5J09A

Crystal structure of decameric bfdv capsid protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
193
structure length
171
Chain Sequence
RIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFALDDFLQAVPNPHTLNFEDYRIKLAKMEMRPTGGHYTVQSDGFGHTAVIQDSRITRFKTTADQTQDPLAPFDGAKKWFVSRGFKRLLRPKPNSARTGWIPLQSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beak and feather disease virus capsid protein
publication title Structural insights into the assembly and regulation of distinct viral capsid complexes.
pubmed doi rcsb
source organism Beak and feather disease virus
molecule tags Virus
total genus 33
structure length 171
sequence length 193
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.950 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j09A00
5J36A 5J37A 3JCIA 3R0RA 5J09A
chains in the Genus database with same CATH superfamily
1PVC1 1Y43B 3K46A 1WLWA 2E33A 2ADEA 1VBE2 2ARCA 2DWRA 3D8CA 3VBRC 1N47A 2VCCA 3SHRA 3ZVXA 3TN92 4DY5A 2OUJA 2WZPP 1I9RA 2XHKA 4KWJA 4XQDA 4B29A 4MX3A 5GZEA 3ACHA 3UKNA 3IZOA 3DKWA 3AB0A 2WS91 3AZVA 4CEYB 4XXAA 2EXJA 4XBNA 1VMJA 3PUAA 3GDBA 2NZ9A 3S6PA 1PMIA 3THPA 2A6XA 1FI2A 3KLSA 4CCOA 5JI9A 2HWE3 5BNOA 4XJZA 1QOSA 3K48A 4OMCA 2UWCA 3B00A 1RUG3 3RMYA 2GU9A 2GZWA 2UURA 3AVSA 4NR1A 3TB0A 3VZKA 1S0FA 2VUCA 1BEV2 1BHGA 5F37A 2ZEWA 2R7EB 1JW6A 5ERLA 4I0AA 5T50A 5I0RA 1FPN3 1OA3A 1OLME 1PIV3 2VUJA 2Y0OA 1D4M2 3OGSA 4WBBA 5FP4A 2X09A 2AEYA 2X5IA 4KMQA 1COV3 4MHUA 4W8JA 3ZIXA 1OLQA 3S5QA 2YU1A 3LDRA 4YRDA 5IVEA 4Z92B 2DBIA 5FUIA 1PVC3 1ENXA 3GCXA 3A0NA 2NMOA 2OXBA 4YYOA 3ZN6A 2A6YA 2DF7A 3KZ4C 4IETA 1UYPA 3HOBA 4JGZB 4LXLA 3WP3A 1DHKB 2DBNA 3MO4A 3FMGA 4C0BA 2WZ8A 4LTAA 4ARYA 4IE7A 5JDBA 5CG9A 3EO6A 4XF0A 3I2IA 3TEWA 1IOAA 4C1XA 2PAKA 3N7LA 3C7EA 3IIAA 5HCBA 5CFCB 2RS11 3UL2A 1QNYA 4BZ4A 1WLDA 4PLNA 2Q5TA 3IWZA 4EZHA 3V0AA 1QOTA 5L19A 5FYMA 2XH6A 1WW5A 3ZO0B 2VQ0A 4IEWA 1HRI2 1NY71 1QH6A 3AJZA 4IEVA 4XEZA 5GALA 2D3PA 1ULEA 4OI1A 3LFIA 1GNHA 2YMZA 4YW7A 3WG1A 4BISA 1S0JA 2VAUA 2WFF3 1LOBA 4Q0VA 1X7NA 5J1XA 2BP6A 3PUIA 1SACA 4EN6B 2K46A 2W47A 1EAH2 1AHSA 5FLIA 3RI9A 3CJIC 4URTA 1S2BA 1L3JA 4BQYA 3KT1A 3AKRA 4EN9B 5D1IA 2BZDA 1RYYA 3B69A 2LROA 1DLCA 2ZGRA 5DUVA 3VUOA 4PDWC 1HQLA 2HWB1 3WR0A 3EBRA 4FVVA 1LOFA 3FUQA 1VBD3 1W6PB 3K75B 4QAWA 1QDCA 1YRZA 1RJ8A 3Q8EA 4FPKA 4LK6A 4R4ZA 5FMBA 2VE1A 1Y4WA 2PLV2 3PUSA 5HCFA 3USUA 4HVOA 5FYZA 5C6CA 1SLCA 3WG4A 5IAXA 1O3TA 4SLIA 1WMEA 4DFSA 2YG0A 4KBZA 4DUXA 2BNOA 4CP1A 5BV6A 2XWJB 3J7HA 4LUKA 1QJZA 5K9YA 1QU0A 2YBPA 4O9EA 4NVPA 2WFPA 4HVRA 2ZGNA 2YGLA 2W5FA 4X6QB 1UAIA 2D3SA 2BDRA 4K9SA 1UMHA 3PUQA 4COUA 3ALQA 3GALA 3R05A 3MLLA 4IXLA 3THCA 1AR72 1MS9A 4BQ4A 1PIV2 1OOPA 1PK6B 5KC6A 2MEV2 2ET7A 1YQ2A 1KS4A 2J1UA 1NCRC 1AXYA 1GWMA 4AF9A 3QLQA 1OQDA 1BLZA 3OEBA 5J7MA 5JXHA 3ILFA 3U75A 5HXMA 4OFGA 1PVC2 3JU9A 1FAYA 5FZHA 1UPIA 3FLPA 1ND3A 1RUJ2 3NO8A 4M4RA 2A6VA 2WO3A 3V0BB 2HH9A 2ZHLA 1M4WA 2JG9B 2W0XA 2HWB3 3N9MA 3POBA 1HJGA 5FMDA 3ES4A 3VBFC 3OUHA 3VGIA 5B4XA 4BLIA 3OYWA 2GH2A 2WIIB 3TNPB 4BK5A 2B9UA 1GOFA 2FD8A 4FPGA 2WNOA 4Q4V1 2WS92 3TNQA 4L92A 4RHV1 5FZCA 4CEYA 2QUOA 2WNVB 4KG0A 1V6MA 3PVNA 3RMXA 2B4KA 4NHMA 2YBSA 2ZABA 2DUQA 3AZYA 3LA7A 2ZGLA 3VBUB 4B7EA 2YC2A 1YLLA 1NE4A 3D5OA 1ZA7A 3ELNA 4HXCA 1IGOA 2VTFA 5A3LA 2FDGA 1XPWA 1H9WA 4UW4A 3NKTA 2FZ1A 1JI6A 2ET1A 3OBZA 2VM9A 1J3PA 1XYNA 5L7OB 1F8VA 1QNWA 4XOGA 5FZOA 4ZHNA 3KHBA 2RJ2A 2RJKA 1ULFA 2OZ6A 3BTXA 1STMA 2J1AA 5CFDC 4AQ2A 3QACA 1CAXA 2E31A 4KGGA 4QXCA 3VKMA 2BVBA 2J7MA 1S2EA 2PHXA 2FBEA 2ZEXA 4HOOA 5JMOA 1AL23 1XB9A 4FQ4A 5FZLA 4CPBA 1SMVA 4FOWA 5LCWL 4Y4YA 5KWRA 1UW8A 3BB6A 2DCTA 1VLNA 4U36A 1J3RA 2QNKA 2BW8A 1SZBA 1OHFA 2GMEA 4K1YA 4PF1A 4QKBA 2J1VA 4B4PA 2WO2A 2G1MA 1YIFA 2VBPA 4RHV3 4XUOA 1VBB3 2RS12 4K6BA 4XMAA 3RYPA 4BMBA 1QQP3 1O5LA 4RN5A 4AW7A 4D6QA 4CU7A 1Q5OA 4BA6A 1AR91 1QOOA 1W8OA 1I5PA 2WQ8A 1HXS1 1C1LA 4GXLA 5ANQA 1NY72 1NCQA 1ODMA 2NLRA 5ABJC 4UBGA 4MGKE 5F9TA 1HB2A 2WT1A 1B35B 1US2A 3MPBA 3GBGA 2D6OX 3AXEA 3OBRA 1VMFA 2BGCA 2TEPA 2Y6KA 4IE4A 1ULCA 5F5CA 5LY2A 1NQDA 1AX2A 4FFGA 4IEOA 5BYNA 3MZHA 2ENRA 2IVJA 1UYZA 2P5BA 5A3OA 4A45A 3AXDA 3JD71 5JPNB 2CGOA 1GZWA 2CU5A 1A6CA 1W04A 5BNOC 4P9WA 5FWEA 4DPNA 4AI3A 4XPVA 5C8CB 4YW1A 2J1SA 3LE0A 4CP9B 5JIUA 1CAVB 5F8PA 1SPPB 5TSWA 4DRVA 1FMD2 5C70A 5LRRA 5C4WB 2FCVA 2VUDA 3I2DA 1CAUA 1G9FA 3MIDA 4MO3M 5C9AB 2CDPA 4NPRA 2IXLA 2X5IC 2IXJA 5L9RA 1VAKA 3ZYFA 4A42A 3O0XA 1N1TA 3ITQA 1OVPA 4H14A 3N4MA 5A7OA 3WCSA 1HXS3 1W06A 3LWCA 4XFFA 5CYYA 4O9GA 4F7ZA 4QPGA 4OMDA 2PHDA 3RI8A 5FPBA 1K5MC 4WM7B 1YQCA 3LAGA 3LDKA 3K77A 2P1BA 3R4DB 4Q0SA 4LOTA 4Q8KA 3WOGA 4OI4A 1JZ7A 5CB7A 3U10A 2UYBA 2ARXA 2YBKA 1ND2B 3T0AA 4LMFA 1WWYA 2AACA 1D2SA 3K51A 3ACLA 1DQ4A 4IE6A 4TTGA 1DG6A 2ARAA 4HSLA 2RMU3 2VMFA 2HWF3 5FYUA 3FHAA 2JG9A 1YQ5A 1RIRA 1OF3A 4YFWA 2R16A 4FQZA 3RDIA 1VAMA 1MZ6A 4RGGA 3N9QA 4QDQA 5CVRA 3WNLA 5J96B 2HEYF 3WW1A 4XF1A 4Q4V2 4URAA 2E9QA 2IC1A 5A7PA 1V6LA 2UU8A 4XDPA 3ZXFA 4XTMA 5IATA 1DQ2A 4L9BA 5FYBA 5D2AA 2VMHA 1ZRRA 3JB4C 1NOVA 1MS3A 4ATEA 1O3RA 4GULA 2V5DA 3OUJA 4XJ9A 2ZCWA 5FYHA 3RPQA 