4LUMA

The crystal structure of the p132v mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
190
structure length
190
Chain Sequence
b'MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPVYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 42
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lumA00
3E5QA 4IEOA 4Z82A 3RPQA 5J3UA 5FPZA 3LZZA 1JUHA 4AVCA 2IXCA 2Q1ZB 1SQ4A 3L2HA 4AXOA 2XL7A 2CAUA 3ZDSA 4IEUA 2Q4SA 4JTOA 1CAVA 3E97A 3GYDA 4Q0VA 3H50A 1EYBA 1WGPA 1Y9QA 4AVAA 1WLTA 2QDRA 2Z69A 1UW8A 1UIKA 2ET1A 4UBGA 1PM7A 1QWRA 4BH9A 4D7SA 3FE5A 1O4TA 3BU7A 3SCFA 3IBMA 3N4MA 4RD7A 1O3TA 1ZNPA 1ZRFA 1YFYA 3NSTA 4YRDA 5BXXA 3SXWA 4LA2A 4IEWA 5CVRA 3CL1A 2IXLA 4WZCA 4XF4A 2UYAA 3NJZA 4N9HA 4CYDA 4HBNA 1CAXA 4I0AA 4IEQA 4HSJA 4LA3A 2XGXA 2K9ZA 2PAEA 1CX4A 4EWDA 4XEZA 4MUVA 3H1MA 5I8SA 5I8YA 1I5ZA 2CV6A 1J3QA 1RUNA 1DGRA 1OD5A 2FMYA 2IC1A 1ZVFA 3SCGA 3BALA 2GU9A 2CAVA 4MH0E 4MGIE 3LA7A 2BNOA 3OCPA 2XLFA 2IXIA 1J58A 4LLOA 2Q0AA 4WBBA 2GC2A 1SFNA 5T3NA 3E5XA 4AVBA 2BGCA 4I09A 1Q43A 1QY4A 1YFWA 3H1WA 2ET7A 4KWKA 4NVPA 2UY8A 3KGLA 5LEKA 1DZTA 1IPJA 4R52A 3BB6A 1ZZ8A 4BYYA 1LRHA 3EHKA 3OGJA 4IEZA 2OZJA 3LAGA 1ZRRA 4XFAA 4IEVA 2GC1A 5BUVA 4QX5A 3KMHA 1FT9A 3UKTA 4ZU4A 2F4PA 3H1YA 4OLLA 4XFFA 3NVCA 5KHGA 5KHJA 3CLPA 3QACA 3WW3A 3UKNA 1J1LA 1X8EA 3FX3A 3BCWA 4BIFA 3DKWA 4PJYA 4LUMA 3RDIA 3DV8A 4XFBA 5J7MA 4XF1A 4LTAA 5JAXA 2UYBA 4XF9A 3HIFA 2CGPA 1DGWA 3NL1A 1NZCA 1RL3A 3U10A 2GH2A 2D40A 2IXJA 3CJXA 4I02A 4YSFA 1RC6A 3M3IA 4XFGA 1UIJA 4PIXA 2QNKA 3USSA 4EWEA 2H6CA 2XKPA 2VQAA 4P9GA 1CAUB 4J1XA 4ZU5A 3ES4A 4HVRA 3O14A 2O1QA 3H7YA 4MV2A 2DCTA 3S0MA 1X7NA 2P17A 1OFNA 1H1MA 3D0SA 2OPKA 3ROUA 3PVBB 1DZRA 2XKOA 4MZUA 1VP6A 2HKXA 3I59B 4MX3A 4ZU7A 2MPFA 1LR5A 2BNNA 5LRSA 5BY5A 1X82A 1YHFA 4XF3A 3RYPA 4IETA 4JVAA 5AVPA 4Q0QA 5JCTA 4A2UA 4EROA 4WVZA 4KU7A 2EAAA 4O9GA 5I0UA 4EWAA 4L2NA 3H7JA 1RTVA 1YWKA 4K8FA 1G6NA 3EQEA 3M70A 1I6XA 2QCSB 3ACLA 5FLJA 4QM9A 3ES1A 4F7ZA 3IDCB 5JSRA 1PMIA 3CEWA 2B9UA 5FQ0A 