3B00A

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8 in complex with cetyltrimethylammonium bromide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
251
structure length
251
Chain Sequence
EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Laminarinase
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 58
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3b00A00
3ZYRA 3NV2A 1QNWA 1SLCA 3ILNA 1V00A 2ZGSA 5L73A 5GJ6A 1G9CA 2ZBJA 4BMEA 4YG6A 2W52A 3O0WA 4Y22A 4FQZA 1UPSA 4K1YA 5DZEA 1JXNA 5EXOA 1Q8OA 1ENQA 3AP9A 4XXAA 2R1DA 1GYKA 1U0AA 5GLVA 2ZGRA 1LCLA 4Y24A 1W6NA 3WDXA 1W6PB 3OGGA 4UW3A 5T5JA 1KITA 2ZMNA 4ASMB 5GLTA 2DVFA 2JE9A 3SH5A 1AXKA 2VW2A 4K1ZA 4IQPA 1KRIA 1AX2A 1DFQA 2P3JA 5DG1A 1N1SA 2ZGPA 3WUCA 5CAZA 3RSJA 1SBEA 2WLQA 2DYCA 4LBQD 3WVJA 1MVQA 4YZ2A 4AGRA 1ENRA 4UW6A 4XTMA 1IKPA 1CPMA 1GKBA 2ZMKA 3N36A 1LOEA 3O12A 4PCRA 3TB0A 1AJOA 2CNAA 3WDTA 3IMNA 1JUIA 1H9WA 2P2KA 4OZXA 2ZABA 4RL7A 5KXEA 2EXIA 2ZGLA 1LU1A 1MS5A 1Y7BA 3M2MA 3B00A 3M3EA 4AVTA 1APNA 3AFKA 4R9CA 2EF6A 3WG2A 1RIRA 4M3CE 1DQ0A 3V64A 1PZ7A 5GZGA 4XIKA 5DUVA 2YROA 3AYCA 2ZGTA 2GDFA 1VALA 2G4IA 1AVBA 5IK5A 1JYIA 5GZDA 2ZGOA 1CESA 4YM1A 5LK5A 1LHNA 1VAVA 4LBOA 1MACA 2ZZJA 4Q27A 1B09A 4DPNA 5CNAA 1S0EA 3KQRA 3WDWA 5IUQA 1SLBA 3FLPA 4R9AA 3IN9A 2ZGKA 4Y1ZA 3SISA 1LHVA 1DQ6A 2OVUA 3IKWA 5IK8A 4GWMA 1CPNA 4YGEA 1GLHA 3RS6A 3WZ1A 1GZCA 3SH4A 2UWCA 1QGLA 3D4KA 4XBQA 1FNYA 2DVAA 2YZ4A 4LBQB 1Q56A 3ZXLA 3V0AB 1W6OB 5CA6A 2D44A 1D2SA 4RA0A 2AUYA 1IS5A 1QOTA 3RRDA 2DUPA 4YW1A 3ZSKA 3CNAA 3AJZA 3OJBA 4YW4A 1HKDA 1WD3A 2EAKA 2LALA 3AZYA 4Y20A 3USUB 1AJKA 1FATA 1NXD1 2A71A 1BXHA 4DQAA 2RHPA 2ZHNA 1WW6A 4BLJA 2DV9A 1ZA4A 2KM2A 1PZ8A 3AP4A 3OBRA 1WW5A 5F5QA 2PHFA 5JVVA 4LBJA 4PQ9A 4R9DA 2DVGA 1V6LA 3NV1A 3O5SA 4YG0A 4D69A 1SFYA 1WCSA 2XB6C 3INAA 1Q8VA 2A3WA 3AX4A 4YW2A 3UL2A 4WZFA 3W58A 1TEIA 4YZ4A 2VUAA 4GA9A 1S0DA 3ZVXA 2JDZA 2H0BA 1LJ7A 2E7TA 3M3QA 3PMEA 4FPFA 3AK0A 1LECA 2GN3A 1HDKA 2VY0A 1GZ9A 3OPZA 4K21A 1N47A 4Y1UA 2YY1A 1GBGA 2FHRA 1S1AA 1XQNA 2DU1A 4XBLA 3AXEA 2DTWA 2GMPA 2DURA 3V0BA 3MPPG 3VKOA 1LULA 2A3XA 1A78A 2EALA 2A6ZA 4M3CB 3UJOA 5JOWA 1S0IA 2A6YA 2P37A 3ZYPA 2DU0A 1LENA 1JW6A 4CZSA 3QLQA 3WDUA 4P14A 3MEPA 1URXA 2D3SA 4K20A 3T1LA 2JECA 3AJYA 4XIOA 1YXWA 3IPVA 3WOGA 3FLRA 1N1VA 2YXSA 1IS6A 1LOGA 1FNZA 3Q9OA 4ATEA 3N7KA 2DUQA 4JRAA 3RMXA 2GNDA 1G7YA 2B7YA 3N3HA 1OQ1A 1W6QB 3BOPA 1NLSA 4LBKA 4XJ8A 3AP6A 1DIWA 4XJZA 4FOVA 3RG0A 5GALA 1F31A 1GNZA 3ZXJA 1ONAA 2DVBA 3SNMA 5JOYA 1FX5A 2TEPA 4Q8LA 5E88A 1W0PA 4XHBA 1V6MA 4FQ4A 2NZ9A 1OKQA 1CN1A 4XYXA 5T5PA 5JOXA 1LHOA 3WG4A 3B01A 1LOFA 3N35A 4BLIA 1S0FA 3WG3A 1GZWB 2CYFA 4FPGA 4WVWA 2EXKA 2A75A 1DGLA 2D43A 1ULDA 3L2YA 3M3CA 1LEDA 2VW0A 1OFSA 1DHKB 4M3CA 1LODA 1MS9A 1QOOA 1YI7A 3VKFC 1DZQA 2ERFA 1O4ZA 2W68A 1JBCA 3HR9A 2AREA 4GALA 1AZDA 1LHWA 3FUQA 3A4UA 4GWNA 4P9YA 1LOCA 1RITA 3N7MA 4XZPA 2PELA 4UW4A 4AWDA 4XILA 5DZGA 3RMYA 3OY8B 2DUOA 2YMZA 1SACA 3GNEA 4PBOA 1H30A 2AH2A 4XJWA 3OYWB 3PVEA 1F5FA 1QMJA 5DUWA 4PF5A 1Q8PA 2WNEA 3WNXA 4AVVA 1Z0HA 3NV4A 2AENA 4AGGA 5JMCA 3WDVA 3SITA 2R1BA 3AYAA 1V6JA 1DQ5A 2HYKA 4XMIA 1C4RA 1JHNA 2R49A 4FPYA 4TYSA 4YGCA 2SLIA 4KBBA 1W6PA 3VKMA 1DLLA 2W08A 4XOGA 5JOZA 1J1TA 1KDMA 3AP7A 4Y1YA 1HLCA 5GZEA 2AR6A 2JD4A 3POYA 3W59A 1N3PA 3SLIA 5FREA 4XJUA 5H9PA 4F83A 5GLWA 1LEMA 1O4YA 1DQ4A 1Q8SA 3IM0A 3R4SA 2NP0A 1WW4A 1QNYA 3AYDA 2UURA 1I1EA 4XTPA 3QCWA 2BQPA 2D3PA 5H9SA 3B69A 2XG3A 4Q8KA 1G86A 2GALA 5CBLA 3APBA 5DXDA 2PHXA 1UN1A 2OUJA 4JC1A 1G9FA 1N3QA 1MZ6A 2CL2A 2NMOA 1C57A 1VAMA 4JCKA 4MYEA 5IK7A 4FOQA 2ZGQA 1WLCA 2WT2A 5GZFA 1Z78A 4GKXA 4P9XA 3ZSLA 1GANA 2E6VA 1MS0A 1W6MB 3AYEA 2P34A 1DYKA 1JN2P 1VLNA 1GNHA 2GNBA 3I8TA 4Y1XA 4YM3A 5KXDA 5KXCA 3A0KA 3POWA 4L8QA 5BYNA 2GNMA 3OBTA 4FPHA 4ISQA 2VW1A 3I4IA 4FPJA 3R05A 2P3KA 1AXZA 3FLTA 3ZXKA 1G9BA 3M3OA 2VXRA 2Z42A 4XJ9A 1S0GA 4CRQA 4CTEA 1QDCA 3N7LA 2VH9A 5DG2A 3JU9A 3ZXFA 1V6KA 4XXPA 1ULEA 1MR5A 1N1TA 4YFWA 3ZXEA 4YW3A 2CWSA 5H9QA 2E53A 4YG3A 2D6OX 1WBFA 4LBQA 2WQZC 3V0AA 1W6OA 1A8DA 2Q5TA 1UZZA 1GV9A 5GZCA 4H55A 2R0HA 4YGDA 2ARXA 5T5LA 4BM8A 3WHUA 3USUA 2ZHMA 1UL9A 2ZGMA 4DS0A 5EYXA 5HCBA 2PHUA 3VKNA 2ZGUA 5T55A 5DZFA 2GMEA 2ARBA 2OUHA 3LSDA 4U2AA 2EIGA 4AGVA 4FP3A 4Y22B 5IK4A 1FV3A 2CWMA 1KJLA 1LGNA 2JE7A 1YYNA 2NM1A 2AGSA 1FYUA 3BIWE 3ENRA 2A6VA 4HL0A 4PBPA 3ZSMA 2A5ZA 4DFSA 4YZ5A 4FOYA 3ZSJA 1W6NB 5IT6A 4AVSA 5T52A 1KQRA 3WG1A 4NOTA 2WSVA 4XHXA 4R9BA 4AYUA 1C1FA 3KM5A 3ATGA 3RQ0A 1QDOA 2R0FA 4LBMA 5EWSA 3HMYA 4ATFA 4NO4A 1MZ5A 3HN1A 1MS1A 4I30A 2ZACA 3R4UA 1BQPA 1UKGA 4XBNA 4Q2FA 4FPLA 1MS8A 3D5OA 3VKLA 1WBLA 2WT0A 1KJRA 2EXJA 2EXHA 2A70A 2ZKNA 1ULCA 1AX1A 4UW5A 1AXYA 3BODA 4BQ1A 1R1ZA 2LTNA 3WV6A 3UJQA 3ASIA 1CJPA 4YZ1A 4FP2A 4YM2A 1RINA 4ZKTB 3GALA 1SBDA 5DUUA 1IKQA 1N1YA 1W0OA 2AYHA 4TZDA 3LSEA 4WV8A 4FPEA 2DVDA 4DRRA 4P9WA 2DTYA 4WVVA 1X50A 3LCPA 1WW7A 2I2SA 5HCAA 3VUOA 4XDQA 1LHUA 1DQ1A 5HCFA 4FOWA 4Q1RA 1QOSA 2P3IA 4Y26A 1MS3A 1PZ9A 5GLZA 1W6QA 3N7JA 2WKKA 3AZXA 1ZM1A 4YW5A 3WDYA 3MW3A 1I3HA 4BPZA 