5J09A

Crystal structure of decameric bfdv capsid protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
193
structure length
171
Chain Sequence
b'RIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFALDDFLQAVPNPHTLNFEDYRIKLAKMEMRPTGGHYTVQSDGFGHTAVIQDSRITRFKTTADQTQDPLAPFDGAKKWFVSRGFKRLLRPKPNSARTGWIPLQSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beak and feather disease virus capsid protein
publication title Structural insights into the assembly and regulation of distinct viral capsid complexes.
pubmed doi rcsb
source organism Beak and feather disease virus
molecule tags Virus
total genus 33
structure length 171
sequence length 193
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.950 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j09A00
5J36A 5J09A 5J37A 3R0RA 3JCIA
chains in the Genus database with same CATH superfamily
2V4AA 2ZX0A 3U14A 1BVVA 3O7OA 4LKDA 1QOTA 1H8TB 2RR13 4XDOA 3N9OA 5BNOA 1LAJA 3WNKA 4DY3A 4HK9A 3TWIA 2WNEA 3HBKA 2RDSA 2RV9A 4F3JA 2R49A 1DFQA 4IGOA 4U36A 4WV8A 4OI0A 4TSVA 5IWFA 1JYTA 4LPLA 4Z1VA 1OH3A 1VBD2 2D6OX 1PGW1 5LCWL 3GBGA 1QWRA 2HKXA 3M2MA 4XUPA 2W91A 1CJPA 4FPEA 3AVSA 4N7UA 1S0JA 2ZGRA 4YARA 1GP6A 1XYPA 4OULA 5FCCA 4UOJA 4RR3C 3ZX7A 1J84A 1KXGA 2LUWA 4A7KA 5IHRA 2IFRA 3ZFGA 5BNPA 1F5FA 1C5HA 2OVUA 4LO5B 5F6LB 4QKBA 1FOD2 4ATFA 2A71A 5FK7A 3N4MA 3WOGA 2EVXA 2YHJA 2HYXA 2ZGSA 4O9GA 3NO8A 1UIJA 3WCSA 1JI6A 2WFF2 4B1LA 4CP1A 1HN1A 1VAMA 3JBG2 3PJQA 5JOZA 3P6BA 3ZYFA 5FZMA 4CDUC 5JPNB 4MXWA 3SLIA 4KH9A 2C9KA 3T2QA 4IEUA 1FV2A 3CBNA 4XXPA 3U4SA 4CVUA 1QNWA 2X5IA 3AP7A 1O5UA 4CTEA 3HEIA 1NOVA 5K8SA 4QHOA 3I2OA 4AXOA 4WM8B 4ISQA 5DG2A 3VZLA 2O8QA 4SLIA 5C33A 5FZHA 4B4QA 5KXEA 2BU9A 3WG1A 3O1RA 4XBQA 1TME2 1DLCA 2PLV1 4X6QB 4ZZ8A 1BEV2 1KFUL 2BV4A 3N9LA 1QU0A 3OB8A 1HXS1 1V6OA 3PHMA 4GZ9A 1WMEA 3N9MA 3ON7A 5J37A 4D6QA 3LEKA 5T5OA 1SDDB 4FT8A 2Q8CA 4OZXA 4EN9B 2D6LX 3ZYHA 5I8YA 1Q8OA 1KQRA 5FMOL 1Z7S1 3ZMNA 3VV1A 5CKNA 3C8XA 2J1UA 3VKOA 4PLMA 1RUH3 3Q9OA 2PXJA 2ZZJA 4XF9A 1O3QA 1WKYA 2WN2A 4AWDA 1W9WA 2LTNA 2TNFA 2GC0A 2JEMA 4JX0A 1DGRA 2CWMA 2D3PA 4RHV2 2HWD2 3BCWA 5A33A 3BTZA 4M3CE 4RS5C 3MW3A 3MYXA 3RYKA 3J26N 1N1SA 3WF1A 3EHKA 4CEYB 3B3QE 1PO13 1LKNA 2WNOA 4R52A 2ZGKA 1UCXA 2WO3A 4KL1A 4QB2A 3LPGA 3WF0A 2VUCA 3O0XA 4Y20A 1W6MA 3A4UA 3IAQA 4WVZA 1AR61 2FHRA 3NJXA 2D3SA 1GWKA 4TLFA 4XMIA 3UGHA 4CDWC 3UETA 4EN8B 3ITQA 1R093 2WNVC 3VBFB 2GC2A 3OUHA 1SDWA 5FZ8A 1GOGA 2PTMA 4Y5TA 1W2TA 2HWB3 1RIRA 2R1BA 3WW1A 1TNFA 2VOTA 4LO7A 3KVBA 1XRUA 2HBUA 1V9U2 1N1TA 2VC9A 5BY5A 3ACIA 3E6BA 3RI9A 2WRAA 2JG8A 3NRUA 4H7MA 5FQ0A 1FMD2 1GMMA 3ZDSA 2JDYA 2VQAA 3BOWA 2JDMA 4GULA 1SFYA 4EWAA 1F35A 4W6XA 4URAA 1ZZBA 4RFT0 5FP4A 1PZ7A 3RJRA 1AJOA 5EJZB 2Y64A 1SLTA 2XBO2 4ZU5A 3VDDA 4YW5A 5JR7B 4AVBA 2WT1A 3WP6A 1QJY3 1QQP2 1UAIA 4Q4X3 1OQ1A 3GDBA 5L9VA 1BQPA 3ZXFA 2RHPA 1NE4A 4NHLA 1AR91 4BIOA 1VBB2 4HKWA 2OQ7A 3EBRA 5I0RA 1GP5A 2UYAA 4FP3A 5J98B 4CYDA 4YW4A 4QM9A 1VBA1 3RZKA 2AH2A 5CFCB 1AYN1 1DIWA 1WW7A 4XVHA 1TZOA 1DQ5A 4A3XA 1QXRA 1KITA 1JBCA 2RDNA 1H2NA 2YPDA 3LQCA 1WGPA 4ARYA 5A1AA 2DURA 3IMNA 1V6LA 1QMJA 2CDPA 5JZGC 1QDCA 1HV1A 2D6NA 4AW7A 3KCXA 4RQPC 2RS33 4GKYA 1IQDC 1MZ6A 3J8F3 4HT1T 4F8AA 1GKBA 1OQDA 3MFCA 3T0BA 3WNXA 1DF0A 2G1MA 2QQWA 3HOBA 1GANA 4RA0A 1SHWB 4Q1RA 2ARXA 2WO2A 2JG9B 2RM21 4LLOA 5C8CB 1A8MA 1ASJ1 2JIGA 1OFNA 2WQ4A 4IQPA 5FY4A 4NIDA 1MVEA 4M3CA 3ORJA 2VZVA 4E2GA 2QCSB 2F17A 4UFHA 2LROA 1VRH2 2QQLA 3ACLA 1DZQA 3Q8FA 3R05A 2WYSA 4QB1A 3N7KA 2XB6C 3DPRC 1VBD1 4K21A 3EXUA 4BLJA 3OBAA 3OYWB 4L2NA 3MHZA 2WJSA 4FPGA 3WQ1A 4LOTA 5E8AA 1F8VA 1X9PA 4K8FA 1BLZA 4JVAA 1JZ4A 4MGZE 2VW2A 1S0DA 2VH9A 1AYM3 3TN93 2FDFA 2WYFA 4M0NA 5GZCA 3DKWA 5LBBA 2A6YA 1WBLA 2GMMA 3BALA 4XBLA 1ZRCA 2VMCA 3NMBA 3ATGA 4CUGA 2B9VA 5F3EA 4EZ4A 3GBFA 3OBRA 4YPJA 5K0UB 2VCBA 1OKOA 1VB2A 2ZEZA 4D6SA 2HWE2 4YW1A 3Q8BA 5FZGA 5A32A 4UT5A 1Q43A 4LBQD 1WMFA 2RS53 4YW3A 3G6JB 4COUA 4YZ1A 2XKPA 1EUTA 2HWC2 2NM1A 2CU5A 1GQPA 2A5ZA 2P1BA 1YFXA 3ZO0B 3OD0A 1DYKA 4OI1A 2JWPA 4CU7A 4H7LA 2RS13 5KHHA 2W47A 4YVWA 4GKXA 4QPIA 2JDNA 1PIV2 2J1RA 4YVSC 3F95A 3KSCA 2RE9A 2R30A 3MLLA 3IB3A 1RUE3 3BIEA 3RYRA 5JOYA 1GZWB 3MGUA 1A3KA 1QOOA 1IKPA 3ZSJA 3N9QA 1H2KA 3I3BA 3SEPA 4CE8A 2VG9A 5A6ZA 2WIIB 2QQVA 3PNAA 4HVQA 1V00A 2DVDA 1CAVB 1BHGA 5J09A 2XVKA 4CRQA 1O4YA 4MZUA 1T2XA 2XOMA 4CEWC 1UPIA 4I02A 3EQEA 2P5BA 2Z5WA 3AXDA 2R6QA 4QDSA 3ZYJB 1POV0 5HBAA 4NIGA 2ZHLA 4TXWA 3TBDA 3TRSB 5JMCA 3KS7A 1BMV1 2WNUC 5DAXA 2HWD1 2QUOA 5FYBA 3OD4A 2VZ3A 4Y5Z0 1HX6A 3FJSA 2W39A 4FFHA 4XDPA 1FPN2 3UK9A 1NLSA 2W1UA 1GZTA 4O7XA 1GR3A 1MQTB 2YB7A 2RMU2 4CDXC 5JDBA 3VBSB 3L9JT 2P3YA 4EJRA 2OA2A 1LOEA 1AR71 2ORZA 4AOCA 1C57A 2B45X 3OGSA 3N9PA 1MEC3 1YQ2A 3SXWA 4P14A 5A1LA 5DDJ1 3OGJA 1YFYA 3N7LA 1UZWA 2QE3A 5L9BA 4EN7B 4MG2A 3HJRA 2EXJA 4Q4W1 4GXLA 3OY8B 5LB6A 5FBZA 1YJKA 5F8PA 1XPWA 3DXUA 4WVMB 4KNCA 3CZJA 2VNGA 3ZKUA 1W05A 1WW6A 1WD4A 2DBIA 4FOWA 2FDJA 1V9U1 2XHNA 4XILA 1US3A 1GV9A 3TEWA 1DGWX 2MEV3 1YQ6A 1FXZA 3I2DA 1AR81 4HLTA 3H3UA 1B35A 4RL7A 4FAGA 3UJOA 3DYMA 4K7JA 1YQCA 3LCPA 4YZ4A 3POJA 