3B00A

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8 in complex with cetyltrimethylammonium bromide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
251
structure length
251
Chain Sequence
b'EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Laminarinase
molecule tags Hydrolase
source organism Thermotoga maritima
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
total genus 58
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3b00A00
2ZGSA 5JVVA 2Q5TA 1IKPA 2DTWA 4YW3A 4ASMB 1AX0A 1VAMA 4Y24A 3A0NA 1Q56A 2DU0A 1W6MA 4LBMA 3OY8A 4XJZA 2OVUA 5T50A 4JC1A 4PF5A 1G86A 4YZ5A 2CNAA 4FOQA 4YGCA 2E7QA 3D5OA 2WSVA 2R1DA 4YGEA 3WDXA 3WDVA 1LGBA 4Q27A 3AP6A 1GZWB 2R0HA 4LBLA 4D69A 5GALA 2GN7A 3ILNA 2DVAA 3VKOA 4Z8BA 1DBNA 2G4IA 4DPNA 4BM8A 1IS6A 4PBPA 3WUCA 1LOFC 3BODA 1A8DA 4R9CA 4YG6A 1CPMA 1XQNA 2CWMA 3UJOA 5GLVA 5CBLA 3FUQA 4LBQD 2DURA 2JDZA 2NM1A 4LBQB 2NP0A 1MS8A 2VH9A 3ZYPA 1LOFA 1FV2A 2ZHMA 4WZFA 3FUOA 1PZ9A 4GXLA 3RRDA 5GZGA 3GALA 4M00A 3TB0A 2A71A 1BQPA 1LOCA 1LOGA 2WLQA 2SLIA 2EXKA 2VY0A 4XIKA 2RHPA 3WCSA 1BJQA 4M3CA 1SLTA 1WW6A 2ARBA 1GZ9A 3HMYA 3WOGA 1YRZA 3I8TA 1WD3A 2PHFA 1NXD1 4XXPA 2JECA 4YLZA 2JKBA 2ZMNA 3PVNA 2R16A 5EYXA 1A78A 1RITA 1V6IA 1WW7A 4YZ3A 2PHRA 1YXWA 3MW4A 4FPEA 1LECA 3B9CA 1HLCA 1N1VA 3D6EA 3ILRA 2DUPA 4CTEA 2JJ6A 3AYEA 1W0OA 1AXZA 2ES3A 2ZHNA 3AZYA 3IM0A 4LBQA 1QNWA 3W58A 4R9AA 1YIFA 2VW1A 3WG3A 1ONAA 2UURA 2DYCA 1JN2P 1CR7A 1ENSA 3FFZA 1SLCA 4ZKTB 1RINA 2AUYA 1DQ2A 1WW5A 3TAYA 3V0BA 2XG3A 2GALA 4Y1ZA 1UN1A 4TZDA 4YM3A 4PCRA 1PZ7A 1DQ1A 4R9DA 2YMZA 4XMAA 4ATEA 2DVDA 2W52A 4FPHA 4K1ZA 2V73A 5JDBA 2CWSA 3C2UA 3UK9A 2EXIA 1Q8VA 4XYXA 1V6KA 1Q8QA 4BPZA 4YW4A 2WQZC 1V6MA 3ZXFA 1DQ5A 3N7KA 4M01A 5BYNA 5EYYA 2A70A 2AH2A 4Y26A 3N7JA 3ZYRA 5F5QA 1ENQA 4AWDA 1GV9A 1MACA 2NMNA 1BXHA 3AK0A 4K21A 3IKWA 3V65A 2GN3A 2EXHA 2UWAA 2ZGPA 1I1EA 2E7TA 4XE9A 3OJBA 2CYFA 2A3XA 4Y20A 2DUQA 4YFWA 2GNMA 3OY8B 4WVWA 3T1MA 4YM2A 1IS5A 5CAZA 1S0FA 1X50A 2A3WA 2DWRA 3ZSLA 2A75A 3A0KA 1NLSA 3LSDA 4Y20B 2ZHKA 3ZSJA 5GLUA 1W6MB 2ZACA 5T54A 2W68A 4ISRA 1N1TA 3M3QA 5GLWA 2ZKNA 5DXDA 2ZAAA 3WG2A 4JCKA 1RIRA 3ASIA 4FPKA 1FYUA 2PHTA 1EPWA 1C57A 2NZ9A 5DG1A 1DFQA 1H9WA 1N47A 3MPPG 4FPCA 2A3YA 2EIGA 1AJKA 1AX2A 2R49A 2WT1A 4DQAA 3ZSMA 1LULA 4XJWA 1W0PA 1QDOA 3L2YA 5DZGA 1W6PB 3WDWA 5CA6A 3DGTA 1GICA 4UW5A 1DQ4A 1R1ZA 2CTVA 3USUB 2YXSA 2ERFA 2UWCA 5SV8A 5IK8A 3VUOA 3RMYA 4U2AA 1FV3A 1GBGA 1CJPA 4LBKA 4XJAA 3OBTA 4DRRA 4P14A 1MVEA 4AGRA 3IPVA 1KITA 1QF3A 4PBOA 2JE9A 5DUWA 4YZ1A 1UPSA 2JE7A 4HL0A 3AZVA 3UL2A 1N1SA 4F83A 3NV4A 1SLAA 4P9WA 2ZGRA 3JUUA 2YY1A 2AR6A 2ZMLA 5T5LA 1HQLA 4FOWA 4XILA 4YW1A 2A6WA 4C1WA 1N3PA 1ULEA 2D6LX 2PHWA 3IPVB 2LALA 4HANA 5T5PA 4H55A 4AYUA 1C4RA 2WNEA 5GJ6A 1Q8OA 2PELA 4XMIA 1S0GA 4YGDA 1AXKA 3QCWA 4YM1A 5IK7A 2A7AA 1Q8SA 1ZM1A 1ULCA 2AREA 2DVBA 1D2SA 1F31A 2D3RA 4Y1UA 5T5JA 1W6OB 1QDCA 3OPZA 1JHNA 1Q8PA 3ILFA 3O0XA 1LHVA 3SITA 2P3JA 2DUOA 3VKFC 1DZQA 1F5FA 1MS5A 3FLPA 3N35A 5DG2A 4Q8KA 3WZ1A 2ZA9A 2TEPA 1FNZA 3NV2A 5T55A 3N3HA 1DQ6A 3SISA 3O5SA 2P37A 2ZHLA 2GNTA 1CVNA 1AXYA 2NYYA 1CPNA 2GMPA 1FAYA 3JU9A 3M3CA 1IS3A 1AF9A 1GNZA 4PQ9A 1V6NA 3RS6A 4DS0A 1A3KA 3ZXEA 2W08A 1SLLA 4FOYA 3N36A 1AJOA 5CNAA 5FREA 1S0EA 3UJQA 1H30A 1SFYA 2GMEA 2UWBA 3LCPA 1CONA 1QMJA 1WBLA 1QOSA 2D6KA 2DV9A 2NMOA 1VAVA 3U4XA 1V6JA 1MR5A 1BYHA 1UAIA 1N3QA 4BLJA 1N1YA 5GZDA 1SCSA 4YG3A 5E8AA 3V0AA 1GNHA 4RL7A 1F9KA 2D44A 3N7LA 5AVAA 1ULGA 4CRQA 2LTNA 1S0JA 4P9XA 4K20A 5JLVA 4DRVA 4CZSA 3T1LA 5DZFA 4LBJA 1FATA 3FBYA 3POWA 4SLIA 4ATFA 1UL9A 2D3PA 3AZXA 5HCBA 2OUJA 4K1YA 2ZGNA 1WW4A 3CNAA 3WDUA 5LK5A 1AVBA 2GNDA 3DUIA 3AP7A 2EAKA 4OZXA 1V6LA 1V6OA 2SBAA 2V5YA 3O12A 4WV8A 4XHXA 3ZXKA 1W6QB 4IQPA 1W6OA 2GNBA 4P9YA 5DUUA 5JMCA 3AZZA 4FPOB 3W59A 1VALA 2A6YA 3ZXLA 2ZZJA 4BMEA 1ENRA 5JOWA 4Q1PA 4XIOA 3WNXA 1VIWB 2VXRA 1UKGA 1LHWA 3OBRA 5KXDA 5H9SA 1WLWA 3M2MA 4XBQA 4Q1RA 4BOWA 2A5ZA 4UW4A 5H9QA 3GNEA 3WDYA 2WT0A 3QLQA 2I2SA 3SH5A 1W6NA 4NO4A 1W6PA 1MZ5A 3FLRA 5IUQA 1DYPA 3R4SA 4XBNA 5DZEA 5FRAA 3ZSKA 2ZMKA 1KJLA 4YG0A 3AJYA 3WUDA 1S0IA 3RG0A 1YI7A 1IOAA 1G9CA 4ZXKA 1KDMA 3HN1A 1GLHA 4C1XA 5GLZA 4GALA 1BKZA 3VKLA 3POSA 2WJSA 4XOGA 2P2KA 5DUXA 4GWNA 1LESA 5H9PA 1IS4A 2WT2A 1G9BA 3V0BB 3RMXA 3V64A 1APNA 1CN1A 3N7MA 2UU8A 4AVTA 3AFKA 1AZDA 1SBFA 1FNYA 3M3EA 4Y22A 2ZABA 2R0FA 4DFSA 4AVVA 1LHOA 4FP3A 2VW2A 3B01A 3WDTA 1CQ9A 1SACA 1O4YA 4FQ4A 4RA0A 3PJQA 1WLDA 2AYHA 3NV3A 2D6NA 3AZWA 4FPLA 1WCSA 4ISQA 4XXAA 1LHUA 4Q2FA 3BTAA 4LBOA 5KXEA 1QOOA 3AYDA 1QU0A 5GZEA 4L8QA 5IK4A 3AXEA 3IMNA 3KM5A 3ZPYA 3PVOA 1Y7BA 2D3SA 2D6MA 2P3IA 4YFZA 1LTEA 1UX6A 2NN8A 1H9PA 3O0VA 2ZGOA 4GWMA 2DU1A 4XDQA 4YM0A 2WSUA 2FHRA 5L73A 2VUAA 1KJRA 1TEIA 3AP5A 4NOTA 1WUVA 2D7FA 4UW6A 1JYIA 2C9AA 4I30A 1AX1A 1LEDA 1QOTA 2Z42A 4R9BA 3WVJA 3PMEA 2A6VA 3KQRA 1J1TA 5GM0A 5HCAA 4XJ8A 2P34A 5JOZA 3I4IA 2FMDA 2JD4A 3V0AB 4Q8LA 2D6OX 1O4ZA 4WVVA 1GKBA 1KQRA 1VLNA 2E53A 1G8WA 1MS4A 5E89A 1S1AA 5T5OA 2VU9A 4ITCA 1G9DA 1DIWA 4W65A 4XTPA 3AP9A 4FOVA 2DVFA 4FQZA 1MS3A 2EALA 1D0HA 