2N7GA

Structure of the cyclic nucleotide-binding homology domain of the herg channel
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
131
structure length
131
Chain Sequence
RSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Structure of the Cyclic Nucleotide-Binding Homology Domain of the hERG Channel and Its Insight into Type 2 Long QT Syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2n7gA00
4IEUA 1ZZBA 1J1LA 4J1WA 3H3UA 2BNMA 1NZCA 3E6DA 2IXKA 3HT1A 3BB6A 4YSFA 1Y9QA 3BALA 2MNGA 4QGNA 2XL9A 3WW3A 5C6CA 3SXWA 1ZZ8A 1WLTA 4HSLA 1J3QA 2XLGA 2V09A 1NXMA 1SQ4A 3KCCA 4EROA 4P9GA 4XF9A 5BUVA 1O5UA 2D5FA 4YRDA 1LB2A 1J3PA 4NVPA 2EVXA 2IXCA 1XE8A 3CLPA 3UKVA 1CAUB 4PIXA 5E16A 2DCTA 4AVBA 5FLHA 3B02A 2GC0A 3BPZA 4I02A 4Q0QA 1ZVFA 2O8QA 3M70A 3LA3A 3E6CC 4UBHA 3CO2A 1DGRA 4AVAA 4HN0A 5JR7B 3USSA 1L3JA 1O4TA 4EWDA 1PM7A 4XETA 4KU8A 4CYDA 1OD5A 3ELNA 2BGCA 3H50A 1RGSA 1ZRCA 4HVOA 4N9IA 2I45A 4KWKA 4YARA 4IETA 5J3UA 4I09A 1ZRRA 4WVZA 2GAUA 4LA3A 3GYDA 4FBFA 5CVRA 4LULA 4IEPA 4ZU4A 2HJIA 2B9UA 4Q29A 1X82A 3NJZA 1YLLA 3JZVA 4YNIA 5FPZA 2CV6A 3I54A 2EA7A 3H1YA 3E6BA 3MYXA 4PIZA 3RYKA 1ZRDA 4IEWA 2ETEA 3CEWA 4E2QA 3N4MA 4O9GA 5I8YA 4XFBA 3HIFA 4D7TA 3ES1A 3L2HA 2XKOA 2BEOA 3CL1A 2ZKLA 4KL1A 1UPIA 2PFWA 1CAUA 1ZREA 4META 3LAGA 4H7LA 4MGKE 4TLFA 5I8SA 5D1IA 5JSRA 1UCXA 4I0AA 3EHKA 3PVBB 4KWJA 4HVQA 3ST7A 2Y0OA 1CAXB 3ZDSA 2PAMA 5T3NA 5JCTA 3DKWA 4MGZE 3KGLA 1UD1A 3E97A 3TNQA 1XRUA 4IEZA 1J59A 1Q43A 3OCPA 4OLLA 4PJYA 3H9AA 1RC6A 5FLIA 1O3SA 1O3TA 3IIAA 4QMAA 1O7FA 5CU1A 3BCWA 1X7NA 4HZFA 3PLQA 2CAUA 1GQGA 3FZ3A 2UYAA 3LA2A 1O5LA 3WW2A 4ZU7A 4F8AA 2ATFA 1YFYA 1UIJA 4KU7A 3I59B 3FX3A 4DINB 3LZZA 4BHPA 3G7DA 3RNSA 3SCFA 3QACA 1UW8A 2GC1A 2GC3A 3H8UA 5LRSA 2F4PA 4Z07A 2FMYA 4QM8A 1QY4A 4XFFA 1FT9A 1RL3A 3FFQA 4BH9A 1TQ5A 4IEVA 1QWRA 1RUNA 4HSJA 1LKNA 3EQEA 2MPFA 2GC2A 4L2NA 4HBNA 3SMHA 4LEJA 2Q1ZB 5J48A 5I0RA 5C8WA 2QVSB 2PQQA 1CAVB 2QJVA 4N9HA 4XFAA 2OYZA 1OI6A 2IXHA 2OZJA 2O1QA 3CJXA 4XFHA 2Z69A 2PAKA 4IEQA 5I93A 1HW5A 1EYBA 5BY5A 2PA7A 3NVCA 2CGPA 5E1RA 2VPVA 3EJKA 3NL1A 4JV4A 2VECA 3ES4A 2GZWA 4JTOA 3KSCA 4Q0PA 5JSPA 3SCGA 3MZHA 1O3QA 4I01A 3U11A 1J58A 3FHIB 2BNNA 5EZWA 4AVCA 5FLJA 4LTAA 5BXXA 4E2GA 1QXRA 1YFUA 4HLTA 4Z82A 1SEFA 2PHLA 2UYBA 4Q0VA 3SHRA 1JUHA 3D82A 3OD0A 3U10A 3I59A 2KXLA 5I0TA 1DZRA 4QM9A 4LLOA 5FCCA 5K8SA 4HMZA 1Q3EA 3EO6A 4YYOA 3LWCA 2VQAA 2CAVA 4OFGA 1YWKA 4JTNA 4XFCA 4J1XA 2FQPA 3UKTA 5F1RA 2ZCWA 3SCHA 4AXOA 1EP0A 1YFWA 2E9QA 1FXZA 1U12A 3HT2A 1WGPA 1DGWA 3WW1A 3DL3A 3DV8A 2GU9A 4MGYE 3IDCB 4HN1A 4WZCA 4X6RB 3E5QA 2QDRA 3M3IA 4IEOA 2BYVE 1ZX5A 1YFXA 1IPJA 2D93A 4LA2A 1FI2A 1VP6A 3OTFA 2UY8A 3ETQA 3MPBA 4LUMA 1J3RA 1YUDA 4AQ6A 2OA2A 4ORFA 4QXKA 5FQ0B 1XE7A 3UKNA 3KGZA 5KHHA 2UY9A 1H1MA 3IDBB 1NE4A 3VHRA 4E2SA 2ET7A 3I7DA 4MUVA 4KWLA 3QOPA 3E5XA 1SFNA 3D0SA 4L11A 3RYRA 4A2UA 1ZRFA 2IXJA 5I0SA 4O9EA 4QX5A 2Q0AA 4MH0E 3GBFA 2B5HA 3FWEA 2N7GA 2IXIA 1ZZ6A 2XGXA 2WC2A 5FDBA 1OFNA 3NKTA 4EWAA 1DZTA 5KHIA 3FE5A 5FPXA 3EBRA 4K8FA 2H6BA 4QGLA 4MZUA 5KHJA 1CAWB 2WFPA 4I3PA 1EY2A 2EAAA 3LOIA 3CF6E 3RYPA 5KHKA 4IERA 5JAXA 2XLAA 1I6XA 4ONUA 4JVAA 4F7ZA 5I91A 2IC1A 3S7IA 5J7MA 3C3VA 2XLFA 5LRRA 4BIFA 3H1MA 3TNPB 3H3ZA 4I2OA 2PAEA 1CAXA 1VJ2A 2QNKA 2K9ZA 4EV0A 4QGMA 2XHKA 4XF1A 1IPKA 1H1IA 3BU7A 2Z2SB 1VR3A 2HKXA 4XF0A 5LEKA 3FJSA 4IESA 1ZZ7A 2QCSB 5FQ0A 2D40A 2Q30A 4I0BA 3H7YA 4WBBA 3D0JA 1NE6A 3PNAA 5EFUA 4EWEA 5I0UA 4MV2A 5JSOA 4XFGA 5AVPA 4D7SA 2IXLA 3RDIA 3LA7A 4MGIE 5I8TA 3DN7A 1O3RA 4XF3A 1LRHA 1Q5OA 5LEJA 3IWZA 1PMIA 5HI0A 1I5ZA 4XF4A 4ZU5A 5KBFA 2BNOA 2MHFA 2OZ6A 4MX3A 1GQHA 4IEYA 1X8EA 2C0ZA 4X6QB 5BPXA 1CAWA 3NSTA 3HQXA 1V70A 1ZZ9A 4BYYA 5BV6A 2OPKA 4PIYA 1OMIA 4Q0UA 1EPZA 1WA4A 1YHFA 2ET1A 1X8MA 2GH2A 1NYWA 3S7EA 1CAVA 2PTMA 3OGJA 4AQ2A 5KHGA 2PHDA 5CADA 2Q4SA 1G6NA 4FAHA 1CX4A 1Y3TA 1QXJA 4UBGA 2H0VA 4LUKA 3RPQA 1ZNPA 1RTVA 4GULA 3RZZA 3MDPA 2H6CA 3O14A 4FAGA 4B29A 4Q0SA 1ZZCA 4HVRA 1UIKA 4XEZA 3S0MA 3H1WA 3KMHA 4RD7A 4R8HA 4IEXA 1RUOA 3WW4A 3ACLA 4R52A 4UXAA 2K0GA 2B8MA 2PYTA 3OF1A 2XKPA 4FT8A 2XL7A 2P17A 3NW4A 1CGPA 1LR5A 3H7JA 2D5HA 3E5UA 3ROUA 3IBMA 4XFIA 3U0ZA 3R6SA
chains in the Genus database with same CATH superfamily
2WYFA 4XTMA 2BTVC 2QQOA 1J1TA 2ZMLA 4N43C 4LBOA 5IAXA 2BRTA 4XHBA 5T52A 2BNMA 3VDDC 3HT1A 1S0JA 3AMPA 4QPGB 4H3WA 4UWDA 3RQ0A 3WG4A 1C8M3 4UYBA 1ASJ3 3SH4A 4YSFA 3CBNA 4DOUA 4GQ7A 1V6NA 3BALA 4PQ9A 2MNGA 3GHNA 2PMWB 2VM9A 1QKQA 2WN2A 1G9AA 3Q8EA 3SXWA 3WDUA 2R0FA 4X8NA 4JZRA 5DAXA 2XLGA 2V09A 4EROA 3TEYA 1B09A 4HANA 2P3YA 4P9GA 1AZDA 4PCRA 1HQWA 2WT1A 5JWPA 5HCHA 4C0HA 2UWCA 4IV3B 1O5UA 1KFXL 4O7XA 3I2OA 2A6VA 1LB2A 4NVPA 3RZJA 4AVVA 1GP6A 4BISA 2XONA 4QXHA 4NIAA 3JCIA 4XDOA 4CU8A 3ZXFA 2VW0A 3EB7A 4MGTA 2CY6A 4TSVA 5C3SA 3N9LA 4XIOA 1C1FA 4MVTA 3UKVA 4PIXA 2JEMA 1WCSA 3ALQA 2WN3A 3TBDA 1QIQA 5CZKA 1AUYA 2GC0A 4LOSA 1UYZA 1HXS1 4BQWA 1KS5A 2F17A 2XDVA 4Q0QA 3RZHA 4WM8A 1V0AA 3AL6A 3AFGA 3ZYPA 1QJX1 4AHWA 3ACHA 2VXJA 2P5BA 3LA3A 5FMOL 3UYJA 1C8M2 1NA1B 2QDNA 1ASJ2 2RS51 2VOKA 4UBHA 