2N7GA

Structure of the cyclic nucleotide-binding homology domain of the herg channel
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
131
structure length
131
Chain Sequence
RSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Structure of the Cyclic Nucleotide-Binding Homology Domain of the hERG Channel and Its Insight into Type 2 Long QT Syndrome
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2n7gA00
1FT9A 4HN0A 4I09A 5FQ0B 4RD7A 1I6XA 3RYRA 4HVRA 2GC1A 2O1QA 3WW3A 1ZRCA 3RNSA 2PHLA 4YRDA 3U0ZA 4HSJA 4XF3A 5KBFA 3OD0A 5J3UA 4XF4A 3MZHA 3NKTA 2CGPA 4UBGA 1O5UA 2H6BA 1EYBA 4AXOA 3E5XA 3KSCA 4ZU5A 2CV6A 3G7DA 5JSPA 5KHKA 4YYOA 4IEVA 2I45A 3I59A 4E2QA 4MGIE 1CAUA 3ROUA 3I7DA 1EY2A 4E2SA 1UCXA 4AQ6A 3H7YA 5EFUA 4YNIA 4XFBA 3IDCB 1CGPA 2XHKA 4QGMA 1LKNA 1NZCA 1J58A 1TQ5A 3IIAA 2P17A 1UIKA 1RTVA 2PYTA 4XFHA 1DGWA 2QVSB 3H7JA 4IEPA 2ET1A 2XLGA 4HVQA 4ZU4A 2B9UA 4X6QB 1GQGA 1YFWA 5CADA 3M3IA 2ZCWA 1XRUA 3U11A 3LOIA 4N9IA 1O3TA 3ST7A 2PTMA 2EVXA 3U10A 2MHFA 2Z2SB 4EWDA 2BNOA 4KU8A 4BH9A 5J7MA 3S0MA 3E5UA 3LA3A 1YHFA 3H50A 4JTOA 3LWCA 4QGNA 5FLJA 3LA7A 1X82A 4BHPA 5T3NA 2BGCA 1X8MA 2QDRA 4I0AA 3ES1A 1VR3A 5I8YA 4XF0A 4QM8A 2GAUA 5E16A 1DGRA 2HJIA 3H1WA 3QACA 1CAXB 1GQHA 4ORFA 2QCSB 4D7TA 1ZRFA 3HT1A 4MGZE 4XFFA 4UXAA 3JZVA 1RC6A 3RDIA 3R6SA 4LA2A 4GULA 2FQPA 1ZZ7A 5BV6A 3IWZA 1UPIA 3NSTA 4OFGA 3MPBA 3NL1A 2HKXA 2PHDA 4WZCA 1UD1A 4EWAA 4LEJA 4E2GA 2IXIA 1YUDA 1ZRRA 2UYAA 4FAHA 4IEUA 1ZVFA 5BXXA 3DL3A 1CAVB 1DZTA 4MV2A 3WW4A 1EPZA 2GU9A 1YFXA 1SQ4A 3HQXA 2IXHA 5KHJA 2MNGA 1J59A 1QXRA 1ZREA 2XLFA 1ZNPA 3SHRA 1NE6A 4JVAA 1ZZCA 1LRHA 4WBBA 1X8EA 4ZU7A 5I8TA 1O3RA 4F8AA 4IESA 4QGLA 4XF1A 4IEXA 3H8UA 4D7SA 1Q5OA 4FT8A 3BU7A 1QXJA 5JSOA 4MUVA 1OI6A 4J1WA 4Q0UA 4KL1A 3DV8A 3E5QA 4XFIA 3NW4A 4AVCA 2UYBA 3PNAA 4FBFA 2MPFA 2OA2A 1WLTA 2GH2A 4NVPA 4KWJA 2Y0OA 2H0VA 3UKNA 3H1MA 1SEFA 1NYWA 1Y3TA 1LR5A 1OMIA 2H6CA 4QX5A 4EWEA 4HMZA 1YFYA 4MZUA 1WGPA 2C0ZA 3BCWA 2Z69A 1JUHA 4Q0PA 1PMIA 2VECA 3UKVA 3USSA 1UIJA 2ATFA 3BB6A 2KXLA 2BEOA 5K8SA 1EP0A 3E6CC 5J48A 3D0SA 4N9HA 4HBNA 4ONUA 2UY9A 1O3SA 3KMHA 5AVPA 2CAUA 2GC0A 5D1IA 4MH0E 5I0SA 3E6DA 4LLOA 4MGKE 4R8HA 1NE4A 1WA4A 2ZKLA 1I5ZA 4HSLA 1G6NA 2XLAA 4FAGA 4LA3A 4AQ2A 4XETA 4IEYA 4K8FA 2IXJA 3I59B 1H1IA 4XF9A 2D5HA 4META 5FLIA 3WW1A 3ACLA 2OPKA 3H1YA 1CAUB 4Q0QA 4PJYA 2VPVA 1YFUA 2O8QA 2XGXA 4IETA 2BNMA 4Q29A 5CU1A 3NJZA 2DCTA 1H1MA 5BUVA 3S7EA 3D82A 2QNKA 3SCHA 4KWKA 2OYZA 2VQAA 3OF1A 1V70A 1FXZA 3H3ZA 5LEJA 3FHIB 4EROA 5KHHA 1J3RA 1XE7A 3FZ3A 3L2HA 3TNQA 3WW2A 1ZZ9A 1U12A 3GBFA 3ELNA 4P9GA 4OLLA 5FDBA 4LULA 2XKOA 4AVAA 5FQ0A 1ZZ6A 2BNNA 4IERA 1CAVA 3RYPA 2B5HA 2WC2A 3ZDSA 4Z82A 2UY8A 3FX3A 1ZZ8A 2OZJA 3FJSA 1O4TA 1YWKA 1ZZBA 2IXKA 3ETQA 5I93A 4HVOA 4Q0VA 2B8MA 3SCGA 4QM9A 4DINB 3OCPA 1RUNA 3MYXA 1Q3EA 3OTFA 5I0TA 3EHKA 5I91A 3KCCA 2GZWA 3LZZA 3SMHA 5JCTA 1Q43A 3FFQA 3SCFA 3E97A 5KHGA 3CLPA 5LRRA 1J3QA 3E6BA 1O5LA 3PLQA 3FWEA 1QWRA 3CL1A 4F7ZA 3M70A 4L2NA 4LTAA 4A2UA 4XEZA 4XFAA 2E9QA 3VHRA 2CAVA 1OD5A 2XKPA 3KGLA 2ET7A 3FE5A 4MGYE 5FPXA 5BY5A 2GC3A 3OGJA 1IPKA 3C3VA 3BPZA 4JV4A 3D0JA 2V09A 4I2OA 1CAWB 3DN7A 1UW8A 1DZRA 1YLLA 5FLHA 5JAXA 4I02A 2Q0AA 2Q30A 5EZWA 4HLTA 3EBRA 5FCCA 3N4MA 4O9GA 5I0UA 3BALA 1L3JA 1X7NA 2XL9A 1J1LA 1ZX5A 1RL3A 4Q0SA 2K9ZA 1OFNA 4CYDA 2BYVE 3LAGA 1PM7A 3RYKA 5I0RA 1ZRDA 5I8SA 4JTNA 4J1XA 1HW5A 5LEKA 4UBHA 2EAAA 2QJVA 3H3UA 4LUMA 4I0BA 1NXMA 4X6RB 3IBMA 4XFGA 2F4PA 2PAKA 1CAXA 5HI0A 1Y9QA 3SXWA 1VJ2A 2D93A 3UKTA 4QXKA 4MX3A 3GYDA 1J3PA 2Q1ZB 5F1RA 1O7FA 5LRSA 3KGZA 2D40A 5BPXA 5KHIA 3CEWA 4IEZA 3NVCA 4PIZA 4R52A 2IXCA 2PFWA 5JSRA 3CJXA 3TNPB 4YARA 5JR7B 4PIYA 4QMAA 1XE8A 3PVBB 2Q4SA 1O3QA 4IEWA 4KU7A 4KWLA 5FPZA 2PAEA 1CX4A 3HIFA 3MDPA 4HZFA 4WVZA 4Z07A 2IXLA 4BYYA 2WFPA 1VP6A 2N7GA 4HN1A 1LB2A 5C6CA 2ETEA 4EV0A 5C8WA 4AVBA 1SFNA 3EQEA 3EO6A 3QOPA 4L11A 4TLFA 4BIFA 1RUOA 3CF6E 3EJKA 2PQQA 3S7IA 1IPJA 4H7LA 3O14A 2D5FA 2FMYA 2GC2A 4XFCA 4IEOA 2EA7A 5E1RA 2IC1A 1RGSA 3H9AA 4I01A 3DKWA 1CAWA 4LUKA 5CVRA 2PAMA 3I54A 2OZ6A 3IDBB 3ES4A 4PIXA 3HT2A 4I3PA 1FI2A 2XL7A 1QY4A 3B02A 3RPQA 3RZZA 4B29A 3LA2A 4YSFA 4O9EA 2PA7A 3CO2A 4IEQA 2K0GA
chains in the Genus database with same CATH superfamily
5E8AA 4HN0A 2X53S 4MHUA 4RD7A 5FQ0B 1XNTA 4PI0A 1O4YA 5FMDA 3VKNA 2GC1A 4LO8A 4IV3A 5A7WA 5GLVA 4AI9A 1WCQA 2WRAA 3AKQA 5FYVA 1DDLA 4TTGA 4YRDA 3OD0A 1ULCA 4XBQA 1ONAA 2J7MA 1ASJ2 1VBB2 3AYCA 3MZHA 2Y34A 3ASIA 4AXOA 3TEZA 1BKZA 1RUH2 5T5JA 2JDNA 2JECA 5F5AA 1NCQA 3PMSA 2VZPA 5A3WA 1RIRA 1ND2C 4GKYA 3OEBA 1PNGA 4N53B 2WBKA 3GBGA 1ASJ3 1VBB3 3I59A 2ZXQA 3W20A 2XPJA 1RUD3 3OBRA 5CZKA 1COV2 1W06A 2WO7A 3SKVA 1CAUA 4E27A 4YVSB 4JGYC 1JXNA 1VIWB 2F17A 3D3AA 4Y20A 3ROUA 1TE1B 4E2SA 5AFBA 3BTXA 1UCXA 2HWD1 1SCSA 3H7YA 1FPN1 2C26A 2D6PA 4WM7C 4Y1ZA 4W6WA 4YG0A 3UGFA 3DUIA 3HN1A 1M4WA 1QOSA 4PLNA 3VKMA 1BMV1 5FFOC 1COV3 4UF0A 2KR2A 2RR11 4FPJA 2YZ4A 2Z4FA 4QGMA 5G05L 1CZVA 1RINA 3AB0A 4B1MA 5GZCA 2CL2A 1QQP2 2RDSA 5HCFA 3RMYA 5L36A 3RZLA 2JE9A 5AC93 4QPIA 3VL8A 1ULEA 1NKGA 3E1F1 5FO9B 