3B00A

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8 in complex with cetyltrimethylammonium bromide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
251
structure length
251
Chain Sequence
EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Laminarinase
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 58
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3b00A00
2AGSA 1NXD1 1BQPA 5DUWA 1G9DA 5GLWA 1V6LA 2W39A 3ZYPA 4C1XA 2A7AA 1AZDA 2PHUA 3WDVA 1LOEA 4AGGA 1MS8A 1MS5A 3WUDA 1LHUA 1QNWA 3WDYA 1ONAA 1W6MB 5GZGA 1N3OA 4AWDA 1W6OA 2D6KA 3V65A 1G86A 2ZZJA 3OJBA 4XDQA 2C9AA 2ZGTA 2A3WA 1NLSA 4XILA 4WVWA 1CN1A 1FNZA 2ZACA 2P3KA 5H9SA 3ZSLA 1VAVA 5E88A 5JMCA 1YRZA 2EXHA 1GLHA 4XJZA 4R9CA 1D2SA 4XZPA 1BKZA 2LTNA 2V73A 4YG0A 2D6OX 5JOZA 2GNMA 1SLAA 3WHUA 5BYNA 1LHOA 2GN3A 3B3QE 1PZ7A 4WV8A 1ENRA 4AVVA 2CL2A 1KJRA 5KXEA 3T2TA 4JCKA 5IUQA 2DU1A 2EXJA 3VKNA 5GM0A 1LJ7A 3HMYA 4FPCA 1QOOA 1VAMA 5CAZA 2ZGNA 1ZM1A 2A6ZA 2OUHA 2VH9A 4AVSA 1N47A 1B09A 3LCPA 2R16A 1G9AA 3AYEA 1F9KA 2D6PA 2LALA 3O0WA 1DFQA 4JC1A 3ILRA 4HANA 2P34A 4LBMA 3IPVB 3N7JA 1SBDA 1DIWA 2V5YA 3KM5A 1W6PB 4YW5A 2ARXA 4P9YA 1IS4A 3ASIA 1UAIA 1V6MA 2ZA9A 2ES3A 3M3QA 4LBQA 3KQRA 1UX6A 1SBEA 2DUPA 3I8TA 3MW4A 4XBQA 4YW3A 1SACA 1AJKA 4XBLA 1C1LA 4AGRA 3AYCA 5L73A 1V6KA 3T1MA 3INAA 3RSJA 4YFZA 4FPEA 1WD3A 1OQ1A 4YFWA 5KXDA 1VLNA 3PVOA 4FQZA 3ZPYA 4Y20B 4PBPA 2ERFA 3GNEA 3NV2A 4M3CE 1AX0A 1LU1A 3IMNA 1W6NB 2Q5TA 2P3JA 5T5JA 3AP4A 5JVVA 2GMPA 3N7KA 3ZVXA 5GJ6A 4Y22A 3ATGA 1SBFA 2BQPA 1DYKA 3M3OA 2FHRA 3IKWA 4YM0A 2DVAA 4P14A 1KJLA 1WBLA 2WT2A 5GZFA 2NP0A 3WCRA 1RIRA 5EYYA 3N35A 2ZAAA 3CNAA 4XBNA 2UWBA 5IK5A 1FNYA 3AYDA 1LHWA 1G8WA 1AXZA 4FPLA 5SV8A 1LOGA 1WW6A 5T52A 4LBKA 4XJUA 4CRQA 1BZWA 3BODA 1QGLA 4ATFA 1S0JA 1N1VA 4ISRA 2YV8A 1LCLA 5HCBA 1PZ9A 4BPZA 1AJOA 3AJZA 2DWRA 1TEIA 3AJYA 1I3HA 1OKQA 2CWMA 2XG3A 3DUIA 2GMEA 3PVEA 4ITCA 1QNYA 3WOGA 2EF6A 1GSLA 1FV2A 1F31A 1O4YA 2DVDA 2WT0A 1CPMA 1LOBA 3PVNA 2I2SA 4FP2A 4Q26A 1DBNA 1YO8A 3WHTA 2DVFA 2A70A 1IOAA 4YM2A 2ZABA 3N36A 4FPKA 2OW4A 4LBNA 1MS3A 3SNMA 4Q8KA 2EXIA 4GA9A 4M01A 1N1SA 1LODA 4BOWA 3B01A 3D4KA 4PCRA 3N7LA 4YZ3A 1IS5A 2D3RA 2DU0A 1SLCA 2PHWA 4Y1YA 3DGTA 2GDFA 4P9XA 3ZYRA 1FATA 4ASMB 3OPZA 1V00A 4Y1UA 5GLTA 5DZFA 4XIKA 1ENSA 1C57A 1ENQA 4U2AA 3JUUA 4UW4A 4YM1A 3WDWA 3ZSKA 4YLZA 2A3XA 1DYPA 2DVBA 4C1WA 4AYUA 4XHBA 1GNZA 2VW0A 5EYXA 3AZVA 3WG3A 5T50A 4NOTA 1LGBA 3V0AA 1QDOA 3WG4A 4Q1PA 3POYA 1QOSA 1MS9A 1BXHA 1SLIA 2D7FA 4K1ZA 5GLZA 3RRDA 3SITA 1FX5A 1LHVA 1DQ1A 4WZFA 1DZQA 2C5DA 5H9QA 5CB7A 1W6QB 5CNAA 3FUQA 1W0PA 2TEPA 2ZMKA 1GZWA 3SH5A 3U4XA 2E6VA 3L2YA 3OYWA 4Y22B 3WZ1A 1G9CA 1G7YA 2VW2A 3AP5A 1Q8PA 3N3HA 1GYKA 2WSVA 1JYIA 2A75A 1JHNA 2JKBA 2A6XA 2UU8A 2YROA 1QKQA 3SLIA 3O12A 1V6IA 4FPJA 2GNDA 1WCSA 4M3CF 3WVJA 4FPYA 2ZMNA 4XOGA 1JOJA 2WSUA 3PMEA 4DRRA 1J1TA 3NV4A 3M3EA 2EAKA 3FLPA 2WKKA 3AFKA 2ZGPA 3AP9A 3UK9A 4MYEA 3B00A 3VKFC 1DQ2A 5H9PA 1QF3A 1G9BA 3MEPA 5DUVA 1WW5A 4XJ9A 3ZXKA 4BMEA 1FYUA 2E53A 1SFYA 4ISQA 2D43A 1Z78A 2ARBA 4DQAA 4M00A 1MS1A 4UW3A 1WD4A 1WLDA 1CQ9A 1QOTA 2NYYA 2DTWA 5DG2A 2KM2A 3W58A 4BM8A 1UMZA 5FRAA 2YMZA 3R05A 1X50A 2CY6A 1Q8OA 1S0IA 3AP7A 3USUA 1ZA4A 1WLCA 1BYHA 2WLQA 4LBLA 1CIWA 1LECA 2NMOA 1YI7A 2WJSA 1Q8SA 1WW7A 4LBJA 1GBGA 3FBYA 2D6NA 4XTMA 2VXRA 1IKQA 1MACA 2ZBJA 4M3CB 3APBA 1JYCA 4FOQA 1LTEA 3HN1A 3ILNA 1JW6A 3MW3A 1LOCA 4Q8LA 2PHFA 2A6VA 2Z42A 1A78A 1SLLA 4JRAA 2W08A 5DG1A 4TZDA 3VKOA 2D3PA 3V64A 1DQ6A 2R49A 3BTAA 5JOXA 1APNA 1ULGA 4FPOB 4GKXA 1H9WA 2PHXA 2ZGLA 5GLUA 2A6WA 2GNBA 3R4UA 1VIWB 2JE9A 4FOVA 4D69A 2P37A 3V0BA 3V0AB 1GZCA 1ULCA 2CTVA 2GN7A 4XJWA 2ZGKA 3QLQA 4Z8BA 1W6MA 2ZHLA 3MPPG 1W6OB 4W65A 1N1TA 1HKDA 4UW6A 4XMAA 4ZXKA 3VKMA 3M3CA 1KQRA 2GMMA 2D44A 1LEMA 2DURA 5IK8A 5GALA 1A3KA 2RHPA 2R0FA 3IN9A 2DUOA 2NMNA 1AVBA 3MW2A 1GV9A 1CJPA 3WCSA 3WDTA 1OFSA 1LU2A 1R1ZA 5JDBA 2B7YA 1C4RA 3M2MA 2E51A 2ZGOA 3A4UA 4Y1XA 4XMIA 3ZXEA 2ZGSA 1UZZA 1G9FA 4YG6A 2DVGA 4FPFA 3ZXFA 2GNTA 2VY0A 5T5OA 2ZGQA 4XJAA 3ZSJA 3GALA 1S1AA 5LK5A 1KDKA 4KBBA 5T5PA 2NM1A 3W59A 1SCRA 3VV1A 2AH2A 1LHNA 3IPVA 1QDCA 4HL0A 4XXAA 3D5OA 1JUIA 4Y1VA 1Q8VA 3D6EA 1IS6A 3FLTA 4YZ1A 1F5FA 4R9AA 5IK7A 3UJOA 4LBQB 2ZMLA 4XHXA 1BJQA 1LOFC 4CTEA 2HYKA 5F9TA 1HDKA 2ZGMA 1AX2A 3WNXA 1LGNA 3WG1A 5HCAA 3QCWA 3ZXJA 4WVVA 4L8QA 5GZEA 1CVNA 3A0NA 3WLUA 3OY8A 4Y20A 3NWKA 3RG0A 1UL9A 2VUAA 4FPHA 5EWSA 1GANA 2A71A 2W52A 4DFSA 1QU0A 1KITA 4FP3A 3WDXA 3UL2A 2JE7A 1IKPA 1W6NA 1A8DA 1O4ZA 4FOYA 1MVEA 4GXLA 1IS3A 2R1DA 3FLRA 4H55A 4I30A 4PBOA 4K21A 4Q1RA 1UZYA 3AP6A 3OGGA 1RITA 1URXA 1GICA 1GZ9A 2P3IA 2D6MA 4ATEA 2UWCA 1LOFA 2ZHNA 3V0BB 4FVVA 3AZXA 4XTPA 5DUUA 1S0CA 2ENRA 1JXNA 2UURA 1N1YA 4DS0A 1PZ8A 3O0VA 1CESA 4SLIA 5CA6A 1AXYA 5DUXA 2H0BA 3BIWE 2JDZA 3AXEA 1CPNA 4R9BA 4TYSA 4XJ8A 4XXPA 2JECA 4AVTA 5IT6A 4FOWA 4Y1ZA 1MR5A 3FFZA 2FMDA 2SLIA 2WQZC 2ZHMA 1MVQA 5E8AA 2PELA 1UN1A 3I4IA 3OBTA 4YGBA 1ULFA 1Q8QA 3NV3A 1QMJA 2ZGUA 4Q2FA 4YW2A 1D0HA 4Y24A 5DXDA 5F5QA 2P2KA 3ZSMA 5DZGA 1I1EA 1FV3A 5T54A 5DZEA 1ULEA 