC 3UGGA 3WP4A 1NCQA 1AHSA 1K5MA 3FUQA 1NZIA 2GN7A 4URTA 1RUI3 1MVQA 5FCCA 2GSYA 3GCXA 4CU6A 3NJYA 3PUHA 4LLOA 4JQTA 5F3CA 3RJRA 1H6XA 3E5QA 5C5UA 3W5NA 4LITA 5FYMA 1MS4A 4HMZA 5DXDA 3WG1A 3VBSC 4W4ZA 3BTXA 3N9LA 2FBEA 3MIDA 4PIYA 4CUAA 2K2SA 2VZVA 3BTYA 2R043 3KV9A 4BQ2A 1Z7S1 5FQ0B 1QQP1 1V6KA 3BU7A 1DQ6A 5KHGA 2A70A 1YQ2A 3AKRA 1YQCA 3ETPA 2VZTA 3DYPA 3HNYM 4RYDA 4P14A 2Q8DA 1STMA 2DVBA 2GALA 2EF6A 1QJX2 3Q8AA 4I09A 3U11A 1EP0A 1U5YA 1LHOA 3I3BA 3DXTA 5FMOL 4TZDA 2JG8B 1ND2A 4FVVA 4B4PA 4EE2A 2JIJA 3WP6A 2BP6A 2ADDA 4FXKB 3I2KA 4FAHA 4RR3B 1JOBA 2XQXA 2RHPA 2ZOEB 4K8RB 5FREA 2JIGA 3ZIWA 4QM8A 2A71A 4CRQA 4LNVA 4Q5OA 2H0VA 3IAPA 1UO9A 1PNGA 1LENA 2GNMA 2X5IB 2LM3A 1AL21 5K9YA 5FYUA 5L9BA 4NWWA 4QB6A 1YQ6A 5H9SA 1NCRB 3POWA 3WDWA 4UW5A 2WNVB 3KV5A 1W6QA 3LCPA 4JAAA 3PU8A 1VBD2 4BXFA 2B8MA 2C5DA 2J1RA 3TAYA 4HPKB 2BYVE 5J3UA 5EXOA 2J22A 4HOOA 5EP9A 4GJYA 2BVBA 1OLME 3USUB 4CPBD 2YC0A 2Y6GA 3ZFGB 1GP6A 1BBT2 1QJX1 3QCWA 1EYBA 2EICA 3WLUA 2XKOA 4WM7B 3K3OA 3N7KA 4EZ4A 3AP5A 3O0XA 3CEWA 4J25A 2FMYA 2XQRA 4IV3B 3GBFA 4KQ7A 1PX4A 2PAMA 4UF0A 5FYHA 3LFMA 1QJU3 1VRH2 1PVC3 2RMU2 5A6XA 1OVSA 1S4CA 2PHUA 1HJFA 2TEPA 1SLLA 2BU9A 1AXYA 4P9IA 1V00A 2FCUA 2VMHA 2VTFA 3D0JA 4PDWA 5GZDA 4AGVA 4FFFA 4ZHNA 1QNWA 3A0NA 4CSWA 3EO6A 2J1SA 4JGYA 1FAYA 1XE8A 3V0AB 5LB6A 2GMEA 5LA2A 2R16A 3MV11 5BNNB 2HWB2 1QXJA 2GN3A 3IPVA 4MUVA 5FMDA 1V9U3 2MHFA 1VBD1 4C90A 4XUPA 4DXRA 1ENQA 4NO4A 4B4QA 4Q0UA 4E8CA 3VBOC 5C3PA 2WA4A 5T5JA 1PIV2 1QWRA 3O5SA 4XUNA 4K21A 4A42A 3R05A 4CA9A 4FPOB 2VAUA 3AM2A 3B02A 4HKWA 4BXSV 1LOGA 3OBTA 4YLZA 4XFAA 2SLIA 4M0HA 4UBHA 3EQEA 4FOWA 2J7MA 2MEV3 4EN8B 3BIWE 1VRH1 2RMU1 4XTMA 3P3NA 2D43A 3GDBA 3N9NA 4RS5B 3VV1A 3KGLA 1FATA 2DBNA 4IEOA 1MZ6A 5JOWA 4A7YA 1MR5A 1XU1A 4IGQA 2AUYA 3D8CA 3T2QA 5DAVA 3O14A 3WDYA 4R4ZA 3MW3A 4WVWA 2JWPA 4LBNA 3WSOA 1WCSA 2HWB1 2WN3A 1VAKA 1R1A2 3WW2A 1J3RA 5C3QA 4CUBA 4D6RA 4CDUA 3KT7A 1F35A 1LHVA 2JDAA 2VR4A 3IMMA 5JVVA 5LBCA 3I4IA 2WA3A 4Q4X1 4W50A 4EQVA 3WNKA 1GQGA 1W9FA 2BNMA 1BZWA 4LULA 4QPIA 5J48A 4P5HA 3KVAA 1H0BA 1SPPB 5JLVA 1DU3D 1WLDA 2ZEYA 4KBZA 3VDAA 1QMJA 3DCQA 4ATFA 3DYMA 1UOFA 3AMMA 5FZEA 2ZBJA 3OSDA 3ZYPA 2QQIA 5ACA3 1O8SA 5FOJB 3ACFA 1NZCA 4IETA 1A6CA 1W8UA 4L92A 4K20A 1OQEA 1WW4A 3I2FA 4LO7A 4IV1B 5K4LA 1W2OA 5FY8A 1S0CA 5A1AA 2R32A 2VULA 4N90A 4OZXA 5FLIA 1VAMA 3DL3A 5I93A 1Y4WA 5LWBA 2LTNA 1I3HA 3O1SA 4N7UA 5KXCA 4QB2A 1LJ7A 3J8F2 4AWDA 3CDZB 2YU2A 3RQ0A 4AF9A 2W0XA 4DO0A 5JIUA 1UF2C 1SACA 2JDZA 4MZUA 5I0DA 1DGWA 5JZGC 1GBGA 4CCEA 1QHDA 1U0AA 4CXXA 3I2JA 3ZXJA 4CU8A 4Y22B 1J84A 3BCWA 5ANNA 5F3IA 4XZPA 1LGCA 1POV3 1WCKA 5FJHA 4B1MA 5CFDB 2DTYA 2WNEA 4LBMA 4YZ1A 1UZWA 2V72A 1OLQA 1PNFA 2VW0A 3LA7A 4PF1A 5LBFA 2JB4A 1BLZA 2LROA 5IHRA 2G9FA 2LUWA 4O9GA 3KT1A 4Y26A 4CP0A 1YHFA 2P3KA 2UWAA 2BOJA 2B4KA 3VBUB 5CG9A 3FX3A 1DGLA 4L8QA 3KWVA 5K0UA 5LA9A 4I2OA 2W95A 1UL9A 2HKXA 3KCCA 4PIZA 2WYFA 4ZY9A 2WZ8A 3GALA 1AXKA 1H8TA 1C8M2 3GJAA 3KHBA 4LORA 4MHUA 4OUMA 4XFIA 2VMIA 1UKGA 3HVDA 5BV6A 4WM8A 3GHMA 1TG7A 2JEMA 4AHWA 5L19A 5FZ6A 1GICA 1OF4A 3J8F1 5FZHA 5KC5A 1BEV2 3ZXAC 3UGHA 1JXNA 4MH0E 4XUTA 4OVEA 5GLUA 3C3VA 4YZ2A 5HXMA 4HANA 4BE3A 4BK5A 1KD7A 1OHFA 3HEIA 2DURA 2VMFA 3JU9A 1GZWB 5IT6A 1JS9A 4CYDA 1HRV2 5A3MA 5BNOC 1G9CA 3BN6A 4DXSA 3POFA 4EV0A 2YY1A 3NL1A 3OPTA 5FK7A 3T3YA 2PA7A 2XVLA 3VBHB 4CDXB 3AKQA 1ND3C 1A8DA 3RSJA 2Q4SA 3R4DB 2H0BA 2GNTA 1W9WA 4A41A 1RVF1 1OOPB 3P1IA 1D4M3 1IZ3A 1JN2P 2WZPP 3A0KA 1LOEA 4E4DX 4JX0A 4HZFA 2YROA 2QZ2A 3NKGA 5BNPC 2Y60A 5HV0A 1AXZA 2V5DA 4GB32 2WAOA 3RZZA 3AYEA 5JXJA 1W6OB 3VDDB 4EYUA 1M06G 2R1DA 3VHNA 3RVHA 4FT8A 3VBRC 3ZN5A 1D2SA 1RYYA 4MXWB 1BKZA 