3B00A

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8 in complex with cetyltrimethylammonium bromide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
251
structure length
251
Chain Sequence
EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Laminarinase
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 58
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3b00A00
2ZGLA 1VALA 3WG2A 1DZQA 1LOAA 4FOWA 2EIGA 4AGRA 5JOWA 5GZDA 1GNHA 1UPSA 1W6QB 4OZXA 5IK7A 5KXCA 3MPPG 1WBFA 1DGLA 3AZWA 4YGEA 3SNMA 2ZGOA 4XTPA 2SLIA 1IS6A 1UN1A 1JXNA 2A6XA 1MR5A 1W6NB 3AZVA 1GICA 2FMDA 1QNYA 1YI7A 3BOPA 4PF5A 1CPMA 2AREA 3AK0A 5JVVA 4YZ5A 1W6MA 1X50A 4AGGA 3M3OA 1IS3A 3N7JA 2DVAA 4YG6A 3LCPA 4Q27A 1HDKA 1EPWA 3V64A 1QNWA 4BQ1A 1SLAA 1S0JA 4LBQB 2ZGKA 3A0KA 4XHBA 2I2SA 3VKOA 3R4SA 4YM0A 2DU0A 4H55A 2W08A 1N1SA 5CNAA 1FX5A 3WUDA 2ZGQA 1W0OA 3RQ0A 3ZYPA 3AP6A 2W68A 3N3HA 4RL7A 2GN7A 1APNA 3B01A 5E88A 1GZ9A 1N1YA 5LK5A 1BZWA 1UZYA 3SH5A 1C57A 2GMMA 2ZABA 2ZGNA 1FYUA 2AUYA 3QCWA 3NV4A 1LENA 1Y7BA 4FP3A 2D43A 1F31A 2DVDA 3ZSLA 4AGVA 1LJ7A 3ASIA 4YM2A 1LU2A 1NLSA 4FPJA 2DVGA 1G86A 2ZMKA 1BYHA 4Q1PA 4BOWA 3MW3A 1Z78A 2OUJA 2LTNA 4GA9A 1UKGA 4GWMA 1GANA 2ZMNA 3VKNA 5T50A 3SH3A 1F5FA 2JDZA 3H0OA 1ULFA 1YIFA 1D2SA 1HQLA 1KITA 3BODA 1LGNA 4GALA 2LALA 5F5QA 3PVEA 4HL0A 2CYFA 2ZZJA 4AYUA 3AP4A 4PCRA 4CRQA 1JUIA 1ULCA 2P3IA 3DUIA 5DZGA 1PZ8A 4NO4A 5KXEA 3ILNA 1JYIA 1QOSA 2ARXA 3M3QA 3SH4A 2VUAA 5T5JA 2DVBA 4NOTA 2NMNA 1DQ0A 3NWKA 4Q8KA 3FLTA 2PHTA 1AVBA 3HMYA 2W39A 4YGCA 3GNEA 2D44A 1DBNA 1GZWA 3VV1A 3WCSA 2OW4A 2P3JA 2UURA 3R05A 2GNTA 2OVUA 3AP9A 4DPNA 4LBJA 2CY6A 4LBLA 2KM2A 4ISRA 3V0BB 3AP5A 3WV6A 2A6VA 2JKBA 4Q26A 4YFZA 1LEMA 4ATFA 1V6OA 4XZPA 4DQAA 3MW4A 1QOOA 1LOFA 4SLIA 2NP0A 4YZ4A 3V0AA 3T1MA 4XDQA 4Y1XA 3AFKA 1N1TA 1N3OA 2WQZC 3NV3A 4XXAA 2E6VA 1LECA 1W6OB 2GNMA 5GLZA 3RS6A 1HLCA 4LBKA 4M3CB 3ZXEA 1BXHA 2E51A 4PBOA 1S0EA 5JMCA 3B69A 2CTVA 1ULDA 4DRVA 5KXBA 2PHFA 3JUUA 4FPFA 1GZCA 1LTEA 3SLIA 5GLUA 1LOGA 1BKZA 3AX4A 1G7YA 5JOZA 5E89A 5L73A 2V73A 4M00A 3USUA 2XG3A 3OYWB 5GJ6A 4AVTA 4CZSA 1MS1A 2EXHA 1DFQA 1ENRA 1LCLA 1DYKA 2ZHMA 4AWDA 3WG3A 4YW1A 4Q1RA 5DXDA 4XE9A 3LSDA 4FPHA 1LHOA 1FAYA 3O12A 2ZHNA 1JBCA 1S0BA 1DQ5A 4P14A 4YZ3A 3WVJA 3ZSKA 3POYA 2D6OX 5GM0A 1QKQA 5HCBA 3DGTA 4R9DA 5EWSA 3ZXLA 4ASMB 4BM8A 3UJQA 2ZGSA 4UW6A 1G9DA 3ILFA 3UJOA 4R9AA 2AGSA 2YROA 5DG1A 1S1AA 2WSUA 4FQ4A 5HCFA 1LEDA 2E7QA 4FVVA 5GLTA 3VKLA 1OKQA 2C9AA 1ZA4A 2JE7A 3D5OA 3OGGA 3ZXJA 2GDFA 2WSVA 5GZFA 4YZ1A 1S0CA 5SV8A 1MS4A 2DWRA 3ZPYA 1LOEA 3IPVA 2ZBJA 1D0HA 1DHKB 1JW6A 2GMPA 4M3CE 3QLQA 3N7MA 1Q8VA 2WT0A 3ZSMA 3WDVA 5CAZA 1LGBA 5EYYA 1LODA 2AH2A 4IQPA 2A5ZA 4FQZA 1SCSA 2YZ4A 4GKXA 3W59A 5BYNA 2HYKA 4U2AA 2EXKA 1C4RA 1LHWA 2SBAA 2R1DA 3RMXA 4YGDA 1B09A 3PVOA 2YV8A 4FOYA 4Y22A 4DS0A 1LHNA 1W6MB 4K1ZA 4FPOB 3JU9A 1YO8A 1AJKA 1FNYA 1GNZA 3ZYRA 4WZFA 2ZHKA 5H9RA 2DV9A 2ENRA 1UAIA 3AP7A 3POSA 1DQ2A 4K20A 2ZMLA 4XHXA 1WD4A 3WLUA 3FLRA 1KRIA 1LOBA 1YXWA 5T5OA 1AXYA 1MVQA 3AJYA 1SBFA 1RIRA 1QDCA 4Y26A 2ZGRA 3N7KA 5IK4A 1SLIA 4XBQA 3OY8A 2R0FA 2R0HA 2GALA 2PHRA 5GZCA 2CL2A 1AXKA 2XB6C 2VH9A 3WHUA 3L2YA 2A6ZA 1ULGA 2A71A 4ITCA 3INAA 4D69A 2NYYA 3N36A 1BQPA 2Z42A 2PHXA 4YM1A 1GLHA 2YMZA 4XJWA 1WW6A 3IM0A 1GSLA 1SACA 1V6NA 3AZZA 2WT1A 5IK8A 1O4ZA 2A7AA 5GALA 2P3KA 3AXEA 2D6PA 1VLNA 2ZHLA 4HANA 4XJ9A 2JJ6A 1V6LA 1YRZA 2WJSA 3HN1A 1G9BA 2UWCA 4XJZA 2V5YA 3OJBA 4JC1A 3RG0A 1Q8SA 2ZA9A 3WG1A 5HCAA 1SLLA 1Z0HA 4Y24A 1N47A 2PHUA 3GALA 2A3WA 2D6LX 2H0BA 1SLCA 1A78A 4LBMA 4XMIA 5JDBA 2DUOA 1LU1A 2DTWA 5T54A 2NN8A 3AZXA 3O5SA 1JYCA 3SISA 2ZGPA 5E8AA 1KQRA 4XJUA 1A8DA 1VIWB 4YG3A 3UK9A 5EXOA 4U36A 2A6WA 4GXLA 3WG4A 5H9QA 1ULEA 1WW7A 1A3KA 5DUUA 4P9YA 1GZWB 2Q5TA 4K21A 1VAMA 3FUQA 4W65A 3CNAA 4XBNA 3RRDA 5GZGA 1H9WA 1G9AA 1MVEA 3T2TA 3OBTA 1QDOA 2EAKA 5H9SA 3AJZA 4YFWA 5DG2A 5JLVA 1FV2A 1KJRA 1MACA 2P37A 4LBNA 5T52A 4DRRA 3U4XA 5IT6A 1DLLA 1IS4A 1JN2P 4M3CF 3R4UA 1CESA 4FOVA 3D6EA 1V00A 2E7TA 3V0AB 4YW3A 2DU1A 1G9CA 4Y1ZA 2DVFA 2ZGTA 4Y20A 3M3EA 1N3PA 1V6MA 5JOXA 1V6JA 2NMOA 3MW2A 1R1ZA 4ATEA 1DYPA 1S0DA 1C1FA 3B3QE 3KQRA 2VY0A 2AYHA 2G4IA 3M3CA 3ENRA 4FPEA 1Q8OA 3APBA 4K1YA 4WV8A 4FPKA 3WDUA 2ERFA 1WLDA 2RHPA 1WCSA 4FP2A 2VW1A 1WUVA 1GV9A 2DYCA 4Q2FA 2D7FA 2ZGMA 1MS3A 3USUB 3VKFC 3SITA 1SLBA 1MS9A 4F83A 5DUXA 3IMNA 5KXDA 1W6PA 4R9CA 3O0WA 1AJOA 1PZ7A 3AXDA 1MS0A 1V6IA 3IKWA 4UW5A 4YLZA 1W6QA 2ES3A 2PHWA 1CIWA 1CONA 2R49A 5GZEA 5EYXA 4YGBA 1G8WA 3RMYA 3V65A 2GNDA 1FV3A 1S0IA 4BMBA 1GYKA 4Y1UA 3WNXA 5CA6A 1W6NA 1LOFC 1QF3A 1GKBA 3WZ1A 3O0VA 3A4UA 3MEPA 4P9XA 3RSJA 4PBPA 2FHRA 5DZFA 1O4YA 2A6YA 1DQ1A 1KJLA 1AXZA 1S0GA 4YW2A 4FOQA 2VW0A 1UMZA 4BPZA 3OBRA 1PZ9A 1HQWA 3FFZA 1MS8A 4LBQA 4YW4A 2DURA 1RINA 1IS5A 3PMEA 5F9TA 1OFSA 4I30A 4LBQD 2CWMA 2ZACA 1CQ9A 2D3PA 1DQ6A 1Q56A 3IPVB 3C2UA 1H9PA 4YM3A 1IKPA 3PVNA 4R9BA 2A3YA 4FPYA 1LESA 1XQNA 5GLVA 5IUQA 1BJQA 4UW4A 3ZXKA 1GBGA 2VU9A 4YW5A 1WLWA 4C1XA 3LSEA 1CPNA 5AVAA 1I3HA 3WDWA 4XBLA 2EF6A 4UW3A 5GLWA 3BTAA 4XXPA 3ZVXA 4Y22B 