4XJ9A 5IK5A 2EF6A 4Y1VA 3SH4A 3AX4A 3AYAA 1S0DA 3B69A 4FPGA 1JBCA 3VKMA 3MW2A 1KRIA 4XHBA 3SH3A 2W39A 5T52A 2ZGLA 1SLIA 3FLTA 1GANA 4FPJA 3VKNA 2D43A 1W6QA 1G7YA 1V00A 2CY6A 5IT6A 1ULDA 4AGGA 1UMZA 1Z0HA 1YYNA 4U36A 1LOEA 1SLBA 3AXDA 1MVQA 2WKKA 2ZGMA 4M3CF 4Q26A 3RQ0A 3MW3A 3AP4A 4AVSA 3SNMA 1JYCA 1C1LA 1G9FA 4YZ4A 2E6VA 1S0CA 4TYSA 1HDKA 2XB6C 2ZGTA 1LGCA 4M3CB 5EWSA 3T2TA 1MS9A 3MEPA 2C5DA 2OW4A 1Z78A 3APBA 3WHTA 1U0AA 1DGLA 5F9TA 5KXCA 2ZGUA 5CB7A 3BOPA 2EXJA 4LBNA 3Q9OA 1LCLA 1ZA4A 2E51A 3D4KA 5DUVA 1LGNA 1QNYA 1QGLA 1CIWA 1GZWA 1DLLA 2YROA 3H0OA 1LENA 3IN9A 3M3OA 4M3CE 2CL2A 4FVVA 3HR9A 2A6ZA 3B3QE 2BQPA 5GZFA 3ZXJA 4BQ1A 4FPFA 1GSLA 1QKQA 2GDFA 1I3HA 2AENA 3M1HA 3B00A 1BZWA 1URXA 1CESA 1SBDA 2AGSA 4KBBA 4Y22B 5EXOA 1OKQA 4YW2A 4MYEA 1OQ1A 1HQWA 3WG1A 1UZYA 3VV1A 5KXBA 2PHXA 2VW0A 2H0BA 1S0BA 3WCRA 4GKYA 4XBLA 1LJ7A 1ULFA 4Y1YA 1WD4A 5GLTA 5GZCA 4UW3A 2ARXA 1SBEA 1LODA 3OGGA 1LHNA 2OUHA 3ATGA 1JW6A 3ENRA 3O0WA 4BMBA 1FX5A 3OYWB 4Y1XA 1UZZA 2D6PA 3WG4A 1G9AA 1WBFA 2B7YA 3AYCA 4FPYA 1MS1A 2ZGQA 4JRAA 5E88A 1C1FA 3BIWE 2DVGA 2YV8A 1JXNA 4XJUA 4XTMA 5JOXA 3POYA 1HKDA 2PHUA 3INAA 3NV1A 1LEMA 2ZBJA 4BLIA 1MS0A 3LSEA 4FP2A 2A6XA 3WLUA 1IKQA 1LOBA 1W6NB 3WV6A 4YGBA 5H9RA 1GYKA 4YZ2A 1YO8A 3R05A 2KM2A 4XZPA 2YZ4A 1GZCA 1KDKA 2GMMA 3AJZA 1LOAA 4GA9A 1LU2A 5JOYA 1MZ6A 1PZ8A 3OYWA 3PVEA 1DHKB 1SCRA 1N3OA 3NWKA 2HYKA 1DQ0A 4YW5A 1LU1A 1B09A 3A4UA 4GKXA 3USUA 1DYKA 3R4UA 2P3KA 1JOJA 1WLCA 3ZVXA 5HCFA 1OFSA 1JUIA 2R1BA 3WHUA 4AGVA 2DTYA 3SLIA 2ENRA 3RSJA 2ZGKA
chains in the Genus database with same CATH superfamily
1VRH3 2XPJA 3K4AA 4IESA 2Q5TA 2VCBA 2DTWA 1D4M3 4QXBA 5FUPA 1W6MA 4LBMA 5DQ0A 3OY8A 4JDMA 4XJZA 5IW0A 2FBEA 5HPOA 2BGPA 1YFUA 2Q8EA 3D82A 1K5MB 1G86A 3B7MA 3I2HA 3ZM8A 3ZN6A 5JSPA 3O1PA 3TNPB 4XETA 3MLKA 2WO7A 2GH8A 4IEOA 3VDDB 4K8FA 3PUQA 4QX0A 2X5IB 5FAXA 2WS93 4YGEA 1LGBA 1A8MA 1GZWB 4FBFA 4L11A 3K48A 5C9AC 3K3NA 3E5UA 4IEVA 1VBA2 4I3PA 1IS6A 2ARAA 2J1UA 4PBPA 5LBEA 3WUCA 1LOFC 1LRHA 2YBKA 4MXVA 3JQWA 4R9CA 5D21A 2CWMA 3UJOA 4A45A 1JU3A 1ZBE1 2YU1A 4GMP0 4H14A 5IFTA 1VMJA 1FPN2 1EUTA 1PVC3 2R073 3U1XA 1JZ4A 4V2VA 1IPJA 5KC6A 4QPIA 3FUOA 4HVQA 3S5AA 5F5CA 1R082 2LUWA 4XF4A 4IXLA 2A71A 1LOCA 3VBRB 2RM21 2SLIA 3KT1A 5IHRA 4LITA 3RZZA 4XIKA 3ZN6B 4RQPB 4M3CA 1SLTA 3E6DA 5FZOA 1UY0A 2Q8OA 1GZ9A 3QH6A 2YFZA 2PHFA 2X5IA 1D0GA 1NXD1 1W8TA 2ET1A 4LUMA 4RYDA 5BPXA 3KV9A 3J8F1 4EWDA 1WW7A 1C5IA 5DAQA 4COUA 1OUXA 1RVF3 2IUWA 2OQ6A 2Y0IA 3I49A 3E6CC 1YXWA 4OHZA 3NSTA 3POEA 3S5QA 4N53B 4A44A 4FTSA 3B9CA 1HLCA 1EV11 1QY4A 3D6EA 4H2AA 4QGNA 4ARXA 5DDJ2 1H4HA 3LGRA 1W0OA 1AXZA 3AZYA 2YC2A 2IC1A 5LB6A 4XDOA 4JGZA 4DB5A 1ONAA 2UURA 1OOPA 4QPIB 1RINA 3MGUA 3OTFA 3WF1A 4LUKA 2XOMA 2GC3A 4TZDA 2FCTA 4PCRA 5C5UA 2DVDA 4FPHA 3THTA 2V73A 5JDBA 2CWSA 2Q1MA 5B4XA 1O91A 1Q8VA 4AI9A 5KHIA 1VE0A 3WT3A 4DEVA 3G7DA 3IIIA 4YW4A 4I2OA 2WQZC 1RHI2 2D97A 3N7KA 5BYNA 3S7IA 1UOGA 2A70A 4Y26A 2VZ3A 4QB6A 4GQ7A 4AWDA 5F5QA 3G6JB 3KHBA 3I3DA 5F3CA 3P1IA 3AK0A 4K21A 3V65A 2GN3A 4JQRA 1DG6A 1TVGA 2JENA 5JIAA 5FPUA 4Y20A 1RUNA 1QQP3 2DUQA 4WVWA 3T1MA 4RHV1 5CAZA 4YM2A 4A41A 3ZYGA 1NLRA 3M3IA 3WW2A 1NLSA 1QXJA 1E5RA 1W90A 2Y64A 3TN91 1ZZCA 4MXWB 3T09A 1BLZA 2HEYF 2ZACA 5A7NA 2W1WA 1M4WA 1N1TA 1OF4A 3M3QA 4I0AA 4IEWA 2ZKNA 1XNDA 5FMDA 4YARA 3RYRA 1MPXA 2PHTA 5FKBA 1C57A 2R041 5DG1A 5G04L 4DUWA 2VECA 3KV5A 1HRV3 3WNLA 1O4TA 1US3A 3PTRB 3OBAA 4XF9A 1AX2A 2R49A 4TSVA 3U07A 2FZ2A 1O5LA 5CKNA 4PDWA 2B9UA 3LF7A 1NAEA 5BNQA 2HWD3 5F7UA 4Q4V2 1VBD3 1ULPA 5FMOL 5DZGA 5JZGC 5D1IA 4D0QA 4UW5A 1GICA 1JOPA 1X33A 2ID4A 1REFA 2CTVA 3USUB 2YXSA 1QJU1 4CPBA 3RMYA 4NAMA 5FLIA 1CJPA 1GBGA 4N90A 1AYN3 1GOHA 1E5HA 1YJKA 2E32A 2Q4SA 3OBTA 4OQ9A 3S57A 1T6BX 4AGRA 3IPVA 4P5YA 2BBAA 2W9XA 1LB2A 3ZFEB 2LRPA 4HL0A 4CEYC 1R091 5HBAA 1SLAA 2C6SA 3J7LA 3WW4A 3I59A 3B02A 3K2OA 2ZMLA 2QQPA 2P5BA 4Z82A 3T2OA 2VBPA 3E97A 3GJAA 3IWZA 2EVXA 3CJIB 3IAPA 1WZXA 3VZLA 4D7YA 1S0GA 4NVPA 3QCWA 4YM1A 4YGDA 2OZJA 5IK7A 5LCWL 1FMD1 1Q8SA 1ZM1A 4A6SA 1ZBA3 1D2SA 2OT7A 4RGKA 3VD4A 2GH2A 2P3YA 4QPGC 1JI6A 2D3RA 4Y1UA 1PVXA 4KWUA 4W6YA 3UETA 1BBT1 1LHVA 2W1UA 3RVHA 2P3JA 2DUOA 4Q8KA 3LEKA 2WS91 5FTTC 4KG8A 5F32A 1CD3G 1X7NA 3CQOA 4Z92B 2MEV2 1ND2B 1UMHA 3N3HA 3SISA 4AK3A 4CEWC 3LEIA 5FOBB 2GNTA 3JU9A 3OYWA 2JWPA 4CDXC 4EQVA 5CFCC 1AF9A 4DS0A 3RS6A 2J22A 3ZXEA 2W08A 4LQRA 1SLLA 1D4M1 3RJ2X 4BK4A 3RWKX 4AQ2A 1CZVA 1ZA7A 1PO23 4KH9A 1NUKA 1SFYA 2UWBA 2WNUC 3C7HA 5C8CA 2BRTA 5A3TA 1QOSA 5L7OB 2WR9A 3KMHA 4LKFA 2KR2A 3U4XA 1IPSA 1HIXA 1SQ4A 1J83A 1V6JA 3E1F1 1V9U1 4WM7C 5FYVA 1HRV2 3DPRB 5A7OA 1N3QA 1BEV2 1UAIA 1SEFA 1X36A 4INDA 1JTZX 2TBVA 4Z1VA 5FY0A 4IERA 1NZCA 4Q4Y3 3EHKA 3N7LA 4EV0A 4Q29A 1UD1A 2HWC2 3GXUA 1S0JA 4CZSA 3T1LA 2QQMA 5DZFA 4BH9A 1GWMA 2HWE3 1CGPA 1UPIA 4CCCA 1UL9A 2D3PA 5HCBA 3GZTB 2OUJA 4NE9A 2ZGNA 4ASKA 3BPSA 4HKWA 2CV6A 3I2JA 1H2KA 4OZXA 1V6OA 4P9JA 2SBAA 2QCSB 2WFPA 4QT6A 1XYOA 1AR82 1HJFA 2GNBA 4MXWA 4P9YA 3AZZA 2CSGA 2XLGA 2JICA 4GB31 4L92A 3W59A 3OD0A 4QPGA 4RR3B 1VALA 3ZXLA 4D6QA 1ENRA 5C7GA 