2W92A 4RGAA 5FBJA 3WNOA 3H3ZA 4UFLA 4YGDA 5L7OA 2Y33A 2QZ2A 3AKTA 4I30A 1RUH2 3QOPA 1LOFC 4LITA 2WDBA 1RXFA 2BNNA 3VBRB 3I2OA 4MV2A 3AKSA 1GKBA 1E57A 1GFF2 4INDA 4OQ8A 2PHFA 4IEYA 4LBNA 4XFBA 5F3IA 4YZ5A 1WW6A 4BWOA 3BOPA 4HONA 2FMYA 1AR61 4Q2FA 3ZSKA 2Q0AA 5B4NA 3O7OA 2HWD3 2EXKA 4XF4A 2CGPA 5FO7B 4FSJA 5F2SA 2ZX1A 1RUOA 4V2WA 2R061 4KI5M 5H9SA 4JV4A 5IYYA 3PDQA 4QU2A 3DPRC 3SQOA 1CIWA 3T0BA 2W1QA 2XJQA 5FZGA 3CU7A 3NNLA 5A3UA 4MGTA 3BTYA 1PM7A 1YC61 2XGXA 3N9LA 3WY6A 4XBLA 1IQAA 1K5JA 5JSRA 4CYDA 2TUNA 1AR92 3T1LA 3SCGA 1AUYA 3VHOA 1AYN1 3ZXAC 4AOCA 1ND3C 5A6QA 1CAWA 2VECA 1S0GA 1WMXA 3WDTA 2XKPA 2RDNA 5FP9A 4ASKA 1RUF1 4LO8A 1QIQA 4XW3A 2E63A 4EWEA 2VW0A 4HN0A 3ZR5A 1LNSA 1T6GC 3GZTB 2GC1A 2VQAA 2ZPXA 5ACA1 3FWEA 5F32A 5J09A 5IK8A 4YW2A 4M4PA 2NM1A 3RRDA 2Z5WA 3LOBA 3W58A 4FPLA 5J37A 1R1A3 3AM2A 1AJKA 5A7WA 1S0DA 5FLHA 3AMMA 3T2QA 1KXGA 2OVUA 2W08A 3JD72 1PHMA 5C3OA 5KXDA 1K45A 1DLLA 4CCMA 1LECA 2P3KA 3O5SA 4HMZA 5JPMB 3VD3A 4ZXEA 1AYM2 5C8CA 1GP4A 3AX4A 3IIIA 1UWWA 3AFGA 5JWPA 5FZ0A 1GSLA 4IV3A 1ULDA 1SPPA 1YWKA 5FZIA 3U78A 2BRTA 4N9HA 3NL1A 2WZR2 3SCHA 4DEVA 5E89A 5C9AA 1A8MA 3UYJA 4Z1VA 1YXWA 3AVRA 2GNMA 3AMNA 4BH9A 2UY8A 2C9KA 1VB4A 2VVFA 5DDJ1 5I0UA 5C71A 3NNFA 4P9LA 1A34A 1N3PA 4HETA 1NYWA 1RUE1 2JD4A 3GF6A 3VDCA 4COYA 2QDNA 4W6YA 2BTVC 2O0OA 1N1SA 1X50A 2EICA 4UXAA 4PDWB 2A1XA 4XJ8A 1H1IA 2FZ2A 2ZMLA 3VLBB 1BK1A 2GAUA 2XJTA 2YV8A 4XUPA 2HBTA 1O8PA 4OCTA 4DNYA 2VL4A 4GMP1 3MIGA 1Z7S2 1NT0A 2V73A 5FZBA 5DG1A 1Q8OA 4GH4A 2J22A 3BOWA 2XJVA 1YNAA 3TBDA 4GJYA 2R0FA 1GNYA 1VMHA 5GLVA 4ITCA 3WX5A 3VDDC 4ASLA 2C5DA 2CDOA 1OLRA 2OQ7A 2Q8CA 1NCQC 3RZGA 2VZRA 1GWKA 2VZVA 2C9AA 4N90A 4XCAA 3VBOA 4IV1C 1ENRA 3FX3A 2Y6HA 3J7NA 1PX4A 1I5ZA 4BU2A 3B9CA 5BUVA 1RHI2 4FTBA 1NCRB 2E7TA 1KEXA 2HBUA 2WABA 3VHNA 5I93A 3PNAA 4FBFA 5KBFA 3OGJA 1R1ZA 4LBQB 3W9AA 1UMZA 4FPEA 1RUE3 3I2KA 3CHXA 4RS5A 2R30A 2VMDA 1MPXA 2PQSA 2X05A 1KQRA 1QDOA 3VBFB 4Y5TA 1SHWB 1J1LA 1O59A 1C1FA 4Q4X1 3V65A 1MS1A 3MW3A 4WVMB 4Y5SA 3HBZA 1Y7BA 3MFCA 1AR62 2VZUA 4OLLA 2VMGA 2JEMA 4DS0A 1OSGA 3OTFA 5CIRA 3AKPA 4HPKA 5AVAA 5DAWA 4MH0E 2IXHA 4MGSA 2A70A 2R062 3HAGA 2TNFA 1JZ5A 4YARA 1F2NA 1PO12 2CWMA 2FDHA 1W2UA 4QPGC 1SQ4A 2FMDA 1AJOA 3Q8CA 1OT5A 1QXJA 1XC6A 1AR81 1S55A 2QQNA 4OZXA 4W65A 1MQTA 5IT6A 1Z78A 4COZA 4C90A 3K2OA 1VRBA 4HK9A 5C3PA 2JDPA 1LOEA 2XWBB 1BCXA 1O4ZA 1RVF1 5CFDB 4W4ZA 3WEZA 1IPJA 4GALA 1AYN2 1HW5A 5FQ0B 1TMF1 2HKXA 1E5SA 2Z69A 5HCAA 4YFZA 4QXHA 4J1WA 1FNYA 1UQXA 1D7PM 5C8WA 4Q0PA 1JYWA 3PLQA 5T5PA 2ORXA 4L97A 1RUF2 5DZFA 4R9CA 4CZSA 1V70A 5ACA2 4X8PA 5HV4A 1UIKA 5C5TA 5JVVA 4HL0A 3T2TA 1NA1C 3W21A 4E4HA 4Q4X3 2RR11 3PVEA 4HBNA 3ZXEA 1LTEA 4A44A 2QJVA 2G4IA 2B5HA 1S0IA 2A73B 2QQKA 3GYDA 4JQTA 4UFKA 4XTPA 5GLZA 1W8ZA 1ZZ9A 4Y1XA 5BY5A 1SEFA 3NSTA 3APBA 4IESA 4UF0B 4ASMB 3GHNA 1C4RA 2KXLA 3WQ0A 1XSRA 3I3EA 4H7MA 1CJDA 3NJXA 4XETA 4DOUA 4YZ4A 5ABJB 3LCPA 3HNMA 2D6MA 2OX0A 3POFA 1BBT3 4QQHA 1TVGA 1AR83 5B2GB 4AAPA 4NIDA 1DYOA 2G19A 4OYUA 3P1IA 2J1RA 3MUZ1 5DDJ2 1FXZA 1UKRA 5FXZA 3WNMA 3CJIA 2C26A 3ON7A 4LLOA 5HXVA 1DZTA 4YWAA 5L36A 3UNPA 3SKVA 3ZIWA 1UY1A 2WINB 4Y1YA 4EN8B 5BNOB 4JQRA 4Q1RA 4I2OA 3GZEA 4YM3A 4IEPA 2XHNA 4OI2A 4N8MA 1JOBA 3AYEA 5CBLA 1UO9A 4LO5B 1UYXA 1W90A 1JHNA 2RR13 3I3QA 4QX2A 1N1VA 4CCJA 2VCBA 3RFRA 5LWBA 1DP0A 3ILNA 2X5IB 1TQ5A 3M8LA 4A3XA 3W5NA 3BCWA 4J25A 1RUC1 1X9PA 1VR3A 2H0VA 2OPKA 3KCYA 3DEMA 4LE3A 2QE3A 2B8MA 1CZTA 3IDAA 1H8TA 1K5MB 3M3OA 3U1XA 4XJWA 2WA3A 4R8HA 2D3RA 1H1AA 5FZDA 2XONA 1IS5A 1MEC1 1KJLA 1VBC1 2GP3A 3DGTA 3J8F3 4Z2AA 3KVAA 1ULGA 4CU6A 1VB2A 4MVTA 1RUD3 3TAYA 1EV12 1SBEA 2HWC2 1JZ3A 4IV3C 1APNA 1TG7A 2ERFA 3C7FA 3OPWA 1GOGA 3FC0A 4HKLA 3UKTA 3JBG1 3KB5A 2XQXA 4AI1A 2XBO2 4L2NA 3SISA 4YGEA 3WHTA 5IW0A 2PN5A 2H6CA 1UY3A 4CP2A 2C1FA 3I2JA 3C8XA 5EJ1B 5A80A 3WUCA 3GJBA 3ZMNA 1JYIA 3WQ7A 1AX0A 1DZRA 2VBBA 5EJZB 2OT7A 2WO1A 3ROUA 3LF7A 5AFEA 5LY1A 3CZUA 2ZTNA 3PURA 1RUC3 4R9BA 1MS4A 2VZQA 4CDXC 3I3DA 1JBCA 2B46X 2RG4A 3BPSA 4XIOA 5C5UA 2CV6A 3FUOA 3RWNA 1X82A 4NWWA 4NPLA 4AI2A 3H50A 3ZYJB 4CU9A 2QQJA 5A1AA 1RVF2 1ULOA 5CFDA 3HN1A 4GH4C 3SH5A 3USUB 1MEC3 5JZGA 5FQ0A 3B93A 5APAA 1VBC3 1TMF2 3M2MA 1FOD3 4K7JA 5GLUA 4DINB 4OZOA 2HWE1 4MXVA 5IFPA 1LHUA 4PQQA 2YB7A 2O8OA 1RUG1 2XR4A 4NIGA 5F5AA 3ZSJA 1NUKA 3AP7A 3KM5A 5T5OA 2R073 1LOCA 3DXTA 3VBOC 4OUSA 1QF3A 2IXCA 2O1QA 3FBYA 3DPRB 1O6UA 3CO2A 4MGIE 1HLCA 1FPN1 5EXOA 1OOPB 4AK3A 4AVSA 2UYAA 1COV1 4XF3A 5JSPA 3H7YA 4CRQA 2QQPA 1YFXA 2RV9A 4W6WA 4ZU4A 4BK4A 4P9XA 3VBHC 4A7KA 5A3NA 5I8TA 4DRRA 2VQTA 2B42B 1ND3B 1QJU1 1W3VA 2V4VA 5ABJA 1EPWA 4RS5C 4D3WA 4IGQA 2Q1MA 3E6CC 3AZXA 4OHVA 4S2FA 3OYWB 4LKDA 4CXXA 2X8KA 3M1HA 5I8SA 4DY3A 2E32A 2X10A 4AG4A 3NMBA 3NV2A 3TOJA 2WT2A 5AC92 3BVCA 4DQAA 3JUUA 2VNRA 3WP6A 5D8AC 4OHZA 2PELA 4KWUA 2ZGOA 1CN1A 3OGVA 1DZQA 1VE0A 1WCSA 3H8RA 3KSCA 4IEUA 2Y8KA 2QQOA 3OBAA 3AMQA 2DFBA 2YYOA 3SH4A 5LRSA 3IDCB 5A3WA 2RDSA 2WFF1 4YVSA 4HT1T 1MQTC 4AL9A 1L7LA 1I6XA 3LDBA 2RJLA 5FZOB 4Z8BA 3D3AA 1TZOA 2E26A 1XJAA 4G3YC 2EA7A 2ZGSA 4E4ZA 1U5YA 1V6OA 3D4KA 1W3XA 5LBFA 3OGGA 5FZ4A 4K21A 3O0VA 