5DUVA 4AVSA 2R1BA 3KM5A 1CN1A 3BIWE 3AYAA 1SLTA 2A3XA 4M01A 1KDKA 1U0AA 4KBBA 4XMAA 4TZDA 2D6KA 4WVVA 3NV1A 3FUOA 4XTMA 4Y1YA 2ARBA 2WLQA 4FPCA 1LHVA 3IN9A 1I1EA 1Q8PA 2WKKA 5H9PA 1ZM1A 2BQPA 4YG0A 3WDXA 3ZXFA 1DIWA 4CTEA 2NZ9A 5CB7A 4L8QA 1WW5A 3ATGA 1LOCA 1WBLA 3OY8B 3WOGA 1QOTA 4Y1VA 4Z8BA 4ZKTB 4BMEA 3V0BA 1LULA 1URXA 1QMJA 2DUPA 4MYEA 1AF9A 2VW2A 3TB0A 1UL9A 4FPGA 1MZ5A 1ONAA 1VAVA 2JE9A 5JOYA 1UX6A 2B7YA 3NV2A 2JD4A 1WW4A 4WVWA 1S0FA 2GMEA 1AX1A 4TYSA 4XOGA 1LGCA 3AYEA 4XILA 3WHTA 2P34A 4ZXKA 1Q8QA 1FATA 2ZKNA 2E53A 4FPLA 2D6MA 2WT2A 5T55A 2C5DA 4P9WA 3D4KA 1YYNA 5DUWA 3AYDA 1N1VA 1SBEA 3FLPA 1KDMA 2AR6A 3Q9OA 3B00A 4RA0A 4DFSA 4AVVA 5CBLA 3OPZA 1CVNA 2AENA 1H30A 3N35A 3B9CA 2EALA 1MS5A 1W6OA 3I4IA 2A75A 5DZEA 4M3CA 3ZSJA 2P2KA 2VXRA 1UZZA 2PELA 3A0NA 1TEIA 3W58A 2A70A 3POWA 1RITA 4XJAA 3VUOA 5IK5A 2GN3A 2TEPA 5FRAA 3TAYA 4XIOA 2NM1A 1G9FA 4C1WA 2ZAAA 1JOJA 1SBDA 2WNEA 3M2MA 4XYXA 1AX2A 1QU0A 2D3RA 1SFYA 2GNBA 2UWAA 1JHNA 3OYWA 4GKYA 1ENSA 2UU8A 3WDYA 3M1HA 1N3QA 1V6KA 2CWSA 2CNAA 3HR9A 1IOAA 1DQ4A 1LHUA 1WLCA 2DTYA 1HKDA 1W0PA 2YY1A 2YXSA 1J1TA 2ZGUA 2OUHA 3AYCA 1NXD1 1QGLA 4BLIA 1IKQA 1AZDA 1F9KA 3UL2A 2UWBA 1ENQA 2EXIA 1OQ1A 1CJPA 4XIKA 3WUCA 2R16A 1AX0A 4Y20B 5FREA 3WCRA 1CR7A 4YZ2A 3T1LA 2D6NA 1MZ6A 3N7LA 1WD3A 5T5LA 4GWNA 3I8TA 3ILRA 2DUQA 4PQ9A 3VKMA 4LBOA 4BLJA 3O0XA 3WDTA 1SCRA 1FNZA 2D3SA 2EXJA 3PJQA 3AZYA 4ISQA 2JECA 4JCKA 4Q8LA 4XJ8A 3FBYA 5T5PA 4JRAA 2W52A 1W6PB 1C1LA
chains in the Genus database with same CATH superfamily
1VALA 5LWBA 2D93A 4XURA 3OB8A 2XHNA 1O3RA 1LOAA 1AYN2 1QWRA 2G1MA 2RDQA 4Q29A 5JOWA 4LHLA 3O1OA 1UPSA 2VECA 4OZXA 5IK7A 5KXCA 1GUIA 2Q1FA 1WBFA 1DGLA 3KHBA 3SNMA 2ZGOA 3CZUA 2W1WA 3OSDA 4XTPA 2SLIA 5ISLA 1IS6A 3RJRA 1GQGA 1JXNA 2A6XA 1W6NB 3I2DA 4N7UA 3ACFA 1JYXA 4Q4W1 1Z7S3 3JD71 1A34A 5E16A 2FMDA 3BOPA 4A6SA 4PF5A 3GZEA 2AREA 4BQ2A 4OUSA 5JVVA 4CCDA 4A3ZA 2FZ1A 2UY8A 1H4GA 2DCKA 4CCKA 2RJLA 4RFRB 2DCZA 2DVAA 2E26A 4Q4X2 1QQP3 3LCPA 4GB32 4AEDB 2TNFA 4Q27A 5LCWL 1HDKA 2HWD2 3V64A 1NYWA 4BQ1A 1SDDB 5J48A 1S0JA 2J1AA 2UYBA 3H7JA 3OD4A 4IEWA 4AEKA 3WR0A 2KXLA 4Q4Y1 3VKOA 2R6QA 1POQA 4LIUA 3HNMA 2W08A 1N1SA 4C91A 3RQ0A 2H6CA 4Q0SA 3ZYPA 5KC5A 2VTXJ 1VPHA 3I2JA 3N3HA 4IESA 5B4XA 1RHI1 5F7UA 3GJBA 1C8M3 5F5CA 1UZYA 3SH5A 5LB6A 2EIBA 2XGXA 3PHMA 2ZABA 3IDAA 2WWJA 2ZGNA 1ASJ2 4OHWA 4RN5A 1NAEA 4HN1A 3CO2A 2DVDA 4IUGA 4MSVA 4AGVA 4PLNA 1HXS3 4BCUA 1LU2A 1NLSA 2ZMKA 4Q1PA 2X29A 3LPGA 2YC4A 3MW3A 4GULA 5FPZA 4JRLA 1Z78A 4NIGA 2LTNA 1W2UA 3MIDA 4EZ4A 1J84A 2VZ1A 3E5UA 4GQ7A 4HSLA 2HWF3 5T50A 2JDZA 3H0OA 1HQLA 1LGNA 3H1YA 3HNBM 1VJ2A 3C8XA 5JZGA 2QQNA 1AR81 1CAVA 4IE5A 3T4HB 2B42B 4AYUA 4CRQA 3V0BB 2W1SA 3PDQA 4QX0A 2ARXA 3M3QA 3VHOA 4CDUA 1JZ8A 5T5JA 5J7MA 2TUNA 2VMEA 3MHZA 4L97A 1W2NA 1H2LA 5FYMA 1QIQA 4QKFA 4LNVA 3LEIA 5FUIA 4KQ7A 3IAQA 2D40A 2W39A 5FZAA 2JG9B 3UETA 5A6XA 3I2KA 3RI9A 3T0DA 1W0NA 1GZWA 3WCSA 4AAXA 3B94A 2WFPA 2FQPA 4JGYC 1AR93 1CAVB 1O5UA 3NJYA 4XVHA 3BGAA 2QUOA 4NIIA 1NXMA 5DQ0A 2VBPA 1VRBA 4Q0VA 5KBFA 5LA1A 4QB1A 2JKBA 1OXCA 2HWE2 4ATFA 1X82A 5FY4A 2RG4A 2DBNA 1QOOA 5F3IA 2NP0A 3T1MA 3LEMA 1XYNA 3DXTA 4QGNA 3AFKA 4XDQA 4XXAA 4YZ1A 3ZXEA 4AEMA 1HLCA 4LBKA 4M3CB 4IV3A 2XJPA 3OEAA 1KS5A 4JTNA 2Q0AA 1QXPA 4DRVA 3HEIA 2PHFA 2ZJCA 4IGOA 1GZCA 3ZO0B 3SLIA 2XJUA 1LOGA 1PMIA 3ZFFB 1PGW2 3I2HA 5L73A 4DMIA 2GZWA 4M00A 5GJ6A 4P9GA 4WM7B 1YCIA 2V72A 2QQLA 1DFQA 1ENRA 3M8LA 4Y4YA 4CU9A 2ZHMA 3ACIA 4JX0A 3ST7A 1POV1 4YW1A 1RUOA 1OH3A 4RS5B 5A7QA 3LSDA 4FPHA 2JDKA 3O12A 2WWUA 4XQWA 2QBXA 5FMOL 3WVJA 3JD73 2D6OX 3POYA 2PMWB 1SHWB 5HCBA 3DGTA 3HQUA 4D8MA 4R9DA 3I2IA 5EWSA 4GMP1 5BNPC 1KGYA 4ZU5A 5JXGA 4K6BA 1VBC2 4UW6A 3ILFA 4LXLA 4TLGA 1S1AA 5LEJA 5ACA3 5HCFA 1WMXA 1BBT1 5I0UA 4N43A 4Q0QA 2IXLA 2JE7A 3ZXJA 5FYYA 4YWAA 5SV8A 5EV7A 4NHYA 4IV1A 3TYJA 3UKNA 4B4RA 4CE8A 1VBB3 4Q4Y3 1GZTA 1OOPC 2W3JA 5LBFA 5FOJB 3TEXA 1DHKB 1JW6A 1O8SA 2RMU1 2GMPA 2Y38A 4KGQA 2WT0A 3ZSMA 4L9BA 3WDVA 1W8ZA 1LGBA 5BY5A 4FAHA 2GC2A 1LODA 3BN6A 5KWRA 2CGPA 2QKDA 3OPTA 4RFT0 4GKXA 2WO2A 1STMA 4U2AA 4LKFA 1XC6A 1HB1A 2WNVB 2SBAA 2ZX4A 3NNGA 1ND2A 3PVOA 2X5IA 2Y60A 1W6MB 3ZFEB 2W94A 3JU9A 3PU3A 1YO8A 4FPOB 1AJKA 4NHLA 3U14A 3UKVA 3ZYRA 4OHZA 1UY1A 4MGTA 1U5ZA 1K5MB 2Y8KA 1UAIA 1OLRA 1VB2A 3Q8AA 3MGUA 4K20A 2ZMLA 4MGKE 2ARCA 2VMIA 3WLUA 2LUWA 1LOBA 1PIV1 1W2AX 1AXYA 5FIXA 4IEVA 3AJYA 5FZ7A 3VBFB 4Y26A 1RIRA 1YWKA 2O8QA 1SLIA 1T6BX 2QFEA 4XF1A 4QPWA 3QACA 2OIIA 4XAEA 1AR83 5J09A 5LA9A 2W0XA 5AFBA 1ZREA 3MIEA 4K40A 1A6CA 1PO11 4LTAA 2VUJA 2XB6C 2BERA 3WHUA 1PGL1 2DFBA 3L2YA 1NA1C 2G19A 1BEV1 2A71A 4ITCA 4MO3M 2RJKA 2W2IA 3ZR6A 2NYYA 3G6JB 2VBBA 3H1WA 4YM1A 3O1TA 4JKLA 5LBBA 4LO5B 2P3YA 1RUH3 5LY2A 4JHZA 2E31A 3RI8A 2WT1A 1O4ZA 2A7AA 5GALA 5F39A 1RUI3 1W3XA 2ZHLA 4LLFA 4CPBD 5F8PA 4DXSA 1JYWA 2XUMA 3G7DA 4LHSA 4HANA 5G05L 4AQTA 4FTSA 4HLTA 4WBBA 3HN1A 3O1UA 1RUC1 2V5YA 5I0SA 1SG3A 3OJBA 3U0ZA 4JC1A 3RG0A 2VZVA 3WG1A 3T09A 5JPMB 4UFKA 5CISA 1UD1A 2PHUA 2WA3A 2OKXA 3GALA 4OZOA 1NCQB 2JB8A 5FO9B 1A78A 3BYWA 3FJSA 1AR61 