2N7GA

Structure of the cyclic nucleotide-binding homology domain of the herg channel
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
131
structure length
131
Chain Sequence
b'RSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Structure of the Cyclic Nucleotide-Binding Homology Domain of the hERG Channel and Its Insight into Type 2 Long QT Syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 17
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2n7gA00
2XHKA 4HBNA 3NL1A 1Y3TA 3UKNA 1ZZ8A 4YYOA 3FFQA 2ET1A 5FCCA 1UIKA 3S7IA 4UBGA 1G6NA 5LEJA 5LRSA 4FBFA 2CGPA 2GC3A 2QJVA 2BNNA 2IXIA 4IEWA 1J3RA 1LKNA 1PMIA 4PIXA 3LOIA 4MZUA 2QNKA 1YFXA 1ZRDA 5FLJA 3SXWA 3WW3A 3NW4A 1J3QA 4IERA 4E2QA 1RUNA 4YNIA 4QM9A 4DINB 5I8SA 4HMZA 5JAXA 2XGXA 2BGCA 3FHIB 5KHJA 4OFGA 4D7SA 1CX4A 2K0GA 4LLOA 4IEOA 3DN7A 4MGKE 4YSFA 1YLLA 2MHFA 3H1MA 2CV6A 1LRHA 2XLAA 3E6DA 1NE6A 3C3VA 1UCXA 3OGJA 2HKXA 3PLQA 5F1RA 2KXLA 3LAGA 2Z2SB 2D5HA 3ACLA 3S0MA 2PYTA 3RYKA 2N7GA 2O8QA 3BCWA 4Q0VA 2XKOA 3KCCA 3SHRA 2GC2A 3QOPA 4WVZA 1WGPA 3B02A 1O3RA 2XL9A 2Q1ZB 4BYYA 4EWEA 4KWJA 4MGIE 1XE8A 5BV6A 2EVXA 4QGLA 4KWLA 3SCGA 4XFGA 5E1RA 2PHLA 1Q5OA 1Q3EA 4MX3A 1X8MA 3H3UA 4R8HA 4XFHA 4OLLA 2PHDA 5CU1A 1SEFA 4QXKA 4RD7A 2GC0A 2IXLA 2UY9A 4XF3A 5FLIA 4HVQA 2BYVE 1X82A 2HJIA 3M3IA 4LULA 3DL3A 5CVRA 4JTNA 5KBFA 3H1WA 2GZWA 4I0AA 1LR5A 3TNQA 3MPBA 1SFNA 2ET7A 1O3TA 4IEVA 5EFUA 2V09A 3FWEA 4N9IA 1OD5A 2Q4SA 3CJXA 4AQ2A 1NE4A 2GC1A 2XKPA 4BHPA 1CAXB 1GQGA 2UYAA 1I6XA 2OZJA 2QCSB 4AQ6A 4LUKA 4HSJA 4I09A 2EA7A 3H3ZA 2PA7A 3E5QA 3EHKA 1EYBA 5I0RA 4Q0PA 1ZRCA 2B8MA 4IEQA 5I0UA 1J1LA 3N4MA 1EPZA 1NXMA 2PAMA 4IETA 2EAAA 3FX3A 4FT8A 5E16A 4O9GA 4AVAA 3PNAA 3R6SA 3BALA 2QDRA 2IXKA 4WZCA 3MDPA 4F7ZA 1J3PA 3BPZA 5KHHA 1SQ4A 1RGSA 1ZNPA 5J7MA 2C0ZA 5J3UA 4LUMA 3DV8A 2UY8A 1RL3A 4EV0A 1FT9A 3HQXA 5KHIA 1QY4A 4NVPA 1VJ2A 4J1WA 1ZZCA 4ONUA 1RC6A 1J59A 2XL7A 4E2SA 1QWRA 2B9UA 1ZZ6A 5C6CA 4I2OA 4O9EA 4QGMA 4HZFA 2IXHA 2MNGA 4QM8A 4UBHA 4KL1A 3H9AA 3E5XA 3DKWA 1UW8A 2H6BA 3ES1A 1WA4A 1Q43A 5I0TA 2H0VA 5CADA 3G7DA 2IC1A 1CAXA 3WW4A 4BH9A 4ZU5A 3KGLA 5FQ0A 3FJSA 3H1YA 3UKTA 1FXZA 3LA7A 3OCPA 3OTFA 2K9ZA 4Z07A 3UKVA 4XFBA 5T3NA 4MGZE 4EWDA 3RYPA 3D0JA 5I8YA 2OA2A 5LEKA 3WW2A 3SMHA 3D82A 2B5HA 3CEWA 1ZZ9A 3LWCA 4MH0E 3TNPB 3I59A 3KMHA 1ZZBA 5D1IA 5J48A 1O7FA 2VECA 5I93A 4Z82A 1GQHA 3RZZA 2IXJA 2XLFA 1RTVA 4PIYA 1ZVFA 4XEZA 1XRUA 4XFAA 3ROUA 1H1MA 5FDBA 1DGWA 2GU9A 3ST7A 2PFWA 4ZU4A 4IEUA 4K8FA 2ETEA 3IIAA 1EY2A 3OF1A 2GAUA 3HIFA 5JCTA 4Q0UA 1UD1A 5JSOA 4Q29A 5BUVA 2Z69A 1CAUB 4QGNA 3S7EA 3VHRA 1TQ5A 4I01A 3USSA 4AXOA 4MGYE 4FAHA 2XLGA 2GH2A 4Q0SA 1CAWA 3GBFA 2PTMA 5FQ0B 2FMYA 3HT2A 1YUDA 4EROA 2CAVA 1YFWA 4IESA 3D0SA 3IBMA 3CL1A 3LA3A 2Y0OA 4L11A 1YFYA 1ZZ7A 1CAVA 1X7NA 4N9HA 3I7DA 3MZHA 5I0SA 4XF0A 3JZVA 5FPZA 2PAKA 3OD0A 4LA3A 3RDIA 5LRRA 1WLTA 3BU7A 3ELNA 5KHGA 1UPIA 3I59B 1UIJA 4P9GA 3E97A 3KSCA 3IDBB 4KWKA 1DZTA 3FZ3A 2WFPA 3EJKA 3ZDSA 4FAGA 2QVSB 3CF6E 4TLFA 2UYBA 4MUVA 4L2NA 4F8AA 1ZRRA 4I02A 3NJZA 2H6CA 2ZCWA 1OMIA 4PIZA 2OPKA 3PVBB 2D40A 4HN0A 4HN1A 1FI2A 1QXJA 5KHKA 1O3QA 4X6RB 4YRDA 1X8EA 3CO2A 2D93A 4AVCA 5C8WA 1YFUA 2VQAA 1U12A 1Y9QA 1CAUA 4HVOA 4J1XA 2PAEA 1DZRA 3IWZA 1ZRFA 4HSLA 3EBRA 1CAWB 2ZKLA 1CGPA 3NSTA 3I54A 5JR7B 4I3PA 1YWKA 3NKTA 3U11A 1OI6A 2PQQA 5I8TA 3EO6A 1CAVB 4MV2A 2O1QA 5BY5A 4JV4A 4QX5A 4EWAA 3O14A 3KGZA 4E2GA 3WW1A 5BXXA 1YHFA 5EZWA 4JTOA 2MPFA 3EQEA 3RPQA 4XFCA 3H7YA 4LTAA 1O4TA 1EP0A 3U10A 2OYZA 3E6BA 4XFFA 2FQPA 2Q0AA 4YARA 4PJYA 5I91A 1O5LA 3ES4A 4QMAA 1QXRA 3IDCB 1DGRA 3H7JA 4JVAA 3L2HA 5FLHA 4AVBA 3H50A 1IPJA 2OZ6A 5FPXA 1OFNA 1IPKA 4XF1A 3BB6A 2VPVA 3MYXA 3GYDA 2DCTA 4BIFA 4XF4A 1VP6A 1O5UA 1NZCA 3CLPA 3FE5A 1NYWA 1XE7A 1L3JA 5K8SA 3E5UA 4IEXA 2ATFA 5BPXA 2IXCA 4KU8A 5AVPA 1HW5A 3LZZA 3HT1A 1H1IA 1ZX5A 1JUHA 4I0BA 4Q0QA 2Q30A 4XETA 4META 4XFIA 4HVRA 4KU7A 4GULA 4WBBA 4A2UA 1VR3A 4X6QB 4IEPA 3SCFA 2BNOA 2D5FA 5JSRA 3LA2A 1J58A 4HLTA 4ORFA 3SCHA 1RUOA 1PM7A 3RNSA 2WC2A 4H7LA 3QACA 1LB2A 4XF9A 2BNMA 3ETQA 4CYDA 3E6CC 5JSPA 2CAUA 2I45A 1I5ZA 4LA2A 4B29A 1V70A 4D7TA 2F4PA 5HI0A 2P17A 2BEOA 4IEZA 4ZU7A 1O3SA 1ZREA 3H8UA 4LEJA 4R52A 4IEYA 4UXAA 3RYRA 3M70A 3U0ZA 3NVCA 2E9QA
chains in the Genus database with same CATH superfamily
2XHKA 2ZOEB 2Y34A 5D8AB 4GIQA 1Y3TA 2WABA 3D8CA 1VBC3 3Q9OA 3W59A 2WNOA 1ZZ8A 2XQRA 4NJ4A 4MLOA 2ET1A 2GALA 3MIFA 3S7IA 3WHUA 3RJ2X 3RS6A 1YIPA 3KWVA 4Q4V1 4ET7A 2GC3A 1KDMA 3PIGA 2VC9A 4ZONA 2B46X 1EUUA 2P3KA 2QJVA 4LKSA 3RGBA 1J3RA 2GNTA 4AVVA 4B8EA 3UGGA 5ANNA 4PHZA 5FO8B 5JXHA 1VBD3 2YUEA 2QNKA 4QKFA 4XHBA 1C57A 3VD7A 3R4DB 3SXWA 4QKDA 3WW3A 3ZPOA 3JD72 4S2GA 1EAH2 1HV0A 2WNVA 5CZKA 1PVC3 3TN92 4AYUA 4TLGA 3S57A 3IPVB 4DQAA 2J1VA 2QQIA 2B7YA 3DXUA 1MVEA 2XGXA 1PO11 2R042 4Y22B 5FZ0A 2CWSA 1XNKA 1QEXA 1GU3A 2KR2A 4LLOA 4MGQA 4IEOA 1LHVA 4DS0A 1V6NA 3DN7A 1DQ0A 5T5LA 3MLLA 4MGKE 4AHYA 3O1MA 4QXHA 1SLAA 4FI9A 2XLAA 3E6DA 2HWB3 1NE6A 4RS5A 3U4XA 5A32A 4CVUA 3KD4A 5C71A 2VMCA 3C3VA 4EN9B 3OGJA 2HKXA 2EIBA 2Z5WA 2OIIA 2WQ8A 1U5XA 4LKFA 