1SLAA 2PHWA 3ILFA 2NN8A 5E8AA 4BMBA 1SBFA 2PHRA 1LOBA 2ZAAA 3B9CA 2CY6A 3WLUA 5GM0A 1CR7A 1GZWA 2UWAA 3AZZA 2WJSA 1EPWA 3POSA 1BJQA 4XMAA 2A3YA 2YV8A 4Y20B 1LU2A 2GNTA 1BZWA 2WSUA 2JJ6A 5AVAA 3T2TA 5E89A 3WCSA 3ZPYA 1UAIA 1H9PA 5GLUA 1N3OA 3AP5A 1VIWB 2V5YA 1ULGA 3OY8A 4U36A 4C1WA 1D0HA 3FFZA 1SCSA 2DWRA 2FMDA 2GMMA 3MW4A 3OYWA 5T54A 1CONA 4ISRA 4SLIA 4YM0A 1G9AA 3O0VA 1SLTA 5CB7A 1WUVA 4FPKA 1MVEA 2NYYA 1WLDA 4FPOB 1QU0A 2ES3A 2D6NA 1DBNA 2VU9A 5H9RA 2A7AA 1QF3A 3VV1A 1YRZA 2UU8A 3FBYA 1BYHA 1S0CA 4Z8BA 1HQLA 2E51A 5F9TA 1LGBA 2E7QA 4GXLA 1IOAA 2SBAA 5JLVA 3U4XA 2WT1A 1S0JA 3TAYA 3MW2A 3PVOA 4M00A 1JYCA 2W39A 1G9DA 1LOFC 2JKBA 1GICA 3WUDA 2CTVA 1JOJA 3DUIA 5EYYA 3V0BB 3M1HA 3BTAA 1LOAA 1UMZA 4C1XA 2D6PA 1MS4A 3A0NA 3H0OA 4XJAA 4W65A 3NWKA 1C1LA 1SCRA 1A3KA 2V73A 1V6IA 1IS3A 3D6EA 1IS4A 1UX6A 3NV3A 3PVNA 3IPVB 1HQWA 1S0BA 5T50A 1F9KA 4ITCA 3V65A 2D6LX 4M01A 4LBLA 3SH3A 4XE9A 3WCRA 4ZXKA 2R16A 1CVNA 1G8WA 1W6MA 2GN7A 1V6OA 3FUOA 1LGCA 1AF9A 2UWBA 4HANA 5FRAA 1SLIA 2ZMLA 2PHTA 1YIFA 3WHTA 4M3CF 1DQ2A 1ULFA 2D3RA 1WD4A 2D6KA 4YGBA 2OW4A 5T5OA 1LTEA 3AZWA 2ZHLA 2C5DA 1LESA 1ENSA 3B3QE 1KDKA 1WLWA 1QKQA 1SLLA 4Q1PA 5SV8A 5DUXA 3JUUA 3UK9A 4YZ3A 3DGTA 1GSLA 1UZYA 4FPCA 3AZVA 2ZGNA 4FVVA 3O0XA 5JDBA 4GKYA 4YFZA 3AXDA 3ILRA 2ZHKA 1V6NA 3PJQA 1FAYA 2D7FA 3C2UA 4YLZA 1FV2A 4LBNA 1YO8A 4DRVA 2ENRA 4Q26A 2ZA9A 4Y1VA 1DYPA 2C9AA 2A6WA 1BKZA 1AX0A 3T1MA 4BOWA 5KXBA 2NMNA 1CIWA 1Q8QA 2D6MA 1CQ9A 2A6XA
chains in the Genus database with same CATH superfamily
3VGIA 4XZUG 1W9YA 2WO3A 4QU2A 5JMOA 3C7GA 2ZGSA 5CFDB 4JDOA 3E6DA 4HSLA 4OULA 5FY7A 4AHWA 4FQZA 4K1YA 5DZEA 1NY72 5LRSA 3AP9A 4XXAA 1V70A 4QMAA 1RUH3 5GLVA 4QQ2A 4UBHA 3WDXA 4CEWB 4QHZA 3LD8A 1KITA 2ZMNA 1W06A 4QGNA 2J1UA 5JI7A 4DMIA 1YJLA 3PMSA 4MX3A 1POV0 5KC5A 4CUBA 5FZAA 1DFQA 1O8PA 2P3JA 1AL0G 3DKWA 3N9NA 1MQTA 4RS5A 3RSJA 1WA6X 1SPPB 4R8HA 4I2OA 1UU6A 1MVQA 3HT2A 4QX1A 3M4FA 4Y33A 4NHYA 5ACA1 1ENRA 2RR13 1W2UA 2GC3A 3TEXA 4BIOA 3FN9A 4Y5Z0 4LKFA 3SCHA 1Y9MA 3TB0A 2EA7A 1CPMA 1H6YA 1W05A 4UT5A 5FZKA 1AL23 1AUYA 2XXZA 3VBFB 1PM4A 3GJAA 3LZZA 3VDAA 5FZIA 1GQHA 3UETA 3GZTB 4B4QA 4RL7A 2EXIA 2ILMA 4OHXA 1QIQA 4IV3A 4PDWA 3TN91 1RMU2 3CJIB 3B00A 1GP6A 4OLLA 4CCLA 5FK8A 2BJSA 3SC7X 4CDWB 1RIRA 2HWC3 2R32A 3V64A 1PZ7A 4LOSA 5KBFA 5DUVA 4N43C 2RS33 4Z2WA 2ARAA 1AVBA 1V0AA 3KV9A 4N90A 4MZUA 2VR4A 3T2QA 1JYIA 1D4M2 4Q27A 4LXLA 1B09A 3T3YA 3MUY1 4BE3A 5JPMB 4AI2A 1JUHA 4OHWA 1W2AX 2RMU1 3FLPA 4R9AA 3VHOA 2P17A 4Y1ZA 1Y43B 1JYTA 4FTEA 2OVUA 1VR3A 2OZ6A 3SEPA 1W3XA 3RS6A 3NAPA 1GZCA 2VOTA 1HXS3 4LJHA 2VQ0A 3D4KA 1RUH2 4IV1C 3POGA 4XBQA 3UV9A 3ZOIA 3ZXLA 4LBQB 2ZZQA 4JHTA 3V0AB 5J37A 2D44A 3Q8BA 2F4PA 3WW3A 4I0AA 1U5IA 1H2KA 2ZEWA 4Y20A 1WD3A 1R1A1 4ATEA 4AVBA 4DY5A 4FTSA 3GBGA 4XFGA 2NPIA 2ZXQA 3K46A 3VZNA 2BFUS 1GR3A 4HKLA 4DQAA 5BNOB 5I0SA 2X29A 2DCYA 4FT8A 3DPRB 4TLFA 2WS93 3SEEA 2CAUA 4CDXB 2RR12 2IXIA 3LWCA 4OZOA 5DAVA 5JZGA 3MIHA 4A3XA 4D6RA 3WW2A 1AL22 4PQ9A 4R9DA 2DVGA 4YG0A 1X8MA 3KT4A 3LFIA 3O5SA 5F39A 5FAXA 3TNPB 3JCIA 4CCJA 1Q8VA 1V9U3 3AX4A 4JKMA 4XPVA 5EJ1B 4YW2A 2K0GA 1TEIA 5FCCA 1BMV2 5C7GA 2VUAA 1S55A 3AKSA 3T2PA 3ZVXA 4ZU4A 2O0OA 4QM9A 2VTXJ 3PMEA 3D8CA 5KHKA 4V2VA 3P1IA 5LZ6A 4S2HA 3AK0A 4LE3A 3AVSA 2CSGA 1LECA 2HWC2 2GN3A 2R041 2KR2A 4K21A 1N47A 4JKKA 2RS32 3HWJA 3P3PA 3HJRA 3RZZA 1XQNA 1ZRIA 2E7AA 2GZWA 4XBLA 4CDQB 1JU3A 2GMPA 3V0BA 1H2LA 5A33B 3VKOA 1LULA 1A78A 3OEAA 4XQDA 1UU4A 3KV4A 3VBRC 3PUHA 3O1RA 3X29B 5FUIA 3ZYPA 1KGYA 2X8KA 3Q8EA 5L9VA 3PURA 2QTWB 4GWIA 1NQJA 3MEPA 1URXA 2D3SA 1PK6A 4CCNA 5C9AB 1JZ3A 2VAUA 4HSJA 5LBBA 1VE0A 1YXWA 2QE3A 2BGOA 1Q3EA 2FDGA 1HXS2 2CGPA 1DU3D 4BK4A 3N7KA 5IFTA 2W1SA 4ONUA 1ZVFA 2B7YA 2JEMA 3G6JB 2BOJA 4IW3A 3ZYJB 1EUTA 4OI0A 5B2GB 3O1PA 4XJZA 4A42A 3L9JT 1F31A 2V72A 2P5BA 3OD0A 4YVWA 5JSPA 3W5NA 4J25A 4Q8LA 3JBG1 4XHBA 4A7KA 5KHGA 2WS92 4NHMA 5L7OB 3I49A 1CN1A 4Q4Y3 2HJIA 4WM7B 4KWLA 3WG4A 3B01A 1LOFA 4OI1A 1GZWB 4FPGA 4XW3A 2Y6LA 1AR71 1F5JA 1ULDA 4AEDA 3HQXA 1LODA 2MNGA 1YI7A 2WAOA 1NCRC 4UOJA 3IDAA 4YVSB 2RM23 1V9U2 2W91A 3K3OA 4NRQA 5C8WA 1RYYA 1P8JA 4AK3A 1DZTA 3FUQA 3A4UA 3HIFA 4P9YA 1LOCA 2JKXA 3N7MA 3HQUA 4J6GA 5G05L 4AWDA 4XILA 1SMVA 2WFPA 3GNEA 5FZOB 2UY8A 4GH4B 4C0HA 3T09A 2QBXA 4DRRA 3MDPA 3PVEA 4DZGA 1RL3A 1QMJA 4Y5TA 3RWKX 2VCMA 5DUWA 4P02B 1Q8PA 1O6UA 2WNEA 1LAJA 1Z0HA 1UMHA 4H7LA 5IVCA 2JDYA 5EV7A 3ACGA 2R1BA 1V6JA 1PIV1 1UOGA 2HYKA 5F2WA 3MZHA 2FCUA 1EYBA 4XCAA 4LMFA 1WMDA 1HN0A 4KBBA 5C8CA 2VCAA 5JOZA 3NQHA 3ZFEC 1RB8G 4Y1YA 1E5RA 3ZN6A 1HLCA 2XH6A 4HETA 1BVVA 1VBC1 4QKNA 5GZEA 5A7QA 5ABJA 3SLIA 4CSWA 3N4MA 4IE7A 1AR61 1K5MB 4A6OA 4MXWB 3OBZA 1NCQB 2WN3A 1DG6A 4IXLA 4F83A 2QVSB 3IM0A 2BNNA 3AYDA 2LS6A 4HK9A 5FZDA 3VZLA 2IWGB 5A6QA 1I1EA 1PVXA 2J1RA 3QCWA 1W28A 4K9SA 5HPOA 2QQNA 2Y0IA 1VBD3 2VOVA 5CBLA 1UZWA 5FY1A 4ORFA 1COV3 1T6BX 4QXCA 1G9FA 1N3QA 2CL2A 4KQ7A 3WP3A 5FZ0A 5LA1A 4RQPB 4JQTA 2Y60A 4Q4Y2 1YQ2A 5BNNA 5A32A 2ZGQA 1WLCA 4AFDA 4COWA 3B93A 4FFIA 4GD4A 2WN2A 2VZTA 5F6LB 1JH5A 3ZSLA 1Y9GA 2B45X 4AAPA 