2DCJA 3FWEA 4XF4A 5JDBA 1LU1A 2W1QA 5FXZA 1FMD1 4LA3A 4N53A 2YBKA 3KVBA 4TSVA 2ZGPA 3BU0A 1VIWB 3ZYFA 4AI2A 4YG3A 3UK9A 5LK7B 2A6WA 1HRV1 3WG4A 3L9JT 4MV2A 1OHFA 1WW7A 3A7QA 4OUEA 4PT6A 5F5AA 2XONA 3MYXA 4P9YA 2Q5TA 2JDPA 1JUHA 4K21A 5FMCA 3EJKA 4QPIC 3IIIA 1COV2 3BCWA 2RVAA 5GZGA 2EAKA 1J3QA 1UIJA 5H9SA 3AJZA 5JLVA 4DRRA 4LBNA 4QB2A 5T52A 2ZEXA 3VZOA 4GH4A 2W47A 1HIXA 1CESA 4AFDA 3T2QA 2XBO1 3ZXGA 4GMP3 1E5HA 2QCSB 2JX9A 3GGLA 4QKBA 5C8CA 2J22A 1IPJA 2ZGTA 2L9LA 5LRSA 4ATEA 2I07B 1LRHA 2QQWA 4CUGA 5FPLA 3B3QE 1UKRA 1YQ8A 2RR11 1J3RA 5BNOB 2NPIA 1EP0A 5FZDA 3APBA 3PURA 4OULA 5C4WA 5TSWA 1C5IA 4IEPA 2ERFA 3VDCA 4B3NA 4MGQA 5JXIA 4GH4B 2DYCA 2LROA 4I3GA 1NY71 4GD4A 2VM9A 4PDWA 2D7FA 3Q8BA 4OVEA 4YYOA 4I09A 2VMFA 4J6GA 3USUB 4BZ4A 3VKFC 4AFCA 5KXDA 1D4M1 2H0VA 3LFMA 4NRMA 4ORFA 1M4WA 1AJOA 4B1LA 1PZ7A 5B2GB 1MS0A 1V6IA 3EXUA 1OI6A 1BLZA 1W6QA 1ZA7A 4AFMA 1CIWA 2R49A 3KV6A 3LA2A 4LOSA 5FZBA 2RDRA 3U75A 2PA7A 4YGBA 1PM4A 4BIOA 4CUAA 1JYNA 1YNAA 1WMFA 4YVWC 1GP4A 3P3NA 4OHVA 1YHFA 3ES1A 4OMDA 4NN0A 5CYYA 4DZGA 1QJX2 5FJKA 4WM8C 3T2PA 3RSJA 1XB9A 4MGYE 5FQ0A 2P6CA 4YW2A 1ZBE1 1VMHA 2VW0A 1YEWA 1GOFA 3DPRC 3VBRC 2WFF2 1XNBA 1W9TA 3NAPA 3FFQA 1MS8A 1UU5A 1AR71 4YW4A 4CXYA 5K0UB 4QHZA 1Q56A 2Z4FA 1IKPA 3PVNA 4XFIA 1PO13 2J7MA 3KB5A 2WNOA 3IWZA 1VR3A 1R64A 4UW4A 4GJYA 2VTFA 1CPNA 1R092 3I3QA 3ON7A 3QH6A 1XBFA 2PAMA 5FZ8A 1QJU2 2EF6A 2W5FA 3CBNA 4CU7A 1BMV2 4EWAA 2WDBA 4Y22B 2BEOA 1UIKA 5KHHA 4YVSA 2WINB 1CN1A 1KEXA 2A73B 2G9ZA 5IVJA 3CLPA 1SLTA 3KD4A 3VBOC 2PXJA 3NNMA 3DYOA 2JD9A 1S2KA 5BPXA 1W05A 1RUC3 2WLQA 3IN9A 1I1EA 3O1MA 1Q8PA 2HBTA 2C1FA 5F3CA 3BOWA 2PN5A 4Z92B 5C3RA 3N9MA 2Q30A 4HK8A 3ZFGB 2J1TA 3I2FA 4IW3A 1W9WA 5DAVA 3OY8B 1AR63 4IXLA 2R041 4ZKTB 5BNNA 1FMD3 3O1SA 2XXZA 4QM9A 1RUD2 1ZZ7A 3CHXA 4FT8A 4LR4A 5L7OA 3SXWA 4BYYA 4A41A 5J37A 1EAH2 4CDWB 1ZZ9A 4WVMA 1SPPB 1MZ5A 2UYAA 1VAVA 3VDDA 1HRV3 2W9XA 4CDQB 4JQRA 1UX6A 2IXIA 2PFWA 4DINB 4NIAA 4XEZA 5FZKA 4LITA 4WVWA 5F6KA 2GMEA 5I8TA 1HRI3 4TYSA 5HPOA 2IXHA 4XOGA 4E8DA 2P4EA 4META 2XLFA 3A21A 2QQMA 3I49A 1IPSA 3F95A 3MZHA 1FOD3 1RJ7A 4GJZA 3WY6A 5FZ1A 1WLTA 2Z69A 4QPGC 4FPLA 3VDDB 2H6BA 4P9WA 4UXAA 3MIHA 3SCFA 3AYDA 3TEWA 4FXKB 4KGGA 4QB6A 3SMHA 1CD3G 1RUE3 3KCXA 3PNAA 5FJHA 5CBLA 1TE1B 3RWKX 1RXFA 5IAXA 1W03A 3I4IA 3WF1A 3C7GA 2P2KA 4A7KA 4XF9A 2WNUB 2PELA 5CFCA 2RR13 3H8RA 3POWA 1RUJ3 1RITA 2EVXA 3HBKA 4XDOA 4XJAA 4EWDA 2GN3A 3PL0A 4WZCA 5FP9A 5FCCA 4C1WA 3N9OA 1C5HA 3WNKA 3M2MA 5DMYA 3J8F2 5C9AB 3PUIA 3JBG1 4LA2A 5EQUA 2UWAA 1D4M3 3OYWA 5IVVA 3W20A 3ZN6A 1YLLA 3CJIC 5L9RA 4HMZA 4PLMA 3HAGA 3ELNA 1W8WA 2VZOA 4TWTA 1RVF3 1DQ4A 4MZUA 1PO22 2E7AA 3J7HA 3ZN5A 5LY1A 2JDYA 3TOJA 4BK4A 1HB2A 1W8HA 1PHMA 1W0PA 4V2VA 2ORXA 2OUHA 3AYCA 1XOYA 1QGLA 1IKQA 1XNCA 3MUZ1 4E27A 5AC93 4IERA 4PI0A 1FXZA 5LRRA 5KHGA 5A3NA 4E2QA 5I0DA 4Y20B 4XAAA 2OZ6A 1CR7A 2D6NA 1UMIA 4CEYC 5C71A 3N7LA 3N4MA 5FYHA 1IZ3A 1K3IA 2DUQA 3H3ZA 5J96B 2K0GA 3U4SA 1EUTA 4RR3A 1SCRA 1VBD2 3ECQA 4A6OA 1AR73 2D3SA 3PJQA 3AZYA 2ZTNA 2JECA 4JCKA 4M4PA 2ZX0A 1NQDA 2FBEA 3FBYA 1CAXB 4EROA 1CAWA 3ZPOA 4JRAA 4LKDA 5A3MA 4MXWA 4CEWB 2FMYA 1VMJA 1PK6B 4XCBA 1DZTA 1A8MA 1GNHA 1R082 1S2EA 3D8CA 5GZDA 1JMUB 4CCJA 1H1AA 2PLV1 3MF9A 3AZVA 1GICA 4IEUA 3TN92 2LS6A 3VD9A 3RZLA 1UOBA 3AVSA 3SHRA 5CADA 1IS3A 1SFNA 3LZZA 1UY2A 4MXVA 3MLKA 3RZGA 2QZ2A 2CAUA 1ULOA 3R6SA 1H8TA 5A3PA 3GZUC 1UYXA 1NCRB 4URAA 1QNWA 3POEA 5IVBA 1Z7S1 4LHNA 4I2OA 2RS51 4XHBA 3S5QA 3THCA 2W91A 3WT3A 4CP9A 5CNAA 2MEV1 2RS11 3ZKYA 3THTA 1DP0A 2KA3A 3AP6A 4P00B 3SCHA 2W68A 1QQP1 1X8MA 3DF0A 3C7OA 3DL3A 1QJY2 2Y64A 1APNA 5E88A 1N1YA 4MGIE 2WYSA 5LK5A 4BB3A 1GQPA 2JDMA 1TME2 1PVC3 2OQ7A 3KF5A 2ZKLA 4B1MA 1FYUA 1JZ5A 5KR7A 1L7LA 5C8WA 3NV4A 2JDAA 5EP9A 1QJEA 5FZEA 1OFNA 5L19A 1Y7BA 1F31A 4QU1A 1G6NA 1LJ7A 3ASIA 3KV9A 1WA6X 4AEDC 4LO7A 4Q4X1 3O14A 4BOWA 4EV0A 1C8M1 3NO8A 4GB31 2BNNA 1UKGA 4GWMA 4K8FA 1Q3EA 1UXXX 4RHV3 2WA4A 3SH3A 3NNLA 1F5FA 5K4LA 2QVSB 1KITA 4GALA 3WNPA 4QX2A 3MV11 4LHKA 5A1LA 1OVSA 4HL0A 2CYFA 2VOKA 4KL1A 4BQ4A 5FZIA 3AP4A 5FP3A 4PCRA 2CGOA 1JUIA 3DUIA 5IFTA 5KXEA 4NO4A 5FY8A 2XJVA 3ILNA 4AVCA 1W2OA 2VUAA 1VB4A 3LOIA 4OHYA 3OUHA 2HWF1 3IMMA 4Q8KA 4RQPB 3WW2A 3UNPA 2RV9A 3HMYA 5IW0A 3GNEA 3KMHA 2D44A 5FYZA 1DBNA 4GWIA 4L99A 2V4AA 1BK1A 1AL0G 3MF6A 2OW4A 1HB4A 4E4DX 3GHMA 1YC61 3R05A 3AP9A 4P5YA 2CY6A 3KV5A 3V56A 4LBLA 4DY3A 2KM2A 2LW8A 4ISRA 3AP5A 3WV6A 3MDPA 3VBSA 1YIPA 1YFXA 4D7SA 1V6OA 5JI7A 3LGRA 1LOFA 4CCEA 2Q8DA 4SLIA 3VBHB 4YZ4A 3V0AA 2WRAA 5IATA 4EYUA 2O0OA 4Y1XA 1N1TA 2E32A 2WN2A 4AG4A 5GLZA 2HEWF 1LECA 1AR91 2GNMA 1J59A 1BXHA 1T2XA 1TMF2 2V4VA 2Y0IA 5JMCA 3NL1A 1ULDA 4HXCA 5E6HA 4XUTA 1X9PA 1XNTA 4O65A 4PQQA 5A7WB 1REFA 5GLUA 1F4AA 3AX4A 3MFCA 1DGRA 2JG9C 3N9LA 4JGZA 3U07A 4BQXA 2R072 4AVTA 4CZSA 3CU7A 5FZHA 4QX3A 3WG3A 2B4KA 5DXDA 4QXBA 4PIZA 4HKLA 5FPAA 1QXJA 4FFFA 2A1XA 3UKTA 1FAYA 4Q4V3 1MQTA 2VTXA 1K42A 1S0BA 5FOBB 4YZ3A 1DLCA 4NAMA 2GP5A 2YPDA 5GM0A 3BTXA 4A4AA 2DBIA 3J9SA 4ASMB 3DYPA 4IEXA 3Q8FA 4YW7A 1O3TA 1GWKA 1ND3B 2VOWA 