1GNZA 4XFHA 1TZOA 2ES3A 5EJ3A 5C9AA 4P02B 3O0WA 5FK7A 4XMIA 3BYWA 5FP8A 3LDKA 1UO9A 4ZU4A 4HVQA 1QDOA 1QQP3 1AHSA 3H0OA 4R4XA 5CADA 4OI4A 1AYM1 5J98B 4AHYA 2VTXA 2E53A 2ZHMA 4GALA 4HPKB 4XDPA 1XRUA 4NIGA 4G3YC 1XU1A 1VAKA 2YFUA 2PHFA 5L9BA 2ZX2A 5HCAA 4ZS2A 2PTMA 3N7LA 1F5FA 2G19A 4XAEA 4KU8A 4GWJA 1W3XA 4OI1A 2W1QA 1XC6A 4FOVA 1HQNA 2P3YA 1MQTB 2BBVA 2W1SA 1D4M3 4AWDA 2ZTNA 1RITA 5T50A 2BGCA 1VAVA 4COUA 1X8MA 3VBSB 2QDRA 4Z92B 4O65A 2OUJA 1CR7A 2ARXA 4JKLA 4QD2A 1GQPA 4XJ9A 4LHLA 1Q8VA 2R1DA 1RUJ2 5I8YA 2DCZA 1DG6A 1NA1A 1OUXA 4DUWA 1UYXA 5ABJB 2QUOA 5E16A 3AZVA 4UYBA 3H1WA 3QACA 3ZYRA 2P6CA 3NV1A 3CQOA 3THTA 4XXPA 1PMJX 2BWAA 1GP5A 1ASJ1 1RUJ3 2EIBA 2OS2A 4LKSA 1UY4A 1RUD1 4NIAA 5A6YA 1CZTA 5C3OA 3HN3A 4A7ZA 4AEDC 2HWC2 1RC6A 3R6SA 4K8RB 2JDHA 3NAPA 3IPVB 3B9CA 4CEWB 4M4PA 3AKRA 4BQ3A 5FPUA 2FQPA 1ZZ7A 5JUVA 3IWZA 2PXJA 4KWUA 2HWF3 3AP6A 5FTTC 1VALA 5T5OA 3NSTA 3IB3A 4LBNA 1COV1 1YI9A 2HWC3 2D6NA 2DCJA 1V9U2 2PHDA 1UOJA 1W9SA 2XQXA 3R4SA 4NMIA 1I5PA 1AUYA 2AREA 1I9RA 5AC91 3BOPA 4BMEA 2YPJA 4AI1A 3N9NA 4GXLA 2HEYF 2JKXA 2VMGA 1PVC2 4MHRA 4Q4V2 4QWNA 1YUDA 5D21A 1BBT1 5DAQA 4CEYC 4LLFA 1K5MB 4JCKA 5FBJA 5C5TA 2CWMA 3WHTA 3KQRA 3TYJA 2C24A 2JDAA 2JKBA 1UPSA 3I3MA 1CAVB 3B69A 3OPTA 4Q4V3 1U5YA 4RSUA 2RG4A 1JYVA 3CJIB 4LO7A 1X36A 4GA9A 4U36A 2GU9A 2QZ3A 3O0XA 1WCUA 4F83A 1YFXA 3FHQA 3HQXA 3PVEA 4P9XA 1ENSA 1UZYA 1J59A 4E4HA 2JG8B 1MZFA 3VD3A 5FY5A 2XLFA 4Y4RA 4E4DX 3VD9A 3SHRA 5F2SA 4EQVA 2BV4A 5KWRA 4ZONA 5A3TA 2XJSA 4NN0A 4COVA 3VZNA 4F8AA 1RXGA 1PMHX 3AVSA 1D4M1 1ALYA 2CGNA 4BMBA 2HBUA 3VL9A 4D7SA 4CDXC 3VDBA 5JSOA 4X8PA 4J1WA 1XB9A 1SDDB 4NE9A 1RUE2 2VBBA 2XH6A 1NQJA 3PJYA 4XFIA 1NY72 2Y6HA 3PNAA 3D8CA 4QQLA 5IVJA 1AX1A 3V64A 4DB5A 1WW5A 3O5SA 1E5SA 4B7EA 2LM3A 2BU9A 1MS5A 5F7UA 5IK5A 2C9AA 5JIUA 5FYMA 1SEFA 1NYWA 1VAMA 1Y3TA 5EP9A 1LR5A 3H42B 1RUE3 4EWEA 2YGLA 2CHHA 2ZOEB 4HMZA 4QX5A 4Y33A 2P6HA 4FXGB 1RUJ1 1WGPA 3LPGA 3LB9A 4UFLA 2ZEXA 2VECA 5A3LA 3SITA 5HPOA 4CDXA 2LS6A 3PUAA 4XMAA 5CKNA 2ATFA 3BB6A 4IE7A 1R1ZA 2VXJA 2VVDA 4NIDA 1LTEA 5FKBA 5K8SA 5FYZA 1YIFA 4IV3B 5A7WB 5J48A 2HWF1 2VTXJ 3V0BA 1Y9GA 3ZXGA 1NAEA 2UY9A 1RXFA 2HWC1 3K46A 3OBZA 2WDBA 4QDSA 1RMU2 2GC0A 5FZ7A 5EV7A 1W28A 3GM8A 3PHMA 1YYNA 2V5YA 2YV8A 3AZXA 3MBWA 4KNCA 4HSLA 2XLAA 3OPZA 3APBA 3QH7A 3MLLA 2CNAA 2VG9A 4K1ZA 1NCQB 1YQ2A 1XSRA 4ITCA 4RGGA 2J1RA 4C0HA 1RMU3 1BJQA 3NNLA 3I59B 4RN5A 4RQPC 1QU0A 4XF9A 3KB5A 1OA4A 3DPRA 3LQCA 4O7XA 4PLOA 4XQWA 3WW1A 3ACLA 2WR9A 3H1YA 1CAUB 4Q0QA 1JU3A 4FOYA 4CDWB 2RS12 4FP2A 4CPBA 5LW9A 1QGLA 2WNVC 1WLDA 4Y20B 2CTVA 2R062 1LEDA 2O8QA 5L9RA 1JU4A 2DTYA 4LBLA 2JDYA 2XMLA 3NJZA 5IFPA 1GSLA 2W39A 5F39A 1QXPA 2QNKA 4CDQC 1W90A 1UU4A 4GH4A 3RWNA 1O4ZA 2RS13 3WNKA 3ME2A 2HEWF 1Z78A 2VMIA 3VZJA 4KG0A 2WUHA 4A6OA 4QPIB 2YROA 5DAPA 1HV1A 4NHLA 3K4AA 5JVVA 1J3RA 1K3IA 3B00A 5C9AB 1RUG2 3W5MA 2FDJA 2J1UA 2FCVA 3TNQA 3OY8A 1QNWA 3WY6A 1M06G 2ZPXA 3LEKA 1UL9A 4OLLA 4P9GA 2Y6KA 5KC6A 4IERA 3RYPA 1OLME 5A32A 2B5HA 3GZAA 2JX9A 2WC2A 5FZEA 1UWWA 1OUSA 1RUG3 1QMJA 2QQVA 3D5OA 2WYFA 3ZFFA 1RUE1 3VUOA 3FJSA 4M3CA 1R1A2 4AEKA 1YWKA 5IATA 2KM2A 2JDZA 4QU2A 2IXKA 4GWNA 4RHV2 1B09A 1QJFA 2B8MA 2ZX0A 1KGYA 4D6QA 4UOJA 1N1TA 2Y6LA 1FNZA 5FIXA 4YM1A 4AI8A 4HT1T 3WHUA 3WG1A 1JYTA 3MYXA 4BLIA 1Q3EA 1R1A3 2ENRA 2ZABA 3ILNA 5LBBA 2PHXA 3LZZA 4RHV3 4A45A 5KC5A 4AW7A 2JD4A 5JCTA 5FYBA 4YW3A 3E97A 1NA1B 2VW2A 1IS6A 2WO2A 2J1SA 3AZYA 3CLPA 5LRRA 1O5LA 3QLQA 2FBEA 1OPMA 3K4ZA 3FWEA 3KM5A 4FOWA 3POWA 5JWPA 2Y64A 4GQ7A 4LTAA 1GICA 4R4ZA 4R9AA 3THPA 1RMU1 2E9QA 4Q1PA 3VHRA 2CAVA 3HMYA 4D3WA 4EN9B 4NRQA 3ZIXA 3BUCA 4GWIA 4AVTA 1YI7A 1UQXA 2DVDA 5CFCC 4PQQA 1SMVA 3NAPB 3MFAA 2F6BA 3P1IA 5BY5A 2WWSA 1W6OB 2EIGA 2HYKA 3I4IA 4JV4A 2A70A 5CKMA 2Q1FA 5DZEA 4I2OA 1UW8A 3VD5A 1NCRA 3DEMA 4QXHA 4LORA 4NRPA 1HQLA 2P37A 2E6VA 4M3CF 5FR3A 1VRBA 2RS11 2DDUA 2WZ8A 4XE9A 1Q8OA 4FI9A 4I02A 2Y38A 2Q30A 3C7GA 5EZWA 4HLTA 2W95A 3POBA 1PNFA 2FDIA 1PGL1 1XYNA 3VBHB 3K48A 2D6OX 1W2AX 1WKYA 1H2LA 5A33A 4XUTA 5IK4A 2RDQA 1LECA 2PLV3 2RS52 1NLSA 1J1LA 2E63A 4K3UA 1CWPA 4AHWA 4CYDA 1OFNA 3LAGA 1MVEA 2DCKA 2G9FA 3SH3A 1RUG1 3WV6A 4M0NA 3K3OA 3POIA 2J1AA 2W5FA 4J1XA 2RS53 2RMU1 3HAGA 4UBHA 2VXRA 2ZGMA 3Q9OA 2GNMA 4ATFA 4DZGA 3I2OA 4X6RB 4L97A 3IBMA 1K5JA 4URAA 2ZEYA 2VZ3A 1W8OA 2F4PA 2PAKA 3AP5A 4QX7A 4YWAA 5T52A 4R9BA 2WABA 1S0BA 4JGZA 2JG9C 5HI0A 5A7SA 1SFPA 3HNBM 4DIQA 3ILFA 1UOGA 2YC2A 1R1A1 1VJ2A 2WINB 5H9RA 4DEVA 1W8UA 4ZXKA 5DUXA 1W9FA 1PZ7A 4RHV1 3KF5A 3ABZA 4WVMA 2Q1ZB 5IFTA 5LRSA 3KGZA 1RUC3 1UU5A 1ZBE2 1ZA7A 2RS32 5BNOB 2YMZA 4BWOA 3ZFEC 1JH5A 5D2AA 3WNMA 2UU8A 2GH8A 4XHBA 2ZGSA 3R05A 3ZN6A 2VNRA 5EJZB 5FYUA 4KI5M 2IXCA 4PCRA 2WZPP 3CJXA 1MZEA 1F9KA 4UW4A 4IGPA 5B2GB 2Q4SA 3V0AA 1O3QA 1T6BX 2WNUA 2BJSA 3O1SA 1ZBE3 2JG9A 1OFSA 5F3EA 4XW3A 5FPZA 1DU3D 1H4HA 2PAEA 4YVWC 3CNAA 5L19A 4D94A 3OEAA 2GP3A 3D4KA 2B39A 5JIAA 5EYYA 4D69A 1GYKA 4CUCA 3AKSA 5F3CA 2PELA 2OXBA 2YDEA 5IYYA 4Q4X2 2IXLA 3M3QA 5DDJ2 5FY0A 4BYYA 1UYYA 3HNMA 2VE1A 4AQSA 1OF4A 4WM8C 1OVSA 4CUAA 1JZ5A 3UGHA 1Z7S1 