4XIOA 4AI8A 3ZFFA 1UKGA 2O14A 3OBRA 5H9SA 1B35A 4GD4A 5JSRA 3WINE 2X10A 2O8QA 1XYPA 2RG4A 3GNEA 2WT0A 5C3SA 5FR3A 2AEZA 1UYZA 3SH5A 1W6NA 4YYOA 1F15A 4NRQA 3KT4A 4AFCA 1B35C 5FZAA 3NMBA 3FLRA 3JBG2 5A6YA 2P6HA 4XBNA 4PIXA 5FZ6A 1QJY2 3RI9A 4YG0A 3AJYA 1OD5A 3FMGA 3RG0A 5CFDB 1G9CA 4RN5A 4C1XA 3HN1A 1K45A 2VTFA 4GALA 2KA3A 2XVGA 2H0VA 2OX0A 2WJSA 4COYA 5DUXA 4GWNA 4QQHA 1W04A 1IS4A 2WT2A 3A23A 3WQ0A 4PHZA 4Q4V1 2IFRA 3UKTA 4BZ4A 1GFF2 4E4ZA 4N9IA 4AVTA 2VNVA 1XB9A 5IVEA 3RJRA 3TEZA 4Y22A 3M4FA 1AR61 4AFAA 3L2HA 3O1UA 4CSWA 4NHYA 2VW2A 1CQ9A 3LPFA 1UKRA 4QGLA 4CP1A 4UFLA 1AYM3 4FPLA 1HB3A 4ES9A 2EICA 4QPYA 4CP0A 3RZGA 1QOOA 3EBRA 5F5IA 2OPWA 2YU2A 1WMDA 3LZZA 1COV2 1XSRA 1W28A 3KM5A 4YFZA 4QX8A 3VZOA 4CPBD 4FFIA 3HQRA 2DU1A 4GWMA 2BGCA 4HKLA 5ANNA 5I93A 4OHYA 1C3HA 1EV13 3GHNA 4PF1A 2EIDA 5L73A 5FJKA 4QX2A 5FMBA 3AP5A 1CAUB 3PL0A 4B29A 1JYIA 3UGGA 2XJTA 3OPTA 4R52A 4XACA 3I2KA 5A7WB 1MQTB 4BXFA 4KU7A 1RUH3 1ST8A 3A21A 5GM0A 3KGZA 2TNFA 4XJ8A 4ARYA 5ACA1 1OH3A 3QACA 4AQ6A 4IGPA 3L9JT 5F3IA 4B4RA 2YDEA 2Q8DA 2GZWA 3ZKUA 3ZDSA 1KQRA 2E53A 4ET7A 1L7QA 4YW6A 1G8WA 3AMNA 5E89A 5EHDA 1G9DA 4BQ3A 2GC1A 3MDPA 4BK5A 3NQHA 4FOVA 2DVFA 3DKWA 1MS3A 3DPRA 2HJIA 1CIYA 4UXAA 1OUSA 2C1FA 1FMD3 3QOPA 5JXJA 4V2WA 3LAGA 3RDIA 3B69A 3VKMA 3VHRA 2ZS6B 2JDAA 1JZ5A 3U14A 3SH3A 5IVJA 4FPJA 5JMOA 2WFF1 1VBE1 3O1OA 2D43A 1G7YA 2C4XA 4AGGA 3GBGA 1VBA1 1VBB3 3M7AA 1YYNA 3HQXA 1SLBA 4CDUA 1MVQA 2WKKA 1POV3 4Q26A 2XJPA 1WMXA 4LLOA 3LWCA 1FI2A 5A3WA 1JYCA 1C1LA 3JB4C 4GZ9A 4QD2A 3WP6A 5A3NA 5JXHA 5JPMB 4V1PA 1LGCA 4M3CB 4OUSA 2C5DA 2WA4A 1Z78A 3APBA 1PK6B 1OSGA 1DGLA 1W9YA 5CB7A 4GB33 1IGOA 4RGGA 2W5FA 1AR63 3Q9OA 1UYPA 3VBOC 4FTBA 4MHUA 1VBD1 2E51A 5DUVA 1SZBA 2V72A 1DLLA 1LENA 3M3OA 1JUHA 2JD9A 2UY9A 3IDBB 2PAMA 2A6ZA 5T3NA 3ZXJA 1QKQA 1GWLA 3ALQA 3ZSEA 3PIJA 1OLME 1QJZA 2QZ2A 4GMP1 4IEPA 2RJKA 2AGSA 1URXA 2VE1A 4HPKB 4CCJA 4CVUA 1OKQA 2B39A 2L9LA 2JKXA 4K9SA 1OQ1A 3HVDA 5KXBA 1QWRA 3IDCB 4TLFA 3NJXA 3WCRA 4IE4A 2YYOA 1UOJA 1ULFA 1KD7A 1WD4A 2VM9A 4JKKA 4Y1YA 5GLTA 5C33A 4UW3A 2ARXA 2PFWA 4E4HA 3ELNA 1OF3A 2OUHA 3OUJA 2Y6LA 4XFIA 3O0WA 2VMFA 4Y1XA 5FZCA 2WRAA 4AXOA 3HWJA 2B7YA 3MIDA 3AYCA 4FPYA 4AF9A 1J84A 4X8PA 3LB9A 3FFQA 1JZ3A 2YV8A 3VDCA 1JXNA 2DBIA 4IEQA 4S2GA 2Y34A 3N9MA 4XJUA 5AFEA 4Z2AA 3T2PA 3NRUA 2PHUA 3NV1A 2WO3A 2XKPA 2XONA 3KCXA 2H6CA 3MLLA 4K7JA 1RUI3 3JD72 5HV0A 2Y6KA 1KGYA 2OS2A 3P3PA 4QU2A 2Y0OA 2YB7A 1MEC3 2A6XA 1TMF3 4QM9A 4BQ4A 5C8CB 4S2FA 4CXWA 1V0AA 4I0WB 1LOBA 3WV6A 3CMGA 2FDKA 2VTXJ 1HXS1 3KB5A 4YZ2A 1ZRIA 1WCUA 5BNNA 5EV7A 1EYBA 4XZPA 1S55A 1YHFA 2XL9A 5FBJA 1GZCA 3TN92 4I09A 1RUJ2 4GA9A 1D7PM 3ZFEA 3DEMA 3VZNA 2R7EB 1LU2A 4PDWB 2N7GA 3ZFGC 1MZ6A 4CUCA 2VQAA 4XFAA 4KWLA 2DBNA 4JV4A 3FWEA 3IDEA 4Q4Y1 1UXZA 3I2DA 3FHAA 3NNJA 4YW5A 3THCA 2G1MA 1YFYA 3USUA 1DYKA 2WNUB 2YBSA 4UBHA 2JG8B 2XWJB 4HOOA 4CU9A 4JTNA 3J8F2 3H3ZA 1R093 5BNPB 1WLTA 4HSJA 1RMU2 3CBNA 2CGPA 4DNYA 4AGVA 5KHGA 3SLIA 5E6HA 4BE3A 1T2XA 1XRUA 3RSJA 5HI0A 1UU5A 4NMIA 2IVIB 4BISA 2YFUA 2ZGKA 1VBE3 4A2UA 1WMFA 4P00B 3FHIB 1VAKA 4ASMB 1AX0A 1UNBA 1VAMA 4MV2A 5FZ0A 2X29A 5LASA 3A0NA 1RYYA 3C3VA 5A1FA 3T0AA 3DXUA 4KBZA 4KQ7A 2OYZA 4IW3A 1UOBA 3WEZA 4YZ5A 1R092 2Q30A 1RJ7A 4URAA 3W9AA 4JX0A 4A6OA 4J1WA 3VZMA 3ZXGA 4YGCA 2ZPXA 2E7QA 5BNPC 4A4AA 4G9SB 3AP6A 2R0HA 4N43C 1VBE2 4GWIA 3VDDA 2QTWB 1QQP2 1D2QA 2G4IA 1XPWA 4CUAA 4BM8A 4LO8A 5C3RA 4AQSA 3BODA 1A8DA 1ZRCA 1OMIA 1CPMA 1XQNA 3U0ZA 2WNVB 1UYXA 3UYJA 5BV6A 4LBQB 1WMEA 1ND2A 1MS8A 4O7XA 1YQ6A 1AR92 2HWD2 3BPZA 5FXWA 4A3XA 2QKDA 1ACCA 2Y38A 4WZFA 3RRDA 5GZGA 4CCEA 3GALA 3JD73 2WFF3 2XJVA 3TB0A 4B1MA 1JMUB 1BQPA 4SBVA 3PIGA 1KEXA 5DN2A 4MGTA 1VBD2 2TUNA 3WCSA 4E2GA 2CDPA 2FD8A 3OF1A 5EZWA 3CZJA 5ACA3 4CXYA 4MGQA 3HMYA 3TOJA 4XF1A 3PVBB 1AYM1 3VBUB 3ORJA 1WD3A 1PVC2 2R072 5DPNA 2JKBA 4YPJA 1ZZBA 5LY1A 4BIFA 4A42A 1V6IA 2QDNA 3AVRA 4YZ3A 5LZ6A 2PHRA 2WZR3 3C7GA 2VOXA 3BI3A 5FZKA 3NVCA 5LW9A 1N1VA 3ILRA 5LATA 3LE0A 2YC4A 1BEV1 1UO9A 2ES3A 2WWUA 3IM0A 4LBQA 3HQUA 1QNWA 4MUVA 3M70A 4R9AA 5FLHA 3VDBA 3KS7A 5IYYA 3WG3A 5FYUA 4MX3A 3S0MA 2DYCA 1HW5A 3FFZA 1ENSA 1PM4A 4O9EA 1DQ2A 1H8TC 1WW5A 2AUYA 4YM3A 4XABA 4ATEA 4K1ZA 1QJX2 3DCQA 1HXS3 3GGLA 3RZLA 3VL8A 3SCGA 4DXRA 1FT9A 2EXIA 3KF3A 5DDJ3 1W2TA 1JHJA 3NAPA 3OOXA 4LMFA 4BPZA 1BK0A 4CXXA 5A3PA 4JVAA 3ZXFA 3ACIA 1TE1B 1NOVA 5EYYA 1HV0A 2YPJA 3N7JA 1JYVA 2VXJA 1D4VB 3JD71 1GV9A 3ETQA 3OSDA 5CKMA 2NMNA 3VBOB 1BXHA 3WNPA 4AI3A 2VZTA 5LBFA 1A6CA 3HT1A 1PIV3 2E7TA 3MIEA 3NNFA 3OJBA 2CYFA 4UF0A 1HXS2 4I02A 4AAPA 2RS51 3LDRA 3OY8B 2H6BA 4LTAA 4AL9A 1IS5A 2VZSA 4HT1T 2DWRA 2HWB3 4YVSA 2WNVC 2WS92 4XF3A 4F7ZA 5BNPA 2J1EA 3GCXA 3LSDA 4NPLA 3OCPA 4Y20B 1W6MB 5T54A 2W68A 5FPVA 4CP2A 4IEXA 4E8DA 3ZYHA 1U5YA 5GLWA 4NRPA 3ZN5A 4EN8B 1G6NA 2ZAAA 1QJY1 3AKQA 1H2NA 1NA1A 2VCMA 1FYUA 4FPKA 1EPWA 4Q4Y2 4ASLA 5C71A 4EE2A 4N43B 3MPPG 4F8AA 2A3YA 1BEV3 1AJKA 5F3EA 5EFUA 4DQAA 5A6XA 2XMLA 3DXTA 1OLMA 3NAPB 4D7TA 3O1MA 1JS9A 1QDOA 2BEOA 1QH6A 4LKEA 4A7YA 4MG2A 5JR2A 2AEYA 1ZVFA 3HN3A 1NLQA 3KHCA 3T08A 