3GXUA 2HEYF 1BK0A 1LEDA 3VKLA 3HT2A 5FK7A 4FFHA 4DXZA 5JMOA 3H42B 2WZR2 1B35A 2ZOEB 1L7RA 1W8UA 2R063 4AHZA 4QX5A 3GJAA 2O14A 3ZFFC 1MS4A 2RS53 5CFDA 1LOEA 3ZPYA 1H1IA 1PGW1 2F4PA 2VD7A 3T0AA 3IPVA 2MEV3 2RS13 3E5QA 4WM7C 2C0ZA 2PYTA 2ZBJA 4I02A 2FDKA 1UY4A 3OOXA 4KG0A 2BGPA 1R1A3 1W04A 3QLQA 5FYVA 1PVXA 5ACA1 1Y4WA 1CAUA 1AYN3 4OHXA 4RS5C 1TVGA 3AFGA 5EHDA 4LORA 5JWPA 5FP7A 3GDBA 3HIFA 2XQXA 3M7AA 2FCUA 3JCIA 4IQPA 4N9IA 5AFEA 4IGQA 4FQZA 3ZSEA 5BYNA 1XE0A 2QQKA 3I3EA 2HYKA 2C9KA 3VZLA 2ADEA 2JG8A 4D7TA 1VBB1 1C4RA 1VRH2 4F3JA 2B45X 3RMXA 4YGDA 3AKPA 4L11A 4FOYA 2BW8A 1QHDA 1VBE2 5DABA 1BVVA 3VZKA 2BU9A 1OF3A 2HJIA 4OI1A 1I5ZA 4C0BA 4IETA 1ACCA 4WZFA 5H9RA 4Q4X3 3SEPA 3AMHA 4GB33 3WF4A 1MEC2 3POSA 2OZJA 2HWD3 1HN1A 5D2AA 1KRIA 2R30A 1MVQA 4AVAA 3AMNA 2Y33A 1SBFA 2O8OA 1QDCA 3ZYIB 2ZGRA 3N7KA 1E5IA 2WR9A 3OTFA 3KLSA 5GZCA 1QY4A 2RM22 1EY2A 1ZRFA 2XMLA 2ET7A 1AL22 5JXJA 2WQ8A 4YRDA 4Y4RA 1RUNA 1UOGA 1H1MA 3CL1A 2XUEA 4R8HA 4D69A 3DYMA 2YHJA 4TLFA 3N36A 1BQPA 3THDA 4ES9A 2PHXA 4XQDA 5LZ6A 1GLHA 1TQ5A 2WNVC 5LBCA 3IM0A 1GSLA 4UF0B 2WL1A 4QXHA 1SACA 3AZZA 1O8PA 1ASJ3 5IK8A 2HWC2 3VZJA 5D8AA 3P5BA 3ZFEC 1C28A 2P3KA 5ABJC 3RYPA 1VLNA 3LWCA 2WUHA 1K5MC 4XJ9A 5F5IA 1JS9A 2RM23 4JHTA 3H8OA 4ET7A 1G9BA 3FZ3A 4LO4B 4HG6B 4XJZA 4PF1A 2R7EB 1XNKA 2FDFA 3VBFC 4P9LA 3LA3A 1RUH1 2RE9A 4ZS2A 2XQRA 4IEZA 5CG8A 2H0BA 5JZGB 1SLCA 4LBMA 4XMIA 5FZ9A 3RDIA 1RL3A 1BVP1 1RUI1 2DUOA 3PTRB 2NN8A 1EYBA 1XU2A 4UBGA 5E8AA 4B7EA 1YFWA 2F17A 4CDUB 4O7XA 2CU5A 4U36A 4UFMA 4ARXA 2GH2A 1DCSA 2XWBB 2GU9A 3DKWA 1A3KA 5A32A 3OGVA 5DUUA 1RUF2 3NNFA 1GZWB 4URTA 1YQ5A 1VAMA 3FUQA 3VL9A 2VBDA 2AEZA 2X53S 2BWAA 4LLOA 3RRDA 1W3VA 3RYKA 4MX3A 3T2TA 1G9AA 1RJ8A 4XFCA 4YFWA 3VDAA 1FV2A 1KJRA 1MACA 4GZ9A 2IXCA 3NJZA 4RGGA 1GOGA 5CEHA 1H4HA 3B5LB 2EA7A 2HWE3 1E5RA 2PHLA 3D6EA 1V00A 4NWVA 4XUOA 4ZONA 5EZWA 5FLIA 5A7SA 4D7YA 4Z2WA 4ZS3A 1NCQC 1G9CA 4QMAA 1N3PA 3UESA 5IWFA 1R1ZA 4IV3B 2YU1A 4IEOA 4LKSA 2ATFA 3K77A 1WCDJ 4AQ6A 2BFUL 1IGOA 4IL7A 2AYHA 4BJ0A 4BXSV 4K1YA 2VVDA 4FPKA 1KD7A 3BALA 4OMCA 4ZXEA 4AFAA 5LATA 1WUVA 1XYOA 4M0HA 4Q4W2 4Q2FA 3VLBB 1ZVFA 5FY1A 4F83A 1J1LA 5DUXA 3WQBA 1F4HA 4R9CA 3LDBA 1O7FA 3FC0A 3FMGA 3I3BA 3WW4A 1DGRN 2Y6GA 4UW5A 2XVGA 5FZCA 3I3MA 2G9GA 3E5XA 3RMYA 1G8WA 3V65A 5EJZB 4AE2A 3JQXA 5A3WA 1NZIA 1S0IA 4PJYA 5FP8A 1Q43A 1QF3A 5FLJA 3JB8A 1ST8A 2PAKA 4A45A 3K48A 3WZ1A 2BRTA 4KG8A 5DAQA 5JIUA 1AYM2 2V09A 1VBC3 2E33A 3EO6A 4QU2A 2TBVA 2GH8A 3NRUA 5DZFA 1O4YA 2A6YA 2WO3A 1XE8A 5JI9A 1DQ1A 1KJLA 1AXZA 1RHI2 4N43B 5BNOC 3U10A 3IT8A 1UMZA 4IE0A 3VL8A 1KS4A 3VD4A 4M4RA 1PZ9A 5L9VA 1HQWA 4LIVA 4IV1B 4LBQA 2DURA 4LBQD 1CQ9A 2HH9A 4R4ZA 3C2UA 1UOJA 3WNOA 1H2NA 1REEA 1WZXA 2C24A 4CCCA 4DOUA 4FPYA 1LESA 2W87A 3AM2A 1XQNA 2JWPA 4A3XA 4P08A 3BTZA 1GBGA 2BYVE 4XETA 5JSOA 3LSEA 4N8MA 3LOBA 5AVAA 3TNPB 4EN7B 1F2NA 2F4LA 3RWNA 1GFF2 4UW3A 3ZVXA 2XJTA 4XUQA 4XXPA 1ND2B 3RNSA 1PMHX 2X5IB 4LPLA 2OS2A 5DUVA 3VBUC 2R1BA 3KM5A 4COWA 2ZEWA 2VNVA 4JGYA 4NHXA 2WS92 2F6BA 4M01A 1KDKA 1U0AA 3GHNA 4KBBA 4XMAA 5C6CA 4TZDA 3KHCA 2CDOA 3GBWA 3GYDA 4AI9A 3ZYGA 3N9QA 3ALQA 1OH4A 1UPIA 1W8TA 5H9PA 2WFF1 2WKKA 4YG0A 4JKMA 4CTEA 5K0UC 4L8QA 1WW5A 3ATGA 1LOCA 1YFYA 5FYIA 4CPBA 1QOTA 4Y1VA 4Z8BA 5ANQA 4XFHA 3UGFA 5FKCA 1H2MA 3WQ1A 5A33A 4QDRA 1ENXA 2FDGA 4FPGA 4KU7A 4FAGA 2JE9A 4MADA 4SBVA 1DZRA 2OT7A 5CKMA 5J1XA 2B7YA 1DG6A 1OQDA 3GBGA 2JD4A 3HJRA 1QJU1 2B5HA 1NT0A 3IAPA 3NJVA 5FZ3A 1S0FA 1AX1A 2WAAA 2BV4A 2BNMA 1YJKA 2RS32 2VG9A 5JR2A 1LGCA 4PHZA 4HBNA 4P9IA 3LQCA 4XILA 4ZXKA 3TWIA 5A33B 1YI9A 4ZY9A 1FATA 3FL7A 3I2OA 3ACGA 3LPFA 2WT2A 5IVEA 4ZU4A 1YYNA 2VC9A 1N1VA 3E6BA 3VDBA 1KDMA 2YDEA 1ZBA2 1GP5A 2WZ8A 3ZFGC 1CX4A 1RMU2 1W9SA 3RGBA 3OPZA 5BNPA 1EV12 1HRI1 2WBKA 2JIJA 3AL6A 3N35A 1W6OA 4PIYA 4HZFA 5EJ1B 3R0RA 4N53B 3RPQA 5IAVA 3B02A 4HT1T 1FOD1 4Z2AA 4CDWC 2BDRA 1UZVA 4AVBA 1UX7A 2IC1A 2VCBA 4XIOA 4CDQC 2ZAAA 1WCQA 1W9FA 1PX3A 2WNEA 4HKOA 5CIRA 5FY5A 5HI0A 1RUE1 1OOPA 4I0AA 3VD7A 1JHNA 2XLAA 4MHRA 4ZU7A 1DGWA 2VXJA 1YQ2A 1CJDA 3NW4A 3WINE 4LKEA 4MUVA 1COV3 4Q5OA 3HR9A 5FZLA 1DDLA 2OPKA 3THPA 1BBT2 5IJRA 1RUJ1 1IOAA 4A7ZA 4XC9A 3PUSA 3IBMA 5T3NA 3POJA 2DTYA 3WSOA 2YY1A 3KT1A 5IFPA 3KVAA 2YXSA 1J1TA 5M0TA 1NXD1 4BLIA 3K2OA 4IE7A 5LEKA 2UWBA 4BWOA 2EXIA 5C8CB 4BA6A 1Y9GA 1OSGA 1CJPA 4XIKA 3RVHA 5FREA 2RMU2 4YZ2A 3T1LA 1MZ6A 2IFRA 3OEBA 1JTZX 4OYUA 5FZFA 1RVF1 2WQ4A 1WD3A 2GP3A 2WNUC 5T5LA 3UYJA 5FZ4A 1RTVA 2VAUA 4E2GA 5C4WB 4BLJA 3O0XA 3WDTA 3PLQA 3WP3A 3ZMNA 1FNZA 5C9AC 4PDWB 3S5AA 5AC91 3J8F1 4XFFA 2VUDA 5APAA 3TEZA 1C1LA 3LD8A 3W5NA 3FHQA 3WG2A 4O61A 5EJ3A 3RYRA 4AGRA 3KCYA 3POBA 4H3WA 4MVTA 1OPOA 1W6QB 4EN6B 3LFIA 4UT5A 4W6WA 1NA1A 4QAWA 2RDNA 5A3TA 1EUUA 1PIV2 1MR5A 2AEYA 2FZ2A 1OF4A 3JXSA 1QNYA 1CPMA 1GWLA 3AK0A 3UGGA 4J1XA 2JICA 4NRQA 3U37A 4YZ5A 1HN0A 1QJX3 4CCNA 1CGPA 5FQ0B 3AMPA 3M3OA 3ZYHA 3N7JA 4YG6A 2BFUS 2IVIB 2I45A 1NLQA 2JEMA 3SCGA 1BEV2 5C3QA 5FMOS 1S55A 4LUKA 5FPXA 5DN2A 2WFF3 3POFA 1SLAA 3NAPB 4MHUA 4DO0A 3I59A 5J98B 4X6QB 3WW3A 1VBD1 2I2SA 4IEQA 3ZYJB 