3LEMA 1IHMA 5CKQA 4MLOA 4Q5OA 3FL7A 3URFA 4EV0A 1BLZA 2DVFA 3QCWA 4AI3A 2JB8A 1SACA 1SFNA 4QPYA 4Q4X3 4DQAA 1ULFA 5DDJ3 5K0UB 4OI2A 4TLFA 5FBZA 5FZKA 4PI2A 4UT5A 4AAPA 4AYUA 1RUOA 1AX2A 2XWBB 2PLV1 3K4DA 1LHVA 1W2UA 3PUIA 4QQ2A 2BPA2 1RJ8A 3RWKX 2XJQA 4EE2A 3DPRB 4JZRA 2D5FA 1N47A 2E32A 3MIDA 4IEOA 4XFCA 5E1RA 4FFIA 4N53C 3VBRC 4R9CA 3VV1A 1H9PA 1ND3A 3KT4A 5FJHA 3ACHA 5LASA 1C57A 3R0RA 3GZEA 2BQPA 4WM8A 4WVVA 2VW1A 4YVSC 5FP4A 3DKWA 3WP3A 4CU9A 2RS51 1JYXA 4YG3A 1W8HA 1BCXA 4N7IA 2PAMA 1QIQA 2WFF2 4R9DA 3TRSB 3SH4A 5CFDC 1XNKA 5FY8A 3ZXJA 4MG2A 2VCMA 3MPPG 1PK6A 1FAYA 1FX5A 3MW4A 2VM9A 3I49A 1IS4A 5A6QA 1QY4A 3RPQA 2GSYA 2A3XA 4J25A 1VMFA 2VCAA 4I3GA 4JKKA 4B29A 3H8RA 2ZGOA 2WFF3 1VBA1 3CO2A 3IAQA 1N3OA 4XHXA 1S1AA 1OPOA 3LSEA 2FD8A 2ZEWA 1RUC1 2K0GA 3VBFB 2VCBA 1FT9A 1HKDA 2ZMNA 1ENRA 1UZZA 3RYRA 1I6XA 3ZXAC 1LGNA 5A32B 4HVRA 2I74A 2NN8A 2A6WA 2O1QA 3WW3A 1MS0A 1ZRCA 5CFDA 4P9WA 1OOPA 5DZFA 5CB7A 5J3UA 4XF4A 3ZFFB 3ACFA 5T5LA 2CY6A 2AACA 2RJKA 3GZUC 3A0KA 3M1HA 3RSJA 3T2TA 1JN2P 1V6KA 4QDQA 3T08A 3WX5A 2H6BA 4V2WA 3OOXA 4NWVA 3USUA 3POJA 4AHXA 1R092 3G7DA 2PQSA 4JX0A 2XONA 3VZLA 5JMOA 2XVLA 5LA9A 1V00A 1MQTC 3CIHA 2E33A 2XXZA 1JHJA 1CD3G 1FYUA 3J26N 2Y6GA 3MFCA 3VBUB 2R073 2D6LX 4BQ5A 5FZLA 4XQ4A 5HXMA 1LHUA 1W2TA 3I7DA 2IVJA 4XILA 3HJRA 2QQLA 1SBEA 3OPWA 3POEA 4AQ6A 3AC0A 1IOAA 5DG1A 3WF0A 3NNMA 3Q8CA 5K7PA 1KRIA 1AR92 1ULOA 1VRH1 2HWB2 4QXCA 4FPLA 4OYUA 5LBCA 3QD6A 3U1XA 5IUQA 1O59A 2PMWB 1UU6A 1UIKA 1MS8A 1ENXA 2W87A 4HKWA 4CXXA 3OUIA 4A41A 4FPYA 2NMNA 1DGWA 4GMP0 3H7JA 1AR93 3IAPA 4IEPA 5A7OA 3WNPA 1HXS2 4B7KA 2ET1A 2HWB3 3W5NA 2XLGA 1JBCA 5DAXA 2VVFA 3F95A 3AVRA 1GQGA 4XUNA 2DF7A 3J8F3 5FYHA 2C6SA 2ZGLA 4PDWB 1O8SA 3Q8FA 3MUY1 2ZCWA 4RR3A 5FWJA 1CPMA 1REDA 1Y43B 5C4WB 1HQWA 3LOIA 2DU1A 2R1BA 1KS5A 5J09A 1O3TA 3GDBA 2C4XA 5F5IA 4UW5A 2EVXA 1LOCA 2RDNA 1SPPA 4FPCA 1S0JA 4RS5C 2WFF1 4W6YA 3BODA 4IE6A 3E5UA 4L92A 1F4AA 1YIPA 2NPIA 3GCXA 3LA3A 4LBOA 5FLJA 1QNYA 3LA7A 4BHPA 1QH7A 1A34A 5JZGC 1S0IA 5JXIA 3BVCA 3PJQA 1KITA 1ULDA 1AX0A 1HIXA 2R7EB 4IV1A 1J83A 4H14A 3NJVA 3GJBA 4IQPA 1R64A 2QQNA 3WG2A 2I2SA 4GWMA 2JG8C 3J4UH 3U78A 4K6BA 3N3HA 1KEXA 1UKGA 4IDZA 4ORFA 4D7TA 5ACA2 4HK9A 4Q4W2 3FC0A 5BNNA 3AZWA 4XFFA 4XIKA 1AR63 4DEQA 1FNYA 3HQRA 4BQXA 2R071 2IWGB 3AKTA 2R30A 2FZ1A 4D6RA 1VB2A 4GULA 5ACA3 1LENA 4Q4W3 2DFBA 1YRZA 3ZN6B 4A7KA 4YZ1A 2GNTA 1JODA 4XCAA 3N9QA 4OFGA 5DAWA 2XG3A 3MPBA 2HKXA 4DS0A 1QHDA 2KD7A 2NMOA 4YPJA 3N7KA 3ZFGA 2WNUB 3TBDA 2VQ0A 1ULPA 4KG8A 1XU2A 5CEHA 4LEJA 2ZGUA 3MLJA 5JMCA 5EWSA 4LBQA 1AR91 1MPXA 2UYAA 4UW6A 1D2SA 1ZVFA 2HWB1 2XBO3 2QDNA 2CGOA 4NPRA 5JXGA 3PURA 3KS7A 3WVJA 1PGSA 3J8F1 2ID4A 1DCSA 3RQ0A 1LHWA 1F31A 3N7MA 4MV2A 1L7RA 3PUQA 5A3MA 3OYWA 5F9TA 4Y5Z0 1SQ4A 4XYXA 1OC1A 4YW6A 4CXWA 3POFA 2A6XA 3NQHA 4LKDA 4Y24A 1OKQA 4YGCA 3ENRA 3KT7A 4L8QA 4FTBA 1NE6A 1PO12 2PHTA 1WZXA 3LDRA 3WR0A 3W58A 1ZZCA 1LRHA 4WBBA 4ZU7A 5FOBB 2RV9A 5IT6A 2HEVF 4IESA 3WSOA 4CU8A 1OLQA 3CU7A 3UGGA 2R32A 2JIJA 4MXWA 3KVAA 4XF1A 1DIWA 4AVVA 3DYMA 3RZKA 3A7QA 1ND3B 1Q5OA 3BU7A 1PZ8A 4MUVA 1OI6A 4CDWC 3AJYA 2AYHA 1MZ6A 4M3CE 1GU3A 1PO13 3JU9A 3DKQA 1GNYA 3DV8A 3E5QA 4QKDA 4AVCA 4CCJA 4COZA 1RUH3 4DRRA 2MPFA 5H9PA 4C0BA 1WLTA 2GH2A 4MXVA 3NMBA 1A3KA 1J84A 4KWJA 3UKNA 1H8TC 2B9VA 3AYAA 3FMGA 3ECQA 3NV3A 3ZKUA 1OMIA 3U07A 2WO1A 1YFYA 5LA2A 4Z1VA 1LGBA 2QQJA 2YG0A 2VZTA 2YU1A 1AR61 5FXWA 1WUVA 2GNDA 1ND2A 4E8DA 5H9SA 1QJX1 5FKCA 1XBFA 4LBJA 4QB2A 2VULA 3GCWA 3UJOA 2ZS6B 2BEOA 1SLIA 3CZUA 4NROA 1EP0A 4JGYA 3T4HB 3WOGA 5ACA1 1CESA 1AR72 3F2ZA 1BHGA 1CIYA 4Q8KA 2EICA 2TUNA 4HBNA 1OQDA 1ENQA 1S0GA 3BIEA 1PGW2 4WM7A 3PL0A 4WVWA 5AVPA 4C8DA 1J1TA 4GKXA 5CIRA 3RS6A 4DY3A 3H3LA 1WLWA 5I0SA 2H0BA 3E6DA 2W1WA 2PHUA 1G9AA 3TEWA 1GZ9A 4R8HA 1NE4A 5FXXA 2ZKLA 3WDTA 2W68A 1G6NA 3AXEA 4CCNA 1X50A 3USUB 1KFXL 2WS92 4Q26A 5DUUA 4DNYA 3V65A 2ARAA 1T6GC 1XJAA 2O0OA 4IEYA 1W8ZA 2XBO1 1UY2A 2B45X 4ZZ8A 3JQWA 4OVEA 4DFSA 2D5HA 2FDKA 3BPSA 4RGAA 2ERFA 4BISA 3UT0A 4H3WA 3JCIA 4M4RA 4PJYA 3O1UA 1DQ0A 2VPVA 2WS93 1YFUA 3PTRB 4IETA 4Q29A 2WLPA 4BM8A 1YO8A 1H1MA 5A7NA 4CCEA 1EPWA 3SCHA 5KXDA 1LHOA 3M8LA 4KWKA 1JYNA 2VQAA 4ASKA 4N90A 4TLGA 1XNCA 4G4FA 3OF1A 5AFEA 1FXZA 4COYA 3WCRA 4URTA 1G9FA 4XURA 1L7LA 5CA6A 1S4CA 5KHHA 3WQBA 2AUYA 5FZ3A 1VBB1 1WLCA 2VMFA 5GALA 4H55A 1EV12 1MEC2 2QQIA 1PO11 3L2HA 3NKGA 3GBFA 1U12A 1RUH1 2JDKA 4LULA 2XKOA 1S2KA 4NRMA 2VUAA 2BNNA 4AVAA 4CP2A 1LJ7A 1JYWA 3J7MA 4LKFA 4NHXA 4RR3B 3T30A 4NR1A 2WT1A 3WQ7A 2JXAA 3GHNA 4HL0A 1DQ2A 3KZ4C 5IAVA 3ZDSA 1JMUB 1EV13 2D98A 3HWJA 3JXSA 2UY8A 4Y22A 3FX3A 2A6YA 3KV9A 4Y26A 3L2YA 1CONA 1AYN2 1UNBA 4NIHA 1YNAA 1LU1A 2L9LA 4FTSA 2WKKA 3ETQA 4OMCA 5I93A 4Q0VA 3SCGA 3VBHC 2BGOA 4QM9A 1V6IA 1OSGA 1W8WA 5D8AC 4LT5A 4AEDA 1H0BA 1RUNA 2WQ4A 1V9U3 3N35A 1DQ5A 2X5IB 2G9ZA 4AGVA 4ARXA 5IJRA 2FZ2A 1QQP1 3SMHA 4HG6B 1XNAA 2V4AA 1Q43A 1R082 4QX2A 3SCFA 1PVC3 1UXXX 2ZA9A 4IV1B 3RZMA 5FMBA 1AR82 1DF0A 1CVNA 2O8OA 3PLQA 3I2JA 4OULA 4CDUB 4FCAA 4MYEA 3CL1A 4F7ZA 3KCYA 3M70A 3ON7A 4A2UA 3A23A 2CU5A 1FOD2 