2GAUA 1LKNA 3WW1A 1ZZ9A 1CAWA 1IPKA 2H6BA 4QGMA 3RYKA 1ZRCA 2ETEA 3GBFA 3PNAA 5FPXA 2ZCWA 3E6DA 1RGSA 3EBRA 3B02A 4IESA 4Q0PA 4YARA 4LEJA 1GQHA 4IEXA 1NYWA 1ZZBA 3RYRA 3CF6E 2IXHA 5BPXA 4HVOA 5K8SA 4FT8A 4LULA 1H1IA 3EO6A 1EP0A 2OZ6A 4KWJA 1V70A 4AQ2A 4LUKA 1CAVB 4HN0A 5KHIA 5I8TA 3H8UA 2Y0OA 1RUOA 4FAGA 4YNIA 3SCHA 1O7FA 3WW2A 1ZZ6A 1NXMA 3SMHA 1ZRDA 4QGNA 1OI6A 5C8WA 3KGZA 4X6QB 1FI2A 3R6SA 1O5UA 2OYZA 1YLLA 3S7EA 4JTNA 4Q0UA 1QXRA 3LWCA 1ZX5A 4FAHA 4PIYA 2ZKLA 3OTFA 4Q0SA 4MGYE 3E6CC 3H9AA 1VJ2A 3MPBA 3JZVA 4ORFA 1CAXB 3U11A 1CGPA 2B8MA 5KHKA 1J3RA 3ELNA 4QM8A 1WA4A 2PHDA 4I3PA 4QXKA 4J1WA 3HT1A 4IEPA 5F1RA 2PA7A 4UBHA 2PQQA 5FCCA 4B29A 3EJKA 4HN1A 2QVSB 4JV4A 4UXAA 5BV6A 1YFUA 4R8HA 2Q30A 4H7LA 3D0JA 5CADA 3FJSA 3D82A 1O5LA 2E9QA 2PTMA 4E2QA 4QGLA 1EY2A 2WC2A 3HQXA 4I0BA 3TNPB 4AQ6A 3FFQA 3LA2A 1TQ5A 2BYVE 2PHLA 5LEJA 2QJVA 3I7DA 3IIAA 4L11A 1QXJA 3MYXA 5KBFA 3I54A 4GULA 1Y3TA 2WFPA 1J59A 1XE7A 4IEYA 4QMAA 3DL3A 3ETQA 2K0GA 2BNMA 2O8QA 4FBFA 4E2GA 2IXKA 1O3QA 1U12A 1J3PA 2EA7A 2C0ZA 4BHPA 5E1RA 2N7GA 3TNQA 5JSOA 4I2OA 1Q3EA 2D5FA 2XLGA 3KCCA 1O3SA 3H3UA 1YUDA 2GC0A 2XHKA 4D7TA 3VHRA 1VR3A 3LA3A 4IERA 3PLQA 5I93A 5FDBA 3IWZA 3UKVA 5J48A 4KWLA 4EV0A 3NKTA 3LOIA 4HZFA 2VECA 4I01A 5EFUA 1XE8A 1SEFA 2EVXA 1O3RA 5I0SA 4OFGA 1UD1A 1X8MA 1ZZCA 2HJIA 3RNSA 2V09A 3CO2A 3NW4A 1EPZA 3OF1A 3HT2A 4XETA 4YYOA 4Z07A 4DINB 4Q29A 3MDPA 2D93A 1LB2A 3S7IA 2GZWA 2UY9A 1GQGA 4META 1OMIA 5E16A 1CAUA 1ZREA 3BPZA 1YFXA 3G7DA 4XFHA 3H3ZA 5I91A 4XFIA 5KHHA 4PIZA 3C3VA 2GC3A 4XFCA 3DN7A 4XF0A 2FQPA 3MZHA 1UCXA 1XRUA 2OA2A 4HLTA 3I59A 5CU1A 4F8AA 3U0ZA 4HSLA 4ONUA 3QOPA 1Q5OA 5D1IA 2PAKA 1FXZA 5HI0A 3RZZA 5JR7B 3FHIB 2PAMA 1ZZ7A 5FLHA 3E5UA 4TLFA 3WW4A 4N9IA 2XLAA 2PFWA 3FWEA 2H0VA 2XL9A 3FZ3A 2MNGA 4MGKE 3ST7A 2I45A 5I0TA 2Z2SB 4HVQA 1UPIA 4KU8A 3IDBB 2VPVA 1NE6A 5EZWA 5JSPA 4HMZA 5FQ0B 4X6RB 2PYTA 2ATFA 1CAWB 2D5HA 4E2SA 1NE4A 4MGZE 2B5HA 4KL1A 5LRRA 2MHFA 1L3JA 3SHRA 2KXLA 1HW5A 4O9EA 5FLIA 5C6CA 3E6BA 3OD0A 5I0RA 3KSCA 2BEOA