3RZHA 4R4XA 4ZZ5A 2DU0A 1XE7A 4H55A 5JSPA 4R52A 3C3VA 3IDBB 3NQHA 4EN0A 3ORJA 1W0OA 4QKNA 4CEWC 4HN0A 5BNQA 1PK6C 4NPLA 3LA7A 2O1QA 4CCOA 1OLMA 4L0PA 4DEVA 5FYCA 1MPXA 3MIFA 1F15A 4YW6A 1R093 4ZZ8A 4W50A 5CG9A 1BZWA 1C57A 1H6XA 1QJU3 2GMMA 1JYVA 3HBZA 4YVSB 2Y26A 4QPIA 1RXGA 3DECA 3GF6A 1Y43B 1Q5OA 2E63A 2JDNA 3LIGA 1G86A 4FPJA 4WVZA 3T2OA 2Y34A 2ADDA 4E9KA 2OUJA 1SZBA 1DF0A 3WQ7A 1NCRC 2GC1A 2HEVF 2VCAA 2ZMNA 1WGPA 1LKNA 3AKQA 3HPNA 4UI9L 4W6XA 3VKNA 1PVC1 4AQSA 5JPNB 5FBZA 1VBA2 3EBRA 3BODA 3R4DB 5F5QA 2R32A 5K7PA 3AMQA 2C6SA 3MUY1 1ZZCA 5FLHA 5BNNB 2J1UA 3OG2A 2ZZJA 1ULCA 5L7OB 5DZGA 1RUD3 4CU8A 2VQAA 4XF3A 1JYIA 1EAH3 3CQOA 3HD8B 4WVMB 5HBAA 4RHV1 2VULA 1GQHA 2NQYA 1QJY1 2NMNA 1IQAA 4H14A 1DQ0A 3NWKA 4QWNA 4D3WA 2PHTA 4BXFA 2XBO2 4TN7A 4BQ3A 4PLOA 1TME1 4FSJA 1W8NA 1J58A 3ZN4A 5F6LB 3B7MA 2P17A 2UURA 1RGSA 2OVUA 4DPNA 2QE3A 4LBJA 3HN3A 4L2NA 2VMDA 4C90A 2A6VA 2JIGA 3UV9A 1TNRA 4DUWA 1OVPA 4YVWA 5FYTA 3VD5A 1PMJX 2YB7A 3CEWA 4LO6B 5FPUA 4AR2A 3T4VA 2MHFA 3WNMA 4CCMA 1W39A 4DS0A 4WM8A 2E6VA 2GSYA 3KSCA 2EIEA 3EB7A 4NPMA 4UFHA 5CFCB 3B69A 3P6BA 1BHGA 5I8SA 3OGSA 4Z1VA 3DPRA 3VBRA 2Q8CA 5KXBA 2GC3A 2QQPA 2XOMA 5DDJ2 2WYFA 2Y6FA 1GP6A 4RQPC 4YVWB 2VZRA 1G7YA 3CIHA 4JZRA 3ROUA 3J7LA 3J8F3 5F2WA 2V73A 4NROA 2DDUA 2XG3A 3OYWB 3OGRA 3ZN6B 1MS1A 2EXHA 3D3AA 5DAXA 1LCLA 1DYKA 3NKGA 2BVBA 4CP2A 4Q1RA 3I3DA 2FD8A 2VQUA 1LHOA 1UQXA 1ZBE2 2MPFA 5IVYA 1PO23 1X7NA 1JU4A 2ZHNA 1QXRA 3M4FA 1JBCA 4AOCA 3K75B 4JKKA 3P1IA 3ZSKA 3VBHC 2WZPP 3K3NA 3ZXLA 2VMGA 1XJAA 3UJQA 3T3YA 2ZGSA 4EJRA 1P8JA 2QQUA 3UJOA 4R9AA 2AGSA 3PUHA 2WSUA 1QJZA 4FQ4A 1QJFA 1RUG2 2E7QA 3QOPA 5GLTA 3VBOA 4CP1A 4CSWA 5A6YA 5EIYB 1TMF1 4Q4V1 4CUBA 3D5OA 3OGGA 4HPKA 1OD5A 1PM7A 2BOIA 2GDFA 5GZFA 2B9UA 2DCTA 4RR3B 2DWRA 1VBD3 1XYPA 3ACHA 2AZ5A 4B7KA 5DPNA 1CAWB 1NLRA 2K2SA 3LE0A 2JKXA 3ITQA 3ZOIA 1JZ6A 1QEXA 1V9U2 4MXWB 2OYZA 4P02B 4QXCA 1CWPA 2VNRA 1R083 4HVOA 2KR2A 2AACA 4JVAA 3ZYBA 3RZJA 2AH2A 4LJHA 2R061 3RZKA 5A1AA 2YC2A 4QPYA 5FMDA 2FCVA 5C5TA 1D2QA 2YGMA 2ET1A 1W8OA 2I74A 1B09A 3RZMA 2YV8A 3TN93 2XH6A 1LHNA 3ZKUA 1ND3C 1SMVA 4KI5M 1R1A1 2R042 4QHBA 1GNZA 1FNYA 3T08A 2BUKA 4UFIA 3PIGA 1AYN1 2VCCA 2HWB2 1V9U3 3HNYM 2IUWA 4P9JA 4AI3A 1SFPA 2ENRA 4CVUA 5KHKA 2ZCWA 1FPN2 1H8TB 3URFA 4XUPA 4QPGA 1WD4A 2VGDA 3FLRA 1K12A 1C3HA 2HKXA 5FPBA 4D94A 3OD0A 4CP9B 4OLLA 5IK4A 4XBQA 3BB6A 1JZ3A 2BTVC 1POV0 3ZX7A 3BI3A 2R0FA 3P3PA 3F2ZA 2R0HA 4KWJA 2PHRA 3VB9A 4EE2A 3FE5A 2CL2A 1AXKA 2NLRA 2VH9A 2BWCA 3B93A 2A6ZA 1WKYA 1QJY3 1VE0A 2HWD1 1SQ4A 4QKDA 2YMZA 3LDRA 4RGAA 3QD6A 1TME3 5F32A 3S7IA 1VRH1 1DU3D 1V6NA 4AFBA 1HX6A 3NJXA 3PU8A 3CJIA 2AC1A 3USSA 2D6PA 4QDSA 5A6ZA 4NPRA 3H3LA 1JZ2A 1O3QA 1V6LA 2WJSA 4KWKA 1U5IA 2ZAHA 2BNOA 2UWCA 3MPBA 3I54A 2ZA9A 2IWGB 5HCAA 3UGHA 3VGIA 1SLLA 1Z0HA 3EMRA 3JBG2 4Y24A 1ZNPA 1ZYBA 2D6LX 5FDBA 1ASJ1 1C8NA 3LEKA 3IIAA 2GAUA 4HONA 1ZZ6A 4CEYA 4MGZE 3IB3A 2JB4A 3O5SA 5FMBA 2RM21 3SISA 4W8JA 4XJUA 3WP6A 4CXWA 3GM8A 3IDCB 4NAOA 4X8NA 4AHWA 4EWEA 4ARYA 4ONUA 5EXOA 1HQNA 4GXLA 3PUQA 3CDZB 4CDXA 2VMHA 2Z79A 5I91A 1ULEA 3KZ4C 3EQEA 3AKSA 3K46A 5FYUA 2YBSA 4XZUG 3CNAA 4XBNA 1H9WA 1OLQA 4HK9A 1MVEA 3H7YA 3OBTA 4CEYB 3IDEA 4BE3A 5LA0A 1OLME 3MFAA 3E6CC 2YGLA 4Y5Z0 2Q8EA 2FDJA 4FTEA 5IT6A 4DUVA 1CIYA 2CSGA 3VBSB 3ZMOA 1JN2P 4M3CF 3R4UA 5FAXA 4FOVA 4NWWA 4CDXB 1UYPA 2IXKA 2E7TA 3OUIA 5FFOC 3V0AB 2DU1A 4Y1ZA 3BTYA 5JZGC 2DVFA 4KNCA 1V6MA 4K3UA 5JOXA 3D0JA 4HVQA 2BPA2 4YSFA 2XR4A 3K3OA 5C3OA 1DYPA 1S0DA 2HLEA 4CU6A 2B46X 1C1FA 4B29A 1TMF3 3DN7A 3KQRA 4IDZA 2D97A 2PLV2 3BPZA 3S6PA 3M3CA 3N9PA 5FXXA 1Q8OA 4CDUC 5C3SA 2XDVA 3O1VA 2HWE1 1GOHA 1WCSA 2RHPA 4FP2A 2VW1A 1GV9A 1HB3A 1KFUL 1YQCA 2PAEA 3MICA 4JGZB 5A3LA 2QQVA 1SLBA 1MS9A 5ERLA 3IMNA 2R073 4YARA 1W6PA 1OKOA 3H3UA 3T30A 3AXDA 1IPKA 3POIA 2VZ3A 1NOVA 2ES3A 2PHWA 1CONA 4XFAA 2WN3A 4QX8A 5EYXA 3FX3A 1MQTB 1X33A 2GNDA 2OQ6A 4NUBA 4COVA 4BMBA 2ETEA 1Z7S2 3H50A 1W6NA 3WNXA 5CA6A 1GKBA 4CUCA 3MI8A 3O0VA 3A4UA 1E5SA 2CV6A 3J7MA 2JXAA 2IXJA 4ASLA 3HT1A 2EIDA 4IV3C 3WF2A 1QQP2 2FCTA 2XKOA 1PX4A 1S0GA 3J7NA 4K8RB 5BXXA 4FOQA 4AEDA 4BISA 1B35B 2OX0A 4BHPA 2CDPA 2PTMA 2WZR3 2YG0A 4MH0E 3GCWA 3OBRA 4KMQA 4BPZA 4CDXC 4AI8A 1ZZ8A 5I0TA 4PIXA 5C3PA 5C5UA 5CFDB 5F9TA 1RINA 3PMEA 1O59A 1LNSA 1OFSA 5F2SA 2ZACA 3IPVB 5J36A 2D3PA 4BU2A 2JE8A 4K7JA 4YM3A 4KH9A 1VBC1 2WLPA 2VZTA 1GMMA 3IZOA 4R9BA 4V1PA 3AKRA 2DFCA 4EN8B 2Y6KA 1CAUB 4QX7A 1ULPA 2ARAA 5IUQA 1NZCA 4FBFA 1NE6A 2JDHA 2VU9A 3NSTA 3PJYA 1C8M2 3WF3A 4C1XA 2K46A 3WX5A 5FXWA 5IVFA 2FDHA 2JG8B 3K51A 4XBLA 2ZEYA 4K9SA 1W2TA 1VRH3 5BV6A 4NR1A 4BDVB 3K4AA 1KXGA 1VBE3 5F3GA 1AYM1 1UWWA 5FZ0A 1HXS2 4NHMA 1D4VB 1JODA 3TBDA 4E8CA 1OBNA 1QH7A 3NV1A 4N43C 4X8PA 4XTMA 1IQDC 1X8EA 1NG0A 3J26N 4COUA 1MEC3 2HWF2 1XNAA 4O9EA 4RGKA 3WDXA 1D0GA 1UNBA 4IV1C 3ZXFA 4XDPA 2NZ9A 1OPMA 4LO8A 3PTYA 3WOGA 1WBLA 3K4ZA 1O91A 2ZX2A 2C4XA 2Q4SA 3AL5A 2XWJB 3KV4A 1URXA 3V0BA 1QMJA 4MYEA 4QDQA 1AF9A 4AI0A 4QQLA 1AL23 2VW2A 4OI2A 1ONAA 4OCTA 5JOYA 1UO9A 1NKGA 1X9TA 2Y0OA 3NV2A 3OUJA 3HQRA 2JG9A 1L3JA 1ND2C 