2E6VA 1KFUL 1MS0A 5A6XA 4EZHA 4XFBA 1YQ6A 1JN2P 1VLNA 1RXFA 2LUWA 2RM22 2WFF3 3DYPA 4DIQA 4O7XA 3I8TA 4Y1XA 4DXTA 4PQQA 1QJZA 1RUOA 3LDBA 1VB4A 1BK0A 3GGLA 3MLKA 2YYOA 3NKTA 3OEBA 1OC1A 4R52A 4RS5C 2VNVA 1MQTC 2VUJA 3FMGA 1PNGA 3VZKA 3ZXFA 4B1LA 3VD5A 4XXPA 3RZHA 3TEZA 1QQP1 1U5ZA 2HKXA 4YW3A 5DAWA 2VVDA 5H9QA 5F1RA 2B5HA 2D6OX 4AFMA 3CZUA 1LNSA 2QDRA 1EUUA 2WQZC 3AMQA 1W6OA 2NQYA 2GC0A 4QDSA 3V56A 3W5MA 4AFAA 5GZCA 1TME3 2VMGA 1OPMA 3ETQA 3WHUA 2BVBA 2VCCA 1UL9A 2BERA 4FBFA 5F8PA 4LEJA 4E4ZA 2BPA2 5FO7B 1XNAA 4DUWA 2ZGUA 2X5IA 2XONA 2PQQA 1BBT3 1J83A 3H3ZA 2X05A 3TYJA 1RUC1 2VMDA 3WNOA 1KJLA 3N9LA 1KXGA 1YYNA 4N53C 4PBPA 2A6VA 2AACA 4YZ5A 2K46A 1VBD2 3B9IA 1W6NB 3GCXA 4QXBA 2Q8OA 4AVSA 5LY1A 3ES4A 1COV2 1KQRA 2XQXA 3WG1A 2Y26A 4NOTA 3LIHA 4K8RB 2Q30A 5I0RA 2HWE1 5EWSA 1BEV3 3JB8A 2BW8A 4MH0E 1MZ5A 1F8VA 4YW6A 5LA0A 3E5UA 1ZZ8A 4BQWA 1ULOA 4COVA 2RS52 2ZEZA 4V2WA 1H6XA 1QJY3 1OMIA 2WFF2 4URAA 3NAPC 3UGGA 2WO7A 5E6HA 5IW0A 4Q4V1 3C7EA 3HQRA 2UYBA 5K0UA 4CP1A 2EXJA 4IERA 2EXHA 4AI9A 4LNVA 3OPTA 3WNLA 3CLPA 1XNCA 2FDHA 3BODA 3T0AA 1K3IA 2LTNA 3POJA 3UJQA 1GU3A 2HWC1 2K2SA 4ZKTB 3FZ3A 3BUCA 1W0OA 1F2NA 5FYUA 3QH6A 3LSEA 5FQ0A 4FPEA 5ANQA 2DVDA 3NNGA 1HB1A 1W2NA 5HCAA 1GFF2 5JPNB 3CZJA 1O4TA 3BVCA 4XDQA 4J1XA 1XNTA 2ZX3A 5JZGC 4E8DA 3FJSA 5CFCA 1OLME 1ZRRA 2XKPA 3WF4A 1MS3A 4XF3A 5LASA 1PO23 1HJFA 1TME2 3W9AA 1J59A 2WKKA 2WNVA 1L3JA 4ZU5A 2W0XA 3AB0A 1US3A 3WDYA 4LOTA 4EE2A 1SLAA 2PHWA 1G6NA 3SKVA 1L7QA 1BBT2 1SDDB 2NN8A 5E8AA 2JG9C 4E4DX 2PHRA 3RI9A 3IT8A 5FXVA 5IVBA 1LOBA 3I7DA 4UYBA 1CR7A 1NE4A 3U78A 3RZGA 3I2GA 3VBOA 2UWAA 2VUDA 3VBHB 4TWTA 3CHXA 4AR2A 3POSA 2VNRA 1BJQA 3PJYA 4JHZA 1IGOA 1RJ8A 5BY5A 2L9LA 4G4FA 3AMHA 1BZWA 2WSUA 1YQCA 1BEV2 2EIDA 5C4WA 1H1AA 3OOXA 1H9PA 2BTVC 2J1TA 2ZAHA 4META 3GZEA 1HB4A 3LPFA 2XLFA 3OGSA 1YQ8A 4K6BA 1WLTA 1PK6C 2GMMA 4BIFA 4EROA 1QJY2 2ZCWA 3MICA 3KGLA 3U10A 4IGOA 4NIIA 3ZFGC 1WUVA 3T4HB 1I6XA 2XWJB 4FPKA 1XU1A 2VUCA 5JIAA 1ACCA 4DB5A 2W3JA 3DXTA 4HZFA 3DEMA 5FLHA 4A41A 1YRZA 2DCTA 2HEWF 3ZDSA 5I8YA 2Q1MA 2XR4A 4QM8A 2E51A 5FLJA 4COZA 1LGBA 3PLQA 2XLGA 1U5XA 3LDKA 4TN7A 1VBA3 5A7WB 5BUVA 4QT6A 3I2OA 3TAYA 1JODA 2W39A 3K75B 1LOFC 3VBUB 1SDWA 3SMHA 2JKBA 2VOXA 2CTVA 2D97A 4W6YA 5EYYA 2FZ1A 4NROA 3HD8B 3M1HA 1PO22 4N7UA 4PHZA 2BUKA 3ALQA 4LUKA 2J42A 3A0NA 2W1QA 4XJAA 4F3JA 1SG3A 3NWKA 4JAAA 1NLRA 4E8CA 3EYPA 1TNRA 1SCRA 2DF7A 1A3KA 1EV12 1ND3B 3H1YA 2OYZA 2P1BA 3NV3A 3PVNA 1YFYA 3VL8A 1JZ6A 2PA7A 4ITCA 2D6LX 4Q4X3 4FO9A 4QX0A 4AFCA 1FPN1 4MGIE 1OD3A 2R16A 5AC91 1CVNA 1G8WA 1W6MA 4AVAA 2MEV3 4XF0A 3VBSB 5FRAA 4GMP1 2XDVA 4QHOA 5FV3A 4JGYB 3M3IA 4M3CF 2QUOA 4N43A 2Z69A 4UBGA 1I5ZA 1UY1A 1WD4A 2DFBA 2OW4A 4YGBA 1LTEA 5T5OA 2ZHLA 2C5DA 4XAEA 1CAWB 2QQWA 1LESA 2B9UA 3S5AA 3B3QE 1WLWA 1RHI3 1QKQA 4Q1PA 5DUXA 3JUUA 4BB3A 4WZCA 2OX0A 2LROA 3DGTA 4XABA 3LPGA 4O9EA 4A4AA 1W9SA 3LOBA 2F17A 3O0XA 5JDBA 1HRI1 1TG7A 2JB8A 1W04A 3AXDA 1NZIA 2Z4FA 5FZCA 1UW8A 1AR91 4CXWA 1PGW2 2JICA 4YSFA 2A73B 4IEPA 5J09A 1W9WA 1RUI1 2OPKA 5FZ3A 3THCA 3EB7A 4IV1A 1OQDA 3FHAA 4Y1VA 1DYPA 1CAXB 4P5HA 5A80A 1BKZA 4PF1A 4BOWA 1VBA2 4CP9A 3MIEA 3WD5A 2A6XA 4A2UA 5BV6A 1QNWA 5JI9A 1MEC1 5L73A 4COYA 3EO6A 2ZBJA 5KC6A 4BMEA 5IJRA 4YG6A 4XTMA 1UMIA 1ENQA 2BFUL 2MHFA 2WAAA 1UNBA 2ET7A 2ZGRA 4Y24A 1W8ZA 3I3DA 3I97A 2NLRA 4ASMB 4FFHA 4EWAA 2WA3A 4AVCA 3HEIA 2OS2A 1PVC3 2BZDA 3IZOA 1OKOA 2JG8B 1H8TC 4TTGA 4Q4X2 4FAHA 1KRIA 1AX2A 2QQKA 3ZXAC 2XBO3 3WUCA 1SBEA 2DYCA 4QXHA 2O14A 4UI9L 3WVJA 4O65A 1AR81 2JDUA 2WYSA 2MEV2 2OQ7A 4HN1A 1FI2A 1XE0A 4W6WA 4P08A 1H0BA 3CBNA 2VCBA 3NMBA 4LKSA 4X6RB 1IKPA 2RE9A 4WM8B 4OHYA 2JD9A 2WWUA 4JZRA 2ORZA 4XUPA 4UFIA 3J7HA 5F37A 4JGZC 5CKQA 4N9IA 3ZX7A 5LEJA 3B5LB 5A6ZA 1RHI2 1Y7BA 2LW8A 3M2MA 3VBRA 1XNBA 1OA3A 5EJZB 3PU8A 4HPKB 4R9CA 2EF6A 3A23A 3ZYBA 4C8DA 4M3CE 4RSUA 1DQ0A 4AI0A 4XIKA 5FLIA 4NE9A 4PI2A 3AYCA 2GDFA 1VALA 3PTRB 5FJKA 2YHJA 5FPZA 2ZGOA 1OURA 1GWKA 1DZRA 1OBNA 5DAXA 2YU1A 2ZZJA 3KD4A 1LKNA 4ZHNA 3GF6A 5CNAA 1YQ5A 3KQRA 3WDWA 5C3SA 3SISA 1PGL2 1LHVA 5LBCA 4GWMA 2JIGA 5DQ0A 3KZ4C 1BCXA 3VDDB 3BTXA 3KLSA 2P4EA 3SH4A 4DXRA 3RPQA 5BNNB 1NX9A 1FNYA 2DVAA 2YZ4A 1Q56A 5FPLA 5FZ8A 3JB4C 5SV5A 4PI0A 5B4XA 2ATFA 2AUYA 1IS5A 1R083 2ZS6B 3O7OA 3CNAA 4YW4A 2EAKA 1PVC2 1C3HA 3AZYA 2HEYF 3NVCA 1UO9A 2A71A 4YW7A 3HBZA 2XBO2 3ITQA 4B29A 2YC4A 2DV9A 2X10A 5FR3A 3BCWA 1EAH1 1MZEA 1QXPA 1QHDA 2WZ8A 2VBDA 4RR3B 3RZMA 2R30A 2ZX0A 4CEYB 1Y9QA 5F5QA 3U0ZA 2QQVA 4LO5B 4CE8A 2QZ3A 4UFLA 1V6LA 2UY9A 3DYMA 5DDJ3 1BEV1 4X6QB 2ID4A 1WCSA 2XB6C 4L0PA 3UL2A 4WZFA 1VPHA 2E7TA 2EVXA 3M3QA 4XETA 4D3WA 1HQNA 4BJ0A 4NIGA 4IUGA 4N7IA 2VY0A 5FKCA 1W0NA 3OPZA 3ZR6A 1GBGA 4Y4RA 2JE8A 3VBOC 1PMHX 1ZBE1 3FC0A 2DU1A 4NAMA 3WP4A 3AXEA 2DURA 4OI4A 4M3CB 4FXGB 2EALA 2A6ZA 3NKGA 3I2KA 1ZRDA 1ZZ9A 1W8HA 1S0IA 2P37A 3DF0A 2DU0A 3OBAA 5C4WC 2FMYA 1CWPA 3RWNA 1VBE3 3ZMOA 1L7RA 4UF0B 3ST7A 3UKVA 3QLQA 1T6GC 2JECA 2R071 2JDPA 3IPVA 3WOGA 1IS6A 1FNZA 3LQCA 3Q9OA 2IXJA 2BNOA 1CAVB 2Y64A 3HNBM 4IE4A 2JIJA 4PJYA 3RMXA 3WY6A 3J7MA 5APAA 