1CAXB 1EY2A 3I59A 4GB32 4Q27A 5JOYA 3UKVA 3ILRA 2WUHA 3EHKA 2FDKA 4PJYA 3WDXA 3JXSA 1QJU3 1UU4A 3ZLIA 4COVA 1VBD1 3VD5A 1K5MA 2XKOA 4QXBA 2CY6A 1CPNA 1S2KA 5JOZA 4O65A 2WA4A 5FY8A 1HIXA 1MEC2 2JE7A 2RDQA 5FP7A 2ZGTA 4I3PA 5I91A 4FCAA 4I0BA 1JYXA 2D5HA 2KR2A 4MSVA 1UKGA 1LGNA 1YI9A 3VDDB 2LS6A 2Y6GA 1HDKA 2JE9A 2WSUA 3H1YA 1NCQB 4XQ4A 3RG0A 5E6HA 2YHJA 3DCQA 1C8M1 4P5YA 2D7FA 3JBG2 2BPA2 1EUUA 2QQLA 4Q0UA 1H4HA 4XQWA 1RJ7A 2GP5A 5EP9A 3O12A 4EZ4A 2PTMA 3WQBA 3QBQA 3ASIA 4OULA 4EV0A 5LA1A 4M01A 3WF0A 1HN1A 3S30A 3N9NA 4FTEA 1SDWA 2JJ6A 1XOYA 1H9PA 2XL9A 3NQHA 5JLVA 2BUKA 2UWAA 1GZWB 4Q0QA 4XUQA 5CA6A 1H4GA 2ZEYA 1WW7A 5IUQA 3CMGA 2KD7A 3LQCA 3NNGA 2DCJA 2WAOA 4CUAA 2W52A 1O4YA 4QXKA 1SG3A 1W6OA 1U12A 2BU9A 1UU6A 1XU2A 2ATFA 3MW4A 4LIVA 3WNNA 4QM9A 1EYBA 1JHJA 1J83A 4ONUA 4AZZA 1CAUB 4CUBA 4GIQA 2VXRA 3AYCA 2ZXQA 4AQSA 2P3IA 4HANA 4BIOA 1KITA 5A6ZA 4LBOA 1IQDC 2ZGQA 5A3TA 2HWE2 2F4PA 1QHDA 2VY0A 2XXZA 1RUG2 1XNAA 5JAXA 3UGFA 4IDZA 3ZYPA 2QCSB 1JN2P 1OLMA 2WQ4A 1C8M3 1OD3A 2WSVA 3DPRA 3DXUA 3CZJA 1H8TC 4NJ4A 4Q8LA 1F31A 1FPN2 1Q8QA 2JX9A 2Q8DA 2EAKA 1W8TA 3T09A 4YNIA 4JZRA 4B1MA 1COV2 4BIFA 2DVAA 4UYBA 4CXYA 4DB5A 5IK7A 1OH4A 2GNBA 2EF6A 2W68A 5IVVA 1WBLA 5J98B 5L9VA 3T0DA 2WAAA 5ISLA 1AL21 2DVDA 4NHLA 2C24A 4LBJA 5FK8A 5FR3A 4EQVA 4JTOA 5EYYA 1URXA 3SH3A 4XURA 1K3IA 4K20A 4B8EA 4LHKA 2F17A 4AGRA 3Q8BA 4WVWA 2OS2A 4QM8A 4N43A 2DU1A 5CZKA 1AVBA 3PU3A 2WJSA 1NA1B 3B9IA 1VBB1 4IGOA 1QQP1 1EPZA 5IVCA 4IEZA 2XPJA 2XUEA 1OA2A 3P3PA 3T2OA 2VNGA 2Z2SB 1JZ6A 1HV1A 3OSDA 2A6ZA 4QHBA 1O91A 3KV9A 4XBQA 3LSEA 1GZTA 3RZMA 5A7QA 2YGMA 2AUYA 4AVTA 2VW1A 1OUXA 2WFF2 3WV6A 2WBKA 3A21A 4R9AA 4TYSA 3AL5A 3VV1A 4YM0A 2PHLA 3Q8FA 1D2QA 4LE4A 3JQWA 4UWDA 5JZGC 2JWPA 5KXBA 2PMWB 1V9U3 2NPIA 3QD6A 1YEWA 5FJKA 3THDA 1UNBA 3DN7A 4GJZA 2ETEA 3KF3A 1EUTA 4UFHA 5FYSA 1H8VA 4LBKA 1FX5A 4MZUA 5G05L 4IGPA 2BOJA 3MF6A 1VBD2 3MIFA 4TZDA 1ZM1A 3MFAA 3UESA 1W8FA 1NE6A 4OHYA 2JDNA 3I2FA 3VZMA 2IFRA 4M0NA 4Y24A 5I0SA 2QFEA 1YHFA 2JG8C 4LKFA 3DYMA 2WN3A 3ZFGC 1QMJA 3NNMA 2VOXA 2G9GA 5CEHA 1SBFA 2YROA 5FUPA 4B3NA 4NROA 5F3EA 3VDDA 4LBQD 4JX0A 5FZMA 4L99A 1CZSA 4V2VA 4DUWA 1CAWB 2YUEA 2XJSA 4OHXA 5EPAA 2XJRA 1WKYA 1Y3TA 4CUCA 5DZEA 3ZFFC 3KGLA 5BNQA 4IV1A 5L73A 3A0KA 3UGHA 2WL1A 5I0TA 3A4UA 1OPOA 4QPWA 1RITA 5J36A 4EE2A 1KFXL 1PZ7A 3MICA 5CADA 2LM3A 3URFA 5LA0A 2EVXA 2XJPA 5A7WB 1BXHA 2TBVA 4XJUA 4NN0A 2RMU1 2HWF1 1GP6A 1QJEA 2JXAA 4A2UA 2Y6FA 2H6BA 3J9SA 2GN7A 4MGZE 2HWB2 3RYKA 3FHQA 4PBOA 4SBVA 5A70A 2D6LX 3WUDA 5T55A 1WUVA 2ZKNA 1FNZA 4E9KA 4S2GA 1LGCA 1LEDA 3HNYM 5F6KA 1OXCA 1GOHA 1F15A 3IM0A 4IV3B 3ZDSA 4YVSC 3VBSA 2VQUA 1CJPA 1DU3D 4L8QA 2QQIA 4GWNA 1N3QA 2E7AA 4Y33A 3ZXLA 2FQPA 1H2KA 3ZXJA 4LT5A 4JC1A 1JTZX 5HI0A 1OQ1A 2VVEA 4FT8A 3TEXA 3AMHA 1VRH1 2IFWA 2W91A 4KBBA 1LHVA 5FCCA 4O7XA 1RGSA 4H55A 2ES3A 3LKJA 4YLZA 2GNTA 1JYCA 4P9YA 2CSGA 5FY1A 4C8DA 1NLQA 1O3QA 3ZSLA 4RYDA 4CDXB 3OCPA 4QX7A 2P6CA 1LU1A 4IE0A 1POV1 2JKBA 1XYOA 1TME3 4XFCA 3WG3A 2Y0IA 3B5LB 5LBEA 5BNNA 1C8NA 4GH4B 1AL22 2HWD1 1PNFA 1UY0A 3FLTA 3FE5A 4UW6A 1CD3G 1G9AA 4FAGA 4LORA 1LKNA 3JCIA 4QMAA 4I0WB 1PGW1 2C0ZA 1LRHA 1C57A 1TEIA 2E53A 4QQPA 2PHUA 3QH7A 2I2SA 3MDPA 4CDUA 4NUBA 1NG0A 1OBNA 1OD5A 3H42B 4M00A 1LEMA 4QHZA 4U2AA 3SITA 3VBOB 5A6XA 1NA1A 1PMHX 3A22A 4XDQA 3RZZA 4MG2A 4RHV2 1VBB2 2JKXA 1Y9GA 2J1TA 1N3OA 1HKDA 1QQP2 1YFWA 1WCDJ 1G9CA 4CDQC 3AK0A 5LEKA 5HCHA 4Y26A 1O8SA 1QKQA 3ZKYA 1UZWA 3OPTA 3VBHB 4AR2A 1VRH3 4PIXA 4XAEA 4V1PA 3I3MA 5FKCA 3K3NA 1OF4A 2R32A 1G9BA 4CCLA 4AFBA 3M3EA 3N7MA 2JIGA 4RS5B 2XLGA 1HJFA 5G04L 1S0BA 4N53C 4DXZA 1POV3 3KQRA 3OOXA 1R1A1 2D6NA 5FZFA 2X53S 2BQPA 2YU2A 5H9QA 3RYRA 1V6IA 4P9GA 4LNVA 1UPSA 2QVSB 4HPKB 5FDBA 2GNDA 2XDVA 5EV7A 1OKOA 3WQ1A 3VKLA 4ATFA 1S0EA 1CONA 4Z2WA 4P14A 5FXWA 1Y9QA 2IXKA 2ARBA 1QJY3 2PHTA 5DUUA 2A3XA 4CEWC 3TWIA 1IKPA 3ME2A 1Q8PA 2BFUS 4TSVA 1MQTB 1S1AA 2HJIA 1DYPA 4KGQA 4WZFA 5A33A 4BYYA 1JYNA 1UY4A 5HV0A 2D40A 1RB8G 5CKMA 1AX1A 2W46A 5IHRA 3PJYA 1HXS2 1US3A 2VBDA 2VZSA 3ZYRA 1JU3A 3PVBB 2JD9A 2ZMKA 4DXRA 4QD2A 3FHIB 4CCDA 5FYIA 1ZBA3 3AKQA 3C7GA 1UN1A 5FMOS 4M3CE 2W2IA 4WVVA 4N43C 1ZBE3 2ZBJA 3ZPOA 4ZKTB 5FZ9A 3ZYIB 1AF9A 2WLPA 2DTYA 3AYAA 1W9FA 3BU7A 3INAA 3KWVA 1GZCA 4HN1A 5C33A 1DGRA 3WDYA 1LJ7A 1KD7A 4ZXKA 2RMU2 2HWF2 1WW4A 4ZU5A 1NX9A 2EIBA 2QQWA 4JGYA 4QKNA 3V64A 4QX0A 3NJZA 5J48A 4D6SA 1R64A 4CE8A 2I45A 4EN7B 5FYCA 1GWLA 2XB6C 2DVBA 4XFGA 4BM8A 4XUNA 3ZMOA 4LLFA 3AYDA 4M0HA 5FPAA 3PMEA 2VUAA 2F6BA 1JUHA 2VMCA 1GR3A 3I4IA 1XNCA 1N1YA 3ZPYA 5F7UA 4LOSA 1H30A 3SXWA 5GZCA 4CCNA 3B02A 2BNMA 3CJIB 1HX6A 5IK5A 3CDZB 3ETPA 3MLJA 3NJVA 4R4XA 1CR7A 3OG2A 5GJ6A 2CGNA 5FOBB 4I02A 4AYUA 4CDXA 5KXEA 4RGKA 4JKKA 3X29B 3ACIA 2B45X 2JDKA 3H8UA 3WZ1A 1UZ0A 3WF3A 1R091 5K7PA 3C3VA 3H8XA 3HQXA 3GXUA 3O1OA 5EYXA 2HWD2 4FFIA 1BVVA 1MACA 3LB9A 3CLPA 1DGRN 5FZ1A 1PZ8A 5LATA 5FYTA 1CX1A 1PGW2 4XILA 4AFCA 3V56A 4YG0A 3JB8A 1ZYBA 4P5HA 3M3IA 3ZN5A 1W28A 3VDAA 4PI2A 3WW2A 4D94A 2EXIA 1T2XA 3MHZA 4BQ1A 1GBGA 4Q1PA 3IAPA 3MPPG 1E5RA 1HRV1 2W1WA 3L2HA 5DQ0A 4BXFA 5FPUA 4PBPA 4XACA 5EWSA 2BJSA 1H8TB 