5KHHA 2VE1A 3WX5A 2A3WA 2N7GA 2ZHKA 4Q0PA 3PMEA 4JRLA 3EMRA 2QVSB 4Y1XA 4S2GA 4Y20B 1QH7A 4IE6A 2KR2A 5C9AB 3OBZA 2A1XA 2A6WA 4FPLA 1MZEA 1OA2A 1QF3A 2W94A 3T2PA 1JYTA 1HN1A 1QJY3 2FZ2A 1S0JA 1X33A 4XJ8A 3BODA 4GZ9A 3ZXLA 3S30A 5CEHA 3HR9A 2WZR2 3W58A 4JGZA 1VBC3 1SEFA 1WW5A 3W9AA 2D3PA 4ZU7A 1VLNA 4NHLA 2PELA 5FYYA 5GLTA 4IE7A 3BU0A 4QPWA 4CEYA 3AP7A 3AZWA 5IVCA 4M3CF 2VC9A 5A32B 4I01A 4P08A 1OF3A 1ZBA2 3LD8A 1WBFA 1FT9A 2QQOA 4DY5A 1XXNA 3RNSA 4W6YA 1RUH3 1AYM2 4X8NA 4Z2WA 1ODMA 1H6YA 2R042 3BKZA 3NRUA 1DGRA 4LTAA 2H6CA 2ZJCA 1VE0A 3FJSA 1WA4A 5DG1A 2JDHA 2GC0A 3N3HA 1H1MA 4XETA 2NN8A 4YYOA 4R9CA 5FUNA 1CPMA 2RDNA 4DY3A 4FTSA 2OZJA 1GMMA 2WZR1 3LPFA 1PM7A 4DUVA 3UV9A 3GF6A 4URAA 2PN5A 2ZZQA 5LK5A 1RUI1 3TYJA 1G86A 2VBDA 4FPEA 4R4XA 1LESA 3K4DA 2VOTA 3K77A 3LQCA 3MIEA 4P9GA 4IE4A 4H7LA 5IVEA 1H4HA 3AZZA 2XKPA 5F5QA 1ENRA 1CAUA 4GH4B 2RJLA 3UGFA 1AYM1 3GZEA 3I3EA 5A33A 1LULA 1OH3A 1V0AA 2Z5WA 4V2WA 5GZEA 3RWNA 1ZA7A 5L7OB 3KCYA 1UPIA 4CXWA 4C0BA 1ZNPA 2R041 2UWBA 1K12A 3ZLIA 3C7OA 4RQPA 3WG3A 4BQWA 3T2TA 4HN0A 4PBOA 2F4LA 4X6RB 3IKWA 5FO9B 1PGL2 1QNYA 3OJBA 4Z2AA 3ZFEC 1K5MB 2WKKA 2OIIA 2JG9C 5EZWA 1POQA 4LXLA 3M3IA 3OD4A 4YG3A 5FY9A 2VW2A 5GZCA 3ILNA 2P6HA 1ZRIA 2PXJA 2I2SA 3AXDA 3R4SA 5T52A 4QHZA 1HXS2 4Y1UA 2W3JA 2R30A 4AQ6A 1JI6A 4A4AA 1GZ9A 5FYCA 3U14A 4XHXA 4BQ5A 3ZSKA 2ET1A 2VM9A 2ZACA 3RGBA 4BLIA 5BNQA 3L9JT 5F2SA 3AZVA 5EFUA 4AQ2A 3RG0A 1DDLA 3QH7A 4ITCA 1SFYA 1W8NA 2ZX4A 1US2A 4JVAA 4NIAA 2EALA 2OUJA 5F37A 3J7HA 1JUIA 2ZGOA 1C1LA 5F3GA 4FPFA 1ULCA 4ZU4A 4Q2FA 4BH9A 1ND2B 4D6SA 4Y4RA 1PGL1 1BYHA 5FP4A 2BRTA 2WS92 3PNAA 1QJX3 1K3IA 1Q8OA 5FTTC 5LY2A 3N9QA 1GUIA 5A3PA 4MV2A 1YYNA 3H42B 1CWPA 4N43C 2ZGMA 4OI2A 4XF3A 2ZHLA 2WT2A 2XDVA 2ZAAA 4C91A 5IFTA 1VRBA 2D98A 1M4WA 4IEUA 4XIKA 1LTEA 5B4NA 1HXS1 2ZCWA 3SITA 1W39A 1YI7A 1QJU1 2A3YA 4AK3A 1G9DA 4CDWC 1REEA 4D7TA 2JE7A 4DFSA 2E7AA 4XFHA 2L9LA 2XHKA 4AFCA 3Q9OA 4LBQB 5LRRA 1OURA 1MEC2 2K46A 1MPXA 1MS3A 1OA3A 3LE0A 4AEJA 4OHZA 4ISQA 4JC1A 1VBD3 4XJUA 5LASA 3ECQA 1RJ7A 1AUYA 3DEMA 1S55A 1AR83 2PHDA 1JZ7A 4YFWA 5KHJA 4UF0B 1RITA 3SXWA 4XEZA 2EXJA 5E88A 1BBT3 4AOCA 3K2OA 4L2NA 5FXXA 3WNLA 1W8FA 5A7PA 4PDWB 4E2QA 1VAVA 3J4UH 1JUHA 2B9UA 3SLIA 4I0WB 4XJZA 1LHUA 2RS52 4JGYB 4LPLA 4Q27A 4W6XA 1LCLA 1SLAA 5FMCA 3OGGA 1VRH3 2RDSA 4B3NA 2FCTA 2RMU3 5A80A 1YEWA 2ZGKA 3FLTA 3CF6E 5FP9A 3IPVB 4ZPIA 1I1EA 4DRVA 4N53C 2V4VA 4XILA 1W6MA 3PUAA 1MEC1 1SDDB 5T5LA 3I49A 1YFUA 4FOYA 5JSOA 3A7QA 4MHRA 4YVWC 3IIIA 2HWB3 2DWRA 2Q8OA 3WF2A 3NJVA 3M4FA 3ZM8A 1W2NA 5HBAA 2VUAA 4YVSC 4X6QB 4IGOA 1R092 5KC6A 2W87A 3SH5A 3VUOA 4QXCA 1J3QA 3HWJA 1PIV3 2VMCA 1FNYA 1UNBA 4NHXA 5FYVA 3VLBB 4E4ZA 4TXWA 4JDNA 2SBAA 2RS51 5EJ1B 1UY0A 2OQ6A 3INAA 3WD5A 4Q29A 5ACA1 1GWKA 1OA4A 3RPQA 1AF9A 2EIGA 4CDUB 2BPA2 4IESA 2Q1MA 4MG2A 5FUPA 5H9PA 4XZUG 1DLCA 1JBCA 1GNZA 4O9EA 1V6OA 2QQJA 1NCQC 3AXEA 3KM5A 3WOGA 1OVPA 5M0TA 1NYWA 3QACA 4YG6A 1R1A3 5DAPA 3LDRA 4XBNA 5SV5A 4QPIB 5CKNA 4LBOA 2W5FA 2A6ZA 3K48A 4YW5A 2RS12 4I02A 5A3OA 1IS3A 1LOAA 3HN3A 4AVAA 1F31A 1MACA 4C8DA 1X8EA 2O1QA 5CFCB 5JI9A 3POJA 4XJAA 3I7DA 5AVPA 5JMOA 1CZSA 1PMJX 2XWBB 4LIVA 3WVJA 3MI8A 2W52A 5JI7A 5KXBA 3W59A 1ZRDA 1CAVB 1FI2A 4NIDA 4BWOA 1WZXA 4MGQA 3L2HA 4OHYA 1LHNA 1NUKA 2HEYF 1X8MA 1QOOA 3JUUA 2AENA 3BALA 4S2FA 5FPAA 2RM22 2EXKA 1B35C 3KB5A 3THTA 1SCRA 3UJQA 3NMBA 1JYVA 2J1UA 5J98B 1CAXA 2WNUA 3UKVA 5LZ6A 1YUDA 2WNOA 3WCSA 4NPLA 4D8MA 5BPXA 1LEDA 3ZPOA 1RUOA 2ET7A 3BB6A 2YMZA 2ZGLA 5FZ1A 2E26A 4XF0A 2VNGA 3RWKX 4D3WA 1ENXA 3M1HA 2RS11 1J1LA 2RR12 1S0IA 2WABA 1ZZBA 1I5PA 3AJYA 1CZVA 4OMDA 4KU8A 3ZXEA 5FY1A 5HCFA 1WLTA 2GNBA 3FLRA 2E63A 3VKNA 