4CCJA 5FZFA 5HBAA 4GIQA 1L3JA 5FZ8A 2Y6GA 3PTYA 1E5SA 1PO13 5CIRA 3VBFA 1UZWA 4GH4A 4KU8A 1OD5A 1APNA 1DQ5A 2BGCA 4NHKA 3O1RA 2ZHLA 2WNVB 5BNNA 4ZZ8A 3VD7A 3B94A 4KWKA 3WG2A 4FFIA 4Y33A 4FSJA 5J3UA 1O91A 3LKJA 2E31A 1AX0A 4Q4X3 4WVZA 1RUJ3 3UNPA 2RJ2A 1S55A 1ZA7A 5EQUA 4QPWA 1SDWA 3RMYA 5A3PA 3N9NA 2HWC3 2W68A 3B69A 4V2WA 4QPGA 4FBFA 3VDAA 3VBSB 2B9UA 5JZGA 1UYYA 4PHZA 1A3KA 4DMIA 4YM0A 4FOQA 1ULDA 2A6ZA 2ZGSA 4ATEA 5F37A 2WT0A 3JZVA 4LKSA 1N3OA 1SCRA 3MIDA 4LO8A 4YNIA 2Q8CA 4LR4A 3E6BA 4M3CF 4Q4V3 4XE9A 4Y5SA 5BNOC 5GZCA 4NIGA 2VD7A 2XBO1 4LO7A 1CX1A 2W95A 3AZWA 1YQ2A 5HXMA 2PHFA 3AKTA 3CEWA 3DUIA 4FPLA 4FPCA 4SLIA 5C3PA 3KF5A 2W91A 4W6XA 1PZ9A 2FZ1A 2P4EA 1PGW2 4IV3A 3K4AA 2RHPA 4XFBA 5FOBB 5I8YA 3SQOA 2JKBA 4URTA 5I0DA 4AHYA 4NO4A 5IVCA 4TXWA 3PU8A 3HNBM 3T3YA 1LTEA 4Y1YA 4GB31 3L2HA 5LASA 2VR4A 4BXFA 3MLJA 2BDRA 3GZTB 2P1BA 1JYTA 3WINE 4MHUA 4LBQB 4QB6A 2XKOA 1DFQA 5IW0A 4QPIC 4OMDA 4QX1A 4KL1A 3AK0A 3WR0A 3KT7A 1UPIA 2QQNA 4UFJA 4OHYA 4IE7A 1WKYA 1Q8SA 4IV1B 4I0AA 4RQPB 1DCSA 3EHKA 3FHQA 3PVBB 2JICA 4UT5A 1RUJ2 1URXA 4YGDA 4TN7A 3I2IA 3DPRB 2HWC2 2Y0OA 1UKGA 4IW3A 1PNFA 2JDKA 4Y22B 1AR83 3K48A 5F3IA 3MIHA 1R093 2C9KA 2YBKA 1HKDA 1NA1A 2ZZJA 1UOBA 5FYCA 2ARXA 5A7SA 2P3IA 5T3NA 2R32A 2XOMA 3DKWA 2R043 4MGZE 5GM0A 3WUDA 3ZKYA 3U14A 2WBKA 4Q4V2 1CZSA 3VZKA 3EXUA 3ZN4A 1JYVA 5FY9A 1OC1A 2VC9A 3POBA 3I4IA 5F5CA 1J59A 5FO7B 1OOPB 4PJYA 2GNTA 1GANA 1ND2A 1PX3A 4GWIA 5F3CA 3A23A 1RC6A 3LB9A 5FLIA 1WLDA 1HB2A 3IN9A 2YHJA 3WNKA 3VZMA 1O7FA 4TTGA 4XHXA 5FZEA 1DZQA 4ASLA 3BTAA 1YC61 1YEWA 1H6XA 3GGLA 5CG9A 2C1FA 3HMYA 1E57A 3LA2A 2JB8A 4WM8C 2ATFA 1NCRB 4GWNA 1MPXA 4Y20B 2CL2A 4LBNA 3CKHA 3I59B 2VJXA 2W1WA 2BZDA 5DZFA 5FZCA 4M4PA 1YJKA 4BHPA 1PGSA 4NRPA 4INDA 3G7DA 3RNSA 5L7OB 2QQMA 1UW8A 3H8UA 4GJYA 2JDPA 4Z07A 2SLIA 2ZGRA 3RGBA 1AR82 2WO3A 1RUE3 4ZHNA 1R092 2RS32 1FT9A 1JU4A 2ZEWA 5DXDA 1S0CA 3M3OA 2ZGPA 2RJKA 1YQ5A 1ZBA1 2R042 2E51A 3POGA 1V6KA 1H2NA 1HJGA 4IGQA 4Q8KA 5A6YA 2J1VA 1LULA 4HSJA 3MFAA 1CPMA 4LBQA 1EAH3 5FJHA 3NV2A 1FPN3 2WINB 2Q1ZB 4LEJA 5BNPC 5J48A 3V56A 5C3RA 3CZUA 5JZGC 2RDSA 3WUCA 1MEC1 1NCQA 2QZ2A 4RQPA 3ZFEC 3DXUA 3MLLA 2FDHA 2I07B 1F5JA 1JYIA 1S2BA 1OI6A 1XBFA 2IXHA 2RS13 3DPRA 3VL8A 1XNCA 4Y26A 2JDAA 2WRAA 2ZKNA 1AYM1 2WS91 4Y22A 5JPNB 1G9DA 2BJSA 2Z69A 2PAKA 4IEQA 2L9LA 4PLOA 2ZGNA 1OKOA 1S0BA 1RUF1 2SBAA 1YIPA 1RUG3 4Q1RA 4GMP0 2YGMA 4B7EA 2CGPA 1RUC1 4XZPA 1LEMA 1W6MB 1R1A1 2KA3A 2OVUA 2QQVA 2VBDA 2VPVA 4D6SA 1QJU3 2K46A 1NLRA 2Y33A 2VECA 3PUIA 1H9WA 1S0IA 4LO4B 3MEPA 4OUSA 4BJ0A 2VG9A 2TUNA 1PVXA 2WSUA 1RUE2 2GZWA 1XNDA 3RG0A 3KSCA 4BK4A 2JG9B 3SCGA 4I01A 1OA3A 2JJ6A 1J58A 1RITA 5EZWA 5IVYA 2VAUA 1KS4A 2KM2A 1XSQA 5FLJA 5BXXA 4E2GA 1EAH2 1FPN2 1OD3A 1SEFA 3MUY1 1NCRA 4G9SB 4JHZA 1OF3A 3AZYA 3FLTA 3I59A 5EP9A 3ZR6A 2KXLA 3K77A 5EYYA 5JXGA 2YGLA 2X5IC 5C3QA 1BLZA 3RWKX 4QQLA 5FZ3A 1SLBA 2RS12 3IDAA 3WNNA 4DUWA 3NNJA 4HK8A 5FMOS 1ND2C 1KQRA 1LNSA 5FFOC 3GM8A 4WVMB 2ZS6B 1CVNA 1GOGA 3OBRA 5FY7A 4MOAA 2FDJA 2VQAA 5DZEA 2CAVA 2D3SA 3ATGA 2FQPA 5F1RA 1W2NA 5F3GA 4CCLA 2WA4A 4UI9L 5FYMA 3VKFC 3B00A 1U12A 2XB6C 3JBG3 1Z7S3 4AI2A 1SLTA 3QD6A 4B8EA 3WDYA 2VMGA 1G7YA 5C70A 3BYWA 1OPMA 5FTTC 3S5AA 3ZFGB 3DV8A 3ZR5A 2ZTNA 2OUJA 3PTRB 1F9KA 4HN1A 1FV2A 3QLQA 3VHNA 1LJ7A 2IFWA 3OPWA 1QOSA 2VU9A 2JDZA 4JGZA 2EXJA 1IPJA 4LA2A 1FI2A 5A7PA 4XJ9A 4AAPA 3M4FA 1W6MA 4JQTA 5M0TA 3BUCA 1HB3A 1TZOA 3MPBA 4LUMA 1J3RA 3SEPA 4PBOA 4QXKA 5HPOA 3ILNA 2D7FA 1R083 2ZGMA 3BGAA 1H1MA 2DURA 3HQRA 2G19A 1VAKA 1H9PA 2ZX3A 4RSUA 3WZ1A 4E2SA 2ET7A 4MUVA 1F8VA 4KWLA 2P6HA 5F5AA 5CFCC 1WCQA 4D69A 1NCQC 1GBGA 4QQOA 5C71A 3FLPA 1R64A 4LBQD 2ZAAA 4MHRA 4PF1A 4A2UA 4XXPA 2XG3A 4JX0A 2W46A 3WSOA 4K6BA 1COV3 3O12A 4MH0E 2Z42A 1G9FA 2E7TA 3T4VA 3FWEA 2TNFA 3E1F1 4CDUB 1LU1A 2XGXA 3UV9A 2DYCA 4C90A 3ZYIB 1V00A 4M0HA 1OKQA 1W8NA 2ZHMA 1VBC3 5IJRA 3P5BA 4Z92B 4PI2A 1W6NB 5AC93 4COWA 1E5RA 1ULPA 2I2SA 2R071 1S2EA 4I3PA 2BBAA 1LOEA 1HRI3 3CMGA 3L9JT 5LW9A 2EAAA 2WFF1 2E32A 5L19A 1KJRA 3TWIA 1PVC1 1W04A 2XLAA 1I6XA 1SLIA 1WW5A 4FP3A 1WW7A 5A6XA 1H4GA 4AGGA 4XJUA 2XLFA 4IE6A 1X9TA 4DUXA 1HX6A 3H8RA 5FP8A 1R082 1UQXA 3TNPB 2WO7A 4P9XA 3MW2A 5FP7A 2HYKA 1MR5A 3AYCA 1CAXA 5F6LB 4MYEA 2YXSA 1VRBA 1HQNA 4IL7A 4LHKA 1WMXA 2NP0A 2EXKA 4CUAA 4UFMA 5IK8A 4XF1A 1FAYA 2ZABA 1COV2 1IPKA 1H1IA 1GWKA 4MXVA 1WMDA 1POV1 4LORA 4IUGA 4M00A 3ZYHA 4A45A 3FJSA 2JECA 4DZGA 3A0KA 2RM21 4AZZA 4CRQA 1VBB1 3BKZA 1R1ZA 4BQXA 1VBC2 3N7KA 2AEYA 2G1MA 5HV0A 5FO8B 2ZHKA 5FZ9A 2RJLA 5AC92 2FDFA 4NMIA 2X8KA 1HRI2 1J84A 3EYPA 1YRZA 3OG2A 2C4XA 5I0UA 4MV2A 5JSOA 4P9LA 5AVPA 5C8CA 3JQXA 4W6YA 3FUQA 4D7SA 2ERFA 4KBBA 1JBCA 1CD3G 3DYMA 4HETA 5FUPA 3DN7A 2WL1A 4CCEA 3OBTA 4XF3A 4BQYA 1LECA 1DDLA 5JXIA 4YGBA 4JGZC 5T50A 2P2KA 3W59A 3IWZA 3BN6A 2WWUA 3OPZA 1I5ZA 5HI0A 3CHXA 5JIAA 3FC0A 3WF3A 1EUUA 2OZ6A 2XHNA 4MX3A 5DUXA 1D0GA 4HT1T 1W6NA 2AENA 1BBT3 2VUJA 3ILRA 4HONA 5BPXA 4YW5A 3NWKA 4R9CA 4XQ4A 3V65A 3HQXA 1ZZ9A 1DYOA 3WOGA 5BV6A 3VHPA 4AEDB 3WP3A 3ZYGA 2PHTA 2CSGA 3J26N 4FP2A 4PDWB 1VBE3 1NUKA 