3M4FA 3LAGA 2FDKA 1IOAA 2DVDA 3ACLA 1SLIA 1RUH2 3BCWA 3KB5A 4TN7A 3PDQA 2XKOA 1GP4A 3KCCA 3SHRA 2GC2A 3URFA 1RUD1 1WGPA 1O3RA 1VBA2 2BQPA 1E5RA 4MXWA 4HK8A 5A3PA 1H2LA 4KWJA 2JE8A 1GNYA 2XUMA 3WSOA 1ENSA 3O1TA 3ZIWA 1HQLA 5BV6A 5FBZA 1AYM2 4AEDA 1RUC1 4DY3A 1PMJX 4NR1A 2QFEA 1BLZA 4LBNA 4QGLA 3AKPA 1AL0G 3SCGA 1RUF3 1IZ3A 1HRV1 1DYPA 1RJ7A 4FP2A 5JXGA 1LGBA 1XU2A 4QDQA 1Q3EA 2CGNA 1K5JA 4MX3A 4R8HA 4OLLA 5GLTA 2OUJA 3VBOC 1FNYA 2UY9A 3RZHA 1RUJ1 1PGW2 5FLIA 4P5YA 4K1ZA 1OLMA 3RZGA 1X82A 3AYEA 1RYYA 4RHV2 3VKOA 2NN8A 1HRI1 1M4WA 4ASMB 2CYFA 3CQOA 2GZWA 1UKRA 1QU0A 1VBE1 4I0AA 4RQPC 1K42A 4BXSV 2YC2A 1JI6A 3D6EA 4Y4RA 3PMEA 5FZOA 3GCXA 2WN2A 1YI7A 2Q4SA 4QAWA 3P3NA 4AE2A 4AQ2A 1DF0A 3AFKA 2GC1A 2V4AA 3VD4A 2XKPA 3AB0A 3D4KA 1NA1A 4N8MA 3VBRC 4Q4Y1 1BVVA 4JDNA 1R092 1ACCA 2YBPA 2RMU3 2UYAA 2QCSB 3HOBA 4LK7A 3WZ1A 4LUKA 1BMV2 4HL0A 5DABA 3MIEA 2ZKNA 1VBC2 2A5ZA 1GZ9A 1BKZA 2ZZQA 2AZ5A 3EHKA 5E6HA 5BNNA 4IEQA 5I0RA 1XE0A 1ZRCA 2HWE2 1EPZA 3K4AA 4KH9A 2PAMA 4OMDA 4P02B 1LOBA 3T1MA 3N9LA 4CDXB 2SLIA 4DRRA 4K6BA 4MG2A 3FUQA 1BYHA 2HWD2 4AHWA 1FMD3 5FYVA 1QJU3 3WP5A 1YQCA 4MSVA 4FP3A 1ASJ3 2IXKA 4RN5A 3U37A 2CNAA 1SQ4A 4LXLA 4EN8B 3WR0A 3ZO0B 3N7LA 4CXYA 1RHI3 4FPHA 1MZEA 4GA9A 5J7MA 4P14A 4QKNA 4JCKA 3ZFGC 2C0ZA 3BODA 4QU1A 2VZTA 4CUAA 3BIEA 4K9SA 5J3UA 3DV8A 4GH4B 4HG6B 2EICA 3MI8A 1QY4A 5JOZA 3VKFC 2NM1A 2XMLA 4NVPA 1VJ2A 4J1WA 4OUMA 1RVF3 4W50A 5F3CA 3KF3A 3TB0A 2HWB2 2D6LX 2OQ7A 5FZIA 2B9UA 3THDA 3WLUA 1I1EA 1GWMA 2A71A 2WUHA 4LITA 4XMIA 5A3WA 1W04A 1DQ2A 2W5FA 5A1FA 5E8AA 2LTNA 3OY8B 3H9AA 2WA4A 1MEC1 1R64A 2C9AA 1OPMA 2YPJA 1OXCA 2RDRA 3IKWA 1JYWA 2ID4A 2H6BA 3MLKA 5FXXA 1B09A 1E5SA 1P8JA 2JDMA 3ES1A 4YGBA 4P9IA 5CBLA 2H0VA 2DF7A 5L7OC 4QKBA 1WWYA 4P08A 1PVXA 1UKGA 2BTVC 2HWF2 1JU3A 2E33A 4HKLA 1J84A 1RUF2 3FJSA 3OPTA 3RMYA 1A6CA 3BOWA 3C7FA 4QB6A 3ZKYA 1FXZA 3MLJA 3ZYHA 2VCAA 1ZYBA 3OBTA 3OCPA 1C1FA 3V0AB 3OTFA 1S4CA 1UMHA 3IIIA 2KM2A 3UKVA 4XFBA 4EN6B 2J1EA 5IAXA 3LEIA 5JXJA 5LEKA 3OG2A 3O1VA 3JUUA 5DQ0A 3T3YA 4AFMA 3SMHA 4XC9A 1AR91 3CEWA 3K4ZA 5IFTA 1D2SA 1XSRA 1H2MA 5FMCA 3NV3A 3TNPB 1Y9MA 1WD3A 3KT1A 3J8F3 3BVCA 3VDAA 3WG2A 3KV9A 1ZZBA 5JUVA 3E1F1 1XJAA 4COZA 5J48A 2XOMA 4O61A 4YW4A 3I2HA 4IE7A 5FY8A 1X9TA 2LRPA 4M0NA 4Z82A 3MW4A 4PQQA 3ALQA 2KD7A 2RMU2 4Y5Z0 2WQ4A 4R9AA 1XRUA 4XFAA 5JOYA 1DGWA 2GU9A 4RHV1 5FZDA 2E63A 5FP9A 3ST7A 4IEUA 1Y9GA 2AUYA 4Y24A 3WDYA 4K8FA 2ETEA 3CNAA 1N1TA 4NRQA 3MIGA 3FLRA 1CZVA 2K2SA 5C8CA 1G9AA 4RL7A 4FPLA 2CY6A 3NNGA 3VL8A 4Q0UA 1W6NA 3WP4A 2RS13 1FMD2 1LODA 1S0BA 1QJU2 1R091 2Z69A 4QGNA 4UI9L 1C5HA 2P3YA 4NHYA 3UK9A 3Q8FA 1ASJ2 2VTXJ 4IGOA 5DDJ1 5HV0A 2QQLA 2VCBA 2XLGA 3ZFEC 1GP5A 1RHI2 3VBHA 2XG3A 5FYIA 4E8DA 1PK6B 4JKMA 1IPSA 2FMYA 4NPMA 3TBDA 4EROA 2CAVA 2OXBA 1TNRA 4L11A 3EXUA 5CFDB 1YFYA 2W1QA 2X53S 4WVMA 3T0AA 3MF9A 3WVJA 4A7KA 1CAVA 1C8M3 3I7DA 4IXLA 1VBD1 2AEZA 1RVF2 3ACGA 3JZVA 4GWIA 5FPZA 3VD3A 2PAKA 2VULA 4Y33A 1PVC1 2P5BA 4LA3A 1WD4A 1FV2A 3CJIA 2VZQA 3LKJA 3ZN5A 5EP9A 5LRRA 2JDKA 1NCRA 1Z7S3 1N3OA 2FD8A 1UWWA 4IV3A 4B4PA 2Z42A 2XWBB 3GM8A 2XVGA 2WT2A 1ND3C 4KWKA 4QQOA 4YG6A 1OC1A 1RITA 1GNZA 3FZ3A 1IQAA 1HXS3 3EJKA 4L99A 3WY6A 4AGRA 4Y1XA 4Y26A 1HN0A 2BGPA 3M8LA 4MUVA 1CIWA 3UT0A 4L2NA 1DZQA 1LU2A 4F8AA 4XCBA 3HNMA 3UYJA 1ZRRA 2A3YA 2W94A 3WF0A 2XJRA 2XJQA 5F6KA 5A33B 3BIWE 2OPKA 2ZJCA 3PVBB 4RR3C 1LJ7A 4AQTA 2CTVA 5T55A 4CZSA 5FXZA 5DZEA 3ABZA 1AYN3 3GHNA 4LO7A 1N1YA 2Y6LA 5F5AA 2LROA 2X5IB 4JAAA 4R4XA 4AVCA 1JTZX 1FPN3 1EPWA 4NPRA 4KQ7A 5K0UB 3GF6A 3KT7A 2HLEA 3I3QA 4QPGB 3RQ0A 2WYFA 4YVWC 4GWJA 1QJX3 5AC92 2OUHA 5F9TA 1UAIA 4DB5A 4HSLA 1EV11 4IW3A 4MADA 5FZMA 5A6XA 1CAWB 2Y26A 1X36A 2ZKLA 5G05L 3HEIA 3KZ4C 3NSTA 3T30A 4JDMA 2YC0A 2VQ0A 1US2A 3ILNA 3T4VA 3MICA 3IDEA 4AGGA 1UY1A 5ERLA 4CXWA 2RDQA 4XJAA 4QQPA 2Y33A 3LOBA 2W68A 2VVDA 2O1QA 3MIHA 1CWPA 5LCWL 4QX5A 4YM0A 4AGVA 4IV1C 3PVNA 3Q8BA 1W2OA 4CUBA 3ZKUA 3SEEA 3KCYA 2DCYA 1A3KA 1GICA 3GJAA 1WMEA 5EV7A 4E2GA 1LU1A 3LPFA 3WNOA 4XJ8A 4DUXA 1OOPC 2Y60A 1KXGA 3I4IA 3TYJA 2QUOA 1H4HA 2R061 2VZ1A 5BXXA 4XABA 2UWCA 2WNUB 2NMOA 2RS12 1DQ4A 2W52A 3RPQA 2AYHA 2JX9A 4IQPA 2X09A 5EWSA 4A45A 3NJXA 4AWDA 2E26A 2YROA 4Q1PA 3BTZA 4JGZC 1O4TA 1PM4A 4FPJA 2RJ2A 2EXJA 2J42A 4OULA 3BTYA 2OYZA 4AEJA 1A34A 3EB7A 2FQPA 1LOCA 1BJQA 1UN1A 2ZGSA 1NQJA 5FYHA 4A7ZA 1C8NA 1SLBA 5FYSA 2E32A 2CDPA 3ES4A 5IVBA 1V0AA 2R16A 1LOGA 4JVAA 1Q56A 1W2AX 3J7LA 4TTGA 4AVBA 3WQBA 4Q5OA 4SLIA 5FPXA 1FMD1 1OFNA 2GN3A 4H2AA 3ZSEA 2Y6JA 3KHBA 2VPVA 3MYXA 3CBNA 1C8M2 3DGTA 3GYDA 3RRDA 5C4WC 3IN9A 1CJPA 1QIQA 2VOKA 2G9GA 4YVSA 3VBOA 2DCTA 1ASJ1 1L7QA 4BIFA 1KD7A 4XF4A 2Y64A 1SG3A 2DFCA 3APBA 2YBSA 5GJ6A 1WA6X 5IATA 5FZ6A 1W9SA 4EZ4A 1NY71 3LD8A 3LIGA 2V4VA 2RJKA 2Y38A 1Z7S2 4X8NA 4CDWC 3PUIA 1L3JA 2I2SA 5K8SA 4IEXA 1WMFA 4RQPA 4Y1VA 2WFF3 5FYYA 4Z1VA 5DG2A 1ZRIA 3HD8B 4KU8A 3POIA 2YPDA 2NP0A 4XURA 1HW5A 3LZZA 1BK0A 5BNQA 1RVF1 5FYMA 4P5HA 4NAOA 2EF6A 1ZX5A 4JRAA 5FPAA 4I0BA 4RSUA 1ULOA 4CEYC 2W47A 5FZKA 3IDAA 4META 5EHDA 1XPWA 5GLWA 4DZGA 5CB7A 4XJZA 3FBYA 4XOGA 1NXD1 1YC61 