5A3PA 3H1MA 1AX1A 3MEPA 4HXCA 2VQUA 5C71A 3V0AA 5KXCA 4QGMA 2E9QA 3LB9A 4PF1A 5E88A 2YC2A 1IS6A 3JB4C 1F2NA 1UZ0A 3PUQA 2WINB 4XFAA 1D4M3 4K40A 4QGLA 5FY7A 5LY1A 2VOKA 5HCHA 1JTZX 1OLRA 2KR2A 4RN5A 5JI7A 3DYOA 1BK0A 1N3QA 3A21A 1SMVA 2PHFA 1EUUA 3AYDA 3C7FA 2QVSB 3K3NA 4NMIA 4BQ4A 3VBHC 4J1WA 2FZ1A 4AVSA 2XLGA 3WP3A 1CWPA 1VALA 2WZEA 5F5AA 5C4WC 1H8TA 4EROA 5T3NA 1EPZA 3GZTB 4LKSA 1H1IA 4GB31 3BTYA 1RUD2 4MH0E 4OFGA 4QDQA 2LS6A 3WXPA 3E1F1 4ET7A 1G9BA 4DPNA 4Q0PA 2JE9A 1CAUB 1X33A 4KG8A 4FPYA 1ENXA 2ZZQA 2G9FA 4MGTA 2OS2A 1PK6C 4LULA 2VZOA 4UFMA 4IXLA 4IE7A 2QQMA 1ZZ6A 3GZAA 1H0BA 1O8PA 3TNQA 5L7OB 4COYA 4XBNA 3T3YA 2YYOA 4BMBA 4FTBA 2ADEA 1G9AA 4AFCA 5CAZA 1ENSA 1UYXA 2VMDA 2WT2A 3O12A 2BNNA 1LODA 3BGAA 4IEZA 1ZRFA 4JKKA 1KD7A 1QJU3 3VD7A 1RUI2 1RHI3 1YEWA 3ECQA 2H6BA 5T55A 3CLPA 4HSJA 2PELA 2XJVA 4MHUA 3MIDA 3WDTA 2CHHA 1GOFA 3M1HA 3VD3A 5FUNA 1SLBA 3ZPOA 4DXZA 1W0OA 4A42A 5FXWA 4UAPA 1PGSA 4N53C 5ERLA 1ZRIA 1X8EA 5IVJA 5JPMB 1TEIA 2UU8A 4IV3B 2VZPA 1W3XA 2N7GA 3EB7A 3J7LA 5FZDA 3AP9A 1XB9A 2R043 3VBOC 1W3VA 4BA6A 2NP0A 4LORA 4R9AA 1Y43B 4NUBA 4WM8A 3FFZA 4RR3B 3MIFA 4EWDA 2A6WA 1KS4A 4JC1A 4BLIA 1J3PA 4R8HA 4DXSA 3WR0A 5FZIA 2ERFA 4N43B 2Q1FA 2ZKLA 2JDZA 2B9UA 3SH4A 4AGGA 4JKMA 2NMOA 1ZA7A 3VZKA 5LZ6A 1X36A 1I1EA 2AEYA 2WZR1 5CG9A 3S30A 3T4HB 3J7HA 4LIVA 1QJX1 2D6KA 1HRI2 4CDUB 5T52A 3QCWA 2RJLA 3K75B 1G8WA 1CZVA 1G6NA 1JODA 2PAMA 4MADA 1W03A 1WWYA 3BODA 3FHQA 5FZOB 3VD9A 4Z2WA 5LY2A 3O1SA 1TE1B 4CP2A 1O7FA 1XSQA 5HXVA 5FFOC 4A7ZA 4IEPA 5AC92 3IMMA 1GNZA 4LEJA 3W20A 3IAPA 5FMCA 4L8QA 2XVGA 2GALA 4YRDA 1RUC2 4I30A 2VMHA 4CEYA 1AL22 5IK5A 2P3JA 1LJ7A 1MACA 3NNMA 3POBA 5IAVA 2ZMLA 3V0BB 5F32A 5CADA 5F9TA 1P8JA 1RVF3 4MUVA 5BNQA 1CR7A 3SH5A 2I74A 5GLWA 5HI0A 2LW8A 3VBFA 1SBEA 3GZUC 1PVC3 3JD72 4RSUA 3ABZA 4LHKA 3OF1A 1NQDA 3AMNA 1DHKB 5E89A 1UXXX 2D7FA 3HN1A 3PUIA 4YG0A 3AYCA 2B8MA 1C8M2 3HWJA 3S5QA 3FX3A 5FZFA 3K4AA 4PBPA 4QQOA 1OOPC 4RS5B 5I0TA 3L2YA 4KU7A 4NN0A 1CPMA 3GCWA 1RUF2 4LBKA 4W6YA 1RB8G 2GH8A 4QXCA 1D0HA 2E7QA 5FPUA 4R9CA 3VBRC 3E5QA 4MOAA 4FPFA 5A3OA 3I8TA 3B69A 4XUQA 2W68A 2ZEWA 2PHTA 2KD7A 2EA7A 4CDWB 1QIQA 2ZGPA 4AFBA 4LITA 1V6NA 4HPKB 2EIEA 1RL3A 3WQ7A 2WNVB 5EYYA 1NCRC 3JUUA 3NQHA 4DIQA 5FPXA 3ZXEA 5C3SA 3N7MA 1N1YA 2PMWB 2WS93 2UY9A 4W4ZA 1KJLA 1SZBA 3ILFA 2EIBA 4PJYA 4UFLA 1UD1A 3O1VA 2BNOA 2VOWA 5CFCA 5AFBA 1XYOA 1OKQA 4UF0B 1RJ7A 4QU1A 4LLFA 4Q1PA 4MO3M 1RITA 2ZGMA 4AI9A 1OC1A 2IXJA 4J25A 4FXKB 5IVCA 4MGQA 3CU7A 3P1IA 1CAWA 4AI2A 3ZSMA 5JUVA 2VZTA 1PGW2 1POV1 2PHLA 4DXRA 4BWOA 1ZBE2 1RUJ1 4CUCA 1IPKA 4XIKA 2FBEA 1MR5A 2FD8A 4WM7C 2WWUA 4P5YA 3ROUA 3TNPB 1BBT2 4Z8BA 3MLJA 1WLWA 2JG9A 2VNOA 2YUEA 1VBE3 5C8CA 1WUVA 1DQ1A 1Z0HA 3WT3A 1YYNA 5ANNA 3HQUA 2XQXA 3KZ4C 3SQOA 1VMHA 2GP3A 2RJ2A 1BCXA 4UFIA 2NZ9A 4GWNA 1NLQA 3ES1A 5C9AC 2DUQA 3I2IA 2AC1A 2P17A 1WCDJ 3PTYA 1OA4A 4RGGA 4LK7A 4EE2A 3O5SA 3VDAA 3Q8AA 4C91A 5JAXA 4M4RA 3OYWA 1YUDA 1ZNPA 1CGPA 4YW7A 4XUOA 2IZWA 1O3RA 1XQNA 4RQPB 5F5IA 2YC4A 1PX3A 2YPJA 2YV8A 3DF0A 2AUYA 1I6XA 1UMHA 4FPLA 4PDWB 5IK7A 1R1A1 3JB8A 4GA9A 4XHBA 3MV11 4CXYA 4Q0SA 1RMU1 1XNKA 4OCTA 1Y9MA 4LQRA 2WN3A 1XE0A 1DQ2A 1SPPB 1LCLA 2PLV2 1UOBA 5C3QA 2ZHMA 5K0UA 1HXS2 4XACA 4JHTA 4MV2A 5GLZA 3ZKYA 3S0MA 1RUNA 4QXHA 3ZN5A 4CCDA 5B4XA 3RZGA 4CXWA 2CNAA 5C7GA 2Y26A 3MUZ1 1O3SA 3VBUC 3B94A 1Z7S2 3N35A 2CWSA 3GJBA 4Y24A 2VMEA 1YI9A 3AXEA 1K42A 2J1SA 1D2SA 1GQGA 2BEOA 2R061 5F3IA 1PZ9A 1PGL1 4K6BA 1S55A 5D8AC 5CISA 5EV7A 2VGDA 1AL0G 1YQ5A 3MFAA 2VVEA 1JH5A 2XG3A 3WUDA 5JLVA 1FI2A 3T1LA 2FDIA 2D98A 3H1WA 3NV1A 5FXZA 1GZWA 2ENRA 4AG4A 2JIJA 1COV3 5JIUA 1HRI1 1VMJA 2R0FA 1AR62 1CAVA 5D21A 1C3HA 1YXWA 1EV13 4Q4V1 3OPWA 4YG3A 3NAPC 1DGRN 1UXZA 3VHOA 2OPWA 4IEQA 3U37A 3KV9A 4QM8A 5E6HA 2SLIA 1DP0A 1C1LA 5FRAA 5ACA2 5G05L 1PO12 3R4DB 4PBOA 3AP4A 3KF3A 1JXNA 4HK8A 4A44A 5AC91 1ALYA 2YZ4A 4KBZA 3VL9A 4ZY9A 2DDUA 2VW0A 1XNTA 3BKZA 4QKDA 2BBAA 3BN6A 3LSEA 4DRRA 4XUNA 5DAQA 2B4KA 2H0BA 4YVSB 1MZ5A 5LA9A 4FOVA 5K7PA 1MQTA 1LHWA 1SQ4A 3NWKA 5H9RA 3VBSA 2HWB2 1ZZCA 1CIWA 5IVBA 1GNYA 4AQSA 1QEXA 1UO9A 3EJKA 1QJZA 3MZHA 4A6SA 2O1QA 4CCLA 2J7MA 4CU9A 5DUUA 2OIIA 4AYUA 2EICA 3I3DA 4CEWB 3OY8A 1BYHA 3THTA 2DYCA 4A6OA 3BB6A 3V56A 2FCUA 3PTRB 5LEKA 1A6CA 2W52A 4XJZA 5I93A 1C8M1 4TYSA 1TMF3 4AHXA 2WNUB 3MUY1 2BVVA 2Q30A 4B3NA 1MS8A 4IE5A 1F15A 2XPJA 2G19A 5T50A 1VBA2 2HWF3 4E8CA 4HFSA 5A3MA 4CCKA 4LIUA 3JZVA 1OXCA 4QX0A 4HG6B 4LHNA 1XYNA 4TWTA 1OSGA 1HN0A 2W2IA 5FY9A 4BQWA 2VXJA 5CFDC 3D8CA 2OT7A 4NPRA 2KA3A 3VN4A 2BZDA 1GBGA 3JCIA 1XU2A 4LT5A 3F2ZA 4XCAA 4U2AA 1AXZA 1ZX5A 4EQVA 5HCFA 2OUJA 4RFRB 3IDEA 1SBDA 4UFKA 3SKJE 4JGYB 3A7QA 2IXHA 2OQ6A 1RJ8A 2RM22 5FPBA 1ASJ2 3RYPA 1FATA 2QZ2A 3AZXA 1VR3A 1OQEA 4QHBA 3RS6A 1E57A 1JU3A 1SLCA 4P00B 4BE3A 1UY2A 3HIFA 4JV4A 2B39A 2EAAA 2ZOEB 5FWEA 2RR11 2EALA 3POWA 4YM1A 2ZHNA 2A3YA 1AXYA 2JXAA 2PAEA 4KWUA 1GWLA 1ZBE1 2VMFA 1CAUA 4BOWA 1OA3A 2E63A 5LW9A 1BBT1 1Q5OA 4AQTA 4OQ8A 1RYYA 1IS5A 4AFDA 5L7OA 1PNFA 2HBTA 5J1XA 4FQ4A 1C5IA 1GSLA 1Y3TA 1S4CA 1FNYA 3RPQA 2C6SA 5F2WA 2X5IC 3RG0A 4Z2AA 5JSPA 5JXHA 4ES8A 1JW6A 1JYWA 1YQ8A 