1WCDJ 5CG8A 1G7YA 1R082 1UU5A 1OQ1A 3BPSA 1NA1B 3WQBA 4QPYA 3AP6A 3LFMA 3H7YA 1OA2A 2Q8CA 3NNFA 4FOVA 4FSJA 1WMXA 1REEA 3DKQA 2JDMA 4AOCA 3SNMA 1ND2C 3IBMA 5JOYA 1FX5A 2UYAA 3Q8AA 2WUHA 2RJ2A 2NZ9A 1OKQA 5T5PA 5T3NA 1ZYBA 1RVF1 2QQOA 3KHCA 1S0FA 3MHZA 5BNPB 1UKRA 2EXKA 2A75A 4AG4A 1VMJA 1LB2A 3M3CA 4NJ4A 1DHKB 1PO12 1MS9A 1VJ2A 5DDJ2 2BYVE 4GB33 1DZQA 4LPLA 1O4ZA 2YG0A 3IMMA 1JBCA 4AFBA 3HR9A 2AREA 4GALA 4XQ4A 3UGHA 4XUTA 4NPRA 4UW4A 2J22A 1CD3G 5DZGA 3OY8B 2DUOA 5FY8A 4PBOA 3A21A 3P5BA 4DXSA 3NO8A 4AEKA 1F5FA 2IUWA 1S2BA 3OGVA 2J7MA 3Q8CA 2XVLA 4PF5A 4AHZA 3NJXA 3NV4A 4AGGA 4B4PA 4CXXA 3WQ0A 2BVVA 3WDVA 4D7TA 3MV01 4XMIA 2C24A 1LR5A 4TYSA 3I3QA 4LITA 1ODMA 4N53A 2SLIA 4YGCA 1O3QA 1OUSA 1VBE2 1W6PA 5FYZA 3VKMA 1POV1 4NIHA 4AHYA 1KDMA 1UZ0A 3AP7A 3CL1A 4FTBA 2OT7A 1DGWA 4NIAA 1J58A 2H6CA 1N3PA 3W59A 1C28A 5FREA 1WKYA 4XJUA 1A8MA 2RS13 5FPVA 1OA4A 5I0TA 1O4YA 3SCFA 1JYXA 3R4SA 2R6QA 4LR4A 3MF6A 1QWRA 2VECA 2VNGA 2YFUA 2E31A 4EYUA 1UIJA 5FZBA 2D3PA 1WCUA 2XG3A 3H1MA 2GALA 2ZEXA 3KWVA 3NNJA 3O1UA 3D0SA 4Q4X1 4A44A 4EN8B 5FP4A 3MI8A 4N9HA 1C57A 5LBFA 5IK7A 1RUJ3 4FOQA 2QQJA 2XKOA 4CU7A 5CYYA 5GZFA 1Z78A 2Q8DA 5LRRA 4GKXA 4P9XA 2FDIA 2Y6JA 1GANA 3EMRA 4S2GA 4WVMA 1QJX1 4DNYA 3JZVA 2WZPP 3J7NA 2ZPXA 4GB32 4IEXA 4K8FA 3VHPA 1ZZ7A 5FO9B 4AE2A 1ZZ6A 4R4XA 1GQPA 5KXDA 3A0KA 5A1LA 4D7SA 4QPGB 4QX8A 1RHI1 2VBPA 2GNMA 1BHGA 3ZFEB 4TXWA 3I4IA 5CVRA 5FMBA 2PAKA 1J1LA 3FLTA 2E32A 1UOBA 2VZVA 2AEZA 1RUF3 3AMPA 1HB2A 4NVPA 1W8WA 4CRQA 2HWF3 4CCOA 4HVOA 2ZKLA 1QDCA 3N7LA 2VH9A 2WNOA 1TMF3 3BALA 3JU9A 4AXOA 1XYPA 1XC6A 2FDJA 2P6CA 2WZR1 1ULEA 1UX7A 5EHDA 4YFWA 4NIDA 2JG9A 4PLOA 2VL4A 3IB3A 4YG3A 2HBUA 3UGFA 3VZOA 4MGTA 3POFA 1RUE3 4CP0A 2VPVA 1OOPA 5FZEA 3KSCA 1KEXA 1NXMA 1UZZA 2DBIA 5A3WA 2BEOA 5T5LA 4E2GA 2VG9A 3USUA 3RYRA 4DO0A 2PMWB 3R6SA 2PAEA 3AKRA 1LRHA 1ZBA1 2RS12 2EAAA 2ZX4A 5DZFA 5K4LA 1ZREA 2GMEA 4AQ2A 1QY4A 1XBFA 2VE1A 2EIGA 3LSDA 3WF3A 4UFMA 3BIEA 1IHMA 1AYN1 4ZONA 5F5IA 1HIXA 2D93A 3F2ZA 5IK4A 5JXHA 1O3RA 1D0GA 3BIWE 4P00B 3BTYA 1VBB3 4LT5A 4YNIA 1ASJ3 4JTNA 4FOYA 2CV6A 2C9KA 5IT6A 3MO4A 2G9GA 1IG0A 5T52A 5D2AA 3UYJA 3ZFGA 3K4ZA 4F8AA 1S2EA 4B3NA 4XHXA 4AYUA 2B4KA 2XBO1 5FP9A 4MLOA 1RUJ2 1C1FA 3FHQA 3ATGA 3KM5A 1QDOA 2R0FA 4LBMA 1RGSA 1RUD1 1R093 3HMYA 1JOBA 4L9BA 4NHKA 4ATFA 4AQ6A 5J96B 1RUNA 3H3LA 4I30A 1MQTB 4XBNA 2Q1ZB 4Q2FA 4FPLA 5AFEA 2C6SA 2WNUA 2GSYA 5FYVA 1XPWA 4G3YC 1WBLA 3JD73 5FUPA 4DINB 3KCCA 4I01A 3PHMA 4M0NA 2BWAA 4AZZA 1KJRA 4B4RA 4J1WA 1O5UA 2BGPA 4UW5A 4BQ3A 1AXYA 4IEZA 3CJIC 1GQGA 2PN5A 5J48A 1RUF2 4IV3B 4PDWB 2HWF2 2VZ1A 3E5XA 3GALA 4MV2A 1N1YA 1TMF2 3NSTA 4JVAA 3ZDVA 4TZDA 2HWD1 5FUNA 3EHKA 4WV8A 4B1MA 5KHHA 4PIXA 4WVVA 2I2SA 3VUOA 1HRV3 4CA9A 1DQ1A 1RUE2 2FD8A 4FOWA 4LHSA 2FCVA 3ON7A 4Q1RA 4Y26A 3PL0A 2D98A 5GLZA 3VD7A 1W6QA 4GIQA 1YEWA 1PMJX 1ZM1A 4HONA 1IG3A 3ZFFA 3MW3A 5A3NA 4EN7B 4BPZA 5DN2A 2RJLA 3ILFA 3ABZA 4BMBA 3H1WA 1RUG3 3WF1A 1A34A 1TQ5A 2EICA 2ZAAA 3WLUA 4OFGA 1VBB2 1F15A 2TNFA 1ASJ2 1UYXA 3BGAA 2WJSA 2XMLA 1NY71 2RV9A 2A3YA 4RHV3 1DDLA 3F95A 4Y20B 1CZTA 1AYM3 5BNOC 1R092 4Q29A 3ZPYA 5GLUA 1N3OA 3DPRC 3IAQA 3UNPA 1XNKA 4KWKA 4CDXC 1SEFA 1D4VB 3FFZA 1PX3A 1SCSA 5IHRA 3OYWA 3JD72 3MBWA 4YM0A 2P3YA 5CB7A 1H2MA 3TRSB 5JZGB 2VBBA 1C8NA 4ZXEA 3HVDA 4M4RA 3J8F3 1WLDA 4CUCA 2ES3A 2D6NA 2JX9A 2VZOA 2RS53 4MSVA 4HK8A 2A7AA 3VN4A 1OPOA 1UF2C 5IFPA 1BYHA 4QB2A 4Z8BA 4IEQA 5F9TA 5KWRA 3T0DA 1DP0A 4EWEA 1O3TA 4KGQA 4QQPA 5JLVA 3I59A 5JXIA 2PQSA 2YPDA 1S0JA 3K3NA 1RMU1 2WIIB 5EPAA 3OUIA 5LBEA 1HRV2 4ZZ5A 3CU7A 1H8TA 1VRH3 4CDQC 1POQA 4ARXA 4CU6A 2RDNA 3V0BB 3OSDA 2YDEA 4YYOA 1VBE1 4KL1A 4QPIA 3UT0A 4A7YA 2D6PA 4BQ5A 3T08A 3KT1A 1B35A 4W65A 1JYVA 1D4M1 4I3PA 1JI6A 1C1LA 1GZTA 3KB5A 4KBZA 1PK6B 5IYYA 3D6EA 1IS4A 1RUG2 1ZNPA 5CG9A 4JGZA 1YFXA 3VHNA 1HQWA 4NN0A 1F9KA 1OHFA 4LBLA 4QQOA 4XE9A 4EWDA 5FDBA 4D6SA 4DEQA 1Z7S3 5E1RA 1AF9A 1RUH1 1SLIA 2PHTA 2ZMLA 1YFWA 2E63A 3CO2A 4H2AA 1VP6A 4RHV2 1AYM2 4MHUA 2O8OA 3WHTA 1KD7A 4XF4A 4BXSV 4YVWB 2D6KA 3N9QA 4XDOA 1TE1B 2XL9A 3AZWA 5A7NA 2G1MA 4OHZA 4QX3A 4W4ZA 1ENSA 1KDKA 1RC6A 4MGKE 1SLLA 4RGAA 5EQUA 4CDUA 3MV11 1H1IA 3UK9A 4FCAA 2W87A 1UZYA 3B94A 5FYTA 3ZLIA 4AEDB 2VQTA 2RR11 2HWB3 3J8F2 1OD5A 4GKYA 4CXYA 2W47A 3PJQA 3ZXDA 4FAGA 2D7FA 4BK5A 1XU2A 4IL7A 1YO8A 1AL21 5KR7A 1AHSA 2GC2A 3WF0A 1SQ4A 4RGGA 3S57A 3VHRA 4DRVA 2ENRA 5FBJA 3U37A 1CZVA 5LB6A 5JSOA 3QH7A 1BMV1 2EIBA 2D6MA 2QQLA 4MGYE 4M0HA 1QJU3 4OQ8A 3ILNA 5CISA 5I8SA 1V00A 1ZZBA 1G9CA 1VRH2 1W8NA 1JU4A 3VBSA 5CU1A 4YWAA 3H8RA 1H8VA 4Y22A 3K2OA 5FP8A 2BBVA 1JXNA 2XHNA 2RS31 2WDBA 2YBKA 2R1DA 1GYKA 1U0AA 3LGRA 1FMD3 4Q4W3 4AQSA 3K48A 1YHFA 1QH6A 1R64A 5C8CB 3OGGA 4DEVA 2B42B 3PUSA 5GLTA 3ZN6B 4RD7A 2RS11 2DVFA 5I8TA 4YRDA 4BQ2A 3Q8FA 5ABJB 1K5MC 1NCQC 2DBNA 2VW2A 4K1ZA 5HV0A 4IQPA 3MIFA 1CAUA 2W9XA 3AKPA 5I93A 5CAZA 1N1SA 4O9GA 3ZXJA 1JYNA 4XAAA 4LBQD 4EQVA 5FOJB 1Z7S2 1OT5A 2VZ3A 4AGRA 1EV13 1HXS1 4UW6A 3R4DB 4X8PA 2Y8KA 1GKBA 1M4WA 2W5FA 3N36A 1LOEA 4PCRA 1GMMA 1AJOA 2CNAA 4FXKB 4S2FA 2WWJA 3WDTA 1OOPC 