5CA6A 3DGTA 3MPBA 1DQ4A 4NHKA 1R083 1OVSA 2W46A 1MQTA 4IEUA 3LOBA 2HLEA 4QQPA 4OI2A 4QHBA 2XXZA 1JZ8A 1PNGA 3UT0A 1MVEA 3TRSB 3LEMA 1QF3A 4LHNA 4Q4X3 4XCBA 1UPSA 3UESA 3AZVA 3WNOA 4PI2A 5AVPA 2QJVA 1LAJA 2QUOA 1WCDJ 1COV1 3JUUA 2YY1A 2AR6A 4FOWA 1XNBA 2A6WA 2IXIA 4C1WA 3HNBM 1N3PA 2Z79A 3ACFA 3DECA 4LA2A 4Q0SA 4HANA 1TMF2 4AYUA 2G9GA 1HRI2 1BBT3 1ZZ6A 1Q8OA 2RS53 3ACLA 2PELA 2R30A 2BDRA 3BALA 1QJY3 4B4QA 1AR81 1H8VA 3QD6A 4JRLA 2NLRA 4AI2A 4OCTA 2X5IC 1FOD1 4H3WA 1OA4A 1UX7A 3KVAA 4XUNA 2DVBA 1HB1A 5JI7A 4JTOA 5B4NA 1RUF3 2BP6A 1OFNA 2VZOA 4ZS3A 1RUD2 4HXCA 5C4WA 1YQ2A 5E1RA 3OPZA 3O0XA 3ILFA 5EIYB 5A7SA 3SITA 5FMOS 2GSYA 3KLSA 1P8JA 3EYPA 1F5FA 1OXCA 4OVEA 5DG2A 4ZS2A 3VKFC 3WZ1A 4DXTA 3I3MA 4N43A 1ZREA 2Y6FA 3BUCA 3EO6A 5T55A 5LEKA 5FUIA 5FY1A 4CP9B 1RHI3 2XDVA 5CEHA 2ZHLA 3JBG1 2BZDA 2BGOA 1AXYA 3HD8B 5I8TA 3NJVA 1FAYA 1NKGA 2WBKA 5FIXA 3S6PA 1GNZA 1PGSA 1X9TA 1AYM2 3R4DB 3DL3A 4WVMB 3J7NA 4UT5A 5JCTA 1IHMA 4FOYA 5FZFA 1H4GA 3N36A 5DMYA 4EWAA 3LA3A 1CAXB 4XCAA 3LA7A 2R062 1H30A 2GMEA 4IGQA 1RUC1 3VBHC 3EQEA 3JQXA 4YVSC 4Z2WA 1MR5A 1GU3A 4GIQA 4BLJA 5FYYA 1N1YA 4PDWC 3V56A 1XU1A 1SCSA 1SFNA 4YG3A 5FXZA 5FPAA 4RL7A 3HNYM 2WUHA 2HEVF 1U5ZA 5A80A 2D44A 1ULGA 1ULOA 2LTNA 1W3XA 5F2WA 4A3ZA 1RUI2 4NIDA 2FZ1A 2FCVA 1VBC3 3VBHB 1WCQA 1PIV1 1R64A 1YI9A 2MPFA 3LDBA 3MICA 1H2MA 4SLIA 4XFGA 4ATFA 1YC61 1HQNA 4LEJA 1YQ8A 2BV4A 3WDUA 1AVBA 2GNDA 2PN5A 4HK9A 4O61A 1BMV1 4FFHA 2V5YA 4IE6A 5FBZA 1X82A 4WV8A 4XHXA 4E4DX 4HPKA 1OHFA 1W6QB 4IQPA 4QXKA 4YNIA 5DUUA 3S30A 2O0OA 5JMCA 2WO1A 4FPOB 2WZEA 5I0RA 4MGKE 2A6YA 4E4SA 1WA6X 5KXDA 1WLWA 2RS52 4BOWA 2FDIA 2A5ZA 3R0RA 4YVWC 4AVBA 4UW4A 2DCKA 5ABJB 3PURA 1K5JA 1SPPB 2PLV2 1VMFA 3ZLIA 2I2SA 4CDQA 2WYFA 1HB2A 3N9OA 4D6SA 3ZYIB 2C26A 5KR7A 3FJSA 1HRI3 4I0BA 1ASJ2 4QKFA 4BQ2A 1DYPA 1L3JA 5DZEA 1PO21 4LO7A 4NROA 5FRAA 2IFWA 2PTMA 5FPLA 3ZSKA 1KJLA 5FYBA 4WM7B 1S0IA 1NYWA 5G05L 1IOAA 4Y5SA 4ZXKA 1GLHA 1JYXA 4Y5TA 1BKZA 4XOGA 3WP3A 2P2KA 3D0JA 1EP0A 4HN1A 1APNA 1CN1A 3N7MA 5D2AA 2VULA 1WWYA 4LPLA 3T30A 3J26N 4UFHA 5FJHA 2ZEZA 5CFCB 4UI9L 3KZ4C 5LK7B 3U11A 4CYDA 3CLPA 4FP3A 3SKVA 2W91A 1TME2 3B01A 1J3PA 2VUJA 4PIYA 4L97A 1BK1A 1PK6C 2VMIA 2AYHA 3HJRA 1NCQA 5LA0A 5JWPA 3ZYFA 1LHUA 3GCWA 4Q2FA 3BTAA 2XLFA 4HLTA 4LBOA 4QHZA 1QU0A 3K75B 5GZEA 1UXXX 4URTA 5CVRA 3F2ZA 3ON7A 4Q4W3 5A3UA 3WQ7A 1PO13 3W5NA 3NAPC 3ZOIA 1Y7BA 2P3IA 3RZKA 1PMHX 1LTEA 1RUH1 1UX6A 4QQ2A 1W39A 2ZGOA 5APAA 3VHPA 1HRI1 2VUDA 4JDNA 1UYYA 5JIUA 2E26A 1O3RA 4CCLA 2WSUA 1UY3A 1XE8A 2VUAA 1KJRA 1ODNA 1TEIA 1WUVA 2D7FA 1FOD2 4UW6A 4I30A 1AX1A 3H9AA 4AEJA 2V5DA 4ZU4A 3K4DA 2XBO2 2HWC3 4DY5A 1J59A 5FCCA 1C8M2 2BVVA 4FAHA 5IATA 1K3IA 4E8CA 4CA9A 3SXWA 4XW3A 1OC1A 3QH7A 4WVZA 4CCDA 2FMDA 2JD4A 3ZFEC 4L99A 4CCKA 5L9BA 1RUE1 2D6OX 1O4ZA 2YGMA 4M4RA 4WVVA 5F3GA 3VL9A 1S1AA 4Q5OA 5T5OA 2VU9A 4XEZA 2HWF3 4BJ0A 4W65A 2BOJA 3AP9A 4NJ4A 4LHLA 1FXZA 4Q4V3 2JG9C 4F3JA 2EALA 3SKJE 5A32B 2DF7A 4XJ9A 4AW7A 5IK5A 3SH4A 4HKOA 3UV9A 2A73B 4I3GA 5FXXA 5IWFA 4XHBA 1HN0A 2W39A 1Y9QA 5JXIA 1TQ5A 1WKYA 1GANA 4BQXA 5FZ7A 5FZOB 1AYN2 3IDAA 2CY6A 1ULDA 1UMZA 2XVKA 3H1YA 2FMYA 4PT6A 1QJX3 1B35B 1IQDC 4HBNA 4XQDA 5BNNC 4M3CF 5AFBA 2JX9A 5SV5A 2IXLA 2RS32 3MW3A 4AVSA 3I97A 2VOKA 5A33A 2E6VA 2BYVE 2QVSB 4RGAA 1HDKA 2XB6C 4OZOA 1RMU3 2VG9A 1MS9A 4LOTA 3T2TA 3WHTA 1GOFA 1IG0A 5CFDA 1MEC1 3J7HA 2ZGUA 4XFBA 5HXVA 1TME3 4Y4YA 4RR3C 4XFCA 3N9QA 1UU6A 1GNYA 3AM2A 4LBNA 5ANQA 4IE7A 1LGNA 3NNGA 3VBUC 4HVRA 3H0OA 2YROA 3IN9A 4JKMA 4ZZ8A 1SPPA 3X29B 4FVVA 1I6XA 3HR9A 4AHYA 1U12A 3Q8CA 1PVC1 2R071 3H7YA 2XJSA 4FPFA 4COWA 4AG4A 4B7KA 2Z4FA 1OH4A 2V4VA 1H1MA 3TNQA 5AC92 4QQLA 1UIKA 4AFDA 5BUVA 1I3HA 1RXFA 3H8OA 3O1TA 2ADEA 4Y22B 1W2OA 3HNMA 2ZX0A 3WNMA 1PGW1 4MYEA 4WM8B 2LROA 2DCYA 1YIPA 3H42B 4L9BA 3VV1A 2R043 2PHXA 3C7EA 2Y33A 5JZGA 1UOFA 2QDRA 1AR72 4HN0A 4NPRA 5F6LB 3OBZA 1NG0A 4GKYA 1ASJ1 1PO22 4UBGA 1C8M3 5I91A 5GZCA 4QDRA 1LODA 5AC93 2BW8A 3OGGA 1LHNA 3KGLA 4BYYA 3ENRA 2JDUA 1UZZA 2D6PA 2Q8CA 1G9AA 4XUOA 1W8OA 4FAGA 3UKNA 5E88A 2K2SA 2XL7A 1C1FA 3PNAA 3ZMNA 1BVP1 4MADA 4YVWA 2BVBA 4HONA 4XTMA 5JOXA 5FPBA 4TTGA 1W9FA 5BY5A 2XR4A 3O14A 3GBFA 5LY2A 4BLIA 1TME1 2ARCA 4NRMA 1O59A 3NNLA 1ZBE2 5DAVA 5A6QA 1IKQA 2PHDA 2HYXA 2ILMA 1W9SA 1GYKA 1HN1A 2HWD1 4FXGB 2QBXA 1GQHA 1YO8A 1W05A 4QB1A 4D94A 2CGOA 2KM2A 4CP9A 5C3QA 1LOAA 2CHHA 3AFGA 3VD5A 4LULA 5J96B 4J1XA 2JG8C 4IGOA 3BOWA 5BXXA 3ES1A 4NIIA 3PVEA 2ZEYA 1N3OA 3D0SA 3NWKA 3R6SA 4ZU7A 1DQ0A 1PHMA 1LU1A 4N7UA 2Y8KA 2BNNA 4C0BA 5J3UA 2LM3A 2MEV3 4LO4B 1JOJA 2XLAA 3U10A 3VHOA 3ZFGB 1JYNA 1UY4A 4ZPIA 2XBO1 2VZUA 1I5PA 1XYNA 5DAXA 2XGXA 1YQ5A 3VDDC 2ENRA 1U5XA 1AHSA 4LK7A 1DCSA 1OPOA 4JAAA 4LR4A 4CEWB 5C9AA 1CAVB 2ZGSA 5C4WB 2JXAA 1IKPA 4XURA 2W92A 3WR0A 3IIAA 3NW4A 4Y24A 4BU2A 1Q56A 2DU0A 4I01A 3POBA 4QWNA 3D8CA 4XQ4A 3MV11 4ZU5A 3WXPA 2OVUA 4HETA 5T50A 1JH5A 1TG7A 4PF5A 1O6UA 5C70A 4AZZA 5FDBA 4OI0A 1FPN3 2CNAA 2AACA 2IWGB 4FOQA 3HT2A 1KS4A 2WSVA 2R1DA 4QU1A 4D69A 4Q27A 4LBLA 2PMWB 5FPXA 1AL0G 2OXBA 2ZX2A 2GN7A 2QZ3A 3ILNA 5ERLA 1GR3A 