2QQOA 2BVVA 2VZ3A 3NV2A 2CSGA 5J09A 2JDUA 1GNHA 5A1AA 1Y43B 3W58A 1E5HA 4M00A 2Y8KA 5CNAA 1QQP3 4NHXA 2JKXA 3I2IA 1AYN2 3GJBA 1DIWA 1DQ1A 5FZGA 2BFUS 1FPN2 1ULPA 1F5FA 3KM5A 2BNOA 3N35A 4QT6A 2DVBA 3A23A 3U14A 2JWPA 3QLQA 1JXNA 5LW9A 4FXKB 1SFYA 1QJX2 3ILFA 1CJDA 5B4NA 1J58A 3C7GA 2PHTA 3O1UA 4YM3A 4K1YA 4LBKA 1BK1A 1NG0A 4QPIB 2UURA 4RS5B 1TVGA 5A32B 1H8TC 5FZCA 3WNXA 3R4SA 1PM7A 4XQWA 4CEWA 5JOXA 2RG4A 2QQNA 4TWTA 4DPNA 1U0AA 4DXRA 1JZ7A 3LIHA 5CG9A 1XQNA 1PO21 2VXJA 4FQZA 5FP4A 1XU1A 4B7KA 1LESA 5KR7A 1UNBA 2DUOA 4L8QA 4Q4W3 4J6GA 3FL7A 4HFSA 5DPNA 1S0FA 1V70A 1QJFA 2G1MA 2ZEXA 3J8F1 1QJY1 2WWJA 3P6BA 4Y4YA 3VN4A 2PHWA 3G6JB 4K3UA 2XVKA 3BPSA 1ND2C 2W91A 4FFIA 2YC4A 4IEZA 3OGSA 1VBB2 1F9KA 4K20A 3ZSLA 2X29A 4A3ZA 2GMMA 3B9IA 4CUGA 5CA6A 1D0GA 2E9QA 5C3SA 1HLCA 1DYKA 1QNWA 3NKGA 1ENXA 4KG8A 4FOWA 4BMBA 1V6MA 1UYPA 3SH3A 3TWIA 4QQ2A 2VM9A 2WNEA 2VOWA 2ZHLA 5GZCA 1UIKA 1LAJA 3NQHA 1U5YA 4O65A 4UBGA 3AKRA 3SISA 2PELA 2WLQA 3VBSC 5L7OA 1WUVA 2WS91 2BNNA 4IEWA 1LKNA 1WZXA 2R071 4LBLA 4QX0A 4XE9A 1JHNA 5FYUA 3NO8A 3GZAA 1CN1A 3R05A 2VVFA 2RS11 4Q27A 3SC7X 3ZX7A 5CEHA 1XYNA 4LMFA 1SBDA 4M3CE 5FLJA 2ZXQA 4NROA 2HWC1 3NW4A 4LBOA 4FPFA 1M06G 3J4UH 2VMIA 4ATEA 4BE3A 2BGCA 5HXVA 4GWMA 3FHIB 1K5MC 2FDHA 5LBCA 1CX4A 4D7SA 4Y1YA 4XBLA 1IG3A 1YEWA 3N9QA 1KFUL 1ZA7A 2WFF2 3SKVA 4EN0A 5CISA 3RZJA 4R9DA 4YSFA 1YLLA 3H1MA 3WG4A 5FKCA 3LFIA 4CUCA 1JYTA 2DU1A 4AEMA 5BYNA 4ZZ5A 4OUEA 5T50A 5FY4A 1RUG2 2MEV1 5JZGC 2JG9A 4AW7A 4LLFA 5F1RA 2W92A 4LK6A 3LEGA 2D5HA 2N7GA 2VXRA 3NMBA 5L19A 2BFUL 3C7EA 5B2GB 3VGIA 5DAPA 5FAXA 2RS31 4FTBA 4KMQA 2XHNA 3AZXA 2FCVA 3INAA 1C3HA 2Q1ZB 5CFCC 3FLTA 3DPRC 2R043 1QQP2 1HXS1 1OH4A 2RR13 3DYMA 3WNLA 1NLSA 1XE8A 3FUOA 2BU9A 2FZ2A 1EUTA 3CIHA 1F8VA 4B4QA 2EVXA 2G9FA 2YXSA 2JENA 4UFMA 4N7UA 3VDDA 3VZOA 3POFA 2WAAA 1JYVA 3ENRA 4NIHA 1Q5OA 1US3A 3OEBA 1MS0A 2XQXA 3CHXA 2VZPA 3ZFEA 2CU5A 1IS3A 1SEFA 3N9PA 3K51A 1UXXX 4AI3A 1UMIA 1AR81 2GC0A 1SHWB 1YIFA 2IXLA 4HVQA 1WLCA 2C4XA 1RUH3 2BYVE 1AYN1 1VMHA 1SFPA 2DBIA 2Q1MA 3R4UA 3DL3A 5LA1A 4A3XA 1SPPB 5CVRA 4JTNA 5KBFA 2ORZA 1MR5A 1GZWA 2DUQA 4DUWA 4QB2A 3TNQA 4N43B 1VRH1 3MPBA 3VZMA 1KDKA 1DBNA 5EYYA 2LS6A 2V09A 3FWEA 4N9IA 1OD5A 4AZZA 3LEKA 1G9CA 2JIGA 1NE4A 1WW4A 5DZFA 4TYSA 1AL22 5K7PA 1QDOA 2HH9A 2VUAA 3L2YA 1AR72 1GQGA 4NIAA 3DXTA 1I6XA 1W9WA 2BOIA 2W1UA 3C2UA 3HJRA 1YJLA 1UZWA 4UYBA 2QQKA 3T1LA 3WXPA 4AQ6A 3N3HA 3ITQA 4D94A 1ND3A 3H3ZA 3V0BA 5FYCA 4Q0PA 4CCJA 2HEVF 2HYKA 1FATA 1JMUB 1J1LA 1LHUA 3I3DA 3N4MA 3AL6A 1DGLA 1NXMA 2EAAA 3FX3A 1KJLA 4FT8A 1JZ5A 4O9GA 1WKYA 1PMHX 4JQRA 4AVAA 1UX6A 2DTYA 5IK5A 1VIWB 1IS5A 1KITA 2WAOA 3PL0A 4MHUA 3R6SA 3WF3A 4ZPIA 3FHAA 4RR3A 5FR3A 3MDPA 4D6RA 3NNFA 2QZ2A 3PUQA 1J3PA 4QU2A 4CCNA 1DU3D 2DUPA 5KHHA 2AACA 4UF0B 2VZSA 1BEV3 3JB4C 2XDVA 4XCAA 5GLZA 2X10A 4Y5TA 1QKQA 1UY2A 5LBBA 4A6SA 1MQTB 2JD4A 1JW6A 4HOOA 2QTWB 4Y3OA 4CP9A 4CU8A 4YVWA 2DYCA 3VL9A 5KHIA 4Q4X3 2AEYA 4PBPA 3VHPA 2VBDA 1ZZCA 1RC6A 2HWE3 4PDWB 2VCMA 1QWRA 4GAZA 3WF2A 4GMP0 5C8CB 1UOBA 1S2EA 1ONAA 2YU1A 1ZZ6A 2HWD3 3PJYA 4KWUA 4QB1A 4QPYA 4ZKTB 4I2OA 5GKAC 3AMNA 3ZSKA 4EE2A 1G9DA 3N7KA 4NHMA 2BRTA 1KRIA 2DV9A 4XZUG 5IHRA 4QM8A 2J1AA 5CYYA 4IV1A 4KL1A 4UW4A 1R081 4M3CA 3DKWA 1UW8A 5A1LA 4LHKA 4NUBA 4BQ1A 1OOPA 2ZMKA 2JE7A 4HKOA 3AMQA 1ULEA 4H7MA 1Q43A 2RR12 5I0TA 1VAMA 1WCKA 3A0NA 4QXBA 3G7DA 1U5IA 3B69A 1OPOA 1OF4A 2XH6A 1AX2A 1XNBA 4WVMB 4JGZA 3WDVA 5FWJA 4UWDA 2ZACA 1SCRA 3KLSA 4IE6A 4I3GA 4C1XA 4TZDA 3OGVA 5ACA1 1H30A 3J9SA 2HEWF 4BMEA 3ZOIA 2K46A 2VUDA 4CPBD 3CJIB 5T3NA 4E4HA 2WZR3 4EWDA 1AJKA 4QHBA 5I8YA 3K77A 1UZZA 3MIBA 2JB8A 3WW2A 4IV3B 3U78A 4Y1ZA 3D82A 4YM2A 1AX0A 2BGOA 4V2WA 3I59A 4CDUA 3KMHA 2G4IA 2ADDA 3RWNA 5DMYA 3PUHA 3MIDA 4LBQD 4GMP3 3ZN4A 5A6QA 1MS8A 4NHKA 4GKYA 4AR2A 1GQHA 1UY4A 4CDWA 2IXJA 4XACA 2HWF3 1RTVA 2XLFA 4O7XA 4PIYA 1ZVFA 4XEZA 4LORA 4CDXC 2GNDA 4QQLA 5CKQA 5A80A 1H1MA 3S30A 3D5OA 1XYOA 2WRAA 1PGL2 2VR4A 2PFWA 3KV4A 4AVTA 2OVUA 2A3XA 2EAKA 2B4KA 3IIAA 1IKPA 4Q4W1 2GAUA 4M3CF 4P9YA 4CEYA 1QOTA 3RI8A 1UD1A 2VMHA 2VNGA 1DQ6A 3AX4A 4PBOA 4Q8KA 1WW6A 1BBT2 3S7EA 3VHRA 3N9OA 1RUE1 3RZKA 4GH4C 4YW5A 4I01A 5FUPA 5C7GA 1FAYA 3AKQA 1B35B 1XB9A 3AVSA 4FPEA 4FAHA 3FFZA 3KQRA 3CZUA 4OHXA 1SDWA 1BEV2 4Q0SA 5LK7B 3KT4A 5FQ0B 3HT2A 5JXIA 3H8XA 5F8PA 1YFWA 1H1AA 1OA2A 2O14A 3CL1A 2Q5TA 1URXA 1VLNA 4AFBA 2ZAAA 1FOD1 1GP6A 1QXPA 4Q4X2 4N9HA 3MZHA 2TNFA 2VMGA 1V6KA 5EJ1B 3MUY1 1H8TA 4GZ9A 4XDOA 5LATA 4EN7B 1NLQA 4YG3A 5FJHA 1MPXA 4XTPA 4LOSA 1F2NA 4HANA 4J25A 4X8PA 5APAA 1QMJA 1NCQC 2DVFA 5LA2A 3HQRA 5T54A 3RDIA 3WF4A 5JOWA 4AI9A 2V5DA 3ELNA 4W4ZA 5KHGA 1XSQA 2RV9A 4BB3A 3KSCA 2BDRA 1PZ8A 2FZ1A 3GDBA 4FFFA 3P3PA 3OUJA 2PHXA 4AOCA 3ZDSA 4YZ2A 1ND2A 5HCAA 4Z92B 2QVSB 2UYBA 5FO7B 3BTXA 3I2OA 3OGRA 1W6PA 2ARCA 3BUCA 3U07A 4FVVA 4JGYC 1LECA 1W8WA 2UU8A 4NO4A 4P9WA 2WKKA 3NJZA 5FP3A 2H6CA 1NZIA 1UU5A 1OMIA 4PIZA 3F2ZA 4XQ4A 2D40A 4HN0A 4YVSB 2D3RA 4XMAA 1AF9A 4COYA 3JD71 4LO5B 1EAH1 1N3PA 2J1SA 3CKHA 3TN91 4IE0A 5FZ9A 4CCLA 1XXNA 1X8EA 1UYYA 1QJEA 3WNMA 2WZR2 5ABJC 