2R073 4ZU7A 1OPOA 1JOPA 3W9AA 1RC6A 3U78A 1PO23 3TN92 2HJIA 2X8KA 3NW4A 4P5HA 3C7GA 3DV8A 3U4XA 5GZDA 2OZJA 1UW8A 4TZDA 5FYMA 4AEDB 1PK6B 1W06A 4IV3A 1QXPA 2JECA 1OVPA 2IVJA 1XU1A 3CF6E 2QQKA 2VOXA 3FFQA 2BTVC 2GSYA 1W8OA 4Q4Y2 1VRBA 4ZONA 4BQ3A 4CU6A 2DCTA 3MIHA 5L36A 4WZCA 1IHMA 1ND3C 1UU5A 2DTYA 4RR3A 1ZREA 3THDA 2XJPA 2JD4A 4L97A 3H8RA 4WVWA 1AUYA 1SACA 4MXVA 4XF3A 2ZAHA 4C1XA 4N43A 3ZLIA 1WLTA 1VBC3 3AMHA 2WLQA 4LBMA 3I4IA 4KGQA 3WQ0A 4NHXA 3G7DA 2Y6HA 1UZZA 1LGCA 2VQTA 3OOXA 5FZKA 1K5MC 3PIGA 4FAHA 2W0XA 5D2AA 2Q8DA 3AB0A 3KMHA 2YFZA 4GWMA 3AX4A 4CDUA 4DZGA 3RFRA 1S2BA 3LFIA 2XGXA 4KWKA 1BMV2 5FZOA 4LOSA 2VOVA 3UGGA 3VBOB 2X09A 3PUAA 1OF3A 4JTNA 5C6CA 3RWNA 2W1QA 2EXIA 3GZEA 2D5FA 2JDKA 4DRVA 4I2OA 4KI5M 4KG0A 5ACA1 3IDAA 2D97A 3B02A 4DXTA 5J96B 3SITA 2XWJB 3SCFA 4Q0VA 5C8WA 1AR72 2V73A 4PI0A 3ACHA 3AZZA 3H50A 3V0BA 1J59A 2QNKA 4QX7A 1LHUA 2XMLA 3R6SA 4ZU4A 3O0WA 1SLLA 2UWBA 4AFAA 1PO11 1KFXL 5DDJ2 3VDBA 1W39A 4DUVA 2DF7A 4Q4W2 1W6QB 4Y5SA 3K4DA 3HPNA 5G04L 2BUKA 4QQLA 5EP9A 4NRQA 3URFA 3MBWA 3J4UH 2F6BA 1R091 4QD2A 1MEC2 3ZPYA 4ORFA 1AR82 3WINE 3VZMA 4QPYA 4DQAA 4OZOA 4BYYA 4S2DA 2HWB1 4FTSA 2WZ8A 4XJ8A 1OBNA 1HRV3 1QNYA 4RS5A 3H42B 3KV5A 4OQ9A 2BERA 2XJTA 4ATEA 5DMYA 2WQZC 2HEVF 3M3OA 4FOYA 2ZACA 2YBPA 1S0BA 5APAA 1OFSA 1W2NA 4PLNA 1ZA4A 2ORXA 1U5ZA 5CKQA 5FKBA 4CDWA 2XH6A 3HD8B 4HPKA 4QDRA 3V65A 4BB3A 3WSOA 2WNVA 2NN8A 3B5LB 3WF2A 4CCCA 1W9FA 2BWCA 2VCAA 3R0RA 2VU9A 2YROA 2ZGOA 1QJY1 4DMIA 3KM5A 1W2UA 1AR93 1W6PB 3HN3A 2XWBB 4V2WA 1S2KA 1O91A 1R083 4GB32 4UF0A 1CAWB 1JOBA 1YC61 1XOYA 1AYN3 1YO8A 1OOPB 2EIDA 5JCTA 1W2OA 2Z4FA 3N36A 3PL0A 1XE8A 5KHGA 1T6BX 1UY4A 3NV2A 4QPWA 5EXOA 3WNNA 1ZZ7A 3VBRB 4E2SA 1O6UA 4ASKA 5A3TA 2C1FA 2RJKA 4NROA 3MLKA 3I59B 3ZMOA 2D3RA 1F4AA 3OUJA 3M3QA 5A1FA 4W65A 1K3IA 4CP0A 1EP0A 3NJZA 1NCRB 1NUKA 1WLDA 2V5DA 2RS31 3S57A 4E4DX 3J8F1 2BOJA 3GJAA 4RGKA 2VVFA 4IL7A 4XXAA 3LOBA 2ZMKA 3WEZA 4QXKA 4W8JA 3WHUA 2XJSA 3BU7A 3TEXA 2YDEA 1J83A 1XNDA 3DCQA 3DUIA 4GWJA 5JR2A 3VKFC 3AKRA 3BYWA 2W87A 1VBD3 3M3IA 1UYZA 4IE4A 4BQ2A 1H4HA 3VB9A 2ZEYA 4MGSA 5JZGA 3QBQA 1V6KA 4W50A 2YGLA 4C8DA 5DPNA 4P08A 1VMFA 3WDVA 5LATA 4RQPA 1O8SA 4PDWA 2P6CA 3ZFEB 1S0GA 1RUG2 5JSOA 2W1SA 4IEXA 1IPJA 4PQ9A 3T2OA 1NA1C 5F3CA 1AF9A 3LOIA 4CDQC 1FOD3 1MZFA 4XETA 1ONAA 1STMA 5FZ0A 1AYM1 1SPPA 3TN91 2FCVA 3WG3A 2W9XA 3R4UA 1Y4WA 3I3QA 2W95A 2CAUA 1UU6A 3WHTA 2WA3A 4AHYA 2BW8A 3I54A 2WFF3 2VD7A 1QF3A 4GH4C 3EMRA 3JBG3 5C9AB 2WZR2 3DPRA 4ONUA 3ZIXA 3E5XA 3QH7A 4A7YA 2XHKA 1QJX2 5AVAA 4YM2A 1YFWA 2DFCA 1GFF2 4NHKA 4QGNA 1ULEA 1UNBA 2E7AA 3BPSA 4Q4Y1 5LRRA 3ZR5A 3JQXA 2RS51 1YI7A 1YJLA 2GNBA 4XFBA 5C3RA 2CGPA 4FSJA 1W6OB 5FYVA 1V6JA 4CCEA 3ENRA 5FIXA 2AZ5A 2CDOA 4BK5A 1TME3 2YY1A 4R4ZA 3GALA 1BEV3 2JDAA 2IFWA 2RS11 2D43A 2FDGA 1VAKA 4BPZA 3HT1A 4K1YA 1YCIA 1CVNA 2C0ZA 4R9DA 1BVP1 2Q5TA 5IVFA 4D7YA 1LR5A 2I2SA 3LF7A 1QOSA 1RUE1 2O8OA 1W8HA 1RTVA 4FPHA 4Z82A 5F39A 3JU9A 3CIHA 3VBUB 1CESA 2JJ6A 3WG2A 1HB4A 4XF1A 2DCJA 3D4KA 2EIGA 1POQA 1SG3A 3MW2A 1DLLA 4YM0A 2FZ2A 1H2LA 1HIXA 1JUIA 1WMDA 2DFBA 3AYAA 1WW4A 2ADDA 3AKPA 3KQRA 4GMP3 3VHNA 4RHV3 2HWD3 4Y4RA 5JXGA 4ARXA 1SFNA 5D8AB 2GP5A 4YVSA 1W8TA 4A45A 2O14A 5DABA 2WAOA 3HMYA 1J3RA 5FBJA 2VL4A 4AGVA 5CKMA 1B35C 2WWJA 4IERA 1WCUA 3CNAA 2RDQA 4FCAA 5DZGA 5FLJA 5FYYA 3USSA 2O0OA 1QKQA 3A0NA 4IGQA 4CUBA 3CEWA 5FYZA 5FOJB 4HKOA 4S2GA 3QACA 1BXHA 3TEZA 5FXXA 3AJZA 4XCBA 5KHJA 4CEWA 3HQRA 1MEC1 1LU2A 1O5LA 2J1AA 4CCOA 1UWWA 2WNUA 4HZFA 5FYTA 4L99A 4AI0A 1V9U3 4LBLA 5KWRA 1JYVA 2BVBA 4PCRA 4P9GA 1FMD3 3ETQA 5C5TA 3H7YA 2NLRA 2MEV1 4KBBA 2E7TA 3VZJA 4CDXA 4DB5A 2WO1A 2XBO3 4AHWA 4YGCA 5HCAA 3WCRA 3AYEA 3OBZA 1QQP3 3HNYM 1UY1A 3ZYIB 1N47A 1RUJ2 4PF5A 3C7OA 2AACA 2GNMA 1D4M1 1OD5A 1VBB3 4X8NA 4JGYA 1UOFA 4YWAA 4YZ3A 3IWZA 3RNSA 1OHFA 4XAEA 1JZ8A 4X6RB 1N1VA 5F2SA 1HQLA 4A3ZA 1HB1A 4QX3A 3LSDA 1O4ZA 3H8UA 4UXAA 1NCQC 1F31A 4AVCA 4LBNA 3O1UA 4ASMB 4PQQA 3MPBA 3Q8CA 3C7EA 4LBJA 5CFDB 2OZ6A 2ZTNA 2OX0A 3BUCA 2ILMA 1OD3A 4B4RA 2Y0IA 1R1A2 2E33A 1ZBA2 5T54A 1TG7A 3RMYA 2EXHA 2WAAA 1RMU2 2VW1A 1XSRA 4BQ5A 4IUGA 1LOGA 1HQWA 1UY3A 3H1YA 2QQPA 4AAPA 1O4TA 1NXMA 1VRH3 2EF6A 5C4WA 4QX1A 2G9ZA 3POYA 4XZPA 5SV8A 2QFEA 5EPAA 2BDRA 4Y1UA 1QJU1 2GN7A 2IXLA 3SHRA 1XNBA 4XIOA 3I2JA 1RHI1 4E9KA 3POSA 3WNMA 1IOAA 2XVLA 4Y1YA 5ABJC 2EXKA 4AEDA 4BISA 1UYPA 2BQPA 2UYBA 2PN5A 3T30A 5A3LA 1Q8QA 1PK6A 1RUG1 2A6VA 4LA2A 4AEJA 1PNGA 4NJ4A 3FBMA 2ZGNA 4M3CF 1H4GA 2R062 4WVVA 1PGL2 1C4RA 1UYYA 4LK6A 1UX6A 2R041 4LA3A 5CNAA 2K2SA 3DN7A 1WCSA 2FMDA 3O14A 5DXDA 5ANQA 2HWE3 5HV4A 3WW3A 1E5SA 2ZHKA 1ENRA 2P2KA 5FUIA 3WF3A 1ULFA 4FOQA 4Q4V2 5GKAC 2HWC3 2P6HA 3U11A 1OURA 5C70A 4XFGA 2A70A 4M0HA 2QQOA 1OA2A 2B7YA 2Q1MA 4JTOA 4ZPIA 5FPLA 4OMCA 3OJBA 3WVJA 3VBOA 2NMNA 2OPKA 1MPXA 1PIV3 3AMQA 3VKMA 3VKLA 2BOIA 3FHIB 1ND3B 1SLIA 2YBSA 1PHMA 1BK1A 1NXD1 1W8NA 3MDPA 3NNJA 3KCYA 4NWWA 3RWKX 5H9PA 4QQPA 1UQXA 2XONA 4OLLA 5EWSA 1A8DA 5FP8A 4AI3A 2WKKA 4MGYE 2BRTA 2WA4A 4Y33A 4PT6A 3CJIC 2BBVA 1K5MB 3VGIA 1YNAA 5EFUA 3VD4A 3OSDA 3THPA 1W6QA 1QHDA 4D3WA 1Z78A 2A7AA 3GCXA 3W21A 1RVF1 