3VKOA 1IG3A 1DBNA 1K5MA 2VBDA 4DPNA 4NHXA 4W8JA 4RFT0 3WNNA 2D5FA 3OGVA 4OUMA 2YGLA 1PK6A 4CEYA 5GLVA 3EJKA 3FUQA 4LBQD 2JDZA 1NCRC 4TN7A 4O9GA 4AFBA 5CZKA 1RUD1 5F5AA 5HCHA 4CEWA 1LOFA 4LE4A 4WM8C 4B3NA 2ZHMA 2YUEA 4MGSA 1NE4A 3JZVA 3RZMA 2CAUA 2VZ1A 3FC0A 4GXLA 4TXWA 2R6QA 5FO7B 2WDBA 4M00A 2FDGA 1E5SA 2WLQA 2G9FA 2IZWA 2JDPA 2YC0A 5TSWA 3AKTA 4CCNA 2RHPA 2JB8A 4OULA 1KXGA 2ARBA 4JDOA 3WOGA 3O1SA 4PLNA 3I8TA 3OPWA 4B1LA 4WZCA 3JXSA 4XXPA 4YLZA 1SMVA 3U78A 1H2LA 1NX9A 5JXGA 4LOSA 2R16A 3I2GA 1RITA 3ACHA 2K9ZA 4DOUA 1VBC1 3VBUA 4Y4RA 4LKSA 3HAGA 4XPVA 3DF0A 4FPEA 1H0BA 4AI1A 3C7FA 1RUG3 1W99A 2NPIA 4FFFA 1M06G 1LECA 3FE5A 5EJ1B 1VPHA 2B8MA 4B4PA 1OBNA 2GP5A 5JAXA 2BWAA 3LA2A 4CTEA 2JJ6A 1QJU2 3AYEA 1QXRA 2ZTNA 3B5LB 3H7JA 3U75A 2ATFA 5J09A 2VW1A 1AR71 4EWEA 4HMZA 4FCAA 1H6XA 1RTVA 4DUXA 1SLCA 4PLMA 3TAYA 5BNNB 1V9U3 3OEAA 4IV3A 3V0BA 2XG3A 2Y26A 1RUF2 1UN1A 2RDNA 5A7QA 1PZ7A 3ME2A 2W2IA 3ZDVA 1AUYA 1PIV2 4META 2YMZA 5LRRA 1OD3A 1QH7A 1W3VA 2W52A 5F6KA 3U4SA 3UK9A 3E6BA 4WM7A 4EROA 5A70A 2BPA2 2ZCWA 1HB4A 2RE9A 3RZHA 5EJ3A 4KG0A 2XQRA 4PLOA 4EN0A 3CF6E 4QGMA 1DQ5A 4IV1A 5FP8A 4M0NA 3MIFA 2AH2A 4LE3A 5ABJA 5M0TA 3ZYRA 2J1VA 1MACA 2Y6HA 3DYMA 4KMQA 4KU8A 2VGDA 1REEA 1YUDA 2EXHA 2X8KA 3HIFA 4BQYA 2WINB 1OI6A 1CX4A 2VPVA 3CO2A 1KS5A 2A3XA 1GUIA 4YFWA 2W3JA 4OI1A 2GNMA 3VBOA 5I8YA 3GYDA 1PGL2 3JCIA 2BUKA 1S0FA 2A3WA 3ZSLA 2W94A 4LHKA 1DP0A 2A75A 2Z2SB 3A0KA 1MQTC 1YQCA 1XE7A 3LDKA 4L0PA 4UFKA 4IL7A 2F6BA 3BTXA 2ZHKA 4Y33A 5GLUA 2VUCA 3MF6A 1T6GC 5FZBA 5FZ8A 1OVPA 4BDVB 3C8XA 4IE0A 3WF4A 1ODMA 1RUG1 4JCKA 2WC2A 5FY7A 2WQ4A 1H9WA 1R1A1 3I2OA 1GP4A 2EIGA 2WT1A 2YPDA 3ZSMA 1LULA 4BA6A 2R061 1CZSA 5J37A 4XAEA 3OUHA 1RUC2 3I3QA 1W6PB 3W21A 3O1VA 1R1ZA 3POJA 4C91A 5DDJ1 5SV8A 2W47A 3VBRC 3HOBA 3WY6A 4LBKA 4DRRA 3OGRA 1GZTA 4N53A 2ZJCA 3CJXA 3WX5A 1VMHA 4DMIA 4XUQA 4PBOA 2JE9A 3ABZA 5DUWA 3TYJA 4YZ1A 1F8VA 3WW3A 2ZXQA 2JE7A 1N1SA 4F83A 1ZZ9A 4OHVA 5FYHA 5A3OA 2JDYA 5KWRA 2ZGRA 1CWPA 3VBSA 1VR3A 1UZ0A 1HQLA 4XILA 4LXLA 3TBDA 2XHKA 2VNRA 4MZUA 2PHWA 1GQGA 3SEPA 2VVDA 3IPVB 5T5PA 4H55A 2OZ6A 5GJ6A 5CFDC 2QFEA 3MUZ1 4XMIA 1GWKA 4AFMA 4GB32 3PTYA 1ZRRA 1IPKA 2W87A 1ULCA 3H1MA 4LK6A 1BCXA 4NN0A 2RDQA 4UWDA 1F31A 1ASJ3 2QQLA 1CJDA 2RJ2A 3LKJA 3NJYA 4XF0A 5E16A 5T5JA 1K5MC 5ABJC 3I2IA 1Q8PA 4RHV2 3AMQA 1JOBA 2Y6JA 5L9VA 2O1QA 1MS5A 3FLPA 1RVF1 3IBMA 3N35A 2DFBA 2D93A 2PLV1 2TEPA 4E27A 1JZ6A 1FNZA 1DQ6A 5I0UA 3A7QA 3O5SA 2NYYA 1CVNA 3M3CA 2GMPA 1IS3A 4COVA 1V6NA 3NO8A 1SFPA 4QX7A 1OA2A 4EZHA 1NY72 1O8SA 2UY8A 2Y60A 2VVFA 4KGQA 2WZ8A 5CNAA 4CDXA 1S0EA 3SMHA 3UJQA 1VBC2 2JDMA 4BB3A 1O3TA 4QX3A 1CONA 1QMJA 2D6KA 2PXJA 1DU3D 1LNSA 3IAQA 3SEEA 1NT0A 2NMOA 4A7ZA 5FO8B 1YEWA 3VDAA 3J7MA 4AR2A 1UY1A 2GC0A 1RJ8A 3V0AA 1J58A 1GNHA 1UW8A 3N9LA 1W8UA 3T3YA 1F9KA 5ISLA 1DGRA 1GOGA 3H8XA 4IUGA 5AVAA 3K77A 2JDKA 4P9XA 2AZ5A 3B9IA 2WZR1 3PUHA 1ND3A 1J1LA 4LBJA 1FATA 3POWA 1MEC2 5JI9A 3PUAA 3AZXA 4OHXA 1WW4A 5FYZA 5LK5A 1NA1B 2BJSA 4DZGA 5C3PA 4S2HA 4Q4X2 4GMP3 2ETEA 1V6LA 4UFJA 3ZXKA 2B9VA 1RUJ3 2VO5A 3NL1A 4CDXB 1YWKA 5HXMA 3PLQA 2J7MA 3PUSA 2ZZQA 1OOPC 3IMMA 4QB2A 3CJIA 2ZEWA 4X6RB 5AC91 5JOWA 2D40A 2QQUA 2VXRA 1JYTA 1VB2A 2IXHA 1LHWA 1CAVA 1W2UA 2OA2A 4IV1C 4XBQA 3M2MA 2D98A 3KCYA 1PGW2 3LOIA 1GP5A 1US2A 1W2NA 2ZOEB 4GJZA 3BB6A 2VD7A 4Q0UA 5FY5A 1DGWA 5H9QA 1W03A 5ACA2 2F17A 2ZX4A 3E5XA 3WDYA 4XC9A 4QPGB 4RR3A 3BKZA 1W8ZA 5C8WA 1RUE2 3CZUA 4GULA 5KHKA 3OG2A 5KHJA 1W6PA 5JR7B 3E5QA 1Z7S1 4HSLA 1EAH3 2ZMKA 4RHV3 2ZX3A 3WUDA 3CJIC 4LT5A 3K4ZA 1SG3A 1KDMA 3DV8A 4N7IA 1D4M2 5FYIA 5GLZA 3VBFA 3AC0A 3MIGA 1OQEA 3POSA 1YFXA 1BHGA 3D3AA 3DN7A 1DLCA 5A3LA 1G9BA 4FTEA 1AYN1 3V64A 1F4HA 2Q1FA 3ZFGA 1PO12 3PDQA 2C0ZA 3I7DA 4CEYB 1AZDA 3KCCA 1V9U2 4DO0A 2ZABA 4QPWA 2RS12 5CISA 1LHOA 2W95A 1CZTA 5A1AA 1O3QA 1Q5OA 3WDTA 1SACA 2R063 4FQ4A 4XFHA 2VOTA 2RS31 4AAXA 1WLDA 2JDNA 5CFCA 2VQ0A 3NV3A 3AZWA 2HWC1 4XXAA 4ISQA 3RFRA 1NQJA 1ENXA 3ZXDA 3VZJA 1UIJA 5FP7A 4FO9A 4LO5B 2XBO3 3AYDA 3Q8BA 5FLJA 3BU0A 3PHMA 1HJGA 1F4AA 3IT8A 2WAAA 4L8QA 2HKXA 3AXEA 3IMNA 3I3EA 4XQWA 5FZ3A 1F2NA 4KWKA 2D3SA 2D6MA 4R4ZA 3ZKYA 5J48A 1AR73 4OHWA 2NN8A 1H9PA 2VZRA 5L9RA 4AEMA 4WVMA 3RYKA 4XDQA 5GKAC 4EN7B 2VBBA 1RC6A 3NJZA 2RDSA 3C7OA 3ITQA 4C90A 5IVFA 3ZXAC 4QXCA 3VZKA 4C0HA 1GP6A 2X09A 3I3BA 1LEDA 1W9TA 2WNOA 2Z42A 2VNGA 5EQUA 4DY3A 2XUMA 4R9BA 4M4PA 4BWOA 3HPNA 1J1TA 3TWIA 5HCAA 2P34A 3CEWA 3ZYJB 4XUPA 1H1AA 3TEYA 4CU6A 3F95A 3I4IA 3ZFFB 2YBPA 2RVAA 1QJFA 1C5HA 1XXNA 1VLNA 4YRDA 1QHDA 2WWSA 1KFXL 4ITCA 4YW7A 1DIWA 1GQPA 3H3UA 4XTPA 4JHZA 3SCHA 1X9PA 1J3RA 1QJU3 4A7KA 1D0HA 2EF6A 5LWBA 4NIAA 3AYAA 1S0DA 4Q0PA 1PMIA 1JBCA 4TLGA 5I8SA 2XH6A 5J7MA 1RUE3 2ORZA 3KF5A 2VMEA 1I5ZA 3KD4A 3LFIA 1YCIA 2HBTA 3P6BA 5FUNA 5A7PA 1O8PA 3VKNA 3RYPA 3UGFA 3WNKA 3LIHA 2JIGA 1W6QA 2WLPA 1V00A 3Q8EA 5EJZB 5IT6A 4XVHA 1REDA 2WZPP 1AR62 1W2AX 1H8TB 3BTYA 4U36A 5LBCA 4LIUA 2ZGMA 3KQ4B 5F8PA 3HBZA 4LIVA 4QM8A 1EUUA 3EXUA 4AEKA 3RQ0A 5F1RA 4LJHA 3AP4A 3BIEA 1JYWA 4E9KA 1G9FA 4YZ4A 3FZ3A 4TYSA 5FP3A 5FZDA 3NKGA 3MF9A 2ZGTA 