5JIUA 4RQPC 4OHVA 1JUIA 1GNYA 2B46X 2IXLA 2P2KA 4OVEA 4Q5OA 4MUVA 2RDQA 3ZYHA 5KXEA 1JZ2A 2R063 2PAMA 2Y38A 5A32B 3QD6A 1LU1A 1MS5A 3C7OA 3NRUA 4HN0A 3M3EA 3GDBA 3I3EA 3U75A 1W03A 4AVTA 1APNA 3AFKA 3PNAA 4P9IA 2WS91 5K7PA 4LO6B 5A7SA 2FDFA 2HWB2 3WG2A 4ARYA 1NUKA 3VD4A 5JR2A 3WQ1A 4OQ9A 5GZGA 3AVRA 3GZUC 2TBVA 1X8EA 1TZOA 2G4IA 2Y6GA 5GZDA 3WP6A 1RUF1 1LHNA 1V9U1 4LBOA 1MACA 2HWF1 2WO1A 3HPNA 4XQWA 4CYDA 1SFPA 1F35A 4UFKA 1S0EA 1QJU2 1SLBA 1TVGA 5C3PA 3IN9A 3GM8A 3NNMA 2ZGKA 3U14A 3FX3A 3VD3A 3ZN5A 1DQ6A 5IK8A 3KGZA 5FYHA 1ND2A 3KF5A 2WNUC 4YGEA 1RUE1 1GLHA 4GJZA 5ACA3 3WZ1A 4Q4W2 3O1TA 1FMD2 2B8MA 4UXAA 1W6OB 1D2SA 4RA0A 1QOTA 3PUAA 3RRDA 3K4DA 3TOJA 3ZSKA 3ZSMA 3AJZA 4A3ZA 2LALA 1J3PA 1AJKA 1FATA 1NXD1 1GWLA 3HT1A 5J1XA 1BXHA 1YFUA 2OPWA 2RHPA 5AVPA 3J26N 5TSWA 2ZHNA 2WA4A 1BLZA 2QNKA 2X5IB 4JQRA 4QDQA 2OZJA 4QD2A 4BLJA 1J84A 4RFT0 2KM2A 5LA2A 3NL1A 3POEA 5FYMA 3GCWA 2R7EB 4GWJA 1PZ8A 4ET7A 4GMP0 1WW5A 3PTYA 5JVVA 4LBJA 2ZTNA 4DUVA 3I2HA 5C3QA 2A3WA 5FIXA 3W58A 2R062 1GOHA 3ZFFC 4GA9A 2YU2A 4OMCA 2H6BA 3VL9A 2JDZA 2RMU3 5FXXA 1HX6A 4FPFA 3ZN4A 4Q4Y1 4FI9A 5CIRA 2GH2A 2JDAA 2WC2A 3S30A 2YY1A 2EIEA 4DOUA 5FXZA 2FHRA 3NNLA 5A7PA 5K0UB 1S1AA 4LULA 4A7ZA 4B8EA 2RM21 2DTWA 4XDPA 2PYTA 2VVEA 4JDMA 2A3XA 1IPKA 3RFRA 1QH7A 3UJOA 4AEMA 3CQOA 5JOWA 5KHJA 1R1A3 3ZYGA 1H4HA 3C7HA 4H3WA 5FPBA 4QQHA 3QACA 3WF2A 3WDUA 4BQXA 4K7JA 3T1LA 1I9RA 2VC9A 5FQ0B 4OI2A 3N9PA 3FLRA 1N1VA 4LO7A 5BPXA 2YXSA 5ACA2 1LOGA 1XYOA 3LB9A 3PVBB 4L2NA 4JRAA 5A3PA 1SZBA 5F5AA 2YC0A 5CFCB 1C8M3 1X9PA 2BNMA 1W39A 3ECQA 3N3HA 1CIYA 4IE6A 4JTOA 4LBKA 4EJRA 1C5HA 2WNVB 2I07B 3RG0A 3S7IA 2WBKA 5GALA 5LA9A 2ETEA 3AC0A 1ONAA 2DVBA 4XUOA 2BP6A 3O14A 5D8AA 4DXZA 1W0PA 1W3VA 1V6MA 2GU9A 4FQ4A 5CKMA 3ACIA 3I2JA 5JOXA 1LHOA 4GZ9A 3E5QA 4BLIA 3WG3A 5FPAA 3VBHC 1O3SA 1E5HA 5G04L 2D43A 2R043 3VBOB 3ZM8A 4C90A 1LEDA 3T2OA 1IPJA 1OFSA 4M3CA 3VKFC 1QOOA 3ZPOA 1D2QA 1Q43A 3H8XA 3AL6A 4QPIC 1VBD1 1W90A 1AZDA 4XZPA 5AFBA 3H8OA 1COV1 4OYUA 1B35C 1RITA 1TNFA 2RMU2 3RMYA 2YMZA 3ZSEA 1XXNA 5HBAA 1H30A 1NG0A 4HG6B 2G9FA 4BXFA 5C5UA 2BBAA 4LA2A 4UAPA 1PGSA 5KHIA 3VDCA 4MADA 5CFDA 4AVVA 3SCGA 1M06G 2VZSA 4LTAA 2AENA 2RS51 3T4VA 2BRTA 3TBDA 3ZMNA 2WFF1 4Y5SA 2E9QA 4P5YA 5DAQA 2CGOA 1DQ5A 4W8JA 1C4RA 1JHNA 5FZ1A 4FPYA 3U4SA 4UFJA 1R1A2 4IGQA 2ZOEB 4CEWA 2W08A 4MGZE 4XOGA 1J1TA 4P9GA 4E2SA 2WR9A 1OXCA 2AZ5A 2AR6A 3POYA 3JBG3 3LEMA 4CU8A 4IE5A 4CDUC 3SKJE 5IVYA 3W21A 5H9PA 5GLWA 1DQ4A 1Q8SA 1SPPA 4CPBD 1C8M2 1E5IA 1QNYA 1WW4A 2QQPA 1OH3A 4PIYA 1Y4WA 2HBTA 1GWMA 2VMIA 3BYWA 1YIPA 1ZX5A 1G86A 4E4SA 2Z2SB 3APBA 3K51A 5DXDA 5C3OA 1ND3C 4I0BA 1TME1 2ZX2A 4JC1A 2QZ2A 3VBFA 4Z1VA 4HFSA 1UY0A 1PHMA 1MZ6A 2PFWA 2NMOA 4MYEA 5FMOS 1VAMA 3EBRA 4JCKA 5FP3A 2WT2A 3CJIA 1BBT1 4GULA 2R042 2C1FA 4XFAA 1NZCA 4OUSA 2GH8A 4L11A 3WSOA 3I2DA 3I3MA 1W6MB 3VBSC 1XJAA 4CDWA 4KMQA 2RVAA 4JGYC 2GNBA 4B7EA 4AI1A 1NLQA 4KH9A 5KXCA 1H2NA 3AFGA 3POWA 4N43B 3BOWA 3GYDA 4RGKA 4I3GA 2D40A 2QJVA 3MF9A 4FPHA 5BYNA 2GP3A 3I54A 4ISQA 2VW1A 3RI8A 1PO13 4FPJA 2P3KA 1AXZA 3GXUA 4HBNA 4KGGA 3ZXKA 1G9BA 2J1EA 2VXRA 2QKDA 3BU7A 3HNMA 3M3OA 4XJ9A 1VBC3 4AHXA 1AR63 5DG2A 2Q1FA 2V4VA 1YCIA 2KD7A 1QJY1 3JQWA 5J3UA 4HKOA 1MR5A 1O5LA 1VMFA 1YLLA 3S5QA 3ZXEA 1YJKA 5LATA 3K4AA 5EFUA 2VZQA 2CWSA 4LKEA 3GHNA 1DCSA 4LBQA 3KS7A 3CF6E 5DAPA 1OVPA 4IV1B 3V0AA 5FY4A 1RTVA 5FYIA 2BDRA 4CP9B 4P9LA 1MZFA 2LM3A 3AMNA 3JBG2 2X53S 3MLJA 4DS0A 5FPXA 2YFZA 3NJVA 4WBBA 5FWJA 1QXJA 4CCDA 5BNOA 2J1VA 4Y4YA 3DPRA 2VD7A 5JWPA 2BWCA 4CDXA 1LGNA 2VULA 4C91A 2NM1A 2AGSA 1FYUA 1S2KA 2VMEA 2JDHA 4IEOA 2A5ZA 5L9RA 3OF1A 4KG8A 2AC1A 4DFSA 3ZSJA 5HCHA 3ZIXA 1YUDA 5F7UA 1PO21 2WSVA 5A70A 2JG8C 3QBQA 2WABA 1EP0A 1JHJA 4NO4A 5L19A 1KS4A 1EV11 2ZACA 3R4UA 1BQPA 1UKGA 1IQDC 2YGLA 4BHPA 1MS8A 1PX4A 3D5OA 3BN6A 3VKLA 3ZYFA 4WM8C 4F7ZA 1W9FA 3JQXA 1UXXX 1QQP3 5HXVA 3SXWA 3OD4A 2XJVA 4NUBA 1CGPA 1XNDA 2A70A 4CDQA 2D5FA 4EN0A 5A33A 4FFFA 4IESA 4QKFA 1A6CA 4Z07A 4BQ1A 3KV5A 3I3BA 5FPUA 1VBC2 3ASIA 1XE7A 3EJKA 1CJPA 3VBRB 5FZGA 4YM2A 3FBMA 1AR62 5DUUA 1IKQA 4LA3A 1JTZX 5LY2A 5C9AA 2W95A 5FZHA 4ZU7A 4MHRA 1RUC3 1PMIA 2VJXA 4P9WA 2DTYA 1OI6A 1X50A 1ALYA 4ZS3A 3H9AA 3U1XA 4CUGA 3RZJA 3PUIA 4MVTA 1LHUA 2HLEA 1YC61 4K3UA 4BU2A 1X36A 2I74A 4KWUA 3BI3A 4Q0SA 1PGW1 2XVKA 3BB6A 2W46A 5J98B 4QWNA 4JKLA 3CMGA 2HWE3 1I3HA 3WW1A 4AI3A 1VBA1 2JB4A 5D1IA 1JZ8A 2FQPA 2PLV3 3VDDC 5L7OA 4XACA 2VGDA 4WM7A 5GM0A 4ES9A 4D69A 1GZWA 1GP4A 2O8QA 3D0JA 4YPJA 4MXVA 4Q4V3 4QPWA 1W8OA 4YVSA 3RGBA 1NCRB 2XLAA 1LU2A 1NYWA 2QCSB 4Z2AA 2RJKA 3O1SA 5FZFA 2JJ6A 5AVAA 3ZKUA 4PLMA 5E89A 1JMUB 1UAIA 5IVFA 3NW4A 1J3QA 2V5YA 4U36A 5FZOA 4GH4A 2ADEA 4RR3C 2DWRA 3MW4A 4GAZA 4ZPIA 1UOFA 4CEYC 1CONA 3E6BA 5FYYA 1REDA 2XGXA 2Z5WA 4YARA 4XFFA 1QQP2 1YI9A 4OUEA 3OGJA 4CVUA 2PXJA 3RDIA 1MVEA 2MEV1 5CKNA 1QU0A 1DBNA 5A7OA 1OUXA 4AL9A 5EIYB 5H9RA 1W2TA 4IETA 3URFA 3VV1A 3FBYA 4Q0PA 1RJ7A 1S0CA 4GJYA 1HQLA 3RYKA 3UKNA 2YUEA 5D8AC 3ZXGA 3KHBA 2SBAA 5A3MA 3ZIWA 4X8NA 2WT1A 5FYSA 4AF9A 3MW2A 3PVOA 4M00A 3RZLA 1JYCA 1RUC2 1UPIA 