2ZX4A 4HKOA 1BVP1 1W03A 3E5UA 1RMU1 2PAEA 4QDRA 1YQ6A 5CFCC 2FCTA 3N7KA 4QPIA 1RUI3 5LBBA 4KQ7A 3VBHA 3LIHA 4QX8A 1UY2A 3UV9A 2UWBA 4R9DA 3RWKX 4BPZA 3B94A 5AVPA 1QJX3 4BQXA 3IPVA 2ZEZA 4UI9L 4YW5A 3JQXA 4DO0A 1PO23 1W6QA 5KHJA 1W8UA 3ZM8A 5CISA 5DPNA 4MYEA 5DAQA 3K3OA 4TLGA 1R081 4XUTA 1OI6A 3Q9OA 4ZS2A 3VBSC 1R1A2 4BQWA 3VB9A 4LO7A 4AFDA 2QQUA 1R093 3E5QA 2A6WA 1MS0A 5FY5A 3AZWA 4DXSA 1OQEA 1SFPA 5JMCA 1UF2C 1GV9A 2R49A 5D8AA 2RE9A 5AFBA 3H3UA 1WMDA 3LA3A 1W0PA 4XHXA 4GWIA 1UZYA 2ADDA 4CPBD 3FJSA 1KFUL 5C3SA 2VXJA 4I01A 1GQGA 3CEWA 1WCKA 1AXZA 1YUDA 5JXGA 5JIAA 1REEA 1BBT1 4XF9A 1HRV3 2D6KA 3NNJA 3MI8A 1D0GA 3B3QE 3JZVA 2UY9A 3OY8B 2VGDA 1W9TA 3H9AA 1RMU3 4WM8A 1LB2A 2GMPA 5BNNC 2FDIA 2VZTA 5JZGB 4DEQA 2WR9A 1POQA 5FRAA 4GZ9A 3AP5A 1H0BA 2DVGA 3CL1A 1L7QA 3DF0A 4CDUC 4CU8A 1PGSA 3DL3A 2PXJA 1ASJ1 2V72A 4XJAA 3HIFA 3OD0A 1IPSA 1PK6C 1R083 3ATGA 3B01A 3RZJA 4YSFA 1GZ9A 3E97A 1LHWA 2VOTA 4LKEA 5JUVA 2BYVE 1MZFA 2VD7A 2ZGUA 4XZUG 3KV6A 4FPCA 4XFHA 4MOAA 3NWKA 3H0OA 3WDWA 2XQRA 4CVUA 1SLTA 1O7FA 4LQRA 5FY7A 3ZDVA 3IDEA 4AEJA 4FI9A 1VJ2A 2L9LA 2BERA 1UOGA 2FHRA 1QEXA 3PU8A 4XAAA 2OYZA 1WLCA 2B9VA 4YVWC 4JDNA 1WCUA 3KD4A 1C3HA 1UMIA 4HSJA 5F3GA 3RSJA 3ZFFB 2VNVA 3D0JA 3IKWA 4LULA 4X6RB 5EZWA 4PIYA 3WNPA 4AHXA 4AI0A 1CWPA 4QKDA 3J8F1 4ZPIA 4ZS3A 4AVCA 2BGOA 1JXNA 4LIUA 1OURA 3S57A 4J6GA 3AJYA 5T52A 2A7AA 4NRMA 4RQPA 1RUE2 1TNFA 2Y6JA 1RUD1 4ES8A 1H6XA 4QHOA 1XE0A 2XOMA 4YZ3A 3VKFC 4HVQA 2ZA9A 4QT6A 4ISRA 3RZHA 2RS33 4FOVA 3PIJA 3D6EA 1ASJ3 5E16A 3VD4A 4YVSB 3A7QA 4B7KA 2XG3A 3BIEA 4PI0A 4KH9A 4A7YA 2CYFA 4FOYA 2ZX3A 1C28A 2Y64A 4FPJA 3E6BA 3LEGA 2A75A 4RR3C 2ZGMA 3POSA 4KG8A 3I59B 4AI8A 1GQHA 5K0UA 5LA9A 2JDUA 1ZX5A 3K4ZA 1TE1B 5FLJA 5JI7A 3S0MA 5LA2A 1XNTA 3KMHA 2LW8A 5IK4A 4LA2A 4A7ZA 3POGA 1J84A 2IWGB 3DV8A 1ZVFA 2OUHA 3I54A 1NAEA 2ZGPA 4QDSA 4F83A 5T3NA 1FOD1 2LUWA 4JGYC 1QGLA 4XZPA 5I0DA 4Q4Y3 4MXWA 4YM1A 4ZZ8A 1Q8VA 1OFNA 5IVBA 2HEVF 1VBA3 3Q8AA 1L7RA 1SFNA 1VPHA 1WMFA 2R071 4G9SB 2CAVA 4N7IA 2V4AA 5FKBA 1LCLA 4Q4X2 1VBE3 1G86A 1ZZCA 3IDBB 3ABZA 3LEMA 3EQEA 1UYYA 3HVDA 2D93A 3POIA 4IL7A 5FXXA 1H1MA 4HZFA 4Z82A 4A41A 1JYTA 4XVHA 3N9OA 3PUHA 1J59A 3OBTA 4CDQB 2F4LA 3RNSA 1OPMA 2O14A 3NV3A 3UJOA 1ALYA 1FV2A 1CX4A 1ZZ8A 2LTNA 1SLBA 3ETQA 3WSOA 4C91A 2V5YA 1W6NA 5JOWA 4XXPA 3VHRA 1BBT2 4XE9A 4KWKA 3USSA 1AR82 3WP5A 2WYFA 4Y20B 4QGMA 2VCMA 3IMNA 3OY8A 5FFOC 1W6OB 4HFSA 4A3ZA 1REDA 3H7JA 2Q8OA 2ZZJA 4UOJA 4E2QA 3O1SA 3KV4A 4BJ0A 1BEV3 1X8MA 2CWSA 4QQ2A 4Y1UA 2VULA 4C1WA 4Y3OA 4S2DA 3CJXA 4XABA 3HT2A 1D4M3 2QQVA 3AP4A 5A7SA 1EAH1 3K4AA 5D21A 1OVSA 3L9JT 3PL0A 4META 2Y6LA 4CXWA 2WWSA 3LSDA 3VKOA 4FO9A 5FUNA 3T08A 4P00B 5FBZA 1O5UA 3KGZA 2JG8A 2RR12 3OEAA 1NZIA 1YFYA 3ZFGA 1X9TA 2YC0A 4DZGA 3HQUA 3KF5A 3DUIA 3UT0A 2PLV1 3GGLA 4P02B 4ZU7A 4QPIC 1CZVA 1D4VB 2ZJCA 4FOQA 2JE8A 3U4SA 3NRUA 5BXXA 2ORZA 3HD8B 4S2HA 2DURA 3P6BA 2JDMA 4CCCA 2CTVA 4LHSA 2GN3A 2D43A 4JKLA 4YZ1A 2GMMA 4KWLA 4LR4A 4A6SA 4QB1A 3ZFFA 4F3JA 1HRI3 3K4DA 2PA7A 4N43B 3N7JA 3ZKUA 4KU8A 3J8F2 5DZGA 1YJKA 3ORJA 4B4QA 3MV01 3N35A 1PNGA 4BB3A 3HQRA 3HMYA 1LOAA 2WWJA 1ZZ6A 1RUD2 2PHWA 3KCCA 4A6OA 2DTWA 5FO8B 1BZWA 3POJA 3HNBM 1EAH3 4XYXA 3SNMA 1W2NA 1YO8A 2BWAA 2W87A 1WCQA 4Q5OA 1RUJ1 2PAMA 3U14A 5GKAC 4KNCA 5F3CA 2BV4A 2DV9A 3WT3A 3UETA 2VU9A 2DU0A 5GZDA 1HQNA 4AEKA 4QWNA 2XVKA 4AHWA 4QX1A 3WNXA 2BBAA 5LASA 4WM8C 4P9IA 3WXPA 4D0QA 2PLV3 2P4EA 5FP8A 3KQ4B 1GU3A 3H3LA 4AHZA 1BMV1 3LD8A 1DQ6A 2YDEA 2D98A 1RUC2 3LEKA 3OPZA 1DIWA 3BALA 3ZFEA 2R0HA 1W8NA 4LHNA 3W5MA 4E2SA 4EJRA 2DYCA 4E27A 1HQWA 4NRQA 4AVVA 4TLFA 4AEDA 4AE2A 3U37A 1REFA 4Y1VA 1W0OA 5FPZA 4CCKA 1CIYA 4JAAA 3ZR6A 2R041 3LFMA 4BDVB 4JCKA 5I8YA 1AR73 1CPMA 1ONAA 1VBC2 4C0HA 1LODA 4UFIA 1FOD2 2MEV3 1LHOA 3MIBA 1FATA 5CKNA 3P3NA 1UZVA 5GZFA 1V6NA 2R072 4GKXA 4PHZA 5EFUA 2D5FA 2FDFA 2VG9A 1RUJ3 1W2TA 2DDUA 5F39A 4JRLA 4YW3A 4JRAA 3ST7A 1QJFA 4IV1B 3AFKA 3POEA 5BNPA 3VDBA 1LR5A 1NXD1 2GALA 1A78A 3DYPA 4BQ2A 4GMP0 1IS3A 5FPXA 2H0BA 2JIJA 4CDQA 1UXZA 4BXSV 4E4DX 3G6JB 1W8HA 5E88A 1O3SA 2WS93 4RQPC 5LK7B 1RUNA 1PGL1 3H1WA 1V00A 4OQ9A 4ISQA 3WDVA 1V0AA 2HYKA 5FZ3A 1DQ0A 3DYOA 3OJBA 2J1EA 2WNUC 3D82A 1CESA 5FK7A 1FT9A 3S5AA 4Y20A 2DVFA 2RHPA 2XLFA 3QH6A 3WW3A 2K0GA 4NIAA 3LOIA 4N53A 3VBSB 2G9ZA 2P2KA 5IVYA 2R043 4FXKB 2VJXA 4XCBA 4XHBA 3WG2A 3DKQA 2ZX2A 4NHXA 5EJ3A 2JDHA 3AL6A 2PFWA 1U5XA 3LA2A 4AFMA 1Q43A 1VAVA 2W1SA 2AH2A 5K0UC 2QZ3A 2B7YA 3SC7X 2NQYA 5FIXA 4PT6A 1QXRA 4CEWA 2OIIA 2AENA 2ZHNA 4FFFA 3CF6E 3IAQA 4GKYA 2GDFA 1O4TA 2WKKA 4CDWB 5FO9B 1DYKA 1KDMA 3SEEA 1RTVA 1JOJA 3IBMA 1FMD1 1V9U1 4FXGB 5FYVA 1AL0G 5BNNB 5JSOA 1IKQA 5DAVA 2RS13 1QJU2 2W1UA 2PYTA 3BGAA 2EIDA 3GNEA 2JENA 2ZAHA 2R1DA 2DUPA 2XL7A 2VH9A 4CDUB 2P3JA 4MADA 2WWUA 3EXUA 3FBMA 5T5JA 2R1BA 2G9FA 3SCFA 4EWAA 2VNOA 2WYSA 1LULA 4M3CF 2XUMA 4IQPA 3ZXDA 1MZEA 3NAPA 3J7LA 3N9PA 5JXIA 2P34A 2RDRA 1F4HA 1X36A 1ZNPA 2VW2A 1JODA 2IUWA 3NV1A 3U4XA 4AVBA 1XNKA 1DGWX 5A32B 3BUCA 1KJRA 1J1TA 4YVWB 1U5ZA 1DGLA 2A5ZA 2R6QA 5SV5A 1HB4A 4L11A 1XE7A 2E6VA 4ZY9A 1FMD3 4NRPA 3M4FA 1ODNA 2WC2A 1BMV2 2YFZA 1F35A 1Y9MA 