4I0WB 1EPZA 1WA4A 5A3UA 1BQPA 2ET1A 3J9SA 2WWSA 3OGGA 5IYYA 5C3OA 4W8JA 2O8OA 5F39A 1CAVA 3J7LA 5E89A 2R0HA 3OGJA 1XYNA 2IZWA 2DF7A 5FJKA 5LY2A 1VMHA 5CADA 1IKPA 1UOJA 1GNHA 1JXNA 4FI9A 3I49A 1W03A 1ZNPA 3AP4A 4GULA 1JZ6A 5CNAA 3GBGA 1W8WA 2ZJCA 5J36A 1DF0A 5FBJA 4GMP3 3KT4A 5EXOA 2XWJB 1UIKA 5SV5A 1PIV1 3DXTA 3WT3A 5FYYA 5A6ZA 2VOTA 5A7NA 1AR73 5FMDA 1K3IA 1S0DA 1GP5A 3FLRA 1LEDA 2WNOA 3OUJA 4R9DA 5T54A 4I30A 3T30A 4COUA 2ID4A 2GNDA 4Q1PA 1GKBA 2DFBA 1CESA 4BWOA 1KGYA 3ACLA 1RIRA 1BBT2 4MADA 1XSRA 5ACA1 4UXAA 2QQJA 3OF1A 3IZOA 3T2PA 3V0BB 4MXWB 3LCPA 1VBE2 3MI8A 1CGPA 3H7JA 2D5HA 1AL0G 3PURA 1WW4A 4LKDA 1TNRA 4K3UA 4W50A 4XFIA 5FP4A 3VBOA 1PNGA 3U0ZA 3A22A 3R6SA 4N90A 5FMCA 3WF1A 5EIYB 2YFUA 2A3YA 2A7AA 1U5IA 5A3NA 4J1WA 3OY8B 3G6JB 3LDBA 4RS5B 4AR2A 1RUD3 4HXCA 2AACA 1ULFA 3MF9A 4P08A 1H8VA 2OQ7A 3JB4C 4KG0A 1S4CA 3PUSA 5LK5A 2V73A 2A75A 1DGRN 4UAPA 2WZR3 2R16A 2VOWA 1NLQA 5C6CA 2W92A 1GMMA 1IG3A 2VZRA 4AEDA 1K5MC 4HSLA 1GR3A 4W65A 3A0NA 1J3QA 4PDWA 4IDZA 4IE5A 1NXMA 4DQAA 1AR72 3KCCA 4GJZA 4Y3OA 5GLWA 4QX8A 2HEYF 5C8CC 1HB1A 3KV6A 2D5FA 2WA3A 2UU8A 4YRDA 1J3PA 1TVGA 3W9AA 4UFHA 1UXXX 1MS8A 4L8QA 1QJY1 4Q4W1 2DU1A 1N3QA 1JZ3A 2DCKA 5FO9B 1GZTA 1VBA1 2A6XA 5A7WB 4YW4A 2FBEA 4K7JA 4YZ4A 4AVBA 1WA6X 2V72A 3BPZA 1FNZA 4I02A 3WEZA 1FOD1 4CU7A 4XUNA 2DTWA 1RUD2 2FHRA 1BK1A 2Y26A 3PMEA 4AEKA 3M70A 2QZ3A 2NN8A 2BP6A 3K51A 3PUQA 3J8F1 2WZR2 4NROA 1DGRA 4CP0A 4K21A 4Y4YA 3RWNA 1YQ6A 3ZFFB 5D8AC 4EWDA 1PM7A 3ZN5A 1RUH1 3ELNA 3MV11 4S2HA 2GMPA 1DP0A 2VTFA 4HVOA 4N9IA 3OD4A 5LY1A 2AUYA 1W99A 4CDXB 2ZX0A 4GZ9A 4LK7A 4AQSA 1M4WA 1PM4A 5FZ4A 3T1LA 5JOYA 3I2HA 1WBLA 4I09A 3OY8A 1OQ1A 1MS5A 2RMU1 3MIBA 4H14A 4AQTA 2E7AA 4COZA 5FYUA 5JR2A 2V5DA 5CVRA 1V6OA 3O1OA 2HJIA 1GP4A 3BI3A 2A70A 1X82A 1QF3A 4Y1ZA 2BU9A 3WQ0A 3NO8A 4Q2FA 2XH6A 2CHHA 5LWBA 5C33A 3AM2A 4PIZA 3GXUA 4B1LA 1AR91 1GU3A 5FZ7A 4B1MA 4FPYA 5FKCA 5IWFA 2HWE1 3MO4A 1IS5A 4A6OA 3WQ7A 1KJLA 4J25A 4BZ4A 3N4MA 1K12A 1OLME 1I5PA 1BKZA 1U5XA 4JRAA 4CCCA 4D7TA 3VBOC 1AL23 1FMD1 1D4M3 3ES1A 4LK6A 2BVVA 2VMDA 1OLQA 3B3QE 4JGYA 1HJFA 5KXDA 2YY1A 2JDUA 2WZ8A 1YYNA 4N8MA 5FZMA 2ZKLA 1BJQA 5A7WA 3WV6A 3K3NA 2O14A 1ZREA 1DQ2A 4FPHA 4META 3K2OA 4MGKE 2G9FA 4P5HA 4TLFA 2DTYA 5E88A 5K9YA 1UYPA 2DCZA 1UCXA 1ZA4A 3BIWE 5FZ6A 1S0GA 4R4XA 4KWJA 3HAGA 4M01A 3IAQA 4LNVA 4MSVA 2W5FA 5BYNA 3OSDA 2VL4A 1FX5A 4CUCA 4LKFA 2YBSA 2BQPA 5GZEA 3ZM8A 2PAMA 1UWWA 4XCBA 3WNPA 2HLEA 3ZFFA 4AI8A 3UJQA 5C9AB 3E97A 3T1MA 1C5HA 4FQZA 5K0UB 5T5OA 2X29A 4XBLA 1XRUA 3IKWA 2NMNA 4GALA 1DLCA 2PHUA 4OULA 1O3TA 2C9AA 1RJ8A 4CCNA 3AYEA 3BVCA 1WBFA 4QMAA 1SLCA 2VUDA 3OBAA 1AL22 5F2SA 1D4M2 1YNAA 3AL5A 4LMFA 1YCIA 3PLQA 2YZ4A 3CDZB 2A6YA 1JI6A 2CAUA 4P14A 2JE7A 4ZZ5A 3N3HA 1GLHA 2LW8A 4NJ4A 4XUPA 4ZU7A 2FCUA 4B3NA 4F8AA 3AX4A 1YFYA 3RZGA 4Y4RA 4KU7A 1DQ0A 5LA9A 1C8NA 4AHXA 1YI7A 1RUI1 4Y1XA 4DINB 2Q8EA 3CQOA 5FPUA 1QJX3 4YPJA 5FPBA 1PHMA 1REFA 5CEHA 1SBEA 2JE9A 2Q8OA 1CPNA 4QKNA 4JDMA 3VBHB 1W2OA 1SLAA 1QY4A 2BPA2 2DUQA 1BZWA 3FFQA 4QB1A 1TQ5A 1OUSA 4CPBA 1JYWA 1VMJA 5FYSA 5JUVA 2HWB1 4S2GA 3WDXA 3PL0A 4UFLA 1XXNA 3QCWA 5LK7B 4BB3A 2ZBJA 3FN9A 2GC2A 4JKMA 4FPFA 2A5ZA 3ZPYA 4QX7A 3Q8BA 5I0RA 2Y34A 1J83A 1Q8QA 3M7AA 4Z2WA 5L9BA 4CXYA 2XR4A 1NG0A 1PGL1 4DEVA 1OT5A 2A3WA 2OZJA 3ZMOA 2O1QA 4AWDA 5JMCA 1K5JA 4O61A 5FZ1A 4BLIA 4QX3A 1F2NA 1HXS2 2XVKA 3O7OA 1HW5A 2XBO3 1EYBA 3W58A 1UY1A 4BPZA 2VO5A 5C9AA 1KFUL 1PK6B 1QJX2 5BNQA 3TEZA 1H0BA 4CP9B 3NL1A 3Q8AA 2LUWA 2RS52 1UU5A 1QDOA 4JGYC 4YM3A 3WNOA 3TRSB 2XXZA 3AKRA 5JI7A 3LE0A 4JTOA 3RSJA 4DY3A 1A8MA 1QXPA 4GB33 1KRIA 4Q0PA 3DEMA 3MZHA 5C4WC 1CZTA 2EIEA 3FHIB 4OHWA 1W2TA 4P9WA 1ENQA 2BGPA 4FTSA 3VBRB 4ET7A 4JKKA 3ZX7A 5JOWA 4G4FA 5JI9A 2B46X 4NHMA 3NAPC 4Z82A 2PHLA 4XBQA 1CJPA 2GMEA 3MPPG 1HN1A 4COVA 3RZLA 1G86A 3OYWB 4QM9A 4LLOA 1GWMA 4AEMA 2DCJA 3IM0A 2DVAA 4CUBA 4RHV1 4QHBA 4CEWB 5K8SA 4HMZA 4LBJA 5IK5A 1POV0 2WLQA 1Q3EA 4FFFA 2HWD1 1UO9A 2JG8C 1W0PA 3B9CA 2PLV1 3ZPOA 4AE2A 2XBO2 3WXPA 2R49A 4G3YC 1YWKA 1LCLA 1W28A 1LOFA 3UKTA 4FFHA 4YVSB 4NPLA 4URAA 3P3NA 1YFWA 2E9QA 1FXZA 1PO11 2K2SA 1X9PA 4GB32 1WGPA 4ZXKA 3IIIA 3LDRA 1JZ7A 3THTA 2A1XA 4UW6A 3ON7A 4OI1A 1REEA 3OUIA 3MICA 3ZVXA 2GU9A 4MGYE 2RS33 4X6RB 3A4UA 2RG4A 2W9XA 3HNMA 2WQ4A 1HLCA 4YM2A 1IQAA 2VZOA 2QDRA 4AFMA 2VOXA 2CDOA 4IEOA 4RR3B 3AZXA 1ZX5A 1YFXA 3GJBA 3JD71 4AEJA 1WCUA 3M3QA 4I3GA 3SEEA 1EPWA 1PMJX 1PK6A 2ILMA 4PT6A 4UW5A 4CDQB 1WMEA 2XJQA 4CP9A 2AH2A 4D0QA 4YVWB 3HN3A 2R061 2WNVA 2EALA 5H9PA 1D2SA 3DF0A 1UYXA 4ORFA 5FQ0B 1ZBA3 2D6KA 3LD8A 5KXBA 5KHHA 1AJKA 4CPBD 2AZ5A 4AL9A 2TEPA 2DVBA 5LBCA 1OURA 1SFYA 1H2KA 3AC0A 3QOPA 2YPJA 3VBRA 3F95A 4HG6B 1GQPA 3LEGA 4A7ZA 4M3CE 2BERA 3VBSA 2BFUL 3X29B 1JZ8A 4LITA 2IXJA 4O9EA 1MEC3 3ME2A 4OI4A 2GP3A 4XJAA 4A6SA 4E4DX 1A34A 3USUB 4LHSA 2B5HA 3T4HB 3KHBA 2N7GA 5J37A 1ZZ6A 4OMCA 2HYXA 3KT1A 3OYWA 1DBNA 3L2YA 2VCAA 1AYM3 2GALA 2WS93 3MF6A 4FFGA 3IAPA 5L73A 5FOJB 2PQSA 3KCYA 2DVFA 1D2QA 3VBFC 4GH4C 2HEWF 2BWAA 3FE5A 1RUF3 4K8FA 1VBD1 3EMRA 1UZ0A 4IE0A 5BNNC 4LO5B 2XJPA 1RUC3 2Y64A 