3VKMA 2VCMA 3WQ0A 4XPVA 1YWKA 4HG6B 3VZLA 4OUEA 4CXYA 1GNYA 2BEOA 5K0UB 3JBG2 2D6PA 4FP3A 3S0MA 1GQHA 2XG3A 3N9OA 4YWAA 4CCLA 1H8TB 4YZ3A 4CDQB 3CBNA 2DU1A 4LMFA 3CJXA 1D4M1 1F4AA 2DDUA 1NQJA 3GHNA 3CJIA 4Q1PA 4WM8B 3SNMA 4AFDA 2BBVA 2BV4A 4DIQA 4FPCA 5HI0A 1RUD3 3OEBA 1JZ5A 1YJKA 3ZKYA 2E51A 3NQHA 2YDEA 4WVZA 1DYPA 4HBNA 4AVVA 2NYYA 1C8M3 1AJKA 1D0HA 1YI9A 2WO1A 3GZUC 2P37A 1PZ8A 5E16A 1N3OA 2BNNA 2Q0AA 1BEV3 4MGYE 3LIGA 3ZXDA 4XJWA 4E9KA 2Y6LA 1K42A 4NPRA 4ONUA 2A75A 4XACA 1RMU3 2ZMLA 3LDBA 1C28A 1HRV3 2J1AA 2VCCA 4YRDA 2CGPA 1BQPA 4JCKA 1H2KA 2B5HA 5DMYA 4AEDC 3ZO0B 3AC0A 4LBKA 4HN1A 4YW7A 4DS0A 2WN2A 5DN2A 3OUJA 3WNOA 1F2NA 1H30A 1VR3A 1IOAA 1RUNA 5TSWA 4AAPA 4X8PA 4XIOA 4P9YA 4UFLA 1HN0A 5JWPA 5D8AC 3LSDA 1PGW2 1WMXA 1DGRN 4MVTA 2HWD2 1NA1A 2CAUA 4GB33 3AP4A 1AX1A 4XBQA 4E4HA 1EUTA 1KXGA 3VHPA 2R1BA 4A7KA 3J9SA 4QQPA 1PK6A 1RUH1 3R0RA 1UMHA 3I3DA 5BY5A 2RDRA 4E4SA 4P9XA 3DN7A 5JOXA 1TME2 1APNA 2XHNA 2YXSA 4JGZB 1XNTA 2WLPA 4P00B 5A3NA 1A34A 1W2AX 2UWCA 5E89A 3MIFA 4RSUA 1JHNA 3OUIA 4E2GA 4ES9A 1CAWA 5FO8B 1RINA 1GANA 1WMDA 3AMHA 3KS7A 5J96B 3ASIA 2OVUA 3B3QE 3QOPA 1ASJ2 4PJYA 3ROUA 3ZYFA 3ZSJA 3M3OA 2VUCA 2WZR3 2XJSA 3POIA 4K1ZA 4HVQA 3IDEA 2G9ZA 4FQ4A 5LCWL 3SISA 1VB2A 4BMBA 4HVOA 4LO6B 3VD5A 1W3XA 3WT3A 2HJIA 4QGMA 4WBBA 1PMIA 1UYZA 3Q8CA 2IXLA 4AFMA 5A70A 2GZWA 3THDA 3KLSA 2W1WA 1ZBA3 4IEXA 3AK0A 4QX1A 2DU0A 2HWD1 5FZMA 4RA0A 1MS0A 2DTWA 2ZTNA 4EZHA 1UIKA 4FOQA 1UMIA 3RZHA 4FI9A 5ABJC 3C2UA 1AYM3 5CZKA 1MVEA 2GU9A 1RUE2 4LOSA 3T2OA 5G05L 4EWDA 3ZN6A 1GR3A 2XL9A 4MSVA 5GZGA 2AEZA 4MYEA 4TN7A 1NY72 1TME1 4XAEA 2IUWA 3SKJE 3V65A 5J09A 3I2GA 5FZAA 4XFBA 1N1VA 5FLJA 1W9TA 3NNFA 4AAXA 2Y6HA 4QGNA 4FBFA 3MLKA 1ASJ1 1AR72 5EYYA 4WVMA 5FZ3A 2XVGA 5FZGA 2EIDA 1C57A 4BDVB 1V6NA 2EIBA 5FPXA 4E8DA 1CAUB 1FYUA 4MADA 4EJRA 1IPSA 5T55A 4CCOA 5DAWA 5A33B 5FIXA 1DYOA 3VHOA 2XR4A 1KQRA 1UOJA 2BWCA 2VNVA 3FBYA 1N3QA 1DBNA 4RQPB 4A6SA 3K51A 4QQOA 3VBFC 4YGEA 1X50A 2JDKA 3MFCA 2E32A 4PLNA 5EHDA 4R9DA 3VB9A 2VVFA 4XVHA 4A7ZA 3O0VA 3U4XA 3FFZA 3H8UA 3WHTA 5I91A 1EAH2 1I9RA 3APBA 4ARXA 1DGWX 5FZLA 1SBEA 2GDFA 2YZ4A 3BOPA 4LBQA 1AR82 3T09A 1NXD1 2WWUA 4R52A 4AVCA 5C8CC 4XFFA 2BQPA 3ZFFC 3WEZA 2QJVA 4BB3A 5T54A 5FBJA 5A3WA 4AHZA 2DVDA 4F7ZA 4P9WA 5HCAA 1D7PM 3H8XA 2QDNA 2OZ6A 2A5ZA 3D3AA 4PQ9A 2CU5A 2XWJB 3PTYA 3A4UA 3I3MA 2HWC2 1HXS3 1BVVA 3GNEA 1WW6A 5FZFA 3BTZA 1RHI2 3UL2A 1SDWA 2A6XA 3RZKA 3MF6A 3NV3A 1COV2 1UY1A 1W04A 3ITQA 3QBQA 1Q56A 1C3HA 1BCXA 4EN0A 1JYNA 4FFGA 2F6BA 1TNFA 3PUSA 4AL9A 4ZZ8A 3AVSA 5CKMA 1QDCA 2BFUS 3KGZA 4LO5B 4H3WA 3CZJA 1GZTA 5LK7B 2CGOA 5IK7A 4BQ3A 1AR81 2BUKA 3RDIA 3JQWA 2WS93 3B5LB 5JCTA 1VALA 2OW4A 3E6CC 3GJBA 1G8WA 1BBT1 5JXIA 1IGOA 3BPSA 4QPGC 2FDKA 4XOGA 1UX7A 2W1QA 3CQOA 5KXEA 3WQ7A 3O1PA 3NW4A 5JDBA 2XUEA 4OUSA 2ZGSA 3AMPA 2E6VA 2YV8A 4AQTA 4YSFA 3DYOA 2XJPA 3OCPA 3USSA 2XL7A 4IEQA 3WDXA 1RHI1 5I0TA 4L11A 3PVOA 2BZDA 3OBRA 4AI8A 3H50A 5FDBA 5ISLA 2XGXA 2AC1A 4M4RA 5HCBA 1XYNA 4YGBA 1UYXA 2WL1A 3RYRA 1MEC3 3FWEA 1RTVA 1W8TA 1CQ9A 5IVYA 1KDKA 3JD72 4JRAA 1GQPA 4QD2A 3PMSA 4U2AA 4QMAA 3TB0A 4JKKA 3OTFA 3OF1A 2WR9A 1Q8QA 2J42A 3DKQA 3I2IA 3CL1A 1QKQA 1RUC3 1TMF2 1IPJA 1JW6A 4QQHA 4CCNA 1VMJA 4NJ4A 3S7IA 1IS6A 5FP7A 4CTEA 1W9SA 1PIV1 4Q4W2 3MPBA 1H1AA 4PLMA 4ES8A 3H0OA 4AHXA 4BM8A 5F6KA 1DLLA 1ZREA 1UIJA 3ELNA 3K4AA 2VPVA 1EPZA 4XXAA 1W6MB 4HLTA 4J6GA 4OHVA 2RS53 4CEWA 1JYCA 1HRI3 3RYPA 1N3PA 4W8JA 4DUWA 2ZPXA 3ABZA 5C4WA 5F3EA 5GLWA 4E27A 2JENA 2WFF2 4LBJA 1HQWA 2PQQA 5CFCA 2C24A 2G4IA 3FBMA 1JZ4A 5C70A 3NAPC 4F3JA 4GJZA 4CP2A 3SC7X 3HAGA 1FMD2 1CAVA 2BWAA 3JD71 1FOD2 3PJQA 2VW1A 3GZTB 2QQLA 5L9RA 3MZHA 1IPKA 