1ZZBA 3GJAA 2E7QA 1GLHA 1YJLA 1XU1A 1XSQA 3HPNA 2VMEA 3ZXKA 4CSWA 5KHIA 2AREA 1LAJA 4WV8A 2AYHA 1ZRCA 1EP0A 3EJKA 3WVJA 4J1XA 3EMRA 4AVAA 4XMIA 1SFYA 3RVHA 4JVAA 5JOXA 1RUH1 2VC9A 4Y1ZA 2JB4A 1YIPA 4D7TA 2VOKA 3WNKA 5H9RA 2R042 4LEJA 3SKJE 1H2LA 3IB3A 5A33B 1X8EA 2GC0A 4QX5A 2IVIB 5GM0A 3VD9A 4W6XA 3BU0A 1UL9A 3J7MA 4QGLA 3OGRA 4RR3B 3J4UH 4IE5A 1KRIA 4IUGA 1DQ5A 3LZZA 4GD4A 1C8M2 5DXDA 1W2OA 3UJQA 3C7HA 4JGZA 2O8QA 3MV11 4UFJA 3VZJA 1DCSA 2SLIA 3I7DA 1UZZA 5CG8A 4NWVA 3GBFA 4K3UA 1TME1 4AQ6A 1I1EA 1U5IA 4Q4V3 3R4SA 1B09A 5CFCA 4A4AA 1PGL2 3VZNA 4PCRA 4G4FA 4RD7A 4B1LA 1GYKA 3S7EA 5FOJB 3CKHA 2BEOA 4JGYB 4JDMA 3MUY1 3PMSA 5CAZA 5JCTA 3HBKA 5SV8A 3I2HA 2BVVA 4OUEA 4P08A 3TYJA 1XYPA 2VOVA 3KT4A 1A8DA 1YCIA 2I74A 1RUH3 4NMIA 1OFSA 3ZYGA 2Q1ZB 1LHNA 2BBVA 5FZKA 3NW4A 2VCAA 3PIGA 2OW4A 1H2MA 1G7YA 1T6BX 4X8NA 1MR5A 1HB1A 1F9KA 2FDJA 1RINA 4OVEA 2DCZA 1LOGA 3ZFEC 4YZ2A 2VR4A 5HBAA 1Z0HA 1AXKA 1PX3A 5FY4A 1AYM1 1IZ3A 3ZSMA 4YGCA 1IPKA 3ACFA 2ZS6B 1W6PA 1W8WA 1XE8A 3R6SA 4AEDC 1DBNA 2D44A 3WDUA 3O1PA 2Z79A 4K8RB 4FP2A 4TWTA 1GICA 4YPJA 1V9U2 3CIHA 1DQ1A 2ZGKA 5IVFA 2WZR1 5EIYB 5FTTC 3VZOA 2JDAA 3GBWA 4YG6A 1YQ8A 1CQ9A 3IN9A 3TRSB 5FYYA 1IG3A 4LO4B 5JR7B 3WHUA 5KHGA 3ZXGA 1GNZA 3NVCA 1KGYA 3T1MA 5CU1A 1J3QA 2OQ6A 2YPJA 1AR93 2JICA 4UAPA 1WD4A 3MLKA 2Z42A 4PLOA 1QJY1 1WZXA 1NXMA 1ENSA 3E5XA 4QGNA 4FPFA 3MF9A 2XVLA 4E4SA 2C6SA 3FN9A 1XXNA 1NZCA 3FZ3A 2P6HA 1GQPA 5BNPC 2AR6A 1PK6A 2YC4A 1LU2A 2PQQA 1X33A 4QU1A 3ZYBA 5IAVA 3ZOIA 4AHYA 3WW4A 3RJ2X 1F4AA 4UBHA 1Z7S1 3E6DA 4CP0A 1XRUA 4Q29A 1D0HA 1YYNA 2WT0A 4H7LA 2ZAAA 4Q26A 4UFMA 4QPIB 4XFIA 5A1FA 5L9BA 3ZN4A 1KS5A 3GHMA 3JD73 4M3CB 1ZBA1 1DGWA 2YFUA 3V0BA 1OA4A 3QCWA 5A32A 1OMIA 4OI0A 1QH7A 1AYM3 3HN3A 1LGBA 4HK8A 1SBDA 1ZBE1 3IPVB 3MEPA 4LA3A 4YVWA 4AAXA 1W6QB 3VHPA 1NLRA 4NO4A 2YZ4A 1XQNA 4OHWA 2P37A 5F5QA 3OD4A 2Q1FA 1YFUA 4PF5A 4MLOA 3O14A 2WNVA 3L2YA 2WZR3 4EROA 1E5IA 1ZZ7A 3ACGA 4YG3A 2XMLA 3PJQA 5A6YA 1J58A 1RHI1 3GCWA 5K8SA 4RFT0 3VBUA 3POYA 1MZ5A 5D8AB 5GZGA 2B39A 2WQZC 3FLRA 3F95A 3KCXA 4MHRA 5LBCA 2ZOEB 3SMHA 4P9JA 3D0SA 2A3YA 4AEMA 2OPWA 1GP5A 1K12A 2JECA 2A3WA 4HLTA 4LBLA 2N7GA 4FTSA 4LO6B 1W6MB 1JMUB 1HN0A 5DAPA 3S7IA 3UK9A 2W95A 3AC0A 4BOWA 2Q30A 2QBXA 4BMEA 1ZRDA 1JS9A 4WVZA 3VZLA 1QXPA 1UOJA 2XLAA 5LK5A 1SLAA 4WM8B 3WF1A 1ZRFA 1SCSA 1Z7S3 4QKFA 3MYXA 4RR3A 5C3RA 2ZZQA 3KVBA 5JXJA 1CGPA 1JZ2A 3RZLA 1ZREA 2D6PA 4XIKA 4B4RA 2W39A 1PO11 2V09A 3HR9A 1UCXA 3M3QA 2GC3A 4K40A 1SLIA 4N9IA 4ORFA 1IG0A 1CVNA 1TME2 1U0AA 1OOPC 5M0TA 3KHCA 4HKWA 4EWDA 4D6RA 3VD7A 3KT7A 4AGVA 1C5IA 2HEWF 2QQMA 3NAPC 3T3YA 3MW2A 5FY9A 1RHI3 2BOIA 4KL1A 3VL8A 5IJRA 1OC1A 1PMJX 4NPMA 4KU7A 3DECA 3H8OA 4EYUA 4XC9A 1AZDA 5FZ7A 4XFAA 3WD5A 1B35A 2Z4FA 4BCUA 2VZ3A 3HWJA 2ZHMA 3PTYA 2AGSA 1WLTA 2EIEA 4R52A 1JYVA 3ES1A 4D69A 4QX3A 5FY0A 1VIWB 1HV0A 4CDWA 4JTNA 3BTAA 3U07A 1C5HA 3G7DA 4Y22B 2FCUA 4Y5Z0 2DCKA 2KA3A 1RUI1 2W3JA 2DFCA 4GQ7A 4CEYC 2NP0A 4LBMA 5DMYA 1VRH2 5FZEA 3N3HA 1AR63 1PM4A 2WRAA 4JDOA 4RQPB 4BQ5A 1QJX1 2X29A 2WN2A 2DUOA 1PO21 1W39A 4RL7A 2WNUB 3BTZA 4Q4W1 2R063 4CP9A 1CAVA 1MS5A 1PO13 2ZX0A 3TEZA 1LESA 1RL3A 4H3WA 1E5HA 3A23A 2W9XA 5F2WA 1S4CA 5C4WA 3ZYHA 4NIHA 1OKQA 2JDYA 4RA0A 2JDZA 3HJRA 1ENQA 5F6LB 4LHLA 4O61A 4COWA 3GM8A 1JUIA 3W20A 3TEYA 3B7MA 5LB6A 4ES9A 2CAUA 3UGGA 4NOTA 1AYN3 1ST8A 1QJY2 1UXXX 1RXGA 2BFUL 2YY1A 2ZMNA 4QQOA 5IFTA 5K0UB 5LW9A 4JGZC 1W99A 4WM7A 5FZ6A 3LPGA 4DUVA 4Y4RA 1RUF3 4NE9A 1UIJA 5T54A 1NKGA 2ZACA 1PVXA 5ACA3 1H2NA 1XNDA 3O0WA 5DG2A 3MIHA 5JR2A 5FMOL 1ND2A 1WD3A 1DF0A 1IS6A 2VTXA 2HYXA 2NMNA 4JKMA 4M3CA 1UX7A 1ZBA2 3AMPA 3R0RA 3VL9A 4CTEA 1BJQA 4K1ZA 4MXWB 3O1UA 2Q8EA 1UU5A 1WGPA 1ZBE2 2ID4A 5FAXA 2YPDA 4Q4W3 3AP6A 3IMMA 5E1RA 1QY4A 3H1MA 4TXWA 1Q3EA 3LPFA 4LKSA 2K2SA 2XVGA 5CNAA 3OUIA 3ZSEA 1JH5A 5DDJ3 4AXOA 1QWRA 4QQLA 4K8FA 4GWJA 3RS6A 1A3KA 1JU4A 2RM21 4BE3A 5A1LA 5KR7A 3BKZA 4WZCA 4E8DA 3O1RA 1W6NB 1W6MA 3RGBA 3VBRA 1HB3A 1EV11 2HWC1 4YW4A 3ZX7A 3AP9A 3MIEA 4UW3A 2C4XA 3EB7A 4IW3A 5DAXA 5DABA 2XBO1 4GMP3 3RQ0A 4MGQA 1JZ4A 3PTRB 1BKZA 3FFZA 2HLEA 5FJHA 5C3QA 2CNAA 1RC6A 3FL7A 2MPFA 1NQJA 3LIGA 3THTA 2VMIA 3RZKA 4JHTA 2BWCA 1BK0A 1M06G 4QPGB 5FXVA 1ACCA 4DIQA 3BYWA 1S0CA 3T4VA 2RS31 2VZOA 5FPLA 1ZA4A 1Q8SA 4I09A 1YI7A 4H2AA 2IXIA 2VO5A 1GMMA 3N36A 1VP6A 3CNAA 2JG8B 3AZZA 2DCYA 5KHKA 3ZFGB 4D8MA 3ECQA 4NAOA 1G9DA 2BGPA 5LZ6A 5C7GA 1OUSA 4DMIA 3M3CA 3FFQA 2CL2A 5HPOA 1PZ9A 4QPYA 5KHHA 2P3YA 3T30A 4F8AA 2JG9C 4NIIA 3U11A 5K4LA 2RM23 4LK7A 4MGYE 5GLWA 4IEQA 1FV3A 5FP3A 3IT8A 4QB2A 1EV13 2HWC3 2LALA 3I97A 2RS51 4RFRB 5A3MA 2Y26A 4Y22A 1V6KA 1W2AX 2KM2A 1I3HA 1RUI2 2WNVC 4PQ9A 2XBO3 4UW5A 4AQTA 1XBFA 3PVOA 4Q4Y1 3VBUC 2AZ5A 5CKQA 1H6YA 2VOWA 4FFHA 4E8CA 1QJX2 1VBA1 4GAZA 5F1RA 5DN2A 1PO22 2WNUA 4Q4W2 5FZ8A 5L7OC 1UOBA 2WNEA 3KV5A 1VBE1 2RVAA 2VVDA 4D7SA 1R092 2QTWB 3TN91 2IZWA 4XDOA 5A7NA 2EALA 2ZHKA 4NAMA 4OUMA 2Y34A 2EXHA 4IEXA 4FPYA 1BQPA 4AFAA 5AC91 4BQ3A 1RVF3 2J42A 2Q4SA 3LGRA 4RSUA 4YGBA 5LEJA 2YXSA 3GZAA 1GANA 3KS7A 3VKNA 3M7AA 4ZONA 3T4HB 1TMF3 3WCRA 3ZFEB 3I3BA 3P5BA 4PDWA 2MHFA 4JHZA 5EQUA 1HRV2 2VTXJ 