4KGGA 4MZUA 1CAWB 1R1A3 1JHNA 2WFPA 3AXDA 5EPAA 4L92A 5T5JA 5ABJB 1SPPB 3RYPA 1WUVA 3VZLA 1HQLA 4IERA 1O4YA 5KHKA 4A3XA 1N3PA 1RHI1 1SLLA 4JVAA 4K1YA 2C5DA 4QPGC 2IC1A 1H2LA 4HK9A 4YVSA 3ZIXA 4DXZA 4EZHA 5J7MA 1XYPA 1SBFA 1ZBA2 3C3VA 4QPYA 2J1RA 4IV1A 4QHOA 4BDVB 2CTVA 4KG8A 1G8WA 4P02B 5IVFA 2YROA 3H1MA 3WNMA 4B4RA 4I2OA 1DLLA 2W87A 5FZAA 1NQJA 1IZ3A 1K45A 4GAZA 1OPOA 4EV0A 2P6CA 5KWRA 1F31A 1MEC2 2XHKA 2ZGQA 1FYUA 4IV3C 5K7PA 1W8HA 1H6YA 2RE9A 3C7HA 4JHTA 1VR3A 4X8PA 1ONAA 1QQP1 4NN0A 4XF0A 2JD9A 1AR61 4BQ2A 1AYM2 1E5IA 2EXIA 2WS92 1OOPA 3VKNA 4YVWA 1ZZ7A 1W8TA 4K20A 1W3XA 3AJZA 1KITA 1RUF2 5FQ0A 2D40A 2Q5TA 2HH9A 2Q30A 3T0DA 4Z2AA 2E6VA 1RUC2 4B7KA 2BOJA 4WBBA 1R1A2 1ST8A 3AKQA 4MLOA 3PNAA 4ASMB 4BMEA 4FOWA 5HV4A 4EYUA 3DGTA 1PZ8A 2WNUB 4Y20A 3RDIA 4MGIE 4NHYA 3AYAA 5FY4A 1C1LA 2Y0IA 4WM7B 1NA1C 3USUA 4LPLA 3VGIA 1O3RA 1N1VA 5IVBA 3JXSA 4XMIA 1TEIA 5L7OA 2J1AA 1ACCA 1I9RA 4C0BA 1Q5OA 1AYN1 3H3LA 2QTWB 3JB8A 4XW3A 1W8ZA 3ZN6B 4A7KA 4XF4A 1PK6C 1WCDJ 5F2WA 5KBFA 1W9WA 3ZXLA 3IB3A 2XMLA 2Z4FA 4HKOA 2WNVC 1K42A 4X6QB 1CAWA 5FK8A 5IVEA 5ABJA 1V70A 4CUGA 4JKLA 3WF4A 3ZXEA 2ZGLA 2OPKA 3IPVB 2J22A 4Q0UA 4YGCA 1BK0A 5CFDB 4OI0A 1GOHA 2C24A 5CG8A 3D6EA 5IFTA 5A80A 1RUG1 4LQRA 3VBRC 4YZ3A 1LHOA 4OI2A 1XNAA 3VBSC 3LFMA 4PQQA 3S7EA 2WLPA 3AMHA 5KHGA 4OHXA 2D6MA 4U36A 3RI8A 2PHDA 3FUOA 2Q4SA 4FPGA 4FAHA 3I3EA 2ZXQA 3ZXGA 1Y3TA 4XDPA 1QXJA 5F8PA 2GP5A 3M8LA 4EQVA 4A44A 4L97A 4HKWA 4Y5TA 3S30A 4FXKB 1RTVA 2JDHA 3RZZA 1BEV1 3MDPA 4P00B 4NIDA 5FPVA 4AYUA 2JDMA 3SC7X 2ZAHA 4Q0SA 1UX7A 1MQTB 4CCKA 3NNFA 1UPSA 2A6WA 2CNAA 4RGAA 5FZLA 3S6PA 4ARYA 1NZIA 4JQRA 4ARXA 2VNVA 4CCOA 4JAAA 3KMHA 4RD7A 1F15A 2R073 4R8HA 2OS2A 4IEXA 2JDYA 2JG9A 3O0VA 4NRMA 1BHGA 4XC9A 2WFF3 3U37A 4RGGA 5GLZA 3LFIA 3UT0A 4CU6A 2X09A 4R52A 4IV1C 4FOYA 4RQPC 3D8CA 2K0GA 2NMOA 1CZVA 2B8MA 2PYTA 2XJSA 1MS9A 2NYYA 2W52A 2WT2A 4FT8A 1GZ9A 4BXSV 2P17A 2WNUA 3DPRC 2VGDA 3ROUA 3IBMA 5LBBA 1VB4A 1JOJA 4JC1A 3T2OA 1C4RA 1N47A 1XYOA 5L9VA 3SISA 1ZZBA 4LIVA 3WF2A 1FNYA 2EXHA 4UW3A 3ZN6A 3H3UA 1NZCA 2IXKA 1DIWA 3JBG1 4YW7A 5AFBA 3H8OA 2BBVA 3BU0A 1OOPC 5EWSA 2F6BA 4YVWC 1POV3 1OQEA 1Y9QA 4N7UA 4WVMA 5DPNA 2XL9A 3WW3A 1P8JA 2RM23 2JE8A 5FPAA 3IPVA 2WJSA 1HRV1 4NIIA 4XJ8A 3GALA 1SQ4A 4FPOB 5IFPA 2R072 3C2UA 2XUMA 2JENA 2JIJA 1IQDC 4YW6A 1NCRC 3MGUA 5LCWL 1SMVA 2WFF2 4AHZA 3A21A 1ZBE1 1PVC2 1ODMA 4DPNA 3OPTA 3VL9A 4QD2A 3ZFGA 4GD4A 2IXCA 3VKMA 4A42A 1RB8G 3AP5A 4D3WA 5L7OC 3CLPA 3N9OA 4QXBA 2BFUS 5FK7A 5C5UA 2JXAA 2ARAA 4XUTA 4P9JA 1Q56A 2DCTA 5E16A 5FLHA 5FRAA 3B02A 3OGVA 1LU2A 3WP6A 3VB9A 2DVDA 4DS0A 1OSGA 1OXCA 5A3LA 4N53B 4LE4A 5ABJC 5JIUA 1H8TB 2HBTA 2TBVA 3IMNA 1ZVFA 3POEA 1F4AA 1TMF1 1WWYA 1ZM1A 3ZSMA 5D21A 1RMU1 3E6CC 3AFKA 3GJAA 4AVAA 2YC2A 4M3CB 4K40A 1F35A 3CJIB 5JR7B 3SKJE 4H7MA 2RM22 3AJYA 1VBB2 5F5QA 5FZ0A 4XETA 1MVEA 2YPDA 3ENRA 1GOFA 4JCKA 4CYDA 3H50A 1B35B 4NUBA 3WF0A 2P3KA 1ND3B 5FYTA 2JDNA 4CDUA 3QH6A 4AFAA 4XYXA 1AXKA 2MEV1 2OQ6A 3RFRA 3O5SA 3PUHA 1XNKA 2YB7A 5K4LA 2GAUA 4XJZA 4LA3A 2V4AA 4QX2A 1S1AA 2GNBA 2AC1A 1UF2C 4YW3A 4Q8LA 4LULA 4ZU4A 3ZSLA 4UF0B 1V6LA 5CYYA 3NJZA 3B5LB 5IUQA 1DU3D 4BMBA 1L7QA 3SNMA 1PIV3 3M3CA 2VULA 2JG9C 1XB9A 5JOXA 2EA7A 1TE1B 3H1YA 2ZGUA 3RYKA 3KVBA 2EAKA 5DABA 4IEWA 3WQBA 1ZRDA 3ZMNA 3SKVA 1D0HA 1GZWB 1JN2P 3GZUC 4E2QA 1I3HA 3TOJA 3P6BA 3VV1A 5ACA3 2J1EA 4O9GA 1YQ8A 2WNUC 2HBUA 3TB0A 1L7RA 2FD8A 2WZEA 3HIFA 2JX9A 4Y24A 3I2GA 2CDPA 4PLNA 1GV9A 3H0OA 1DYPA 1BMV1 1LENA 1GNYA 4ZONA 4C1WA 1OVSA 5EV7A 3BIEA 2BEOA 3CL1A 5GKAC 1T6GC 1W8UA 3PJYA 5FPLA 1W8FA 3HD8B 2W1QA 1QH6A 4CSWA 3D4KA 5GJ6A 3RI9A 4C91A 2QQKA 2GN3A 2YDEA 5JMOA 5I8SA 3RVHA 1UU4A 2VCMA 5F32A 4B4QA 4ES8A 1XOYA 3IT8A 3ST7A 4N53A 4FVVA 2NQYA 3K75B 1G9CA 3W5MA 1REDA 2R6QA 1XPWA 3NNGA 4ISRA 4FOVA 3GBWA 3JU9A 4E4SA 4LJHA 4BOWA 2UURA 1RXGA 1XC6A 2NLRA 3HOBA 2W2IA 3WD5A 1PIV2 2DFCA 4XBNA 4C1XA 4AGRA 3LEKA 5L9RA 4N43B 3J7NA 5DDJ1 3VDDB 3ZFGC 3D5OA 1BCXA 5FKBA 3KD4A 2WYSA 1Q43A 4OLLA 1MS4A 4Q26A 1ND3A 5ACA2 1HIXA 3N7JA 5T5PA 1O3SA 5DAPA 2JWPA 2WQ8A 3IIAA 4Q4W3 4Q4Y1 4OQ9A 4BIOA 4BQ3A 2P37A 3KM5A 3T2QA 5GLVA 3MIFA 2VMIA 5B4NA 5DAQA 4QU2A 3O1SA 1VBA3 1X7NA 3OB8A 4HZFA 5FZOB 2HWF1 5KXCA 4DXSA 2OT7A 4GKXA 1PO21 3HR9A 1WD3A 3MW4A 5G05L 4CZSA 3T09A 5A3WA 3VD5A 3KQRA 3LDKA 1UIJA 1FOD3 2PHRA 3SITA 4AW7A 3FX3A 1PX4A 2J1UA 2ES3A 3PUAA 5C5TA 5A33B 4NPRA 3WP4A 3NNMA 4QQ2A 1LESA 3ZYFA 1QJEA 3I2KA 1W05A 3POWA 3J8F3 2ARCA 1UZYA 5LA0A 1GZWA 2NPIA 2F4PA 1NY71 2ZGKA 4AAXA 2VZTA 2FMYA 4XZUG 3CZJA 4QM8A 4XFFA 3OEBA 1RL3A 1W9TA 1BYHA 3WLUA 3PDQA 1DQ6A 5IAVA 4CDUC 2VVDA 4FPKA 1W6OB 4IEVA 1UOGA 1RVF1 4QWNA 3O1TA 1RUNA 5A32B 1LKNA 3UJOA 5HCAA 4YGEA 2MPFA 2H0BA 2RR11 3SMHA 3OEAA 4SBVA 4PBPA 4WVWA 3N9MA 2ZACA 2OW4A 3AZZA 1JUIA 2QVSB 4RFRB 2RDNA 4XQDA 4Q4W2 1QJY2 2XJUA 3KLSA 3BPSA 2EIBA 1JW6A 2YV8A 4V1PA 4XCAA 1VBA2 3RS6A 2XQRA 2VBBA 4XFHA 4XUQA 1VRH1 2VXRA 4QKBA 5J09A 4NR1A 1YXWA 4CXWA 4QKFA 1FOD2 5BY5A 3ZXJA 2QQWA 3AB0A 2PA7A 1S0FA 3LQCA 3NVCA 4N43A 4XQWA 4MXWA 2HWE3 2QUOA 5E1RA 3O0WA 2YYOA 1EV11 3V64A 3VDDA 