2B42B 1DDLA 5EWSA 5D8AC 2V4AA 3MEPA 4DUVA 2OW4A 2VZQA 1I9RA 1UY2A 2DCTA 3N9NA 1QIQA 5F9TA 5KXCA 5DAPA 1RUJ1 3BOPA 4XFFA 4AHXA 5FV3A 4DXSA 1LCLA 1ZA4A 3JB8A 4Q4X1 5FYCA 4C8DA 2D5HA 4JQTA 1QNYA 2HWB2 3SHRA 2B4KA 1GZWA 1QGLA 3SQOA 1YFWA 2RS33 1ND3C 3ZPOA 5FPZA 4RD7A 2CL2A 4RSUA 3FBMA 3RI8A 3GBWA 4BQ1A 4D6RA 4W6XA 3K3OA 2GDFA 4BCUA 3WF3A 1O3SA 2HH9A 2K0GA 2GP3A 2JE8A 3AKRA 3LQCA 2JDHA 1QJEA 1RMU1 1CESA 1RL3A 3J4UH 4H7LA 4KBBA 4N9HA 5EXOA 4YW2A 1Z7S3 1DYOA 1HQWA 3WG1A 4K6BA 5K0UB 1UZYA 1VRBA 2W1SA 2I74A 3VBSC 4LKDA 2VW0A 2H0BA 1XNAA 1S0BA 4G3YC 4W6WA 2FDJA 3DKQA 3K46A 3OEBA 4XAAA 2QQOA 3O1RA 4KGGA 1EY2A 5L7OC 3B94A 4LA3A 3DYPA 3OGJA 4QMAA 5CU1A 3T4VA 4IV1B 3WQBA 3THDA 3ATGA 4RQPA 1RXGA 3FX3A 4N53C 1JW6A 5C9AB 4JGZB 1FX5A 3LFMA 3WG4A 2XUEA 1WBFA 5BNOC 4CDWB 2IVJA 1NE6A 2W1QA 2WFF2 2XJQA 2ZGQA 4OI4A 5I0SA 3BIWE 2BWCA 1AL21 1YNAA 3DYOA 3MHZA 4ZY9A 2BFUS 4H7MA 3POYA 1HKDA 4PJYA 4ZZ5A 2RS11 2VCAA 5KHHA 2DDUA 2ZBJA 2XVLA 2Q0AA 3LSEA 4EN6B 2JIJA 5B2GB 3WLUA 5C3OA 3ECQA 4P9IA 4ORFA 1W6NB 5F37A 2NQYA 5LBBA 1AR91 3FHQA 1OURA 1PGL1 5IAVA 2BOIA 4GWJA 5J98B 2VR4A 5FXVA 1AR83 3QBQA 5A32A 1PM7A 5IAXA 3MLJA 1RUD3 4JHTA 4XUTA 2VNOA 4S2DA 3ZMOA 2WIIB 1DHKB 1RUG2 1TNRA 3MFCA 4RS5A 2HYKA 5K9YA 2A1XA 1R1A2 2RMU3 3A4UA 3PUIA 4GKXA 3TEXA 5IVCA 1OA3A 2P3KA 1WLCA 5FOJB 4KL1A 5HCFA 1OFSA 2E33A 2R1BA 3WHUA 4EN9B 2YG0A 2DTYA 2QQKA 4B7EA 2V09A 3USSA 3JBG3 1K42A 2P17A 2WNUA 5JVVA 5C8CC 4HFSA 2RR11 4YW3A 1VB4A 1XBFA 1W0NA 3T2QA 2VMGA 4IETA 3UGHA 3THPA 1ZNPA 1SHWB 4QDQA 4JC1A 1WCKA 1RUF1 1ZBA1 2AC1A 2VVEA 4J25A 4UOJA 3BGAA 1IZ3A 2P4EA 3CHXA 3WP4A 3D5OA 3CIHA 1DGWX 3URFA 1RB8G 3WDXA 1NCQB 3OB8A 1UF2C 3WDVA 4AEDB 5GALA 2PAEA 2DVAA 4Z8BA 3I59B 3RPQA 2FDHA 1Q3EA 3W20A 1H1IA 1EAH1 4NHLA 3MYXA 3MFAA 4KWJA 4MO3M 4YG6A 3ZIXA 2WA3A 1W06A 5CBLA 2DURA 2NM1A 2NP0A 4ZXEA 2VH9A 3LPGA 3ZYPA 1K12A 1FV2A 1X8EA 4MGYE 5I0DA 2WN2A 4HK8A 1LR5A 1PZ9A 1UWWA 1RVF2 2HBUA 4LORA 4MSVA 2VAUA 1VP6A 1LOGA 2WNVA 2EXKA 1VJ2A 2VY0A 5D8AA 3VD7A 4OFGA 1BJQA 1WW6A 5CADA 1KFUL 3ACGA 1YRZA 1O5UA 2JECA 1NY71 3N4MA 2ZMNA 3PVNA 3ST7A 4ES8A 4NAOA 2X53S 4AEDA 3H1WA 5EYXA 1A78A 4CDUB 4CDWC 3AB0A 2HWE1 5BNOB 1J3QA 3MW4A 1CAWB 1XC6A 3VD9A 5CKQA 1OPMA 2BU9A 2GC2A 2E9QA 2QNKA 2DUPA 1QEXA 5FZ1A 4CDWA 2VOVA 4ZONA 1Q43A 2ZHNA 3PMSA 1YIFA 5J36A 5LA1A 3AMHA 1ZX5A 1DGRN 1JN2P 1CR7A 2IXCA 4ZKTB 3MZHA 4OUEA 1NXMA 5FY4A 2OKXA 2GALA 4Y1ZA 1PX4A 4LHSA 2WZR2 1DQ1A 1POQA 1UQXA 2P1BA 4R9DA 1UZWA 4XMAA 2CGNA 1VBB2 4GH4A 1XNTA 3C2UA 4Q0QA 4XYXA 1V6KA 1U5IA 2VJXA 3ZYBA 3UNPA 1Q8QA 2QQWA 1NQDA 2J42A 1MZFA 1OT5A 4CDQC 1QQP1 1TMF1 1UU4A 1V6MA 2G19A 1VRH2 4M01A 5FZHA 4AOCA 2YHJA 3VBFC 3ETPA 4DEQA 2VQUA 1YLLA 1ENQA 3SCFA 1JZ7A 2P6CA 3IKWA 2ET7A 5L7OA 1ZYBA 2PYTA 2UWAA 2ZGPA 1I1EA 4IEZA 4XE9A 2LS6A 3LIGA 4D8MA 2RM23 4AI0A 2LW8A 1A34A 4UFMA 1UZVA 5D8AB 2QQIA 1X50A 4P9LA 4MGIE 2DFCA 1Y3TA 3I2FA 2BTVC 3ZSJA 5A3MA 4CU8A 1PMJX 4ISRA 3FN9A 5DXDA 4P08A 4WM8A 3WG2A 1RIRA 3ASIA 4GJYA 2NZ9A 5HV4A 4AEDC 1DFQA 4GH4B 1N47A 5J1XA 4FPCA 2EAAA 4CDUC 5KBFA 4XJWA 1W0PA 3ZIWA 3AMMA 3L2YA 4LNVA 4BQWA 4EZ4A 1NZIA 2GAUA 5FFOC 1L7LA 1W8WA 1ALYA 3AMPA 3WQ1A 4DINB 3RNSA 3WDWA 5DAWA 3I54A 3LEGA 2BFUL 2ERFA 2UWCA 5IK8A 3VUOA 4U2AA 1FV3A 2PQQA 4XJAA 4YWAA 4AVCA 4YSFA 4J6GA 4P14A 5FYTA 1AL23 5FZLA 3W58A 1KITA 3GZUC 1JODA 3BU7A 4ONUA 1QXPA 3UL2A 4L2NA 1ZBA2 2CU5A 4O65A 1RUI1 3NV4A 3BTZA 1NCRB 4P9WA 4FT8A 1QJX1 1OQDA 1E5IA 2UYBA 1XU2A 2WYSA 3POFA 4UFIA 4YW1A 2EIEA 5T5LA 3ZR5A 3AKPA 3VGIA 2PLV3 3Q8FA 1ULEA 2D6LX 3IZOA 2XQXA 4K8RB 4P5HA 2HEWF 5FK7A 3ZO0B 2VMHA 4OQ8A 2F4PA 2LALA 2VQTA 4Z07A 1C4RA 2JEMA 2XKOA 2WNEA 4X6QB 1EAH2 5FZ4A 4PIZA 3WD5A 1AXKA 2VCCA 1NCQC 4OYUA 2A7AA 4G4FA 3A22A 3CL1A 2AREA 3TN93 3ROUA 2J1RA 3AL6A 1H8TA 2PHLA 4LO6B 3GDBA 5K7PA 1W6OB 4FI9A 1QDCA 1JHNA 2XJRA 5L19A 3KV6A 1DZQA 2MHFA 4NWVA 4MVTA 1OLRA 2FCUA 2ZA9A 1XOYA 3AL5A 5FZIA 5BNOA 2RS13 3EB7A 1W8FA 5C4WC 3NV2A 5CYYA 5FY9A 2UYAA 2P37A 1Z7S2 3FL7A 5FP4A 1CPNA 2OQ7A 2DCZA 1W8HA 1S2BA 2EA7A 2R042 3KVBA 4PQ9A 3OUIA 1A3KA 2RR13 1RGSA 1ZZ8A 3ZN4A 1AJOA 2JB4A 3HEIA 1UCXA 3VBRA 5FREA 1CAUA 2HWE2 2ZAHA 3LCPA 1WBLA 4CCMA 2DV9A 1C28A 3VN4A 1VAVA 1PO11 4OMDA 2FQPA 2Z69A 2VC9A 4JKLA 1BYHA 2C9KA 4HZFA 4JZRA 5GZDA 4CE8A 4Q4W2 5I0TA 4MLOA 1CAXA 5E8AA 2ZX1A 1FOD3 3OGSA 4QKNA 4XZUG 1XSQA 3DPRC 4CRQA 1WGPA 1OLQA 1PNFA 4K20A 5JLVA 4DRVA 4BHPA 5IVYA 3ES4A 3FBYA 1VBA3 1VBB1 2WQ8A 4K40A 2KD7A 1Y4WA 4RS5B 4K1YA 3CNAA 3LD8A 1OOPB 3DUIA 1ND3B 3AP7A 2EAKA 1RUH2 2WN3A 4AHWA 4W4ZA 4ZHNA 3O12A 4D3WA 2HWF2 4NR1A 2CAVA 1W6OA 4JGYB 5FZMA 1FMD2 4QX1A 5EP9A 1ND2C 5L36A 1NA1C 2ZZJA 3KWVA 3PU3A 4BQ5A 4BMEA 2VZVA 4Q1PA 4RS5C 4JGZC 1VIWB 3AVSA 3WNXA 4AQTA 1R1A3 2RMU2 1C8M1 1BBT2 1MZEA 2F4LA 2VOWA 4Q1RA 5FZEA 4BXSV 1ZRDA 2ZEXA 2RV9A 3KV4A 3H8UA 1W9WA 2BNOA 5IFPA 3QLQA 5IJRA 2MEV1 5K4LA 1TZOA 2VMCA 3MIBA 3VBSB 4NO4A 3J9SA 5FQ0B 5K0UC 1MZ5A 3UKVA 5FKCA 4UYBA 2PQSA 3R4SA 4NUBA 5IUQA 4EYUA 4RFRB 1YI7A 3EMRA 3VKLA 3IB3A 4OMCA 2IXKA 4CDQB 1LESA 5H9PA 4QQOA 5FZGA 2VMDA 4IV3B 3TEWA 3V0BB 3RWNA 2E7AA 4JGYA 1COV3 2EIBA 3RMXA 1SDDB 2UU8A 