4LJHA 3BODA 1JOPA 2ZKLA 1W05A 4D7YA 1F5JA 3BPZA 4AEDB 2GH8A 4QB6A 1RMU2 4Z07A 1SDDB 2RS53 1BEV1 4E2GA 3M70A 4YW6A 3O1TA 2W94A 4GWMA 5EHDA 3I8TA 3PHMA 1F5FA 5FWJA 1D4M1 4AGGA 1BYHA 4MUVA 2JB8A 2XJUA 2EIGA 1JZ8A 1G8WA 2OA2A 4GB31 3MBWA 2SBAA 3BN6A 3VN4A 4BHPA 1DDLA 1WBFA 1W0NA 1B35C 4W50A 4BLJA 2NYYA 4HG6B 3ZN6B 1R082 2EAAA 4FPOB 2Y38A 2K9ZA 3EYPA 4LPLA 2CHHA 3C7OA 4CDWC 4NHYA 3TN93 5BNPB 1POV0 4AWDA 1OH3A 1SLLA 2I07B 4ET7A 4GA9A 5FMCA 5J3UA 1NCRA 3O1VA 1K42A 1IS4A 1W9YA 4UT5A 3WP4A 4DXTA 5DUWA 1ZRIA 4CCEA 1FYUA 5AC93 1G6NA 4LBQA 5E8AA 5FREA 2RM22 3V0AB 5C8CC 2WO7A 4AI9A 3MGUA 5KXCA 3OB8A 1LENA 2MNGA 3WINE 1HRI1 3VBFA 1MVQA 3T2PA 2QDRA 3W59A 4FAHA 4WVMA 1MS8A 2QKDA 1P8JA 5C4WC 4L0PA 4N53B 1UX6A 2ILMA 5T5LA 3SEPA 5C9AC 5BPXA 2Y60A 4EN0A 1TNRA 3BIWE 3J26N 5GLTA 5F5IA 4ZZ5A 4YM2A 2NN8A 2A71A 3WF4A 4I3GA 4NHKA 3SLIA 2OZJA 4GB33 3ENRA 3BI3A 2RS32 4N7UA 4WM7C 1SCRA 1ASJ2 1XNBA 2P17A 1KDKA 3HT1A 3R4UA 1VALA 2AEZA 3O1MA 5FZAA 3WLUA 5ANNA 2WLQA 3RJRA 4CEWB 3U0ZA 4IERA 4CA9A 1DFQA 1UOFA 5A3PA 3NJYA 1ND2C 1ULPA 1IHMA 5IVJA 4FP3A 1WA6X 3CQOA 1V6JA 2GSYA 3C2UA 2VZ1A 1GUIA 3E1F1 4LUMA 1NLSA 3I49A 2E51A 3POWA 4FPHA 2OKXA 3WF2A 3HEIA 1MVEA 2GC2A 2RS52 3LEIA 3F2ZA 3NKGA 4ARXA 3CBNA 5FV3A 1W9WA 3OF1A 1W9SA 2VZPA 4PLMA 1AR71 3NV4A 3JBG3 1PIV1 2LRPA 2MEV1 1Q56A 1UD1A 2AC1A 4PIZA 4Q4Y2 4CUGA 2D97A 2WZEA 1WA4A 3NAPB 4TN7A 5IWFA 4UF0A 5FPVA 5H9PA 2VPVA 3GZUC 1VBA2 5DUXA 3I2GA 2PHRA 5KC5A
chains in the Genus database with same CATH topology
1PVC1 1Y43B 1WLWA 1VBE2 3D8CA 2DWRA 3VBRC 1N47A 3SHRA 3ZVXA 3TN92 4DY5A 2OUJA 2WZPP 1I9RA 2XHKA 4KWJA 4XQDA 4B29A 4MX3A 5GZEA 3UKNA 3DKWA 3AB0A 2WS91 3AZVA 4CEYB 4XXAA 2EXJA 4XBNA 2NZ9A 3S6PA 1PMIA 3THPA 2A6XA 1FI2A 3KLSA 5JI9A 2HWE3 5BNOA 4XJZA 1QOSA 3K48A 2UWCA 3B00A 1RUG3 3RMYA 2GU9A 2GZWA 2UURA 4NR1A 3VZKA 3TB0A 1S0FA 1BEV2 1JW6A 4I0AA 5T50A 5I0RA 1FPN3 1OA3A 1PIV3 2VUJA 4WBBA 2Y0OA 1D4M2 3T2TA 2X5IA 3ZIXA 1COV3 1OLQA 4YRDA 4Z92B 1PVC3 1ENXA 3A0NA 2NMOA 4YYOA 3ZN6A 2A6YA 2DF7A 3KZ4C 4IETA 4JGZB 3WP3A 1DHKB 3FMGA 4C0BA 4LTAA 5JDBA 5CG9A 3EO6A 4XF0A 1IOAA 4C1XA 2PAKA 3N7LA 3IIAA 5HCBA 5CFCB 2RS11 3UL2A 1QNYA 4BZ4A 1WLDA 4PLNA 2Q5TA 3IWZA 3V0AA 1QOTA 2XH6A 1WW5A 3ZO0B 2VQ0A 4IEWA 1HRI2 1NY71 1QH6A 3AJZA 4IEVA 4XEZA 5GALA 2D3PA 1ULEA 4OI1A 1GNHA 2YMZA 3WG1A 1S0JA 2WFF3 1LOBA 4Q0VA 1X7NA 1SACA 4EN6B 1EAH2 1AHSA 5FLIA 3RI9A 3CJIC 4URTA 1S2BA 1L3JA 3KT1A 3AKRA 4EN9B 5D1IA 5DUVA 3B69A 3VUOA 2ZGRA 4PDWC 1HQLA 2HWB1 3WR0A 3EBRA 4FVVA 1LOFA 3FUQA 1VBD3 1W6PB 1QDCA 1YRZA 1RJ8A 4FPKA 4R4ZA 5HCFA 2PLV2 5C6CA 3USUA 4HVOA 1O3TA 1SLCA 3WG4A 4SLIA 1WMEA 4DFSA 2BNOA 4CP1A 5BV6A 2XWJB 4LUKA 1QJZA 5K9YA 1QU0A 4O9EA 4NVPA 2WFPA 4HVRA 2ZGNA 2YGLA 4X6QB 1UAIA 2D3SA 4K9SA 4COUA 3ALQA 3GALA 3R05A 3MLLA 4IXLA 1AR72 1MS9A 1PIV2 1OOPA 1PK6B 5KC6A 2MEV2 2ET7A 1KS4A 1NCRC 1AXYA 4AF9A 3QLQA 1OQDA 5J7MA 3ILFA 4OFGA 1PVC2 3JU9A 1FAYA 1UPIA 3FLPA 1ND3A 1RUJ2 3NO8A 2A6VA 3V0BB 2ZHLA 1M4WA 2JG9B 2W0XA 2HWB3 3VBFC 3ES4A 3VGIA 4BLIA 3OYWA 2GH2A 2WIIB 3TNPB 2B9UA 4FPGA 4Q4V1 2WS92 3TNQA 4L92A 4RHV1 4CEYA 2QUOA 2WNVB 4KG0A 1V6MA 3PVNA 3RMXA 4NHMA 2ZABA 2DUQA 3AZYA 3LA7A 2ZGLA 3VBUB 4B7EA 1YLLA 1NE4A 3D5OA 3ELNA 5A3LA 1IGOA 1H9WA 4UW4A 3NKTA 2FZ1A 2ET1A 1J3PA 1XYNA 5L7OB 1F8VA 1QNWA 4XOGA 2RJKA 1ULFA 2OZ6A 5CFDC 4AQ2A 3QACA 1CAXA 4KGGA 3VKMA 2BVBA 2PHXA 2FBEA 1AL23 4FQ4A 1SMVA 4FOWA 4Y4YA 5KWRA 1UW8A 3BB6A 2DCTA 1VLNA 4U36A 1J3RA 2QNKA 2BW8A 1OHFA 2GMEA 4K1YA 4B4PA 1YIFA 4RHV3 1VBB3 2RS12 4K6BA 4XMAA 3RYPA 4BMBA 1QQP3 1O5LA 4AW7A 1Q5OA 4BA6A 1AR91 1QOOA 1HXS1 1C1LA 4GXLA 1NY72 1NCQA 2NLRA 5ABJC 4UBGA 4MGKE 5F9TA 2WT1A 1B35B 3MPBA 3GBGA 2D6OX 3AXEA 3OBRA 2BGCA 2TEPA 4CDWB 5L19A 1ULCA 1NQDA 1AX2A 4IEOA 5BYNA 3MZHA 2ENRA 3AXDA 3JD71 5JPNB 2CGOA 1GZWA 1A6CA 5BNOC 4P9WA 4DPNA 4AI3A 4XPVA 5C8CB 4YW1A 5JIUA 1CAVB 5TSWA 4DRVA 1FMD2 5LRRA 5C4WB 3I2DA 1CAUA 1G9FA 3MIDA 5C9AB 4NPRA 2IXLA 2X5IC 2IXJA 1VAKA 3O0XA 1N1TA 4H14A 3N4MA 3WCSA 1HXS3 3LWCA 4XFFA 4O9GA 4F7ZA 4QPGA 2PHDA 3RI8A 1K5MC 4WM7B 3LAGA 3R4DB 4Q0SA 4Q8KA 3WOGA 4OI4A 5CB7A 3U10A 2UYBA 2ARXA 1ND2B 3K51A 1D2SA 3ACLA 1DQ4A 1DG6A 4HSLA 2RMU3 2HWF3 2JG9A 1RIRA 4YFWA 2R16A 4FQZA 3RDIA 1VAMA 1MZ6A 4RGGA 5CVRA 5J96B 2HEYF 3WW1A 4XF1A 4Q4V2 2E9QA 2IC1A 1V6LA 2UU8A 3ZXFA 4XTMA 1DQ2A 4L9BA 2VMHA 1ZRRA 3JB4C 1NOVA 1MS3A 4ATEA 1O3RA 4GULA 4XJ9A 2ZCWA 3RPQA 4RGAA 3H3ZA 4YGDA 5L7OA 2QZ2A 3AKTA 4I30A 1RUH2 3QOPA 1LOFC 2BNNA 3VBRB 4MV2A 3AKSA 1GKBA 1E57A 1GFF2 4INDA 2PHFA 4IEYA 4LBNA 4XFBA 4YZ5A 1WW6A 4BWOA 3BOPA 2FMYA 1AR61 4Q2FA 3ZSKA 2Q0AA 3O7OA 2HWD3 2EXKA 4XF4A 2CGPA 5FO7B 4FSJA 2ZX1A 1RUOA 2R061 5H9SA 4JV4A 4QU2A 3DPRC 1CIWA 2XJQA 3CU7A 1PM7A 2XGXA 3WY6A 4XBLA 1IQAA 5JSRA 4CYDA 2TUNA 1AR92 3T1LA 3SCGA 1AUYA 3VHOA 1AYN1 3ZXAC 1ND3C 1CAWA 2VECA 1S0GA 3WDTA 2XKPA 1RUF1 4LO8A 4XW3A 2E63A 4EWEA 2VW0A 4HN0A 5ACA1 1T6GC 3GZTB 2GC1A 2VQAA 2ZPXA 3FWEA 5J09A 5IK8A 4YW2A 3LOBA 2NM1A 3RRDA 2Z5WA 3W58A 4FPLA 5J37A 1R1A3 3AM2A 1AJKA 1S0DA 5FLHA 3AMMA 1KXGA 2OVUA 2W08A 3JD72 1PHMA 5KXDA 1DLLA 1LECA 2P3KA 3O5SA 4HMZA 5JPMB 1AYM2 5C8CA 3AX4A 3AFGA 5JWPA 1GSLA 4IV3A 