3UJQA 3B9CA 1UKGA 2VW1A 3T1LA 3HR9A 1MZ6A 1DQ0A 2EIGA 1ULDA 4BMBA 5IK4A 1DQ4A 2G4IA 1XQNA 1JBCA 2DTYA 2JD4A 1MS0A 1DGLA 2D3SA 4YGEA 2R0HA 1SCSA 2E7TA 1EPWA 2WT1A 3WDUA 4CZSA 5AVAA 2CWSA 1DHKB 3AZZA 3OBRA 5T5LA 1HQWA 2A3YA 3SISA 3VKLA 4LBOA 1W0OA 5EXOA 5KXCA 1S0FA 2YXSA 3N7MA 1KRIA 5HCFA 3M1HA 4Q27A 1GNHA 4FPGA 1SLTA 4BQ1A 1CONA 2EALA 3LSDA 3LSEA 1GKBA 1HLCA 3FUOA 1S0GA 3TAYA 2GALA 3AXDA 1U0AA 2A5ZA 1LULA 2EXKA 3Q9OA 4YG3A 5FREA 4UW5A 4DRVA 2PHRA 3OY8B 3NV1A 4LBQD 3PJQA 4PF5A 4XYXA 4YZ5A 4BLIA 2YZ4A 4RA0A 4YW1A 1LGCA 3JU9A 3RS6A 1AF9A 1S0EA 4BLJA 1SLBA 3ZXLA 2A6YA 4OZXA 4R9DA 1WBFA 4GWNA 1W6QA 1LOAA 5KXBA 3POSA 1VALA 1GZWB 3AZYA 1LEDA 4GALA 4Y26A 3OYWB 3H0OA 3WUCA 2NN8A 1YYNA 5GZCA 5GLVA 2D6LX 1S0DA 2R1BA 4FQ4A 3ENRA 2XB6C 2DV9A 2OVUA 3B69A 3C2UA 3IM0A 3POWA 4RL7A 1JN2P 1V6OA 2UWAA 1RINA 1N3PA 3VUOA 2AR6A 2CYFA 1YIFA 2NZ9A 2ZKNA 3BOPA 1FAYA 2AUYA 4YW4A 4ZKTB 1AXKA 1LENA 1Y7BA 2CNAA 2VU9A 1KDMA 1H9PA 2OUJA 3AK0A 4IQPA 5H9RA 2AYHA 2PHTA 2JJ6A 4YM3A 3RQ0A 3SH4A 2DYCA 2AENA 3O5SA 3RMYA 4K20A 1WUVA 1Z0HA 2W68A 3AYAA 4YGCA 4F83A 3AX4A 4XE9A 1DLLA 1HQLA 1V6NA 1YXWA 1MS4A 2ZGRA 3AZWA 4AGVA 1W6PA 2AREA 1MZ5A 4NO4A 5JOYA 1DQ5A 1Q56A 1UPSA 2DUQA 1H30A 4XIOA 3USUB 5E89A 3SH3A 3WV6A 1V6JA 4YZ4A 1N3QA 3A0KA 4DPNA 5CBLA 1WLWA 1AX1A 2WNEA 4YZ2A 1S0BA 1CR7A 5T55A 3RMXA 3TB0A 3WG2A 4K1YA 5GZDA 2ZHKA 3R4SA 4M3CA 4PQ9A 3O0XA 1C1FA 1LESA 1WW4A 5JOWA 3ILFA 2YY1A 4U36A 4GKYA 4P9WA 2E7QA 5JLVA 2SBAA 4GWMA 4YGDA
chains in the Genus database with same CATH superfamily
3IIIA 2OZ6A 2VUDA 1CAWA 2G19A 5A3UA 1BQPA 1OT5A 1PGL2 4I0WB 4XFBA 5IVFA 4AVBA 1V6LA 3T2PA 2W39A 1QH7A 2IXCA 3ZYIB 2PHUA 3UT0A 3WDVA 3LOBA 4RFRB 3VHPA 4AGGA 4Z2WA 3ZFFC 4C90A 2E9QA 2W0XA 2Y26A 1T6GC 2B8MA 1ALYA 4QGMA 4FFFA 1IZ3A 5C4WB 4AWDA 1W6OA 4TTGA 2WNVA 1WZXA 2IXKA 5L9RA 1ZREA 5FK8A 1TVGA 3R6SA 3B93A 3ZMNA 1G86A 3MIEA 1I6XA 3OJBA 4N8MA 4WVZA 2ZGTA 2A3WA 2HKXA 2G1MA 3PHMA 4XILA 5H9SA 4H3WA 4A42A 1UU5A 4CU7A 1YRZA 4V2VA 1QEXA 2BWAA 1EV13 1NZCA 1YC61 4NUBA 4AEDA 5JOZA 4AI2A 1SLAA 4CU8A 2GN3A 1EV11 4AVVA 3DKQA 4LKDA 1R092 2Q8EA 1HIXA 5KXEA 4JCKA 1RUJ2 2J1EA 1OOPB 1O8PA 5IUQA 5CG8A 4PQQA 1UD1A 4XFAA 4BE3A 1OUSA 3CJIA 5CAZA 1QOOA 1VAMA 5A3NA 2A6ZA 2VH9A 3KZ4C 3IIAA 5C70A 3LCPA 1G9AA 1POQA 4HANA 2E31A 3CBNA 3R0RA 2OA2A 4LBMA 4R52A 5DDJ2 4HPKA 4NRQA 4RYDA 3KM5A 1W6PB 4YW5A 5AC93 4L99A 1KS5A 3K2OA 5FZCA 1W2OA 4P9YA 3T3YA 3ASIA 2ZA9A 4MHRA 4XF9A 4ORFA 5A32A 5AC91 4YARA 1L7RA 1E5HA 1SACA 1UYZA 2FCUA 3UGHA 1TE1B 4N43B 3T1MA 1V6KA 2WZR3 3INAA 3Q8EA 3TWIA 2RS52 3RSJA 1QQP2 5L7OA 1RUE3 4X8NA 4QKNA 4YFWA 3VBHB 3BKZA 3PVOA 4FQZA 4OQ8A 1Y3TA 3HN3A 3FE5A 4P9JA 1ZZ6A 2WZR1 5BNOB 3W5NA 2NQYA 3KT1A 4GJYA 4M3CE 1RUE1 4RQPB 3J4UH 4Q0UA 2FDKA 4XCAA 4DIQA 3P5BA 4N53B 4XDPA 1S55A 2P3JA 1G6NA 2VNVA 2VOXA 4PDWB 1PO22 2BNMA 2JDMA 4HSLA 4EWEA 2GZWA 2W1QA 3VZKA 4Y22A 2Y33A 1AR81 1DYKA 3FX3A 3HPNA 3FHQA 1LAJA 1K5MC 3NJVA 5FZ9A 3W20A 4C0BA 5F2SA 1NCQA 2Y6KA 1GNYA 2R063 5GZFA 5JIAA 1W9WA 4CA9A 2NP0A 3CZUA 1VJ2A 2XHNA 5T3NA 4EZHA 2C4XA 3BIEA 4DO0A 2VTFA 1W8OA 2R061 2VECA 3KLSA 2AZ5A 1AXZA 1JU4A 4FPLA 4PF1A 3MZHA 1YQ8A 5FQ0B 5T52A 1E5IA 4XJUA 4CRQA 1WLTA 3BODA 5HI0A 2VVDA 2RDNA 4CXYA 2HJIA 3N9PA 4QX2A 2YV8A 4QX7A 4XF4A 2BVBA 2FD8A 4LNVA 3MGUA 2B45X 4MGQA 3VDAA 2Y6LA 4WVMA 3C7FA 2CWMA 3DUIA 3OEAA 4CEWC 2Q8DA 3WOGA 1JZ6A 2DVDA 3SH3A 3WQ0A 1LOBA 1VMFA 4Q26A 1DBNA 2AEZA 4TWTA 4CXXA 4EQVA 3WY6A 3N9NA 4D3WA 2XDVA 3SMHA 3HEIA 1MS3A 5C3QA 4Q8KA 2EXIA 1GWKA 4M01A 1N1SA 3B9IA 3VZLA 4IV1A 4PCRA 1VB4A 4W8JA 3T08A 1RGSA 2XGXA 2DU0A 1UXXX 3LDKA 3AVRA 4QHBA 3AFGA 2XQRA 3J26N 3MUY1 3RI9A 5FZGA 1A6CA 3WF1A 1W0NA 3OPZA 3BU0A 1V00A 4BXFA 1HRI1 4CUAA 3OUIA 3ZYBA 3VHOA 2QQWA 1UIKA 4MUVA 1PIV3 4YM1A 4E8DA 1DYPA 3E97A 2VG9A 4YVWC 1NG0A 4UFLA 4IV3A 2VW0A 1PIV1 5B4NA 4JTOA 1OLMA 4CXWA 1MQTB 1HB2A 1Q5OA 1QDOA 3GCXA 1E5RA 4JKLA 3POYA 1QOSA 5F5IA 1HN1A 1SLIA 2HWD3 1YJLA 3FHAA 3K46A 4JQTA 2XWJB 4UBGA 4E2QA 3RRDA 3AKRA 4FAHA 4WZFA 1DZQA 5CU1A 4OI1A 3ZMOA 2HWD1 4HLTA 1REDA 3FUQA 3ACIA 3S57A 1NAEA 3L2HA 3SH5A 3OYWA 2VNRA 3ITQA 2VW2A 1UZVA 1O8SA 2WO7A 1QWRA 3AL6A 3GZAA 4A3XA 1KXGA 3VBSC 3WNOA 2D97A 5FZOB 1UPIA 3O12A 1V6IA 5BUVA 5FY5A 1WCSA 2PLV3 5SV5A 4YRDA 3WVJA 4FPYA 4XOGA 2WSUA 4DRRA 2QJVA 5FY4A 4W6YA 2WKKA 4YVSA 3MYXA 3BPZA 3AP9A 1GR3A 2PLV1 3GBWA 3I2FA 4IGQA 4LKEA 4X6QB 5BY5A 1HV1A 1DQ2A 2VQTA 4XAEA 2JEMA 2HWB3 1G9BA 4ET7A 5DUVA 4XJ9A 4K3UA 2XUEA 4QPGA 1OMIA 1DCSA 2D43A 2ARBA 4DQAA 4M00A 5FIXA 1JOPA 2HWB1 3MBWA 4UW3A 3SEEA 1WD4A 2LM3A 2NYYA 4MGSA 4OQ9A 1OF4A 2DTWA 4MGYE 2KM2A 5A33A 3O1UA 5FRAA 2YMZA 2CY6A 1W03A 5L36A 2VL4A 3AP7A 3I59A 4B8EA 1WLCA 2WLQA 2OS2A 2YUEA 5JMOA 3TNPB 4KWLA 5KR7A 2X5IA 2YBSA 2QQMA 3WXPA 3ZSEA 1U5IA 2DCZA 3OOXA 1GBGA 4LBJA 1F8VA 4XTMA 2ZBJA 1JYCA 2W94A 3MLLA 2I45A 4I02A 3W9AA 3HN1A 2R043 1UY0A 3ZOIA 4Q8LA 1QJU3 2WNUA 2ZX3A 3U37A 4LKSA 2Z42A 4JRAA 3KCCA 4TZDA 1UOBA 2FQPA 2OXBA 2VPVA 4OHWA 2D3PA 3WSOA 2R041 3OBZA 5I8YA 4AI0A 3WNLA 4XQ4A 1CD3G 4D94A 5CEHA 1QJU1 1EAH3 5AFBA 2ZGLA 4EWAA 4AHXA 5FZLA 2A6WA 2GNBA 1VIWB 