1UIKA 1DU3D 2DU1A 2GU9A 2HH9A 3AMMA 1FPN3 1ULCA 1RINA 1K12A 1I3HA 2SBAA 3RMXA 3W59A 3WY6A 4XJAA 2Y33A 5A3WA 4ZS2A 3ZSEA 4JGZC 2RMU3 3U1XA 5IUQA 4C0HA 5TSWA 4BCUA 2PHRA 3K2OA 4BHPA 4CUAA 2ES3A 2DCZA 4C1WA 1YRZA 1NAEA 4O65A 2OKXA 5ISLA 3MIGA 5DN2A 4I3GA 4O9EA 5JOXA 5F5QA 5FY0A 1V0AA 4YGBA 2VE1A 2VZRA 5F37A 1LOCA 3POIA 3FMGA 3S6PA 4HN0A 4CXXA 3DKQA 3LA7A 3KV6A 4IESA 1MS1A 2V4VA 5BNNC 2CYFA 3O1MA 1UL9A 1AHSA 1PM7A 4NR1A 3HAGA 3NNFA 1W6PA 1XNAA 2VJXA 3APBA 4LO8A 3WDWA 4BQYA 1TVGA 4XTMA 4K20A 4L11A 3NV3A 3MPPG 3PLQA 2R7EB 5EQUA 4YLZA 1F9KA 1K45A 2DVGA 4R9BA 3UV9A 3WNPA 1O3TA 5B4NA 4Z92B 1DG6A 4K3UA 4P9XA 2RR12 1OOPA 2ZBJA 3BPZA 3H3LA 3M3CA 2VTXA 2X29A 3VBRA 3GF6A 4LUKA 4AVTA 1LU1A 1NKGA 3I59A 1X50A 4HVRA 1U5IA 3VL8A 5LK7B 5FO8B 1L7LA 2GNTA 4X8PA 4QQHA 2VZUA 3DEMA 5I8TA 1HB2A 4Y1ZA 3KWVA 1G86A 1NCRA 5DUWA 4AGRA 2Y6KA 4I09A 3T0AA 2ATFA 2YU2A 4DOUA 1VLNA 2GDFA 2OYZA 1RUD3 2JKXA 2ZPXA 3WNOA 4IW3A 5FZ4A 1VBE1 1WD3A 4H55A 4D7SA 3CO2A 1OPMA 2DUPA 3H3ZA 5JZGB 4A2UA 4DUWA 2QQUA 2VR4A 2E6VA 1ZVFA 2LRPA 1AX0A 2PAKA 3GHMA 4QQ2A 5EZWA 2FQPA 2Y6JA 1KGYA 1NZIA 4G3YC 4D8MA 4LO6B 5CYYA 1ZBA1 1W8ZA 3AJYA 4IEWA 1ST8A 4YZ2A 1QY4A 1RGSA 2F4PA 4MSVA 4AFMA 1QH7A 1HQNA 4BU2A 3ZFFC 3ZFEA 4L0PA 3U75A 1EAH3 5DUVA 5J3UA 3RZMA 2VECA 4LTAA 5FP7A 3LGRA 1GYKA 1RUI3 3K3OA 4YYOA 4XJWA 1W6NB 3DPRB 1RUOA 3PVOA 5FO9B 4COZA 1DQ0A 5F6KA 4LR4A 4FPOB 1GQHA 2JENA 4DUXA 4JCKA 5C9AA 4QMAA 3GYDA 2VXRA 5EJ3A 1H1AA 4UYBA 4COWA 2J22A 3L2HA 4IV1C 4JHZA 1MVQA 5F5CA 4M01A 4AEMA 5C3PA 4N8MA 4XF0A 3PVBB 3P3PA 3MIBA 1W9YA 2ZA9A 3LDRA 4LE3A 4XF4A 4ZZ5A 2Z79A 3OTFA 1W6OA 2ZGUA 4QU2A 1DYOA 3QOPA 1CJDA 1RUH2 1NA1B 4BMEA 4LHSA 1B09A 3CKHA 1ND2C 1REFA 1ULOA 3AMPA 4K9SA 5I91A 4CDQB 5IK8A 3I49A 2H6CA 2J1VA 3LFMA 1C1FA 5BYNA 3ELNA 5FPVA 4PHZA 3ZVXA 2Y6GA 5FZ3A 1F5JA 1J1TA 1N3PA 4GH4B 3E6CC 1APNA 3U07A 1S0EA 1J58A 3WZ1A 1HRI3 1MQTC 3FLPA 3HT2A 4FI9A 3ZM8A 3ETPA 3NL1A 2ARCA 3I7DA 4OHWA 5FYHA 1HJFA 1ODMA 3VBUA 1I5ZA 3LDKA 3O0VA 3OG2A 2ZX4A 4FPJA 1LOFC 1KDKA 4L92A 4NWVA 1LB2A 1PMJX 3C2UA 3NJVA 4QPGC 5DAVA 4PLOA 3FL7A 4G9SB 3GBWA 3DECA 5FXVA 1R092 4NO4A 4QAWA 5L73A 1XE7A 4FXGB 5GALA 2I07B 3A0KA 2E51A 4BZ4A 2E31A 4JDOA 1RUC3 1GWMA 1KDMA 1AL23 5D8AA 4BH9A 3JXSA 3FE5A 3GM8A 3PVEA 5DZFA 1M06G 1S0IA 1DGLA 4Q8KA 4EYUA 4GJZA 1OUSA 2WC2A 3KB5A 3OCPA 1C28A 4AHZA 2VTXJ 2DCKA 4JDNA 2ZJCA 3HVDA 3D0JA 3JD73 3W58A 2JDPA 3WDUA 3AFGA 2PHWA 5D1IA 5LA1A 4LMFA 1QJY2 3AVRA 1J1LA 3AZWA 4Q4X2 1VP6A 1ZYBA 5H9QA 3KD4A 4Q27A 4CDXB 3SCHA 4I0AA 4TN7A 3OPTA 5BNOC 1TMF1 4I01A 5J7MA 1RUF3 1HDKA 2DVBA 5FWJA 2AEZA 3BIWE 1VIWB 1SCRA 2HWF1 5JVVA 3FBYA 1W2AX 3BI3A 3B93A 2B42B 1URXA 3BOPA 2FDHA 4TLGA 2XJUA 2RDRA 2XJQA 3SEEA 1I9RA 1OI6A 4AF9A 3D0SA 4TTGA 1JYCA 5A7NA 5AFEA 1OLME 2OUHA 1NZCA 3PURA 4CP9B 4QWNA 1DCSA 3DYPA 4B4PA 2YGMA 1JMUB 3FWEA 5A7OA 3TOJA 2JB8A 1YFUA 2RS32 2YXSA 1IG3A 2BGOA 1FX5A 3C7HA 3J8F2 4OHXA 1UU4A 4FO9A 5FYCA 1UZYA 3ZFGC 1ZZ8A 4NHYA 5BNPC 2Y34A 4JQRA 3PUSA 3V64A 2AENA 4UBGA 5C5UA 3WLUA 5K4LA 2LM3A 2OXBA 3HQXA 3AZVA 5FP3A 4PI2A 3RGBA 1IS4A 3RVHA 3HNMA 3RZHA 5FYIA 2IVIB 1V6IA 2D6PA 4N9HA 4XE9A 5CFDA 5FLIA 4ES9A 3OGGA 1ZBE3 1GZ9A 5LBEA 1OT5A 3VBHB 1UOGA 1BZWA 4OYUA 4NAMA 2G9GA 4UW4A 2ZCWA 1E5IA 2GN3A 4MGIE 1BBT3 4KQ7A 4XFHA 1DZTA 1IKQA 1U5YA 2ARBA 2VBPA 3ME2A 1TNRA 1H9PA 5C4WB 4HN1A 3OGVA 4IV3C 2WABA 2ZX1A 4ISRA 4YW6A 1AYM2 4AK3A 2WT0A 1YIFA 1AZDA 4GMP0 5FUPA 3CMGA 1LECA 1L7RA 4B8EA 1NCQB 3FLTA 3HR9A 3LIGA 3LZZA 5T5JA 2R071 2W94A 2YU1A 2VPVA 3PUHA 4N43C 3SC7X 2BYVE 2J1TA 3FUQA 3MF9A 2VZSA 1UOJA 4OI4A 4J6GA 1PO21 4NAOA 2ZS6B 4KU8A 3UKVA 2RS52 3KVAA 1ULDA 2GZWA 3ZR6A 1UN1A 4QX2A 3ZN6B 3VHRA 4ZKTB 4XJ9A 5CA6A 4AE2A 2P3IA 2VBBA 2HEWF 3T4VA 2PLV3 5KXDA 2BJSA 3OEAA 2C9AA 2JX9A 1PVXA 1HXS3 2DV9A 2RS12 1CQ9A 2ZX2A 3BTAA 4RD7A 4E4SA 2JDHA 3K51A 2XXZA 4HKLA 1DDLA 1A34A 1CD3G 4NE9A 3SCGA 1Q3EA 4N53B 2VNRA 4GAZA 4EN0A 3ILNA 1RUE2 1D4VB 1WCKA 4HL0A 4XABA 4YNIA 1VBC1 1VAVA 1PX4A 1Z7S3 4YGDA 1OLMA 4C90A 3S7IA 5JOWA 1H1MA 1LNSA 5JXIA 5K9YA 2FDKA 5ABJB 3LEIA 5KR7A 2DWRA 1CZSA 1WW5A 4XDQA 4QKNA 4WBBA 2IC1A 2BFUS 1RUH1 2W5FA 3K48A 1F4HA 5IW0A 4LXLA 4GQ7A 1QH6A 4E4HA 3BVCA 3RZJA 1E5HA 3IPVA 3U10A 1D2QA 1ND3A 1W8WA 3H7JA 2Y0OA 5HPOA 3KHCA 4YFWA 5LA2A 5EYXA 2VY0A 1U5XA 1KJRA 3B01A 4UI9L 2X53S 2ZGTA 2JG8C 2RVAA 3ZDVA 2VZ1A 2JE7A 5A70A 1AR63 3J7NA 4N7IA 2CL2A 1ZRDA 1DQ6A 3I2GA 4QXBA 4Y22B 1JOJA 4NHMA 1YWKA 3LDBA 4H14A 5CB7A 1ZM1A 2VTFA 3VDDC 5ACA3 1K5MA 3NKGA 4M00A 3USUB 1NG0A 2I45A 2Y6FA 5FV3A 3ZOIA 1W8FA 4FVVA 5I0UA 2V72A 5FZ6A 4KWLA 4C0BA 2IXIA 1GLHA 3VZNA 2JICA 2MHFA 2QDRA 3UKTA 1SLAA 4LHLA 5AC93 1LTEA 2VVDA 1Y9QA 2ET1A 3ZXGA 2ZABA 3AP5A 4A41A 1GP4A 5FKCA 2A1XA 2MEV2 3HBZA 2XL7A 1UF2C 5FZ7A 4M4PA 1XNCA 1W04A 4QKFA 5BUVA 1JZ7A 2PQQA 1W28A 4P9WA 3INAA 3PU8A 1HRV1 4NRPA 5A6XA 3W5MA 2R0HA 4YSFA 3CJIB 5CIRA 3ZIWA 3LWCA 3KLSA 3ZYPA 1DQ4A 4P9YA 4Q4X1 1D4M2 2WR9A 2CGNA 4OVEA 3LA3A 3B9CA 4N9IA 4KWJA 1WBFA 3R4SA 1XXNA 2ETEA 2ET7A 2QQJA 2RG4A 5SV5A 2FMYA 1VBA3 4EZHA 4JKLA 4PIZA 4HANA 4YG6A 3KT7A 5A7WB 1J3QA 1NY71 2P4EA 5CEHA 1CN1A 4JGZB 3MI8A 5FLHA 3A22A 1LESA 3OGRA 3AM2A 2A3XA 5FAXA 