1ULDA 1YWKA 4N9HA 3NL1A 2WZR2 3SCHA 5E89A 5C9AA 1A8MA 4Z1VA 1YXWA 2GNMA 3AMNA 4BH9A 2UY8A 2VVFA 1VB4A 5DDJ1 5I0UA 4P9LA 1N3PA 4HETA 2JD4A 1NYWA 1RUE1 3GF6A 4COYA 2QDNA 4W6YA 2BTVC 2O0OA 1N1SA 1X50A 4UXAA 4PDWB 4XJ8A 1H1IA 2FZ2A 2ZMLA 3VLBB 1BK1A 2GAUA 2XJTA 2YV8A 4DNYA 4GMP1 3MIGA 1Z7S2 2V73A 5DG1A 1Q8OA 4GH4A 3BOWA 2XJVA 1YNAA 3TBDA 2R0FA 5GLVA 4ITCA 3WX5A 3VDDC 4ASLA 2C5DA 1OLRA 1NCQC 2C9AA 4N90A 3VBOA 4IV1C 1ENRA 3FX3A 1I5ZA 3B9CA 5BUVA 1RHI2 4FTBA 1NCRB 2E7TA 3VHNA 5I93A 3PNAA 4FBFA 5KBFA 3OGJA 1R1ZA 4LBQB 3W9AA 1UMZA 4FPEA 1RUE3 4RS5A 2R30A 1KQRA 1QDOA 3VBFB 1J1LA 1C1FA 4Q4X1 3V65A 1MS1A 3MW3A 4WVMB 3HBZA 1Y7BA 3MFCA 1AR62 4OLLA 2VMGA 2JEMA 4DS0A 1OSGA 3OTFA 5CIRA 3AKPA 4HPKA 5AVAA 4MH0E 2IXHA 2A70A 2R062 3HAGA 2TNFA 4YARA 1F2NA 1PO12 2CWMA 1W2UA 4QPGC 1SQ4A 2FMDA 1AJOA 1QXJA 1AR81 1S55A 4OZXA 4W65A 5IT6A 1MQTA 1Z78A 4COZA 4C90A 4HK9A 1LOEA 2XWBB 1BCXA 1O4ZA 1RVF1 5CFDB 1IPJA 4GALA 1AYN2 1HW5A 5FQ0B 1TMF1 2HKXA 2Z69A 5HCAA 4YFZA 4J1WA 1FNYA 5C8WA 4Q0PA 3PLQA 5T5PA 4L97A 5DZFA 1RUF2 4R9CA 4CZSA 1V70A 5ACA2 4X8PA 1UIKA 5JVVA 4HL0A 1NA1C 4Q4X3 2RR11 3PVEA 4HBNA 3ZXEA 1LTEA 2QJVA 2G4IA 2B5HA 1S0IA 2A73B 4XTPA 3GYDA 5GLZA 1ZZ9A 4Y1XA 5BY5A 1SEFA 3NSTA 3APBA 4IESA 4ASMB 3GHNA 1C4RA 2KXLA 3WQ0A 4H7MA 1CJDA 4XETA 4DOUA 4YZ4A 5ABJB 3LCPA 2D6MA 1BBT3 4QQHA 1AR83 5B2GB 5DDJ2 1FXZA 1UKRA 3CJIA 4LLOA 5HXVA 1DZTA 5L36A 3ZIWA 2WINB 4Y1YA 4EN8B 5BNOB 4JQRA 4Q1RA 4I2OA 4YM3A 4IEPA 4OI2A 3AYEA 5CBLA 4LO5B 2RR13 1JHNA 1N1VA 3ILNA 2X5IB 1TQ5A 3M8LA 4A3XA 3BCWA 1RUC1 1VR3A 2H0VA 2OPKA 3KCYA 4LE3A 2QE3A 2B8MA 1H8TA 1K5MB 3M3OA 4XJWA 2WA3A 4R8HA 2D3RA 1H1AA 1IS5A 1MEC1 1KJLA 1VBC1 3DGTA 3J8F3 1ULGA 1VB2A 4MVTA 1RUD3 3TAYA 1EV12 1SBEA 2HWC2 4IV3C 1APNA 2ERFA 4HKLA 3UKTA 3FC0A 3JBG1 3KB5A 4AI1A 2XBO2 4L2NA 3SISA 4YGEA 3WHTA 2PN5A 2H6CA 4CP2A 2C1FA 3WUCA 3ZMNA 1JYIA 3WQ7A 1AX0A 1DZRA 3ROUA 5AFEA 2ZTNA 1RUC3 4R9BA 1MS4A 4CDXC 1JBCA 2B46X 4XIOA 2CV6A 3FUOA 3RWNA 1X82A 4NWWA 4AI2A 3H50A 3ZYJB 1RVF2 5CFDA 3SH5A 3HN1A 4GH4C 3USUB 5JZGA 1MEC3 5FQ0A 3B93A 1VBC3 1TMF2 3M2MA 1FOD3 4K7JA 5GLUA 4DINB 2HWE1 4MXVA 1LHUA 2O8OA 1RUG1 3ZSJA 3AP7A 5T5OA 3KM5A 2R073 1LOCA 3VBOC 4OUSA 1QF3A 2IXCA 2O1QA 3FBYA 3DPRB 3CO2A 4MGIE 1HLCA 1FPN1 5EXOA 1OOPB 4AK3A 4AVSA 2UYAA 1COV1 4XF3A 5JSPA 3H7YA 4CRQA 2QQPA 1YFXA 4W6WA 4ZU4A 4P9XA 3VBHC 4A7KA 5I8TA 4DRRA 2B42B 1ND3B 1QJU1 5ABJA 1EPWA 4RS5C 4D3WA 2Q1MA 3E6CC 3AZXA 4OHVA 4S2FA 3OYWB 2X8KA 3M1HA 5I8SA 4DY3A 4AG4A 3NV2A 3TOJA 2WT2A 5AC92 4DQAA 3JUUA 2VNRA 3WP6A 5D8AC 4OHZA 2PELA 2ZGOA 1CN1A 1DZQA 1WCSA 3KSCA 4IEUA 3AMQA 2DFBA 2YYOA 3SH4A 5LRSA 3IDCB 2WFF1 4YVSA 4Z8BA 4HT1T 1MQTC 1I6XA 2RJLA 4G3YC 2EA7A 2ZGSA 4E4ZA 1U5YA 1V6OA 3D4KA 3OGGA 4K21A 3O0VA 1CAXB 1EY2A 3I59A 4GB32 4Q27A 5JOYA 3UKVA 3ILRA 3EHKA 4PJYA 3WDXA 1QJU3 1UU4A 4COVA 1VBD1 1K5MA 2XKOA 2CY6A 1CPNA 1S2KA 5JOZA 2WA4A 1HIXA 1MEC2 2JE7A 2ZGTA 4I3PA 5I91A 4FCAA 4I0BA 2D5HA 4MSVA 1UKGA 1LGNA 1YI9A 3VDDB 1HDKA 2JE9A 2WSUA 3H1YA 1NCQB 4XQ4A 3RG0A 2YHJA 1C8M1 2D7FA 3JBG2 2BPA2 4Q0UA 1H4HA 4XQWA 1RJ7A 3O12A 2PTMA 3QBQA 3ASIA 4OULA 4EV0A 4M01A 3S30A 4FTEA 1SDWA 2JJ6A 2XL9A 1H9PA 5JLVA 2BUKA 2UWAA 1GZWB 4Q0QA 5CA6A 1H4GA 5IUQA 1WW7A 2DCJA 2W52A 1O4YA 4QXKA 1W6OA 1U12A 1UU6A 1XU2A 2ATFA 3MW4A 4QM9A 1EYBA 4ONUA 1CAUB 4GIQA 2VXRA 3AYCA 4AQSA 4BIOA 2P3IA 4HANA 1KITA 4LBOA 2ZGQA 2HWE2 2F4PA 1QHDA 2VY0A 1RUG2 5JAXA 3ZYPA 2QCSB 1JN2P 2WQ4A 3DPRA 1C8M3 2WSVA 4QPGB 4Q8LA 1H8TC 1F31A 1FPN2 1Q8QA 2JX9A 2EAKA 4YNIA 4BIFA 1COV2 2DVAA 4DB5A 5IK7A 2GNBA 2EF6A 2W68A 1WBLA 5J98B 1AL21 2DVDA 4NHLA 4LBJA 4JTOA 5EYYA 1URXA 3SH3A 4K20A 4B8EA 4LHKA 4AGRA 4WVWA 4QM8A 4N43A 2DU1A 1AVBA 2WJSA 1NA1B 3B9IA 1VBB1 1QQP1 1EPZA 4IEZA 2XPJA 1OA2A 3P3PA 2VNGA 2Z2SB 1HV1A 2A6ZA 4QHBA 1O91A 4XBQA 3LSEA 2YGMA 2AUYA 4AVTA 2VW1A 2WFF2 3WV6A 4R9AA 4TYSA 3VV1A 4YM0A 2PHLA 1D2QA 4LE4A 3JQWA 5JZGC 5KXBA 1V9U3 2NPIA 3QD6A 3DN7A 2ETEA 1H8VA 4LBKA 1FX5A 4MZUA 3MF6A 1VBD2 3MIFA 4TZDA 1ZM1A 3MFAA 1NE6A 4OHYA 3VZMA 5I0SA 2IFRA 4M0NA 4Y24A 2QFEA 1YHFA 2JG8C 3ZFGC 1QMJA 2VOXA 2G9GA 1SBFA 2YROA 4B3NA 3VDDA 4LBQD 4L99A 1CAWB 2YUEA 2XJSA 4OHXA 2XJRA 1Y3TA 5DZEA 3ZFFC 3KGLA 5BNQA 4IV1A 5L73A 3A0KA 2WL1A 5I0TA 3A4UA 1OPOA 1RITA 5J36A 1KFXL 1PZ7A 3MICA 5CADA 2LM3A 3URFA 2EVXA 2XJPA 1BXHA 2TBVA 4XJUA 4NN0A 2RMU1 2HWF1 2JXAA 4A2UA 2H6BA 3J9SA 2GN7A 4MGZE 2HWB2 3RYKA 4PBOA 4SBVA 2D6LX 3WUDA 5T55A 1WUVA 2ZKNA 1FNZA 4E9KA 4S2GA 1LGCA 1LEDA 5F6KA 4IV3B 3ZDSA 3IM0A 4YVSC 3VBSA 4L8QA 1CJPA 1DU3D 4GWNA 1N3QA 2E7AA 3ZXLA 2FQPA 1H2KA 3ZXJA 4LT5A 4JC1A 1JTZX 5HI0A 1OQ1A 2VVEA 4FT8A 3AMHA 1VRH1 2IFWA 4KBBA 1LHVA 5FCCA 1RGSA 4H55A 2ES3A 3LKJA 4YLZA 2GNTA 1JYCA 4P9YA 1O3QA 3ZSLA 4CDXB 3OCPA 1LU1A 1POV1 2JKBA 1XYOA 1TME3 4XFCA 3WG3A 2Y0IA 3B5LB 5BNNA 1C8NA 4GH4B 1AL22 2HWD1 1PNFA 3FLTA 3FE5A 4UW6A 1CD3G 1G9AA 4FAGA 1LKNA 3JCIA 4QMAA 4I0WB 1PGW1 2C0ZA 1LRHA 1C57A 1TEIA 2E53A 4QQPA 2PHUA 3QH7A 2I2SA 3MDPA 4CDUA 1NG0A 4U2AA 1OD5A 4M00A 3SITA 1LEMA 3VBOB 1NA1A 4XDQA 3RZZA 4RHV2 1VBB2 1N3OA 1HKDA 1QQP2 1YFWA 1WCDJ 1G9CA 4CDQC 3AK0A 5LEKA 4Y26A 1QKQA 3VBHB 1VRH3 4PIXA 4V1PA 2R32A 1G9BA 4AFBA 