2JE9A 4D69A 4LXLA 4MSVA 3V0BA 3IT8A 2CTVA 1EAH1 3ZN6A 1PM7A 5F6KA 1H1MA 4RGAA 4QX8A 5FO9B 1CJDA 3ST7A 1W6OB 4L9BA 2WNVB 1N1TA 1HKDA 2BFUL 4IGPA 4LE3A 1DYOA 1RB8G 2CV6A 5C8CA 4RSUA 1XYPA 5F3EA 1SDWA 2LRPA 1H2LA 5A3PA 3JD72 3IN9A 4Q4X2 4DXRA 3ZYGA 5J3UA 3DL3A 5LASA 3MW2A 1GV9A 3P3NA 1CJPA 3WDTA 5JXGA 1OFSA 4Q29A 1R1ZA 3H1WA 4E8CA 1SDDB 3WW1A 4XW3A 3ZYJB 5E6HA 3IDEA 4OMDA 3E6DA 4MXWB 4WM8A 1UZZA 2CU5A 4YG6A 3CJIB 2C0ZA 1YWKA 5D21A 3LKJA 4FPFA 4KWJA 4OUMA 5G05L 2KR2A 1XSQA 3ZFGC 4OCTA 4P5HA 1IPJA 3BVCA 4MADA 1OBNA 4JGYB 3GYDA 5T5PA 3RJ2X 4QDQA 2NM1A 3W59A 1C8M1 2AH2A 3I3EA 1NCRC 1W90A 5CFCA 4LULA 1UF2C 5JI9A 5A3LA 4CDQC 2RG4A 2Y8KA 4L92A 2FMYA 4YZ1A 1HW5A 4LOSA 5BV6A 2JG9A 1FOD2 4XHXA 2XJQA 1LOFC 2YC0A 3MLJA 4AF9A 1HJGA 2AACA 4IW3A 3OUJA 1O3SA 1IQAA 2W47A 5L7OB 1A34A 3BTXA 5FY7A 2W46A 1XNKA 2YG0A 4GULA 4WVVA 5CVRA 3O1RA 2QCSB 2ZEXA 1KFUL 3A0NA 3IDCB 1H4GA 1ND3A 3WLUA 3OY8A 4Y20A 3H9AA 4MGTA 4LLFA 5EWSA 2W52A 5FP8A 3OBAA 5A80A 1QU0A 3PMSA 3QH6A 3WDXA 2JE7A 3F95A 2HBUA 1MVEA 1QJX1 4A7KA 4NIAA 1RUOA 3H1YA 3PIGA 4LMFA 1RITA 2WYSA 5A7QA 4Y33A 3NQHA 3NJZA 5FOBB 1ZBA3 3LEIA 4XTPA 1JI6A 4I3PA 4UF0B 4AFDA 2XJVA 3CF6E 4HVOA 4SLIA 3BYWA 3KV9A 1W2TA 2JDZA 1ZBA1 4TYSA 4AVTA 1ND2C 3AVSA 2XVKA 1JZ3A 3OCPA 2WINB 2WQZC 3OD0A 4QKDA 1OLRA 3EYPA 3OBTA 4QQPA 1O3TA 4YW2A 2XH6A 1D0HA 3D0SA 2FZ2A 1BHGA 2P2KA 2Y60A 3HNBM 4Q0PA 4UXAA 1WA4A 5KHKA 5FXWA 4CCKA 3P3PA 4Q0SA 2ZX1A 1KEXA 2VW1A 3C7EA 1OA2A 1GU3A 1ZVFA 5F3IA 2W95A 4YYOA 4LLOA 1EV12 3JBG3 2G4IA 1AYN3 1DGWA 1GOFA 3FFQA 2D3SA 2WN3A 5E1RA 2E7TA 3N9QA 1OHFA 3JBG1 3OBRA 4V1PA 1AYN1 1OPOA 2A3YA 3LE0A 3SISA 4COZA 3VGIA 5LBEA 1S0FA 2YXSA 3N7MA 4OHYA 5HCFA 1KRIA 4QAWA 4CP2A 1R64A 4RR3B 3VHNA 3POGA 4GWIA 3RZKA 2V4VA 1XU1A 4FPGA 3WNMA 3ZKUA 2Y34A 2VMDA 1CONA 1UWWA 1UKRA 3LSEA 3FC0A 4QT6A 3WP3A 1JZ8A 2MEV3 1S0GA 3WW3A 4YW7A 5A1LA 3KSCA 4IV3B 3O1SA 1DLCA 2A5ZA 1LULA 1ULOA 4LITA 5AC92 1V0AA 2Y6JA 3IMMA 2MEV1 2ZKLA 1W9FA 4PF5A 4YZ5A 5KHHA 1W8HA 2YZ4A 4RA0A 3DXTA 2Y6GA 2FBEA 3U10A 5BNPB 2CGNA 4NMIA 3ZXLA 5JAXA 2VCMA 2WZR2 1WBFA 2XL9A 3GF6A 1RUE2 2C26A 1RMU3 5IVYA 2VZUA 4YWAA 3AZYA 1LEDA 5DPNA 3OYWB 2XHKA 3WUCA 2NN8A 1PNGA 1Y4WA 3VL9A 1F4HA 3GXUA 1UZWA 4GJZA 2VMHA 1RMU1 4HSJA 4AFMA 2XB6C 5JPMB 1WCQA 2DV9A 2ZS6B 3B69A 3IM0A 4QXKA 4XZUG 3WQ7A 5FP4A 3NAPB 1AR82 1H2MA 3KS7A 1HXS3 3VUOA 2NZ9A 3BOPA 4ZKTB 2WO3A 4CPBD 1YNAA 3OPWA 1AXKA 1Y7BA 1ODNA 1OOPA 2PHDA 2VZPA 1H9PA 2YGMA 3MDPA 4JDOA 2Q30A 4A45A 4YVSB 1HXS1 1FI2A 2AYHA 2Y0IA 2X29A 5H9RA 4DUXA 5C6CA 2DF7A 3GDBA 5KWRA 4YM3A 2JDKA 1YQ6A 2R062 2WBKA 3CHXA 3O5SA 3RQ0A 3SH4A 3VBFC 4FBFA 1XSRA 1UOJA 1WUVA 3N9MA 2HEWF 1W8NA 3AYAA 4EE2A 3AX4A 3EBRA 1PM4A 2BOJA 5KHGA 2ZGRA 3AZWA 1H1AA 1W6PA 1X8EA 3USSA 2XJSA 4IE5A 3RZZA 4A41A 5JOYA 5FZ3A 1UPSA 2DUQA 5GKAC 4V2WA 3AMNA 3LB9A 1ASJ1 2VVEA 1DGRA 4PIZA 3H42B 3WW2A 3OGRA 5KC5A 4BA6A 4DPNA 1GWLA 1W9SA 1AX1A 1UMHA 5FY1A 4QB1A 1VE0A 4RGGA 3PUHA 3VBHA 1DU3D 1CX1A 1OQDA 2WO1A 2X5IB 2XOMA 1RUI3 2G9ZA 3CL1A 4HT1T 5BNOA 2DCKA 4PQ9A 4OZOA 3O0XA 1C1FA 1NX9A 1WW4A 4LK7A 1RUI1 2YY1A 4U36A 2X53S 4P9WA 2Z5WA 2G9GA 2E7QA 2WN2A 4N53A 4P08A 5HXVA 5HCAA 2Y0OA 4D6SA 2W87A 4FXGB 3WD5A 1Y9GA 2RDQA 2WS93 2JDUA 4HKLA 4FCAA 5DUWA 5GLWA 1G9DA 4LO5B 3CDZB 3ZYPA 1HRI2 2JDYA 2WS91 2ZTNA 1RXGA 2Q1FA 3W5MA 2VMCA 4LHLA 1NXMA 1MS5A 4Y4YA 2E32A 3MV01 4J1WA 2VQ0A 4QQ2A 2YGLA 3HNYM 1ONAA 1PIV2 2J42A 1UO9A 5ANQA 1T2XA 1HV0A 2ZZJA 3C3VA 1VBA3 4QPYA 3CMGA 4XDQA 5FQ0A 5C8CB 1H8TC 1GMMA 5D8AC 2VULA 1VAVA 5C5TA 4OI2A 1VBA1 3HIFA 2EXHA 4IEOA 5FYMA 4ZU7A 4IEQA 2HWD2 4B4PA 4AQTA 3MLKA 2YC2A 3T2OA 3I97A 2XLAA 3WP4A 3LA3A 2WO2A 5BYNA 3B3QE 3N9OA 4YVWA 5EQUA 1ENRA 4YSFA 5J96B 1KJRA 4Y5Z0 1RUH3 3CJXA 3MI8A 2Z2SB 4URAA 3VKNA 4AFCA 4LHSA 4CVUA 2FDHA 1F2NA 1PMJX 5FYVA 1RUH1 2OUHA 3K77A 3BTYA 4AVSA 4HG6B 1N47A 1NLRA 3CO2A 1F9KA 2D6PA 3O0WA 4JC1A 1DFQA 4NHMA 4Z1VA 5LA0A 3ILRA 2PLV2 3M3IA 1W28A 4DXTA 2JENA 5C71A 1IPKA 2Y6HA 1SBDA 2V5YA 3S6PA 1W2NA 4AZZA 2VOTA 2WQ4A 1EUUA 2BV4A 2ARXA 1HJFA 3ZKYA 3ZLIA 1RC6A 3JQWA 2ZJCA 1UAIA 2HWB2 4LBQA 3KQRA 1YLLA 1CAUA 1UX6A 2RS11 5F3GA 5C33A 3VBSA 4H7MA 3ZDVA 1K12A 1X9TA 2H0VA 1OI6A 1OVPA 4FFHA 3MICA 5ABJC 1ND3B 3ZPYA 4E2SA 3MF9A 4Y20B 4LO4B 2ERFA 2P4EA 1XBFA 3GNEA 4CUGA 3RDIA 3DKWA 1LU1A 5CYYA 1ZZCA 3IMNA 2BFUS 3WR0A 2AC1A 5IVJA 2GMPA 3N7KA 3PUAA 4LJHA 1CZTA 4KU8A 4PT6A 5GJ6A 2VTXJ 3K3OA 3I49A 3UYJA 5J1XA 2BQPA 5CKNA 2E63A 4YM0A 4YW6A 2DVAA 4P14A 1AL23 5FKBA 3S7EA 4ASKA 2R042 1WBLA 5FZOA 5I0UA 2Q8OA 3TEXA 1QJU2 5EYYA 4Q0VA 3N35A 4QGNA 4D7SA 4X6RB 1AL21 3NNMA 1JTZX 4E4ZA 1ZRIA 1J1LA 1LHWA 5IK5A 3POFA 1NY71 5SV8A 2WWSA 4HOOA 1WW6A 3DF0A 3QBQA 4BQ4A 1H1IA 2H6BA 4JGZC 2J7MA 2BP6A 4JV4A 4DB5A 1FOD3 3K3NA 4AHZA 2VMGA 1N1VA 3Q8BA 2YDEA 4ISRA 5FUPA 1LCLA 5HCBA 5JI7A 4BQXA 1AJOA 1FOD1 2Q4SA 2DWRA 1TEIA 3AJZA 2XG3A 3PJYA 3PVEA 3UV9A 2GMEA 3J7HA 1QNYA 4JVAA 2EF6A 1GSLA 1F31A 2WT0A 3PVNA 4FP2A 5JSRA 3MIFA 2J1RA 1HX6A 2BRTA 3POJA 4QGLA 4IL7A 3WQ1A 2A70A 3M4FA 3ZFFB 1O4TA 3PLQA 1TME1 1ACCA 3N36A 2GP5A 2OW4A 2VAUA 4XF0A 4C0HA 1CGPA 3ZO0B 4IERA 1NA1C 