2VZ1A 3M1HA 1D7PM 1VE0A 3T2TA 3TN91 3J8F2 1POQA 3MLKA 4QKDA 3ES4A 3T0AA 4C8DA 4LBMA 1FMD3 5EYXA 3VDCA 3DECA 1UXZA 4GWMA 3C7FA 3ZSJA 1C5IA 4RL7A 2QBXA 2ZX1A 3PIJA 4LHLA 4COYA 1RUH2 2VMCA 5BNOB 3V0BA 4RS5A 3AMQA 3VD3A 1TME1 2BNNA 2ZGOA 3Q8CA 3I3MA 4AVCA 3DYOA 4XMAA 5FZOA 1QXRA 4XPVA 4R9BA 1YFUA 4HLTA 3TAYA 4UFKA 3WDWA 2VOVA 1H4HA 4Q0VA 2W47A 1WD4A 1JUHA 3D82A 1JOPA 3OD0A 5E8AA 3U10A 1X50A 3VDBA 3WCRA 2RMU2 5I0TA 4QQHA 1UU6A 4RGKA 5L36A 5AFEA 5A33A 3BOWA 5FCCA 5JVVA 1LHUA 3VZOA 5ANNA 2D3PA 4QPIB 4EN7B 1W39A 2J1TA 1W2UA 5ISLA 1V9U1 1OFSA 4WVVA 2VNRA 3MV01 1X36A 5CA6A 2VVEA 1AR92 2CWSA 1VALA 3AXEA 2W0XA 5A1LA 2HWE2 3VZJA 4GA9A 5IT6A 5A32A 4OFGA 3AP7A 4NAOA 2ZCWA 4DUVA 4UOJA 1US2A 3I2DA 1C57A 1N1YA 3SCHA 1XNTA 1MS1A 1QOOA 1FMD2 2YBPA 4MG2A 3WX5A 3APBA 1ALYA 1GFF2 2YU2A 3ECQA 4KQ7A 3WW1A 4AEDC 1OF4A 3DL3A 1Q8OA 5DAVA 4PDWC 5HCFA 4WZCA 2AR6A 1H30A 3FBYA 3WNXA 3E5QA 2F4LA 4NIHA 3M3IA 4ZXEA 3ZXAC 3GF6A 2OIIA 4NOTA 3PVOA 1ENSA 4EJRA 3R4DB 5LZ6A 4JDOA 3BTYA 3W21A 1ENXA 3OTFA 2UY8A 5LBEA 3N35A 4H55A 3ETQA 4AQ6A 4CDXA 1UZVA 2ZMNA 3WDVA 2HWB3 3NRUA 5APAA 1XE7A 1NLSA 3UKNA 1EUTA 4XABA 1M06G 4F83A 4E8CA 1NAEA 2UY9A 2KR2A 1VAVA 1ZRIA 2W94A 3IDBB 4DXRA 4ES9A 3VHRA 2DCYA 5BNOA 1JU3A 4Y1VA 2P34A 5FZKA 2ARBA 3HNYM 3E5XA 3LIGA 1ZRFA 3K4ZA 1XJAA 1HXS3 1VMFA 5DMYA 2YU1A 4NHXA 5I0SA 4Z1VA 4DRRA 2A3XA 3GZEA 4ZKTB 2LROA 3GBFA 1JHJA 2Q8DA 3GZAA 2W1UA 2IXIA 2RS53 3OUHA 2XQXA 5FDBA 1ODNA 1HN0A 1OFNA 1YI9A 4XAEA 4EWAA 4QPIA 5FPXA 4CCDA 2WKKA 3K46A 4GKYA 5BNPB 1RUI2 1VAMA 4W6WA 4QGLA 1MS3A 2Y60A 3DYPA 3KZ4C 2WIIB 5JZGB 3CIHA 4XDQA 1HB4A 1XU1A 2CGNA 3HQUA 5KHJA 3R0RA 3ZFEB 3C7GA 3CF6E 3I8TA 5F5IA 5IATA 4FTBA 5JAXA 5A6QA 1DGWX 4ZY9A 4RS5C 4AI9A 5FYBA 2LM3A 3KV5A 3ACFA 4KGQA 1STMA 5FXWA 4F7ZA 1QJFA 2PHXA 3S7IA 1MZ6A 3ETPA 5FZHA 2HWB2 4HOOA 3UK9A 1JH5A 1YO8A 2X53S 1HV0A 2YC0A 1JZ5A 4KMQA 1A8DA 5FR3A 2PAEA 4PLMA 5GZGA 2QQPA 5IHRA 1V6MA 3WHUA 3LPFA 3POYA 5A3OA 4E27A 4EN8B 1VJ2A 2QNKA 4R9AA 3WP5A 5GLTA 4QGMA 3DCQA 5FZIA 5A7QA 2D98A 3BU7A 2IVJA 1PGL2 3JQWA 2Z2SB 3J7MA 1C8M1 4P5YA 4XTPA 1ASJ1 3ZIWA 4OZOA 5KC5A 5K0UA 2ZEXA 1OA2A 4RHV3 3WDTA 5CAZA 4IESA 3ORJA 3MBWA 2DBIA 1DQ1A 2HWD3 1YJLA 2C6SA 2PLV3 2QCSB 4TZDA 1AVBA 1AHSA 1UMZA 4IQPA 4I0BA 4AF9A 4A41A 3AP6A 3PMSA 1FATA 3H7YA 3POFA 4CDWB 2X5IB 3D0JA 1NE6A 1SDDB 3U78A 1KD7A 4EWEA 2XWBB 4Q5OA 4XFGA 4KBZA 4DEQA 3I3DA 4AGVA 4AK3A 4DO0A 1JYCA 1Q8PA 3LA7A 2VQ0A 3RJ2X 1ND2B 2WR9A 1IS4A 1T2XA 3PHMA 3ZFFC 2Y8KA 4CXXA 1IPSA 4EZ4A 2VBPA 3LPGA 3PIGA 4IGPA 4ZU5A 3UGFA 5A7OA 3VBHA 5IVJA 3JD73 4MGQA 5BNPA 1GQHA 2ZZQA 4IEYA 2C0ZA 4CDXC 5CISA 1UN1A 1O8PA 5T55A 3ZFEA 3OGRA 2VTXA 1IS3A 1UL9A 2R063 1PGW1 1RINA 3Q9OA 3WG1A 4E8DA 3O1MA 4RHV2 4DNYA 1JMUB 3MUZ1 2Y6FA 4YZ2A 3VLBB 2HWD2 2EIGA 1W6QB 1UX6A 1AF9A 4YG0A 2PLV2 1X8MA 1OH3A 2FDIA 2VTXJ 3ZYBA 1BXHA 2PTMA 3HBZA 3RRDA 4AQ2A 2IWGB 2PELA 2D6OX 3NV4A 1G6NA 2BWCA 4Q27A 3UETA 4TWTA 1AX1A 4UBGA 4LIUA 4LUKA 4OYUA 2DUPA 4Q4X1 1PO12 1RUJ1 3HJRA 5A70A 1QNYA 4XOGA 2VZQA 4NAMA 1VPHA 3ZDVA 3H8XA 2HWC1 4QDQA 4DB5A 1AJOA 3KHCA 5FUNA 4Y1UA 4HFSA 5CFCB 1ZZCA 5FP9A 4HVRA 5HCBA 1VBD3 1NCQB 4RA0A 4OZXA 4Q4X2 3H1WA 1UY0A 4L0PA 4Q4V1 3I97A 1W0NA 3THPA 2UWAA 1NXD1 3JD72 1NOVA 4BCUA 1RUOA 3WW4A 1W9SA 2B39A 3WVJA 2X5IA 1RHI3 4CDWA 5A1FA 4XJWA 2D6LX 2R062 3WHTA 3VHOA 2XVLA 3FBMA 2VZPA 3LF7A 2XL7A 3NW4A 3P1IA 1LR5A 4EN9B 1W6PB 3MIEA 5FIXA 4XUOA 5H9RA 2DWRA 3I2FA 3VUOA 5CKQA 4IEUA 2Z79A 2BUKA 1J1LA 1UY4A 5SV8A 5C9AC 2J7MA 2E26A 3I3BA 4RFT0 3PU3A 3E6DA 4QT6A 4CEWA 5K0UC 3BB6A 1U5ZA 5AVAA 4FPEA 2Y38A 4ZS2A 3NJYA 1XU2A 4OUMA 1QQP3 2XJRA 3F2ZA 3S5QA 1AR63 1AR81 4QGNA 1R091 2RS31 4ISQA 3IDEA 1ZZ8A 2WO1A 1T6BX 1WLTA 4P9YA 2D3RA 3O1UA 3O1VA 1VBD2 3O0XA 3KS7A 2R041 4MO3M 2WDBA 2W39A 2VZUA 3LSDA 4UW4A 4BQ1A 1QNWA 2RDRA 1W6QA 4XF9A 5BUVA 2OPWA 5J1XA 1LHNA 4QXCA 5FBZA 1ZYBA 5CKNA 2EVXA 3D3AA 4AFBA 1RHI2 3ZO0B 3HVDA 1AXYA 5FMBA 4AOCA 1DQ4A 1QU0A 2ORZA 1XE8A 4KNCA 1UMHA 1H2MA 4RR3A 3GHMA 3WCSA 2RVAA 1CAUB 2OXBA 4YG3A 3VBHC 4BK5A 1GWLA 5JLVA 1AYN3 4HPKB 4QAWA 3AVSA 4CDQA 1S2KA 3M2MA 4K1ZA 5CFCA 1RYYA 2GNMA 5J96B 4H2AA 3U4SA 4DRVA 1WLCA 1JYXA 2E33A 5ANQA 2O8QA 4IGOA 3ZXKA 1LOFC 4QDSA 5JXJA 3AKSA 2D43A 5KXEA 2VH9A 1IOAA 2Z5WA 4CCMA 4BLJA 5FXZA 4A4AA 3CO2A 2NM1A 1QQP2 1UMIA 1AR62 4PF5A 4HN0A 4R4ZA 5FV3A 4A3ZA 2BGOA 1RUE1 2GSYA 1O4TA 3AMMA 4JGZB 3USSA 2JIGA 4HL0A 1JS9A 3KQ4B 1RXFA 1PZ7A 3B9IA 1RGSA 3OGSA 4ZS3A 3VBUB 1LAJA 1ZRCA 1W6PA 3LSEA 2I45A 1ENRA 2DU0A 1CJDA 1CONA 1LOCA 2KD7A 4IETA 4YARA 1EAH1 1GZCA 1FPN1 3P3PA 2ORXA 1ZRRA 1OLMA 4CA9A 4NPMA 1GYKA 1BEV3 3N9PA 3GYDA 1BVP1 4K9SA 4IEPA 3B7MA 2VZ3A 4LO6B 1IKQA 4Q29A 4QQPA 2RS11 4DFSA 1YLLA 1SPPA 1Y7BA 1AYN2 4OVEA 5FPZA 1LOBA 2CV6A 1VIWB 3I54A 3VKOA 3MYXA 2A71A 4CDWC 2YMZA 2VZVA 2AYHA 2VVFA 1KEXA 2ETEA 5H9QA 3TEXA 1DGLA 4QDRA 5B4XA 1SG3A 3FL7A 3C7EA 5IVVA 4AI3A 1TNFA 1QJU1 4OQ8A 1X33A 1S0EA 3C8XA 2WNEA 3SLIA 4D6QA 1GNZA 5EJ3A 1D4VB 2LALA 1RUG2 3INAA 3I2JA 3NV1A 5DG1A 2Q1MA 2D44A 3WNLA 5F7UA 3MW3A 2VMFA 4FO9A 2PFWA 1CAUA 1QJU2 4CEWC 1MACA 2E63A 2ZGTA 3LAGA 4H7LA 1IG0A 4HPKA 2WWJA 