5JSOA 3AFKA 2XWBB 3BCWA 1SBFA 1FNYA 3M3EA 2R0FA 3Q8AA 4IE5A 2BERA 2WABA 4AVVA 4DFSA 4HVOA 2WWJA 1BVVA 3O7OA 2B45X 4NHMA 1O4YA 5LA9A 1L7RA 1TNFA 4RA0A 3PJQA 2D6NA 1WCSA 3MBWA 4AVAA 3M8LA 4NIGA 4P02B 3NKTA 3ZR6A 5KXEA 3GZAA 2X05A 1POV1 2PA7A 2B46X 5F39A 2Q1ZB 5FQ0A 5IK4A 4WBBA 2IXJA 5FWEA 2OIIA 3ZPYA 5FYMA 5C5TA 3PVOA 1Y9MA 3BYWA 4M0HA 4UAPA 3VBHA 1BMV2 2B5HA 2I07B 3O0VA 4AHZA 5LRSA 1JU4A 5K8SA 2HWB1 1RUOA 2R32A 4YM0A 1XJAA 2FHRA 4FSJA 4Q0VA 5A7WA 2DCJA 4NOTA 4EJRA 5IVBA 2C9AA 5CIRA 3S7EA 3W5MA 1QOTA 1ZRFA 1S4CA 2WAOA 4E2QA 3KSCA 2QE3A 3GZEA 3WVJA 5JZGB 3PMEA 2A6VA 2XHNA 5DABA 3KQRA 2JG9B 4DXZA 3MO4A 5JOZA 2JG8A 1EPZA 4QKBA 3PU8A 2J1AA 3V0AB 3RZJA 1JZ2A 3K51A 1OKOA 2MNGA 3GHMA 4Q8LA 2QQJA 1GKBA 1XNCA 1MS4A 3ZFFC 2J1TA 4FQZA 2FDFA 3VB9A 4IV3C 5K0UA 4Y1VA 3AX4A 4FPGA 2WO2A 1HV1A 3MW2A 5IVVA 1KRIA 4IEYA 4MHRA 5T52A 2ZGLA 1SLIA 3FLTA 1ZBE3 4QAWA 4XDPA 5CG8A 4R4XA 5CG9A 3H3LA 1AL22 4GH4C 5FY8A 1Z0HA 3CKHA 4MOAA 1HRV1 4QPIC 3MUY1 5FO9B 1LOEA 3AXDA 1STMA 3RGBA 4NIHA 4Q4W1 1S2EA 2GU9A 5FWJA 1HX6A 1S2KA 2G9ZA 2JG9A 3SNMA 4AE2A 3WF2A 1FPN1 3WP5A 1GMMA 1S0CA 3J8F3 3PJYA 3WSOA 5FK8A 2E63A 1XNKA 4QXHA 1IQAA 3BVCA 1X8MA 3MV01 5FZ9A 5JUVA 3MIHA 3NNMA 4BIOA 1U0AA 4IDZA 4QX5A 1R081 2C24A 1YJLA 4D7SA 2EXJA 2RM22 4JGYC 5A33B 3D4KA 2VZPA 1CAWA 1DF0A 1CIWA 2HWF1 2RDRA 3H50A 1V70A 2E31A 4M3CE 4NPMA 3VBFB 4RQPC 3B3QE 2Y6GA 3POGA 3T4HB 2BQPA 4CUBA 5GZFA 3GM8A 4QHOA 1GSLA 2VTXA 3KT7A 3WF0A 2VL4A 4LLFA 3VD3A 5C6CA 2OPKA 3VLBB 2AENA 2PAKA 3M1HA 3B00A 1BZWA 2RMU1 1SBDA 2Z5WA 4B8EA 3T0BA 4KI5M 2ORXA 1EV12 4E2SA 2WL1A 2ADDA 1E57A 1XE0A 1Y43B 2RR12 2K46A 2I45A 1RUC3 2QQNA 3P5BA 4XBLA 1LJ7A 5F2SA 3H8RA 4PQQA 1NCRA 3GF6A 4N8MA 4YVWB 4DIQA 1SBEA 2CDOA 4X8NA 3SC7X 1AR93 1DZTA 2BNMA 1H6YA 4BMBA 3OYWB 3AKSA 1ZZ7A 4FXKB 2ZKLA 1Y9GA 3P3NA 1MS1A 4JRAA 1CX1A 4TWTA 2DVGA 1WA4A 4W50A 1RHI1 4K3UA 5LA2A 1VRH1 3HBKA 3CU7A 3INAA 3VHNA 1LEMA 4NWWA 1MS0A 4Y3OA 4FP2A 4CU7A 1F5JA 1PX3A 2KXLA 4OLLA 5EPAA 2O8OA 1C8NA 3GJBA 1DZRA 4GAZA 4YGBA 5H9RA 4R8HA 1O7FA 3R05A 4Y5Z0 2YZ4A 5FP9A 1KDKA 2GMMA 3AJZA 3MI8A 3OD4A 2BBVA 4CUGA 4FFGA 2RJLA 4KNCA 4CCOA 3B93A 3N9PA 5KC5A 5JOYA 1PZ8A 1W8NA 5JPNB 1UMIA 3POIA 5LEJA 4QKDA 1SCRA 4YVSB 3WW1A 3U37A 4HG6B 2J1SA 4PI0A 1B09A 2XJUA 3CDZB 3R4UA 1F35A 5A1LA 4MH0E 1LKNA 3BN6A 2QQVA 4MGZE 3ZX7A 3ZVXA 1SDWA 4COZA 5FMCA 5FYSA 2W0XA 1JUIA 4P9GA 3T0DA 5A6ZA 4QDSA 4UF0B 1POV0
chains in the Genus database with same CATH topology
1VRH3 2XPJA 4IESA 2Q5TA 2DTWA 1D4M3 1W6MA 4LBMA 3OY8A 4JDMA 4XJZA 2FBEA 1YFUA 3D82A 1K5MB 1G86A 3B7MA 3ZN6A 3TNPB 4XETA 3MLKA 2GH8A 4IEOA 3VDDB 4K8FA 2X5IB 5FAXA 2WS93 4YGEA 1LGBA 1A8MA 1GZWB 4FBFA 4L11A 3K48A 5C9AC 3E5UA 4IEVA 1VBA2 4I3PA 1IS6A 4PBPA 3WUCA 3ZN4A 1LOFC 1LRHA 4R9CA 4MXVA 3JQWA 2CWMA 3UJOA 1ZBE1 4GMP0 4H14A 1FPN2 1PVC3 2R073 1IPJA 5KC6A 4QPIA 3FUOA 4HVQA 1R082 2LUWA 4XF4A 4IXLA 2A71A 1LOCA 3VBRB 2RM21 2SLIA 3KT1A 3RZZA 4XIKA 3ZN6B 4RQPB 4M3CA 1SLTA 3E6DA 2Q8OA 1GZ9A 3QH6A 2PHFA 2X5IA 1D0GA 1NXD1 4LUMA 2ET1A 5BPXA 3J8F1 4EWDA 1WW7A 1C5IA 4COUA 1RVF3 3E6CC 2Y0IA 1YXWA 4OHZA 3NSTA 4N53B 4FTSA 3B9CA 1HLCA 1EV11 1QY4A 3D6EA 4QGNA 5DDJ2 1H4HA 3LGRA 1W0OA 3AZYA 1AXZA 2IC1A 4JGZA 4DB5A 1ONAA 2UURA 1OOPA 4QPIB 1RINA 3MGUA 3OTFA 4LUKA 2GC3A 4TZDA 4PCRA 2DVDA 4FPHA 3THTA 2V73A 5JDBA 2CWSA 2Q1MA 1O91A 1Q8VA 5KHIA 3WT3A 3G7DA 4I2OA 4YW4A 2WQZC 1RHI2 2D97A 3N7KA 5BYNA 3S7IA 2A70A 4Y26A 4GQ7A 4AWDA 5F5QA 3G6JB 3AK0A 4K21A 3V65A 2GN3A 4JQRA 1DG6A 2JENA 5JIAA 4Y20A 1RUNA 1QQP3 2DUQA 4WVWA 3T1MA 4RHV1 5CAZA 4YM2A 3ZYGA 1NLRA 3M3IA 3WW2A 1NLSA 1QXJA 3TN91 1ZZCA 4MXWB 2HEYF 2ZACA 1M4WA 1N1TA 3M3QA 4I0AA 4IEWA 4YARA 2ZKNA 1XNDA 3RYRA 2PHTA 1C57A 2R041 5DG1A 2VECA 1HRV3 1O4TA 4XF9A 3U07A 1AX2A 2R49A 4TSVA 2FZ2A 1O5LA 4PDWA 2B9UA 5BNQA 2HWD3 4Q4V2 1VBD3 5FMOL 5DZGA 5D1IA 4UW5A 1GICA 1X33A 3USUB 1REFA 2CTVA 2YXSA 1QJU1 3RMYA 5FLIA 1CJPA 1GBGA 4N90A 1AYN3 3OBTA 1YJKA 2Q4SA 4AGRA 3IPVA 1LB2A 3ZFEB 4HL0A 4CEYC 1R091 5HBAA 1SLAA 3WW4A 3I59A 3B02A 2ZMLA 2QQPA 4Z82A 3E97A 3IWZA 2EVXA 3CJIB 3VZLA 4D7YA 1S0GA 4NVPA 3QCWA 4YM1A 4YGDA 2OZJA 5IK7A 1FMD1 1Q8SA 1ZM1A 1ZBA3 1D2SA 2GH2A 4QPGC 2D3RA 4Y1UA 1PVXA 4W6YA 1BBT1 1LHVA 2P3JA 2DUOA 4Q8KA 5FTTC 2WS91 4KG8A 1CD3G 1X7NA 4Z92B 2MEV2 1ND2B 3N3HA 3SISA 4AK3A 4CEWC 5FOBB 2GNTA 3JU9A 3OYWA 4CDXC 5CFCC 1AF9A 4DS0A 3RS6A 3ZXEA 2W08A 1SLLA 1D4M1 3RJ2X 4AQ2A 1PO23 4KH9A 2WNUC 1SFYA 2UWBA 5C8CA 1QOSA 5L7OB 3KMHA 3U4XA 1SQ4A 1HIXA 1V6JA 4WM7C 1V9U1 1HRV2 3DPRB 1N3QA 1BEV2 1UAIA 1SEFA 1X36A 4INDA 1JTZX 2TBVA 4Z1VA 4IERA 1NZCA 4Q4Y3 3EHKA 3N7LA 4EV0A 4Q29A 1UD1A 2HWC2 1S0JA 4CZSA 3T1LA 5DZFA 4BH9A 2HWE3 1CGPA 1UPIA 1UL9A 2D3PA 5HCBA 3GZTB 2OUJA 2ZGNA 4HKWA 2CV6A 1H2KA 4OZXA 1V6OA 4P9JA 2SBAA 2QCSB 2WFPA 4QT6A 1XYOA 1AR82 2GNBA 4MXWA 4P9YA 3AZZA 4GB31 2XLGA 2JICA 3W59A 4L92A 3OD0A 4QPGA 4RR3B 1VALA 3ZXLA 1ENRA 4XIOA 4AI8A 3ZFFA 1UKGA 3OBRA 5H9SA 1B35A 5JSRA 3WINE 2O8QA 1XYPA 3GNEA 2WT0A 3SH5A 1W6NA 4YYOA 3KT4A 4AFCA 1B35C 3FLRA 3JBG2 4XBNA 4PIXA 1QJY2 3RI9A 4YG0A 3AJYA 1OD5A 3FMGA 3RG0A 5CFDB 1G9CA 4C1XA 3HN1A 