4XEZA 4XFAA 1N1YA 2BFUL 4KGQA 4XAAA 1R083 1UZVA 1GZWA 2W94A 4CEYA 5BNNB 5D8AA 1DQ4A 1AXZA 1OD5A 3KGLA 3LSDA 1AF9A 5E6HA 1S2EA 3AZZA 3N9OA 1JZ2A 2LTNA 3FLPA 4MGYE 3LF7A 4QU1A 1VE0A 5LWBA 1WMXA 1HJFA 3VDDB 1HRI2 3I3QA 1FOD3 3KV4A 1W6QA 4EN6B 2WT0A 3D0JA 2BZDA 3JD72 3DN7A 4DPNA 2ZHLA 5A1AA 2X8KA 1NT0A 2JWPA 4UW3A 5FLHA 3A4UA 5A7QA 3CDZB 3T0AA 3VBOC 3ZFGB 1YQ5A 2Q0AA 3KD4A 1ZA4A 2YU2A 1HRI3 4LXLA 3EBRA 2C5DA 4Z2AA 2Q8CA 5FCCA 5FZBA 2Z79A 3AMQA 1O6UA 2XUMA 1WMFA 3P5BA 3VLBB 1B35B 3N4MA 4FO9A 4X8NA 1V6JA 4OUMA 2A5ZA 1VPHA 2DUOA 4YM0A 2JENA 4N43B 1MACA 1XPWA 5GJ6A 1FV2A 1OLRA 2VAUA 3ZPOA 3H8XA 2K9ZA 5FZ0A 5F32A 3R4UA 3T1LA 3RYKA 5C8CC 3ZXLA 5I0RA 1OH3A 2QQMA 3OYWB 5I8SA 5JOZA 1RUI2 4JTNA 1ZRDA 1XYOA 1HW5A 3VBOA 5A1LA 5H9QA 2W92A 2EAAA 1US2A 2GMMA 4Y1UA 3CKHA 4I0BA 3U4XA 4FPKA 3I2IA 1X9PA 1URXA 5A3UA 1OH4A 5L7OB 1JOJA 4LOSA 5BYNA 1Y9MA 1V9U1 2VU9A 3W59A 5A70A 2D93A 3IZOA 4P08A 5G04L 5IVVA 1H2MA 2WN2A 5FP9A 3GYDA 2O14A 3ZX7A 1SG3A 4H2AA 4RA0A 4Q4V1 1PVC1 5C8CA 4XIOA 4UFJA 1LOAA 2IFWA 3OGGA 5IK7A 1UMHA 1PIV2 4IEZA 2EF6A 4OI0A 2VY0A 1NXD1 4W65A 3GJAA 3LE0A 3NJXA 1F35A 2DUQA 5FYIA 4CCOA 5JSRA 1W6NA 1NQDA 4M0HA 4UF0B 1W0PA 5EQUA 1XE8A 1R081 1G9DA 2ZZQA 1HB2A 2R063 2HH9A 3AMHA 1I1EA 1ND2B 1HN1A 1PIV3 1QKQA 1KDKA 4RQPA 1JYCA 1IZ3A 4HZFA 2WWUA 4K9SA 3ZIWA 3VB9A 5E88A 4Z07A 1FOD1 2EIDA 4JGYB 2WNVA 2XQRA 3N9PA 1CN1A 4OZOA 1S2BA 2WSVA 2WFPA 1TNFA 4CUGA 3CZJA 4WM7B 5LA1A 2VOVA 2VZQA 4GB32 4UFKA 4CDQA 3U14A 2D43A 2Q8EA 3DCQA 1HRI1 2ETEA 1YQ8A 5FZCA 2WNEA 3L9JT 4UAPA 4AR2A 2NP0A 1ZRIA 4CPBD 3EO6A 2W1UA 2ZGQA 4EN7B 3I2HA 1NY71 1RJ7A 1UYPA 1JYIA 3BTAA 3CF6E 1W9TA 4AQTA 5DUVA 3EJKA 4AG4A 2V5DA 4GB33 5FO8B 2C9KA 2VQTA 1FV3A 4KBZA 4JDMA 1G9CA 5J37A 4XBNA 1US3A 5FZGA 1JZ7A 1F8VA 2J42A 2WIIB 2BWCA 3H9AA 4I01A 2A73B 2VL4A 4WV8A 1CAWA 5IVCA 2FCTA 2Y6JA 1W6MA 2OZ6A 3VKLA 1GP6A 3IMNA 1A78A 3WG3A 4XJ8A 1MR5A 4QB1A 3LGRA 3ORJA 2QQKA 3HT2A 1FI2A 4NHYA 3TN92 2A1XA 3RZZA 1QJU2 2ADEA 2VC9A 3JBG2 3SNMA 3LA2A 5KXEA 4FPEA 1MS9A 2LUWA 1JZ3A 1XNBA 2XVKA 2WL1A 4O9EA 2PA7A 4DRVA 3VDAA 2WJSA 4BU2A 4JDNA 2Y0IA 4HK8A 1XE0A 3AP4A 1PX4A 3OBTA 1HB3A 4I09A 3DF0A 2J1TA 3JBG3 3VDCA 2AEZA 3RNSA 2PHLA 2R0HA 1RYYA 4XF3A 5KBFA 4PDWC 5HCBA 3J9SA 4Y22B 5GLWA 2NM1A 2WZR2 1GOGA 1LGCA 4ZZ5A 2ZGRA 3ZYFA 5C4WC 2DV9A 4QPGC 4LMFA 4W50A 2HWE2 2R061 1UZ0A 4UBGA 2CGPA 1K42A 1EYBA 4KH9A 4ZU5A 2W52A 1HDKA 3ZPYA 5JSPA 5KHKA 1H30A 1PM4A 3AJZA 2EXKA 5FZIA 2WZR3 4AEDB 4G9SB 1HB1A 2I45A 4IEVA 3WD5A 4FPOB 4HKLA 5CFCA 4E2QA 1X33A 5IVEA 4P00B 1O8PA 5FP7A 4WZFA 5A6XA 4A44A 3C7HA 2VBPA 4MOAA 1CJPA 4A6SA 4PQ9A 2GP5A 3UYJA 1EUTA 3KHBA 4QPGA 5LZ6A 3PIJA 3WF1A 4UWDA 5EFUA 4YM3A 2R042 2VUJA 4NUBA 2XHKA 1OHFA 5EJ1B 1LKNA 2CWSA 5HCHA 1NZCA 1TQ5A 2NLRA 3O1MA 4BQ1A 5FZFA 1RTVA 5JOYA 3WNNA 1EAH2 1UN1A 2QVSB 2OW4A 2R043 3ZYHA 3N36A 5BNPC 1GMMA 3LDBA 2G1MA 1W6QB 1XNDA 4FOQA 1DQ6A 2B9UA 4X6QB 3AMPA 2EXHA 1YJLA 1VBD2 4FPFA 5FRAA 4GIQA 3SLIA 3IM0A 1UF2C 1W2NA 1LOGA 3I8TA 3M3IA 3O0VA 1SLBA 1ODNA 3GXUA 1REEA 1EAH3 2QQUA 1BK1A 2ZX1A 3N9LA 4N9IA 4XOGA 3ZSKA 2RJLA 5T54A 5CNAA 3J7LA 3ST7A 1TMF2 1XYPA 4C91A 1C1FA 3KQ4B 4XUQA 3ZOIA 2Z2SB 3NO8A 2VH9A 2BNOA 2RS33 5J7MA 3UK9A 1MS3A 4S2HA 3S0MA 4CP9A 5APAA 2GMEA 2R6QA 4CDXB 1Q8SA 1YHFA 2QE3A 1X82A 3JBG1 3K3NA 5CBLA 3MIFA 5T3NA 3MW3A 3OJBA 1SDWA 2G4IA 4A7YA 4I0AA 3ZFEA 3V0BB 5JOXA 3ES1A 1VR3A 4AFCA 3NRUA 4FPHA 2VTFA 3IDEA 4XF0A 3PVOA 3M2MA 3RGBA 4UFHA 4GD4A 1CPNA 5CYYA 2LRPA 4D7YA 1WD3A 1BK0A 1DGRA 1C8M2 5FZOA 2VW0A 2D7FA 5FYCA 4OQ9A 2XOMA 1Q8QA 1POV0 1ZBA2 2WZR1 5JR2A 1A8DA 2CYFA 4YVWA 3RRDA 2J1VA 4JAAA 4UXAA 3JZVA 4JHZA 4C90A 3ZLIA 4V1PA 3I3DA 1D2QA 5FZDA 3RDIA 3P6BA 3ETPA 4LA2A 3KCXA 4TSVA 1C8M3 4LJHA 4V2VA 5C3QA 3VHOA 1D0GA 1JW6A 5LK7B 4Q4Y2 1ZBA3 3FLRA 2W91A 1RUF2 5IVBA 2PHWA 4FVVA 2VOKA 1UPIA 4AVSA 5DAVA 3T4VA 1W6NB 2VUCA 3NL1A 3WQ0A 3WDUA 4A4AA 1SLAA 4GH4B 4WZCA 3ZXEA 3EXUA 1UD1A 2P3IA 4IUGA 3TWIA 3UESA 4EWAA 4K20A 4Q4Y3 2X10A 4K21A 4E2GA 4CU6A 1RUF3 4LE4A 3WNLA 4RQPB 2JJ6A 1ZRRA 4DUVA 2R041 4FAHA 1H4GA 3JB8A 4XZUG 5ERLA 4AK3A 4N53A 5AVAA 3VBRA 3OY8B 2WNVB 3I97A 5L9VA 5BXXA 1STMA 4BQ2A 3BI3A 2BW8A 4OZXA 4YVSA 2PN5A 3TAYA 5KR7A 1H1AA 5J36A 3RZHA 4AEMA 1YQ6A 4I0WB 4CSWA 2V4VA 4SLIA 3VKOA 1EAH1 4Z2WA 2VZVA 3MHZA 4CDQB 4DXTA 2UWCA 2KA3A 1GKBA 3B94A 1JOBA 3LFMA 4M3CB 4XJWA 2MNGA 2K46A 1LOFC 1QXRA 1ZBE1 2RS31 1PHMA 1ZREA 1Y4WA 1ZNPA 1GP4A 3EYPA 2AZ5A 1H6YA 3DXUA 3HBKA 4JVAA 1WBFA 4YW2A 1AL22 1PX3A 2WWJA 4CCKA 1X8EA 5I8TA 1O3RA 1YEWA 1BYHA 4QGLA 1RVF2 4S2DA 1TME2 3H8UA 2LALA 3IMMA 4FT8A 1QXJA 2FDHA 2JDUA 1KJRA 5DPNA 4YZ2A 3WEZA 2OQ6A 5FMCA 2VOTA 1AL23 1GBGA 1UX7A 3NW4A 2UYBA 2OA2A 3VBSC 1W6MB 1E57A 1R093 5FP3A 4NVPA 4HPKA 5DQ0A 1CZSA 3SC7X 2Y0OA 3PTYA 4XACA 1HV0A 4GAZA 4Q4X1 5DDJ1 2LROA 4EYUA 1GANA 2ZX4A 5ABJC 1IS3A 1BXHA 2H6CA 4Q1RA 1OURA 4MZUA 4DXSA 1POQA 1DZQA 1UY0A 2P3KA 3BCWA 2HBTA 1OF3A 2Z69A 1JUHA 1Q8PA 4DY5A 3J7NA 5DXDA 4GMP3 1F15A 2WNOA 4BQWA 1C8M1 1MQTA 3OUJA 4LITA 3T09A 3LEGA 5E89A 3UKVA 5F37A 4AFBA 3I2DA 4XDOA 4YG6A 1OBNA 1ZBA1 2KXLA 5GLUA 1BZWA 1VLNA 1AJOA 4B4QA 3JUUA 