4AI9A 5AVAA 1R1A1 5FKBA 4KGQA 4R9BA 3VBSA 2WUHA 2XONA 4QT6A 4ZU5A 5JXGA 4GMP1 1XNBA 5CB7A 1R093 1TMF1 3HT1A 2R0HA 1AZDA 3TBDA 2JG8C 2PHXA 2VCAA 1KJLA 2WC2A 2DCZA 2IXHA 1OSGA 2VBPA 4IDZA 4Q4W1 4L9BA 3ZXKA 1SFPA 2HH9A 2BJSA 4ASLA 4RR3C 5CISA 2GC2A 1J58A 2G19A 1KFXL 3KV6A 5FP3A 4CUGA 4PLOA 3IDBB 4K6BA 5DQ0A 3JZVA 2X5IC 2D7FA 1RIRA 4Y1VA 4AFAA 1NCRC 4QGLA 2WNVC 3AKPA 2VG9A 3WDTA 3KT4A 1RUD2 4BQ1A 1W2TA 4NHYA 3RS6A 3S6PA 2X09A 4AI2A 3WG4A 3B93A 1AR92 2QFEA 3WQBA 2BFUL 4YGDA 3ZFGC 1KS4A 3ZR5A 1S0GA 5T5PA 5DG2A 5FP8A 2NQYA 4WM7C 5IW0A 4L0PA 2RS13 3ACIA 3OYWA 3P6BA 3VZOA 2RDQA 1RMU2 2UY8A 4IV3C 4NAMA 2W9XA 5A7OA 4AFBA 5FBZA 2JX9A 2I74A 3OPZA 4PBPA 2ZHNA 1ZZ9A 3BIEA 4MGZE 3WG2A 1CAXB 2WNUB 4R9AA 1XNKA 4FTEA 4QQLA 2O14A 1ZZ8A 5B2GB 5BNNC 3ZXFA 1CN1A 1IG3A 3U0ZA 2RM23 3VL9A 3NWKA 2ZGTA 1RUD1 1H2MA 1WMEA 1GOHA 2ZMNA 1RUG2 1UU4A 1UXXX 4HL0A 4CZSA 1AR91 3AKTA 1C8M1 2C0ZA 4GWJA 4Z07A 5JSRA 4COZA 5DZEA 3JB4C 4XHBA 2D97A 4A3XA 2ZXQA 1PZ7A 1BEV1 1RGSA 2KXLA 1C1FA 2QQKA 3RI8A 1LRHA 4LKDA 4IL7A 1X36A 4FP2A 2GH2A 2YHJA 1HB1A 2VD7A 2RR13 1RMU1 3WNMA 2DV9A 3S7EA 3LWCA 1HRV1 4A3ZA 2QQNA 2BOIA 1W8HA 3CJIB 4LHNA 1W3VA 2WO7A 3HQUA 1J83A 4N7IA 4AGGA 1Q8VA 1SG3A 3VBOA 1O4TA 3ACHA 1KDMA 3JBG3 4RS5C 1H4GA 4IE5A 4K1YA 2QUOA 3SMHA 2R062 1BK1A 2QBXA 4Q1RA 5KWRA 1XU2A 5LY1A 3RZGA 2IFRA 1IQAA 4QQ2A 4G4FA 1Y9MA 4GB31 1JZ8A 2XJRA 3SKVA 1RUG1 1Y7BA 5G04L 3WQ1A 2P17A 5C3RA 3BUCA 3WF4A 1XE7A 2CAVA 5JSPA 1WUVA 1NE6A 2VBBA 2VUJA 5FKCA 1K45A 3EJKA 3THCA 3AYCA 5DUXA 5IVBA 5FY7A 3MIGA 5F5CA 1LB2A 3PU3A 3ZR6A 3EB7A 5C33A 4LKSA 1TEIA 1FV3A 2PLV2 2D6MA 1ZA4A 1FPN3 4UW6A 5F32A 1LODA 4KWKA 3JCIA 5JIAA 4BOWA 1NA1B 1H9WA 3W21A 3H8RA 1UY4A 1YCIA 4IE0A 4L99A 2VO5A 1KRIA 4DQAA 5DZFA 2JECA 4NAOA 1PK6B 5FZKA 5FYIA 1ZZ6A 3CLPA 3M70A 4IV1C 3DPRB 1G7YA 5DUUA 1WD4A 1GP5A 4NWVA 4QDSA 2HWD3 1ZBA1 4R8HA 1O3SA 1ACCA 2W91A 2FD8A 2YBKA 3OOXA 2FHRA 3IMNA 4BHPA 1CAWB 2BVVA 3CO2A 1I5ZA 1JU3A 4ZS2A 4XAAA 2ZEWA 3KQ4B 3LOIA 1TME3 1CESA 1SCSA 1WKYA 2VZUA 4YGCA 1J3PA 1UPSA 4ISRA 2WAAA 2ZGNA 3ME2A 3SCHA 5EIYB 3N36A 2DCYA 1S2KA 5CFDC 3HNBM 3MPPG 2A7AA 5FZCA 3J7NA 4NROA 1AX0A 3GYDA 1ASJ3 4YZ4A 3N4MA 2Z2SB 2VVEA 4YM3A 5JZGA 4OI4A 4AVTA 2D93A 5FWJA 1DQ0A 1DF0A 2V4AA 2GMMA 4CPBA 3AL5A 3M8LA 4KNCA 4S2DA 3VBUC 1WCUA 4EN6B 5A7SA 3MYXA 1LOFC 4CU7A 4SLIA 3ZN6B 1UX6A 4OCTA 5FZIA 3RZJA 4AQSA 3O1TA 4YM1A 1L7RA 3TN92 5ERLA 3MIBA 3PURA 5GKAC 4UOJA 3ZSMA 4K40A 4JHTA 2JDUA 2DCTA 3LEIA 1Q5OA 5LEKA 3FE5A 2KA3A 3B00A 5IFPA 5F9TA 1REFA 1RUE3 1N1YA 2EXIA 1RUF2 4RGAA 4XCBA 2BW8A 3LOBA 1YFWA 5FZ4A 5FZ8A 4XABA 4WVMB 3FL7A 5FZDA 3AJZA 3U37A 1US3A 2BDRA 1AX2A 1OH4A 2GC1A 4J1WA 3F95A 3VBHC 4CDXC 2P4EA 3AZYA 4GIQA 1UY2A 2JDMA 1G9AA 2TNFA 4O7XA 2CV6A 4FCAA 3MDPA 1OOPC 2QQMA 1AR73 1ZX5A 4RHV3 3O1VA 4M4PA 2YUEA 2V09A 1O3QA 3PIJA 5GLZA 1X7NA 3LDKA 1S0DA 3CZUA 4LR4A 5BNOA 4ZXEA 5DDJ2 3J7LA 3VDDC 4AE2A 3U10A 4F8AA 3WF1A 1ND3A 4DB5A 4QXHA 1N1TA 1NE4A 2B42B 1QDOA 2P5BA 2Q30A 3H1WA 3HT2A 4AI3A 1ZBE2 1CVNA 1IKPA 1EV12 3I2OA 2ORZA 2D44A 4XJ9A 5C9AC 1V70A 4BQXA 5C6CA 5BNPA 2NP0A 2BERA 1DQ2A 1EAH3 1RUF1 2ZHMA 1X9TA 2TUNA 4DEQA 1EPWA 3VDBA 1HX6A 1OMIA 4GD4A 2YFUA 1E5RA 3AFGA 1RUC2 3ENRA 1DHKB 5A1LA 5C71A 2VZPA 1NKGA 4LA2A 2WS91 2IZWA 4FPJA 4WV8A 3LFIA 1WW7A 5FZBA 5A7QA 3F2ZA 1O6UA 2UYAA 2QCSB 2JE8A 4B1LA 4XTPA 2W68A 1SLIA 1XYPA 3ZN4A 3UNPA 2HWC3 2Q5TA 3KSCA 1HRI2 2QQPA 3BPZA 1W8ZA 4LBQD 2YYOA 5DDJ1 2Q8EA 4AG4A 5KBFA 1RHI3 1SHWB 5D2AA 2XJUA 2CGNA 1COV3 3POEA 3H3ZA 3NJZA 4S2HA 1UKRA 2W1SA 4PI2A 1OUSA 5FLHA 1WMFA 4N9HA 4UFKA 1EV11 4RFRB 4IGPA 3VKLA 1AR62 5JMCA 3MEPA 1C8NA 2G1MA 5FPBA 3RZMA 4YW1A 2ATFA 3POGA 1Z0HA 4K3UA 3S5AA 4FO9A 4QX5A 4B7EA 