2VZPA 2VJXA 2YUEA 2X5IC 4JV4A 4XCAA 4DUXA 5D8AB 1AR92 2HWC3 5LBEA 5FYBA 4NJ4A 1J83A 2ZEZA 2P34A 4ASKA 2WS91 4QD2A 5IVCA 1Q8QA 2VZSA 1K45A 2WO7A 2E53A 3GZAA 4AK3A 2D6MA 2ZPXA 1SBEA 2OXBA 3FLPA 4Y5SA 5DAPA 5A7PA 3VHNA 2AR6A 4RA0A 4DFSA 5C70A 4C8DA 2B8MA 1H30A 3AKTA 4FTBA 3RZZA 3B9CA 2EALA 1MS5A 4KBZA 4EZHA 1FT9A 5DZEA 4NRPA 4M3CA 4FXGB 2VXRA 3SQOA 4HOOA 2BGOA 4JDMA 2Q1MA 3W58A 3VUOA 2B9VA 3CZJA 4Q0PA 5FRAA 2BBVA 5I93A 1LAJA 5F3EA 4TTGA 4JTOA 3VZNA 1U5XA 1SBDA 3KQ4B 3ZFFA 1DGWX 5FWEA 2YFUA 5JUVA 4XYXA 1AX2A 1QU0A 5FBJA 5EFUA 5A32B 2GNBA 4GKYA 4WM7A 1RUF3 1ENSA 1XU1A 1N3QA 1V6KA 4B4QA 2CNAA 1J3PA 2RS31 4RS5A 2XLGA 4BQWA 1WLCA 2QDRA 1HV1A 1OA4A 4KWLA 3JD72 2VNGA 3WP5A 1AZDA 1F9KA 1OQEA 3UL2A 1GNYA 3W21A 4D6RA 4I0BA 1JZ4A 3SC7X 5I8YA 1ZBA1 1UXZA 2WO1A 1RMU1 1COV1 1EV11 1XRUA 5ACA2 4N53C 2ZS6B 2BOJA 4XW3A 3JZVA 2KD7A 4GWNA 5JCTA 5FY9A 3I8TA 2DF7A 3ILRA 2XJSA 3Q8CA 1W8FA 4Z07A 1VAKA 3DCQA 3MIGA 4IE4A 1LR5A 3TAYA 1VBB2 4ISQA 4Q4Y2 2Z5WA 1GR3A 1W28A 2N7GA 4Q4W3 4Q8LA 4XUNA 5F1RA 5JSRA 5T5PA 2ID4A 2C9AA 5D21A 2ZGLA 1SEFA 2X8KA 4QGLA 1DZQA 4FOWA 2EIGA 3MLLA 2LRPA 3MPPG 4YGEA 3AZWA 4ZPIA 3ZIWA 4AW7A 2VMCA 4G3YC 5KHJA 1UN1A 4GH4C 4H2AA 2P5BA 3VHRA 4A44A 1YI7A 2WNVA 2YPJA 5A7NA 4AF9A 5C8CC 4BQ5A 4MLOA 2VO5A 1W6MA 3ZFEA 1X50A 1AYM3 2XL7A 4AGGA 3LB9A 1FI2A 3B9IA 4DB5A 4DIQA 4EN9B 3E97A 5ABJA 2Q1ZB 1UF2C 3NNJA 1K5MA 2VOVA 1RHI3 2IFWA 3PUAA 4FFGA 1EPWA 5C7GA 5C4WC 5FK8A 3C7FA 5J3UA 1OT5A 4I01A 4YNIA 4LBQB 4PDWC 3CMGA 2ZGKA 3A0KA 3KS7A 3JB4C 3VBFA 3BUCA 2E9QA 3R4SA 2J1SA 4YM0A 3BU7A 3ZXAC 1AR82 1FX5A 1QJX1 3FN9A 2ZGQA 1SDWA 4INDA 3WUDA 2CGNA 3AC0A 1HW5A 4CA9A 2XPJA 4NMIA 5ABJB 2WC2A 4RL7A 2QQJA 3VHPA 2QJVA 2GN7A 4AXOA 3B01A 4PI2A 1F5JA 1GZ9A 2Y6JA 1EPZA 3AB0A 3SEEA 1RUH2 4DXRA 5JIAA 2AUYA 3KT7A 3QCWA 1JH5A 2P6HA 1H6YA 4CCLA 4FCAA 1RUI2 5HCHA 1LENA 4FP3A 4LULA 2D43A 4LT5A 4JGYB 3ZSLA 4N90A 4YM2A 5FXVA 1WA4A 2WS93 2DVGA 1BYHA 4LOTA 4NE9A 3WD5A 3PIJA 1UCXA 4GA9A 5B4NA 4LQRA 5L36A 5LW9A 4S2HA 1R091 1GANA 3N9NA 3NAPC 3NVCA 2XKPA 1H2KA 1BMV1 2W92A 1ULFA 1YIFA 2WIIB 1D2SA 2W95A 2C26A 4F8AA 3T0BA 1NCQA 2LALA 4UYBA 3PVEA 2Q8OA 4G4FA 2XL9A 2XJQA 1ALYA 2P3IA 1PZ8A 2W46A 1QOSA 3I2GA 3SH4A 2VZUA 4E2SA 2DVBA 3HWJA 4NOTA 3H8UA 2J1RA 5CVRA 1O6UA 4QGMA 4QX1A 5CZKA 3FLTA 2CAVA 2IVJA 2X09A 1AVBA 3LIHA 3OGJA 4S2FA 4Y3OA 4YGCA 3BPSA 1X36A 4XQ4A 2QZ3A 4YVSC 3E6DA 3VV1A 2XHKA 2P3JA 2W1UA 4IGPA 2RS33 1RUD1 2GNTA 5FUNA 5A80A 3K4DA 5FTTC 3X29B 1EAH1 4AI1A 5IYYA 2D5HA 4O9GA 4Q26A 4LK7A 1UU4A 1LEMA 4YFZA 3ABZA 4XZPA 4DQAA 3MW4A 4F7ZA 3CJXA 1JOBA 3DKQA 1OC1A 2YU2A 3KWVA 4QQHA 1ZBA3 5BNPB 1VBA1 3KF3A 5K9YA 1RMU3 3ZLIA 1N3OA 2WQZC 1EV13 3NV3A 5BNNC 1W6OB 4JDOA 3RS6A 2E51A 4PBOA 5L7OC 1POV3 3O1PA 2J1EA 3UT0A 1O4TA 1S0EA 1KFXL 2CTVA 3MBWA 5BNOA 3C7EA 3VDDC 4D6QA 2G9FA 3JUUA 1LTEA 4FPFA 3HVDA 1UYYA 4LE4A 4GWJA 1BKZA 5JOZA 1OMIA 1US3A 5E89A 4DXTA 3O1RA 1OOPB 1CZSA 3USUA 1XSRA 1UY0A 2OPWA 3ZXDA 3GBFA 2PQSA 5FO8B 4TXWA 4AWDA 4XE9A 1BBT3 5EPAA 3H8XA 4Y5TA 2JENA 3WW1A 1WMDA 4OI4A 3WEZA 1DQ5A 4P14A 1QKQA 2RDSA 2BP6A 4BM8A 1U12A 3VBUA 1BCXA 1NX9A 3EHKA 4AHYA 1G9DA 1O3SA 4CXXA 1CZVA 1W9YA 2RMU3 5I0RA 1CX1A 4B8EA 2YROA 3KGLA 5DG1A 3VD3A 4BQYA 4FVVA 4MGSA 4UBHA 5CFCC 3S7EA 1OKQA 1ODMA 1YQ6A 1PO21 1ZA4A 2OA2A 4GAZA 4JQTA 4A42A 2VZQA 2WSVA 2GC0A 1S0CA 1OUSA 1L7QA 1T6GC 5DDJ1 3NMBA 5K0UA 1I5PA 1D0HA 3VBUB 4DY5A 1PO12 1HJFA 4M3CE 2RJ2A 4XF0A 3N7MA 1Q8VA 2VVFA 5C33A 3BIEA 5CAZA 3AVRA 3S57A 1PGL2 3FHAA 5EYYA 2V5DA 1NA1B 1UY3A 2A5ZA 2QTWB 4JDNA 4S2DA 3WXPA 3W59A 1SCSA 2YZ4A 2X05A 4OQ9A 1OURA 4AQ2A 2EXKA 3PVBB 1PGSA 1IG0A 1PIV3 5FZMA 1LHWA 5FZOA 3ZIXA 4B4PA 1JYTA 2R1DA 4YPJA 4HKWA 4Y22A 1YUDA 4K1ZA 1Y3TA 3GCXA 1PNGA 4UWDA 1RB8G 5A7OA 3MIBA 2YBPA 1GWMA 1R081 2QQIA 2DV9A 1RUC2 2ZHKA 4AL9A 1RUG1 5D1IA 3AP7A 1DQ2A 4HSJA 1BEV3 1W06A 1XSQA 3KT4A 4XHXA 1V70A 4FFIA 4RR3C 4E4ZA 3LAGA 3I59B 1VMFA 1YXWA 5T5OA 5A1FA 2ORZA 2VVEA 4QM8A 3RJ2X 3ZDVA 2JDUA 2UY9A 5FZOB 3ZFGA 3TN91 1AR62 2FDIA 3OY8A 3BVCA 5FO7B 4BIFA 1AUYA 4G9SB 1FMD2 4N9HA 3RFRA 2GALA 1Y9QA 1IHMA 1O5LA 5CKQA 3QBQA 1V9U1 2BBAA 3ES4A 1CZTA 3FBMA 4CDWA 3ZM8A 1UYZA 1HRV2 1SPPA 2VCMA 1MZEA 1ULGA 2QDNA 5HXMA 5KC6A 5A70A 3INAA 4CDQA 4MOAA 1F35A 2Z42A 3VN4A 1ZRIA 4XJWA 4W4ZA 4KU8A 1W90A 1WW6A 3SKVA 3KCCA 1HRI2 4QPIB 5FYSA 4OI0A 3AXEA 2VQTA 4QT6A 4Q0UA 1FOD2 3M3IA 4QQ2A 2JJ6A 1YRZA 3OBAA 3A23A 2VQ0A 4Z82A 2HWB1 2D98A 2WABA 1H8TC 1AHSA 3C7HA 2IZWA 2B39A 2EICA 1FPN1 4X6RB 1Q8SA 2YYOA 1ZX5A 2MNGA 4E4HA 1RUE2 1N47A 4D6SA 5IHRA 1HV0A 1VBA3 2A3WA 5HV0A 4M0NA 4S2GA 4LEJA 3DEMA 1D7PM 2DTWA 5T54A 1YFUA 4COZA 3AZXA 1JYCA 2RR12 1RUJ2 1TZOA 2WNUA 1KQRA 1A8DA 4H7LA 4XPVA 4AZZA 1NY72 3O7OA 2PQQA 5H9QA 3QH7A 5C9AA 1UZWA 1D4M2 2XBO3 4DNYA 5JXHA 2EAAA 3OBZA 5AVPA 4HFSA 1JU3A 1UOFA 4W65A 2PHDA 4XFGA 1WMEA 5FKBA 5FV3A 1UMHA 4UAPA 1QDOA 1RVF2 4I0WB 5DG2A 1JI6A 2P37A 5HV4A 3U4XA 1DLLA 1IS4A 5SV5A 1JZ7A 5FY0A 5AC92 1K5JA 1MZFA 3W5MA 4XABA 2BJSA 5GKAC 4YW3A 4OQ8A 5F37A 3JQWA 2Y6LA 4WM8B 3M3EA 4Y20A 1V6JA 1ZRRA 2BGCA 1REDA 2NMOA 3MO4A 3MW2A 2BVVA 4CYDA 4NIHA 4COYA 