1WCKA 2VZSA 3MGUA 5FPVA 2E7QA 2RM22 4S2GA 3VBSA 3HEIA 4L9BA 4B1LA 4FXKB 4CEWC 4N9HA 2D6MA 1NCRB 1O3SA 1ODMA 4J6GA 4NAMA 5D1IA 5IAXA 4LLOA 4MGKE 2VUDA 3PIGA 1WA4A 5ABJA 1W6PA 5CG8A 2YBPA 1HXS3 4ZY9A 5A7PA 4FAGA 4LA3A 3ACIA 5A33B 1UKRA 2FCUA 2VR4A 5FYTA 5CFCB 1H1IA 5K9YA 2RJ2A 1C5HA 3VZOA 2XUEA 5FLIA 1HLCA 1LNSA 1K5MC 4BK4A 2VMDA 4RGKA 1G86A 2AGSA 3WZ1A 3GZTB 4CCMA 2IZWA 2XGXA 3I2FA 4XBLA 4PBOA 1UY3A 2BNMA 2EALA 2AC1A 3FBYA 2DCTA 5C5UA 3C7EA 5BUVA 1SLLA 1ZM1A 3S7EA 3CJIC 5JI9A 4AFMA 4CP1A 5LCWL 4AEJA 5C3SA 1D7PM 1SLCA 2NZ9A 5A3PA 2E7TA 2AH2A 3PUHA 4W6XA 1ZYBA 1KS4A 4RS5A 2A71A 1LEMA 4Q2FA 4JGZB 1WA6X 3FHIB 2SBAA 2A6VA 2QTWB 3LFIA 1QEXA 4RFRB 4GJZA 3THCA 2HWD2 2X09A 2XJPA 3POYA 3Q8BA 3OBAA 1FPN2 3FZ3A 1DBNA 1BMV2 2I07B 5FY4A 4WVMB 3ZR5A 1AL21 5FDBA 1V6MA 3VDDC 5JZGA 1XXNA 3Q8EA 1ZZ6A 1R091 1WMEA 2RR12 1CAVA 2Y33A 3H8OA 1SCRA 3T3YA 5IHRA 4P14A 3WCSA 4BCUA 1UXZA 1W8TA 2QBXA 4QKBA 2XJTA 5L7OA 4QX1A 3ZYIB 2BOJA 4N8MA 4Z82A 1FPN3 4OHVA 2QKDA 2DU0A 4W4ZA 5FZ1A 3WP6A 1ZZ8A 4YGDA 5JXJA 1O4TA 2JG8A 3V0AB 1XSQA 5EHDA 2JG9B 3OGVA 4HVOA 5FPBA 3VD4A 4EZHA 4GMP1 5GKAC 1U0AA 5FYYA 4CP9B 2BERA 4YZ5A 4XC9A 1B35C 4NHKA 1H9WA 1AYM2 4CCDA 3SEPA 4XTMA 4NHMA 3BKZA 3C7OA 3WXPA 3X29B 3EHKA 3KCCA 2DTWA 2GZWA 5IWFA 3ZFEB 1XQNA 2CSGA 3UV9A 3S57A 4IV3C 3FFQA 4N7UA 1OVPA 5GZDA 5KHGA 1YXWA 1AYM3 1TNRA 2IFRA 4LIVA 4E9KA 4ES8A 1HXS1 5CG9A 4Q27A 2BRTA 4DXRA 1GWMA 1W8NA 2EAKA 3AYDA 3MLKA 2P2KA 4BJ0A 2WA4A 2ZKNA 2Y60A 4YVWB 1IKQA 2DBIA 4Q8LA 5C70A 2PHRA 1NCQC 4CXYA 2Z5WA 2ET7A 3WF4A 4DUXA 1WWYA 3W21A 3FE5A 2ORZA 3MV11 4MGQA 4BXFA 3K75B 1VB4A 2ZGNA 2DFCA 2GC3A 3OGJA 4YW1A 1IPKA 4WM8B 3BPZA 3ZMOA 3RJ2X 4QQHA 3RFRA 2V09A 4KBBA 2ZAHA 4LBQD 1OT5A 2W47A 2OPWA 4BE3A 1YLLA 3KHCA 1D4VB 4OUEA 4QHBA 4EZ4A 5JAXA 1PK6B 1RUD2 4ZS3A 3BOWA 4AL9A 1FMD2 2WQ8A 1CJDA 1UZWA 2DURA 1GR3A 3O12A 1NLQA 3FFZA 4CE8A 2RE9A 2HYXA 4C1XA 1W8FA 2D3SA 2FMDA 2WT2A 4QPIC 3LEIA 3BALA 5I0UA 1W2OA 3TEXA 3VBRB 4CTEA 3NNJA 4BA6A 1L3JA 4XUPA 4D6SA 5C9AC 1X7NA 2XL9A 3K51A 4CDWA 3T0DA 1FMD3 1RL3A 1AJKA 3BGAA 4QT6A 3RVHA 2BYVE 4Q4W1 5CFDB 2C1FA 1ACCA 5AC92 3FHAA 1BEV2 1OOPB 2WAOA 3IIIA 3GF6A 4CRQA 1N1SA 5LEKA 2MEV2 1H8TA 1BBT2 2QJVA 3MUZ1 2P4EA 1YJKA 4LUMA 4YZ3A 1NXMA 4XFGA 4NJ4A 3QH6A 1OA3A 4QQPA 5FJKA 1JZ8A 3SEEA 3HD8B 4TWTA 4FTEA 1AR73 1S0CA 1CAXA 1H2NA 5FMOS 1BEV3 5A6ZA 1IG3A 3O1TA 2MEV3 3A21A 2HLEA 5FZ6A 5ISLA 3RZGA 1BBT3 4Y1YA 4UFIA 5C71A 4XXAA 4QQOA 4RL7A 1GOHA 4W8JA 5F1RA 5DABA 2Q8DA 1DYOA 1HB4A 5BPXA 5KHIA 2G9GA 2W0XA 2SLIA 4NOTA 1C5IA 3IN9A 2YGMA 4IE0A 5FK8A 3NVCA 3SISA 4BB3A 4PIZA 3I2GA 1D4M2 1NA1C 3DYPA 3OGRA 2ZHKA 2UURA 3MEPA 4M00A 3TNPB 5JR7B 1QJY2 1IQAA 1G8WA 5BNQA 3B93A 2BTVC 2B7YA 1P8JA 3JB4C 4L99A 4IEWA 4K40A 2V72A 4KWLA 2JD9A 5HV4A 4BQYA 1CX4A 3HIFA 4WVZA 1GZCA 4IXLA 2YFZA 3LKJA 1G7YA 3MF9A 4YW4A 3ATGA 1IQDC 1QJY3 4LNVA 3ZSLA 1FATA 3NAPC 2WSUA 5JLVA 1GUIA 1VP6A 5C33A 2N7GA 2Q5TA 2OUHA 1C4RA 1F5JA 1WD4A 2DCYA 4HN1A 3OB8A 2BBAA 2J22A 3VHNA 5I0DA 5J1XA 5C6CA 3FUOA 1LB2A 1W6PB 5C8WA 1NG0A 4UI9L 1MEC3 1ST8A 4AVBA 3EQEA 3QOPA 1YQCA 1SPPB 1C28A 4BIFA 2YXSA 4EN8B 3ZO0B 2RDRA 3ZXKA 2HWF2 2RVAA 5GM0A 1F2NA 2F4LA 2ZGKA 4NPMA 2ZMKA 1IPJA 3J7HA 4H7LA 4MVTA 3A22A 2FMYA 2GC2A 3ZYJB 1FMD1 5FUNA 5SV5A 2IC1A 3LIGA 3WF2A 1QH6A 2BUKA 1AYN3 5J96B 5F3IA 1W6OA 3MV01 4BQ4A 4ZKTB 1U5XA 4O61A 4D8MA 4QAWA 3HNYM 3I54A 2GNBA 4A42A 2ZX3A 4XVHA 5IVYA 5HBAA 1GFF2 3ES4A 2P5BA 4PIXA 3C8XA 2R16A 4HETA 3V56A 3ZKYA 1AR71 1EUUA 4LKEA 4RS5B 3VZKA 2DWRA 4OUSA 2XL7A 3AM2A 3WG4A 1BEV1 3ZR6A 3DECA 1DGRN 2RHPA 3B02A 1JHNA 1E5IA 3VBHA 2MEV1 1PGW1 3TOJA 3BTYA 4YSFA 4QDRA 1W05A 4LE3A 4JRAA 1AR83 2YPDA 4NO4A 1HN0A 2W46A 5FZ8A 3MO4A 4BK5A 2WS91 5A80A 2ZGTA 4JQTA 5JZGB 4DOUA 1LODA 2AR6A 1W3VA 3WINE 3P3NA 3U0ZA 4HSJA 3VZMA 1LOEA 4BZ4A 5BNOC 4QPWA 5T5PA 4OHXA 3B3QE 2K2SA 2BDRA 3NKTA 2Q8OA 1SLTA 4QXBA 3N9MA 1O5UA 2VOXA 3E5XA 3KSCA 3VGIA 2JDMA 4BIOA 2YB7A 1MVQA 2CV6A 4C1WA 3JD73 1OA2A 4LBQB 1LU2A 1OQEA 4BPZA 2WYSA 3ZXDA 1YC61 1DYKA 1UYZA 1QJY1 2B42B 4YYOA 4ASLA 4FQZA 2VZ1A 3BN6A 3G6JB 4MGIE 3VHPA 2GN3A 3NJYA 3UL2A 3NNFA 4IE5A 3R4DB 1Q56A 5BNOA 2J1EA 2V73A 5FPLA 1EY2A 5GLZA 2QQOA 3NWKA 2VMHA 1C3HA 4IGQA 1OXCA 1EV11 3W9AA 1MS1A 1MEC1 4DXZA 1CX1A 4XQDA 4YNIA 4XFBA 3IDCB 3KV6A 4B8EA 1CGPA 4IW3A 2JICA 4CCCA 4LK6A 4OHYA 2JB4A 1J58A 4KQ7A 5SV8A 5IVFA 2TEPA 3AL6A 3AMNA 3IIAA 4AI0A 5K0UC 2P17A 1L7QA 3EMRA 2EXJA 2PYTA 1JI6A 1RUI3 3IKWA 3ITQA 3LPFA 3M7AA 2FHRA 4MXWB 4UFMA 4AGRA 3AMMA 1AYN1 3CBNA 4HONA 4Y4YA 2DUPA 2WN3A 4GZ9A 3DPRC 4MGSA 3WF3A 3WNOA 3P3PA 4B3NA 4JRLA 1UOFA 4TXWA 1YFWA 2GDFA 3NNGA 4PF5A 4YFWA 5DUWA 5LBEA 4OQ8A 3GBWA 4YGBA 3U11A 3FUQA 2DVAA 2R49A 4GH4C 4B4RA 3U10A 2MHFA 5K0UA 2VNVA 4INDA 2GN7A 3WNXA 4BDVB 4EWDA 3WQ1A 3VD7A 4BH9A 2ZHNA 2D97A 3AX4A 3OSDA 1TG7A 1AR81 3Q8AA 4FFHA 4JHTA 3C2UA 4Y1VA 5FWEA 4DMIA 1KFUL 4XCBA 3H50A 4JTOA 4YM2A 3LWCA 4QGNA 5K4LA 2FDFA 2JE7A 1DP0A 1DHKB 1LAJA 2Q1MA 3VBFC 4LO5B 2DBNA 3INAA 4AOCA 3VN4A 1PGL2 1OKOA 5F3GA 4LOTA 4XJUA 1H8TB 2D6KA 2VBDA 4HOOA 1QOTA 1E5HA 3C7FA 2OVUA 1VMJA 4QM8A 2XDVA 2GAUA 3ZFFC 