4IGPA 5C8WA 3ZXJA 2R041 1KFXL 1ODMA 1PGSA 4RQPB 2ZX0A 5IK4A 2NMNA 2OPWA 3I2GA 5LBFA 4BQWA 4N90A 5FXWA 3QH7A 5IAVA 4INDA 3IWZA 2C26A 2VAUA 2V73A 5FFOC 1W9FA 1GUIA 3EBRA 1WCSA 1R1A3 3AFGA 4KBZA 3I54A 5KXDA 5L9VA 1CESA 2WZEA 4I3PA 1YWKA 3U11A 4FXGB 1PIV3 5FUIA 2W95A 3ETPA 4MV2A 2RM22 1RUH1 4PF1A 4S2HA 2I07B 3WDXA 3VLBB 3ZFFA 4N53B 4JV4A 3VD9A 3WV6A 4AAXA 3KGZA 1W99A 1VBA1 1LULA 5JZGA 1WLDA 1KJRA 5FYTA 1WCUA 5EZWA 1CPNA 4QDSA 2R1BA 2F4LA 2WYSA 1AYM1 5FRAA 5LY2A 5AC93 1PK6C 3ZXEA 1RB8G 3LF7A 3PUSA 1AUYA 5F6LB 2D43A 4BQYA 2G19A 1W8UA 5CFDC 1LENA 3E6BA 5FZFA 5CFCA 1WBFA 4YGEA 5FMBA 3DPRA 4CEWB 2D6OX 4PJYA 2Q8CA 1TE1B 5I91A 1V6LA 1W9YA 4XQDA 2ZZJA 1W0PA 1DGRA 1REEA 3H7JA 3VB9A 1S0EA 3FLPA 1PGW1 1S55A 2NZ9A 5BNPC 3H50A 3PTYA 1IPJA 1GZTA 1YQ5A 1RUI3 3BB6A 4Y20A 5DAXA 2JIJA 1Q8OA 2WR9A 4P9JA 4YG0A 3WINE 1PNGA 4LOTA 1XNTA 2VOXA 2HYXA 1VP6A 2XJUA 5E89A 3MUZ1 3WCSA 4ZXEA 2XUEA 4ARXA 3VUOA 1PZ7A 3CLPA 2DTWA 2FDFA 1UOGA 4CSWA 2XONA 2R30A 4FO9A 1BMV1 3BTAA 4XBNA 1JYCA 5AVPA 1VBC1 1XNDA 3HNBM 1V6JA 1NT0A 1Q8PA 1GR3A 2C9KA 3HT1A 3S5AA 1H1IA 2A70A 2HWE1 1OVSA 5G04L 4A4AA 5L7OB 2CL2A 3AJZA 2VMDA 4ISQA 3VBUB 2Q30A 1F31A 4K40A 1LOFC 2F6BA 4W6YA 2HWD1 1RXGA 1ZBE2 2GP5A 2VW1A 5SV5A 2ARXA 2R0FA 5K0UC 5GZDA 3FHQA 1FV3A 4QPGC 4GULA 4E8CA 3H8RA 5A3TA 1FYUA 4NRPA 1GWLA 3I3EA 1IQDC 5HCFA 5FPVA 1A78A 3K46A 2ARAA 3IPVA 4TXWA 1OFSA 4IEPA 2R49A 3SCFA 4CDQC 4IUGA 3O1OA 1RMU3 2D5FA 5J37A 4OHWA 2VOVA 4Y22A 5JWPA 2Z79A 2WWSA 2JDZA 4XUNA 4W65A 2D7FA 3U75A 4NIIA 4LHLA 1TMF3 3ZXDA 1R1A2 2HWB1 1UXZA 2JG9B 3BYWA 4JC1A 4WM8B 3POJA 2OKXA 4ARYA 2WC2A 3IMMA 4H7LA 2VBPA 2VW2A 5A7OA 1PIV2 1AX1A 3ZLIA 4LHSA 3E6CC 5DXDA 4IDZA 3ZIXA 2I45A 2WNUC 2ZS6B 5I0DA 1OQDA 2RS53 1COV3 3BGAA 4LA2A 1DLLA 1QOSA 2F4PA 1BVP1 4FPOB 1SBEA 5HI0A 2RJLA 2P17A 1LHNA 1O3SA 1ZREA 2ZX4A 3GXUA 3IM0A 4CCCA 1JHJA 2PLV3 1REDA 2AREA 4MYEA 4IEYA 2J1TA 4R52A 4UXAA 3VDDB 3U0ZA 1MS5A 1KGYA 2A6YA 2VZOA 2XJSA 4AQSA 3RZLA 4HONA 2HWF1 3J7MA 2W08A 4A42A 2YFZA 5A7NA 1RUF1 2A7AA 5C9AC 5CKNA 2JDAA 4AFDA 3UKNA 3ZFEB 4Y5SA 2PHFA 1UY3A 2GN7A 1G6NA 4HK9A 4OVEA 3B93A 5KXEA 5LEJA 4FBFA 1ZM1A 1G9FA 2GP3A 1POQA 1H2KA 4E27A 3RFRA 4CU9A 3PUAA 1UZVA 2VZVA 3T4HB 3ZXFA 3TEYA 1F5JA 1Z0HA 1RUI2 3ACFA 4NWWA 1ZRDA 3AKTA 5IJRA 3IMNA 4IERA 1D4M3 4XILA 4UW3A 4QM9A 3Q8EA 1D2QA 1H2NA 1AZDA 2C6SA 2J22A 3OYWA 4FCAA 4HMZA 1VBB3 5I8SA 2QBXA 3OBRA 5JDBA 3ZXGA 4FFHA 5BNOB 5KHJA 2O8OA 4OFGA 2BUKA 3GZEA 3ZR5A 2K0GA 2RMU1 5DZGA 4M0HA 3MV01 2PN5A 2XJVA 3ZYBA 2BBAA 3VZKA 3V0BB 4LIUA 4OZXA 2MHFA 2ORXA 2CV6A 3WOGA 1E5IA 1LRHA 1ZBA2 4NAMA 4LO8A 1ODNA 3WF1A 2VCCA 4NHLA 4Y1UA 2WZPP 1W90A 1UCXA 4D0QA 4UOJA 3VZJA 2A73B 1GKBA 5AVAA 4E4SA 2KXLA 2Z2SB 4BXFA 3RYKA 4WM7B 2O8QA 1GOGA 5FK8A 1QJU1 1JYNA 3KCXA 4RR3B 2WT1A 4WVZA 1DDLA 4DO0A 3B02A 2TUNA 5DG1A 4ZXKA 4E4ZA 4BYYA 1W6MA 4DEQA 4F3JA 4QPIC 3IB3A 4RS5C 4BPZA 4EWEA 3N7MA 1RHI1 4MGIE 4MVTA 2I74A 4BU2A 3P5BA 4CP9B 4OI2A 1RMU2 4AF9A 1W8NA 3J7HA 3PVEA 4KWLA 4XFGA 1UX7A 2BZDA 3ECQA 3M3CA 5E1RA 3BOPA 1AXKA 1OD3A 4JHTA 3WCRA 1HB3A 2PHLA 4PF5A 4AFAA 2ZGTA 5FPBA 1X8MA 3H3UA 1RUG3 3VBRA 4BA6A 1TMF2 1TZOA 4Q4V3 5CU1A 4L0PA 5HBAA 5L36A 4RD7A 1NKGA 4GJZA 2WLPA 5DAWA 4PCRA 1QHDA 3ZSJA 1UZYA 4LULA 1YO8A 3K3OA 4HETA 4MO3M 1SDDB 2NPIA 3H1WA 4AI0A 4OI1A 2JD9A 2WNVB 3QH6A 3AM2A 2G9ZA 5IVFA 1Q8VA 4OUSA 1SFNA 2ET7A 1O3TA 5DN2A 4IEVA 2RS52 2LW8A 4Q1RA 1COV2 2J1RA 2JXAA 1YXWA 4OQ9A 3WNNA 1OOPB 1W0OA 2WINB 1NCQA 3ILRA 1PO13 2AH2A 1JOBA 1X9PA 2YYOA 4BHPA 2BWCA 4CCEA 2PLV2 4XJ9A 3DCQA 5B4XA 4URAA 2PXJA 5T5OA 3OSDA 3VDBA 3VKNA 2JECA 1S0CA 4HSJA 3KF5A 2LUWA 2XB6C 4I09A 5LWBA 2EA7A 3N7JA 3PVOA 1OUSA 2PA7A 1EYBA 1YRZA 4GD4A 5I0UA 1W3VA 3CMGA 3ZFGA 1IS4A 5JI9A 3POYA 5GZFA 3RMXA 2ZGQA 3AVRA 2JEMA 1AXYA 4XW3A 5FZLA 3T2QA 1SCSA 2BP6A 4FFGA 4JGYA 5FZBA 4KBBA 2V5YA 4BISA 3LGRA 1PHMA 4QHOA 4Z8BA 4CDUB 5FY0A 5C3OA 3TEXA 5AC91 5GZEA 1UU4A 2W39A 4MXWB 4F7ZA 1I5PA 2BVBA 3VBFC 1D4M2 4OYUA 3BPZA 1OQEA 3GALA 1AL23 1RGSA 3U1XA 5A6YA 3IAPA 1W8HA 4B7EA 1AR73 4UFIA 4AEDB 5ABJA 3PU3A 1W39A 1RUC3 2E6VA 5FZAA 1U5ZA 5FOJB 4GB33 1FT9A 3T0DA 2D3PA 4BK5A 3LPGA 3HQXA 3NJYA 5JPNB 3RSJA 4YGCA 3I2KA 1W8ZA 5FV3A 4JZRA 2A75A 2Q8EA 1W06A 5C5TA 2XL7A 1J59A 5LBEA 1W6QA 3B9CA 1JZ6A 4CEYB 2SBAA 1RUJ3 3ZM8A 1D7PM 5C6CA 2R6QA 1GLHA 3J7NA 3BN6A 4QGMA 1VBE3 1W8TA 3WX5A 2IXHA 2MNGA 4NMIA 5FZOB 2Y6HA 5JMCA 5K4LA 3C7OA 2IFRA 4XHXA 3RWKX 4W6WA 4C8DA 2VNRA 3A4UA 2DWRA 1OLRA 3WQ7A 1NA1B 5J36A 4YZ1A 2WWUA 5FXVA 3ZMNA 2YMZA 2VD7A 5CADA 3NV4A 5IT6A 1BCXA 5HCHA 1CAXA 4BH9A 4ZU5A 1PK6A 2CDOA 2P37A 4DXZA 3H8OA 5BNNB 1G7YA 5GLUA 2QZ3A 1H8TB 5CFDA 2BERA 3AZYA 3PURA 2H0BA 5FTTC 5AFEA 1C8M1 1WCQA 4M4RA 1C28A 1POV0 3EYPA 4N43C 4Z07A 3OOXA 5A3LA 4Q4V2 4ASKA 4ISRA 3RYPA 3D0JA 1WLWA 3NAPC 3TAYA 5BNPA 2JG8C 3AP7A 1Z7S1 1ZZ9A 3LB9A 2PHRA 3LWCA 2BWAA 4MH0E 3I97A 4LJHA 4A7YA 4CE8A 1JBCA 2YGLA 3VKLA 3VHOA 3NRUA 5FZ1A 1W8FA 3MV11 4QX2A 1RIRA 1O7FA 1AVBA 3LQCA 5KWRA 4FOYA 2YDEA 1ND2B 3ORJA 2A6VA 2VECA 3OBAA 5FPLA 4XUPA 5I93A 1PO12 3ZPYA 4FOVA 2VQTA 1WCDJ 2VNVA 4DUVA 2FMDA 2XBO3 2ZABA 3D3AA 5IWFA 3ROUA 5FDBA 