2QQIA 1JOPA 1G9DA 1K5MA 1ODNA 4MXWA 1VAKA 1NCQA 4BH9A 3WUDA 5IAXA 3GBWA 4I09A 3DUIA 2FZ2A 4BDVB 1LOAA 1WZXA 4QKDA 4MG2A 1UMZA 3ZR5A 1MS4A 4JX0A 2QDNA 1NOVA 3DYOA 4XEZA 2XJTA 5A3OA 1MPXA 2HWE2 2ORXA 4ES8A 3R0RA 4QX2A 2PLV2 3KQ4B 4QGLA 1IS3A 2ZJCA 1UX6A 4RQPA 2V4AA 3IPVB 2ZEYA 2VZRA 5CZKA 3RJRA 1PGL1 5T50A 1C8M1 2ET1A 1GP5A 5CFDC 3WCRA 2VMFA 4ZXKA 4Q4V2 2CAVA 2GN7A 1NA1C 1V6OA 1UYZA 2UWBA 2C0ZA 3KT7A 4IEWA 5I91A 1YIFA 4AEJA 1J3RA 3HN3A 1L7LA 3WINE 1ULFA 4CEWC 1PVC1 1O91A 2WLPA 5ANNA 4ZZ8A 1GOGA 5BNPC 5ERLA 3TWIA 1I5PA 4NPLA 4YZ3A 5IATA 2XJSA 4FVVA 4L92A 4RS5B 3ILRA 4XC9A 2O1QA 1NQDA 3C2UA 4YLZA 5FZLA 3AKTA 4LBNA 2CU5A 4LLFA 4CPBA 2YBSA 4XCBA 5IVVA 2IXKA 2ZA9A 4Q26A 1O59A 3VBFC 2C9AA 2A6WA 2NMNA 1Q8QA 4EV0A 3ZYRA 4EZ4A 3NV2A 3ZKYA 1DLCA 1SLCA 3WNMA 4A45A 5GJ6A 3IAPA 2IFWA 1FPN3 1REFA 2VOWA 2W52A 3O0WA 4CDWC 5EXOA 1FXZA 1UPSA 3WNNA 5AC93 1XSRA 1Q8OA 4DUXA 4H7MA 1CX1A 3ACFA 4LORA 4CCKA 4GMP3 4OUMA 4N53B 3BTZA 1LCLA 1W6NA 1OVSA 1W6PB 4BZ4A 4UW3A 5T5JA 4CU9A 1W2OA 2JWPA 3LOIA 4XUQA 3VB9A 1F4HA 2VQUA 2JE9A 4R4ZA 3SH5A 3KCYA 1AXKA 4IDZA 3KVAA 1CJDA 1QXRA 4TLGA 5DG1A 2ZGPA 4D8MA 5L36A 4BISA 2DDUA 2WLQA 4YZ2A 3DN7A 2VQAA 3LEIA 2GAUA 3MUZ1 1HRI3 2VVFA 1AR93 5ISLA 2DFCA 2ZMKA 3NAPB 1XE8A 3O12A 4Q0VA 5GKAC 1R081 1RUI3 3IMNA 1X9TA 4KWJA 2XOMA 4E2QA 5JAXA 3DV8A 1H9WA 2G19A 3ROUA 2VOKA 4QXKA 5EJ3A 3WR0A 4OZXA 2ZABA 3HNYM 2Z79A 1DYOA 2ZGLA 2VMHA 3DL3A 4S2DA 4A6SA 1W8UA 2Y0OA 3KMHA 3MLLA 2OIIA 4JV4A 4WVMB 1MEC3 2XJRA 4KG0A 3UESA 5JCTA 4D94A 2J1AA 1ENXA 3CJXA 3TEWA 3IDCB 3TEYA 5DMYA 2YROA 2F6BA 2ZGTA 2XJQA 4QPGC 1PO11 2W92A 4QGMA 2FBEA 5DDJ1 5IK5A 1PM7A 2QFEA 3OCPA 1CESA 4YM1A 5LK5A 3D3AA 1VAVA 3RVHA 2YB7A 2IXCA 4DPNA 3VDBA 1T2XA 3FL7A 4KU8A 4CCEA 1OF4A 4QX5A 4TSVA 5IUQA 3T30A 4BWOA 3BU0A 1ZZCA 1X7NA 1W99A 3JXSA 3KCXA 2BOIA 1VRBA 2W1WA 2HYXA 2G9ZA 3IKWA 5I0DA 1FPN2 4LK6A 1K42A 1CPNA 4KNCA 1CX4A 3MIGA 4FFGA 5AC92 4OMDA 1FOD3 1NE6A 1AR83 2A1XA 2JG9B 4HT1T 1E5SA 3IIAA 2UWCA 1QGLA 1GOFA 1X33A 5FZ9A 3ELNA 4NR1A 3VBHA 4D0QA 1OOPB 5CA6A 2XWBB 2DUPA 3NJZA 1DGRA 4QAWA 4YW1A 3OJBA 1HKDA 3DXUA 1NKGA 3USUB 1EY2A 5C70A 3EQEA 1OLRA 5FP7A 1VB2A 4AQTA 1WW6A 2Y33A 1H4GA 5F32A 1OH4A 1ZA4A 2WRAA 5C9AC 2QQUA 1QJFA 4QB6A 3ZO0B 1HRI2 2Y34A 3MPBA 2GP5A 4KU7A 1AR92 3D82A 3W20A 3AP4A 3OBRA 4LHLA 2PHFA 4CCCA 1UQXA 5BXXA 3LEGA 1RUI2 3NV1A 3ZFGB 2C26A 1SFYA 3INAA 3C7FA 1OFNA 2RG4A 2WL1A 4YZ4A 4LLOA 1S0DA 3MGUA 2H0BA 1LJ7A 2XUMA 1K45A 3EXUA 3ZYIB 1MEC2 2IFRA 5A7WA 4NAOA 2WNUB 4O61A 4WVZA 5L7OC 2BGCA 3M8LA 4Z82A 4BA6A 1HDKA 4WM7C 1GZ9A 5L9BA 4Y1UA 3VBUA 1UYYA 5FYBA 1W8TA 4PT6A 5FXWA 4GB31 4HVQA 5FOBB 1HJGA 1PNFA 4NWVA 5F3CA 1DF0A 3MIBA 3MPPG 4YVSC 2Y6KA 5IVEA 4IV3C 4PDWC 3U11A 2HEVF 2A6YA 3LAGA 1KS5A 3OG2A 2QQMA 1LENA 3SHRA 1JW6A 3DCQA 4ZS2A 3MIDA 3KF3A 5FJHA 3H50A 4CZSA 1OLMA 2WQ8A 4I02A 4P14A 1ND3A 4K20A 1YNAA 4GH4C 3AJYA 4XIOA 1WCKA 1FOD2 1AR82 2IXHA 4JDNA 1EAH3 1JZ4A 3H7JA 3OUJA 1UIKA 5FMOL 2DUQA 2CHHA 2GNDA 4XJ8A 1W6QB 3BOPA 1NLSA 4LUMA 4B7KA 2IVIB 1DIWA 2PLV1 4JGYA 5FY5A 3ZFFB 1H1MA 3WT3A 1GNZA 1YWKA 3B7MA 3T0BA 1S4CA 1K5JA 4LKDA 2WINB 5LW9A 2TEPA 3FE5A 4D7YA 1OQEA 5E88A 4E4HA 3WQ7A 4QHBA 1CAWA 4XYXA 5JSRA 3PIGA 3N35A 5EP9A 2CYFA 1UY2A 1US2A 3E97A 4WVWA 4COUA 1DGLA 3CDZB 5K9YA 3L2YA 2VW0A 1IQAA 4HXCA 1ZBE3 1D7PM 4IEVA 3PUQA 5FZ6A 5C33A 2ERFA 2W68A 4OCTA 4CCMA 3OGRA 5J36A 1LHWA 3LA7A 4GWNA 2XPJA 2PELA 1CAXA 2CGNA 1RUJ1 1SACA 2IC1A 3GJBA 3S7EA 2AH2A 4XF9A 4XJWA 4RYDA 3OYWB 3OPWA 1Y3TA 2R073 5EZWA 2B9VA 3WNXA 3MFAA 5JMCA 2X09A 1UY4A 3THDA 1OLQA 3HOBA 1ST8A 2YGMA 4LIVA 3SITA 3WEZA 2V5DA 1HB3A 3AYAA 2W1UA 4SBVA 5F5CA 3AL5A 1SHWB 2R49A 2Y6HA 2VTXA 3P6BA 2WZEA 5IWFA 5J7MA 1DLLA 1UYPA 4D6QA 3I59B 2JD4A 3P3NA 3H3UA 5FZ7A 3LA2A 4INDA 4M4PA 2JG8A 2J1SA 4MOAA 1EAH2 2XVGA 5LWBA 1WCQA 5HXMA 1TMF1 2VO5A 1RVF3 4EN9B 1H8TB 4XFIA 4BYYA 1WMFA 1LEMA 2F4LA 5K8SA 2WYFA 4HLTA 4EN6B 2VZUA 2NP0A 3HBKA 2UURA 2BV4A 3K77A 4XTPA 4QPIB 5JXJA 1JS9A 2BQPA 3ME2A 5H9SA 2VM9A 3I2IA 3B69A 4Q8KA 3H8UA 4WM8A 1B35B 2N7GA 2PHXA 5FYCA 1UN1A 2OUJA 4DY3A 2OA2A 4PLNA 1OF3A 3KVBA 5F3GA 2VMCA 5CEHA 5IVJA 4JGZB 5I0UA 1UY3A 2XHKA 1WWYA 3IIIA 1JZ7A 3S0MA 3LE0A 5FZ4A 3THPA 4HPKA 2JXAA 5FKBA 4BQ4A 2C4XA 5FY9A 1VMHA 3TN93 1ZBE2 3AYEA 1VBB1 2P34A 1DYKA 3LKJA 5F3EA 1GNHA 1ASJ1 1UCXA 4C0BA 1HV1A 5A1AA 1W8FA 2OQ6A 4AI8A 4YVWC 4YM3A 3RNSA 2JENA 1ZRCA 3IDEA 1CZSA 5JXGA 4L8QA 3PIJA 2W94A 3OBTA 2LRPA 3ACHA 3LEKA 1POV3 3R05A 4JRLA 1HW5A 1R091 2Z42A 2GC1A 1S0GA 2MPFA 2PTMA 2R072 4CDUB 4CTEA 2OKXA 1UD1A 2Q8EA 4AEDC 2V09A 3CEWA 1JYWA 3S6PA 1V6KA 3NJYA 1DGRN 3JD71 2KXLA 4NRMA 1WGPA 4NPMA 1N1TA 3SQOA 4IE0A 3VDDA 4BCUA 2E53A 3LA3A 1WBFA 3RJ2X 4CP2A 1A8DA 5C6CA 2Q5TA 1GV9A 5HI0A 4Z92B 4H55A 2R0HA 4YGDA 2ARXA 4BM8A 3N9MA 2ZHMA 3C3VA 1WMEA 2E33A 2ZGMA 1W9TA 5EYXA 4AAXA 2K9ZA 5HCBA 1QJEA 2PHUA 3ETPA 4GQ7A 1RVF2 3VKNA 5T55A 3AKQA 1XOYA 4NHLA 2ARBA 2OUHA 4U2AA 3O1OA 4XFCA 2VNOA 4AGVA 4FP3A 1QJX3 4Y22B 1FV3A 2CWMA 2JE7A 1HRV1 4RR3A 3ENRA 5B4NA 3M70A 4HL0A 4CEYA 5C8CC 4RFRB 5FWEA 3ACLA 2RDRA 3WNPA 4L97A 1O8SA 1C5IA 2AEYA 2WQ4A 