2VY0A 2G4IA 3DPRB 3ENRA 4FPEA 1OD3A 4WV8A 3VBRB 3ZDSA 4I3PA 3WDUA 1AR72 1WLDA 2XVKA 5DDJ3 2BZDA 4MG2A 2VL4A 2ZGMA 1MS3A 2CHHA 3ZR5A 1OUXA 1CAXA 3SITA 1VP6A 3O0WA 1F8VA 1ZRCA 4CEWA 3IKWA 4IE6A 1PK6A 4YLZA 1V0AA 4J1WA 3I7DA 5GZEA 3LKJA 1ZBE3 3LEGA 5JAXA 3VBSC 1OA3A 3EYPA 3CKHA 1FV3A 1W99A 2VOXA 3KGZA 4RD7A 1GYKA 4Y1UA 4UFJA 4OUMA 1LOFC 1JOPA 4UFLA 3HQXA 5CU1A 3A22A 3OCPA 2R071 4ZHNA 3MEPA 3ACLA 4P9XA 3D0SA 4PBPA 1S4CA 2FHRA 3ETPA 3VBOB 1US2A 3AMMA 3HOBA 5DAWA 3M70A 2VOTA 1RUG3 3NKTA 3MLJA 4HPKB 4NVPA 5A6QA 4AAPA 1NCRA 3FFZA 3U11A 1NQJA 1IS5A 2ZX1A 1QH6A 3OF1A 4I30A 3PMSA 4JGZC 2CWMA 5FUPA 5LASA 1DQ6A 2WAOA 1H9PA 4ES8A 3L2HA 1H0BA 4HETA 2A3YA 3SKJE 2ZZQA 3D82A 1WCUA 5GLVA 1BJQA 1JHJA 1H8VA 5FWJA 3S0MA 4QQPA 3ZXKA 4YW5A 1WLWA 2WZR1 1MQTC 3WNNA 4AHXA 1I3HA 2J42A 3OPWA 3WNLA 1PVC2 2ZXQA 4XACA 3WDWA 1ZRDA 4NIDA 4GIQA 5GLWA 3BTAA 4FI9A 4A7YA 2WWSA 4AEJA 4AVSA 4BH9A 3BIWE 3AYAA 2R043 1GU3A 2A3XA 1ODNA 2D6KA 5A3UA 4WVVA 2HWB3 3FUOA 2HYXA 3DV8A 2ARBA 4J25A 4Y1YA 4FPCA 1B35C 5E1RA 4RHV2 3BKZA 1LHVA 3LDKA 1FPN3 2QQOA 4QPGB 4GMP0 4UF0A 1ZM1A 2BQPA 2VNOA 4NHKA 1DIWA 3U1XA 3E1F1 4RYDA 2VUCA 1U5YA 5HXVA 3VZMA 5CFDC 2QNKA 5CB7A 4D0QA 5FR3A 1VBE1 5FZ6A 2LM3A 4FO9A 4OFGA 3ME2A 4BMEA 4CP0A 5K8SA 4KWUA 1LULA 4L92A 2DUPA 3ETQA 4QQOA 4E4SA 3TB0A 1UL9A 2VR4A 1MEC1 4W6YA 4DEQA 3TEYA 1E57A 2JG8C 2Z2SB 4RQPA 2YC0A 5LA2A 4A2UA 3W9AA 3WQ0A 4EQVA 1WW4A 2ZX3A 3FHIB 3CJIB 1RC6A 1IG3A 2P1BA 1LB2A 3AYEA 5ANNA 5FY7A 3WHTA 1M06G 1HXS1 1AL21 1ZZBA 1S2BA 1I6XA 2ZKNA 5T55A 3S30A 2C5DA 4QXKA 3D4KA 5DUWA 3VBHA 3JBG3 2XJRA 1OA2A 3Q9OA 3B00A 4AVVA 1CVNA 2AENA 2HWC1 1XNDA 4LK6A 2A75A 3ZSJA 1WCKA 5FPVA 4C0HA 1UZZA 2DCYA 3A0NA 1TEIA 4HVRA 2D5FA 2A70A 2VPVA 4JAAA 5FP4A 3MV01 5IK5A 1HJGA 2TEPA 2NM1A 1G9FA 2J1VA 5A7WA 1JOJA 3POGA 3GZTB 1NE4A 1TNFA 2D3RA 4RSUA 1SFYA 2VE1A 3J4UH 1YJLA 4H7MA 1RYYA 5A3OA 1I9RA 4IEYA 2UU8A 5D8AC 3TRSB 3WDYA 3M1HA 1TG7A 1XXNA 2CWSA 1NUKA 3DXUA 3TNQA 2HBUA 3WF0A 3Q8EA 1LHUA 4Q4V2 1DYOA 3U78A 4V2WA 1HKDA 5CKNA 2ZGUA 1UU6A 2YFZA 4LUMA 1WWYA 5L9BA 1ENQA 1OQ1A 3LF7A 4XFBA 1RUF1 2XVLA 3WUCA 2R16A 1AX0A 1ND3A 3H1MA 3WCRA 4LE3A 5FZGA 5BUVA 1UZ0A 3H9AA 4Y33A 5JR7B 1UW8A 3I97A 4QHOA 2K9ZA 2WZEA 5KHIA 2X10A 4PQ9A 3VKMA 2R062 2PLV3 3CF6E 4LBOA 1PNFA 2RS52 4UOJA 2EXJA 2Y6HA 4LMFA 4XJ8A 4N7IA 4BK5A 2MEV2 1Y9MA 3WP4A 2RS12 1XPWA 4P5HA 2W52A 2ILMA 1W6PB 5G04L 1R1A2
chains in the Genus database with same CATH topology
1VALA 2D93A 1O3RA 1LOAA 1AYN2 1QWRA 4Q29A 5JOWA 4LHLA 1UPSA 2VECA 4OZXA 5IK7A 5KXCA 1WBFA 1DGLA 3SNMA 2ZGOA 4XTPA 2SLIA 1IS6A 3RJRA 1GQGA 1JXNA 2A6XA 1W6NB 3I2DA 4N7UA 4Q4W1 1Z7S3 3JD71 5E16A 2FMDA 3BOPA 4PF5A 2AREA 4OUSA 5JVVA 2FZ1A 2UY8A 1H4GA 2DCKA 2RJLA 2DCZA 2DVAA 4Q4X2 1QQP3 3LCPA 4GB32 4AEDB 2TNFA 4Q27A 1HDKA 2HWD2 3V64A 1NYWA 4BQ1A 5J48A 1S0JA 2UYBA 3H7JA 3OD4A 4IEWA 4AEKA 3WR0A 2KXLA 4Q4Y1 3VKOA 2R6QA 2W08A 1N1SA 4C91A 3RQ0A 2H6CA 4Q0SA 3ZYPA 5KC5A 3N3HA 4IESA 1RHI1 1C8M3 1UZYA 3SH5A 2XGXA 3PHMA 2ZABA 2ZGNA 1ASJ2 4OHWA 4HN1A 3CO2A 2DVDA 4MSVA 4AGVA 4PLNA 1HXS3 4BCUA 1LU2A 1NLSA 2ZMKA 4Q1PA 2X29A 4GULA 5FPZA 3MW3A 4JRLA 1Z78A 2LTNA 1W2UA 3MIDA 3E5UA 4GQ7A 4HSLA 2HWF3 5T50A 2JDZA 3H0OA 1HQLA 1LGNA 3H1YA 1VJ2A 5JZGA 1AR81 1CAVA 2B42B 4AYUA 4CRQA 3V0BB 2ARXA 3M3QA 3VHOA 4CDUA 5T5JA 5J7MA 2TUNA 4L97A 1H2LA 4LNVA 4KQ7A 2D40A 2W39A 2JG9B 3RI9A 1GZWA 3WCSA 3B94A 2WFPA 2FQPA 4JGYC 1AR93 1CAVB 1O5UA 2QUOA 1NXMA 4Q0VA 5KBFA 2JKBA 2HWE2 4ATFA 1X82A 1QOOA 2NP0A 3T1MA 1XYNA 4QGNA 4XDQA 3AFKA 4XXAA 4YZ1A 3ZXEA 4AEMA 1HLCA 4LBKA 4M3CB 4IV3A 2XJPA 1KS5A 4JTNA 2Q0AA 1QXPA 4DRVA 2PHFA 2ZJCA 3ZO0B 1GZCA 3SLIA 2XJUA 1LOGA 1PMIA 3ZFFB 1PGW2 5L73A 4DMIA 2GZWA 4M00A 5GJ6A 4P9GA 4WM7B 1YCIA 1DFQA 1ENRA 3M8LA 4Y4YA 2ZHMA 3ST7A 1POV1 4YW1A 1RUOA 4RS5B 3LSDA 4FPHA 3O12A 4XQWA 5FMOL 3WVJA 3JD73 2D6OX 3POYA 5HCBA 3DGTA 4R9DA 5EWSA 4GMP1 5BNPC 4ZU5A 4K6BA 1VBC2 4UW6A 3ILFA 1S1AA 5LEJA 5ACA3 5HCFA 1BBT1 5I0UA 4N43A 4Q0QA 2IXLA 2JE7A 3ZXJA 5SV8A 5EV7A 4IV1A 3TYJA 3UKNA 4B4RA 1VBB3 4Q4Y3 1OOPC 5FOJB 1DHKB 1JW6A 2RMU1 2GMPA 2Y38A 4KGQA 2WT0A 3ZSMA 4L9BA 3WDVA 1LGBA 5BY5A 4FAHA 2GC2A 1LODA 5KWRA 2CGPA 2QKDA 4RFT0 4GKXA 4U2AA 2WNVB 2SBAA 2ZX4A 1ND2A 3PVOA 2X5IA 1W6MB 3ZFEB 4FPOB 3JU9A 3UKVA 1YO8A 1AJKA 4NHLA 3ZYRA 4OHZA 1U5ZA 1K5MB 1UAIA 1OLRA 1VB2A 3MGUA 4K20A 2ZMLA 4MGKE 2VMIA 3WLUA 2LUWA 1LOBA 1PIV1 3VBFB 1AXYA 4IEVA 3AJYA 4Y26A 1RIRA 1YWKA 2O8QA 1SLIA 2QFEA 4XF1A 3QACA 2OIIA 5J09A 1AR83 2W0XA 5AFBA 1ZREA 3MIEA 4K40A 1A6CA 1PO11 4LTAA 2VUJA 2XB6C 3WHUA 1PGL1 2DFBA 3L2YA 1NA1C 1BEV1 2A71A 4ITCA 2RJKA 2NYYA 3G6JB 3H1WA 4YM1A 4LO5B 1RUH3 3RI8A 2WT1A 1O4ZA 2A7AA 5GALA 1RUI3 2ZHLA 4LLFA 4FTSA 2XUMA 3G7DA 4AQTA 4HANA 4HLTA 4WBBA 3HN1A 1RUC1 2V5YA 5I0SA 3OJBA 3U0ZA 4JC1A 3RG0A 3WG1A 5JPMB 1UD1A 2PHUA 2WA3A 3GALA 1NCQB 5FO9B 1A78A 3FJSA 3FWEA 1AR61 2DCJA 4XF4A 5JDBA 1LU1A 1FMD1 4LA3A 4N53A 4TSVA 2ZGPA 1VIWB 4AI2A 4YG3A 3UK9A 5LK7B 2A6WA 1HRV1 3WG4A 3L9JT 4MV2A 1OHFA 1WW7A 3MYXA 4P9YA 2Q5TA 1JUHA 4K21A 3EJKA 4QPIC 1COV2 3BCWA 5GZGA 2EAKA 1J3QA 1UIJA 5H9SA 3AJZA 5JLVA 4DRRA 