2W08A 3W5MA 3H1MA 2AH2A 4XMAA 4DNYA 1RUC1 3LKJA 5EYXA 1OXCA 4ZKTB 5CAZA 2YB7A 1OPMA 5FO7B 4P02B 3WDUA 4UW3A 1HV1A 4H7MA 1ZM1A 1MZFA 1W2UA 4A2UA 4BCUA 4B4RA 5IVFA 1DG6A 3JXSA 2NMNA 2C4XA 3WF3A 1UZVA 1W0PA 2CNAA 2D6KA 1BVP1 3NNMA 4W6WA 3P3PA 4Y3OA 1HRI1 3PJYA 4DZGA 5KXDA 2YBPA 2WQ8A 1NT0A 4GH4C 4IQPA 1U5XA 4Y4YA 2VMDA 3WUCA 5L7OC 2P34A 3C7GA 5CKQA 2PYTA 4RN5A 3TRSB 3O0WA 1PM4A 1QJFA 2QNKA 1A8MA 3UKTA 4DMIA 1POV0 1OI6A 3C7HA 5A3UA 2YFZA 1AR61 3JD73 4FPGA 1SMVA 1K5MC 4XF9A 4Q4Y2 3VD9A 4YW6A 2W46A 3U1XA 4A45A 1IS4A 1QOTA 4CCDA 3VGIA 5FZ0A 1XQNA 3A23A 1MQTB 4GMP3 5FXVA 2E7QA 1TMF3 2JD9A 3MW2A 2OT7A 1R091 4D7YA 4CEWB 1G9FA 4CUCA 4BIFA 5LW9A 4Q4W3 4CCJA 1QEXA 3OD0A 5C4WB 4PCRA 1VBB2 2VQUA 1NOVA 1XNDA 1Z78A 2IXCA 3ES1A 3PUIA 1ALYA 1F4HA 4AI0A 3AMQA 4PQQA 1G6NA 4FAGA 3BYWA 4W65A 5IK5A 3RMYA 3ATGA 4OQ8A 1DZRA 3VD4A 3IM0A 1JU4A 3OPWA 4GWNA 1UW8A 4H14A 4TYSA 4LK6A 2WFF3 5FV3A 3VBSB 3E5XA 2OS2A 5GLVA 1LAJA 1ULEA 4M3CE 1ODNA 5FY5A 5J7MA 4ZZ5A 5HV4A 4P9LA 1NQDA 1ND2C 4AYUA 1FMD3 1W90A 2EVXA 1OBNA 3M2MA 2D40A 1FOD3 5ANQA 5J1XA 4Q4Y1 4Y5TA 2O8OA 1JZ3A 1ZZCA 2DCKA 1O91A 4O61A 3SEEA 2E53A 1MS9A 2Z42A 1VBA2 4NOTA 4AW7A 3MFAA 1OFSA 5C5TA 2QDRA 3ZYIB 2P3YA 3BGAA 4BZ4A 4AVSA 5IVVA 3T4HB 4Q4V3 3NO8A 4BQYA 3MV01 1OQDA 1QXRA 2ES3A 2HWF3 2WZEA 3ILFA 1KEXA 4LQRA 1E5HA 4GULA 5BYNA 3ZSLA 2O0OA 4FOVA 1F15A 2P2KA 4ASMB 4HSLA 5AFBA 2OXBA 1KITA 4N43A 3VBFB 3VZMA 4Q8LA 4BIOA 2JKXA 1Y43B 1VP6A 3DXUA 4YW3A 4NIIA 1NXMA 4EWAA 1OQ1A 1JYIA 4MGSA 2RM21 4NHMA 1BMV2 2PHRA 3OYWB 3OGJA 2VJXA 2ORXA 3WNNA 4DEVA 1AR93 5F5AA 4QXKA 4G3YC 5FWEA 5JR2A 2WWJA 2YC2A 5IWFA 3HD8B 4K8FA 4HKLA 1R082 2R0FA 5FMOS 3B9IA 1F9KA 3R4UA 5C8CB 4PDWC 4ATEA 4B29A 1VBA1 2ZX2A 1ST8A 3VZNA 1OUXA 3T1MA 3ZYHA 1QU0A 2WYSA 3H7YA 3UJOA 2RR11 3DKWA 5A3TA 3PVBB 2VUDA 1PO12 4IERA 4JGYC 1N47A 2D6LX 2Q1ZB 1FPN2 2VQ0A 3HQXA 4MOAA 4GWMA 2HLEA 3WZ1A 4OZOA 4FPYA 4OI0A 2AR6A 5FXZA 4OHXA 3AMNA 3VZKA 2HEVF 4UI9L 1W8WA 2R072 3JBG1 2LALA 4EWEA 4NUBA 3PDQA 4JHZA 2VH9A 3MIHA 2D5HA 2PMWB 4YM0A 4DRRA 1BMV1 1RUG3 4I0BA 2VOKA 4LT5A 1AVBA 3IZOA 3DPRA 4HKOA 4N53A 2WO3A 3B7MA 3I2HA 3LB9A 4J1XA 2EXHA 3PL0A 3WINE 1R081 4QU1A 3SCFA 4BU2A 3FN9A 1L3JA 1XB9A 3VBOB 2JKBA 3ON7A 4YVWA 3RFRA 1PVXA 2IXIA 4LIUA 4YNIA 2YGMA 4QPYA 4Q0SA 4M3CB 1PO11 2VY0A 1NLQA 3OEAA 4QKBA 4YARA 1FPN1 1KS5A 1UWWA 4YVSA 3ZYRA 5E8AA 5EJ3A 4AI1A 1CX4A 3GGLA 5EWSA 2HBTA 3H8OA 2Y64A 3A21A 4GA9A 4I30A 2GH8A 2R071 4TTGA 4CDUC 2D5FA 2HEWF 4IEZA 3ZX7A 1OFNA 5EJZB 1DP0A 1R1ZA 1RXFA 2R063 3D4KA 4UFMA 3UT0A 1NLRA 1LU2A 2P6CA 4NR1A 1PGW1 1Z7S2 4ZXKA 2XLFA 2OPKA 1UYPA 2XUMA 1Q3EA 2ILMA 4HK9A 3ES4A 4QPIC 3HOBA 4KG8A 5L36A 4DXZA 3IDAA 2PHTA 4PT6A 5E1RA 1QOSA 5A6QA 2A6VA 2ID4A 3DGTA 3ZPYA 3M3CA 3Q8BA 1V6MA 2ZGRA 2A6YA 1REDA 2B45X 5F1RA 1YLLA 3GXUA 4NMIA 3ZMOA 5JPMB 5CFCC 1F5JA 5AC92 1BXHA 1A78A 3NV2A 1FNZA 3T0DA 3OG2A 2IVIB 1WD3A 1XE0A 2PLV3 2QZ3A 3MW4A 4XDQA 3V0BA 1IS5A 1WCQA 2ZX0A 3LF7A 2YG0A 1MZ5A 3AKSA 4RHV2 2K0GA 5LBEA 4XFCA 3IAQA 4UFIA 3O1OA 1AL22 2XJTA 3GCWA 5FAXA 4XFGA 2RV9A 4XYXA 3IIAA 1UU6A 2JE9A 2ZZJA 1PX3A 3N7JA 3JQXA 1R64A 4XF1A 2ZGPA 1DQ5A 1O4ZA 5CADA 4BISA 2XVKA 3NAPB 3UKNA 2LW8A 3WR0A 3ZYGA 2Y6FA 1PO22 3POSA 1GV9A 3AVRA 4LKEA 4JZRA 3U78A 4D6QA 1LHWA 1ULDA 4QDQA 4XC9A 3RYKA 4RL7A 3X29B 4CCMA 1QY4A 2Z69A 4GALA 5CIRA 1W9YA 1RUE1 1VMHA 4LUMA 3WDVA 3R6SA 1B35A 5A7WA 1G9BA 3RJ2X 1ULGA 3H7JA 5JZGB 1NY71 1UU5A 2CHHA 2PHFA 3QH6A 1IQDC 2DUQA 4TLFA 5A7NA 3RMXA 5A6ZA 5AC91 2DYCA 5FY4A 3IN9A 1L7LA 2PHWA 3FLPA 4KWUA 3BOWA 3UESA 5K0UC 1H8TC 4CDQC 2RS32 1GWLA 1AR71 4RHV1 4WM8C 2ZX1A 3EYPA 2CWSA 2R49A 5I8YA 2Y8KA 5B4XA 1V6IA 5FJKA 4UFHA 4WZCA 3SQOA 3LPGA 4XF4A 4XE9A 3CMGA 