2JDYA 5IK7A 4DINB 2P3IA 4YPJA 4D8MA 4C0HA 1HKDA 2AENA 4DOUA 1MACA 1EY2A 2WL1A 3M3EA 3OF1A 3GCWA 4PT6A 3I3MA 5F39A 5JCTA 1CONA 2P3JA 5DUVA 3UGHA 4CCKA 1LOFA 4V1PA 3J26N 3T2TA 3N9NA 1LGNA 4XUOA 5CAZA 5DAVA 1FPN1 4LE4A 3KS7A 3MO4A 2VTXA 5K0UA 1MQTC 3JXSA 3ON7A 1TQ5A 4RGGA 1FNZA 5FMDA 1MEC3 1QJX1 5FO9B 1YQ2A 5D8AC 1POV3 2VH9A 1W6OA 1OSGA 2IVJA 4MGYE 3USSA 3ATGA 1PX3A 2GH2A 1CAWA 3GBFA 3WG3A 4CDQA 1YYNA 4GKXA 4PDWC 2PTMA 1OLME 1QH6A 1ULDA 1RUC2 3PMSA 5FZ3A 4LNVA 5KXBA 4IESA 3D0SA 4BQ5A 1JYXA 4GB32 4U2AA 3K48A 2Y0OA 5JR2A 3ZFFB 1SLCA 5KC6A 5M0TA 1R1ZA 1ZZ7A 4DXTA 1DLCA 1L7LA 3LDKA 3ZYGA 1X7NA 5F5QA 1VE0A 2ZGMA 1XNAA 3HPNA 3THTA 1O4ZA 4XF0A 1S0DA 5JMOA 4AVSA 2W0XA 1RUJ2 2Q8DA 4QX8A 1A8MA 4MXVA 5HPOA 1AR93 1KQRA 1UO9A 1WLTA 1BBT3 1VBB1 2LM3A 1HRI2 3BU7A 3MFCA 2A1XA 1HB1A 1S2KA 4LBMA 4AI8A 1NUKA 1UIJA 1VBE2 3ASIA 4AFCA 5ISLA 2CWMA 1Q8QA 3E97A 2YFUA 5JI7A 3UJQA 3JU9A 4AAPA 2A6WA 5GZGA 2KA3A 3MF6A 1VRBA 2ADEA 2EIDA 3DPRB 1G86A 1UYXA 3MEPA 5JPMB 1V00A 2Y0IA 4Q4Y2 3CF6E 4PI2A 1LHOA 3C8XA 2GMEA 3CJIC 2WDBA 2Y6KA 3T0BA 3GZUC 1O4YA 4H3WA 4I02A 3WNKA 4AHZA 5C3PA 5F37A 4IV3C 1ENQA 2ZCWA 3K3NA 4Y20B 2BOJA 3A7QA 3HMYA 5C9AA 5IYYA 4HN1A 1AR63 4Q8LA 3USUA 4X6RB 1GV9A 4YRDA 3S5QA 1W6NB 3ZYIB 4AEKA 3KV5A 1K45A 2PQSA 4U36A 5C33A 1YFUA 2Z4FA 2AGSA 2D6PA 3LDBA 3POSA 2WT0A 4YZ3A 1J1TA 1CAUA 1HX6A 2YU2A 3O0XA 2WFF1 5F32A 2PAEA 1CPMA 2GMPA 2W1SA 5DDJ3 4B4RA 3UNPA 1JODA 4YZ4A 5H9PA 3VBHB 3AP9A 3F95A 3OD4A 1RJ8A 1SLLA 1RUG1 3ZN6A 2W3JA 1QNYA 1OI6A 2PQQA 4XXAA 2ZTNA 1Q8SA 2C5DA 5D21A 5L73A 1LTEA 2XBO2 1CAVB 3ACIA 2WN3A 3C7HA 3EO6A 1ENRA 1DGWX 5LA0A 1GSLA 5FK7A 5BY5A 2CHHA 1JU4A 1LCLA 3THCA 3O14A 2Y6GA 5GLVA 1LGCA 1V9U3 2RDNA 1I9RA 1B35C 1NCRB 3WW1A 5A70A 1QQP1 1IG0A 2WQZC 2EALA 4JTOA 2MPFA 4AL9A 1DCSA 2HEYF 3EQEA 4LO4B 4BOWA 5KXCA 4QD2A 4YW2A 4YW3A 4CP1A 1QJZA 2HBUA 2W87A 1DG6A 3CU7A 5C4WA 5T52A 4RGKA 4W8JA 5IVCA 1UOFA 1TEIA 2E7QA 4GJYA 4LTAA 1K12A 4Q26A 1MEC2 5HCBA 3U10A 2BW8A 1DQ5A 5JLVA 2IUWA 1DGRN 2Q0AA 4COUA 4YARA 4QPIA 3K4DA 1UY0A 1OLQA 3NNJA 4QMAA 4C0BA 4OCTA 3M2MA 4DIQA 4UFJA 5FLHA 2RM23 3MHZA 5AFBA 5C70A 5FZHA 3SH4A 2OQ6A 3AZZA 3M3OA 1IPKA 1S1AA 3WP3A 4XF1A 2B39A 2GSYA 2VMEA 2ZPXA 1OT5A 2B9VA 4CCMA 2ZX1A 2GNBA 5FIXA 3WQ0A 3JBG3 4UAPA 1APNA 1O5UA 4B1LA 3I49A 1AL21 1NZCA 2DBNA 3MW2A 1O8PA 1YQ8A 1AR71 1AR92 1HQNA 1G8WA 2OT7A 4LE3A 4CP2A 1XE7A 2DCZA 2RHPA 1ZA4A 3E5UA 3IZOA 2EXKA 1HB4A 1LOEA 1JUIA 3JQWA 2ZAHA 4GB31 2ZA9A 4JDOA 1EV13 3KQ4B 3PJQA 2ZGKA 1QGLA 1Y7BA 3SKJE 1VPHA 5F5IA 4IGQA 4YVSC 1XC6A 4AK3A 5F7UA 1JUHA 4Q0QA 2JICA 3DF0A 4XETA 4BDVB 1JH5A 4XFIA 3SLIA 2NLRA 3PU8A 2RVAA 2W46A 2OX0A 4HVRA 4D3WA 4KU7A 4K7JA 4FPCA 1PZ9A 2WBKA 3JB8A 3ZMOA 1MS4A 2XR4A 4WBBA 4YWAA 3WT3A 4BLJA 2FCUA 3THPA 3OYWB 1AR62 4A2UA 2R063 1QF3A 1W05A 4X6QB 4EZHA 2XJTA 4C90A 2BV4A 3PHMA 4ZY9A 2QQMA 4ES9A 1HQWA 1YI9A 2ZX3A 3T09A 3ZXLA 5JSRA 2FDIA 2JKBA 1NX9A 3LA2A 5C3QA 2ZGPA 1VB4A 3T2PA 2YBKA 1TME3 2ZEYA 3A22A 4LKEA 4BLIA 3AP6A 4HLTA 2C24A 3AXEA 1V6OA 1D0HA 5DDJ2 3VBFA 3OUHA 3RG0A 4YW1A 3NNLA 3SCHA 4L97A 1VMJA 4N53C 3RNSA 1RUOA 2AC1A 2DCJA 4YW7A 2WIIB 2ZEZA 3OBZA 3QACA 1ZBE3 4XF9A 4I0WB 2P2KA 3BU0A 1TNFA 4CYDA 5JSPA 2CAUA 1GOHA 2XPJA 1I5ZA 1VBD2 1NOVA 2VL4A 3VBOB 2VZUA 4B1MA 4R9BA 5A6ZA 2D6MA 3VBSA 2WO7A 1W6MB 4WV8A 1PVC2 4NPLA 3ZDVA 1V9U2 4DY5A 3FBMA 2BEOA 4NIGA 1YNAA 4OI0A 3AK0A 2RR11 3H8UA 4BWOA 4CEWC 4LEJA 3RYRA 3M70A 3AZWA 4Z2AA 5A7WA 4FTEA 1OF3A 4HBNA 3AYDA 3NL1A 4RFT0 2XBO1 2QQJA 1C1LA 4LKDA 3VD5A 2DDUA 3VBRB 4YYOA 1MVQA 3K2OA 3FFQA 1DFQA 5FCCA 5EYXA 1K5MA 1K3IA 3MGUA 3O7OA 5H9QA 3WDTA 5LRSA 2CGPA 5IVEA 5L9RA 3O1PA 5CG8A 2IXIA 4LO6B 4COVA 4CU7A 2J1UA 1PMIA 1OA4A 4PIXA 2Q1FA 3LOIA 5A3NA 2VOTA 1T6BX 4MZUA 4BCUA 1A8DA 1F35A 1YFXA 1SPPA 3OUIA 4KG0A 3W21A 4M01A 1J3QA 1J83A 4N43A 4Q2FA 4E2QA 1MS3A 4H55A 5FP8A 4YNIA 2D6KA 1RUNA 1NCQB 4BZ4A 1POV1 1RINA 2CGOA 1N47A 2TBVA 3JBG2 4RGAA 4XAAA 5JAXA 1T2XA 3NAPA 3GNEA 3HBKA 2Q8OA 2WJSA 2DU0A 2JG8A 3HNYM 4ZZ8A 1UOJA 1WW7A 5IVYA 4LT5A 5FYZA 4URTA 3POGA 3B01A 1LOAA 3I3BA 2BJSA 5IUQA 3VBUC 3VZLA 5FOBB 4UFHA 1YQ6A 3UL2A 4KGGA 2WO1A 1EV12 1F4HA 1OUXA 1UMZA 2W2IA 2DVAA 3GBWA 3BI3A 1PGL1 2A6XA 4D6QA 3ZFGB 5FPUA 3ZYPA 4BIOA 2L9LA 1HJGA 3FMGA 2X05A 4MHRA 3S6PA 3O1RA 3ACHA 3PLQA 4JGYB 3SH5A 3UJOA 3S0MA 1PO23 3MPPG 2D6NA 2PYTA 1OURA 2QQVA 4FPYA 3ZYRA 4Q0VA 1BBT1 4CPBA 4XUTA 3DYOA 3QOPA 3CDZB 2VE1A 5DUWA 1QJY3 5FY1A 1KS4A 2XL9A 4BK4A 2FDGA 3L9JT 4QHZA 4XAEA 4HPKA 2JDHA 4CCOA 4BQ4A 5ABJB 3NWKA 3DKQA 2R062 4PLOA 1REFA 3SNMA 1BEV1 3IAQA 4UF0A 3PIJA 2ARBA 2JG9C 4WM8C 4QX7A 2IZWA 4NRMA 3RVHA 5F3IA 3VV1A 4LBQA 1MQTA 4E4DX 4ZHNA 2P6HA 5L9BA 4QPWA 1W2NA 2IFWA 4PLMA 1TME2 1ZBA3 5D8AA 2R7EB 4Q4X1 4S2DA 4Z2WA 1HV1A 1W6QB 4XFHA 1XYPA 2WO3A 2PHDA 3AYCA 4PDWA 1AR61 2WS93 3B00A 4QXKA 5FY9A 4XF3A 2R073 1OKQA 2D98A 3AMMA 1VMFA 2VGDA 2HJIA 2X5IC 3M3IA 2ZHMA 4F83A 4ASLA 4JRLA 1AJOA 4HKWA 1I3HA 1LR5A 2HWC3 3VDDC 5FZ7A 4XTMA 5J1XA 3W5NA 3WNPA 5EFUA 1UPSA 3CJXA 3WD5A 3ZYJB 1MS9A 1NY72 2XVLA 4XPVA 1MZ6A 2VVEA 2E53A 1CAXB 1S0GA 3AJYA 3W20A 2QQUA 1GOFA 5JIAA 1C4RA 1HB2A 1JZ2A 