3VZJA 3J9SA 5ABJC 3VD9A 3TNQA 4R9BA 1O7FA 2YBPA 3RQ0A 3GZAA 3AMMA 4QX7A 3E6CC 5FMCA 3WW4A 1CAUB 4W6XA 4LO4B 3HN1A 1MS1A 2PHDA 4IEUA 1RUG1 1HV0A 3WXPA 3ORJA 2XJUA 3TN92 5A3UA 4AW7A 2YPJA 2WZR3 1ZRFA 2DCKA 2WT0A 3OB8A 4URTA 4XF1A 1F4AA 3OTFA 2XUEA 4HVRA 2H0VA 5JR7B 3BPZA 2ZKNA 3M7AA 4MGSA 4RHV1 1ULCA 2RDSA 1AX1A 1HN1A 5BNNC 1AYM1 3G7DA 2DCZA 3VLBB 1R1ZA 3J7LA 3WV6A 4PIZA 4LO8A 4YZ1A 4FP2A 1DGWX 1RINA 3WX5A 4W50A 4UF0A 1SBDA 2XQRA 2AYHA 3CIHA 3FWEA 4H14A 5C4WB 1ZBA3 2I45A 3L2HA 3E1F1 1ZA7A 2XL7A 3LIGA 1OSGA 4G9SB 1JZ5A 5C3RA 1AYN3 1EPZA 3LCPA 1WW7A 1XB9A 2CDPA 2IZWA 3FHIB 4HOOA 4XUNA 3J8F1 5HCFA 1CAVA 2XJPA 4RN5A 1QOSA 2P3IA 1PZ9A 1SFNA 1NA1A 2VXJA 2TUNA 3CKHA 3AZXA 3IWZA 3N7JA 4LHKA 4ASKA 4YW5A 2JDNA 2YC2A 4E9KA 2ARCA 1RUD3 1FOD1 2FCTA 2KA3A 1UZVA 3BKZA 1STMA 1X82A 4MO3M 1KFXL 1ND2B 1SBFA 1QJX2 4IGPA 1ULPA 3B9CA 2CY6A 3RYPA 5CADA 1VRH1 3MFCA 2Q4SA 3VBUC 5BNPA 5FTTC 4UWDA 2CDOA 1XRUA 3AZZA 5FMDA 3A7QA 1EPWA 2VTFA 5D21A 5F6KA 5IAVA 4XMAA 1AR73 3GHMA 2IVJA 2YV8A 3MYXA 2OXBA 3QOPA 4ASLA 4QU1A 4NRPA 3O1VA 2GNTA 5FO8B 3T2TA 3WCSA 2X5IC 5FY0A 5BNQA 3POIA 5M0TA 4QKBA 1QEXA 3AP5A 1VIWB 3OY8A 1ULGA 5A3LA 4C1WA 1D0HA 2FMDA 5FFOC 4K40A 1U12A 2HWD3 2WZR2 4ISRA 2HH9A 4SLIA 5T54A 1G9AA 1WA4A 3H42B 1SLTA 3O0VA 4HMZA 5FBZA 1FT9A 1Z7S1 4I0WB 2Q0AA 2NYYA 3N9OA 3PU3A 3VZMA 5A3TA 4FPOB 3U07A 4QQLA 1RXGA 5FK7A 4HKWA 2VU9A 3FFQA 3THTA 4MGQA 2W2IA 1QF3A 2UU8A 3POBA 1PIV3 2WO2A 3LDRA 2E7QA 4GXLA 1IOAA 1ZBA2 3U4XA 2E26A 4XFHA 5LK7B 5JUVA 4LIUA 1NT0A 2D5HA 1AYN2 2Y6FA 3A22A 3LF7A 3C8XA 5K0UC 1K12A 1U5YA 1GICA 1UWWA 2HWB1 4IEYA 3WNKA 1BK1A 1JOJA 3DECA 3J4UH 3KV6A 1E57A 1NCRA 4QDRA 2FDKA 2VZPA 3BTAA 3USSA 3O1MA 1IPSA 4LE4A 4C1XA 3H0OA 4P9JA 2PHLA 4BQYA 1RUD2 4QB1A 4ZY9A 4NMIA 2V73A 1V6IA 2ZX1A 1IZ3A 4N8MA 5C5TA 1QJU1 2P6HA 4LQRA 5LCWL 4Q0QA 1S0BA 4L99A 5F2SA 4Q0UA 5E16A 3V65A 4M01A 3SH3A 5CFCC 3RZKA 3I2FA 3HAGA 4NHXA 4E27A 4KI5M 1GUIA 3FUOA 3OUHA 1LGCA 2ADDA 2WNVC 1AR72 4HANA 4Q4W1 1FMD1 5DABA 3ES1A 1NAEA 3PDQA 1DQ2A 4QPGA 1UXZA 2D3RA 3WP5A 1Q5OA 5D8AB 3ZFEA 1UOJA 5A6YA 5LEKA 3AM2A 4NWWA 4XURA 5FZMA 2DCJA 2HWD2 5SV8A 1RMU3 5DPNA 5A1FA 3IDBB 1GSLA 2JDKA 3GBFA 5C71A 4FPCA 3AZVA 2B39A 2ZGNA 4LHNA 4UFHA 2WWSA 4YFZA 4XVHA 2ZHKA 1V6NA 1FAYA 4V1PA 1FV2A 4CUAA 1XSQA 3UKTA 4Y3OA 5F3IA 5HV4A 3B02A 1BVP1 1PIV2 1D4M3 1AX0A 1XYNA 4LK7A 2R061 3T1MA 5KXBA 1CIWA 2BU9A 1CQ9A
chains in the Genus database with same CATH topology
3VGIA 4QU2A 2ZGSA 5CFDB 4JDOA 3E6DA 4HSLA 4OULA 4AHWA 4FQZA 4K1YA 5DZEA 1NY72 5LRSA 3AP9A 4XXAA 1V70A 4QMAA 1RUH3 5GLVA 4QQ2A 4UBHA 3WDXA 4CEWB 1KITA 2ZMNA 4QGNA 5JI7A 4DMIA 1YJLA 3PMSA 4MX3A 1POV0 5KC5A 1DFQA 2P3JA 3DKWA 1AL0G 4RS5A 4I2OA 1MQTA 3RSJA 4R8HA 1UU6A 1MVQA 3HT2A 3M4FA 5ACA1 1ENRA 2RR13 1W2UA 2GC3A 4BIOA 4Y5Z0 3SCHA 3TB0A 1CPMA 2EA7A 1AL23 1AUYA 3VBFB 3LZZA 1GQHA 3GZTB 4B4QA 4RL7A 2EXIA 2ILMA 4OHXA 4IV3A 4PDWA 3TN91 1RMU2 3CJIB 3B00A 4OLLA 4CDWB 1RIRA 2HWC3 2R32A 3V64A 1PZ7A 5KBFA 5DUVA 4N43C 2RS33 4Z2WA 4N90A 1AVBA 1JYIA 4MZUA 1D4M2 4Q27A 5JPMB 1B09A 4BE3A 4AI2A 1JUHA 4OHWA 2RMU1 3FLPA 4R9AA 3VHOA 2P17A 4Y1ZA 1Y43B 4FTEA 2OVUA 1VR3A 2OZ6A 3RS6A 3NAPA 1GZCA 1HXS3 2VQ0A 3D4KA 1RUH2 4IV1C 4XBQA 3UV9A 3ZXLA 4LBQB 2ZZQA 3V0AB 5J37A 2D44A 2F4PA 3WW3A 4I0AA 1U5IA 1H2KA 4ATEA 4Y20A 1WD3A 1R1A1 4AVBA 4DY5A 4FTSA 3GBGA 4XFGA 2NPIA 3VZNA 4DQAA 2BFUS 1GR3A 4HKLA 5BNOB 5I0SA 2X29A 2DCYA 4FT8A 3DPRB 4TLFA 2WS93 2CAUA 4CDXB 2RR12 2IXIA 3LWCA 5JZGA 3MIHA 4A3XA 3WW2A 1AL22 4PQ9A 4R9DA 2DVGA 4YG0A 1X8MA 3KT4A 3O5SA 5FAXA 3TNPB 4D69A 3JCIA 1Q8VA 1V9U3 3AX4A 4XPVA 4YW2A 2K0GA 1TEIA 5FCCA 1BMV2 2VUAA 1S55A 3AKSA 3ZVXA 4ZU4A 2O0OA 4QM9A 3PMEA 3D8CA 5KHKA 4S2HA 3AK0A 4LE3A 1LECA 2HWC2 2GN3A 2R041 4K21A 1N47A 2RS32 3HWJA 3P3PA 3RZZA 1XQNA 2E7AA 2GZWA 4XBLA 4CDQB 2GMPA 3V0BA 1H2LA 5A33B 3VKOA 1LULA 1A78A 4XQDA 1UU4A 3VBRC 3X29B 3ZYPA 2X8KA 1NQJA 3MEPA 1URXA 2D3SA 1PK6A 5C9AB 4HSJA 1YXWA 2QE3A 1Q3EA 1HXS2 2CGPA 1DU3D 3N7KA 4ONUA 1ZVFA 2B7YA 2JEMA 3G6JB 3ZYJB 4OI0A 5B2GB 4XJZA 3L9JT 1F31A 4YVWA 3OD0A 5JSPA 4Q8LA 3JBG1 4XHBA 4A7KA 5KHGA 2WS92 4NHMA 5L7OB 1CN1A 4Q4Y3 2HJIA 4WM7B 4KWLA 3WG4A 3B01A 1LOFA 4OI1A 1GZWB 4FPGA 4XW3A 1AR71 1F5JA 1ULDA 4AEDA 3HQXA 1LODA 2MNGA 1YI7A 1NCRC 4YVSB 2RM23 1V9U2 5C8WA 4AK3A 1DZTA 3FUQA 3A4UA 3HIFA 4P9YA 1LOCA 3N7MA 4J6GA 4AWDA 4XILA 1SMVA 2WFPA 3GNEA 4C0HA 2UY8A 4GH4B 3MDPA 3PVEA 4DZGA 1RL3A 1QMJA 5DUWA 1Q8PA 2WNEA 1Z0HA 4H7LA 5EV7A 2R1BA 1V6JA 1PIV1 3MZHA 2HYKA 1EYBA 1WMDA 4KBBA 5C8CA 5JOZA 3ZFEC 1RB8G 4Y1YA 3ZN6A 1HLCA 2XH6A 4HETA 1BVVA 1VBC1 5GZEA 5ABJA 3N4MA 3SLIA 1AR61 1K5MB 4MXWB 1NCQB 4F83A 1DG6A 4IXLA 2QVSB 3IM0A 2BNNA 3AYDA 4HK9A 3VZLA 2IWGB 1I1EA 1PVXA 3QCWA 4K9SA 2Y0IA 1VBD3 2VOVA 5CBLA 4ORFA 1COV3 1G9FA 1N3QA 2CL2A 4KQ7A 3WP3A 4RQPB 4Q4Y2 5BNNA 5A32A 2ZGQA 1WLCA 4AFDA 4COWA 3B93A 5F6LB 3ZSLA 1JH5A 2B45X 2E6VA 1KFUL 1MS0A 1JN2P 1VLNA 2RM22 2LUWA 2WFF3 3I8TA 4Y1XA 1QJZA 1RUOA 1VB4A 3MLKA 2YYOA 3NKTA 4R52A 4RS5C 2VUJA 1MQTC 3FMGA 1PNGA 3VZKA 3ZXFA 4XXPA 1QQP1 1U5ZA 2HKXA 4YW3A 2VVDA 5H9QA 5F1RA 2B5HA 2D6OX 4AFMA 