1OUXA 1LOBA 3SNMA 4CCNA 1AJKA 2VCMA 1QJFA 1R081 4FP2A 2VULA 5JI9A 3N9NA 3ZXKA 5GJ6A 4IEOA 4IEVA 4UFJA 3AKSA 5FYSA 3H8OA 2D44A 5CBLA 4AVVA 2DVFA 4GIQA 4XYXA 4FFGA 5BV6A 2C26A 2X10A 1FT9A 2RM23 5C3OA 2ZGLA 5BNNB 1ASJ3 5A3NA 1R64A 3ZYRA 4BQXA 2B5HA 1ULGA 4CZSA 2W3JA 2VUJA 4NVPA 4BK4A 1ACCA 4Y1XA 3WP5A 1G7YA 1US2A 4XJUA 1JU4A 1MS3A 4PDWC 3GXUA 4H3WA 5EHDA 2UURA 4MGKE 4ASLA 4Y26A 2WLPA 3PMEA 5GZEA 4E4ZA 1G9DA 3VKNA 2AGSA 4CSWA 1QJU2 3ZXAC 3MICA 2ZXQA 5IATA 1H30A 1QGLA 1RHI2 4QX8A 3LD8A 5FMBA 3ZSLA 4P9JA 4LJHA 3ES4A 3T1MA 4HOOA 1PMIA 2WWSA 1WCQA 3ALQA 3M8LA 4WM7B 1L3JA 5JSRA 1DBNA 4XAAA 5GLVA 5DUXA 5F7UA 1IZ3A 2WUHA 3AKQA 5AVPA 1ODNA 1H2MA 1LGBA 4K8RB 3ST7A 4L9BA 3WDYA 2R042 4D94A 2WBKA 3N3HA 4QPIC 4YVWC 3W5NA 1HJGA 1OLQA 3B9IA 3RQ0A 1KS5A 1RXFA 1W6NA 4MLOA 5FK8A 3O1OA 3M70A 1CAXB 1MS4A 4LKFA 3PMSA 3IN9A 4META 4XQDA 4YM3A 1BKZA 2OW4A 2VMIA 1FOD1 3ACFA 2WDBA 4D0QA 2Q8OA 3K4ZA 5FZEA 4BQ1A 1LGNA 2WFF1 4NIAA 3JBG1 4CU8A 4OI2A 4R4XA 2YFUA 1A78A 3U0ZA 2QJVA 3NNGA 3RZLA 1XBFA 4Q4Y3 3WX5A 1WA6X 1Q8PA 3AZYA 1HKDA 1WA4A 5FMOS 5GLTA 1JZ6A 3ZFFB 3VLBB 2KM2A 1D7PM 1E5RA 1NA1A 1MS0A 4DY5A 3POGA 4IEYA 2KXLA 2NPIA 2VQ0A 3TAYA 1GU3A 1RXGA 2AREA 4CDQA 4S2FA 2P3KA 5IFTA 3GGLA 5LA0A 3K46A 5LK5A 4Q5OA 4NIHA 3AL6A 1TME1 4AR2A 4KMQA 4V2VA 4FFFA 1BEV1 2IXKA 4GH4A 3ILRA 4HSLA 2J1EA 2BGCA 3ASIA 1H6XA 4IV1B 1C8NA 1Q8SA 2XR4A 4B7EA 4QB6A 4KGGA 5KHKA 1RVF2 3D6EA 3D5OA 4UWDA 1M4WA 1CONA 4CCJA 2PYTA 3KV4A 4OUEA 1PVC2 4Q2FA 5FY1A 1REDA 4YZ5A 3TEYA 1CX1A 1SFPA 4GMP1 1ND2B 4XMAA 4LNVA 5LBFA 2D6MA 4XEZA 4RHV1 2V5YA 1AR73 4NIIA 5BXXA 3FLRA 5T5PA 2D40A 4EWEA 2BPA2 3NAPB 2P37A 5DDJ3 5FPZA 2YMZA 3POFA 4JRLA 1EPWA 4Q4W3 2A73B 1W9SA 1NQJA 2XUMA 2GC1A 1LEMA 3KGZA 5F3GA 5FR3A 2VUDA 2P34A 1Y7BA 1QJEA 3OPZA 2B46X 1ULPA 1OF4A 5FJHA 3J7MA 4LBQB 4QPGB 1AR83 3ZXLA 4UW3A 1LOAA 4N90A 3H8XA 2LALA 1G9FA 4JGYC 5FY8A 1H8TC 3H0OA 1EYBA 1JHNA 2WS92 2QBXA 3KQ4B 4LO4B 2WFPA 4I3PA 2X05A 2NYYA 3WG4A 4UW5A 3P5BA 2Q0AA 2W46A 1MZEA 5IYYA 2VUAA 4URTA 3LKJA 1OMIA 4XURA 1LHNA 1FMD1 3WF4A 1IPSA 5GZGA 2TBVA 3CDZB 4F83A 4HBNA 5A3UA 1W0PA 5FPAA 1XJAA 1UZVA 3RRDA 2XBO1 4CP9A 1S0FA 5KHIA 2A75A 2DBNA 1X7NA 4XW3A 3MO4A 2K46A 3NV4A 5FZAA 4AAXA 1QQP1 4IE0A 5LASA 1FNZA 2Y60A 2WSUA 2XL9A 2CTVA 3IM0A 5A7QA 2JD9A 3LEGA 1VBB1 4GB33 1DGWA 5DAPA 3I97A 4OHVA 5M0TA 1VBE2 2H0VA 5BNOB 2QDNA 1FV3A 1VPHA 3E6DA 4Q26A 3UGFA 5FMDA 2VBDA 4E2QA 5A7PA 3RJ2X 4NPMA 3FHAA 5CZKA 5KC5A 5IVEA 2WQ8A 4Z07A 4MVTA 4CPBA 4Q8LA 1GOHA 3VBHA 4LKEA 1T6GC 1JZ2A 3B00A 3PJYA 1V6MA 3B7MA 4P02B 4XFFA 2Z69A 4AEDC 4IDZA 5KC6A 4W6WA 3I2FA 4WM8C 1UKRA 2AR6A 3TB0A 1JZ5A 3DGTA 2F4LA 2A6ZA 5FTTC 5GM0A 1UX7A 5IVYA 4AL9A 1JHJA 3SKVA 4JQTA 4ZXKA 3ZFGB 5LWBA 5BNPB 5DQ0A 5J48A 2YG0A 3T0DA 3FZ3A 4NPLA 5B2GB 4XQ4A 1VRH1 1NCQA 1EAH2 4A4AA 4FFIA 4I0BA 3RDIA 3WW2A 3M7AA 3AFKA 1X8MA 5I0DA 3P3NA 1NT0A 2Y6LA 4GWIA 4QHZA 1CZTA 4V1PA 3KF5A 3IBMA 5CVRA 4FTEA 3T2TA 3PVNA 4MXWB 5JMOA 1U12A 1RUG3 1REEA 4SBVA 4HONA 3UJQA 2VNVA 2HLEA 2X5IB 3ZN6A 4BJ0A 4HMZA 1OVSA 1YIPA 4P9IA 2PA7A 4I0WB 3FUOA 3J9SA 4CEYC 5J36A 3BTXA 2WZR3 4BDVB 4UW6A 3LA2A 2L9LA 4J1XA 1KEXA 2YBKA 4N53A 4F7ZA 2C5DA 1QJX3 5T5LA 3WNLA 2HWE1 3LIHA 4CA9A 1N3OA 3KT4A 5HV0A 5IFPA 1COV2 4FQZA 4UBHA 5JXJA 3VUOA 2W92A 2ZMNA 3T2PA 5ABJA 1CPNA 2QQIA 5H9SA 1EV12 2TUNA 3IPVB 3MW4A 2HWC1 2C24A 2MPFA 2UY8A 3QLQA 4IETA 3RZZA 4DEQA 4DEVA 5A6QA 2PQSA 3OEBA 5FYUA 4BXSV 3E97A 3LE0A 1S0CA 3WV6A 2HEYF 4ZS3A 1AXKA 2G4IA 2WO7A 3PDQA 3IZOA 2GH2A 4EV0A 1S1AA 3NNLA 1PIV1 5FJKA 3LEMA 3NVCA 4D7TA 5A33B 5GLUA 2CV6A 4Q29A 3LAGA 4ITCA 2ID4A 1CX4A 2GAUA 1H9WA 2VMGA 2XKOA 3OUIA 1NLRA 4JDMA 2ZAAA 4AI1A 3T08A 1KRIA 1PZ8A 1X82A 4Y20B 4Y22A 4OHZA 1H8VA 1W6MB 3QD6A 5KXBA 2BGPA 1H6YA 4HVOA 3QH6A 2EAKA 1NE6A 3MIEA 3USUA 4AEKA 1V70A 3D3AA 2JB4A 4IE6A 1PVC1 2JDUA 4FPCA 2GMEA 3ZYGA 2HYKA 1IGOA 2VCCA 4Y3OA 1PMHX 2JKBA 3FC0A 3K77A 3WP4A 1Y9GA 3KCCA 3C3VA 5I8SA 4G4FA 1LULA 2Z42A 1TMF2 1FPN1 3IIIA 4OHYA 1JS9A 4MX3A 4B1MA 4B29A 5CFCC 2Q4SA 4DS0A 2HWF2 2PHUA 1Q56A 1BJQA 2K9ZA 4GJYA 2IWGB 4BM8A 2JG8B 2XQRA 5FQ0B 2RMU1 4AVAA 1YLLA 2ZX3A 3WQBA 1WZXA 4AZZA 4WZFA 2VM9A 5HCBA 3UL2A 4FBFA 4YW2A 1O59A 4OUMA 3CJIA 5BPXA 2Q1ZB 1HB3A 2DUOA 1L7QA 1VJ2A 2WSVA 2XUEA 4FPKA 4JRAA 5IJRA 3VDDB 2BNMA 1W9TA 2DVAA 2QKDA 3N7JA 4LUMA 4RGAA 2D93A 4GD4A 1GNHA 3CQOA 5IVVA 1VB4A 3S7EA 5FZCA 2WS91 3AP6A 3GHNA 2JG9C 5DAWA 2Q8EA 3T09A 4AI8A 5C8CC 3EYPA 4XFCA 5E1RA 5KBFA 2J42A 3A23A 5A6YA 5A7WA 4JGZA 1GZCA 1AX2A 5EJ1B 4JAAA 3KT1A 1DYPA 2W08A 2R1DA 3SH3A 1POV3 4XFIA 1S2EA 2CGOA 3NJYA 5JIAA 4BXFA 1RUJ3 3CHXA 3SMHA 2Y8KA 3LPFA 4OMDA 2PHXA 3KHBA 1UY0A 2D5HA 1SBFA 3NKTA 5A80A 1X9TA 2PFWA 1HLCA 5BNNA 2XDVA 2XLFA 1TQ5A 5LEJA 4HETA 2JE8A 3H9AA 4GALA 2W1WA 4K1ZA 3S5AA 1W90A 2E26A 4M3CB 3TYJA 3ZFEC 5FY5A 4BIFA 4DINB 1PM4A 1JZ3A 5K0UC 3IIAA 3DXTA 2VO5A 2PHDA 5L9RA 1RUD1 1ZZ9A 2E32A 2R072 4AQ2A 4EN6B 5FP9A 3DL3A 3NSTA 1UMZA 1UMIA 4DO0A 4XUTA 1LRHA 3E5UA 1PO22 2DCYA 3BU0A 4O61A 4WM7A 2ARAA 5FO7B 2FCTA 2IXCA 4XC9A 5IT6A 5A7SA 1R1A3 1ZBA3 3IDCB 3CZUA 4INDA 1FYUA 4JZRA 1RMU3 3AKTA 4D69A 4DFSA 4MYEA 2AYHA 5E16A 5CG8A 2C4XA 5FZ1A 1SCSA 5L19A 4H2AA 