2OZJA 1E57A 5CKMA 1JOJA 4LR4A 1IKQA 2P4EA 1PNFA 4KI5M 3E5QA 5EPAA 4XIOA 1GANA 2EXIA 3UESA 1WW5A 2B8MA 2MEV3 2DFBA 5A3MA 2VQUA 2UWBA 4FPGA 4IETA 2DURA 1Z78A 5GM0A 3SITA 5E16A 1V9U1 5BNPB 2WZR1 3HAGA 1YCIA 5A3OA 4B3NA 1O91A 2UWAA 4AHXA 3PNAA 2RS33 2WSVA 1SBFA 3BALA 3HWJA 5BNOC 4OQ8A 3ZR6A 3OJBA 1CX1A 4UW5A 2VU9A 2QDRA 4PLNA 4I30A 4WZCA 4XDQA 2FDJA 2R1DA 5FZ4A 1H9WA 2D97A 3VHNA 3JCIA 1VAKA 5E88A 1V6IA 2P34A 4GMP1 1ZNPA 5FBJA 2GDFA 3V56A 1UU6A 2YHJA 4NN0A 3V65A 4KGQA 3UGFA 2FHRA 4LUMA 1N3QA 3POBA 4EYUA 2UY8A 1RL3A 4EV0A 3ZXAC 1ULFA 3M1HA 1STMA 4MGSA 1G9BA 4BQ3A 2VG9A 4YFWA 2RM21 3BKZA 5LZ6A 4WM7C 4ONUA 3HR9A 5LK5A 3A21A 1SZBA 4E2SA 2YG0A 1AR83 2YY1A 1HJFA 1ULGA 3DEMA 3JBG1 3WEZA 3LFMA 4O9EA 2WSUA 1GZWB 1GBGA 1O6UA 1PO22 1VB2A 3GHMA 2VNOA 4K21A 3WUCA 4HZFA 1VRH3 4OMCA 4UBHA 3T2OA 4DXSA 3QBQA 2VMFA 5SV8A 1W6OB 2TEPA 3J8F2 3E5XA 1N1VA 1QJY2 4IE5A 4COWA 2WO2A 2AR6A 5LY1A 3DECA 3WP6A 3CZJA 4CDQB 1B35A 1CZSA 4L9BA 1WA4A 1JZ8A 4L92A 4A6OA 2VW0A 1W2TA 2IC1A 4QXCA 2PHUA 5FZ8A 5A7QA 3WW4A 3KGLA 2D44A 1MZFA 1ND3B 1PX4A 2O0OA 2P1BA 5FQ0A 2BPA2 4MOAA 4R4ZA 4CTEA 1JYIA 3H1YA 4OHYA 3AXDA 3QCWA 3WDWA 4QDRA 3UKTA 2QDNA 1HIXA 3LA7A 2QQWA 1UL9A 5FJKA 2ZHKA 2WNVC 2K9ZA 5JIUA 2V72A 2VTFA 3LSEA 2WS92 4MGZE 5A7PA 2OA2A 3V64A 4CDXA 2R072 1JS9A 1VALA 1GWKA 1BHGA 3GZTB 3Q8AA 1O8SA 3MFAA 2B5HA 4BJ0A 4DMIA 2VJXA 3B7MA 3W5MA 5F2WA 3TRSB 4WVWA 1OVPA 2HWC2 3AP4A 5EXOA 1JZ4A 5D1IA 1TME1 2FBEA 4LQRA 1TG7A 5H9SA 3X29B 4RA0A 1KS5A 5EQUA 3PTRB 4JKLA 3OEAA 4YVWB 4JQTA 3RZZA 4D7YA 5C5UA 4BQXA 5FMOS 1IGOA 2OS2A 2A3WA 1ST8A 4YLZA 5FREA 1NQDA 1ZBE1 2IWGB 4GH4A 2W9XA 5C9AB 4KNCA 1W3XA 4HXCA 5IVJA 1X33A 1LHWA 1SLTA 4QX3A 4ZU4A 5C3RA 4CDUC 2GNMA 1QDCA 3USUB 3EMRA 4LHNA 5DUXA 4K8RB 2MEV2 4M4PA 3WDUA 3HN3A 3HIFA 1MZ5A 1RXFA 1X50A 4LIVA 3UV9A 2ZX2A 5JSOA 2VUCA 4Q29A 2VY0A 4WZFA 5BUVA 4AEDC 2Y6FA 3O5SA 4D69A 1CAUB 4XJUA 4IV1B 2RS32 3RZMA 4M3CB 1HN1A 3H42B 1R083 5A3UA 5A7SA 2JE9A 4AXOA 4CXXA 3FC0A 3OY8A 3O1SA 4HT1T 1HXS2 1R1A1 3ZN6B 1T6GC 3N9MA 4RYDA 4AI2A 3R0RA 4AI1A 1XOYA 1UF2C 2VBBA 3LSDA 1WMDA 1YUDA 1LEDA 4JGZB 1OBNA 4D6SA 3IBMA 1OA3A 1W9TA 1PIV1 1OH3A 2VUJA 3LA3A 3W9AA 3OB8A 5ACA3 2ZEWA 4N7IA 2ZBJA 2D3SA 1H6YA 2QKDA 4C91A 3AC0A 1VAVA 2RDSA 4PQ9A 5I0SA 5IFPA 1W0NA 4N53A 4EJRA 2WA3A 3K75B 4UFKA 5T5PA 3V0AA 1JN2P 5IW0A 2X8KA 2FCTA 2QE3A 1AR82 3OD0A 4JHZA 1NA1C 3Q8CA 4S2FA 3TOJA 4EQVA 2NYYA 3TEWA 5FZEA 3SQOA 1JZ3A 4W6XA 2ZGOA 5C4WB 1UPIA 1UQXA 2EIEA 2P6CA 3I59B 4P9GA 1QOOA 3ZSMA 3HQUA 1RUD3 1VRH2 5IVVA 1XNCA 1AHSA 3IDBB 4OZOA 1DYOA 1DZTA 1GZCA 5BNNC 2WFPA 3MW3A 1XBFA 4IE4A 4FAGA 4CDWB 4TLFA 4OI4A 2VZRA 3MBWA 3O0VA 4YFZA 1HRV3 5EJZB 3LEMA 1S2BA 1ULCA 1QH7A 4YZ5A 4DEVA 3HN1A 4FQ4A 4DFSA 1BQPA 1F15A 1RUI1 4XXPA 1FI2A 1QXJA 5DAQA 3T08A 5KHKA 5F3EA 4CRQA 4RFRB 1O3QA 3HVDA 1LEMA 3CO2A 2ZGNA 4YGDA 5LB6A 2B42B 1O59A 4A41A 2D93A 1GFF2 3AMHA 1WBLA 4XZPA 1HRI3 3JQXA 3KV6A 2J7MA 5H9RA 3IT8A 2XWJB 2B45X 1ALYA 2VQAA 1U12A 1SMVA 1Y9QA 3LCPA 1RUE3 4GALA 3WHTA 3DYPA 4HVOA 5TSWA 4NOTA 5FMOL 4J1XA 1CVNA 1DZRA 4XYXA 1W28A 1ZRFA 1OHFA 2EXHA 1ZBA1 1CGPA 4Q4Y3 1JOPA 2ZHNA 3NNMA 1S0IA 4QWNA 5JR7B 3LDRA 2YB7A 1HDKA 3OPWA 3VDCA 3NKTA 1H8VA 4P9LA 4NE9A 4P9XA 3AZVA 2YV8A 4XBQA 3H3LA 3I2JA 3VBUA 5I8TA 5T5JA 1FOD3 4E9KA 2ZMNA 1IS6A 3TEZA 3KVBA 1CR7A 3B5LB 1OQ1A 3P1IA 2LALA 4IL7A 4WVVA 5ANQA 1CD3G 4EWAA 3NJVA 4DNYA 4CU6A 3RJRA 2E31A 4YW6A 1C5IA 3GBGA 1YHFA 4G4FA 1W2UA 1CQ9A 2E51A 4AG4A 2HBTA 3AMPA 1RMU1 4SBVA 4XFCA 5F2SA 5KC5A 5IK8A 1N1SA 1OKOA 1W03A 3H7YA 3I2FA 4UT5A 3WUDA 3OPZA 4G3YC 4NWVA 3VBFB 3AKSA 3FN9A 1UZ0A 3N36A 1NAEA 1R082 1EP0A 2ERFA 5J98B 3ZFFC 3OGGA 4XFFA 1S0JA 4V2VA 4JKKA 4CP0A 1TMF1 1W6PB 1O5LA 4ZS3A 3I2DA 1QXRA 5GALA 2ZGLA 3IDCB 2C1FA 3KVAA 3AL5A 1LNSA 4WM8A 3L2HA 1F4AA 2ES3A 3I8TA 3B94A 2YZ4A 3WG1A 1SACA 1FX5A 3ME2A 5FYBA 2OZ6A 5DUUA 4PI0A 2JDNA 4LBJA 4BM8A 5ACA2 3JD73 5A33A 1EAH3 3NV1A 1L7RA 1KEXA 1H0BA 5F3GA 5FY7A 3TN93 3VBSB 2RS51 4DRVA 1COV1 4XUQA 4C1WA 2GH8A 1WMXA 2ZGRA 5K9YA 2ZGUA 3GGLA 2X5IA 3FE5A 4MGTA 1NYWA 2E7AA 2PLV1 5CIRA 4LPLA 2VO5A 5FY5A 5A7WB 1GQPA 4QPGA 2ATFA 2XJPA 1RUD2 5FP7A 5BPXA 4ES8A 5HXMA 1Y4WA 2IXCA 3A0KA 1CZTA 1CIYA 4ITCA 2ILMA 2R0HA 2E7TA 1MS1A 4QQHA 2BBVA 2OW4A 1K5MB 4FTSA 2EIGA 1D4VB 3UETA 3O12A 2JJ6A 3RI9A 4FPKA 2JB4A 5C8CC 4ZS2A 3H0OA 4A44A 1HRV2 5JVVA 4QX1A 5EJ3A 5EIYB 3AP5A 2ZMLA 3POEA 1UYZA 2WZ8A 5JZGB 1VBA3 5J96B 1H4GA 4Q4W2 1BXHA 1W8OA 1D4M1 2IVIB 4FOQA 3NAPB 5FWEA 1VR3A 2F17A 4GXLA 2JG8B 4XIKA 4R9CA 3VBHC 3WQ1A 1AYM3 3POWA 4TSVA 4XDPA 1H9PA 2WNUA 2RE9A 4UFLA 4BQ2A 5BNOA 5HV4A 2PMWB 3KHCA 1RUE2 4CCDA 5CFCB 3AYAA 4ATFA 4FSJA 4G9SB 4ORFA 1YJKA 1DP0A 2A6ZA 3M7AA 5LA9A 4H14A 1GMMA 2JDPA 2XXZA 3O0WA 3B3QE 1IHMA 4YM1A 3DUIA 1BZWA 1LB2A 2BNMA 4P00B 3ETQA 4RHV3 1NCRC 1NLRA 5F5CA 4CA9A 3LE0A 1FOD2 5LASA 3ZYFA 4NIDA 3M3QA 4WM7A 1H6XA 2DCKA 2DVGA 2W1WA 5FUNA 5FKBA 4B29A 2YGMA 4GWNA 4UW6A 1GYKA 2NQYA 4HPKB 4OHZA 2ENRA 4D7TA 4XVHA 5D2AA 3VKMA 4ZU7A 4OHVA 4XJWA 3VZNA 2QQPA 3ZVXA 1R093 1DHKB 3ZXKA 3U4SA 3QD6A 4GQ7A 4JX0A 2R32A 4LBQB 3SEPA 3NVCA 1AXZA 3HBZA