4DXTA 5FR3A 2RJ2A 1Q8PA 3ORJA 2PAKA 3TN93 3O1MA 1CONA 1PO21 1RXGA 2C9KA 1SLCA 4MXVA 5CBLA 1DYKA 4FFHA 2Y6KA 5I8TA 5CG8A 1O4YA 4CP9B 3GBGA 1RUF3 2LRPA 3AX4A 1EAH1 4HFSA 4HSJA 3D6EA 2VZRA 1QJEA 4XW3A 5DUWA 1UN1A 1QIQA 1UYYA 2J1VA 4MO3M 4TSVA 5CU1A 4FSJA 5FPZA 1WLCA 3AB0A 5BNOB 3AZXA 4META 1W6NA 2VECA 1VBE3 3V64A 4AXOA 1LGBA 1Q43A 5EPAA 3ZSEA 1ND3B 4WZFA 2RS31 4N9IA 1BJQA 4I3GA 4AZZA 4NN0A 3SH3A 3H9AA 1VB4A 4LJHA 2QQUA 1V6JA 3M7AA 5IAVA 5A1FA 2FDHA 2HWC1 2XJQA 2ZGQA 5DDJ3 1WWYA 5E6HA 1W99A 4AEDA 5BNPB 1S0BA 5DAQA 2DUPA 2CY6A 1W6PA 4EN7B 5T3NA 1COV1 5IJRA 2GNDA 3FMGA 4Z1VA 1ZBE3 1GZCA 3KQRA 1WCDJ 4NPMA 3VBRB 1EV13 4Q4X2 2BNOA 4JGZC 2H6BA 3N9MA 5D8AA 3HJRA 1RJ8A 4BMEA 4UWDA 5IK4A 1LOCA 3ACGA 4DOUA 2HYXA 4RGKA 3DECA 1U12A 5K7PA 5I0SA 2WINB 4CEYC 1UXZA 1X82A 4LE3A 2UYBA 2WQ4A 2B39A 4XQDA 1ENSA 4XMIA 1URXA 5GM0A 3SCGA
chains in the Genus database with same CATH topology
3M3QA 1DZQA 1O5UA 2D6NA 2DVFA 2NM1A 2ZX3A 3J26N 3VL8A 4KGGA 2ETEA 1ZRCA 1D2QA 1H8VA 2HWE3 3D5OA 4INDA 5HXVA 1MQTA 4FPHA 4GMP0 3IT8A 2JD4A 4KBBA 3POYA 4GKXA 3FZ3A 4G9SB 4EN9B 1SBFA 2VVDA 3LA3A 4OHWA 3V56A 4QHBA 2P3IA 5I8SA 1Y3TA 4Q8KA 1CPNA 4Z92B 4FXGB 3NKTA 1AR63 2B7YA 4YG0A 1PGSA 5DUVA 1HV0A 2WSUA 4Y24A 2NMOA 4Y1ZA 3SH4A 2WJSA 5ABJA 4SBVA 1TQ5A 3U07A 1HKDA 4Q4V2 2DF7A 1OPOA 3E97A 1CD3G 1TNRA 1VIWB 1B09A 2C1FA 3ACLA 1H2LA 3PHMA 1SFNA 3FC0A 1DFQA 1GKBA 2HWF2 3SHRA 5IK8A 4RQPC 1IKQA 3MGUA 4HVRA 2NLRA 2VU9A 3I2DA 2UY9A 5AFEA 1LKNA 4KL1A 2WFF1 4Y1YA 4C1XA 5FOBB 3H3UA 3T1LA 2OUHA 4Z82A 2DFBA 2WSVA 5H9RA 1FMD1 1FOD1 4Q4Y3 2D3RA 3IWZA 3VBFA 4C1WA 1HLCA 3ZFEB 1O3RA 2JG9B 1IHMA 1RUJ3 2PTMA 5CA6A 1RVF2 3O12A 4Q4V1 2GC3A 1F8VA 1VBB3 4LLFA 2ZAHA 4KWLA 3G7DA 5C8CA 2HWF1 1RC6A 2OA2A 3B94A 3ZFFA 4OULA 5FFOC 1F5FA 2CYFA 1S0EA 5EV7A 3ZDSA 1LR5A 2AREA 3I59A 4UW4A 1O7FA 3N7LA 4D69A 1AYN2 1DZTA 5JOYA 3FFQA 2K9ZA 4B7KA 2XBO2 1VBA3 1HIXA 3KZ4C 3QLQA 4LE4A 2I07B 4HK8A 4QM9A 2XB6C 2MNGA 4N43B 4JV4A 3ZMNA 4MGKE 4LHLA 3OY8B 2O8QA 2C9AA 4ORFA 4QPGA 4CDWB 4M3CA 5A3LA 1UZZA 3BTAA 1XRUA 2AYHA 1SLBA 1AYN1 3ALQA 1LECA 2EA7A 3VKFC 3NV4A 1H2NA 1R083 2V73A 2XBO1 1LEMA 4DINB 2JXAA 5GJ6A 5JR7B 2F4PA 2Y26A 1RUI2 4LHKA 1FX5A 1PO13 3TOJA 4RGGA 4COYA 1ZRFA 2GAUA 4I0AA 1QH6A 3JB8A 4V1PA 1U5IA 3WHUA 2R073 4JTNA 2YPJA 4LO4B 2IC1A 3HMYA 3AYAA 3MLJA 2R061 4N53B 4H55A 5IUQA 3QD6A 4GKYA 4AHYA 4JDOA 2NZ9A 1S0FA 4YVWB 2WT1A 4RFT0 4GXLA 2X29A 2ZGUA 3VZJA 5FRAA 4JDMA 4AVBA 3D82A 2PAEA 4YVSB 2QE3A 3NAPA 3WXPA 5FQ0A 3G6JB 4K9SA 2WQZC 3PVNA 2IXKA 1ZYBA 1AL0G 3DV8A 2VOXA 4QU2A 1DQ4A 3B9CA 4BLJA 2PLV1 5JAXA 2WT0A 4C0HA 1AJOA 2JG8A 5F6LB 1ZRRA 1HQNA 1MS8A 4KH9A 2XPJA 2A73B 4RR3A 2BGCA 3HN1A 1Z7S3 1QQP3 3VKOA 2X5IA 1C5HA 1NCQB 2IWGB 2ENRA 2HYKA 4FTBA 1T6GC 1NCRA 1QJZA 4LBLA 2WNVA 3V0BB 1CJPA 1Y9QA 3AP9A 1MS1A 2TBVA 5J37A 1SQ4A 4HPKA 1PHMA 5AC93 3LZZA 1YIFA 3USUA 5GZFA 4K7JA 4HT1T 1QJU2 3ZFGA 4BA6A 1PVC2 4IEWA 1D0GA 1VBE2 4I3PA 2ZA9A 4WM7A 2RE9A 3LA2A 2WNUC 3HBZA 3B01A 4IV3A 4FPKA 2ZS6B 3EXUA 1AL23 3LAGA 3CNAA 3WUDA 2NPIA 4MX3A 1V9U2 2VMGA 1B35B 3TN91 1PO23 2ARBA 2VNOA 1GYKA 3AP6A 5C8WA 1KJRA 1O5LA 2DVGA 2VOVA 3V0AA 2PFWA 1E57A 2IFWA 5BNNA 2JICA 3WP5A 1OD5A 2DFCA 4Z8BA 1OLRA 3CJIC 3WY6A 2ARXA 4E2SA 3VBRA 2MEV2 3ST7A 4CP1A 1PVC1 1VBE1 1W6QB 5CNAA 2RS33 1JTZX 3WP3A 2HWE2 4M00A 1CJDA 3ILRA 3WNXA 2XH6A 2GMPA 2Z79A 2PHLA 2A3XA 4P9JA 1TE1B 1YRZA 2X53S 1V9U1 3WW4A 1C5IA 2E7TA 2QKDA 3NVCA 4RS5A 5H9QA 2V5YA 4D94A 3EBRA 5J36A 1ZBE1 3D0SA 2VXRA 3WW1A 2X8KA 1W6NB 1YNAA 1YO8A 4KU7A 1QXPA 1UCXA 5LRSA 1PZ9A 4NHKA 3KD4A 1JH5A 5GALA 1U5ZA 1GLHA 4COVA 4XBLA 3B69A 1NA1C 2ERFA 4UBGA 1CGPA 2MEV1 4OFGA 4AEDB 5ACA2 3WW3A 1PK6C 1W6PB 1W0OA 1D4VB 1WLWA 