4TLGA 3B01A 3PVNA 4FXGB 5D1IA 5JSRA 2R1BA 4CVUA 4JRLA 4HVQA 4KI5M 5GLUA 5D2AA 1LGBA 3UGGA 5JXHA 2DUOA 1BEV2 3GNEA 3BODA 1CAXB 4NWVA 2PHWA 2IUWA 3HN1A 4YVSC 2ZPXA 5FP3A 2R7EB 4XVHA 1PVC3 1ULGA 3ZDSA 1HRV3 1PMHX 1JYNA 5CKMA 5JCTA 4LOTA 3NNLA 1QHDA 3KGLA 1N1SA 2ZOEB 5T5LA 1UD1A 3TNQA 2Y6JA 5FZDA 3BTXA 5FYHA 5DN2A 4OHZA 1ULOA 5TSWA 1LGCA 2CGOA 3T0BA 4IEZA 4WM7A 3UESA 3VBUA 3OCPA 1ZBE3 3U75A 4YWAA 1UAIA 4IXLA 3H9AA 1QDCA 1W2AX 2UWBA 1MZ5A 2YFZA 1MZFA 5FYVA 4RR3C 2VE1A 2VW1A 2ZX2A 5FZGA 4YFZA 1K5MB 4CDQC 1LOAA 2D97A 5CU1A 2VMHA 3BCWA 1Z7S1 2ZEZA 3PJQA 2IVIB 4AI0A 1CR7A 2WQZC 3NKGA 1GQGA 3FZ3A 2UYAA 2YG0A 1O5LA 3AKPA 1W90A 3WW2A 5C8CB 1VBB3 4JDNA 4U2AA 3POSA 1O6UA 1ULEA 1JZ4A 3SH5A 1OQDA 2YC4A 2J1SA 3LZZA 4GXLA 5CFDA 1TMF3 3JBG2 3MFCA 1KXGA 1MS0A 1O4ZA 1Z7S2 4O65A 4YM1A 1RMU3 2ZMKA 5FUIA 5FY8A 4KH9A 3QACA 1RJ7A 2GC1A 2GC3A 5GALA 3SCFA 3W5NA 5LRSA 1XQNA 2VCBA 2RV9A 5IK7A 1Q8VA 4PI0A 2GMMA 3AP9A 4BH9A 1HRV2 2J42A 5FREA 4L9BA 2FDGA 1Z78A 2EICA 4XILA 1NT0A 3ITQA 4RYDA 3VZNA 3U07A 4E4ZA 1QWRA 1R081 2WAOA 2Y6KA 3EQEA 4BQ5A 2IFRA 5DAWA 4AVSA 3NV3A 5GZDA 4FQ4A 4HBNA 2MEV3 4L2NA 3RZKA 1ZBE2 4HKLA 4FPJA 2QE3A 2PN5A 4B4PA 5C8WA 3AMNA 1OLRA 1NQDA 1MQTA 2V4VA 2PQQA 5FZBA 1NX9A 4OCTA 5D8AB 5F9TA 1CAVB 2QJVA 3DKQA 3MIGA 3VKLA 1COV1 4N9HA 1O8SA 3TYJA 4GWJA 1UZZA 4XFAA 3Q8FA 2OYZA 1JOBA 3CJXA 2VW2A 4E9KA 3HPNA 1HDKA 2LTNA 4YFWA 1OBNA 5I93A 1Y9MA 5LA1A 4OHVA 1US3A 5FY1A 1VBC1 3W20A 4EE2A 2D6NA 5AC91 1DYKA 1UOFA 2PXJA 1AX2A 2JKXA 2QQLA 1TMF2 3EJKA 3K3OA 3T08A 1CIYA 1HRI1 1RMU2 1W0OA 3FHAA 4JV4A 2WZPP 2XVGA 4NE9A 5DUVA 2G4IA 3NJXA 3ZYRA 5A3MA 5H9SA 3ZYJB 4L99A 3N7MA 5JSPA 1O3QA 2ZA9A 5JOZA 4LLFA 3U11A 1K5MA 4QU1A 3R4UA 4AG4A 3URFA 2D6PA 2EIDA 4QX0A 3WY6A 2Q1FA 3WQ1A 1OH4A 4LTAA 2C26A 3ZOIA 3IMMA 4FTEA 2B7YA 2MEV2 2UYBA 2GDFA 3SHRA 3OOXA 3KV4A 2OUHA 4J6GA 5LA2A 1CIWA 4CU9A 3AVRA 4DY5A 5A1AA 3LOBA 3VBOB 3ZXDA 1DZRA 1C28A 4XURA 2GN7A 3NQHA 1G9BA 4XACA 2DV9A 3ABZA 4AI1A 2HEVF 3C7OA 1I1EA 5FYIA 2RDQA 1UNBA 1E5HA 5GZFA 4CEYB 3JUUA 4WM7C 1A78A 1LOGA 2E53A 2WSVA 3M3EA 3VBUC 4AFDA 2FCTA 5DDJ3 1GSLA 2VUCA 2DBNA 1KDKA 5G04L 3EO6A 4YYOA 4BM8A 3LWCA 1SBDA 2W08A 1Z0HA 2XUEA 4JTNA 4XFCA 4N7IA 4J1XA 2WABA 4S2FA 1UY3A 3R05A 4Q4Y3 3KB5A 4CTEA 4AXOA 2E7QA 4XAAA 1EP0A 1MVQA 4D6RA 4CE8A 1CQ9A 4CP2A 5B2GB 1BMV2 1SFPA 2VUAA 3HT2A 2R1DA 2HWF3 4WV8A 5D8AA 1DGWA 1H8TA 1W9YA 2W3JA 1PO23 5DZGA 2QKDA 1JTZX 3LGRA 2VQTA 4DXTA 5CFDC 3VN4A 2AREA 3IDCB 2VZSA 1N1TA 4S2DA 4M3CA 4YZ5A 1UY2A 2G9GA 2QQIA 3CJIA 2BYVE 3POJA 3TEWA 2D93A 2AGSA 5DUWA 1BBT1 4YW1A 1B35A 1VP6A 5F3EA 3KVAA 3HWJA 4LKEA 1QH7A 2CWMA 4YLZA 4BU2A 1YUDA 2OA2A 5F6KA 3ZSEA 1LGNA 1QOTA 3N7LA 4NRQA 1H1AA 1QJY3 1VBE1 4ASKA 3KGZA 2BOIA 1RVF3 5FY5A 3ILFA 4EN6B 5KR7A 1NE4A 5DDJ2 2B45X 1KDMA 5HXVA 1QGLA 1IGOA 3I7DA 3RJRA 1MQTC 1CWPA 3R4SA 2RR13 4IE4A 4AVTA 5KC6A 3HBKA 2ADDA 4LE3A 2B42B 4UF0A 1SFNA 3D0SA 4L11A 2VMEA 5J98B 3RYRA 3UGHA 4DIQA 2G9ZA 1IHMA 4QHZA 4Q4Y2 4D94A 4QX5A 3ZLIA 1SCSA 3N9QA 2Q0AA 1WMFA 5FWEA 4LHNA 4LXLA 4KWUA 2OKXA 1SACA 4K8RB 2HWF2 2WC2A 4LT5A 3VD4A 1V6IA 1C3HA 4XIKA 1VRH3 1PO22 4GMP1 3NKTA 5KHIA 1DZTA 3B93A 3U4XA 2VQUA 2ENRA 3EBRA 2VCCA 1OA4A 4CEYA 1AR71 2H6BA 1RUH3 2ADEA 4Y5Z0 5E6HA 5C7GA 1EV13 1EY2A 2ZX4A 2DVGA 1OHFA 3TN93 3LOIA 3I3QA 4NHLA 5JDBA 1DHKB 1YQCA 1NY72 2W1SA 2VY0A 4ONUA 3FFZA 1W9FA 5I91A 3LIHA 4RN5A 4TYSA 1W8OA 2RMU3 4YZ1A 5LRRA 3U1XA 1TME3 1Y43B 3ASIA 3ACIA 4BA6A 4BIFA 5CBLA 1RVF2 1SHWB 5LATA 3RMXA 5DG2A 2QQUA 3H3ZA 5FWJA 2GH8A 1JODA 4WZFA 2RR12 4EN0A 4XXAA 3H42B 2AEZA 4JGYB 2K9ZA 5EJZB 3THDA 3V0AB 3LEIA 3GCWA 1LODA 1RUD1 1W3VA 1AR93 2CYFA 2Y6HA 3CU7A 4YG6A 2BVBA 5C4WB 2VNOA 2FCVA 2HKXA 2B4KA 2R30A 3NJVA 2WZR1 5JPMB 1ULCA 5LEKA 3ACGA 5FY0A 5A3TA 1OUXA 2FDKA 1V9U3 1VRH2 5LB6A 3PVEA 3NAPB 1UKRA 3FMGA 2FMDA 2BW8A 5EHDA 4QB2A 5FYZA 2FZ2A 4ZPIA 1SZBA 1FV3A 2WUHA 3GDBA 1EV12 5FXVA 3KCXA 1NKGA 1Y4WA 4Z8BA 3TN92 5EFUA 2P3JA 1L7LA 1Y9GA 4N53C 3QH7A 4P9IA 1AXZA 1QJZA 1H8TC 1WLWA 1WW6A 2O0OA 4NWWA 2IXLA 4ATFA 3KF3A 5FAXA 5DUUA 5I8TA 4BQ4A 3S57A 2JG8B 4MGSA 1U0AA 1TME2 3BOPA 1O59A 3CJIC 1LRHA 1XE0A 5LEJA 4D8MA 2V5YA 5CB7A 3ZSKA 4ITCA 1PMIA 4BE3A 1IS6A 3SH3A 4W4ZA 1GUIA 1B35C 2BNOA 3K4DA 2MHFA 3O1PA 4E4HA 4F3JA 2CU5A 1X8EA 2WO2A 1MZEA 1ND3C 1W6OA 2NZ9A 3NSTA 4CP1A 2XJTA 3POIA 4V2VA 3KWVA 4BYYA 4PIYA 1JZ2A 1OMIA 1WCKA 2DDUA 1BVVA 2QFEA 1V9U2 3MHZA 3UL2A 5DQ0A 1VB2A 5IK4A 2B9VA 1YHFA 1DG6A 3OBZA 1GICA 2GH2A 3N36A 1NYWA 5ERLA 2LS6A 4OUEA 3OJBA 3KV9A 2JD4A 3WG3A 3AYDA 2VNGA 4YW2A 2X05A 1CX4A 2X10A 4FCAA 3A7QA 4A7YA 2H0VA 1RUI3 3ZKUA 1A6CA 2JB4A 3RPQA 1CN1A 3J7HA 1XNBA 3CNAA 3V0AA 2BV4A 2H6CA 3BTZA 1LHVA 1LHWA 1V6JA 3O14A 4FAGA 4B29A 3VD9A 5C4WA 2I74A 4LBLA 1TG7A 4CEYC 1QMJA 3THCA 3RZMA 1F5FA 2A73B 4XEZA 3NMBA 1YIFA 2OX0A 3S0MA 4WM8B 2XPJA 3NAPA 3QBQA 3HEIA 4D7YA 2EF6A 2YUEA 3GCXA 1HV1A 1WZXA 2Y6LA 1OVPA 1F4HA 2ZHNA 4AFCA 2LRPA 1VLNA 5LBFA 2XKPA 2ZEYA 1U5YA 4GH4B 3VBFB 4LBKA 5FXXA 1AL21 3LEMA 4M0NA 1D4M1 3AZVA 2WAAA 1QEXA 2XJVA 3E5UA 5EJ1B 5BNNB 1W06A 4M4RA 3J4UH 4UFIA 2JG8A
chains in the Genus database with same CATH topology