chains in the Genus database with same CATH topology
2XHKA 2ZOEB 5D8AB 4GIQA 1Y3TA 3D8CA 1VBC3 3Q9OA 3W59A 1ZZ8A 4MLOA 2ET1A 2GALA 3MIFA 3S7IA 3WHUA 3RJ2X 3RS6A 1YIPA 4Q4V1 2GC3A 1KDMA 2B46X 2P3KA 2QJVA 1J3RA 2GNTA 4AVVA 5FO8B 1VBD3 2YUEA 2QNKA 4XHBA 1C57A 3R4DB 3SXWA 3WW3A 3JD72 4S2GA 1EAH2 1HV0A 2WNVA 3TN92 1PVC3 4AYUA 3IPVB 4DQAA 2B7YA 1MVEA 2XGXA 1PO11 2R042 4Y22B 2CWSA 1XNKA 4LLOA 4DS0A 4IEOA 1LHVA 1V6NA 3DN7A 1DQ0A 5T5LA 3MLLA 4MGKE 4AHYA 1SLAA 2XLAA 3E6DA 2HWB3 1NE6A 4RS5A 3U4XA 5A32A 3KD4A 3C3VA 4EN9B 3OGJA 2HKXA 2Z5WA 2OIIA 1U5XA 3M4FA 3LAGA 1IOAA 2DVDA 3ACLA 1SLIA 1RUH2 3BCWA 3KB5A 2XKOA 3KCCA 3SHRA 2GC2A 3URFA 1RUD1 1WGPA 1O3RA 1VBA2 2BQPA 4MXWA 4HK8A 1H2LA 4KWJA 2XUMA 1ENSA 3ZIWA 1HQLA 5BV6A 5FBZA 1AYM2 4AEDA 1RUC1 4DY3A 4NR1A 2QFEA 4LBNA 4QGLA 3AKPA 1AL0G 3SCGA 1RUF3 1IZ3A 1HRV1 1DYPA 1RJ7A 4FP2A 1LGBA 1XU2A 1Q3EA 2CGNA 4MX3A 4R8HA 4OLLA 5GLTA 2OUJA 3VBOC 1FNYA 2UY9A 1RUJ1 1PGW2 5FLIA 4K1ZA 1X82A 3AYEA 3VKOA 4RHV2 2NN8A 1HRI1 1M4WA 4ASMB 2CYFA 1UKRA 1QU0A 1VBE1 2GZWA 4I0AA 4RQPC 3D6EA 3PMEA 1YI7A 2Q4SA 3P3NA 4AE2A 4AQ2A 1DF0A 3AFKA 2GC1A 2XKPA 3AB0A 3D4KA 1NA1A 3VBRC 4Q4Y1 1BVVA 4JDNA 1R092 2RMU3 2UYAA 2QCSB 3WZ1A 4LUKA 1BMV2 4HL0A 3MIEA 2ZKNA 1VBC2 2A5ZA 1GZ9A 1BKZA 2ZZQA 2AZ5A 3EHKA 5BNNA 5I0RA 4IEQA 1ZRCA 2HWE2 1EPZA 4KH9A 2PAMA 3T1MA 1LOBA 4DRRA 4CDXB 2SLIA 4K6BA 3FUQA 1BYHA 2HWD2 4AHWA 1FMD3 1QJU3 3WP5A 4MSVA 4FP3A 1ASJ3 2IXKA 2CNAA 1SQ4A 4EN8B 3WR0A 3ZO0B 3N7LA 1RHI3 4FPHA 1MZEA 4GA9A 5J7MA 4P14A 4JCKA 3ZFGC 2C0ZA 3BODA 4K9SA 5J3UA 3DV8A 4GH4B 3MI8A 1QY4A 5JOZA 3VKFC 2NM1A 4NVPA 1VJ2A 4J1WA 4OUMA 1RVF3 3TB0A 2HWB2 2D6LX 2B9UA 3WLUA 1I1EA 2A71A 4XMIA 1DQ2A 5E8AA 2LTNA 3OY8B 3H9AA 2WA4A 1MEC1 2C9AA 1OPMA 2YPJA 3IKWA 2H6BA 3MLKA 1B09A 3ES1A 4YGBA 4P9IA 5CBLA 2H0VA 2DF7A 5L7OC 1PVXA 1UKGA 2BTVC 2HWF2 4HKLA 1RUF2 3FJSA 3RMYA 1A6CA 3BOWA 1FXZA 3MLJA 1ZYBA 3OBTA 3OCPA 1C1FA 3V0AB 3OTFA 2KM2A 3UKVA 4XFBA 4EN6B 5LEKA 3JUUA 4AFMA 3SMHA 1AR91 3CEWA 1D2SA 1H2MA 3NV3A 3TNPB 1WD3A 3KT1A 3J8F3 3WG2A 1ZZBA 5J48A 4COZA 4YW4A 4M0NA 4Z82A 3MW4A 3ALQA 2RMU2 4Y5Z0 2WQ4A 4R9AA 1XRUA 4XFAA 5JOYA 1DGWA 2GU9A 4RHV1 2E63A 3ST7A 4IEUA 2AUYA 4Y24A 3WDYA 4K8FA 2ETEA 3CNAA 1N1TA 3MIGA 3FLRA 5C8CA 2K2SA 1G9AA 4RL7A 4FPLA 2CY6A 3VL8A 4Q0UA 1W6NA 3WP4A 2RS13 1FMD2 1LODA 1S0BA 1QJU2 1R091 2Z69A 4QGNA 1C5HA 3UK9A 1ASJ2 5DDJ1 2XLGA 3ZFEC 3VBHA 1RHI2 2XG3A 1PK6B 2FMYA 3TBDA 4EROA 2CAVA 1TNRA 4L11A 3EXUA 5CFDB 1YFYA 2X53S 4WVMA 4A7KA 3MF9A 3WVJA 1CAVA 1C8M3 3I7DA 4IXLA 1VBD1 1RVF2 3JZVA 5FPZA 2PAKA 2VULA 1PVC1 4LA3A 1WD4A 1FV2A 3CJIA 3LKJA 3ZN5A 5LRRA 1NCRA 1Z7S3 1N3OA 4IV3A 4B4PA 2Z42A 2XWBB 2XVGA 2WT2A 1ND3C 4KWKA 4QQOA 4YG6A 1RITA 1GNZA 3FZ3A 1IQAA 1HXS3 3EJKA 4L99A 3WY6A 4AGRA 4Y1XA 4Y26A 3M8LA 4MUVA 1CIWA 4L2NA 1DZQA 1LU2A 4F8AA 1ZRRA 2A3YA 2XJRA 2XJQA 5F6KA 5A33B 3BIWE 2OPKA 2ZJCA 3PVBB 4RR3C 1LJ7A 4AQTA 2CTVA 5T55A 4CZSA 5DZEA 3GHNA 1AYN3 4LO7A 1N1YA 4JAAA 2X5IB 4R4XA 4AVCA 1JTZX 1FPN3 1EPWA 4NPRA 4KQ7A 5K0UB 3GF6A 3KT7A 4QPGB 3RQ0A 4YVWC 1QJX3 5AC92 2OUHA 5F9TA 1UAIA 4DB5A 4HSLA 1EV11 1CAWB 2Y26A 1X36A 2ZKLA 3KZ4C 3NSTA 4JDMA 2YC0A 2VQ0A 3ILNA 3MICA 3IDEA 4AGGA 4XJAA 4QQPA 3LOBA 2W68A 2VVDA 2O1QA 3MIHA 4QX5A 4YM0A 4AGVA 4IV1C 3PVNA 3KCYA 2DCYA 1A3KA 1GICA 5EV7A 1WMEA 4E2GA 1LU1A 4XJ8A 1OOPC 1KXGA 3I4IA 3TYJA 2QUOA 1H4HA 2R061 5BXXA 2UWCA 2WNUB 2NMOA 2RS12 1DQ4A 2W52A 3RPQA 2AYHA 2JX9A 4IQPA 5EWSA 4AWDA 2YROA 4Q1PA 4JGZC 1O4TA 4FPJA 2EXJA 4OULA 2OYZA 4AEJA 2FQPA 1LOCA 1BJQA 1UN1A 2ZGSA 1NQJA 4A7ZA 1C8NA 1SLBA 3ES4A 2R16A 1LOGA 4JVAA 1Q56A 4AVBA 4SLIA 5FPXA 1FMD1 1OFNA 2GN3A 3ZSEA 2VPVA 3MYXA 3RRDA 1C8M2 3DGTA 3GYDA 5C4WC 3IN9A 1CJPA 2VOKA 2G9GA 4YVSA 3VBOA 2DCTA 1ASJ1 4BIFA 1KD7A 4XF4A 2DFCA 3APBA 5GJ6A 1NY71 2RJKA 2Y38A 1Z7S2 4X8NA 4CDWC 5K8SA 1L3JA 2I2SA 4IEXA 1WMFA 4RQPA 4Y1VA 2WFF3 4Z1VA 5DG2A 3HD8B 4KU8A 2NP0A 1HW5A 3LZZA 5BNQA 1RVF1 4P5HA 2EF6A 1ZX5A 4JRAA 4I0BA 4RSUA 4CEYC 5GLWA 4META 4DZGA 5CB7A 4XJZA 3FBYA 4XOGA 1NXD1 2BVVA 3NV2A 5J09A 1GNHA 1Y43B 3W58A 4M00A 5CNAA 1QQP3 1AYN2 1DIWA 1DQ1A 2BFUS 1FPN2 3N35A 1F5FA 3KM5A 2BNOA 4QT6A 2DVBA 3QLQA 1JXNA 4FXKB 1SFYA 1QJX2 3ILFA 1CJDA 1J58A 2PHTA 4YM3A 4K1YA 4LBKA 1BK1A 1NG0A 4QPIB 2UURA 4RS5B 5A32B 3WNXA 1H8TC 3R4SA 1PM7A 4XQWA 4CEWA 5JOXA 4DPNA 4TWTA 1U0AA 5CG9A 1XQNA 1PO21 4FQZA 1XU1A 4B7KA 1LESA 2DUOA 4L8QA 4Q4W3 4J6GA 4HFSA 1S0FA 1V70A 3J8F1 1QJY1 4Y4YA 3VN4A 2PHWA 3G6JB 4K3UA 2XVKA 1ND2C 4IEZA 1VBB2 1F9KA 4K20A 3ZSLA 2X29A 2GMMA 3B9IA 1D0GA 2E9QA 1HLCA 1DYKA 1QNWA 3NKGA 1ENXA 4KG8A 4FOWA 4BMBA 1V6MA 3SH3A 3TWIA 4QQ2A 2WNEA 2VOWA 2ZHLA 5GZCA 1UIKA 1U5YA 4UBGA 3SISA 3AKRA 2PELA 2WLQA 3VBSC 5L7OA 1WUVA 2WS91 2BNNA 4IEWA 1LKNA 2R071 4XE9A 4LBLA 1JHNA 3NO8A 3GZAA 1CN1A 3R05A 2VVFA 2RS11 4Q27A 3ZX7A 1XYNA 1SBDA 4M3CE 5FLJA 2HWC1 3NW4A 4LBOA 4FPFA 1M06G 3J4UH 2VMIA 4ATEA 4BE3A 2BGCA 5HXVA 4GWMA 3FHIB 1K5MC 4D7SA 1CX4A 4Y1YA 4XBLA 1KFUL 2WFF2 4EN0A 4R9DA 4YSFA 1YLLA 3H1MA 3WG4A 2DU1A 4AEMA 5BYNA 5T50A 1RUG2 2MEV1 5JZGC 2JG9A 4AW7A 4LLFA 5F1RA 2D5HA 2N7GA 2VXRA 5L19A 2BFUL 5B2GB 3VGIA 5FAXA 2RS31 4FTBA 3AZXA 