chains in the Genus database with same CATH superfamily
2X53S 3I2JA 1JODA 4LORA 1V9U2 4WM8B 3E5QA 5FYBA 1A78A 4P9XA 5FPZA 1KDKA 2RMU1 4LBMA 1YIPA 1D4M3 3N3HA 2C1FA 1K12A 2X10A 4CSWA 2XL7A 1WMDA 1UU6A 4UWDA 4GMP3 3MW4A 5J96B 2CAUA 2RJ2A 1OH3A 3ZDSA 1XQNA 5CKQA 3TEZA 2FCVA 4Q0VA 3GYDA 3MBWA 1SACA 1RUF2 4Y5Z0 5D2AA 3R05A 3T1MA 1RIRA 3ZR6A 1EYBA 3LPFA 3POFA 1O4ZA 2JX9A 1IKPA 2VOKA 3AYEA 3J26N 5FUPA 3WHTA 1UW8A 1ZBE2 4FOWA 5BNOC 1W2TA 4BH9A 5T54A 1LOGA 2JDPA 2LS6A 4L92A 3TRSB 2ARAA 4YVSC 3WNXA 1REEA 4RD7A 5JXGA 1O3TA 2RS33 4ITCA 3ZN6B 2NPIA 3PVNA 4AYUA 1OA4A 2D6PA 1YFYA 5IYYA 5IJRA 3ZXEA 5E88A 2ZS6B 5BXXA 5GZEA 1IQDC 4YPJA 2B9VA 4LA2A 4IEWA 2OS2A 5A33A 3CL1A 1HB1A 4H14A 4NIAA 3AMHA 3NJZA 4GA9A 4SBVA 3P3PA 5D21A 3ZSLA 2XJVA 3LB9A 4CP0A 5DG2A 2ZGSA 2VULA 2A70A 1CAXA 4IEQA 4HSJA 4LA3A 2XGXA 4YW4A 3C8XA 3ZFGB 4EWDA 1GNZA 2D98A 3AKRA 4ZONA 5I8YA 3NWKA 4CXYA 4JX0A 4IL7A 2CV6A 2OXBA 4QU1A 2G1MA 1H30A 1UYXA 2ES3A 2JIJA 1DGRA 1OD5A 1OOPC 3JD73 4JKKA 3NRUA 1VBB2 1ZVFA 3LIHA 2XJTA 2ZX0A 3SCGA 3ZXKA 1DHKB 2GU9A 3W21A 3RWNA 2ZHKA 2RS31 4NWVA 1POV1 4DUXA 2VTFA 2ZABA 1RMU3 2ZJCA 3MIBA 4CP1A 4CU9A 5GLWA 1CX1A 2WYSA 4WVMA 5FP8A 1G9CA 1RUC1 4QPYA 5J36A 3LSDA 2OKXA 1J58A 2Q0AA 3JXSA 5F2WA 4J6GA 3KM5A 4MGSA 1SFNA 1NOVA 3D6EA 1U5XA 4V2VA 4LMFA 2YB7A 2R043 5SV5A 4AVBA 4XURA 2WL1A 1ENXA 3AP5A 1NXD1 5CFDA 5BNPC 3ZN4A 1R081 2ET7A 4KWKA 1K5JA 1APNA 1W90A 3KGLA 1MZEA 2VMGA 3B9CA 4R52A 2WNVB 3JQWA 3DYMA 1FOD2 1AYN3 1W39A 4QX0A 1ZZ8A 3W20A 2EIEA 3WG1A 1LRHA 4IEZA 1GZCA 4AEJA 3LAGA 4BZ4A 1W8UA 2YBSA 5IFTA 2B7YA 4XFAA 5CZKA 4RQPB 4COZA 1M4WA 1V6KA 4K6BA 4QX5A 1IS4A 3ZFEA 3KB5A 3KMHA 1FPN3 1KS4A 1NY72 3M3EA 1RMU1 4NHMA 3C7EA 3VKOA 4XQWA 1ULOA 1R093 4QPIB 5T5LA 5KHGA 2Y33A 3KT7A 3CLPA 5KHJA 2OQ7A 5DAWA 4FCAA 4L97A 3UKNA 2WT1A 2P3YA 1W9WA 2YV8A 1FV3A 5GZGA 1IS3A 1C4RA 4BIFA 1LCLA 3I49A 4PJYA 2BW8A 4Q4X2 4CXWA 3U4XA 1YQCA 3I3QA 3I4IA 2ZGUA 1GSLA 3DKQA 5J7MA 4QDSA 2RDSA 2D6NA 4XIOA 3VBRB 5FYTA 3THCA 3T2PA 1L7RA 5EQUA 