2QDRA 2WQZC 3AMQA 1W6OA 2NQYA 2GC0A 3V56A 4AFAA 5GZCA 1TME3 2VMGA 1OPMA 3ETQA 3WHUA 2BVBA 4FBFA 1UL9A 2BPA2 4LEJA 4E4ZA 5FO7B 2ZGUA 2X5IA 2PQQA 1BBT3 3H3ZA 3TYJA 1RUC1 1KJLA 1KXGA 1YYNA 4N53C 4PBPA 2A6VA 4YZ5A 1VBD2 3B9IA 1W6NB 2Q8OA 4AVSA 3ES4A 1COV2 1KQRA 3WG1A 2Y26A 4NOTA 2Q30A 5I0RA 2HWE1 5EWSA 1BEV3 3JB8A 2BW8A 4MH0E 1MZ5A 1F8VA 3E5UA 1ZZ8A 4COVA 2RS52 1QJY3 1OMIA 2WFF2 3NAPC 4Q4V1 2UYBA 5K0UA 4CP1A 2EXJA 4IERA 2EXHA 4LNVA 3CLPA 1XNCA 3BODA 2LTNA 3UJQA 2HWC1 2K2SA 4ZKTB 3FZ3A 1W0OA 1F2NA 3QH6A 3LSEA 5FQ0A 4FPEA 2DVDA 5HCAA 1GFF2 5JPNB 1O4TA 4XDQA 4J1XA 5JZGC 2ZX3A 3FJSA 5CFCA 1ZRRA 2XKPA 1MS3A 4XF3A 3W9AA 1PO23 1TME2 1J59A 2WKKA 2WNVA 1L3JA 4ZU5A 2W0XA 3AB0A 3WDYA 1SLAA 2PHWA 1G6NA 1BBT2 2NN8A 5E8AA 2JG9C 4E4DX 2PHRA 3RI9A 3IT8A 1LOBA 3I7DA 1CR7A 1NE4A 3VBOA 2UWAA 3VBHB 4TWTA 3POSA 2VNRA 1BJQA 3PJYA 1IGOA 1RJ8A 5BY5A 4G4FA 3AMHA 1BZWA 2WSUA 1BEV2 5C4WA 1H1AA 1H9PA 2BTVC 4META 2ZAHA 2XLFA 4K6BA 4BIFA 4EROA 1WLTA 1PK6C 2GMMA 1QJY2 2ZCWA 3MICA 3KGLA 3U10A 3ZFGC 1WUVA 1I6XA 2XWJB 4FPKA 1XU1A 5JIAA 4DB5A 4HZFA 5FLHA 1YRZA 2DCTA 2HEWF 3ZDSA 5I8YA 2Q1MA 4QM8A 2E51A 5FLJA 4COZA 1LGBA 3PLQA 2XLGA 1U5XA 5BUVA 1VBA3 4QT6A 3TAYA 2W39A 1LOFC 3VBUB 1SDWA 3SMHA 2JKBA 2VOXA 2CTVA 2D97A 4W6YA 5EYYA 2FZ1A 3HD8B 3M1HA 1PO22 4N7UA 2BUKA 3ALQA 4LUKA 3A0NA 4XJAA 4F3JA 4JAAA 3NWKA 1NLRA 1TNRA 1SCRA 2DF7A 1A3KA 1EV12 1ND3B 3H1YA 2OYZA 3NV3A 3PVNA 1YFYA 3VL8A 2PA7A 4ITCA 2D6LX 4Q4X3 4FO9A 4AFCA 1FPN1 4MGIE 5AC91 2R16A 1CVNA 1G8WA 1W6MA 4AVAA 2MEV3 4XF0A 3VBSB 5FRAA 4GMP1 4JGYB 3M3IA 4M3CF 2QUOA 4N43A 2Z69A 4UBGA 1I5ZA 1WD4A 2DFBA 4YGBA 2OW4A 5T5OA 1LTEA 2ZHLA 2C5DA 1CAWB 1LESA 2B9UA 3B3QE 1WLWA 1RHI3 1QKQA 4Q1PA 5DUXA 3JUUA 4WZCA 3DGTA 4O9EA 3LOBA 3O0XA 5JDBA 1HRI1 3AXDA 1UW8A 1AR91 4YSFA 1PGW2 2JICA 2A73B 4IEPA 5J09A 1RUI1 2OPKA 4IV1A 1OQDA 4Y1VA 1DYPA 1CAXB 4P5HA 1BKZA 4BOWA 1VBA2 3MIEA 3WD5A 2A6XA 4A2UA 5BV6A 1QNWA 5JI9A 1MEC1 5L73A 4COYA 3EO6A 2ZBJA 5KC6A 4BMEA 4YG6A 1ENQA 2BFUL 2MHFA 2ET7A 2ZGRA 4Y24A 2NLRA 4ASMB 4EWAA 2WA3A 4AVCA 1PVC3 2JG8B 1H8TC 4Q4X2 4FAHA 1KRIA 1AX2A 3ZXAC 2XBO3 3WUCA 1SBEA 2DYCA 3WVJA 1AR81 2MEV2 4HN1A 1FI2A 4W6WA 4X6RB 4XFBA 1H0BA 4XTMA 4HVQA 1IKPA 2RE9A 4WM8B 4OHYA 4JGZC 4N9IA 3ZX7A 5LEJA 3B5LB 1RHI2 1Y7BA 3VBRA 3M2MA 1XNBA 1OA3A 4HPKB 4R9CA 2EF6A 4M3CE 4RSUA 1DQ0A 4AI0A 4XIKA 5FLIA 3AYCA 2GDFA 1VALA 2YHJA 5FPZA 2ZGOA 1DZRA 2ZZJA 3KD4A 1LKNA 3GF6A 5CNAA 3KQRA 3WDWA 3SISA 1PGL2 1LHVA 4GWMA 3KZ4C 1BCXA 3VDDB 3KLSA 3SH4A 3RPQA 1FNYA 2DVAA 2YZ4A 1Q56A 5SV5A 3JB4C 2ATFA 2AUYA 1IS5A 1R083 2ZS6B 3O7OA 3CNAA 4YW4A 2EAKA 1PVC2 1C3HA 3AZYA 2HEYF 3NVCA 2A71A 3HBZA 2XBO2 4B29A 2DV9A 3BCWA 1EAH1 1MZEA 1QXPA 1QHDA 4RR3B 2R30A 2ZX0A 4CEYB 1Y9QA 5F5QA 3U0ZA 4LO5B 2QZ3A 1V6LA 2UY9A 5DDJ3 1BEV1 4X6QB 1WCSA 2XB6C 3UL2A 4WZFA 3M3QA 2E7TA 2EVXA 4XETA 4D3WA 1HQNA 4N7IA 2VY0A 3OPZA 1GBGA 3VBOC 1ZBE1 3FC0A 2DU1A 3WP4A 3AXEA 2DURA 4OI4A 4M3CB 4FXGB 2EALA 2A6ZA 3NKGA 1ZRDA 1ZZ9A 1S0IA 2P37A 3DF0A 2DU0A 5C4WC 2FMYA 3RWNA 1VBE3 3ZMOA 3ST7A 3UKVA 3QLQA 1T6GC 2JECA 2R071 3IPVA 3WOGA 1IS6A 1FNZA 3Q9OA 2IXJA 2BNOA 1CAVB 4PJYA 3RMXA 3WY6A 5CG8A 1WCDJ 1G7YA 1R082 1UU5A 1OQ1A 1NA1B 4QPYA 3AP6A 3H7YA 1OA2A 4FOVA 4FSJA 1REEA 3SNMA 1ND2C 3IBMA 5JOYA 1FX5A 2UYAA 2NZ9A 1OKQA 5T5PA 5T3NA 1ZYBA 1RVF1 1S0FA 5BNPB 1UKRA 2EXKA 2A75A 4AG4A 1LB2A 3M3CA 1DHKB 1PO12 1MS9A 1VJ2A 5DDJ2 2BYVE 4GB33 1DZQA 1O4ZA 1JBCA 4AFBA 3HR9A 2AREA 4GALA 4XQ4A 4NPRA 4UW4A 1CD3G 5DZGA 3OY8B 2DUOA 4PBOA 3NO8A 4AEKA 1F5FA 1S2BA 2XVLA 4PF5A 4AHZA 4AGGA 3NV4A 4B4PA 4D7TA 3WQ0A 2BVVA 3WDVA 4XMIA 1LR5A 4TYSA 4N53A 2SLIA 4YGCA 1O3QA 1VBE2 1W6PA 3VKMA 1POV1 4AHYA 1KDMA 3AP7A 3CL1A 4FTBA 1DGWA 3W59A 1J58A 2H6CA 1N3PA 1C28A 5FREA 4XJUA 2RS13 1A8MA 1OA4A 5I0TA 1O4YA 3SCFA 3R4SA 2R6QA 4LR4A 3MF6A 1QWRA 2VECA 2VNGA 1UIJA 2D3PA 2XG3A 3H1MA 2GALA 3D0SA 4Q4X1 4EN8B 3MI8A 4N9HA 1C57A 5IK7A 1RUJ3 4FOQA 2XKOA 5GZFA 1Z78A 5LRRA 4GKXA 4P9XA 4WVMA 1GANA 4S2GA 1QJX1 4DNYA 3JZVA 2WZPP 2ZPXA 4GB32 4IEXA 4K8FA 3VHPA 1ZZ7A 5FO9B 4AE2A 1ZZ6A 4R4XA 5KXDA 3A0KA 4D7SA 4QPGB 1RHI1 2GNMA 3ZFEB 5CVRA 3I4IA 2PAKA 1J1LA 3FLTA 1RUF3 3AMPA 4NVPA 4CRQA 2HWF3 4HVOA 2ZKLA 1QDCA 3N7LA 2VH9A 1TMF3 3BALA 3JU9A 4AXOA 1XYPA 2WZR1 1ULEA 4YFWA 2JG9A 4PLOA 4YG3A 3VZOA 1RUE3 4CP0A 2VPVA 1OOPA 3KSCA 1NXMA 1UZZA 2BEOA 5T5LA 4E2GA 2VG9A 3USUA 3RYRA 3R6SA 2PAEA 3AKRA 1LRHA 1ZBA1 2RS12 2EAAA 2ZX4A 5DZFA 1ZREA 2GMEA 4AQ2A 1QY4A 3LSDA 2EIGA 1IHMA 1AYN1 5IK4A 1HIXA 2D93A 1O3RA 1D0GA 3BIWE 1VBB3 4LT5A 4YNIA 1ASJ3 4JTNA 4FOYA 2CV6A 5IT6A 2G9GA 5T52A 3ZFGA 4F8AA 4B3NA 4XHXA 4AYUA 2XBO1 4MLOA 1RUJ2 1C1FA 3KM5A 3ATGA 1QDOA 2R0FA 4LBMA 1RGSA 1RUD1 1R093 3HMYA 4L9BA 4NHKA 4ATFA 4AQ6A 1RUNA 5J96B 4I30A 1MQTB 4XBNA 2Q1ZB 4Q2FA 4FPLA 5AFEA 2WNUA 2GSYA 4G3YC 1WBLA 3JD73 4DINB 3KCCA 4I01A 3PHMA 4M0NA 2BWAA 1KJRA 4B4RA 4J1WA 1O5UA 4UW5A 1AXYA 4IEZA 3CJIC 1GQGA 2PN5A 5J48A 1RUF2 4IV3B 4PDWB 2HWF2 3E5XA 3GALA 4MV2A 1N1YA 1TMF2 3NSTA 4JVAA 4TZDA 2HWD1 3EHKA 4WV8A 5KHHA 4PIXA 4WVVA 2I2SA 3VUOA 1HRV3 1DQ1A 1RUE2 4FOWA 4Q1RA 4Y26A 2D98A 5GLZA