5KXBA 2HJIA 1GLHA 3JD71 3B7MA 1KXGA 3PMEA 5FUIA 1CAXB 1GQHA 3WLUA 3ZMNA 4AFDA 2QCSB 1W0NA 5FZ9A 2BOIA 2DYCA 4LR4A 4QKNA 1U5ZA 5F8PA 1ZRFA 3HT1A 3AFKA 4MGZE 2QZ2A 1S55A 2LW8A 2VQUA 2VMEA 4AI2A 2RMU2 3MIGA 3QBQA 3DYOA 3VBFA 3T2OA 4JQRA 3SQOA 1GWKA 3UJQA 2BGPA 3VBUC 5BV6A 5DG2A 2ADDA 3WDYA 4E4ZA 2VNGA 1NZIA 4CZSA 3O1VA 4FQ4A 4QX8A 2RMU3 4Y5TA 4MGTA 1A8MA 5F6LB 2UWBA 5C7GA 1HJGA 5FXVA 3MIEA 1H6XA 1JZ4A 3MI8A 1RUI1 3ZYBA 2IXIA 1K12A 2BVBA 4LO4B 2WA3A 4PF1A 2W9XA 4FPGA 3AYEA 3B9IA 5F6KA 1V6LA 4IEUA 3N7JA 4XPVA 2A3YA 2QQWA 5GLTA 1C1LA 1S0FA 3VBUA 2YHJA 1OQ1A 2OT7A 3DL3A 2D44A 3TN93 3DGTA 1DZTA 1KD7A 1QJU3 1QOOA 1N3QA 4TN7A 3T2PA 3U37A 3WW4A 4CA9A 1WCDJ 4XUOA 5FV3A 1EPZA 1NCRC 3T1MA 3CHXA 2ZZJA 4LIUA 4PT6A 5F5CA 4B4PA 4BXSV 5LK5A 3PDQA 2IXHA 5KHJA 2WQZC 1IS5A 3B01A 4MSVA 4YLZA 1NUKA 1VBC2 2VO5A 2AEYA 2XJVA 1SBFA 3OUHA 4YGEA 3ZXFA 4LHSA 1PIV1 1WW6A 1AXKA 4ISQA 4LHNA 5F5QA 1KDMA 1V0AA 3ILRA 3PU3A 2CDOA 2A3WA 2ZBJA 3RI9A 2TNFA 1RHI2 4IEXA 1Z7S2 4XDQA 2NQYA 4QKFA 3BTZA 3ZSJA 1I3HA 5FXZA 1UAIA 1VBC3 4Q0UA 2HWE3 4AZZA 5FPAA 2YYOA 4KL1A 1DQ1A 2ZEZA 5B4XA 1IGOA 2WLQA 4FBFA 1W39A 4PDWA 3KV5A 4AF9A 1A6CA 1RB8G 1HRV2 2PLV2 2XJUA 4HANA 1K45A 1RHI3 2H0VA 1Z7S3 5C4WA 3WDWA 4AFAA 2XB6C 3H1MA 4M01A 1SZBA 1KJLA 4F3JA 4TYSA 3UNPA 3S6PA 5FMOL 2ORXA 2C0ZA 1GZWB 4GB31 4CEYB 4JGZC 1WW7A 1IG0A 5D8AB 1W0OA 1DYPA 2JE8A 1HRV3 1PMIA 1QDCA 2BP6A 2W3JA 4Q0PA 3USSA 1UIJA 4AHZA 5FUPA 2Z42A 2IVIB 4NIIA 2E31A 3NV4A 4XTPA 3CMGA 4E4SA 3E6CC 3D0SA 4P5YA 1GNHA 3RJRA 4ONUA 4EJRA 4YFZA 3RMXA 3KMHA 2CAUA 4L0PA 4OHWA 1G9BA 2YY1A 4MH0E 3POGA 1LCLA 3HQUA 1VBA2 4A3ZA 3OGSA 2OQ7A 3NV2A 1UMZA 5EPAA 5A1FA 2YBSA 1I5ZA 3ACGA 3LCPA 1RUC2 2WNUC 3TB0A 1JUIA 4AQ2A 1VBD3 2VMCA 4XETA 2XHNA 5GZEA 4K8FA 3SH5A 1PO22 2IXJA 1PZ9A 1VBA3 2CDPA 4META 2A6ZA 3M3EA 3I3BA 2OPKA 4LBKA 5BNPA 4CP0A 1TMF3 3TN91 1LOBA 1QJU1 1N3PA 3HBZA 4EN0A 4FSJA 4YW7A 1PVXA 3HR9A 1IPSA 4I30A 5CU1A 4ARYA 2E51A 3AK0A 3ZM8A 1PO23 3VBOB 4P5HA 4DO0A 5C3PA 3WUCA 3D82A 1DGLA 1VBE2 2OYZA 5FY7A 3AP7A 3S5QA 5F2WA 1V70A 1POV3 2JEMA 5CISA 3OD4A 2Y26A 2ZACA 4A3XA 4GJYA 3H3ZA 3RG0A 5LEJA 3POSA 1AL0G 2XJRA 4EROA 2VD7A 4NWWA 1SBDA 3KWVA 5EIYB 2WO3A 1VBE3 1VBC1 1XE7A 1Z0HA 2HWE1 3I2KA 4QX3A 3WW2A 4IL7A 5FZHA 4XJAA 1ZZ9A 2ILMA 4LPLA 2QQPA 2P3JA 1DFQA 1ND3C 1VRH2 3ELNA 1YCIA 4Y3OA 5ANQA 5T55A 5C8CB 5FQ0A 2Y8KA 2AENA 4ZXEA 4COWA 1RHI1 4LK7A 3ZSMA 3O7OA 3O1PA 1D0HA 2WZEA 2B4KA 5JPMB 1S0EA 2DVBA 3FLTA 3WP5A 2OZJA 2W08A 4YZ4A 1PK6C 1O91A 3SKJE 3S5AA 1VRH3 1ZZBA 4QHZA 2E26A 3ZN4A 2ARBA 2E7AA 2W2IA 4IE4A 1HRV1 2ZMLA 3GNEA 1DLCA 1APNA 2VOWA 4P9IA 1XOYA 2ZAAA 3ALQA 4DINB 4BOWA 3OCPA 3U75A 3OTFA 4YW5A 5I0TA 5CAZA 4Y1XA 4QX0A 5I91A 2OKXA 4IGOA 4NAOA 4ZHNA 2B46X 3B5LB 5LB6A 5JPNB 3JQXA 4ET7A 1OOPC 3T2QA 4QHOA 1J3QA 2BVVA 3E6BA 4P9JA 2YUEA 4OHZA 3RI8A 5LBFA 3DXTA 4QB6A 4ZPIA 1OD3A 1QWRA 1WMDA 1AZDA 4L2NA 1VBD1 5M0TA 4AGGA 3WDXA 3ZVXA 4Z8BA 1DGWX 4CU7A 3ZYPA 1H2KA 1NX9A 2XKPA 3M3OA 4PBPA 3KF3A 2VZRA 5FYSA 4BLJA 1W04A 3D6EA 1TMF1 1GOFA 1W9YA 1GWLA 3RZJA 3K77A 4FP3A 5FZMA 4E8CA 4SBVA 5FPXA 5DMYA 3C3VA 3S30A 2A7AA 1PO21 1V6OA 4CVUA 1CAWB 1LULA 1DZRA 1RVF3 2TBVA 3THDA 5TSWA 1UY1A 3AKPA 1TME3 3BU0A 1POV1 1LOFA 1V6NA 2X29A 1ULGA 4D0QA 5DN2A 2R072 2YC0A 5FY9A 2ZGPA 2BFUS 1LESA 3MICA 2VNOA 1H8VA 1TVGA 3FN9A 3LOBA 2XR4A 1VBE1 3AL5A 3EB7A 3KT1A 5ANNA 3ZSEA 4O9GA 4ISRA 2VZOA 3GHMA 1BVVA 2ZJCA 4LO6B 1DLLA 1W03A 4MO3M 4AAXA 2VGDA 1QF3A 3ZDVA 4TZDA 1ZX5A 3T0BA 3WUDA 3WT3A 2XVGA 4Q0SA 1LHNA 2VJXA 3IT8A 4PHZA 3K2OA 4FFGA 5FOJB 5JXHA 1WBLA 1Y7BA 2UWAA 1PM7A 1S0DA 2Y6FA 1UOBA 2FDGA 4Y5SA 3U4SA 4RR3C 1QJZA 1UX6A 3I3EA 4JC1A 4XZPA 5IK8A 1AVBA 4ES9A 3H3UA 3LD8A 1BQPA 1NOVA 1W9WA 4Q4Y1 4JDOA 1OLMA 5EYXA 1RUF1 3J8F2 1F4HA 1QJEA 2RM23 3MF6A 1WW4A 5IW0A 1GZTA 3MIBA 5C3RA 1Y9QA 5LA0A 1NLRA 3BIWE 3SXWA 3UETA 1REFA 4MADA 3GALA 2ARCA 2XWJB 4QXKA 3UKTA 3O1OA 4MX3A 5DZGA 1J3PA 1CQ9A 1O7FA 2X5IC 2JDPA 3IPVA 2D40A 2P34A 5LATA 4CEWA 3CEWA 1E5RA 4CCLA 4FFFA 5A3NA 5JI7A 4QPGB 4IV1C 4R52A 4HXCA 2PFWA 3A0NA 5GZGA 1VMHA 2OIIA 4YARA 2YBKA 4PIYA 1JS9A 4QMAA 3PVBB 4CDUC 1MS4A 4KU7A 4ATEA 2YC4A 3MW2A 1SFYA 5GZFA 4S2FA 2DVGA 3MDPA 4PLMA 5BNNC 1UMIA 4OCTA 4LHKA 4U2AA 4K7JA 4LBMA 2GMPA 1K5MA 5LY1A 1N1VA 2WAAA 2X5IA 2JIGA 3PVNA 3OG2A 4HFSA 1CIWA 1T2XA 3PU8A 1W99A 4XJZA 5FZ4A 1RVF1 5EXOA 1TME1 3CJIA 4CUBA 1AR62 2VCCA 2HWD3 1IKPA 5HV0A 1QJX2 1KQRA 1TEIA 3KLSA 1JOPA 3ZN5A 3GGLA 3M3CA 4RYDA 2EIEA 4CDUA 4AE2A 4L11A 4RFT0 5L73A 3ZFGC 2P1BA 3AFGA 2VZUA 4HKOA 3AXDA 5KXCA 4OMDA 5HXVA 4JKMA 1AXYA 1WCSA 2RR13 4H7MA 5A3OA 3LIHA 2PQQA 4LQRA 3MIHA 3ZYGA 1HX6A 2OX0A 3S7IA 5FY1A 5JOWA 2R0FA 3O14A 3HOBA 4XABA 5LY2A 1QJX3 5FREA 5BNPB 2EA7A 1SHWB 1MZ5A 2EXIA 2A75A 4N43C 3HPNA 3VDDA 3KVBA 1RGSA 2NYYA 3FBMA 1JTZX 5FAXA 2QFEA 1X9TA 4LUKA 5CVRA 3TEYA 2D3PA 4ASMB 3IDBB 2XBO2 2D3RA 5JDBA 3HVDA 2X05A 4I3PA 5FZOB 4K1YA 1BVP1 1C8NA 2RM21 4KMQA 3VKFC 5B4NA 1U5IA 3AP9A 3IDAA 3WDVA 4P9LA 2GALA 1GV9A 1B35A 5FZAA 3PUSA 4P9YA 5L7OC 5FO7B 4NPLA 4KGGA 3M4FA 4IEQA 4N43A 2VVEA 2IUWA 1JZ6A 3WP4A 3O1RA
chains in the Genus database with same CATH topology