1XRUA 1JZ5A 3NNFA 2PMWB 1US3A 4UFHA 2D3RA 3DGTA 3D3AA 3ROUA 1Q3EA 4P9XA 3ZYRA 1J84A 4OHZA 4A7ZA 1Y9MA 4EWDA 2IXJA 3J8F3 3NJYA 4Y1UA 4IE4A 1C8M2 4K6BA 4XIKA 5DZFA 4BQ5A 1ENQA 4UW4A 2XXZA 3JUUA 4ARXA 4I09A 3EMRA 4QU1A 2DVBA 3J8F1 2QQPA 1AYM3 3DN7A 2FDFA 4AYUA 5F5AA 2QE3A 3MHZA 4A44A 2VMIA 3AZVA 4HFSA 4Z82A 1GFF2 4GWJA 1LGBA 4JDNA 3WG4A 1AYM1 2ZEWA 3AL5A 4Q1PA 2VQUA 2Z4FA 1GOGA 5J09A 1VBD3 3AKSA 1OFNA 3SITA 4G4FA 5FMOS 3THTA 2C5DA 2BDRA 1R1A3 3JB8A 5FY0A 2VZOA 5BXXA 3OD4A 5CNAA 1VBD1 4W50A 1JYWA 1GZWA 2VTXA 3VDDC 4CDQA 3SKVA 3WZ1A 3RYKA 1G7YA 1R1A1 2BGPA 3AP5A 3KB5A 4GMP3 1QJX2 5FBZA 1GYKA 1H2KA 1Q43A 4QPIC 1JYIA 2JKBA 4IESA 4GMP1 2LUWA 1M06G 5BNQA 3AC0A 4Y5TA 4EN7B 2WA4A 4NAOA 4J6GA 1J1TA 3NV4A 4MXWA 1VAKA 3M3EA 4IGOA 4OI0A 3RYPA 2VJXA 2J1SA 4XVHA 4EN9B 2UYBA 1ZBA2 3SEPA 2ET1A 2W1SA 1X36A 1WW5A 4GZ9A 4HVRA 4JGYA 3MIBA 2JB8A 2E53A 4IE7A 4KMQA 2W92A 4ARYA 1HN0A 5KC6A 4IE6A 1YCIA 1FT9A 4XCBA 4OUSA 5DG2A 3W58A 1OXCA 1UMZA 1K5MB 4XFGA 1Q8OA 4KH9A 1RXFA 3USUA 4BQYA 4QX0A 1HQNA 4LBLA 3JCIA 1LECA 4R4ZA 3I54A 2DDUA 3NJXA 1UX7A 3I2HA 1IQDC 1ND2A 2R073 3FBYA 3NO8A 1VRBA 4LR4A 2BJSA 5BPXA 5FZ8A 4DUWA 1ZRCA 1ZNPA 3CEWA 1LTEA 5FYSA 3NVCA 3ILNA 4D6RA 2R071 1JW6A 3JBG2 1AYN2 1OF3A 1AR83 1A78A 1SLLA 1W05A 2FZ1A 2K0GA 2W08A 3DEMA 5DG1A 4CEWB 2QFEA 1DQ6A 4AFAA 1ULGA 3PURA 1H9WA 3BOWA 5FUIA 4H7LA 3HD8B 2VMFA 3R4UA 1J59A 2B9VA 5ISLA 2Q1MA 1OH3A 1ULCA 3PNAA 4RS5C 4Y3OA 3WW4A 4IE0A 4UF0A 4CP9B 4Z8BA 2VZ1A 5A1AA 1BVVA 4W65A 3VBOC 2MEV2 4ZXKA 3H3ZA 2PYTA 4RHV3 2DURA 2ET7A 3O14A 4JHTA 1A3KA 3VZNA 1OD3A 1I9RA 3T0BA 4RHV1 3FJSA 1MZEA 5F39A 4HK8A 3AMQA 2BYVE 4NIDA 1UQXA 5JDBA 2B7YA 2QQJA 2WWJA 2XJPA 2ZX2A 1LKNA 3LA2A 4YVWB 3S0MA 1RMU2 1XYNA 2XJTA 2ZGOA 2GH2A 4XETA 5JIUA 3ZXEA 1GWMA 4UFJA 5JR7B 3THCA 2ZGSA 3ZFEC 4CP0A 2KXLA 2DVGA 1U5ZA 3LDBA 2GNTA 5T5OA 4KGQA 2ZGQA 3ME2A 5FJKA 4XJAA 5JXJA 4NIGA 1F35A 3ZSJA 1XU2A 4OULA 3CZJA 1RJ8A 1S1AA 3GALA 1HXS2 4ZZ8A 1HRI3 4AVAA 5IAXA 4LK6A 3VV1A 4LHNA 3IPVA 2CSGA 4HL0A 1Z7S1 3ZYFA 5J7MA 3TEWA 4Y1VA 5FYYA 5FK7A 1IS6A 5JR2A 3LA7A 4RR3A 2HEVF 4R9AA 2VMEA 3UJOA 5BNNC 4LBQB 3S7IA 1CAUB 1PGSA 2ARCA 4MGZE 2V4AA 3VBSB 4OUEA 2JD9A 3KGLA 4GH4C 1W99A 2WFF3 5E16A 1BMV1 1XC6A 2ZGMA 4PIXA 3WNXA 4GMP0 2JDHA 3QCWA 3ZXJA 1JZ7A 1ASJ2 4L8QA 4E4HA 3ACFA 2WFF1 4KI5M 1QJFA 3RG0A 1OD5A 2A71A 5CFDC 5BNPA 3O1TA 3B02A 2MPFA 1W6NA 2F17A 1A8DA 1RTVA 3H7JA 2JKXA 4FOYA 1IS3A 2YBKA 3FLRA 4GXLA 4Q5OA 4NAMA 4I30A 1RUI2 5FYCA 1LR5A 4Q1RA 5K8SA 2WR9A 2CAVA 1REEA 1J3RA 1URXA 3LPGA 4H2AA 4B4RA 4EV0A 1VRH1 2PAMA 3I2JA 4AI8A 4ATEA 4XABA 2UWCA 1XE7A 2ZHNA 1EY2A 5K0UC 2JWPA 3NAPA 4FVVA 2GC1A 1S0CA 2ENRA 3CKHA 1N1YA 4DS0A 2MHFA 2WS92 4W4ZA 4UFKA 1OH4A 1AXYA 4TXWA 2H0BA 1CZVA 1XNDA 3BIWE 4XJ8A 1W8ZA 2BBAA 1HB4A 3HQUA 4P9IA 4RGKA 4XXPA 5JUVA 2ARAA 2BU9A 5FYIA 3ZIWA 3P1IA 2WAOA 3TOJA 1NQDA 4WZCA 2C1FA 5LBFA 4LTAA 5E8AA 2PELA 2EIDA 2FDJA 3FBMA 3I4IA 4URTA 4YGBA 3WP6A 5J36A 5LW9A 4JDMA 3NV3A 4Z92B 5F37A 4J25A 4CDUC 5CISA 2OZJA 3ES1A 3VBUC 1RUD2 4DXSA 1VBA2 2CGOA 3PUSA 1JOBA 3SCGA 4QXCA 2K9ZA 3B9CA 3T1LA 3DPRC 2OKXA 2UYAA 2G9FA 2EIGA 1ULDA 5FXXA 5JZGC 3VD7A 3I2OA 4BIOA 1JBCA 2DTYA 2JD4A 4B3NA 5DQ0A 4UWDA 4CEYC 2R0HA 3GBFA 1SCSA 3WDUA 4CDXC 1DHKB 3AZZA 5IVCA 3VBOA 5T5LA 5I0DA 1RUH2 4LBOA 5EXOA 4BISA 5D8AA 1EYBA 5HPOA 4QB2A 1XXNA 2IWGB 3C7HA 5CIRA 2BZDA 2EALA 2K2SA 3OSDA 3EB7A 5I8SA 1HLCA 3ACGA 3FUOA 5HV0A 1OQEA 2MNGA 3TAYA 1U0AA 1ST8A 2EXKA 2O0OA 5FPZA 4AQSA 3G6JB 2RS12 3U75A 4A6OA 5A7NA 1DGWX 2PHRA 3C7GA 5LRRA 3ZFGB 4HK9A 1JYXA 1F5JA 3JU9A 4ZU5A 3RS6A 4BLJA 3I3QA 5LBBA 4DY5A 2A6YA 4R9DA 2X10A 3J7MA 4EROA 1JH5A 2VVFA 1NCRB 3RWKX 5APAA 3POSA 1K5JA 3ACLA 1GZWB 1UMIA 2RDRA 5FLHA 4JTNA 4CDQB 5FZIA 1SPPB 4QHOA 2WZEA 2D6LX 3U78A 2R1BA 4FQ4A 4RFT0 4NHXA 1BBT3 3BTZA 5ACA3 2OVUA 4RL7A 2BPA2 3VBRC 5A7WB 4AEKA 3BU7A 1FPN3 2CGPA 1JN2P 1V6OA 2C24A 3B7MA 4QWNA 1UZ0A 2JDNA 1O3QA 2ZKNA 5FLJA 1BBT1 2AUYA 5ACA1 1LENA 1FPN1 1SZBA 1RUF3 4ZU4A 2UY8A 4EJRA 3UNPA 4IQPA 1ZX5A 5LWBA 2PHTA 3WEZA 1C8M3 3POEA 1AL22 3TRSB 1RUF1 2AENA 1NY72 2DYCA 2VR4A 3X29B 5IFPA 4K20A 1Z0HA 5DAXA 4CCDA 2W68A 2HWE3 3WNKA 4XE9A 1L7QA 4NVPA 4BQ3A 4O61A 4HXCA 4QM9A 1MS4A 2RE9A 3E5UA 2ZAHA 1VR3A 1MZ5A 2WDBA 4AGVA 4E2GA 2HWE1 3ECQA 4MH0E 1PO13 3OPTA 3U0ZA 2W9XA 2WRAA 3H8RA 3USUB 3WV6A 4DMIA 1AR63 3VD9A 1WLWA 1WKYA 1PO11 2QQLA 2IUWA 4S2DA 1CIYA 1TME2 1AR61 1H2NA 1ND2B 1VBE3 3TB0A 3K48A 2HWF3 4M3CA 1QJX3 1CX4A 4GIQA 4JQRA 1LESA 4JGZA 4PLNA 4CUCA 4F3JA 3KV4A 1VBE1 5CADA 2PQQA 5JLVA 3OTFA 4GWMA 2HWF1 2A1XA 1X8MA 3J9SA 2BVVA 3KWVA 1NXD1 4YGDA 2N7GA 4CCMA 5LY1A 4DY3A 3NL1A 2F4LA 4AEDC 2VD7A 5K4LA 2VM9A 4C1XA 3HJRA 3CLPA 3IDBB 5K9YA 2BUKA 3JQXA 3A21A 1AZDA 4AW7A 1HRV3 2QBXA 1MS8A 2YU1A 3J8F2 1H0BA 1NQJA 2X09A 1B35C 1QJY3 3RVHA 1LHUA 1CZSA 3C7OA 2XQXA 3WUDA 5JCTA 5FCCA 3AMPA 4HZFA 1N3OA 1NA1A 1HRV1 1UU6A 1Y9QA 4HONA 4YNIA 3MFCA 5FMOL 2D6KA 1QJY1 1AYM2 3S30A 3ON7A 4XFCA 3ZX7A 1NLSA 4WVWA 3ZSLA 1FNZA 2P3KA 2ZX4A 4LQRA 4K8FA 5E88A 1WMEA 4FFIA 1OVSA 4XJZA 4XZPA 3GHMA 4LE4A 1BKZA 5FP3A 1VBD2 2V73A 4YG0A 4NJ4A 2D6OX 