4LBNA 5T52A 3VZOA 4GH4A 1HIXA 1CESA 4AFDA 2XBO1 3ZXGA 4GMP3 2QCSB 5C8CA 2JX9A 1IPJA 2ZGTA 5LRSA 4ATEA 2I07B 1LRHA 3B3QE 1UKRA 2RR11 1J3RA 5BNOB 2NPIA 1EP0A 3APBA 4OULA 5C4WA 5TSWA 1C5IA 4IEPA 2ERFA 4B3NA 4GH4B 2DYCA 4YYOA 4I3GA 1NY71 4PDWA 2D7FA 4OVEA 4I09A 4J6GA 3USUB 4BZ4A 3VKFC 4AFCA 5KXDA 1D4M1 2H0VA 4ORFA 5B2GB 1M4WA 1AJOA 1PZ7A 1MS0A 1V6IA 3EXUA 1OI6A 1W6QA 4AFMA 1CIWA 2R49A 3LA2A 2PA7A 4YGBA 4BIOA 1YNAA 1WMFA 4YVWC 3P3NA 4OHVA 1YHFA 3ES1A 4NN0A 4DZGA 1QJX2 4WM8C 3RSJA 4MGYE 5FQ0A 4YW2A 1ZBE1 3DPRC 2VW0A 3VBRC 2WFF2 1XNBA 3NAPA 3FFQA 1MS8A 1UU5A 1AR71 4YW4A 5K0UB 1Q56A 1IKPA 3PVNA 4XFIA 1PO13 3KB5A 3IWZA 1VR3A 4UW4A 1CPNA 1R092 3QH6A 2PAMA 1QJU2 2EF6A 1BMV2 4EWAA 4Y22B 2BEOA 1UIKA 5KHHA 4YVSA 2WINB 1CN1A 2A73B 3CLPA 1SLTA 3KD4A 3VBOC 1S2KA 5BPXA 1RUC3 2WLQA 3IN9A 1I1EA 1Q8PA 2C1FA 3BOWA 2PN5A 4Z92B 4HK8A 2Q30A 3ZFGB 3OY8B 1AR63 4IXLA 2R041 4ZKTB 5BNNA 1FMD3 4QM9A 1RUD2 1ZZ7A 4FT8A 4LR4A 5L7OA 3SXWA 4BYYA 5J37A 1EAH2 4CDWB 1ZZ9A 4WVMA 1MZ5A 2UYAA 1VAVA 3VDDA 1HRV3 4CDQB 4JQRA 1UX6A 2IXIA 2PFWA 4DINB 4XEZA 4WVWA 5F6KA 2GMEA 5I8TA 1HRI3 4TYSA 2IXHA 4XOGA 4META 2XLFA 3MZHA 1FOD3 1RJ7A 3WY6A 1WLTA 2Z69A 4QPGC 4FPLA 3VDDB 2H6BA 4P9WA 4UXAA 3MIHA 3SCFA 3AYDA 4FXKB 4KGGA 3SMHA 1CD3G 1RUE3 3KCXA 3PNAA 5CBLA 1TE1B 3I4IA 2P2KA 4A7KA 4XF9A 2WNUB 2PELA 5CFCA 2RR13 3POWA 1RUJ3 1RITA 2EVXA 4XJAA 4EWDA 2GN3A 4WZCA 5FCCA 4C1WA 1C5HA 3M2MA 3J8F2 5C9AB 3JBG1 4LA2A 2UWAA 1D4M3 3OYWA 3ZN6A 1YLLA 3CJIC 4HMZA 4PLMA 3HAGA 3ELNA 4TWTA 1RVF3 1DQ4A 4MZUA 1PO22 2E7AA 3ZN5A 3TOJA 1W0PA 1PHMA 2OUHA 3AYCA 1QGLA 1IKQA 1XNCA 4E27A 5AC93 4IERA 1FXZA 5LRRA 5KHGA 4E2QA 4Y20B 2OZ6A 1CR7A 2D6NA 4CEYC 3N7LA 1IZ3A 3H3ZA 2DUQA 5J96B 2K0GA 4RR3A 4CDXC 1SCRA 1VBD2 3ECQA 1AR73 2D3SA 3PJQA 3AZYA 2ZTNA 2JECA 4JCKA 2ZX0A 1NQDA 2FBEA 3FBYA 1CAXB 4EROA 1CAWA 4JRAA 5A3MA 4MXWA 4CEWB 2FMYA 1PK6B 5GZDA 1DZTA 1A8MA 1GNHA 1R082 3D8CA 1H1AA 2PLV1 3MF9A 3AZVA 1GICA 4IEUA 3TN92 3SHRA 5CADA 1IS3A 1SFNA 3LZZA 4MXVA 3MLKA 2QZ2A 2CAUA 3R6SA 1H8TA 3GZUC 1NCRB 1QNWA 1Z7S1 4LHNA 4I2OA 2RS51 4XHBA 3WT3A 5CNAA 2MEV1 2RS11 3THTA 2KA3A 3AP6A 3SCHA 2W68A 1QQP1 1X8MA 3DF0A 3DL3A 1QJY2 1APNA 5E88A 1N1YA 4MGIE 5LK5A 1TME2 1PVC3 2ZKLA 1FYUA 5C8WA 3NV4A 1OFNA 5L19A 1Y7BA 1F31A 1G6NA 1LJ7A 3ASIA 4AEDC 4LO7A 4Q4X1 3O14A 4BOWA 4EV0A 1C8M1 3NO8A 4GB31 2BNNA 1UKGA 4GWMA 4K8FA 1Q3EA 4RHV3 2WA4A 3SH3A 1F5FA 2QVSB 1KITA 4GALA 4LHKA 4KL1A 4HL0A 2CYFA 2VOKA 3AP4A 4PCRA 2CGOA 1JUIA 3DUIA 5KXEA 4NO4A 2XJVA 3ILNA 4AVCA 2VUAA 1VB4A 3LOIA 4OHYA 2HWF1 4Q8KA 4RQPB 3WW2A 3HMYA 3GNEA 3KMHA 2D44A 1DBNA 4L99A 1BK1A 1AL0G 3MF6A 2OW4A 4E4DX 3GHMA 3R05A 3AP9A 2CY6A 3V56A 4DY3A 4LBLA 2KM2A 4ISRA 3AP5A 3WV6A 3MDPA 3VBSA 1YIPA 1YFXA 4D7SA 1V6OA 5JI7A 3LGRA 1LOFA 4SLIA 3VBHB 4YZ4A 3V0AA 2O0OA 4Y1XA 1N1TA 4AG4A 5GLZA 2HEWF 1LECA 1AR91 2GNMA 1J59A 1BXHA 1TMF2 2Y0IA 5JMCA 3NL1A 1ULDA 1REFA 5GLUA 3AX4A 3MFCA 1DGRA 2JG9C 4JGZA 3U07A 2R072 4AVTA 4CZSA 3CU7A 3WG3A 5DXDA 4PIZA 4HKLA 1QXJA 3UKTA 1FAYA 4Q4V3 1MQTA 1S0BA 5FOBB 4YZ3A 5GM0A 3J9SA 4ASMB 4IEXA 1O3TA 1ND3B 2VOWA 2HEYF 1LEDA 3VKLA 3HT2A 4DXZA 2WZR2 1B35A 2ZOEB 4AHZA 2R063 4QX5A 3ZFFC 1MS4A 2RS53 5CFDA 1LOEA 3ZPYA 1H1IA 1PGW1 2F4PA 3IPVA 2MEV3 2RS13 3E5QA 4WM7C 2C0ZA 2PYTA 2ZBJA 4I02A 4KG0A 1R1A3 3QLQA 5ACA1 1PVXA 4OHXA 1CAUA 1AYN3 4RS5C 3AFGA 5JWPA 3HIFA 3M7AA 3JCIA 4IQPA 4N9IA 5AFEA 3ZSEA 4FQZA 5BYNA 3VZLA 2HYKA 2JG8A 4D7TA 1VBB1 1C4RA 1VRH2 4F3JA 2B45X 3RMXA 4YGDA 3AKPA 4L11A 4FOYA 2BW8A 1QHDA 1VBE2 1BVVA 3VZKA 2HJIA 4OI1A 1I5ZA 4C0BA 4IETA 4WZFA 5H9RA 4Q4X3 3AMHA 4GB33 1MEC2 3POSA 2OZJA 2HWD3 1KRIA 2R30A 1MVQA 4AVAA 3AMNA 1SBFA 2O8OA 1QDCA 3ZYIB 2ZGRA 3N7KA 3OTFA 3KLSA 5GZCA 1QY4A 2RM22 1EY2A 1ZRFA 2ET7A 1AL22 4YRDA 1RUNA 1H1MA 3CL1A 4R8HA 4D69A 2YHJA 4TLFA 3N36A 1BQPA 4ES9A 2PHXA 4XQDA 1GLHA 1TQ5A 2WNVC 3IM0A 1GSLA 2WL1A 1SACA 3AZZA 1ASJ3 5IK8A 2HWC2 3VZJA 5D8AA 3ZFEC 1C28A 2P3KA 5ABJC 3RYPA 1VLNA 3LWCA 1K5MC 4XJ9A 2RM23 1G9BA 3FZ3A 4LO4B 4XJZA 1XNKA 3VBFC 4P9LA 3LA3A 1RUH1 2RE9A 5CG8A 4IEZA 2H0BA 5JZGB 1SLCA 4LBMA 4XMIA 3RDIA 1RL3A 1BVP1 1RUI1 2DUOA 2NN8A 1EYBA 1XU2A 4UBGA 5E8AA 4B7EA 1YFWA 4CDUB 4U36A 2GH2A 2XWBB 2GU9A 3DKWA 1A3KA 5A32A 5DUUA 1RUF2 1GZWB 4URTA 1VAMA 3FUQA 3VL9A 3RRDA 3RYKA 2X53S 2BWAA 4LLOA 1G9AA 3T2TA 4MX3A 1RJ8A 4XFCA 4YFWA 1FV2A 1KJRA 1MACA 2IXCA 3NJZA 4RGGA 1H4HA 3B5LB 2EA7A 2HWE3 2PHLA 3D6EA 1V00A 4NWVA 5EZWA 4Z2WA 5FLIA 4D7YA 1NCQC 1G9CA 4QMAA 1N3PA 1R1ZA 4IV3B 4IEOA 2ATFA 1WCDJ 4AQ6A 2BFUL 1IGOA 4IL7A 2AYHA 4K1YA 2VVDA 4FPKA 1KD7A 3BALA 4AFAA 1WUVA 1XYOA 4M0HA 4Q4W2 4Q2FA 3VLBB 1ZVFA 4F83A 1J1LA 5DUXA 4R9CA 1O7FA 3FC0A 3FMGA 3WW4A 1DGRN 4UW5A 2XVGA 2G9GA 3E5XA 3RMYA 1G8WA 3V65A 4AE2A 3JQXA 1S0IA 4PJYA 1Q43A 1QF3A 5FLJA 3JB8A 2PAKA 3K48A 3WZ1A 4KG8A 5JIUA 1AYM2 2V09A 1VBC3 3EO6A 4QU2A 2TBVA 2GH8A 5DZFA 1O4YA 2A6YA 1XE8A 5JI9A 1DQ1A 1KJLA 1AXZA 1RHI2 4N43B 5BNOC 3U10A 3IT8A 1UMZA 3VL8A 1KS4A 1PZ9A 1HQWA 4IV1B 4LBQA 2DURA 4LBQD 1CQ9A 4R4ZA 3C2UA 1H2NA 1REEA 4DOUA 4FPYA 1LESA 3AM2A 1XQNA 4A3XA 1GBGA 2BYVE 4XETA 5JSOA 3LSEA 3LOBA