4YGEA 3ACGA 1EAH1 3MF6A 1CIYA 2CAVA 1CAXA 1LENA 3X29B 3ZXJA 1RUI1 2MNGA 4E27A 3UNPA 1WLCA 2BWAA 1EY2A 1ENQA 3UESA 1VBC2 2YC0A 2QTWB 5CU1A 2CY6A 5A32B 2Y38A 5HXMA 1LEDA 4COVA 3JQWA 2NQYA 2QQNA 2XLAA 2R063 3UYJA 2XJRA 3EO6A 1JN2P 3THCA 3ZSKA 4NRMA 3M4FA 3ZFFA 1MS5A 2WZPP 1JUHA 3I2KA 3WDXA 2DTWA 1ZRRA 4YVWB 4QPIB 2A6XA 5IK4A 5JWPA 2BP6A 1LHVA 3VBSC 1COV1 3CL1A 4Q4V3 1WMXA 1GICA 4YFZA 1LHOA 5F1RA 1G9CA 5LRSA 1EV11 4MHRA 4Q0UA 3VBFC 3AK0A 1I5PA 1D0GA 1GUIA 2GMPA 4IV1A 5IAXA 3I3MA 1HW5A 1MS9A 2BFUL 2IUWA 3VHPA 3OBTA 3M3EA 2GNDA 1OH4A 3IT8A 3PIJA 4Y4YA 3WD5A 3VZOA 1QXJA 4NOTA 5FREA 1DZRA 3PU3A 3VDCA 3ZYBA 4ZXEA 4E8DA 3SISA 4LBOA 4XTPA 1ND2A 5FZLA 1HV0A 3KGLA 5FOBB 2ZEXA 4CPBD 1IS3A 3CJXA 4XOGA 4XHXA 4AQ6A 1RUC1 3I2HA 2VZQA 4XQWA 1AL21 3NAPA 3FN9A 5LBCA 1HRV2 4OUSA 5FZ9A 3VD5A 3WUCA 1R1ZA 1W8UA 2UWCA 4IGPA 4XPVA 1JYIA 4LE4A 1NYWA 3AC0A 3RI8A 1Q8VA 1VE0A 1K5JA 1C8M3 1FAYA 1LOFA 2K0GA 5EIYB 3IKWA 4XZUG 1AVBA 1UPSA 3Q8EA 4LBQA 5DG1A 3O1PA 3JD71 4QPGA 4Q0QA 2A3WA 4S2HA 5I0SA 4RYDA 4B7KA 1XC6A 2E53A 2R32A 3ZN4A 3IDBB 1NX9A 2WL1A 3WW4A 2UWAA 1NY72 3GNEA 4PIYA 4WVMA 4CCMA 5GZFA 1QDOA 1AR92 1B35B 2V09A 3AL5A 1SEFA 2VAUA 1JYNA 2Z2SB 3MV01 1R082 2R16A 3V0AB 4ZHNA 1RUF1 4QT6A 4DNYA 2ZGQA 1AYN2 2DU0A 4D6RA 1W0NA 1YHFA 3POEA 3RSJA 2QZ3A 3D82A 2ZKNA 1U0AA 4QX5A 1IQAA 3I3EA 5DZEA 3ZXDA 2GC3A 3HNBM 1UKGA 1W99A 4P9LA 5L7OC 1JYXA 2CSGA 4PIXA 1IG0A 3UT0A 3UKNA 5FDBA 5FZBA 3O1TA 2TEPA 4Y1VA
chains in the Genus database with same CATH topology
2ZX0A 1BVVA 3O7OA 1QOTA 1H8TB 2RR13 5BNOA 4DY3A 4HK9A 3TWIA 2WNEA 4F3JA 2R49A 1DFQA 4U36A 4WV8A 4OI0A 4TSVA 4Z1VA 1VBD2 2D6OX 1PGW1 3GBGA 1QWRA 2HKXA 3M2MA 4FPEA 1CJPA 4N7UA 1S0JA 2ZGRA 4YARA 1XYPA 4OULA 5FCCA 4RR3C 3ZX7A 1KXGA 2LUWA 4A7KA 2IFRA 3ZFGA 5BNPA 1F5FA 1C5HA 2OVUA 4LO5B 5F6LB 4ATFA 1FOD2 2A71A 3N4MA 3WOGA 2EVXA 2YHJA 4O9GA 2ZGSA 3NO8A 1UIJA 3WCSA 2WFF2 4CP1A 1VAMA 3JBG2 3PJQA 5JOZA 5JPNB 4CDUC 4MXWA 3SLIA 4KH9A 4IEUA 1FV2A 4XXPA 1QNWA 2X5IA 3AP7A 1O5UA 4CTEA 5K8SA 1NOVA 4AXOA 4WM8B 4ISQA 5DG2A 3VZLA 2O8QA 4SLIA 5C33A 5KXEA 4B4QA 3WG1A 4XBQA 1TME2 2PLV1 4X6QB 1BEV2 1KFUL 1QU0A 1HXS1 1V6OA 3PHMA 1WMEA 5J37A 5T5OA 4FT8A 4OZXA 4EN9B 2D6LX 5I8YA 1Q8OA 1KQRA 5FMOL 1Z7S1 3ZMNA 3VV1A 3VKOA 4PLMA 1RUH3 3Q9OA 2ZZJA 4XF9A 1O3QA 4AWDA 2LTNA 2TNFA 2GC0A 2JEMA 1DGRA 2CWMA 2D3PA 4RHV2 2HWD2 3BCWA 5A33A 4M3CE 4RS5C 3MW3A 3MYXA 3RYKA 3J26N 1N1SA 3EHKA 4CEYB 3B3QE 1PO13 1LKNA 4R52A 2ZGKA 1UCXA 4KL1A 3O0XA 4Y20A 1W6MA 3A4UA 4WVZA 1AR61 2FHRA 2D3SA 4TLFA 4XMIA 4CDWC 4EN8B 1R093 2WNVC 3VBFB 2GC2A 1SDWA 2PTMA 2HWB3 1RIRA 2R1BA 3WW1A 1TNFA 4LO7A 1XRUA 1V9U2 1N1TA 5BY5A 3E6BA 3RI9A 4H7MA 2JG8A 5FQ0A 1FMD2 3ZDSA 2VQAA 3BOWA 4GULA 4EWAA 1SFYA 4W6XA 1ZZBA 4RFT0 1PZ7A 3RJRA 1AJOA 1SLTA 2XBO2 4ZU5A 3VDDA 4YW5A 5JR7B 4AVBA 2WT1A 3WP6A 1QJY3 1QQP2 1UAIA 4Q4X3 1OQ1A 1BQPA 3ZXFA 2RHPA 1NE4A 4NHLA 1AR91 4BIOA 1VBB2 4HKWA 3EBRA 5I0RA 2UYAA 4FP3A 5J98B 4CYDA 4YW4A 4QM9A 1VBA1 2AH2A 5CFCB 1AYN1 1DIWA 1WW7A 4A3XA 1DQ5A 1QXRA 1KITA 1JBCA 1H2NA 1WGPA 2DURA 3IMNA 1V6LA 1QMJA 5JZGC 1QDCA 1HV1A 2D6NA 4AW7A 3KCXA 4RQPC 2RS33 4GKYA 3J8F3 1MZ6A 4HT1T 4F8AA 1GKBA 1OQDA 3MFCA 3WNXA 1DF0A 1GANA 4RA0A 4Q1RA 2ARXA 2JG9B 2RM21 4LLOA 5C8CB 1A8MA 1ASJ1 4IQPA 1OFNA 2WQ4A 1MVEA 4M3CA 4E2GA 2QCSB 1VRH2 3ACLA 1DZQA 3R05A 3N7KA 2XB6C 3DPRC 1VBD1 4K21A 3EXUA 4BLJA 3OYWB 4L2NA 2WJSA 4FPGA 3WQ1A 5E8AA 1F8VA 4K8FA 4JVAA 4MGZE 2VW2A 1S0DA 2VH9A 1AYM3 3TN93 5GZCA 4M0NA 3DKWA 2A6YA 1WBLA 2GMMA 3BALA 4XBLA 1ZRCA 3ATGA 5K0UB 3GBFA 3OBRA 1VB2A 2HWE2 4YW1A 5A32A 1Q43A 4LBQD 1WMFA 2RS53 4YW3A 3G6JB 4COUA 4YZ1A 2XKPA 2HWC2 2NM1A 2A5ZA 1YFXA 3ZO0B 3OD0A 1DYKA 4OI1A 4H7LA 2RS13 5KHHA 4YVWA 4GKXA 4QPIA 1PIV2 4YVSC 3KSCA 2RE9A 2R30A 3MLLA 1RUE3 3RYRA 5JOYA 1GZWB 3MGUA 1A3KA 1QOOA 1IKPA 3ZSJA 1H2KA 2VG9A 2WIIB 3PNAA 4HVQA 1V00A 2DVDA 1CAVB 5J09A 2XVKA 4CRQA 1O4YA 4MZUA 4CEWC 1UPIA 4I02A 3EQEA 3AXDA 2Z5WA 2R6QA 3ZYJB 1POV0 5HBAA 2ZHLA 3TBDA 3TRSB 5JMCA 3KS7A 1BMV1 2WNUC 2HWD1 2QUOA 3OD4A 4Y5Z0 1HX6A 3FJSA 2W39A 1FPN2 3UK9A 1NLSA 1GR3A 1MQTB 5JDBA 2RMU2 4CDXC 3VBSB 3L9JT 4EJRA 2OA2A 1LOEA 1AR71 1C57A 2B45X 1MEC3 3SXWA 4P14A 5DDJ1 3OGJA 1YFYA 3N7LA 4EN7B 2QE3A 2EXJA 4Q4W1 4GXLA 3OY8B 5FBZA 1YJKA 4WVMB 4KNCA 2VNGA 1WW6A 1WD4A 4FOWA 4XILA 1V9U1 1GV9A 1DGWX 2MEV3 1FXZA 3I2DA 1AR81 4HLTA 3H3UA 1B35A 4RL7A 4FAGA 3UJOA 4K7JA 3LCPA 4YZ4A 3H1MA 1AX1A 3MEPA 3V0AA 5KXCA 4QGMA 2E9QA 3LB9A 5E88A 3JB4C 1IS6A 1F2NA 2WINB 4XFAA 1D4M3 4K40A 4QGLA 2VOKA 1JTZX 1OLRA 5JI7A 1N3QA 1SMVA 2PHFA 3AYDA 2QVSB 3VBHC 4J1WA 2FZ1A 4AVSA 2XLGA 3WP3A 1VALA 5C4WC 1H8TA 4EROA 5T3NA 1EPZA 3GZTB 1H1IA 4GB31 1RUD2 4MH0E 4OFGA 3WXPA 1G9BA 4DPNA 4Q0PA 2JE9A 1CAUB 1X33A 4KG8A 4FPYA 1ENXA 2ZZQA 2G9FA 1PK6C 4LULA 4IXLA 1ZZ6A 3GZAA 1H0BA 3TNQA 5L7OB 4COYA 4XBNA 2YYOA 4BMBA 4FTBA 1G9AA 4AFCA 5CAZA 1ENSA 2WT2A 3O12A 1ZRFA 2BNNA 1LODA 4IEZA 1KD7A 1QJU3 1RUI2 1RHI3 3ECQA 5T55A 2H6BA 3CLPA 4HSJA 2PELA 2XJVA 3MIDA 3WDTA 3M1HA 1SLBA 4DXZA 1W0OA 1PGSA 4N53C 1X8EA 5JPMB 1TEIA 2UU8A 4IV3B 2N7GA 4BA6A 3AP9A 2R043 3VBOC 2NP0A 4R9AA 1Y43B 4WM8A 3FFZA 4RR3B 3MIFA 4EWDA 2A6WA 