5IVVA 4E9KA 4QQOA 4EN8B 4X8PA 1R1A2 1SQ4A 3PDQA 1PZ7A 4LKFA 2K46A 4QD2A 3T2TA 1BCXA 3SCHA 4QM8A 1ZZBA 2DU1A 1YQCA 3WP5A 2UY9A 3ZFFA 5I0RA 1DG6A 1UY4A 5TSWA 2YU2A 2ZGNA 2PQSA 1JS9A 3PTYA 5FMCA 1EPZA 2PXJA 3MPBA 2BNNA 1YQ2A 4QXHA 2ZCWA 2X8KA 4GQ7A 2OQ6A 4SBVA 1DZTA 1UXZA 2B5HA 2P6HA 2Z69A 2P5BA 2VC9A 3IPVB 4FI9A 1DIWA 3O1OA 4NROA 3RWNA 3VDDA 5FZMA 3WQBA 4B1LA 3LPFA 5FJHA 1IS4A 1V6MA 3M3QA 2ES3A 1NCQC 2VUCA 2YPJA 4LA3A 4QPIA 3I8TA 4XBQA 4WM7C 5JXHA 5LA1A 4XACA 3AKQA 1AJKA 4XAAA 1C1LA 3KVBA 3EXUA 4YFZA 4FPEA 1WD3A 1OQ1A 1RVF3 1VLNA 2WA3A 1ZA7A 3HOBA 4P5YA 3HVDA 3W21A 1OA4A 4PBPA 3KV5A 2CAUA 3VZMA 1RVF1 3VD4A 4TLGA 3VBFB 2FCVA 1W6NB 4ES9A 2Q5TA 3Q8CA 5T5JA 5JVVA 2OIIA 2R6QA 2XKPA 4H14A 4AG4A 3PVBB 5FDBA 2R072 4AHYA 3ATGA 1RJ7A 5FOJB 4COUA 1A8MA 1PK6C 1WA6X 3M3OA 3WF2A 1D4M3 5JSPA 3SQOA 1FXZA 3F2ZA 3R4DB 4D6QA 1KJLA 1KS4A 1YQ5A 4MXVA 5IAVA 4A2UA 3WCRA 1S4CA 3RZHA 1D4M1 5FYZA 2ZAAA 3CNAA 1CAVB 3HBZA 5FZKA 5A7OA 3AYDA 1G8WA 4IV1C 3LD8A 1C5HA 2VZ3A 1BZWA 5FZFA 4KG8A 2FDIA 3VZJA 1RUG3 1S0JA 3RZGA 5A3OA 4IEZA 1PZ9A 5F8PA 3LAGA 1ASJ3 1I3HA 1RUG1 4ITCA 4RHV2 1CPMA 1K5MA 3WHTA 2XLGA 2DVFA 4NHKA 4YM2A 5FBJA 4QQHA 2JG8C 4S2FA 4K8RB 4BQ2A 3PU3A 1W9YA 2DFBA 4I3GA 1RUC3 4FPKA 1PX3A 2JDPA 4MGIE 4RS5A 4BU2A 2QZ3A 2ADEA 3BGAA 1LRHA 4GA9A 1X9PA 1RUC1 2XL7A 3B01A 3D4KA 4L0PA 4LHKA 1IS5A 4LOTA 4YZ3A 1UY3A 4ZONA 2JIGA 3L9JT 4Y1YA 3UGFA 1H8TB 3LEMA 4ZPIA 5A7SA 5D8AB 1FATA 4ASMB 2OPKA 2R32A 2RMU3 2E33A 3CU7A 4Q4Y1 1Z7S2 1ENSA 5LB6A 3THPA 4CEWA 1EP0A 4CYDA 1ZRFA 2A3XA 3CQOA 4XQWA 1AUYA 2RMU1 1ZZ7A 3U11A 1JU3A 1IG0A 2Y64A 5T50A 4NOTA 2XLFA 3UKTA 3CIHA 1BMV2 5DMYA 3JXSA 4Y5SA 3WT3A 4CP9A 2RS33 2PFWA 5JSOA 3ZXAC 4IEWA 1FX5A 2WFF2 1YEWA 4JKMA 1JODA 1RUD3 4QPGC 5FZ4A 2JB4A 5FZ6A 2FDGA 5CB7A 2B4KA 2RS31 1AHSA 2QQOA 5HBAA 4META 2ZMKA 2D40A 3U4XA 3L2YA 3BI3A 1RUD1 3GJBA 1W39A 2WIIB 2ORXA 4TSVA 1Q8PA 5BNNA 3H8UA 3N3HA 2WSVA 1JHNA 4IEVA 3KQ4B 3T30A 5ERLA 5FUNA 5DAVA 1QKQA 5FZBA 3SLIA 3U4SA 3ZM8A 3O1MA 1VRH2 5CKQA 2ZMNA 1JOJA 3PMEA 5ABJB 5F3CA 1GZTA 1E57A 2EAKA 3FLPA 3A23A 2ZGPA 1OURA 4M4PA 3UK9A 5LA9A 4MYEA 4AQ6A 4CU9A 2JX9A 1QF3A 2IXIA 3KHCA 1TZOA 1GQGA 5FFOC 3ZXKA 4BMEA 2GU9A 1FYUA 3M70A 2WNUC 1SFYA 3IAQA 4A6SA 5C9AC 1Z78A 1JYTA 4IUGA 4A3ZA 1MS1A 3ZN4A 4BK5A 5FZEA 2FCTA 2RS13 1QOTA 1UW8A 2F4PA 4DUVA 3H1MA 4BM8A 3R05A 3WINE 2W1WA 2Y38A 5CZKA 1S0IA 4CTEA 5K0UA 1ZA4A 5FKCA 5FMDA 2RVAA 4B1MA 1CIWA 2NMOA 1YI7A 4QKBA 5FYUA 4IETA 1UYPA 1Q8SA 1WW7A 2J1TA 2D6NA 1AR73 1IKQA 4M3CB 5FZ1A 4JGZB 4FOQA 1ZBE3 4DNYA 1JUHA 3DYMA 1AR93 1GP5A 2QUOA 5F32A 1AR71 3MW3A 1XYOA 2PHFA 2A6VA 3S5AA 4GD4A 2BNOA 3OEBA 4Y4RA 1BK0A 1ZBE1 4MVTA 4FT8A 3VKOA 3ZYHA 4AFBA 4AL9A 5FPXA 1AR91 3V64A 3BTAA 5CKMA 3PUIA 5JOXA 1APNA 4FPOB 3FZ3A 4GKXA 4LA2A 5FYHA 1T6BX 5A6YA 4FOVA 3PIJA 1OLME 1U5XA 2VQAA 2P37A 3DPRA 4WM8C 5EP9A 3V0AB 5LRSA 2GP3A 2IFRA 3KVAA 1O3RA 4G3YC 2P3YA 5ANNA 5FZ7A 1S2KA 1NA1B 1RHI3 1W6MA 2ZHLA 3B5LB 3MPPG 5FZAA 3SHRA 4CEYA 3DV8A 3JB4C 4UW6A 2EIEA 3FHIB 3M3CA 1KQRA 3SCFA 1YUDA 4CP1A 1JZ2A 1COV3 4ZXEA 5LEJA 1LEMA 2BEOA 5JWPA 5IK8A 1RHI1 2VCAA 3GGLA 5C3PA 5GALA 5CFCC 3Q8AA 1TNFA 2ZOEB 4ASLA 1COV1 4N9HA 1IGOA 4D7TA 5EHDA 3WCSA 2JG9C 4BH9A 1TMF3 4IEYA 2EVXA 1V9U3 1TME3 1GOHA 2VZSA 4HMZA 4ZS2A 3SC7X 3T2QA 4CDWC 5L9BA 3A4UA 3LEGA 4Y1XA 4XMIA 4BWOA 3LFMA 3QD6A 1JYVA 1TMF1 2XONA 4PLOA 1V9U1 2Q8CA 2RV9A 3VHRA 1G9FA 1O91A 1YFXA 4KL1A 4NWWA 3ZXFA 2NLRA 3ZDSA 2VY0A 1BBT2 1I5ZA 4O9EA 5ACA2 1CWPA 1CAXB 4QPWA 3LZZA 3FN9A 5G04L 2YPDA 1FPN2 3B94A 5LK5A 4KBBA 3T0DA 2VGDA 4IEPA 1SCRA 1EUTA 4QX1A 4XXAA 4AE2A 3D5OA 2IXHA 1H4HA 1JUIA 1RUF2 2TNFA 3VDDB 1Q8VA 3FLTA 1F5FA 5IK7A 4MO3M 5C7GA 1DDLA 1KD7A 4QPIB 1BJQA 3VBRA 5F9TA 1HDKA 2ATFA 2HWE2 1LGNA 3ACHA 1QJEA 3GZUC 2JXAA 3RFRA 2VUJA 5GZEA 4BXSV 1SG3A 4QU2A 1UL9A 3ZFGA 1PO12 2VUAA 3THDA 3HBKA 3OUHA 3V56A 4AOCA 1KITA 1AL0G 5F5CA 3UL2A 4AEJA 1BEV3 1AR62 2VE1A 1WCDJ 1O4ZA 4N90A 4H55A 2R1DA 1D7PM 1PMHX 1XJAA 2OT7A 3FL7A 4NPMA 5F2WA 1NCRA 1VBC3 3ORJA 1VBE2 4N7IA 1BEV1 3AM2A 1SPPA 3OGGA 1OPMA 2HWF2 2ILMA 2XBO3 2ZEYA 1QXJA 2P3IA 2D6MA 4I0BA 1VBC1 1JZ4A 3U1XA 4FO9A 1LOFA 5FXVA 5A7WA 1FMD3 3AZXA 4NR1A 5DUUA 2XBO1 1JXNA 1HB1A 1PVC2 1GUIA 3N9LA 1PZ8A 2ADDA 4EN0A 1DF0A 5DUXA 4R9BA 5A3MA 1UNBA 4CCLA 1FMD1 2JECA 5HCHA 2BOIA 4NN0A 4AI1A 1YI9A 1MR5A 3FFZA 1HRV2 1GQPA 2FMDA 1QJY2 1UYXA 1MVQA 1UN1A 5DAWA 5F7UA 4HKWA 1ULFA 2IXLA 1Q8QA 2YBPA 1QMJA 4QQLA 4Q2FA 4D0QA 3ETQA 3LWCA 4UFIA 1C5IA 1FV3A 3WF3A 3ZSMA 1JYNA 2D98A 2O8QA 3M7AA 2R30A 5DAPA 4UI9L 5FO8B 1U12A 1DQ0A 4XF3A 1OUXA 4BMBA 4RS5B 3RJRA 4BB3A 1B35A 3NNGA 4AQ2A 1XQNA 2VBBA 3OGSA 1DGLA 2XUMA 5C4WC 4YGEA 2WFPA 5A1FA 4CZSA 3MUZ1 4O9GA 1OC1A 2EICA 2RJKA 5AVAA 3VBOB 4Z07A 4XFHA 3VKLA 1WMDA 1W0OA 4LO7A 1QH6A 2GC0A 2YFUA 5FV3A 1S2BA 1W2AX 1XNBA 4XDOA 2HBTA 2Z79A 1GNHA 4BQ1A 2RJLA 1PMIA 2BGOA 4AI9A 1GKBA 3ALQA 3E1F1 3VDCA 4BZ4A 4HN0A 1LB2A 2GALA 3AXDA 4KU7A 4CCOA 4XUTA 5FREA 3Q9OA 1WMFA 4UW5A 4XC9A 1OOPC 4QX3A 4KG0A 2PN5A 3ZFEB 4DRVA 2WAAA 4XYXA 4LBQD 2QQNA 2W91A 2VZVA 3I2IA 2VO5A 4YW1A 1LGCA 1O7FA 3VD3A 1AF9A 4QKFA 4XUNA 