5E8AA 4HN0A 2X53S 5FQ0B 4RD7A 1O4YA 3VKNA 2GC1A 4LO8A 4IV3A 5GLVA 3AKQA 1DDLA 4YRDA 3OD0A 1ULCA 4XBQA 1ONAA 1ASJ2 1VBB2 3AYCA 3MZHA 3ASIA 4AXOA 1BKZA 1RUH2 5T5JA 2JECA 1NCQA 3PMSA 1RIRA 1ND2C 4GKYA 1PNGA 4N53B 3GBGA 3I59A 1ASJ3 1VBB3 2XPJA 1RUD3 3OBRA 1COV2 4E27A 1CAUA 4YVSB 4JGYC 1JXNA 1VIWB 4Y20A 3ROUA 1TE1B 4E2SA 5AFBA 1UCXA 2HWD1 1SCSA 3H7YA 1FPN1 4YG0A 2D6PA 4WM7C 4Y1ZA 4W6WA 1BMV1 3VKMA 3DUIA 3HN1A 1M4WA 1QOSA 4PLNA 5FFOC 1COV3 2RR11 4FPJA 2YZ4A 4QGMA 3AB0A 1RINA 5GZCA 2CL2A 1QQP2 5HCFA 3RMYA 5L36A 2JE9A 5AC93 4QPIA 3VL8A 1ULEA 5FO9B 1GNZA 4XFHA 2ES3A 5EJ3A 5C9AA 3O0WA 4XMIA 4HVQA 4ZU4A 1QDOA 1QQP3 1AHSA 3H0OA 4R4XA 5CADA 4OI4A 1AYM1 5J98B 4AHYA 2E53A 2ZHMA 4GALA 4HPKB 1XRUA 4G3YC 1XU1A 1VAKA 2PHFA 2ZX2A 5HCAA 2PTMA 3N7LA 1F5FA 4KU8A 4OI1A 4FOVA 1HQNA 2BBVA 1MQTB 1D4M3 4AWDA 2ZTNA 1RITA 5T50A 2BGCA 1VAVA 4COUA 1X8MA 3VBSB 2QDRA 4Z92B 2OUJA 1CR7A 2ARXA 4QD2A 4XJ9A 4LHLA 1Q8VA 2R1DA 1RUJ2 5I8YA 2DCZA 1DG6A 1NA1A 5ABJB 2QUOA 5E16A 3AZVA 3H1WA 3QACA 3ZYRA 3NV1A 3THTA 4XXPA 2BWAA 1ASJ1 1RUJ3 1RUD1 4AEDC 2HWC2 1RC6A 3R6SA 3NAPA 3IPVB 3B9CA 4CEWB 3AKRA 2FQPA 1ZZ7A 3IWZA 2HWF3 3AP6A 5FTTC 1VALA 5T5OA 3NSTA 4LBNA 1COV1 1YI9A 2HWC3 2D6NA 2DCJA 1V9U2 2PHDA 3R4SA 1AUYA 2AREA 1I9RA 5AC91 3BOPA 4BMEA 2YPJA 4AI1A 4GXLA 2HEYF 2VMGA 1PVC2 4Q4V2 1YUDA 4CEYC 1BBT1 4LLFA 1K5MB 4JCKA 2CWMA 3WHTA 3KQRA 3TYJA 2JKBA 1UPSA 1CAVB 3B69A 4Q4V3 4RSUA 1U5YA 3CJIB 4LO7A 1X36A 4GA9A 4U36A 2GU9A 2QZ3A 3O0XA 4F83A 1YFXA 3HQXA 3PVEA 4P9XA 1ENSA 1UZYA 1J59A 2JG8B 1MZFA 4E4DX 2XLFA 3SHRA 5KWRA 2XJSA 4NN0A 4COVA 3VZNA 4F8AA 1D4M1 1ALYA 2CGNA 4BMBA 3VL9A 4D7SA 4CDXC 5JSOA 4X8PA 4J1WA 1RUE2 2XH6A 1NQJA 3PJYA 4XFIA 1NY72 3PNAA 3D8CA 4QQLA 1AX1A 3V64A 4DB5A 1WW5A 3O5SA 4B7EA 2LM3A 1MS5A 5IK5A 2C9AA 5JIUA 1SEFA 1NYWA 1VAMA 1Y3TA 1LR5A 1RUE3 4EWEA 2YGLA 4QX5A 2ZOEB 4HMZA 4FXGB 1RUJ1 1WGPA 3LB9A 2VECA 5A3LA 3SITA 4CDXA 4XMAA 2ATFA 3BB6A 1R1ZA 2VVDA 1LTEA 5K8SA 1YIFA 4IV3B 5J48A 2HWF1 3V0BA 3ZXGA 2UY9A 2HWC1 1RMU2 2GC0A 5EV7A 3PHMA 1YYNA 2V5YA 2YV8A 3AZXA 4KNCA 4HSLA 2XLAA 3OPZA 3APBA 3QH7A 3MLLA 2CNAA 2VG9A 4K1ZA 1NCQB 4ITCA 4RGGA 4C0HA 1RMU3 1BJQA 3I59B 4RQPC 1QU0A 4XF9A 3KB5A 1OA4A 3DPRA 4PLOA 4XQWA 3WW1A 3ACLA 3H1YA 1CAUB 4Q0QA 4CDWB 4FOYA 2RS12 4FP2A 1QGLA 2WNVC 1WLDA 4Y20B 2CTVA 2R062 1LEDA 2O8QA 2DTYA 4LBLA 3NJZA 1GSLA 2W39A 1QXPA 2QNKA 4CDQC 1UU4A 4GH4A 3RWNA 1O4ZA 2RS13 3ME2A 2HEWF 1Z78A 2VMIA 3VZJA 4KG0A 4QPIB 2YROA 1HV1A 4NHLA 5JVVA 1J3RA 3B00A 5C9AB 1RUG2 3TNQA 3OY8A 1QNWA 3WY6A 2ZPXA 1UL9A 4OLLA 4P9GA 5KC6A 4IERA 3RYPA 5A32A 2B5HA 3GZAA 2JX9A 2WC2A 1RUG3 1QMJA 3D5OA 3ZFFA 1RUE1 3VUOA 3FJSA 4M3CA 1R1A2 4AEKA 1YWKA 2KM2A 2JDZA 4QU2A 2IXKA 4GWNA 4RHV2 1B09A 2B8MA 2ZX0A 1N1TA 1FNZA 4YM1A 4AI8A 4HT1T 3WHUA 3WG1A 3MYXA 4BLIA 1Q3EA 1R1A3 2ENRA 2ZABA 3ILNA 2PHXA 3LZZA 4RHV3 5KC5A 4AW7A 2JD4A 5JCTA 4YW3A 3E97A 1NA1B 2VW2A 1IS6A 3AZYA 3CLPA 5LRRA 1O5LA 3QLQA 2FBEA 1OPMA 3FWEA 3KM5A 4FOWA 3POWA 5JWPA 4GQ7A 4LTAA 1GICA 4R4ZA 4R9AA 3THPA 1RMU1 2E9QA 4Q1PA 3VHRA 2CAVA 3HMYA 4D3WA 4EN9B 3ZIXA 4AVTA 1YI7A 2DVDA 5CFCC 1SMVA 3NAPB 3MFAA 2F6BA 5BY5A 2WWSA 1W6OB 2EIGA 2HYKA 3I4IA 4JV4A 2A70A 5DZEA 4I2OA 1UW8A 1NCRA 1HQLA 2P37A 2E6VA 4M3CF 2RS11 4XE9A 1Q8OA 4I02A 2Y38A 2Q30A 5EZWA 4HLTA 1PNFA 1PGL1 1XYNA 3VBHB 3K48A 2D6OX 1H2LA 5A33A 5IK4A 1LECA 2PLV3 2RS52 1NLSA 1J1LA 2E63A 4K3UA 4AHWA 4CYDA 1OFNA 3LAGA 1MVEA 2DCKA 2G9FA 3SH3A 1RUG1 3WV6A 4M0NA 4J1XA 2RS53 2RMU1 3HAGA 4UBHA 2VXRA 2ZGMA 3Q9OA 2GNMA 4ATFA 4DZGA 4X6RB 4L97A 3IBMA 2F4PA 2PAKA 3AP5A 5T52A 4R9BA 1S0BA 4JGZA 2JG9C 5HI0A 3ILFA 1R1A1 1VJ2A 2WINB 5H9RA 4ZXKA 5DUXA 1PZ7A 4RHV1 4WVMA 2Q1ZB 5LRSA 3KGZA 1RUC3 1UU5A 1ZBE2 2RS32 5BNOB 2YMZA 4BWOA 3ZFEC 1JH5A 2UU8A 2GH8A 4XHBA 2ZGSA 3R05A 3ZN6A 2VNRA 2IXCA 4PCRA 2WZPP 3CJXA 1MZEA 1F9KA 4UW4A 5B2GB 2Q4SA 3V0AA 1O3QA 2WNUA 1ZBE3 2JG9A 1OFSA 4XW3A 5FPZA 1DU3D 1H4HA 2PAEA 4YVWC 3CNAA 5L19A 4D94A 3D4KA 2B39A 5JIAA 5EYYA 4D69A 1GYKA 3AKSA 2PELA 2YDEA 4Q4X2 2IXLA 3M3QA 5DDJ2 4BYYA 4AQSA 4WM8C 1Z7S1 1IHMA 4MLOA 3URFA 4EV0A 2DVFA 3QCWA 4AI3A 1SACA 1SFNA 4QPYA 4Q4X3 4DQAA 1ULFA 5DDJ3 5K0UB 4OI2A 4TLFA 5FBZA 4AYUA 1RUOA 1AX2A 2XWBB 2PLV1 4QQ2A 1LHVA 1W2UA 2BPA2 1RJ8A 2XJQA 3DPRB 2D5FA 1N47A 3MIDA 4XFCA 4IEOA 5E1RA 4N53C 3VBRC 4R9CA 3VV1A 1H9PA 1ND3A 3KT4A 1C57A 3R0RA 4WM8A 2BQPA 4WVVA 4YVSC 2VW1A 3WP3A 4A7ZA 3DKWA 2RS51 4YG3A 1BCXA 4N7IA 2PAMA 5CFDC 2WFF2 4R9DA 3TRSB 3SH4A 1XNKA 3ZXJA 3MPPG 1PK6A 1FAYA 1FX5A 3MW4A 1IS4A 1QY4A 3RPQA 2GSYA 2A3XA 4I3GA 4B29A 2ZGOA 2WFF3 1VBA1 3CO2A 1N3OA 4XHXA 1S1AA 1OPOA 3LSEA 1RUC1 2K0GA 3VBFB 1FT9A 1HKDA 2ZMNA 1ENRA 1UZZA 3RYRA 1I6XA 3ZXAC 1LGNA 5A32B 4HVRA 2I74A 2NN8A 2A6WA 2O1QA 3WW3A 1MS0A 1ZRCA 5CFDA 4P9WA 1OOPA 5DZFA 5CB7A 5J3UA 4XF4A 3ZFFB 5T5LA 2CY6A 2RJKA 3GZUC 3A0KA 3M1HA 3RSJA 3T2TA 1JN2P 1V6KA 3WX5A 2H6BA 4NWVA 3USUA 4AHXA 1R092 3G7DA 3VZLA 2XVLA 1V00A 1MQTC 1CD3G 1FYUA 3J26N 3MFCA 3VBUB 2R073 2D6LX 4XQ4A 1LHUA 3I7DA 4XILA 4AQ6A 1SBEA 1IOAA 5DG1A 5K7PA 1KRIA 1AR92 1VRH1 2HWB2 4FPLA 3QD6A 5IUQA 1UU6A 1UIKA 1MS8A 