4GALA 2KA3A 2XVGA 2H0VA 2WJSA 4COYA 5DUXA 4GWNA 4QQHA 1IS4A 2WT2A 3WQ0A 4BZ4A 4Q4V1 2IFRA 3UKTA 4E4ZA 1GFF2 4N9IA 4AVTA 3RJRA 4Y22A 3M4FA 1AR61 4AFAA 3L2HA 2VW2A 1CQ9A 1UKRA 4QGLA 4CP1A 1AYM3 4FPLA 4ES9A 4QPYA 4CP0A 1QOOA 3EBRA 1WMDA 3LZZA 1COV2 3KM5A 4YFZA 3VZOA 4GWMA 2DU1A 2BGCA 4HKLA 5I93A 4OHYA 1C3HA 1EV13 3GHNA 5L73A 3AP5A 1CAUB 4B29A 1JYIA 2XJTA 4R52A 1MQTB 4KU7A 1RUH3 5GM0A 3KGZA 2TNFA 4XJ8A 5ACA1 3QACA 4AQ6A 3L9JT 4B4RA 2YDEA 2GZWA 3ZDSA 1KQRA 2E53A 1G8WA 3AMNA 5E89A 1G9DA 2GC1A 3MDPA 4FOVA 2DVFA 3DKWA 1MS3A 3DPRA 2HJIA 4UXAA 2C1FA 1FMD3 3QOPA 3LAGA 3RDIA 3B69A 3VKMA 3VHRA 2ZS6B 3SH3A 4FPJA 2WFF1 1VBE1 2D43A 1G7YA 4AGGA 3GBGA 1VBA1 1VBB3 3M7AA 1YYNA 3HQXA 1SLBA 4CDUA 1MVQA 2WKKA 1POV3 4Q26A 2XJPA 4LLOA 3LWCA 1FI2A 3WP6A 1JYCA 1C1LA 3JB4C 4QD2A 5JPMB 4V1PA 1LGCA 4M3CB 4OUSA 2C5DA 2WA4A 1Z78A 3APBA 1PK6B 1OSGA 1DGLA 5CB7A 4GB33 1IGOA 4RGGA 1AR63 3Q9OA 3VBOC 4FTBA 1VBD1 2E51A 5DUVA 1DLLA 1LENA 3M3OA 1JUHA 2UY9A 3IDBB 2PAMA 2A6ZA 5T3NA 3ZXJA 1QKQA 3ALQA 3ZSEA 1QJZA 2QZ2A 4GMP1 4IEPA 2RJKA 2AGSA 1URXA 4HPKB 1OKQA 2B39A 4K9SA 1OQ1A 5KXBA 1QWRA 3IDCB 4TLFA 3WCRA 2YYOA 1ULFA 1KD7A 1WD4A 4Y1YA 5GLTA 5C33A 4UW3A 2ARXA 2PFWA 3ELNA 2OUHA 4XFIA 3O0WA 4Y1XA 4AXOA 3HWJA 2B7YA 3MIDA 3AYCA 4FPYA 4AF9A 4X8PA 3LB9A 3FFQA 2YV8A 1JXNA 4IEQA 4S2GA 4XJUA 5AFEA 2PHUA 3NV1A 2XKPA 3KCXA 2H6CA 3MLLA 4K7JA 1RUI3 3JD72 4QU2A 3P3PA 2Y0OA 1MEC3 2A6XA 1TMF3 4QM9A 5C8CB 4S2FA 4I0WB 1LOBA 3WV6A 1HXS1 3KB5A 4YZ2A 5BNNA 5EV7A 1EYBA 4XZPA 1S55A 1YHFA 2XL9A 1GZCA 3TN92 4I09A 1RUJ2 4GA9A 3ZFEA 3VZNA 4PDWB 1LU2A 2N7GA 3ZFGC 1MZ6A 2VQAA 4XFAA 4KWLA 4JV4A 3FWEA 3IDEA 4Q4Y1 3I2DA 4YW5A 1YFYA 3USUA 1DYKA 2WNUB 4UBHA 2JG8B 2XWJB 4JTNA 3J8F2 3H3ZA 1R093 5BNPB 1WLTA 4HSJA 1RMU2 2CGPA 4DNYA 4AGVA 5KHGA 3SLIA 4BE3A 1XRUA 3RSJA 5HI0A 1UU5A 2ZGKA 1VBE3 4A2UA 1WMFA 3FHIB 1VAKA 4ASMB 1AX0A 1VAMA 4MV2A 2X29A 3A0NA 3C3VA 4KQ7A 2OYZA 4YZ5A 1R092 2Q30A 1RJ7A 3W9AA 4J1WA 3VZMA 3ZXGA 4YGCA 2ZPXA 2E7QA 5BNPC 4G9SB 3AP6A 2R0HA 4N43C 1VBE2 3VDDA 1QQP2 1D2QA 2G4IA 4BM8A 4LO8A 4AQSA 3BODA 1A8DA 1ZRCA 1OMIA 1CPMA 1XQNA 3U0ZA 2WNVB 5BV6A 4LBQB 1WMEA 1ND2A 1MS8A 1AR92 2HWD2 3BPZA 4A3XA 2QKDA 2Y38A 4WZFA 3RRDA 5GZGA 3GALA 3JD73 2WFF3 2XJVA 3TB0A 1BQPA 4SBVA 1VBD2 2TUNA 3WCSA 4E2GA 3OF1A 5EZWA 5ACA3 3TOJA 3HMYA 4XF1A 3PVBB 1AYM1 3VBUB 1WD3A 1PVC2 2R072 2JKBA 1ZZBA 4BIFA 1V6IA 2QDNA 4YZ3A 2PHRA 2WZR3 2VOXA 3NVCA 1N1VA 3ILRA 1BEV1 2ES3A 4LBQA 4MUVA 3IM0A 3W58A 1QNWA 5FLHA 3M70A 4R9AA 3KS7A 3WG3A 4MX3A 3S0MA 2DYCA 1HW5A 3FFZA 1ENSA 4O9EA 1DQ2A 1H8TC 1WW5A 2AUYA 4YM3A 4ATEA 4K1ZA 1QJX2 1HXS3 3VL8A 3SCGA 1FT9A 2EXIA 5DDJ3 3NAPA 4BPZA 4JVAA 3ZXFA 1TE1B 1NOVA 5EYYA 1HV0A 2YPJA 3N7JA 3JD71 1D4VB 1GV9A 3ETQA 2NMNA 3VBOB 1BXHA 4AI3A 1A6CA 3HT1A 1PIV3 2E7TA 3MIEA 3OJBA 2CYFA 1HXS2 4I02A 2RS51 4LTAA 3OY8B 2H6BA 1IS5A 4HT1T 2DWRA 2HWB3 4YVSA 2WNVC 2WS92 4XF3A 4F7ZA 5BNPA 3LSDA 4Y20B 3OCPA 1W6MB 5T54A 2W68A 4CP2A 4IEXA 1U5YA 5GLWA 3ZN5A 4EN8B 1G6NA 2ZAAA 1QJY1 3AKQA 1H2NA 1NA1A 4FPKA 1FYUA 4Q4Y2 1EPWA 4ASLA 4N43B 3MPPG 4F8AA 2A3YA 1BEV3 1AJKA 4DQAA 5EFUA 3NAPB 4D7TA 1QDOA 4A7YA 2BEOA 1QH6A 1ZVFA 5CA6A 3DGTA 3MPBA 1DQ4A 4NHKA 1R083 1MQTA 4IEUA 3LOBA 4QQPA 4OI2A 4QHBA 1PNGA 1MVEA 3TRSB 1QF3A 4LHNA 4Q4X3 1UPSA 3AZVA 5AVPA 2QJVA 2QUOA 1WCDJ 1COV1 3JUUA 2YY1A 2AR6A 4FOWA 1XNBA 2A6WA 2IXIA 4C1WA 1N3PA 2Z79A 4Q0SA 4LA2A 4HANA 1TMF2 4AYUA 2G9GA 1HRI2 1BBT3 1ZZ6A 1Q8OA 2RS53 3ACLA 2PELA 2R30A 3BALA 1QJY3 4B4QA 1AR81 1H8VA 3QD6A 4JRLA 2NLRA 4AI2A 2X5IC 1FOD1 4H3WA 1OA4A 2DVBA 5JI7A 4JTOA 1RUF3 3TYJA 1OFNA 4A7ZA 1RUD2 5C4WA 5E1RA 3OPZA 3O0XA 3ILFA 3SITA 5FMOS 2GSYA 3KLSA 4OVEA 3VKFC 1F5FA 5DG2A 3WZ1A 4N43A 1ZREA 3EO6A 5T55A 5LEKA 1RHI3 2ZHLA 3JBG1 5I8TA 3HD8B 1AXYA 3S6PA 1FAYA 1GNZA 1PGSA 1AYM2 3R4DB 3DL3A 4WVMB 5JCTA 1IHMA 4FOYA 1H4GA 3N36A 4EWAA 3LA3A 1CAXB 3LA7A 2R062 1H30A 2GMEA 1RUC1 3VBHC 3EQEA 3JQXA 4YVSC 4Z2WA 1MR5A 4GIQA 4BLJA 1N1YA 4PDWC 3V56A 1XU1A 1SCSA 1SFNA 4YG3A 4RL7A 2HEVF 1U5ZA 2D44A 1ULGA 2LTNA 1RUI2 2FZ1A 1VBC3 3VBHB 1PIV1 1YI9A 2MPFA 3MICA 1H2MA 4SLIA 4XFGA 4ATFA 1HQNA 4LEJA 3WDUA 1AVBA 2GNDA 2PN5A 4HK9A 1BMV1 2V5YA 5FBZA 4E4DX 1X82A 4WV8A 4XHXA 4HPKA 1OHFA 1W6QB 4IQPA 4QXKA 4YNIA 5DUUA 3S30A 2O0OA 5JMCA 4FPOB 5I0RA 4MGKE 2A6YA 4E4SA 5KXDA 1WLWA 2RS52 4BOWA 2A5ZA 3R0RA 4YVWC 4AVBA 4UW4A 2DCKA 5ABJB 2PLV2 4CDQA 2I2SA 3ZYIB 3FJSA 1HRI3 4I0BA 1ASJ2 1DYPA 1L3JA 5DZEA 1PO21 4LO7A 5FRAA 3ZSKA 2IFWA 2PTMA 1KJLA 4WM7B 1S0IA 1NYWA 1IOAA 4ZXKA 1GLHA 1BKZA 4XOGA 3WP3A 2P2KA 3D0JA 1EP0A 4HN1A 1APNA 1CN1A 3N7MA 2VULA 3J26N 5CFCB 3KZ4C 5LK7B 3U11A 4CYDA 3CLPA 4FP3A 1TME2 3B01A 1J3PA 2VUJA 4PIYA 4L97A 1BK1A 1PK6C 2VMIA 2AYHA 1NCQA 5JWPA 1LHUA 4Q2FA 3BTAA 2XLFA 4HLTA 4LBOA 1QU0A 5GZEA 4URTA 5CVRA 4Q4W3 3WQ7A 1PO13 3NAPC 1Y7BA 2P3IA 1LTEA 1RUH1 1UX6A 4QQ2A 1W39A 2ZGOA 3VHPA 1HRI1 4JDNA 5JIUA 1O3RA 2WSUA 1XE8A 2VUAA 1KJRA 1TEIA 1WUVA 2D7FA 1FOD2 4UW6A 4I30A 1AX1A 3H9AA 4AEJA 4ZU4A 2XBO2 2HWC3 4DY5A 1J59A 5FCCA 1C8M2 2BVVA 4FAHA 3SXWA 4XW3A 3QH7A 4WVZA 2FMDA 2JD4A 3ZFEC 4L99A 1RUE1 2D6OX 1O4ZA 2YGMA 4WVVA