1KS4A 4JC1A 4BLIA 1J3PA 4R8HA 3WR0A 2ERFA 4N43B 2ZKLA 4AGGA 2JDZA 2B9UA 3SH4A 2NMOA 3VZKA 1X36A 1I1EA 2WZR1 5CG9A 3S30A 1QJX1 2D6KA 1HRI2 4CDUB 5T52A 3QCWA 2RJLA 1G8WA 1G6NA 2PAMA 3BODA 4Z2WA 1TE1B 4CP2A 1O7FA 5HXVA 5FFOC 4A7ZA 4IEPA 5AC92 1GNZA 4LEJA 4L8QA 2XVGA 2GALA 4YRDA 1RUC2 4I30A 2VMHA 4CEYA 1AL22 5IK5A 2P3JA 1LJ7A 1MACA 2ZMLA 3V0BB 5CADA 5F9TA 1RVF3 4MUVA 5BNQA 1CR7A 3SH5A 2I74A 5GLWA 5HI0A 3VBFA 1SBEA 3GZUC 1PVC3 3JD72 4RSUA 4LHKA 3OF1A 1NQDA 3AMNA 1DHKB 5E89A 2D7FA 3HN1A 4YG0A 3AYCA 2B8MA 1C8M2 3HWJA 3FX3A 4PBPA 4QQOA 5I0TA 1OOPC 4RS5B 3L2YA 4KU7A 4NN0A 1CPMA 4LBKA 1RUF2 1RB8G 4W6YA 2GH8A 1D0HA 2E7QA 4R9CA 3VBRC 3E5QA 4FPFA 3I8TA 3B69A 2W68A 2PHTA 2EA7A 4CDWB 2ZGPA 4AFBA 1V6NA 4HPKB 1RL3A 3WQ7A 2WNVB 5EYYA 1NCRC 3JUUA 5FPXA 3ZXEA 3N7MA 1N1YA 2WS93 2UY9A 1KJLA 3ILFA 4PJYA 1UD1A 2BNOA 2VOWA 5CFCA 5AFBA 1XYOA 1OKQA 1RJ7A 4LLFA 4Q1PA 1RITA 2ZGMA 2IXJA 4FXKB 3CU7A 4AI2A 1CAWA 3ZSMA 1PGW2 1POV1 2PHLA 4BWOA 1ZBE2 1RUJ1 1IPKA 4XIKA 2FBEA 1MR5A 4WM7C 3ROUA 3TNPB 1BBT2 4Z8BA 3MLJA 1WLWA 2JG9A 2VNOA 2YUEA 1VBE3 5C8CA 1WUVA 1DQ1A 1Z0HA 3WT3A 1YYNA 3KZ4C 1BCXA 2NZ9A 4GWNA 3ES1A 5C9AC 2DUQA 2P17A 1WCDJ 3PTYA 1OA4A 4RGGA 3O5SA 4C91A 5JAXA 3OYWA 1YUDA 1ZNPA 1CGPA 2IZWA 1O3RA 1XQNA 4RQPB 2YPJA 2YV8A 3DF0A 2AUYA 1I6XA 4FPLA 4PDWB 5IK7A 1R1A1 3JB8A 4GA9A 4XHBA 4Q0SA 1RMU1 1XNKA 1DQ2A 1LCLA 2PLV2 2ZHMA 5K0UA 1HXS2 4MV2A 5GLZA 3S0MA 1RUNA 3ZN5A 2CNAA 2Y26A 1O3SA 3VBUC 3B94A 1Z7S2 3N35A 2CWSA 4Y24A 1YI9A 3AXEA 1D2SA 1GQGA 2BEOA 2R061 1PGL1 1PZ9A 4K6BA 1S55A 5D8AC 5EV7A 2VGDA 1AL0G 3MFAA 2VVEA 1JH5A 2XG3A 3WUDA 5JLVA 1FI2A 3T1LA 2D98A 3H1WA 3NV1A 4AG4A 1GZWA 2ENRA 1COV3 5JIUA 1HRI1 2R0FA 1AR62 1CAVA 1C3HA 1YXWA 1EV13 4Q4V1 4YG3A 3NAPC 1DGRN 3VHOA 4IEQA 4QM8A 5ACA2 2SLIA 5FRAA 1C1LA 1PO12 3R4DB 4PBOA 3AP4A 5AC91 1JXNA 4HK8A 1ALYA 2YZ4A 3VL9A 2VW0A 3LSEA 4DRRA 2H0BA 4YVSB 1MZ5A 4FOVA 5K7PA 1MQTA 1LHWA 1SQ4A 3NWKA 5H9RA 3VBSA 2HWB2 1ZZCA 1CIWA 4AQSA 3EJKA 1QJZA 3MZHA 2O1QA 5DUUA 2OIIA 4AYUA 4CEWB 3OY8A 1BYHA 3THTA 2DYCA 3BB6A 3V56A 5LEKA 1A6CA 2W52A 4XJZA 5I93A 1C8M1 4TYSA 1TMF3 4AHXA 2WNUB 4B3NA 2BVVA 2Q30A 1MS8A 2XPJA 5T50A 1VBA2 2HWF3 4HFSA 5A3MA 3JZVA 4TWTA 4LHNA 1XYNA 1OSGA 5CFDC 3D8CA 4NPRA 2KA3A 1GBGA 3JCIA 1XU2A 4LT5A 4U2AA 1AXZA 1ZX5A 5HCFA 2OUJA 3IDEA 1SBDA 4JGYB 2IXHA 1RJ8A 2RM22 1ASJ2 3RYPA 1FATA 2QZ2A 3AZXA 1VR3A 1OQEA 4QHBA 3RS6A 1E57A 1SLCA 4BE3A 3HIFA 4JV4A 2B39A 2EAAA 2ZOEB 2RR11 2EALA 3POWA 4YM1A 2ZHNA 2A3YA 1AXYA 2JXAA 2PAEA 1ZBE1 1CAUA 4BOWA 1OA3A 2E63A 1BBT1 1Q5OA 4AQTA 1IS5A 4AFDA 5L7OA 1PNFA 4FQ4A 1C5IA 1GSLA 1Y3TA 1FNYA 3RPQA 3RG0A 2X5IC 5JSPA 4ES8A 1JW6A 2R073 4ZU7A 1OPOA 3W9AA 1RC6A 1PO23 3TN92 2HJIA 2X8KA 3NW4A 4P5HA 3DV8A 3U4XA 5GZDA 2OZJA 1UW8A 4TZDA 4AEDB 1PK6B 4IV3A 1QXPA 2JECA 1XU1A 3CF6E 2VOXA 3FFQA 2BTVC 2GSYA 4Q4Y2 2DCTA 3MIHA 5L36A 4WZCA 1IHMA 1ND3C 1UU5A 2DTYA 4RR3A 1ZREA 2XJPA 2JD4A 4L97A 4WVWA 1AUYA 1SACA 4MXVA 4XF3A 2ZAHA 4C1XA 4N43A 1WLTA 1VBC3 3AMHA 2WLQA 4LBMA 3I4IA 4KGQA 3WQ0A 3G7DA 1UZZA 1LGCA 1K5MC 4FAHA 2W0XA 3AB0A 3KMHA 4GWMA 3AX4A 4CDUA 4DZGA 1S2BA 2XGXA 4KWKA 1BMV2 3VBOB 2VOVA 5C6CA 4JTNA 3RWNA 4I2OA 2EXIA 4DRVA 2D5FA 4KG0A 2D97A 3B02A 5J96B 3SITA 2XWJB 3SCFA 4Q0VA 5C8WA 1AR72 2V73A 3H50A 3AZZA 3V0BA 1J59A 2QNKA 3R6SA 1LHUA 4AFAA 5ACA1 4ZU4A 3O0WA 1SLLA 2UWBA 1PO11 1KFXL 5DDJ2 1W39A 2DF7A 4Q4W2 1W6QB 2BUKA 4QQLA 3URFA 3J4UH 2F6BA 1R091 4QD2A 1MEC2 3ZPYA 4ORFA 1AR82 3WINE 3VZMA 4QPYA 4DQAA 4BYYA 4S2DA 2HWB1 4FTSA 4XJ8A 1HRV3 1QNYA 4RS5A 2XJTA 4ATEA 2WQZC 2HEVF 3M3OA 4FOYA 2ZACA 1S0BA 1OFSA 4PLNA 1ZA4A 1U5ZA 4CDWA 2XH6A 3HD8B 4HPKA 3V65A 2WNVA 2NN8A 3B5LB 2BWCA 3R0RA 2VU9A 2YROA 2ZGOA 1QJY1 4DMIA 3KM5A 1W2UA 1AR93 1W6PB 2XWBB 1S2KA 1O91A 1R083 4GB32 1CAWB 1AYN3 1YO8A 1OOPB 5JCTA 3N36A 1XE8A 5KHGA 3NV2A 5EXOA 4E2SA 1ZZ7A 3VBRB 2C1FA 2RJKA 3MLKA 3I59B 3ZMOA 2D3RA 3M3QA 4W65A 4CP0A 1EP0A 3NJZA 1NCRB 1WLDA 2RS31 4E4DX 3J8F1 2VVFA 4IL7A 4XXAA 3LOBA 2ZMKA 4QXKA 3WHUA 2XJSA 3BU7A 2YDEA 1XNDA 3DUIA 3VKFC 3AKRA 1VBD3 3M3IA 1H4HA 5JZGA 3QBQA 1V6KA 2YGLA 3WDVA 4RQPA 4PDWA 3ZFEB 1S0GA 1RUG2 5JSOA 4IEXA 1IPJA 4PQ9A 1NA1C 1AF9A 3LOIA 4CDQC 1FOD3 1MZFA 4XETA 1ONAA 1AYM1 3TN91 3WG3A 3R4UA 2CAUA 1UU6A 3WHTA 2WA3A 4AHYA 2BW8A 3I54A 2WFF3 4GH4C 1QF3A 5C9AB 3JBG3 2WZR2 3DPRA 4ONUA 3ZIXA 3E5XA 3QH7A 4A7YA 2XHKA 1QJX2 5AVAA 4YM2A 1YFWA 2DFCA 1GFF2 4NHKA 4QGNA 1ULEA 2E7AA 4Q4Y1 5LRRA 3JQXA 2RS51 1YI7A 1YJLA 2GNBA 4XFBA 2CGPA 4FSJA 1W6OB 1V6JA 3ENRA 2AZ5A 1TME3 2YY1A 4R4ZA 3GALA 1BEV3 2IFWA 2RS11 2D43A 1VAKA 4BPZA 3HT1A 4K1YA 1YCIA 1CVNA 2C0ZA 4R9DA 1BVP1 2Q5TA 4D7YA 1LR5A 2I2SA 1QOSA 1RUE1 2O8OA 4FPHA 1RTVA 4Z82A 3JU9A 3VBUB 1CESA 2JJ6A 3WG2A 4XF1A 2DCJA 3D4KA 2EIGA 2FZ2A 3MW2A 1DLLA 4YM0A 1H2LA 1HIXA 1JUIA 1WMDA 2DFBA 3AYAA 1WW4A 3AKPA 3KQRA 4GMP3 3VN4A 3VHNA 4RHV3 2HWD3 1SFNA 5D8AB 4YVSA 3HMYA 1J3RA 4AGVA 1B35C 4IERA 3USSA 3CNAA 4FCAA 5DZGA 5FLJA 2O0OA 1QKQA 3A0NA 3CEWA 5FOJB 4HKOA 4S2GA 3QACA 1BXHA 3AJZA 5KHJA 4CEWA 1MEC1 1LU2A 1O5LA 2WNUA 4HZFA 4L99A 4AI0A 1V9U3 4LBLA 5KWRA 2BVBA 4PCRA 4P9GA 1FMD3 3ETQA 3H7YA 2NLRA 2MEV1 4KBBA 2E7TA 3VZJA 4CDXA 4DB5A 