4XTMA 2BTVC 1J1TA 2ZMLA 4N43C 4LBOA 4XHBA 5T52A 2BNMA 3VDDC 3HT1A 1S0JA 3AMPA 4QPGB 4H3WA 3WG4A 3RQ0A 1C8M3 1ASJ3 3SH4A 4YSFA 4DOUA 4GQ7A 1V6NA 3BALA 4PQ9A 2MNGA 3GHNA 1QKQA 1G9AA 3SXWA 3WDUA 2R0FA 4X8NA 2XLGA 2V09A 4EROA 1B09A 4HANA 4P9GA 1AZDA 4PCRA 1HQWA 2WT1A 5JWPA 4C0HA 2UWCA 4IV3B 1O5UA 1KFXL 2A6VA 1LB2A 4NVPA 4AVVA 3JCIA 3ZXFA 2VW0A 2CY6A 4TSVA 4XIOA 1C1FA 4MVTA 3UKVA 4PIXA 2JEMA 1WCSA 3ALQA 3TBDA 1AUYA 2GC0A 1HXS1 1KS5A 4Q0QA 4WM8A 3AFGA 3ZYPA 1QJX1 4AHWA 3LA3A 5FMOL 1C8M2 1NA1B 2QDNA 1ASJ2 2RS51 2VOKA 4UBHA 5HBAA 4GIQA 1L3JA 3PTYA 1PO13 5CIRA 3VBFA 4GH4A 4KU8A 1OD5A 1APNA 1DQ5A 2BGCA 4NHKA 2ZHLA 2WNVB 5BNNA 3B94A 4KWKA 3WG2A 4FSJA 5J3UA 1O91A 3LKJA 1AX0A 4Q4X3 4WVZA 1RUJ3 1S55A 3RMYA 1SDWA 2HWC3 2W68A 3B69A 4QPGA 4FBFA 3VBSB 2B9UA 5JZGA 1A3KA 4DMIA 4YM0A 4FOQA 1ULDA 2A6ZA 2ZGSA 4ATEA 2WT0A 3JZVA 4YNIA 1N3OA 1SCRA 3MIDA 4LO8A 5GZCA 4LR4A 3E6BA 4M3CF 4Q4V3 4XE9A 5BNOC 2XBO1 4LO7A 3AZWA 2PHFA 3AKTA 3CEWA 3DUIA 4FPLA 4FPCA 4SLIA 4W6XA 1PZ9A 2FZ1A 4IV3A 1PGW2 5FOBB 2RHPA 4XFBA 5I8YA 2JKBA 4URTA 4AHYA 4NO4A 1LTEA 4Y1YA 4GB31 3L2HA 3MLJA 3GZTB 3WINE 4LBQB 2XKOA 1DFQA 4QPIC 3WR0A 4KL1A 3AK0A 3KT7A 1UPIA 4OHYA 1Q8SA 4IV1B 4I0AA 4RQPB 3EHKA 3PVBB 2JICA 4YGDA 1RUJ2 1URXA 3DPRB 2HWC2 2Y0OA 1UKGA 1PNFA 4Y22B 1AR83 3K48A 3MIHA 1R093 1HKDA 1NA1A 2ZZJA 2ARXA 2P3IA 5T3NA 2R32A 3DKWA 4MGZE 2R043 5GM0A 3WUDA 4Q4V2 3ZN4A 3VZKA 3EXUA 3I4IA 1J59A 5FO7B 1OOPB 4PJYA 2GNTA 1GANA 1ND2A 1RC6A 3LB9A 5FLIA 1WLDA 3IN9A 2YHJA 3VZMA 1O7FA 4XHXA 1DZQA 4ASLA 3BTAA 5CG9A 2C1FA 3HMYA 1E57A 3LA2A 4WM8C 2ATFA 1NCRB 4GWNA 4Y20B 2CL2A 4LBNA 3I59B 5DZFA 1YJKA 4BHPA 1PGSA 4INDA 3G7DA 3RNSA 5L7OB 1UW8A 3H8UA 4Z07A 2SLIA 2ZGRA 1AR82 1RUE3 1R092 2RS32 1FT9A 5DXDA 1S0CA 3M3OA 2ZGPA 2RJKA 1ZBA1 2R042 2E51A 1V6KA 1H2NA 4Q8KA 4HSJA 1LULA 3MFAA 1CPMA 4LBQA 1EAH3 3NV2A 1FPN3 2WINB 2Q1ZB 4LEJA 5BNPC 5J48A 3V56A 5JZGC 3WUCA 1MEC1 1NCQA 2QZ2A 4RQPA 3ZFEC 3MLLA 2I07B 1F5JA 1JYIA 1S2BA 1OI6A 2IXHA 2RS13 3DPRA 3VL8A 1XNCA 4Y26A 2ZKNA 4Y22A 1AYM1 2WS91 5JPNB 1G9DA 2Z69A 2PAKA 4IEQA 4PLOA 2ZGNA 1S0BA 1RUF1 2SBAA 1YIPA 1RUG3 4Q1RA 4GMP0 2YGMA 4B7EA 2CGPA 1RUC1 4XZPA 1LEMA 1W6MB 1R1A1 2KA3A 2OVUA 2VPVA 1QJU3 1NLRA 4OUSA 2VECA 4LO4B 1H9WA 1S0IA 3MEPA 2VG9A 2TUNA 1PVXA 2WSUA 1RUE2 2GZWA 1XNDA 3RG0A 3KSCA 2JG9B 3SCGA 4I01A 1OA3A 2JJ6A 1J58A 1RITA 5EZWA 1KS4A 2KM2A 5FLJA 5BXXA 4E2GA 1EAH2 1FPN2 1SEFA 1NCRA 4G9SB 3AZYA 3FLTA 3I59A 2KXLA 5EYYA 2YGLA 2X5IC 4QQLA 1SLBA 2RS12 5FMOS 4HK8A 1ND2C 1KQRA 5FFOC 4WVMB 2ZS6B 1CVNA 3OBRA 2VQAA 5DZEA 2CAVA 2D3SA 3ATGA 2FQPA 5F1RA 2WA4A 3VKFC 3B00A 1U12A 2XB6C 3JBG3 1Z7S3 4AI2A 1SLTA 3QD6A 4B8EA 3WDYA 2VMGA 1G7YA 1OPMA 5FTTC 3ZFGB 3DV8A 2ZTNA 2OUJA 1F9KA 4HN1A 1FV2A 3QLQA 3VHNA 1LJ7A 2IFWA 1QOSA 2VU9A 2JDZA 4JGZA 2EXJA 1IPJA 4LA2A 1FI2A 4XJ9A 3M4FA 1W6MA 3MPBA 4LUMA 1J3RA 4PBOA 4QXKA 3ILNA 2D7FA 1R083 2ZGMA 1H1MA 2DURA 1VAKA 1H9PA 2ZX3A 4RSUA 3WZ1A 4E2SA 2ET7A 4MUVA 1F8VA 4KWLA 5CFCC 4D69A 1NCQC 1GBGA 4QQOA 3FLPA 4LBQD 2ZAAA 4A2UA 4XXPA 2XG3A 4K6BA 1COV3 3O12A 4MH0E 2Z42A 1G9FA 2E7TA 3FWEA 2TNFA 4CDUB 1LU1A 2XGXA 3UV9A 2DYCA 4C90A 3ZYIB 1V00A 4M0HA 1OKQA 2ZHMA 1VBC3 4Z92B 1W6NB 5AC93 4COWA 2I2SA 2R071 4I3PA 1LOEA 1HRI3 3L9JT 2EAAA 2WFF1 5L19A 1KJRA 3TWIA 1PVC1 2XLAA 1I6XA 1SLIA 1WW5A 4FP3A 1WW7A 1H4GA 4AGGA 4XJUA 2XLFA 1HX6A 1R082 3TNPB 4P9XA 3MW2A 2HYKA 1MR5A 3AYCA 1CAXA 5F6LB 4MYEA 2YXSA 1HQNA 4IL7A 4LHKA 2NP0A 2EXKA 5IK8A 4XF1A 1FAYA 2ZABA 1COV2 1IPKA 1H1IA 4MXVA 1WMDA 1POV1 4M00A 3FJSA 2JECA 4DZGA 3A0KA 2RM21 4CRQA 1VBB1 1R1ZA 1VBC2 3N7KA 5FO8B 2ZHKA 5AC92 2RJLA 2X8KA 1HRI2 1YRZA 5I0UA 4MV2A 5JSOA 4P9LA 5AVPA 5C8CA 3JQXA 4W6YA 3FUQA 4D7SA 2ERFA 4KBBA 1JBCA 1CD3G 4HETA 3DN7A 2WL1A 3OBTA 4XF3A 1LECA 1DDLA 4YGBA 4JGZC 5T50A 2P2KA 3W59A 3IWZA 3OPZA 5HI0A 1I5ZA 5JIAA 3FC0A 2OZ6A 4MX3A 5DUXA 1D0GA 4HT1T 1W6NA 2AENA 1BBT3 2VUJA 3ILRA 5BPXA 4YW5A 3NWKA 4R9CA 4XQ4A 3V65A 3HQXA 1ZZ9A 3WOGA 5BV6A 3VHPA 4AEDB 3WP3A 3ZYGA 2PHTA 3J26N 4FP2A 4PDWB 1VBE3 4I0WB 1EPZA 1WA4A 1BQPA 2ET1A 3J9SA 2WWSA 3OGGA 2O8OA 1CAVA 5E89A 2R0HA 3OGJA 1XYNA 2IZWA 2DF7A 5CADA 1IKPA 1GNHA 1JXNA 1ZNPA 3AP4A 4GULA 5CNAA 3GBGA 2ZJCA 5J36A 1DF0A 4GMP3 3KT4A 5EXOA 2XWJB 1UIKA 5SV5A 1PIV1 3WT3A 1AR73 3FLRA 1S0DA 1LEDA 4R9DA 5T54A 4I30A 4COUA 4Q1PA 2GNDA 1GKBA 2DFBA 1CESA 4BWOA 3ACLA 1RIRA 1BBT2 5ACA1 4UXAA 3V0BB 3OF1A 4MXWB 3LCPA 1VBE2 3MI8A 1CGPA 3H7JA 2D5HA 1AL0G 1WW4A 4XFIA 1TNRA 4K3UA 3VBOA 1PNGA 3U0ZA 3R6SA 4N90A 2A3YA 2A7AA 1U5IA 4J1WA 3OY8B 3G6JB 4RS5B 1RUD3 1ULFA 3MF9A 1H8VA 3JB4C 4KG0A 5LK5A 2V73A 2A75A 1DGRN 2WZR3 2R16A 2VOWA 5C6CA 4AEDA 1K5MC 4HSLA 1GR3A 4W65A 3A0NA 1J3QA 4PDWA 1NXMA 4DQAA 1AR72 3KCCA 5GLWA 2HEYF 5C8CC 2D5FA 2WA3A 2UU8A 4YRDA 1J3PA 3W9AA 1MS8A 4L8QA 1QJY1 4Q4W1 2DU1A 1N3QA 2DCKA 5FO9B 1VBA1 2A6XA 4YW4A 2FBEA 4K7JA 4YZ4A 4AVBA 3BPZA 1FNZA 4I02A 1FOD1 2DTWA 1RUD2 2FHRA 1BK1A 2Y26A 3PMEA 4AEKA 3M70A 2QZ3A 2NN8A 3K51A 3J8F1 2WZR2 4CP0A 1DGRA 4K21A 4Y4YA 3RWNA 3ZFFB 5D8AC 4EWDA 1PM7A 3ZN5A 1RUH1 3ELNA 4S2HA 2GMPA 4HVOA 4N9IA 3OD4A 2AUYA 