1ENXA 4HKWA 4FPYA 2NMNA 1DGWA 4GMP0 3H7JA 1AR93 4IEPA 1HXS2 4B7KA 2ET1A 2HWB3 2XLGA 1JBCA 2VVFA 1GQGA 2DF7A 3J8F3 2ZGLA 4PDWB 2ZCWA 4RR3A 1CPMA 1REDA 1Y43B 5C4WB 1HQWA 3LOIA 2DU1A 2R1BA 1KS5A 5J09A 1O3TA 4UW5A 2EVXA 1LOCA 4FPCA 1S0JA 4RS5C 2WFF1 4W6YA 3BODA 3E5UA 4L92A 1YIPA 2NPIA 3LA3A 4LBOA 5FLJA 1QNYA 3LA7A 4BHPA 1QH7A 5JZGC 1S0IA 3PJQA 1KITA 1ULDA 1AX0A 1HIXA 4IV1A 4H14A 4IQPA 3WG2A 2I2SA 4GWMA 2JG8C 3J4UH 4K6BA 3N3HA 4ORFA 1UKGA 4D7TA 5ACA2 4HK9A 4Q4W2 3FC0A 5BNNA 3AZWA 4XFFA 4XIKA 1AR63 1FNYA 2R071 2IWGB 3AKTA 2R30A 2FZ1A 1VB2A 4GULA 5ACA3 1LENA 4Q4W3 2DFBA 1YRZA 3ZN6B 4A7KA 4YZ1A 2GNTA 4OFGA 2XG3A 3MPBA 2HKXA 4DS0A 1QHDA 2NMOA 3N7KA 3ZFGA 2WNUB 3TBDA 2VQ0A 4KG8A 1XU2A 4LEJA 2ZGUA 3MLJA 5JMCA 5EWSA 4LBQA 1AR91 2UYAA 4UW6A 1D2SA 1ZVFA 2HWB1 2XBO3 2QDNA 2CGOA 4NPRA 3KS7A 3WVJA 1PGSA 3J8F1 3RQ0A 1LHWA 1F31A 3N7MA 4MV2A 5A3MA 3OYWA 5F9TA 4Y5Z0 1SQ4A 4XYXA 2A6XA 4Y24A 4YGCA 4FTBA 1OKQA 3ENRA 3KT7A 4L8QA 1NE6A 1PO12 2PHTA 3WR0A 3W58A 1ZZCA 1LRHA 4WBBA 4ZU7A 5FOBB 5IT6A 2HEVF 4IESA 5L7OA 1OLQA 3CU7A 4AVVA 2R32A 4MXWA 4XF1A 1DIWA 1ND3B 1Q5OA 3BU7A 1PZ8A 4MUVA 1OI6A 4CDWC 3AJYA 2AYHA 1MZ6A 4M3CE 1PO13 3JU9A 3DV8A 3E5QA 4AVCA 4COZA 4DRRA 1RUH3 2MPFA 5H9PA 4C0BA 1WLTA 2GH2A 4MXVA 1A3KA 4KWJA 3UKNA 1H8TC 3AYAA 3FMGA 3ECQA 3NV3A 1OMIA 3U07A 1YFYA 4Z1VA 1LGBA 1AR61 1WUVA 2GNDA 1ND2A 5H9SA 1QJX1 4LBJA 2VULA 3UJOA 2ZS6B 2BEOA 1SLIA 5ACA1 1EP0A 4JGYA 3WOGA 1CESA 1AR72 4Q8KA 2TUNA 4HBNA 1OQDA 1ENQA 1S0GA 1PGW2 4WM7A 4WVWA 5AVPA 4DY3A 1J1TA 4GKXA 5CIRA 3RS6A 1WLWA 5I0SA 2H0BA 3E6DA 2PHUA 1G9AA 1GZ9A 4R8HA 1NE4A 3WDTA 2ZKLA 2W68A 1G6NA 3AXEA 1X50A 3USUB 1KFXL 2WS92 4Q26A 5DUUA 4DNYA 3V65A 1T6GC 2O0OA 4IEYA 2XBO1 2B45X 3JQWA 4OVEA 4DFSA 2D5HA 4RGAA 2ERFA 4H3WA 3JCIA 4PJYA 1DQ0A 2VPVA 2WS93 1YFUA 4IETA 4Q29A 2WLPA 4BM8A 1YO8A 1H1MA 1EPWA 3SCHA 5KXDA 1LHOA 3M8LA 4KWKA 2VQAA 4N90A 1XNCA 4G4FA 3OF1A 5AFEA 1FXZA 4COYA 3WCRA 4URTA 1G9FA 5CA6A 5KHHA 2AUYA 1VBB1 1WLCA 5GALA 4H55A 1EV12 1MEC2 3L2HA 1PO11 3NKGA 3GBFA 1U12A 1RUH1 4LULA 2XKOA 1S2KA 4AVAA 2VUAA 2BNNA 4CP2A 1LJ7A 4RR3B 4NR1A 2WT1A 3WQ7A 2JXAA 3GHNA 4HL0A 1DQ2A 3KZ4C 3ZDSA 4Y22A 1EV13 2D98A 3HWJA 2UY8A 3FX3A 2A6YA 4Y26A 3L2YA 1CONA 1AYN2 1YNAA 1LU1A 4FTSA 2WKKA 3ETQA 5I93A 4Q0VA 3SCGA 3VBHC 4QM9A 1V6IA 1OSGA 5D8AC 4AEDA 1H0BA 1RUNA 2WQ4A 1V9U3 3N35A 1DQ5A 2X5IB 4AGVA 1QQP1 3SMHA 1Q43A 1R082 3SCFA 1PVC3 2ZA9A 4IV1B 1AR82 1DF0A 1CVNA 2O8OA 3PLQA 4OULA 4CDUB 4FCAA 4MYEA 3CL1A 4F7ZA 3KCYA 3M70A 4A2UA 1FOD2 4XEZA 4XFAA 1N1YA 2BFUL 4KGQA 1R083 1GZWA 4CEYA 5BNNB 5D8AA 1DQ4A 1AXZA 1OD5A 3KGLA 3LSDA 1AF9A 3AZZA 2LTNA 3FLPA 4MGYE 3VDDB 1HRI2 1FOD3 1W6QA 4EN6B 2WT0A 3D0JA 3JD72 3DN7A 4DPNA 2ZHLA 2X8KA 4UW3A 5FLHA 3A4UA 3VBOC 3ZFGB 2Q0AA 3KD4A 1ZA4A 1HRI3 3EBRA 2C5DA 5FCCA 2Z79A 3AMQA 2XUMA 1WMFA 3VLBB 1B35B 3N4MA 4FO9A 4X8NA 1V6JA 4OUMA 2A5ZA 2DUOA 4YM0A 2JENA 4N43B 1MACA 5GJ6A 1FV2A 1OLRA 2K9ZA 3T1LA 3R4UA 3RYKA 5C8CC 3ZXLA 5I0RA 5JOZA 1ZRDA 3OYWB 5I8SA 2FZ2A 1RUI2 4JTNA 1XYOA 1HW5A 3VBOA 5H9QA 2EAAA 2GMMA 4Y1UA 4I0BA 3U4XA 4FPKA 1URXA 5L7OB 1JOJA 5BYNA 1V9U1 2VU9A 3W59A 2D93A 1H2MA 3GYDA 3ZX7A 4RA0A 4Q4V1 1PVC1 5C8CA 4XIOA 1LOAA 2IFWA 3OGGA 1PIV2 4IEZA 2EF6A 4OI0A 2VY0A 1NXD1 4W65A 2DUQA 5JSRA 1W6NA 1NQDA 4M0HA 1W0PA 1XE8A 1R081 1G9DA 2ZZQA 2R063 3AMHA 1I1EA 1ND2B 1PIV3 1QKQA 1KDKA 4RQPA 1JYCA 1IZ3A 4HZFA 4K9SA 3ZIWA 5E88A 4Z07A 1FOD1 4JGYB 2WNVA 1CN1A 1S2BA 2WSVA 2WFPA 1TNFA 4WM7B 2VOVA 4GB32 4CDQA 2D43A 1HRI1 2ETEA 2WNEA 3L9JT 2NP0A 3EO6A 4EN7B 2ZGQA 1NY71 1RJ7A 1JYIA 3BTAA 3CF6E 4AQTA 5DUVA 3EJKA 4AG4A 4GB33 5FO8B 1FV3A 4JDMA 1G9CA 5J37A 4XBNA 1F8VA 2WIIB 2BWCA 3H9AA 4I01A 2A73B 4WV8A 1CAWA 1W6MA 2OZ6A 3VKLA 3IMNA 1A78A 3WG3A 4XJ8A 1MR5A 3LGRA 3HT2A 1FI2A 3TN92 3RZZA 1QJU2 3JBG2 3SNMA 3LA2A 5KXEA 4FPEA 1MS9A 2LUWA 1XNBA 2XVKA 2WL1A 4O9EA 2PA7A 4DRVA 2WJSA 4JDNA 2Y0IA 4HK8A 3AP4A 3OBTA 4I09A 3DF0A 3JBG3 3RNSA 2PHLA 2R0HA 4XF3A 5KBFA 4PDWC 5HCBA 3J9SA 4Y22B 5GLWA 2NM1A 2WZR2 1LGCA 2ZGRA 5C4WC 2DV9A 4QPGC 2HWE2 2R061 4UBGA 2CGPA 1EYBA 4KH9A 4ZU5A 2W52A 1HDKA 3ZPYA 5JSPA 5KHKA 1H30A 3AJZA 2EXKA 4AEDB 2WZR3 4G9SB 4IEVA 2I45A 3WD5A 4FPOB 4HKLA 5CFCA 4E2QA 1X33A 4WZFA 1CJPA 4PQ9A 4QPGA 5EFUA 4YM3A 2R042 2VUJA 2XHKA 1OHFA 1LKNA 2CWSA 1NZCA 1TQ5A 2NLRA 4BQ1A 1RTVA 5JOYA 1EAH2 1UN1A 2QVSB 2OW4A 2R043 3N36A 5BNPC 1W6QB 1XNDA 4FOQA 1DQ6A 2B9UA 4X6QB 3AMPA 2EXHA 1YJLA 1VBD2 4FPFA 5FRAA 4GIQA 3SLIA 3IM0A 1UF2C 3I8TA 1LOGA 3M3IA 3O0VA 1SLBA 1REEA 1EAH3 2ZX1A 1BK1A 4N9IA 4XOGA 3ZSKA 1M06G 2RJLA 5T54A 5CNAA 3ST7A 1TMF2 1XYPA 4C91A 1C1FA 2Z2SB 3NO8A 2VH9A 2BNOA 2RS33 5J7MA 3UK9A 1MS3A 4S2HA 3S0MA 2GMEA 2R6QA 4CDXB 1Q8SA 1YHFA 2QE3A 1X82A 3JBG1 5CBLA 3MIFA 5T3NA 3MW3A 3OJBA 1SDWA 2G4IA 4A7YA 4I0AA 3ZFEA 3V0BB 5JOXA 3ES1A 1VR3A 4AFCA 4FPHA 3IDEA 4XF0A 3PVOA 3M2MA 1CPNA 4D7YA 1WD3A 1DGRA 1C8M2 2VW0A 2D7FA 1Q8QA 1POV0 1ZBA2 2WZR1 1A8DA 2CYFA 4YVWA 3RRDA 4JAAA 4UXAA 3JZVA 4C90A 4V1PA 1D2QA 3RDIA 4LA2A 3KCXA 4TSVA 1C8M3 3VHOA 1D0GA 1JW6A 5LK7B 4Q4Y2 1ZBA3 3FLRA 1RUF2 2PHWA 4FVVA 2VOKA 1UPIA 4AVSA 1W6NB 3NL1A 3WQ0A