2XBO3 4AHWA 4YGCA 5HCAA 3WCRA 3AYEA 1QQP3 3ZYIB 1N47A 1RUJ2 4PF5A 2GNMA 1D4M1 1OD5A 1VBB3 4X8NA 4JGYA 4YZ3A 3IWZA 3RNSA 1OHFA 4X6RB 1N1VA 1HQLA 3LSDA 1O4ZA 3H8UA 4UXAA 1NCQC 1F31A 4AVCA 4LBNA 4ASMB 3MPBA 5CFDB 4LBJA 2OZ6A 2ZTNA 2ILMA 4B4RA 2Y0IA 1R1A2 1ZBA2 5T54A 3RMYA 2EXHA 1RMU2 2VW1A 1LOGA 1HQWA 2QQPA 3H1YA 1O4TA 1NXMA 1VRH3 2EF6A 5C4WA 3POYA 4XZPA 5SV8A 2QFEA 4Y1UA 1QJU1 2GN7A 2IXLA 3SHRA 1XNBA 4XIOA 4E9KA 1RHI1 3POSA 1IOAA 2XVLA 4Y1YA 5ABJC 2EXKA 4AEDA 2BQPA 2UYBA 2PN5A 5A3LA 1Q8QA 1PK6A 1RUG1 2A6VA 4LA2A 4AEJA 1PNGA 3FBMA 2ZGNA 4M3CF 1H4GA 2R062 4WVVA 1PGL2 1C4RA 1UX6A 2R041 4LA3A 5CNAA 2K2SA 3DN7A 1WCSA 2FMDA 3O14A 5DXDA 2HWE3 3WW3A 2ZHKA 1ENRA 2P2KA 1ULFA 4FOQA 4Q4V2 5GKAC 2HWC3 3U11A 4XFGA 2A70A 4M0HA 1OA2A 2B7YA 2Q1MA 4JTOA 3OJBA 3WVJA 3VBOA 2NMNA 2OPKA 1PIV3 3AMQA 3VKMA 3VKLA 3FHIB 1ND3B 1SLIA 1PHMA 1BK1A 1NXD1 3MDPA 4NWWA 3KCYA 5H9PA 4QQPA 4OLLA 5EWSA 1A8DA 4AI3A 2WKKA 4MGYE 2WA4A 3CJIC 2BBVA 1K5MB 3VGIA 1YNAA 5EFUA 3THPA 1W6QA 1QHDA 4D3WA 1Z78A 2A7AA 1RVF1 1UIKA 1DU3D 2DU1A 2GU9A 3AMMA 1FPN3 1ULCA 1RINA 1I3HA 2SBAA 3RMXA 3W59A 3WY6A 4XJAA 3ZSEA 4JGZC 2RMU3 4C0HA 5IUQA 5TSWA 4BCUA 2PHRA 4BHPA 2ES3A 2DCZA 4C1WA 1YRZA 3MIGA 4I3GA 4O9EA 5JOXA 5F5QA 4YGBA 1LOCA 3FMGA 3S6PA 4HN0A 3LA7A 4IESA 1MS1A 5BNNC 2CYFA 1UL9A 1AHSA 1PM7A 4NR1A 3HAGA 1W6PA 3APBA 3WDWA 4LO8A 4XTMA 4K20A 4L11A 3NV3A 3MPPG 3PLQA 4YLZA 1F9KA 2DVGA 4R9BA 3UV9A 1O3TA 4Z92B 1DG6A 4K3UA 4P9XA 2RR12 1OOPA 2ZBJA 3BPZA 3M3CA 2X29A 3VBRA 3GF6A 4LUKA 4AVTA 1LU1A 3I59A 1X50A 4HVRA 1U5IA 3VL8A 5LK7B 5FO8B 2GNTA 4X8PA 4QQHA 5I8TA 4Y1ZA 1G86A 1NCRA 5DUWA 4AGRA 4I09A 2ATFA 4DOUA 1VLNA 2GDFA 2OYZA 1RUD3 2ZPXA 1VBE1 1WD3A 4H55A 4D7SA 3CO2A 1OPMA 2DUPA 3H3ZA 5JZGB 4A2UA 3GHMA 2E6VA 1ZVFA 2PAKA 1AX0A 4QQ2A 5EZWA 2FQPA 4G3YC 4LO6B 1ZBA1 3AJYA 4IEWA 4YZ2A 1QY4A 1RGSA 2F4PA 4MSVA 4AFMA 1QH7A 1HQNA 3ZFFC 3ZFEA 1EAH3 5DUVA 5J3UA 2VECA 4LTAA 3LGRA 1GYKA 1RUI3 4YYOA 4XJWA 1W6NB 3DPRB 1RUOA 3PVOA 5FO9B 4COZA 1DQ0A 5F6KA 4LR4A 4FPOB 1GQHA 2JENA 4JCKA 5C9AA 4QMAA 3GYDA 2VXRA 5EJ3A 1H1AA 4COWA 3L2HA 4IV1C 1MVQA 4M01A 4AEMA 4XF0A 3PVBB 3P3PA 3MIBA 2ZA9A 4LE3A 4XF4A 2Z79A 3OTFA 1W6OA 2ZGUA 4QU2A 3QOPA 1CJDA 1RUH2 1NA1B 4BMEA 5I91A 1B09A 5IK8A 1ND2C 1REFA 3AMPA 4K9SA 4CDQB 2H6CA 5BYNA 1C1FA 3ELNA 3ZVXA 1F5JA 1J1TA 1N3PA 4GH4B 3E6CC 1APNA 3U07A 1S0EA 1J58A 3WZ1A 1HRI3 1MQTC 3FLPA 3HT2A 3NL1A 3I7DA 4OHWA 3VBUA 1I5ZA 3O0VA 4FPJA 2ZX4A 1LOFC 1KDKA 4L92A 4NWVA 1LB2A 3C2UA 4QPGC 4PLOA 4G9SB 3GBWA 5L73A 5AC93 1R092 4NO4A 1XE7A 4FXGB 5GALA 2I07B 3A0KA 2E51A 4BZ4A 4JDOA 1RUC3 1KDMA 1AL23 5D8AA 4BH9A 3FE5A 3PVEA 5DZFA 1M06G 1S0IA 1DGLA 4Q8KA 3KB5A 2WC2A 3OCPA 1C28A 4AHZA 2DCKA 4JDNA 2ZJCA 3D0JA 3JD73 3W58A 3WDUA 3AFGA 2PHWA 5D1IA 1QJY2 1J1LA 3AZWA 4Q4X2 1VP6A 1ZYBA 5H9QA 3KD4A 4Q27A 4CDXB 3SCHA 4I0AA 5BNOC 1TMF1 4I01A 5J7MA 1RUF3 1HDKA 2DVBA 3BIWE 1VIWB 1SCRA 2HWF1 5JVVA 3FBYA 3B93A 2B42B 1URXA 3BOPA 2XJUA 2XJQA 1I9RA 1OI6A 4AF9A 3D0SA 1JYCA 5AFEA 2OUHA 1NZCA 4B4PA 2YGMA 3FWEA 3TOJA 1YFUA 2RS32 2YXSA 1FX5A 3J8F2 4OHXA 1UU4A 4FO9A 1UZYA 3ZFGC 1ZZ8A 5BNPC 4JQRA 3V64A 2AENA 4UBGA 3WLUA 2LM3A 3HQXA 3AZVA 1IS4A 4ES9A 1V6IA 2D6PA 4N9HA 4XE9A 5CFDA 5FLIA 3OGGA 1ZBE3 1GZ9A 3VBHB 1BZWA 2G9GA 4UW4A 2ZCWA 2GN3A 4MGIE 1BBT3 4KQ7A 4XFHA 1DZTA 1IKQA 1U5YA 2ARBA 3ME2A 1TNRA 1H9PA 5C4WB 4HN1A 4IV3C 2ZX1A 4ISRA 1AYM2 4AK3A 2WT0A 1YIFA 1AZDA 4GMP0 4B8EA 5K9YA 1LECA 1NCQB 3FLTA 3HR9A 3LZZA 5T5JA 2R071 2VPVA 4N43C 2BYVE 3FUQA 3MF9A 4OI4A 4J6GA 1PO21 2ZS6B 4KU8A 3UKVA 2RS52 1ULDA 2GZWA 1UN1A 3ZN6B 3VHRA 4ZKTB 4XJ9A 5CA6A 4AE2A 2P3IA 2HEWF 2PLV3 5KXDA 2C9AA 2JX9A 1PVXA 1HXS3 2DV9A 2RS12 1CQ9A 2ZX2A 3BTAA 4RD7A 4E4SA 3K51A 4HKLA 1DDLA 1CD3G 3SCGA 1Q3EA 4N53B 2VNRA 4EN0A 3ILNA 1RUE2 1D4VB 1WCKA 4HL0A 4YNIA 1VBC1 1VAVA 1Z7S3 4YGDA 4C90A 5JOWA 3S7IA 1H1MA 5ABJB 2DWRA 1WW5A 4XDQA 4WBBA 2IC1A 2BFUS 1RUH1 3K48A 4GQ7A 1QH6A 3IPVA 3U10A 1D2QA 1ND3A 3H7JA 2Y0OA 4YFWA 5EYXA 2VY0A 1U5XA 1KJRA 3B01A 2X53S 2ZGTA 2JG8C 2JE7A 1AR63 4N7IA 2CL2A 1ZRDA 1DQ6A 4Y22B 1JOJA 4NHMA 1YWKA 4H14A 5CB7A 1ZM1A 3VDDC 5ACA3 1K5MA 3NKGA 4M00A 3USUB 1NG0A 2I45A 4FVVA 5I0UA 4KWLA 4C0BA 2IXIA 1GLHA 3VZNA 2JICA 2MHFA 2QDRA 3UKTA 1SLAA 4LHLA 1LTEA 2VVDA 1Y9QA 2ET1A 3ZXGA 2ZABA 3AP5A 2MEV2 3HBZA 2XL7A 1UF2C 1XNCA 5BUVA 2PQQA 4P9WA 3INAA 1HRV1 2R0HA 4YSFA 3CJIB 5CIRA 3ZIWA 3LWCA 3KLSA 3ZYPA 1DQ4A 4P9YA 4Q4X1 1D4M2 2CGNA 4OVEA 3LA3A 3B9CA 4N9IA 4KWJA 1WBFA 3R4SA 1XXNA 2ETEA 2ET7A 5SV5A 2FMYA 1VBA3 4PIZA 4HANA 4YG6A 3KT7A 1J3QA 1NY71 1CN1A 4JGZB 3MI8A 5FLHA 1LESA 3AM2A 2A3XA 5FAXA 1LOBA 3SNMA 5JI9A 1AJKA 4FP2A 1R081 2VULA 3ZXKA 5GJ6A 4IEOA 4IEVA 3AKSA 2D44A 5CBLA 4AVVA 2DVFA 4GIQA 4XYXA 5BV6A 1FT9A 2RM23 2ZGLA 5BNNB 1ASJ3 3ZYRA 2B5HA 1ULGA 4CZSA 2VUJA 4NVPA 4Y1XA 3WP5A 1G7YA 4XJUA 1MS3A 4PDWC 4H3WA 2UURA 4MGKE 4ASLA 4Y26A 2WLPA 3PMEA 5GZEA 4E4ZA 1G9DA 3VKNA 2AGSA 1QJU2 3ZXAC 3MICA 1H30A 1QGLA 1RHI2 3ZSLA 4P9JA 3ES4A 3T1MA 1PMIA 2WWSA 4WM7B 3ALQA 3M8LA 1L3JA 5JSRA 1DBNA 5GLVA 5DUXA 1IZ3A 3AKQA 5AVPA 3ST7A 1H2MA 1LGBA 3WDYA 4D94A 4L9BA 2R042 3N3HA 4YVWC 4QPIC 1OLQA 3B9IA 3RQ0A 1KS5A 1W6NA 4MLOA 3M70A