4CDXB 2ZX0A 4AQSA 1M4WA 3T1LA 5JOYA 1WBLA 4I09A 3OY8A 1OQ1A 1MS5A 2RMU1 3MIBA 4H14A 4AQTA 2E7AA 4COZA 5CVRA 1V6OA 2HJIA 2A70A 1X82A 1QF3A 4Y1ZA 3WQ0A 3NO8A 4Q2FA 2XH6A 5C33A 3AM2A 4PIZA 1AR91 4FPYA 2HWE1 1IS5A 4BZ4A 3WQ7A 1KJLA 3N4MA 1BKZA 1U5XA 4JRAA 4D7TA 3VBOC 1AL23 1FMD1 1D4M3 3ES1A 2BVVA 1OLQA 3B3QE 4JGYA 5KXDA 2YY1A 1YYNA 2ZKLA 1BJQA 3WV6A 1ZREA 1DQ2A 4FPHA 4META 4MGKE 4P5HA 2G9FA 4TLFA 2DTYA 5E88A 5K9YA 2DCZA 1UCXA 1ZA4A 3BIWE 1S0GA 4R4XA 4KWJA 3HAGA 4M01A 4LNVA 4MSVA 5BYNA 1FX5A 2BQPA 5GZEA 2PAMA 3ZFFA 5C9AB 4AI8A 3UJQA 3E97A 3T1MA 1C5HA 4FQZA 5K0UB 5T5OA 2X29A 4XBLA 1XRUA 3IKWA 2NMNA 4GALA 2PHUA 4OULA 1O3TA 2C9AA 1RJ8A 3AYEA 1WBFA 4QMAA 1SLCA 1AL22 1D4M2 1YNAA 1YCIA 3PLQA 2YZ4A 2A6YA 2CAUA 4P14A 2JE7A 3N3HA 1GLHA 4ZU7A 4B3NA 4F8AA 3AX4A 1YFYA 4KU7A 1DQ0A 1C8NA 4AHXA 1YI7A 1RUI1 4Y1XA 4DINB 1QJX3 1PHMA 1REFA 1SBEA 2JE9A 2Q8OA 1CPNA 4JDMA 3VBHB 1SLAA 1QY4A 2BPA2 2DUQA 1BZWA 3FFQA 1TQ5A 2HWB1 4S2GA 3WDXA 1XXNA 3QCWA 5LK7B 2ZBJA 2GC2A 4FPFA 2A5ZA 3ZPYA 5I0RA 1Q8QA 3M7AA 4Z2WA 1NG0A 1PGL1 2A3WA 2OZJA 3ZMOA 2O1QA 4AWDA 5JMCA 4BLIA 1F2NA 1HXS2 2XVKA 3O7OA 1HW5A 2XBO3 1EYBA 3W58A 4BPZA 5C9AA 1KFUL 1PK6B 1QJX2 5BNQA 1H0BA 3NL1A 2LUWA 2RS52 1UU5A 1QDOA 4JGYC 4YM3A 3TRSB 3AKRA 5JI7A 4JTOA 3RSJA 4DY3A 1A8MA 1QXPA 4GB33 1KRIA 4Q0PA 3MZHA 5C4WC 3FHIB 4OHWA 4P9WA 1ENQA 4FTSA 3VBRB 3ZX7A 5JOWA 4G4FA 2B46X 4NHMA 3NAPC 4Z82A 2PHLA 4XBQA 1CJPA 2GMEA 3MPPG 4COVA 1G86A 3OYWB 4QM9A 4LLOA 4AEMA 2DCJA 3IM0A 2DVAA 4RHV1 4QHBA 4CEWB 5K8SA 4HMZA 4LBJA 5IK5A 1POV0 2WLQA 1Q3EA 2HWD1 2JG8C 1W0PA 3B9CA 2PLV1 4AE2A 2XBO2 3WXPA 2R49A 4G3YC 1YWKA 1LCLA 1LOFA 3UKTA 4YVSB 3P3NA 1YFWA 2E9QA 1FXZA 1PO11 2K2SA 4GB32 1WGPA 4ZXKA 3THTA 4UW6A 4OI1A 1REEA 3MICA 3ZVXA 2GU9A 4MGYE 2RS33 4X6RB 3A4UA 4AFMA 2WQ4A 1HLCA 4YM2A 1IQAA 2QDRA 2VOXA 4IEOA 4RR3B 3AZXA 1ZX5A 1YFXA 3JD71 4AEJA 4I3GA 3M3QA 1EPWA 4UW5A 1PK6A 2ILMA 4CDQB 1WMEA 2XJQA 2AH2A 4YVWB 2R061 2WNVA 2EALA 5H9PA 1D2SA 3DF0A 4ORFA 5FQ0B 1ZBA3 2D6KA 5KXBA 5KHHA 1AJKA 2AZ5A 2TEPA 2DVBA 1SFYA 1H2KA 3QOPA 2YPJA 3VBRA 4A7ZA 4M3CE 3VBSA 2BFUL 3X29B 2IXJA 4O9EA 1MEC3 3ME2A 4OI4A 4XJAA 4E4DX 3USUB 2B5HA 2N7GA 5J37A 1ZZ6A 3KT1A 3OYWA 1DBNA 3L2YA 1AYM3 2GALA 2WS93 3MF6A 5L73A 5FOJB 3KCYA 2DVFA 1D2QA 3VBFC 4GH4C 2HEWF 2BWAA 3FE5A 1RUF3 4K8FA 1VBD1 5BNNC 4LO5B 2XJPA 1RUC3 4KGGA 4MZUA 1CAWB 1R1A3 1JHNA 2WFPA 3AXDA 5T5JA 4L92A 5ABJB 3RYPA 1WUVA 3VZLA 1HQLA 4IERA 1O4YA 5KHKA 4A3XA 1N3PA 1RHI1 1SLLA 4JVAA 4K1YA 2C5DA 4QPGC 2IC1A 1H2LA 4HK9A 4YVSA 3ZIXA 4DXZA 5J7MA 1XYPA 1SBFA 1ZBA2 3C3VA 4QPYA 4IV1A 2CTVA 4KG8A 1G8WA 2YROA 3H1MA 4I2OA 4B4RA 1DLLA 1NQJA 1IZ3A 1OPOA 4EV0A 5KWRA 1F31A 1MEC2 2XHKA 2ZGQA 1FYUA 4IV3C 5K7PA 2RE9A 4X8PA 1VR3A 1ONAA 1QQP1 4NN0A 4XF0A 1AR61 1AYM2 2EXIA 2WS92 3VKNA 1OOPA 4YVWA 1ZZ7A 4K20A 3AJZA 1KITA 1RUF2 5FQ0A 2D40A 2Q5TA 2Q30A 2E6VA 1RUC2 4B7KA 4WBBA 1R1A2 3AKQA 4MLOA 3PNAA 4ASMB 4BMEA 4FOWA 3DGTA 1PZ8A 2WNUB 4Y20A 3RDIA 4MGIE 3AYAA 1C1LA 2Y0IA 4WM7B 1NA1C 3USUA 3VGIA 1O3RA 1N1VA 4XMIA 1TEIA 5L7OA 1I9RA 4C0BA 1Q5OA 1AYN1 3JB8A 4XW3A 3ZN6B 4A7KA 4XF4A 1PK6C 1WCDJ 5KBFA 3ZXLA 4HKOA 2WNVC 4X6QB 1CAWA 5ABJA 1V70A 3ZXEA 2ZGLA 2OPKA 3IPVB 4Q0UA 4YGCA 5CFDB 4OI0A 5CG8A 3D6EA 1RUG1 3VBRC 4YZ3A 1LHOA 4OI2A 3VBSC 3S7EA 2WLPA 3AMHA 5KHGA 4OHXA 2D6MA 4U36A 3RI8A 2PHDA 3FUOA 2Q4SA 4FPGA 4FAHA 3ZXGA 1Y3TA 1QXJA 3M8LA 4L97A 4HKWA 3S30A 4FXKB 1RTVA 3RZZA 1BEV1 3MDPA 4AYUA 2ZAHA 4Q0SA 1MQTB 1UPSA 2A6WA 2CNAA 4RGAA 3S6PA 4JQRA 4JAAA 3KMHA 4RD7A 2R073 4R8HA 4IEXA 2JG9A 3O0VA 2WFF3 4RGGA 5GLZA 4R52A 4IV1C 4FOYA 4RQPC 3D8CA 2K0GA 2NMOA 2B8MA 2PYTA 2XJSA 1MS9A 2NYYA 2W52A 2WT2A 4FT8A 1GZ9A 2P17A 2WNUA 3DPRC 2VGDA 3ROUA 3IBMA 1VB4A 1JOJA 4JC1A 1C4RA 1N47A 1XYOA 3SISA 1ZZBA 1FNYA 2EXHA 4UW3A 3ZN6A 3H3UA 1NZCA 2IXKA 1DIWA 3JBG1 5AFBA 2BBVA 1OOPC 5EWSA 2F6BA 4YVWC 1POV3 1OQEA 1Y9QA 4N7UA 4WVMA 2XL9A 3WW3A 2RM23 3IPVA 2WJSA 1HRV1 4XJ8A 3GALA 1SQ4A 4FPOB 2R072 3C2UA 2XUMA 2JENA 1NCRC 3MGUA 1SMVA 2WFF2 4AHZA 1ZBE1 1PVC2 4DPNA 3VL9A 4QD2A 3ZFGA 2IXCA 3VKMA 1RB8G 3AP5A 4D3WA 5L7OC 3CLPA 2BFUS 2JXAA 5E16A 4P9JA 1Q56A 2DCTA 5FLHA 5FRAA 3B02A 3WP6A 1LU2A 2DVDA 4DS0A 1OSGA 5A3LA 5JIUA 4N53B 4LE4A 5ABJC 1H8TB 2TBVA 3IMNA 1ZVFA 1TMF1 1ZM1A 3ZSMA 1RMU1 3E6CC 3AFKA 4AVAA 4M3CB 4K40A 5JR7B 3CJIB 4H7MA 2RM22 3AJYA 1VBB2 5F5QA 4XETA 1MVEA 4JCKA 3ENRA 4CYDA 3H50A 1B35B 2P3KA 1ND3B 4CDUA 3QH6A 4AFAA 4XYXA 1AXKA 2MEV1 3O5SA 1XNKA 2GAUA 4XJZA 4LA3A 1S1AA 2GNBA 4YW3A 1UF2C 4Q8LA 4LULA 4ZU4A 3ZSLA 1V6LA 3NJZA 3B5LB 5IUQA 1DU3D 4BMBA 3SNMA 1PIV3 3M3CA 2VULA 2JG9C 5JOXA 2EA7A 1TE1B 3H1YA 2ZGUA 3RYKA 1ZRDA 2EAKA 4IEWA 3ZMNA 1D0HA 1GZWB 1JN2P 3GZUC 4E2QA 1I3HA 3TOJA 3VV1A 5ACA3 4O9GA 3TB0A 2WNUC 3HIFA 2JX9A 4Y24A 4PLNA 1GV9A 3H0OA 1DYPA 1BMV1 1LENA 4C1WA 5EV7A 2BEOA 3CL1A 5GKAC 1T6GC 3PJYA 3HD8B 1QH6A 3D4KA 5GJ6A 3RI9A 4C91A 2GN3A 2YDEA 5I8SA 1UU4A 4B4QA 4ES8A 3IT8A 3ST7A 4N53A 4FVVA 2NQYA 1G9CA 1REDA 2R6QA 4ISRA 4FOVA 3GBWA 3JU9A 4E4SA 4BOWA 5JI9A 2UURA 2NLRA 3WD5A 1PIV2 2DFCA 4XBNA 4C1XA 4AGRA 4N43B 5DDJ1 3VDDB 3ZFGC 3D5OA 1BCXA 3KD4A 1Q43A