3INAA 1C3HA 2Q1ZB 5CFCC 3FLTA 3DPRC 2R043 1QQP2 1HXS1 2RR13 1NLSA 1XE8A 3FUOA 2FZ2A 1F8VA 4B4QA 2EVXA 2G9FA 2YXSA 2JENA 3VDDA 4N7UA 3VZOA 3ENRA 1Q5OA 1MS0A 3ZFEA 1IS3A 1SEFA 3K51A 4AI3A 2GC0A 1AR81 2IXLA 1YIFA 4HVQA 1WLCA 1RUH3 2BYVE 1AYN1 3R4UA 2Q1MA 3DL3A 4A3XA 5CVRA 4JTNA 5KBFA 1MR5A 1GZWA 2DUQA 3TNQA 4N43B 1VRH1 3MPBA 3VZMA 1KDKA 1DBNA 5EYYA 2V09A 3FWEA 4N9IA 1OD5A 1G9CA 1NE4A 1WW4A 5DZFA 4TYSA 1AL22 5K7PA 1QDOA 2VUAA 3L2YA 1AR72 1GQGA 1I6XA 3C2UA 1YJLA 3T1LA 3WXPA 4AQ6A 3N3HA 4D94A 1ND3A 3H3ZA 3V0BA 4Q0PA 2HEVF 2HYKA 1FATA 1LHUA 1J1LA 3N4MA 1DGLA 1NXMA 2EAAA 3FX3A 1KJLA 4FT8A 4O9GA 4JQRA 4AVAA 1UX6A 2DTYA 5IK5A 1VIWB 1IS5A 1KITA 3R6SA 4RR3A 3MDPA 2QZ2A 4QU2A 1J3PA 1DU3D 2DUPA 5KHHA 5GLZA 1BEV3 3JB4C 1QKQA 1MQTB 2JD4A 1JW6A 4YVWA 2DYCA 3VL9A 5KHIA 4Q4X3 3VHPA 4PBPA 1ZZCA 1RC6A 2HWE3 4PDWB 1QWRA 5C8CB 4GMP0 4ZKTB 1ONAA 3PJYA 1ZZ6A 2HWD3 4QPYA 4I2OA 5GKAC 3AMNA 3ZSKA 1G9DA 3N7KA 4NHMA 1KRIA 2DV9A 4QM8A 4IV1A 4KL1A 4UW4A 1R081 4M3CA 3DKWA 1UW8A 4LHKA 4BQ1A 1OOPA 2ZMKA 2JE7A 4HKOA 3AMQA 1ULEA 4H7MA 1Q43A 2RR12 5I0TA 1VAMA 1WCKA 3A0NA 3G7DA 1U5IA 3B69A 1OPOA 2XH6A 1AX2A 1XNBA 4WVMB 4JGZA 3WDVA 2ZACA 1SCRA 3KLSA 4C1XA 4I3GA 4TZDA 5ACA1 1H30A 3J9SA 2HEWF 4BMEA 3CJIB 5T3NA 2WZR3 4EWDA 1AJKA 4QHBA 5I8YA 1UZZA 3MIBA 3WW2A 4IV3B 4Y1ZA 3D82A 4YM2A 1AX0A 4CDUA 3I59A 3KMHA 2G4IA 3RWNA 3MIDA 4LBQD 4GMP3 3ZN4A 1MS8A 4NHKA 4GKYA 1GQHA 4CDWA 2IXJA 2HWF3 1RTVA 2XLFA 4PIYA 1ZVFA 4XEZA 4CDXC 2GNDA 4QQLA 1H1MA 3S30A 3D5OA 1XYOA 1PGL2 2PFWA 4AVTA 2OVUA 2A3XA 2EAKA 3IIAA 4Q4W1 1IKPA 2GAUA 4M3CF 4P9YA 4CEYA 1QOTA 3RI8A 1UD1A 2VMHA 2VNGA 1DQ6A 3AX4A 4PBOA 4Q8KA 1WW6A 1BBT2 3S7EA 3VHRA 1RUE1 4GH4C 4YW5A 4I01A 1FAYA 3AKQA 1B35B 4FPEA 4FAHA 3FFZA 3KQRA 4OHXA 4Q0SA 1SDWA 1BEV2 5LK7B 3KT4A 5FQ0B 3HT2A 1YFWA 1H1AA 1OA2A 3CL1A 2Q5TA 1URXA 1VLNA 4AFBA 2ZAAA 1FOD1 1QXPA 4Q4X2 4N9HA 3MZHA 2TNFA 2VMGA 1V6KA 1H8TA 4EN7B 4YG3A 4XTPA 1F2NA 4HANA 4X8PA 1QMJA 1NCQC 2DVFA 5T54A 3RDIA 5JOWA 3ELNA 5KHGA 3KSCA 1PZ8A 2FZ1A 3P3PA 2PHXA 3ZDSA 4YZ2A 1ND2A 5HCAA 4Z92B 2QVSB 2UYBA 5FO7B 1W6PA 3U07A 4FVVA 4JGYC 1LECA 2UU8A 4NO4A 4P9WA 2WKKA 3NJZA 2H6CA 1UU5A 1OMIA 4PIZA 4XQ4A 2D40A 4HN0A 4YVSB 2D3RA 4XMAA 1AF9A 4COYA 3JD71 4LO5B 1EAH1 1N3PA 3TN91 1XXNA 1X8EA 2WZR2 5ABJC 5C8WA 3ZXJA 2R041 1KFXL 1PGSA 4RQPB 2ZX0A 5IK4A 2NMNA 4N90A 3QH7A 4INDA 3IWZA 2V73A 5FFOC 3EBRA 1WCSA 1R1A3 3AFGA 3I54A 5KXDA 1CESA 4I3PA 1YWKA 3U11A 4FXGB 1PIV3 4S2HA 4MV2A 2RM22 1RUH1 3WDXA 2I07B 3VLBB 3ZFFA 4N53B 4JV4A 3WV6A 3KGZA 1VBA1 1LULA 5JZGA 1WLDA 1KJRA 5EZWA 1CPNA 2R1BA 5FRAA 1AYM1 5AC93 1PK6C 3ZXEA 1RB8G 1AUYA 5F6LB 2D43A 5CFDC 1LENA 3E6BA 5CFCA 1WBFA 4YGEA 3DPRA 4CEWB 2D6OX 4PJYA 1TE1B 5I91A 1V6LA 4XQDA 2ZZJA 1W0PA 1DGRA 1REEA 3H7JA 1S0EA 3FLPA 1PGW1 1S55A 2NZ9A 5BNPC 3H50A 3PTYA 1IPJA 1RUI3 3BB6A 4Y20A 1Q8OA 4P9JA 4YG0A 3WINE 1PNGA 2VOXA 2XJUA 1VP6A 5E89A 3WCSA 3VUOA 1PZ7A 3CLPA 2DTWA 2R30A 4FO9A 1BMV1 3BTAA 4XBNA 1JYCA 5AVPA 1VBC1 1XNDA 1V6JA 1Q8PA 1GR3A 3HT1A 1H1IA 2A70A 2HWE1 5L7OB 2CL2A 3AJZA 4ISQA 3VBUB 2Q30A 1F31A 4K40A 1LOFC 2F6BA 4W6YA 2HWD1 1ZBE2 2VW1A 5SV5A 2ARXA 2R0FA 5K0UC 5GZDA 1FV3A 4QPGC 4GULA 1FYUA 5HCFA 1A78A 3IPVA 1OFSA 4IEPA 2R49A 3SCFA 4CDQC 1RMU3 2D5FA 5J37A 4OHWA 2VOVA 4Y22A 5JWPA 2Z79A 2WWSA 2JDZA 4W65A 2D7FA 3ZXDA 4LHLA 1TMF3 1R1A2 2HWB1 4JC1A 2JG9B 4WM8B 2WC2A 4H7LA 2VW2A 1PIV2 1AX1A 3E6CC 5DXDA 3ZIXA 2I45A 2WNUC 2ZS6B 1OQDA 2RS53 1COV3 4LA2A 1DLLA 1QOSA 2F4PA 1BVP1 4FPOB 1SBEA 5HI0A 2RJLA 2P17A 1LHNA 1O3SA 1ZREA 2ZX4A 3IM0A 2PLV3 1REDA 2AREA 4MYEA 4IEYA 4R52A 4UXAA 3VDDB 3U0ZA 1MS5A 2XJSA 2A6YA 4AQSA 2HWF1 2W08A 1RUF1 2A7AA 5C9AC 4AFDA 3UKNA 3ZFEB 2PHFA 2GN7A 1G6NA 4HK9A 4OVEA 3B93A 5KXEA 5LEJA 4FBFA 1ZM1A 1G9FA 1H2KA 4E27A 3ZXFA 1F5JA 1Z0HA 1RUI2 4NWWA 1ZRDA 3AKTA 3IMNA 4IERA 1D4M3 4XILA 4UW3A 4QM9A 1D2QA 1H2NA 1AZDA 5I8SA 4FCAA 3OYWA 4HMZA 4DINB 1VBB3 3OBRA 5JDBA 3ZXGA 5BNOB 5KHJA 2O8OA 4OFGA 2BUKA 2K0GA 2RMU1 5DZGA 4M0HA 2PN5A 2XJVA 3VZKA 3V0BB 4OZXA 2MHFA 3WOGA 2CV6A 1LRHA 1ZBA2 4LO8A 4Y1UA 4NHLA 2WZPP 1UCXA 3VZJA 2A73B 1GKBA 5AVAA 4E4SA 2KXLA 2Z2SB 3RYKA 4WM7B 2O8QA 1QJU1 3KCXA 4RR3B 2WT1A 4WVZA 1DDLA 3B02A 2TUNA 5DG1A 4ZXKA 4E4ZA 4BYYA 1W6MA 4F3JA 4QPIC 4BPZA 4RS5C 4EWEA 3N7MA 1RHI1 4MGIE 4MVTA 2I74A 4OI2A 1RMU2 4AF9A 3PVEA 4KWLA 4XFGA 3ECQA 3M3CA 5E1RA 3BOPA 1AXKA 3WCRA 4AFAA 2PHLA 4PF5A 2ZGTA 1X8MA 3H3UA 1RUG3 3VBRA 4BA6A 1TMF2 4Q4V3 5CU1A 5L36A 5HBAA 4RD7A 2WLPA 4PCRA 1QHDA 3ZSJA 1UZYA 4LULA 1YO8A 4HETA 2NPIA 3H1WA 4AI0A 4OI1A 2WNVB 3QH6A 3AM2A 1Q8VA 4OUSA 1SFNA 2ET7A 1O3TA 4IEVA 2RS52 4Q1RA 1COV2 2JXAA 1YXWA 1OOPB 1W0OA 2WINB 1NCQA 3ILRA 1PO13 2AH2A 2YYOA 4BHPA 2BWCA 2PLV2 4XJ9A 5T5OA 3VKNA 2JECA 1S0CA 4HSJA 2LUWA 2XB6C 4I09A 2EA7A 3N7JA 3PVOA 2PA7A 1EYBA 1YRZA 5I0UA 5JI9A 3ZFGA 1IS4A 3POYA 5GZFA 3RMXA 2ZGQA 2JEMA 1AXYA 4XW3A 1SCSA 4JGYA 4KBBA 2V5YA 3LGRA 1PHMA 4Z8BA 4CDUB 5AC91 5GZEA 1UU4A 2W39A 4MXWB 4F7ZA 2BVBA 3VBFC 1D4M2 3BPZA 1OQEA 3GALA 1AL23 1RGSA 4B7EA 1AR73 4AEDB 5ABJA 1W39A 1RUC3 2E6VA 1U5ZA 5FOJB 4GB33 1FT9A 2D3PA 3HQXA 5JPNB 3RSJA 4YGCA 2A75A 1J59A