5IW0A 4COYA 3GM8A 4PJYA 4OYUA 3DYPA 4O7XA 4GWNA 1W6QA 1LOAA 4B4QA 1RVF2 3P6BA 1VALA 4GALA 5FPAA 3M8LA 1OSGA 5EFUA 4Z2AA 5GZCA 5GLVA 1S0DA 3A7QA 1NYWA 1QXPA 3ENRA 3E5QA 5EJ1B 3TN93 5BNNB 2PAKA 1SFPA 3C2UA 4MV2A 4F7ZA 2Y6FA 1NUKA 1DZRA 1UIJA 4GH4B 4QDSA 2UWAA 4IDZA 4M0NA 1RINA 4WM7A 3KHBA 4N43C 4KWKA 3TN91 1FAYA 4YW4A 5C3RA 3VBHC 4FTBA 3POBA 2VU9A 1KDMA 4KGGA 3T09A 3WF0A 2OUJA 3H50A 5BNOC 1NKGA 1D4M2 2JJ6A 2P6CA 4Q4V3 4RQPC 5F6LB 1Z7S3 4A4AA 4EZ4A 4NHLA 5CFDB 5J48A 3D8CA 4GB33 1RYYA 3KCXA 3KMHA 4N53C 3RMYA 4F83A 4UAPA 1R083 4TLFA 4Q4V1 1HQLA 4OI4A 3H7YA 4PDWC 3RZLA 5A6ZA 5A6QA 4GB31 2AREA 4NO4A 3I2KA 2PTMA 4UFMA 1Q56A 1R081 2BERA 1PK6A 2LW8A 4XIOA 2ZZQA 5FPVA 1X33A 4OLLA 1RUG2 5E89A 3BCWA 1ODMA 3MIHA 5K0UB 2JDAA 1XNAA 5CBLA 2X05A 3O1PA 2WNEA 4F8AA 1STMA 1S0BA 3RMXA 3WG2A 3IZOA 2NPIA 2LROA 2ZHKA 3R4SA 4CU6A 2WQ8A 3LGRA 2EIBA 4AR2A 1GQHA 3VBFA 4COVA 1RUC2 4PIYA 3T0AA 2AGSA 2IC1A 5FWEA 1VRH3 4C8DA 2IVJA 4CDUB 3VBUB 3LFIA 4E4SA 3KT4A 2I07B 2A7AA 4INDA 4Q4Y2 1LOEA 5FMBA 4AHWA 3K4AA 1O59A 3DPRB 2JG8A 1UY1A 5JZGB 4S2HA 5EZWA 2RMU2 1O5UA 3D0JA 1QNWA 3WDYA 3H3UA 1W6MB 5GZGA 1CAVA 4CEYB 2VNOA 3EJKA 1IPSA 4CDXB 3V65A 4NRPA 5IFTA 1K45A 2VBPA 2C9AA 4HN1A 2WABA 2O8OA 5LK7B 2ETEA 1CN1A 2QZ2A 2ZACA 2RM23 5JMCA 1MZFA 2P1BA 3AKPA 4FFGA 1GLHA 4R9CA 1D2SA 3AMMA 2RS32 5FZHA 2LTNA 1OA3A 1U5YA 2C6SA 2RM21 2GNMA 3WHUA 4FTSA 1VP6A 1JMUB 1LHOA 4QX5A 4WV8A 1QXRA 2CL2A 4HKOA 1VBB3 2B46X 3HT1A 4Q0QA 4AK3A 4BDVB 2EXJA 4AI3A 1MQTC 3ABZA 5GM0A 4I2OA 3PTRB 1LJ7A 3HMYA 4FPCA 4MX3A 1VBB1 2V09A 3RZJA 1ZM1A 1NT0A 4PLMA 3TNQA 1B09A 2R16A 3AYEA 2LALA 1F4AA 2XWBB 3U14A 3UETA 4L2NA 2P34A 2XR4A 2ORZA 1H8TA 3UGGA 4DEVA 3N7JA 4P00B 1J58A 4KBZA 3J7NA 4NHYA 1HB3A 1UCXA 2B39A 4DEQA 2RR13 4LIVA 4R8HA 5KHIA 4CCNA 2VNGA 2O1QA 3VBRB 1SBEA 2DUPA 3MW4A 4YW3A 4XF1A 5FTTC 4UBHA 3SKJE 5LZ6A 4XBLA 3ES4A 4Q4W3 3AYCA 2RR11 4UOJA 5L73A 1X82A 4AGRA 1US2A 3NNLA 4QXBA 5FO7B 1WGPA 2QDRA 4XUQA 5KXDA 3A22A 1QIQA 1ZRRA 1X7NA 1W3VA 4QB6A 4Q4W1 4UT5A 5A3TA 1IG3A 3NV2A 2WLPA 2Q0AA 1AX0A 1DGRN 3IWZA 2Q1ZB 1YFYA 3KCYA 5IVBA 4CCEA 3AP4A 1CAWB 5C9AA 4LIUA 1QHDA 1WMXA 3ZVXA 1W8TA 4GAZA 3O7OA 4CPBA 1AR72 2QTWB 3DYOA 2VZQA 1SBFA 3GZEA 4OFGA 2FHRA 2GH8A 1TG7A 1VB2A 3IKWA 4OVEA 1D0GA 1UOGA 1ZBE2 4BHPA 1UOFA 1AR92 3VD5A 3KF5A 5FR3A 2WT2A 5HV4A 1RIRA 1RL3A 2CDOA 2QQKA 2QNKA 3RI8A 2HWC2 5LEKA 5K7PA 4XBNA 2UWBA 5ABJA 5JPNB 1FNYA 2WNOA 4FTEA 5FPUA 1LOGA 1PGW1 4AEMA 4LBKA 1W9TA 1MEC3 1QGLA 2DCYA 4ATFA 4COWA 2XKOA 4EYUA 2QKDA 2HH9A 3GJAA 4K7JA 4LUKA 1LNSA 1MEC1 1RHI2 2GC3A 4BPZA 1K42A 3ZR6A 3AJYA 4AEDB 1OKQA 1BVP1 4LORA 4EN6B 1ZRDA 1COV2 2L9LA 1FV2A 1O4YA 1P8JA 4O65A 5FYTA 4BIFA 4DFSA 5IYYA 2I2SA 4XURA 1YO8A 1D4VB 5I0SA 4K40A 1IOAA 2ZABA 2ZX0A 2VOKA 1C28A 2GAUA 4I0AA 1B35B 4KWUA 4QDRA 2LS6A 4LBNA 3SNMA 3BN6A 4CE8A 1TMF2 1ULPA 4OHXA 2WNVC 1LODA 1V9U2 4LUMA 4BOWA 3V0BB 3N7LA 1J3QA 2KA3A 2PHWA 2HYXA 1SLCA 4CCCA 2GDFA 3MF6A 3NSTA 4HPKB 1PGL1 2I74A 4NRMA 3IAPA 3TYJA 2IZWA 2V5DA 2D5HA 1UU4A 2BWCA 5LBCA 4DZGA 3H8XA 1ENXA 5GLTA 3MIGA 1PVC3 4CUBA 2OPWA 1C57A 1SHWB 4U2AA 3BUCA 3WDWA 3ZSKA 5A32B 4YLZA 4BK4A 1ZYBA 1NLQA 2O14A 3K4ZA 4C1WA 5KBFA 1PVC1 4XHBA 2H6CA 4CDWA 1GNZA 4BYYA 5EYXA 3WG3A 4ZY9A 1UYYA 3KT7A 3LF7A 3V0AA 4MG2A 2D5FA 3CJIC 4FXKB 4LPLA 4JZRA 3ETPA 1MS9A 1BXHA 2D7FA 4K1ZA 5GLZA 4I01A 1LHVA 1DQ1A 4JGYC 2QQVA 4PI2A 2V72A 5H9QA 5HXMA 2DBIA 1W6QB 1W06A 3T4HB 1R093 2OX0A 1W0PA 5DAQA 2IVIB 5DN2A 1RUJ3 1SEFA 2TEPA 2E6VA 2GSYA 4Y22B 3C8XA 1G9CA 1R091 4B7KA 1NCQB 1RUJ1 2A75A 2DCTA 2RDSA 2PHLA 4JHZA 3I2GA 1BEV2 2A6XA 1W3XA 2RJ2A 2UU8A 2YC4A 2YROA 4M4RA 4WM7B 1L7LA 4FPJA 2GNDA 1PHMA 5DABA 5FZ0A 4M3CF 5L7OC 1KFXL 1VBC2 4KNCA 5DDJ3 1REFA 1YFWA 4JKKA 3AFKA 2XBO2 4ONUA 2P17A 4W6WA 3B00A 3VKFC 5L9VA 2D93A 5H9PA 5DDJ1 1CAXA 3ZXDA 3TEZA 3MEPA 2VCBA 1FMD2 3HQXA 3RPQA 3GZTB 3KV6A 4ISQA 4P9GA 5F1RA 2RS53 1QQP3 1C3HA 4WVMB 1W8WA 1WLDA 3WNPA 1CQ9A 3KF3A 1PNFA 3HQRA 5FZDA 1PK6B 3I2DA 1X50A 2RS51 1QQP1 4DXZA 3ELNA 1VPHA 4NIHA 1J3PA 2J1AA 4BJ0A 3NNJA 2TBVA 1BYHA 1YFUA 1WCKA 3ZR5A 2WJSA 5FY9A 1PO23 1YHFA 3HWJA 2J1UA 4IV1B 3AKTA 1NE6A 4E27A 2VXRA 1MACA 4NPRA 3APBA 2C9KA 1PO21 3MFAA 5FP9A 3U07A 4ES8A 3WX5A 4FSJA 1LOCA 2QQUA 3EO6A 2VXJA 4D7YA 1XE0A 2JE8A 2VZTA 3OGJA 3ZIXA 2R49A 3PL0A 3J7LA 4DOUA 2PHXA 3UESA 3JZVA 5GLUA 5M0TA 2A73B 2YB7A 1BK1A 3NMBA 4NPLA 4JX0A 2JG8B 3ZXGA 2WUHA 3GHNA 2VOVA 5D2AA 5AVPA 1GZCA 3N4MA 3TEYA 2W3JA 2GN7A 4XJWA 2ZGKA 3QLQA 5C4WA 4AVCA 4LEJA 3VLBB 4ZHNA 3E6CC 5I93A 4XMAA 3VKMA 4PHZA 5FLIA 5I8TA 1V70A 2GMMA 1J83A 2ID4A 2D44A 4AXOA 4JRLA 1W2UA 3VN4A 1VMJA 3NKGA 5LA2A 2RHPA 2R0FA 2DUOA 2DCJA 1AVBA 1E5SA 1UY2A 2NMNA 2ZEZA 3POIA 4RR3C 4B29A 2J1VA 4MOAA 1WCUA 1LU2A 1JHJA 3TBDA 5EJZB 4MHUA 1OLQA 3H3LA 1C4RA 3M2MA 4IV3C 2E51A 2VZRA 5B2GB 1H6XA 1YIPA 4XUPA 2XJRA 3DECA 4P9LA 4D8MA 1H6YA 4HVQA 4C91A 3TN92 3NRUA 5FYBA 4N7UA 1PX4A 3FMGA 5C8WA 5BNPC 5IATA 4LO6B 1TNRA 3KD4A 3RZMA 4KQ7A 1KDKA 4QPGB 3UKVA 5EIYB 4Q4Y3 1LHNA 4YPJA 1QDCA 4OHVA 1O5LA 3D6EA 3I3DA 2JICA 2WWUA 4P02B 5AFEA 4IEUA 4JAAA 5A33B 1XPWA 4Q4V2 3AB0A 