3M3EA 3N7MA 4RS5B 2XLGA 1S0BA 4N53C 4DXZA 1POV3 3KQRA 1R1A1 2D6NA 2X53S 2BQPA 5H9QA 3RYRA 1V6IA 4P9GA 4LNVA 1UPSA 2QVSB 4HPKB 5FDBA 2GNDA 3WQ1A 5EV7A 3VKLA 4ATFA 1S0EA 1CONA 4Z2WA 4P14A 1Y9QA 2IXKA 2ARBA 1QJY3 2PHTA 5DUUA 2A3XA 4CEWC 3TWIA 1IKPA 3ME2A 1Q8PA 2BFUS 4TSVA 1MQTB 1S1AA 2HJIA 1DYPA 4KGQA 4WZFA 5A33A 4BYYA 1RB8G 2D40A 1AX1A 3PJYA 1HXS2 3ZYRA 3PVBB 2ZMKA 4QD2A 3FHIB 1ZBA3 3AKQA 1UN1A 5FMOS 4M3CE 4WVVA 4N43C 1ZBE3 2ZBJA 4ZKTB 3ZYIB 1AF9A 2WLPA 2DTYA 3AYAA 3BU7A 3INAA 1GZCA 4HN1A 5C33A 1DGRA 3WDYA 1LJ7A 1KD7A 4ZXKA 2RMU2 2HWF2 1WW4A 4ZU5A 4JGYA 3V64A 5J48A 3NJZA 2I45A 4EN7B 2XB6C 2DVBA 4XFGA 4BM8A 3ZMOA 4LLFA 3AYDA 4M0HA 3PMEA 2VUAA 2F6BA 1JUHA 1GR3A 3I4IA 1XNCA 1N1YA 3ZPYA 3SXWA 1H30A 5GZCA 3B02A 2BNMA 3CJIB 1HX6A 5IK5A 3MLJA 4R4XA 1CR7A 5GJ6A 5FOBB 2CGNA 4I02A 4AYUA 4CDXA 5KXEA 3X29B 2B45X 3H8UA 3WZ1A 1R091 5K7PA 3C3VA 3HQXA 5EYXA 2HWD2 1BVVA 1MACA 3LB9A 3CLPA 1DGRN 1PZ8A 1PGW2 4XILA 4AFCA 3V56A 4YG0A 3JB8A 1ZYBA 4P5HA 3M3IA 3ZN5A 3WW2A 4D94A 2EXIA 4BQ1A 1GBGA 4Q1PA 3MPPG 1HRV1 3L2HA 4PBPA 5EWSA 1H8TB 2ZX4A 4HKOA 1BVP1 3E5UA 1RMU1 2PAEA 5CFCC 3N7KA 4QPIA 1RUI3 4KQ7A 3VBHA 3UV9A 2UWBA 4R9DA 4BPZA 3B94A 5AVPA 1QJX3 3IPVA 4YW5A 3JQXA 1PO23 1W6QA 5KHJA 4MYEA 3VBSC 1R081 1OI6A 3Q9OA 1R1A2 4LO7A 4AFDA 1R093 3E5QA 2A6WA 1MS0A 3AZWA 5JMCA 1OQEA 1UF2C 1GV9A 2R49A 5D8AA 2RE9A 5AFBA 3H3UA 1WMDA 3LA3A 1W0PA 4XHXA 1UZYA 3FJSA 1KFUL 4I01A 1GQGA 3CEWA 1WCKA 1AXZA 1YUDA 5JIAA 1REEA 1BBT1 4XF9A 1HRV3 2D6KA 3MI8A 1D0GA 3B3QE 3JZVA 2UY9A 3OY8B 2VGDA 4WM8A 3H9AA 1RMU3 1LB2A 2GMPA 5BNNC 5JZGB 5FRAA 3AP5A 1H0BA 2DVGA 3CL1A 3DF0A 4CDUC 1PGSA 3DL3A 1ASJ1 4XJAA 3HIFA 3OD0A 1PK6C 3ATGA 1R083 3B01A 4YSFA 1GZ9A 3E97A 1LHWA 2BYVE 1MZFA 2ZGUA 4FPCA 4XFHA 3NWKA 3H0OA 3WDWA 1SLTA 1O7FA 3IDEA 4AEJA 1VJ2A 2OYZA 2FHRA 1WLCA 4YVWC 4JDNA 3KD4A 1C3HA 3RSJA 4HSJA 3ZFFB 3IKWA 3D0JA 4LULA 4X6RB 5EZWA 4AHXA 4PIYA 4AI0A 3J8F1 4AVCA 1JXNA 4J6GA 3AJYA 5T52A 2A7AA 4RQPA 1RUE2 1TNFA 1RUD1 4ES8A 4YZ3A 3VKFC 4HVQA 2ZA9A 4QT6A 4ISRA 2RS33 4FOVA 3D6EA 1ASJ3 5E16A 4YVSB 4B7KA 2XG3A 4KH9A 4A7YA 2CYFA 4FOYA 2ZX3A 1C28A 4FPJA 3E6BA 2A75A 4RR3C 2ZGMA 3POSA 4KG8A 3I59B 4AI8A 1GQHA 5K0UA 1ZX5A 1TE1B 5FLJA 5JI7A 3S0MA 3KMHA 5IK4A 4LA2A 4A7ZA 2IWGB 3DV8A 1ZVFA 2OUHA 3I54A 2ZGPA 4F83A 5T3NA 1FOD1 2LUWA 4JGYC 1QGLA 4XZPA 4Q4Y3 4MXWA 4YM1A 1Q8VA 1OFNA 2HEVF 1VBA3 1SFNA 1WMFA 2R071 4G9SB 4N7IA 2CAVA 1LCLA 4Q4X2 1VBE3 1G86A 1ZZCA 3IDBB 3EQEA 2D93A 4IL7A 1H1MA 4HZFA 4Z82A 1J59A 3OBTA 4CDQB 3RNSA 1OPMA 3NV3A 3UJOA 1ALYA 1FV2A 1CX4A 1ZZ8A 2LTNA 1SLBA 3ETQA 4C91A 2V5YA 1W6NA 5JOWA 4XXPA 3VHRA 1BBT2 4XE9A 4KWKA 3USSA 1AR82 3WP5A 4Y20B 4QGMA 3IMNA 3OY8A 5FFOC 1W6OB 4HFSA 4E2QA 1REDA 3H7JA 2Q8OA 2ZZJA 1BEV3 1X8MA 2CWSA 4QQ2A 4Y1UA 2VULA 4C1WA 4S2DA 3CJXA 3HT2A 1D4M3 3AP4A 1EAH1 3L9JT 4META 2WWSA 3LSDA 3VKOA 4FO9A 5FBZA 1O5UA 3KGZA 2JG8A 2RR12 1YFYA 3ZFGA 2YC0A 4DZGA 3DUIA 2PLV1 4ZU7A 4QPIC 4FOQA 1D4VB 2ZJCA 5BXXA 3HD8B 4S2HA 2DURA 2CTVA 2GN3A 2D43A 4YZ1A 2GMMA 4KWLA 4LR4A 3ZFFA 4F3JA 1HRI3 2PA7A 4N43B 3N7JA 4KU8A 3J8F2 5DZGA 1YJKA 4B4QA 3N35A 1PNGA 3HMYA 1LOAA 1ZZ6A 1RUD2 2PHWA 3KCCA 5FO8B 2DTWA 1BZWA 3SNMA 4XYXA 1EAH3 1YO8A 2BWAA 1RUJ1 2PAMA 5GKAC 4KNCA 2DV9A 3WT3A 2VU9A 2DU0A 5GZDA 1HQNA 4AEKA 2XVKA 4AHWA 3WNXA 4WM8C 4P9IA 3WXPA 2PLV3 4AHZA 1BMV1 1DQ6A 2YDEA 2D98A 1RUC2 3OPZA 1DIWA 3BALA 3ZFEA 2R0HA 4LHNA 4E2SA 4EJRA 2DYCA 4E27A 1HQWA 4AVVA 4TLFA 4AEDA 4AE2A 1REFA 4Y1VA 1W0OA 5FPZA 4JAAA 5I8YA 2R041 4JCKA 1AR73 1CPMA 1ONAA 1VBC2 4C0HA 1LODA 1FOD2 2MEV3 1LHOA 3MIBA 1FATA 3P3NA 5GZFA 1V6NA 2R072 4GKXA 5EFUA 2D5FA 2VG9A 1RUJ3 4JRLA 4YW3A 4JRAA 3ST7A 4IV1B 5BNPA 3AFKA 1LR5A 1NXD1 1A78A 2GALA 5FPXA 4GMP0 1IS3A 2H0BA 4CDQA 4E4DX 3G6JB 1O3SA 5E88A 2WS93 4RQPC 5LK7B 1RUNA 1PGL1 3H1WA 1V00A 3WDVA 4ISQA 2HYKA 1DQ0A 3OJBA 2WNUC 3D82A 1CESA 1FT9A 4Y20A 2DVFA 2RHPA 2XLFA 3QH6A 3WW3A 2K0GA 3LOIA 4N53A 3VBSB 2P2KA 2R043 4FXKB 4XHBA 3WG2A 2ZX2A 5EJ3A 2PFWA 1U5XA 3LA2A 4AFMA 1Q43A 1VAVA 2AH2A 5K0UC 2QZ3A 2B7YA 2NQYA 1QXRA 4CEWA 2OIIA 2AENA 2ZHNA 3CF6E 4GKYA 2GDFA 1O4TA 2WKKA 5FO9B 1DYKA 1KDMA 1RTVA 1JOJA 3IBMA 1FMD1 1V9U1 4FXGB 5BNNB 1AL0G 5JSOA 1IKQA 2RS13 1QJU2 2PYTA 3GNEA 2JENA 2ZAHA 2R1DA 2DUPA 2XL7A 2VH9A 4CDUB 2P3JA 3EXUA 3FBMA 5T5JA 2R1BA 2G9FA 3SCFA 4EWAA 2VNOA 1LULA 4M3CF 2XUMA 4IQPA 3ZXDA 1MZEA 3NAPA 2P34A 1X36A 1ZNPA 2VW2A 3NV1A 3U4XA 4AVBA 1XNKA 1DGWX 5A32B 1KJRA 1J1TA 4YVWB 1U5ZA 1DGLA 2R6QA 2A5ZA 5SV5A 4L11A 1XE7A 2E6VA 1FMD3 3M4FA 2WC2A 1BMV2 1ZZBA 2E7QA 1GLHA 1YJLA 1XU1A 3ZXKA 5KHIA 2AREA 4WV8A 2AYHA 1ZRCA 1EP0A 3EJKA 3WVJA 4J1XA 4AVAA 4XMIA 1SFYA 5JOXA 4JVAA 1RUH1 4Y1ZA 1YIPA 4D7TA 2VOKA 5H9RA 2R042 4LEJA 1H2LA 5A33B 1X8EA 2GC0A 4QX5A 5GM0A 4W6XA 1UL9A 4QGLA 4RR3B 3J4UH 1KRIA 1DQ5A 3LZZA 1C8M2 5DXDA 3UJQA 4JGZA 2O8QA 3VZJA 2SLIA 3I7DA 1UZZA 5CG8A 4NWVA 3GBFA 4K3UA 1TME1 4AQ6A 1I1EA 1U5IA 4Q4V3 3R4SA 1B09A 5CFCA 1PGL2 3VZNA 4PCRA 4G4FA 4RD7A 5FOJB 1GYKA 3S7EA 2BEOA 4JGYB 4JDMA 3PMSA 5CAZA 5JCTA 5SV8A 2BVVA 3TYJA 1XYPA 2VOVA 3KT4A 1A8DA 1YCIA 2I74A 1RUH3 1OFSA 3ZYGA 2Q1ZB 1LHNA 2BBVA 3NW4A 2OW4A 1H2MA 1G7YA 4X8NA 1MR5A 1F9KA