2CL2A 2E9QA 3DPRC 1DQ1A 1YJLA 2HWE1 1UZYA 1XYOA 2I45A 2FZ1A 4LUKA 4UXAA 5D8AB 5FLIA 1YXWA 2WLQA 3LSEA 4U36A 4IXLA 4NVPA 1Q8SA 3TNQA 5CVRA 3MICA 4LA3A 3ZIXA 4IV1A 4XXPA 4Q4X3 2WFPA 1GNHA 2P3JA 3E6BA 1UD1A 2DVAA 4M0NA 2OYZA 2RJKA 1RUJ2 1I6XA 1JOJA 2Y0IA 2YGLA 4Y22A 3I8TA 2MPFA 2ZMKA 4B8EA 4LEJA 3ZFEA 2JG9A 3KMHA 5K8SA 1A3KA 5CFDA 1MS5A 3MF9A 4GQ7A 2UURA 2AGSA 1HDKA 1V6LA 2CTVA 4WVVA 2UU8A 1YFXA 4YW4A 1UMZA 3HIFA 2R6QA 4AEKA 3DUIA 3VBUA 1RB8G 3NV1A 1NLSA 4F83A 5ABJB 1LOFA 2EAKA 4FQZA 5JPNB 3IDCB 4JQRA 3ZXGA 4COWA 3E6DA 5JOZA 4PIXA 4IEPA 4KG0A 3MLLA 1POV1 1RUJ1 1GZWA 1GFF2 1D4M2 4AEMA 3N7MA 5D1IA 4YW2A 5I0RA 4OI1A 1VBB1 3VBHA 3URFA 4CDXA 5T5OA 3EHKA 2KM2A 3IBMA 1OOPA 3UK9A 4BYYA 2XLGA 4XQWA 5KHIA 2B46X 4RD7A 4Q26A 3I54A 3J8F3 1DIWA 5BUVA 2VOWA 2DUOA 2Y38A 3OY8A 1W6OA 3VDDA 2W39A 1XNCA 2VNRA 3VHRA 3PLQA 4KWJA 1QJY2 4CDWA 2D3SA 4MXWA 4Y5Z0 2IXJA 2BTVC 2VQAA 2ZKLA 2ZKNA 4Y20A 4JTOA 4M01A 1VBC2 5C9AA 3VN4A 4EROA 3ZFFB 4MLOA 1H1IA 1RVF3 3KCXA 4COUA 1J59A 1HW5A 3I59B 1YFYA 5I0UA 2FQPA 2Y0OA 3AYDA 2CWMA 3N35A 5L73A 3ZYJB 4DPNA 4XQ4A 1RUH2 2XJVA 3FUOA 1O3TA 4MGIE 1C4RA 4PF5A 5SV8A 4L97A 5A32A 4IEVA 1ZVFA 3TWIA 3PVEA 1SLTA 2WWSA 3E5UA 1EY2A 3M3EA 5BXXA 1VJ2A 3O7OA 5T50A 3L2YA 5DZGA 1AYN3 1QJY1 4YM2A 3GBWA 1ZZ7A 4HETA 1N1SA 1FXZA 2XBO3 3DF0A 1WBLA 1OKQA 3AFKA 3ZVXA 1VBC1 1GSLA 2FMDA 1YIPA 4Q0QA 3RRDA 1QGLA 1SBDA 3THPA 1ONAA 2VGDA 3NSTA 4QPGB 1KFUL 1ULFA 4LO8A 4YZ5A 4BPZA 2EAAA 1UAIA 5KHKA 3ETQA 2ZABA 3TNPB 1S2BA 3WCRA 2DCJA 1CIWA 1H9PA 2WIIB 2AZ5A 4IEYA 4Q0VA 1HQLA 1LU1A 3RI9A 2D6OX 1QQP2 1WGPA 2G9GA 4OLLA 3FHIB 4TWTA 1CR7A 1NG0A 3LGRA 2XLAA 3GZAA 1FV2A 1MQTC 1S1AA 4GH4A 1LGNA 3H1YA 4AGRA 5LEJA 5L7OA 2JJ6A 1RL3A 3CU7A 4CEYB 1LOBA 4YFZA 4CEWC 1J1TA 4D7SA 5C4WC 3WP4A 1NCQA 1AHSA 1K5MA 3FUQA 2GN7A 4URTA 1RUI3 1MVQA 5FCCA 2GSYA 4LLOA 3RJRA 3E5QA 1MS4A 4HMZA 5DXDA 3WG1A 3VBSC 2FBEA 3MIDA 4PIYA 2K2SA 2R043 1Z7S1 5FQ0B 1QQP1 1V6KA 3BU7A 1DQ6A 5KHGA 2A70A 3AKRA 4P14A 2DVBA 2GALA 2EF6A 1QJX2 4I09A 3U11A 1EP0A 1U5YA 1LHOA 5FMOL 4TZDA 2JG8B 1ND2A 4FVVA 4B4PA 3WP6A 4FXKB 4FAHA 4RR3B 2RHPA 2ZOEB 5FREA 3ZIWA 4QM8A 2A71A 4CRQA 4LNVA 2H0VA 2X5IB 1PNGA 1LENA 2GNMA 2LM3A 1AL21 5K9YA 4NWWA 5H9SA 1NCRB 3POWA 3WDWA 4UW5A 2WNVB 1W6QA 3LCPA 4JAAA 1VBD2 2B8MA 2C5DA 3TAYA 4HPKB 2BYVE 5J3UA 5EXOA 3USUB 2BVBA 2YC0A 3ZFGB 1BBT2 1QJX1 3QCWA 1EYBA 3WLUA 2XKOA 4WM7B 3N7KA 3AP5A 3O0XA 3CEWA 2FMYA 4IV3B 3GBFA 4KQ7A 2PAMA 1QJU3 1VRH2 1PVC3 2RMU2 2PHUA 2TEPA 3WV6A 1SLLA 1AXYA 4P9IA 1V00A 2VMHA 4PDWA 3D0JA 5GZDA 4AGVA 1QNWA 3A0NA 3EO6A 4JGYA 1FAYA 1XE8A 3V0AB 2GMEA 2R16A 5BNNB 2HWB2 1QXJA 2GN3A 3IPVA 4MUVA 1V9U3 2MHFA 1VBD1 4C90A 1ENQA 4NO4A 4B4QA 4Q0UA 3VBOC 2WA4A 5T5JA 1PIV2 1QWRA 3O5SA 4K21A 3R05A 4FPOB 3AM2A 3B02A 4HKWA 1LOGA 3OBTA 4YLZA 4XFAA 2SLIA 4M0HA 4UBHA 3EQEA 4FOWA 2MEV3 4EN8B 3BIWE 1VRH1 2RMU1 4XTMA 3P3NA 2D43A 4RS5B 3VV1A 3KGLA 1FATA 4IEOA 1MZ6A 5JOWA 4A7YA 1MR5A 1XU1A 2AUYA 3D8CA 3O14A 3WDYA 4R4ZA 3MW3A 4WVWA 4LBNA 1WCSA 2HWB1 1VAKA 1R1A2 3WW2A 1J3RA 4CDUA 3KT7A 1LHVA 5JVVA 3I4IA 2WA3A 4Q4X1 1GQGA 2BNMA 1BZWA 4LULA 4QPIA 5J48A 4P5HA 1H0BA 5JLVA 1DU3D 1WLDA 1QMJA 4ATFA 3AMMA 2ZBJA 3ZYPA 5ACA3 5FOJB 1NZCA 4IETA 1A6CA 4L92A 4K20A 1OQEA 1WW4A 4LO7A 4IV1B 1S0CA 2R32A 2VULA 4N90A 4OZXA 5I93A 1VAMA 3DL3A 2LTNA 1I3HA 4N7UA 5KXCA 1LJ7A 3J8F2 4AWDA 3RQ0A 4AF9A 5JIUA 2W0XA 1UF2C 1SACA 2JDZA 4MZUA 1DGWA 5JZGC 1GBGA 1QHDA 1U0AA 3ZXJA 4Y22B 3BCWA 4XZPA 1LGCA 1POV3 1WCKA 5CFDB 2DTYA 2WNEA 4LBMA 4YZ1A 2VW0A 3LA7A 1OLQA 1PNFA 2G9FA 2LUWA 4O9GA 3KT1A 4Y26A 4CP0A 1YHFA 2P3KA 2UWAA 3VBUB 5CG9A 3FX3A 1DGLA 4L8QA 4I2OA 5K0UA 1UL9A 2HKXA 3KCCA 4PIZA 3GALA 1AXKA 1H8TA 1C8M2 4CDQA 