2ZMLA 3I3MA 2YYOA 3I7DA 2PA7A 2EAAA 4GB32 5A7PA 2HYKA 2VBDA 3I59B 1GP4A 1DP0A 3NAPC 4QMAA 5B4XA 1AX2A 1NZIA 1R082 4N43A 3WG1A 1VMHA 3IDAA 3D82A 3LOIA 3ZFEA 1CVNA 3O1VA 3PUQA 4HETA 4OMCA 4YVSC 1H8VA 3NWKA 4FPHA 1GANA 3FWEA 2E26A 4RQPA 5EV7A 5KHJA 5L19A 4LT5A 2EA7A 1XE8A 3EHKA 4FP3A 4IXLA 4RN5A 1IKPA 2BGCA 4M0HA 3MV11 4XUOA 2WNUB 5EPAA 5C5UA 5C9AB 3OB8A 1XB9A 1Y43B 4PDWA 5IWFA 2OYZA 3GBGA 2BW8A 4PBOA 3ZN5A 4K21A 2JIJA 1UZYA 4QHZA 3E6BA 4L11A 3AP6A 4CSWA 4XEZA 2YHJA 1GICA 1GZ9A 2QQIA 3T4VA 3URFA 3BB6A 4MZUA 4R4XA 4XPVA 3OG2A 4XQDA 5FAXA 5I0TA 1POV3 5LCWL 1C8NA 1F15A 4GH4A 4ZS3A 3RNSA 2KD7A 1W8UA 2UURA 2XJUA 5FY8A 3ZN6B 5C3OA 3OGVA 3O0VA 3S5QA 1CESA 5CA6A 3HNMA 5JXIA 3VB9A 2X5IC 3AXEA 1CPNA 1POV1 3GCWA 3LIHA 3VL8A 5IT6A 2J22A 4FOWA 4Y1ZA 5FWJA 1SMVA 4N9IA 2VCCA 5CFDA 2YFZA 5FPBA 2SLIA 2ZHMA 4WBBA 5IVEA 3MIDA 1SFNA 1RUNA 2ZGUA 3EQEA 4Y24A 5DXDA 5F5QA 3ZPOA 3IBMA 1I1EA 3G7DA 5DZGA 2XPJA 1GP6A 2B42B 4B7EA 3HAGA 1BLZA 5T54A 5DZEA 1WWYA 3DXUA 1D2QA 1ULEA 3LDRA 3UJQA 2WYFA 1UKGA 4WM8B 3HR9A 1MZ6A 2RM22 5IK4A 2VOWA 1DQ4A 2W2IA 4L97A 1MS0A 5LATA 1EPWA 2WT1A 3Q8FA 2CDPA 2CWSA 3RGBA 2AEYA 3LEKA 1XNCA 1VBB2 1QY4A 1HQWA 3K51A 5C8CC 1S2EA 3NW4A 5IHRA 5CFCB 2W5FA 5KXCA 4IEXA 1K3IA 3HT2A 4DINB 3UKNA 3M1HA 4Q27A 2E7AA 2HWC3 1NE4A 3BPSA 3NKTA 2JG9B 4MGKE 1SLTA 4NE9A 4CDUA 2DBNA 3LSDA 3VBUA 1O6UA 2DFCA 4XFFA 2QVSB 3WNNA 5FPLA 4CDWB 2HWC1 5I91A 1QJZA 5A6XA 4YG3A 4E4DX 3LQCA 1YJKA 1MQTA 3JD73 2HEYF 4K9SA 2TUNA 3E5XA 5JZGA 3OY8B 4Q4X3 3NV1A 4TN7A 2RR12 3PJQA 3LIGA 5FP7A 4BLIA 2OQ7A 4CCJA 4RD7A 2ZXQA 5IJRA 1S0EA 1SLBA 3JD71 2PAEA 3QOPA 4CDXA 4OZXA 4Q4X1 4Q4W2 4UYBA 4XFIA 2BBVA 4PI0A 5D1IA 5KXBA 1OKOA 1ZZ8A 2WZ8A 5J98B 4Y26A 3H0OA 4G9SB 3MO4A 3VDBA 1YYNA 5EJ3A 3OF1A 4J1XA 3RYRA 4AAPA 3H8OA 3POWA 2ZPXA 5CG9A 3AMHA 1N3PA 5C3SA 2AR6A 2CYFA 1YIFA 4LO8A 1M4WA 2F6BA 1PVXA 3K75B 4NWVA 2CNAA 3WF4A 4HBNA 5LY2A 5A70A 1ND3C 5J37A 3K4DA 3AK0A 4NIIA 3SXWA 1EAH2 4A7YA 4BCUA 3QH7A 4AAXA 4ZZ5A 1L3JA 1NOVA 1IHMA 1TQ5A 1PGW2 1KGYA 4YGCA 3I3BA 4W6XA 2IFWA 1DLLA 1V6NA 3VZOA 1YXWA 4MLOA 1MPXA 4BQWA 1XOYA 1DQ5A 3DCQA 1H30A 1MEC2 4FAGA 5FXZA 2WZPP 4S2GA 1V6JA 4YZ4A 2XVLA 1N3QA 3A0KA 2B9UA 3PU8A 5A3WA 2XMLA 3BALA 1ZZ9A 1W04A 4YZ2A 1CR7A 1I5PA 5T55A 2CHHA 2GC2A 3IB3A 1XNTA 1POV0 2HLEA 2R7EB 2XVGA 1W8FA 4K1YA 5GZDA 3QACA 2W1UA 2QDNA 2BTVC 5JOWA 3ILFA 3KGZA 4GKYA 2WL1A 2WC2A 2SBAA
chains in the Genus database with same CATH topology
2OZ6A 1CAWA 1BQPA 1PGL2 4I0WB 4XFBA 4AVBA 1V6LA 2W39A 1QH7A 2IXCA 3ZYIB 2PHUA 3WDVA 3LOBA 4Z2WA 3VHPA 4AGGA 3ZFFC 4C90A 2E9QA 2W0XA 2Y26A 1T6GC 2B8MA 1ALYA 4QGMA 1IZ3A 5C4WB 4AWDA 1W6OA 2WNVA 2IXKA 1ZREA 3R6SA 3B93A 3ZMNA 1G86A 3MIEA 1I6XA 3OJBA 4WVZA 2ZGTA 2A3WA 2HKXA 4XILA 3PHMA 5H9SA 4H3WA 1UU5A 1YRZA 2BWAA 1EV13 1NZCA 4AEDA 5JOZA 4AI2A 1SLAA 2GN3A 1EV11 4AVVA 1R092 1HIXA 5KXEA 4JCKA 1RUJ2 5IUQA 1OOPB 5CG8A 1UD1A 4XFAA 4BE3A 3CJIA 5CAZA 1QOOA 1VAMA 2A6ZA 2VH9A 3KZ4C 3IIAA 3LCPA 1G9AA 4HANA 4R52A 3R0RA 2OA2A 4LBMA 5DDJ2 4HPKA 3KM5A 1W6PB 4YW5A 5AC93 4L99A 1KS5A 4P9YA 3ASIA 2ZA9A 4XF9A 4ORFA 5A32A 5AC91 4YARA 1SACA 1TE1B 4N43B 3T1MA 1V6KA 2WZR3 3INAA 3TWIA 5L7OA 2RS52 3RSJA 1QQP2 1RUE3 4X8NA 4YFWA 3VBHB 3PVOA 4FQZA 1Y3TA 3FE5A 4P9JA 1ZZ6A 2WZR1 5BNOB 2NQYA 3KT1A 4M3CE 1RUE1 4RQPB 3J4UH 4Q0UA 4N53B 1S55A 2P3JA 1G6NA 2VOXA 4PDWB 1PO22 2BNMA 4HSLA 4EWEA 2GZWA 3VZKA 4Y22A 1AR81 1DYKA 3FX3A 1K5MC 4C0BA 1NCQA 2R063 5GZFA 5JIAA 2NP0A 5T3NA 1VJ2A 3KLSA 2R061 2VECA 2AZ5A 1AXZA 4FPLA 3MZHA 5FQ0B 5T52A 4XJUA 4CRQA 1WLTA 3BODA 5HI0A 2VVDA 2HJIA 4XF4A 2YV8A 2BVBA 4LNVA 3MGUA 2B45X 4CEWC 4WVMA 2CWMA 3DUIA 3WOGA 2DVDA 3SH3A 3WQ0A 1LOBA 4Q26A 1DBNA 4TWTA 3WY6A 4D3WA 3SMHA 1MS3A 4Q8KA 2EXIA 4M01A 1N1SA 3B9IA 3VZLA 4IV1A 4PCRA 1VB4A 1RGSA 2XGXA 2DU0A 4QHBA 3AFGA 3J26N 3RI9A 1A6CA 3OPZA 1V00A 1HRI1 3VHOA 1UIKA 4MUVA 1PIV3 4YM1A 1DYPA 3E97A 2VG9A 4YVWC 1NG0A 4IV3A 2VW0A 1PIV1 4JTOA 1MQTB 1Q5OA 1QDOA 3POYA 1QOSA 1SLIA 2HWD3 1YJLA 2XWJB 4UBGA 4E2QA 3RRDA 3AKRA 4FAHA 4WZFA 1DZQA 5CU1A 4OI1A 3ZMOA 2HWD1 4HLTA 1REDA 3FUQA 3L2HA 3SH5A 3OYWA 2VNRA 2VW2A 1QWRA 3GZAA 4A3XA 1KXGA 3VBSC 2D97A 1UPIA 3O12A 1V6IA 5BUVA 1WCSA 2PLV3 5SV5A 4YRDA 3WVJA 4FPYA 4XOGA 2WSUA 4DRRA 2QJVA 4W6YA 2WKKA 4YVSA 3MYXA 3BPZA 3AP9A 1GR3A 2PLV1 3GBWA 4X6QB 5BY5A 1HV1A 1DQ2A 2JEMA 2HWB3 1G9BA 5DUVA 4XJ9A 4K3UA 4QPGA 1OMIA 2D43A 4DQAA 2ARBA 4M00A 2HWB1 4UW3A 1WD4A 2LM3A 2NYYA 2DTWA 4MGYE 2KM2A 5A33A 5FRAA 2YMZA 2CY6A 5L36A 3AP7A 3I59A 4B8EA 1WLCA 2WLQA 2YUEA 3TNPB 4KWLA 2X5IA 3WXPA 3ZSEA 1F8VA 1U5IA 2DCZA 4LBJA 1GBGA 4XTMA 2ZBJA 1JYCA 3MLLA 2I45A 4I02A 3W9AA 3HN1A 2R043 4Q8LA 1QJU3 2WNUA 2ZX3A 2Z42A 4JRAA 3KCCA 4TZDA 2FQPA 2VPVA 4OHWA 2D3PA 2R041 5I8YA 4AI0A 4XQ4A 1CD3G 4D94A 1QJU1 1EAH3 5AFBA 2ZGLA 4EWAA 4AHXA 2A6WA 2GNBA 1VIWB 2JE9A 4D69A 4MSVA 3V0BA 3IT8A 2CTVA 1EAH1 3ZN6A 1PM7A 5F6KA 1H1MA 4RGAA 5FO9B 1CJDA 3ST7A 1W6OB 4L9BA 2WNVB 1N1TA 1HKDA 2BFUL 4LE3A 1RB8G 2CV6A 5C8CA 4RSUA 1XYPA 1SDWA 1H2LA 3JD72 3IN9A 4Q4X2 3ZYGA 5J3UA 3DL3A 3MW2A 1GV9A 3P3NA 1CJPA 3WDTA 1OFSA 4Q29A 1R1ZA 3H1WA 3WW1A 