4OUMA 4XFIA 5BV6A 2VMIA 1UKGA 5L19A 4WM8A 3GHMA 2JEMA 4AHWA 1GICA 3J8F1 5KC5A 1BEV2 3ZXAC 1JXNA 4MH0E 4OVEA 5GLUA 3C3VA 4YZ2A 4HANA 4BE3A 1KD7A 1OHFA 2DURA 3JU9A 1GZWB 5IT6A 4CYDA 1HRV2 5A3MA 5BNOC 1G9CA 4EV0A 2YY1A 3NL1A 2PA7A 2XVLA 3VBHB 4CDXB 3AKQA 1ND3C 1A8DA 3RSJA 2Q4SA 3R4DB 2H0BA 2GNTA 1RVF1 1OOPB 1D4M3 1IZ3A 1JN2P 2WZPP 3A0KA 1LOEA 4E4DX 4HZFA 2YROA 2QZ2A 3NKGA 5BNPC 1AXZA 4GB32 3RZZA 3AYEA 1W6OB 3VDDB 1M06G 2R1DA 3VHNA 4FT8A 3VBRC 3ZN5A 1D2SA 4MXWB 1BKZA 5KHHA 3WX5A 2A3WA 2N7GA 2ZHKA 4Q0PA 3PMEA 4JRLA 2QVSB 4Y1XA 4S2GA 4Y20B 1QH7A 5C9AB 2A6WA 4FPLA 1MZEA 1OA2A 1QF3A 1QJY3 2FZ2A 1S0JA 1X33A 4XJ8A 3BODA 3ZXLA 3S30A 3HR9A 2WZR2 3W58A 4JGZA 1VBC3 1SEFA 1WW5A 3W9AA 2D3PA 4ZU7A 1VLNA 4NHLA 2PELA 5GLTA 4CEYA 3AP7A 3AZWA 4M3CF 5A32B 4I01A 1ZBA2 1WBFA 1FT9A 4DY5A 1XXNA 3RNSA 4W6YA 1RUH3 1AYM2 4X8NA 4Z2WA 2R042 1DGRA 4LTAA 2H6CA 2ZJCA 3FJSA 1WA4A 5DG1A 2GC0A 3N3HA 1H1MA 4XETA 2NN8A 4YYOA 4R9CA 1CPMA 4DY3A 4FTSA 2OZJA 2WZR1 1PM7A 3UV9A 3GF6A 2PN5A 2ZZQA 5LK5A 1RUI1 3TYJA 1G86A 4FPEA 4R4XA 1LESA 3MIEA 4P9GA 4H7LA 1H4HA 3AZZA 2XKPA 5F5QA 1ENRA 1CAUA 4GH4B 2RJLA 1AYM1 5A33A 5L7OB 1LULA 2Z5WA 5GZEA 3RWNA 3KCYA 1UPIA 4C0BA 1ZNPA 2R041 2UWBA 4RQPA 3WG3A 3T2TA 4HN0A 4PBOA 4X6RB 5FO9B 3IKWA 1PGL2 1QNYA 3OJBA 3ZFEC 1K5MB 2WKKA 2OIIA 2JG9C 5EZWA 3M3IA 3OD4A 4YG3A 2VW2A 5GZCA 3ILNA 2I2SA 3AXDA 3R4SA 5T52A 1HXS2 4Y1UA 4AQ6A 2R30A 1GZ9A 4XHXA 3ZSKA 2ET1A 2ZACA 4BLIA 5BNQA 3L9JT 3AZVA 5EFUA 4AQ2A 3RG0A 1DDLA 3QH7A 4ITCA 1SFYA 2ZX4A 4JVAA 2EALA 2OUJA 1JUIA 2ZGOA 1C1LA 4FPFA 1ULCA 4ZU4A 4Q2FA 4BH9A 1ND2B 1PGL1 1BYHA 2WS92 3PNAA 1QJX3 1Q8OA 5FTTC 4MV2A 1YYNA 4N43C 2ZGMA 4OI2A 4XF3A 2ZHLA 2WT2A 2ZAAA 4C91A 4XIKA 2D98A 1M4WA 4IEUA 1LTEA 1HXS1 2ZCWA 3SITA 1W39A 1YI7A 1QJU1 2A3YA 4AK3A 1G9DA 4CDWC 1REEA 4D7TA 2JE7A 4DFSA 2E7AA 4XFHA 2XHKA 4AFCA 3Q9OA 4LBQB 5LRRA 1MEC2 1MS3A 1OA3A 4AEJA 4OHZA 4ISQA 4JC1A 1VBD3 4XJUA 3ECQA 1RJ7A 1AUYA 1S55A 1AR83 2PHDA 4YFWA 5KHJA 1RITA 3SXWA 4XEZA 2EXJA 5E88A 1BBT3 4L2NA 4PDWB 4E2QA 1VAVA 3J4UH 1JUHA 2B9UA 3SLIA 4I0WB 4XJZA 1LHUA 2RS52 4JGYB 4Q27A 4W6XA 1LCLA 1SLAA 3OGGA 1VRH3 4B3NA 2RMU3 2ZGKA 3FLTA 3CF6E 3IPVB 1I1EA 4DRVA 4N53C 4XILA 1W6MA 5T5LA 1MEC1 1YFUA 4FOYA 5JSOA 4YVWC 2HWB3 2DWRA 2Q8OA 3M4FA 5HBAA 2VUAA 4YVSC 4X6QB 5KC6A 1R092 3SH5A 3VUOA 1J3QA 3HWJA 1PIV3 1FNYA 3VLBB 4E4ZA 4JDNA 2SBAA 2RS51 3INAA 3WD5A 4Q29A 5ACA1 1OA4A 3RPQA 1AF9A 2EIGA 4CDUB 2BPA2 4IESA 2Q1MA 5H9PA 1JBCA 1GNZA 4O9EA 1V6OA 1NCQC 3AXEA 3KM5A 3WOGA 1NYWA 3QACA 4YG6A 1R1A3 4XBNA 5SV5A 4QPIB 4LBOA 3K48A 2A6ZA 4YW5A 2RS12 4I02A 1IS3A 1LOAA 4AVAA 1F31A 1MACA 1X8EA 2O1QA 5CFCB 5JI9A 4XJAA 5AVPA 3I7DA 2XWBB 3WVJA 3MI8A 2W52A 5JI7A 5KXBA 3W59A 1ZRDA 1CAVB 1FI2A 4BWOA 4OHYA 3L2HA 1LHNA 2HEYF 1X8MA 1QOOA 3JUUA 2AENA 3BALA 4S2FA 2RM22 2EXKA 1B35C 3KB5A 3THTA 1SCRA 3UJQA 5J98B 1CAXA 2WNUA 3UKVA 1YUDA 3WCSA 5BPXA 1LEDA 1RUOA 2ET7A 3BB6A 2YMZA 2ZGLA 4XF0A 2VNGA 4D3WA 1ENXA 3M1HA 2RS11 1J1LA 2RR12 1S0IA 1ZZBA 3AJYA 4KU8A 3ZXEA 5HCFA 1WLTA 2GNBA 3FLRA 2E63A 3VKNA 3VKMA 3WQ0A 4XPVA 1YWKA 3VZLA 2BEOA 5K0UB 3JBG2 2D6PA 4FP3A 3S0MA 1GQHA 2XG3A 1H8TB 4YZ3A 4CDQB 2DU1A 3CJXA 1D4M1 1NQJA 3GHNA 3CJIA 4Q1PA 4WM8B 3SNMA 4AFDA 2BBVA 4FPCA 5HI0A 1RUD3 1YJKA 2E51A 4WVZA 2YDEA 1DYPA 4HBNA 4AVVA 2NYYA 1C8M3 1AJKA 1D0HA 1YI9A 3GZUC 2P37A 1PZ8A 5E16A 1N3OA 2BNNA 2Q0AA 1BEV3 4MGYE 3ZXDA 4XJWA 4E9KA 4NPRA 4ONUA 2A75A 1RMU3 2ZMLA 1C28A 1HRV3 4YRDA 2CGPA 1BQPA 4JCKA 1H2KA 2B5HA 4AEDC 3ZO0B 4LBKA 4HN1A 4DS0A 1F2NA 1H30A 1VR3A 1IOAA 1RUNA 5TSWA 4X8PA 4XIOA 4P9YA 5JWPA 5D8AC 3LSDA 1PGW2 1DGRN 4MVTA 2HWD2 1NA1A 2CAUA 4GB33 3AP4A 1AX1A 4XBQA 3VHPA 1KXGA 2R1BA 4A7KA 3J9SA 4QQPA