4XW3A 3ZYJB 3IDEA 3E6DA 4MXWB 4WM8A 1UZZA 4YG6A 3CJIB 2C0ZA 1YWKA 3LKJA 4FPFA 4KWJA 4OUMA 3ZFGC 4P5HA 1IPJA 4JGYB 3GYDA 5T5PA 3RJ2X 2NM1A 3W59A 1C8M1 2AH2A 1NCRC 5CFCA 4LULA 1UF2C 5JI9A 5A3LA 4CDQC 4L92A 2FMYA 4YZ1A 1HW5A 5BV6A 2JG9A 1FOD2 4XHXA 2XJQA 1LOFC 2YC0A 3MLJA 4AF9A 1O3SA 1IQAA 5L7OB 1XNKA 4GULA 4WVVA 5CVRA 2QCSB 1KFUL 3A0NA 3IDCB 1H4GA 1ND3A 3WLUA 3OY8A 4Y20A 3H9AA 4LLFA 5EWSA 2W52A 1QU0A 3PMSA 3QH6A 3WDXA 2JE7A 1MVEA 1QJX1 4A7KA 1RUOA 3H1YA 1RITA 3NJZA 5FOBB 1ZBA3 4XTPA 4I3PA 4AFDA 2XJVA 3CF6E 4HVOA 4SLIA 2JDZA 1ZBA1 4TYSA 4AVTA 1ND2C 2XVKA 3OCPA 2WINB 2WQZC 3OD0A 1OLRA 3OBTA 4QQPA 1O3TA 4YW2A 2XH6A 1D0HA 3D0SA 2FZ2A 2P2KA 4Q0PA 4UXAA 1WA4A 5KHKA 3P3PA 4Q0SA 2ZX1A 2VW1A 1OA2A 1ZVFA 4YYOA 4LLOA 1EV12 3JBG3 2G4IA 1AYN3 1DGWA 3FFQA 2D3SA 2E7TA 1OHFA 3JBG1 3OBRA 4V1PA 1AYN1 1OPOA 2A3YA 3SISA 4COZA 3VGIA 1S0FA 2YXSA 3N7MA 4OHYA 5HCFA 1KRIA 4CP2A 4RR3B 3VHNA 1XU1A 4FPGA 1CONA 4QT6A 1UKRA 3LSEA 3FC0A 3WP3A 2MEV3 1S0GA 3WW3A 3KSCA 4IV3B 2A5ZA 1LULA 5AC92 2MEV1 2ZKLA 4PF5A 4YZ5A 5KHHA 2YZ4A 4RA0A 3U10A 2FBEA 5BNPB 2CGNA 5JAXA 3ZXLA 2WZR2 1WBFA 2XL9A 3GF6A 1RUE2 1RMU3 3AZYA 1LEDA 3OYWB 2XHKA 3WUCA 2NN8A 1PNGA 3VL9A 4HSJA 4AFMA 5JPMB 2VMHA 1RMU1 2XB6C 2DV9A 2ZS6B 3B69A 3IM0A 4QXKA 3WQ7A 3NAPB 1AR82 1H2MA 3KS7A 1HXS3 3VUOA 2NZ9A 3BOPA 4ZKTB 1YNAA 1AXKA 2YGMA 1OOPA 1Y7BA 2PHDA 3MDPA 1H9PA 4JDOA 2Q30A 4YVSB 1HXS1 1FI2A 2AYHA 2Y0IA 2X29A 5H9RA 5C6CA 2DF7A 5KWRA 3RQ0A 2R062 3SH4A 3O5SA 3VBFC 4FBFA 1WUVA 2HEWF 3AYAA 3AX4A 3EBRA 5KHGA 2ZGRA 3AZWA 1H1AA 1W6PA 1X8EA 3USSA 2XJSA 3RZZA 5JOYA 1UPSA 2DUQA 5GKAC 3AMNA 3LB9A 1ASJ1 2VVEA 1DGRA 4PIZA 5KC5A 4BA6A 4DPNA 1AX1A 4RGGA 3VBHA 1DU3D 1OQDA 2X5IB 1RUI3 3CL1A 4HT1T 5BNOA 2DCKA 4PQ9A 3O0XA 1C1FA 1WW4A 1RUI1 2YY1A 4U36A 2X53S 4P9WA 2Z5WA 2G9GA 2E7QA 4N53A 5HXVA 5HCAA 2Y0OA 3WD5A 4FXGB 2WS93 4HKLA 4FCAA 5DUWA 5GLWA 1G9DA 4LO5B 3ZYPA 1HRI2 2WS91 2ZTNA 4LHLA 1NXMA 1MS5A 4Y4YA 4J1WA 2VQ0A 4QQ2A 2YGLA 1ONAA 1PIV2 1HV0A 2ZZJA 3C3VA 1VBA3 4QPYA 4XDQA 5FQ0A 5C8CB 1H8TC 5D8AC 2VULA 1VAVA 4OI2A 1VBA1 3HIFA 2EXHA 4IEOA 4ZU7A 4IEQA 2HWD2 4B4PA 4AQTA 3MLKA 2XLAA 3WP4A 3LA3A 5BYNA 3B3QE 4YVWA 4YSFA 5J96B 1ENRA 1KJRA 4Y5Z0 1RUH3 3CJXA 3MI8A 2Z2SB 3VKNA 4AFCA 1F2NA 1RUH1 2OUHA 4AVSA 1N47A 1NLRA 3CO2A 1F9KA 2D6PA 3O0WA 4JC1A 1DFQA 4NHMA 4Z1VA 3ILRA 2PLV2 3M3IA 2JENA 1IPKA 3S6PA 1SBDA 2V5YA 2WQ4A 2ARXA 1RC6A 3JQWA 2ZJCA 1UAIA 2HWB2 4LBQA 3KQRA 1YLLA 1CAUA 1UX6A 2RS11 5C33A 3VBSA 4H7MA 2H0VA 1OI6A 3MICA 5ABJC 1ND3B 3ZPYA 4E2SA 3MF9A 4Y20B 4LO4B 2ERFA 3GNEA 3RDIA 3DKWA 1LU1A 1ZZCA 3IMNA 2BFUS 3WR0A 2GMPA 3N7KA 4KU8A 5GJ6A 2BQPA 2E63A 4YM0A 2DVAA 4P14A 1AL23 3S7EA 2R042 1WBLA 5I0UA 2Q8OA 1QJU2 5EYYA 4Q0VA 3N35A 4QGNA 4D7SA 4X6RB 1AL21 1JTZX 4E4ZA 5IK5A 1J1LA 1LHWA 1NY71 5SV8A 2WWSA 1WW6A 3DF0A 3QBQA 1H1IA 2H6BA 4JGZC 4JV4A 4DB5A 1FOD3 4AHZA 2VMGA 1N1VA 4ISRA 2YDEA 1LCLA 5HCBA 5JI7A 1AJOA 1FOD1 2Q4SA 2DWRA 1TEIA 3AJZA 2XG3A 3PJYA 3PVEA 3UV9A 2GMEA 1QNYA 4JVAA 2EF6A 1GSLA 1F31A 2WT0A 3PVNA 4FP2A 5JSRA 3MIFA 1HX6A 4QGLA 4IL7A 3WQ1A 2A70A 3M4FA 3ZFFB 1O4TA 3PLQA 1TME1 3N36A 2OW4A 4XF0A 4C0HA 1CGPA 3ZO0B 4IERA 1NA1C 1XRUA 2D3RA 3DGTA 3ROUA 1Q3EA 4P9XA 3ZYRA 4OHZA 4A7ZA 4EWDA 2IXJA 3J8F3 4Y1UA 1C8M2 4K6BA 4XIKA 5DZFA 1ENQA 4UW4A 3JUUA 4I09A 2DVBA 3J8F1 2QQPA 1AYM3 3DN7A 4AYUA 2QE3A 2VMIA 3AZVA 4HFSA 4Z82A 1GFF2 4JDNA 1LGBA 3WG4A 1AYM1 4Q1PA 5J09A 1VBD3 3AKSA 1OFNA 3SITA 4G4FA 5FMOS 3THTA 2C5DA 3JB8A 1R1A3 5BXXA 3OD4A 5CNAA 1VBD1 1GZWA 3VDDC 4CDQA 3WZ1A 3RYKA 1G7YA 1R1A1 3AP5A 3KB5A 4GMP3 1QJX2 5FBZA 1GYKA 1H2KA 1Q43A 4QPIC 1JYIA 2JKBA 4IESA 4GMP1 2LUWA 1M06G 5BNQA 4EN7B 2WA4A 4J6GA 1J1TA 3NV4A 4MXWA 1VAKA 3M3EA 4OI0A 3RYPA 4EN9B 2UYBA 1ZBA2 2ET1A 1X36A 1WW5A 4HVRA 4JGYA 3MIBA 2E53A 5KC6A 1YCIA 1FT9A 5DG2A 4OUSA 3W58A 1UMZA 1K5MB 4XFGA 1Q8OA 4KH9A 3USUA 1HQNA 4LBLA 3JCIA 1LECA 4R4ZA 3I54A 3FBYA 1ND2A 2R073 3NO8A 4LR4A 5BPXA 1ZRCA 1ZNPA 3CEWA 1LTEA 3NVCA 3ILNA 2R071 1JW6A 3JBG2 1AYN2 1AR83 1A78A 1SLLA 5DG1A 2FZ1A 2K0GA 2W08A 4CEWB 2QFEA 1DQ6A 4AFAA 1ULGA 1H9WA 3BOWA 4H7LA 3HD8B 3R4UA 1J59A 2Q1MA 3WW4A 1ULCA 3PNAA 4RS5C 4Z8BA 1BVVA 4W65A 3VBOC 2MEV2 4ZXKA 3H3ZA 2PYTA 4RHV3 2DURA 2ET7A 3O14A 1A3KA 3VZNA 1I9RA 4RHV1 3FJSA 1MZEA 4HK8A 3AMQA 2BYVE 5JDBA 2B7YA 4YVWB 2XJPA 2ZX2A 1LKNA 3LA2A 3S0MA 1RMU2 1XYNA 2XJTA 2ZGOA 2GH2A 4XETA 5JIUA 3ZXEA 5JR7B 3ZFEC 2ZGSA 4CP0A 2KXLA 2DVGA 1U5ZA 2GNTA 5T5OA 4KGQA 2ZGQA 3ME2A 4XJAA 3ZSJA 1XU2A 4OULA 3GALA 1RJ8A 1S1AA 1HXS2 1HRI3 4AVAA 3VV1A 4LHNA 3IPVA 4HL0A 1Z7S1 5J7MA 4Y1VA 1IS6A 3LA7A 4RR3A 2HEVF 4R9AA 3UJOA 5BNNC 4LBQB 3S7IA 1CAUB 1PGSA 4MGZE 3VBSB 5E16A 3KGLA 4GH4C 2WFF3 1BMV1 2ZGMA 4PIXA 3WNXA 4GMP0 3QCWA 3ZXJA 1ASJ2 4L8QA 2WFF1 3RG0A 1OD5A 2A71A 5CFDC 5BNPA 3B02A 2MPFA 1W6NA 3H7JA 1A8DA 1RTVA 4FOYA 4GXLA 1IS3A 3FLRA 4I30A 1RUI2 1LR5A 4Q1RA 5K8SA 2CAVA 1REEA 1J3RA 1URXA 4B4RA 4EV0A 1VRH1 2PAMA 4AI8A 4ATEA 2UWCA 1XE7A 2ZHNA 1EY2A 5K0UC 3NAPA 4FVVA 1S0CA 2ENRA 2GC1A 1N1YA 4DS0A 2MHFA 2WS92 5E1RA 1AXYA 2H0BA 1XNDA 3BIWE 3RPQA 4XJ8A 4YM3A 4P9IA 4XXPA 3ZIWA 3TOJA 1NQDA