4M4RA 4AVSA 2X5IC 1NLSA 1WBLA 4DNYA 3JUUA 5FZAA 1VBA3 5K4LA 3JQXA 2B42B 3CZJA 4I02A 3O1UA 2ZGMA 4P5HA 4I30A 4MHUA 3M3IA 4D3WA 2D43A 2ZPXA 2L9LA 2WZPP 2ZMNA 1ND2A 5FY9A 2XKPA 4YW2A 3O14A 5IK5A 2GALA 2QQLA 1JYTA 1R091 2RVAA 3IPVA 1VBC1 3SNMA 4B7KA 1JI6A 3ACGA 1AX2A 4MADA 3VDDB 4A3ZA 4CPBD 1H1MA 1K3IA 3WEZA 1BKZA 1GWMA 5H9RA 4AGVA 4XIKA 3RSJA 1AR82 2GSYA 3UGGA 4A3XA 2ZMLA 5IAVA 4CU8A 5KXCA 5GLUA 5FUIA 1WLCA 2ZTNA 5C4WB 5F6KA 2Y6LA 4NAOA 1JHJA 2JDYA 3RWKX 3WF2A 2W47A 2BNNA 2FZ1A 5I0DA 4IV3A 1B35B 5E6HA 3N7MA 4LHSA 1UQXA 2VUJA 1VBA1 1H9WA 5JCTA 2AENA 1MVEA 3URFA 4Y4RA 4X8NA 3MIFA 2R0HA 2VU9A 4CEWB 4EROA 1DQ1A 1DGWX 4YW7A 2ZEWA 2OT7A 5LA9A 1DZQA 2BGOA 5D8AB 1H4GA 2GMMA 3NJVA 5T5OA 3M1HA 3O0WA 4QDQA 2ZAHA 1PIV1 2VY0A 4Y22B 2WIIB 4IE0A 1GZ9A 3D4KA 4OI4A 5LK5A 4ISQA 2QQWA 4PDWC 2DFCA 4IGQA 4NHXA 4AL9A 2PHTA 1VBE3 1I6XA 5F6LB 1HJGA 5FLJA 5FY1A 1KD7A 5T55A 3GBGA 4DO0A 5EHDA 1YRZA 5LASA 3T3YA 2W39A 4EYUA 1CZVA 5JSRA 3CEWA 2G4IA 4LKDA 2VZRA 3AZZA 1XNCA 2WSVA 4CCDA 2UWCA 2WNUB 1LGNA 1DDLA 1XB9A 5GZDA 3WCSA 1RYYA 2H6BA 3KVAA 1TVGA 3N9MA 4MO3M 3I2KA 2RDNA 4RHV3 2D3SA 4V2WA 1UMIA 5FFOC 1V9U3 1RGSA 5A7NA 3EBRA 5M0TA 4YARA 2BU9A 1JU3A 3UGFA 3HEIA 3D3AA 4BPZA 1W6OA 4W4ZA 1BMV1 2WA4A 2PHWA 1AXKA 1RUG1 2IXHA 4JQTA 4Q4W1 5DUXA 1PO23 4NE9A 5FV3A 3NNGA 1LULA 2ZGOA 1RUF3 2OZ6A 2JDAA 3DECA 3HR9A 5FZGA 4HANA 1COV2 1VBE1 2HWB1 2XONA 2Y60A 5F39A 4HN0A 3R4DB 3ZSMA 1HRI2 1WCDJ 1RUH1 1ZBE3 3K46A 5FZOB 3LD8A 4R9AA 1AR72 3PDQA 5DPNA 4Z8BA 1S0EA 2PELA 4MHRA 4BISA 1CVNA 4WM7B 5BNNA 1BBT2 4N53B 4UFLA 3ZPYA 4A6SA 1ZZ6A 1W8FA 1ZRDA 4QGNA 1ENSA 1QQP3 2AR6A 2QQMA 2WN3A 4RHV1 5DABA 3RRDA 4BXFA 1OOPB 5C8WA 3Q8FA 3U37A 1XXNA 1FI2A 3MFAA 4KI5M 3R6SA 1UZ0A 4LBNA 3SLIA 5FY5A 1YLLA 4CCMA 5ACA2 4CXXA 3ZYJB 5FP7A 3LWCA 2DCJA 1W8TA 2WUHA 3NV4A 1IKQA 4BQ1A 4FAHA 1PK6B 2VW1A 4PIYA 2WO1A 5DDJ2 1XNBA 2BTVC 1VMHA 3OEBA 1VJ2A 1WCQA 3A0KA 3MPBA 3KQRA 5L7OB 4SLIA 2VZOA 4NN0A 4RN5A 4JGZB 5FO9B 3ELNA 1ZBE1 4AI2A 2XH6A 2VMIA 1VBB3 2PHDA 4XJZA 1US2A 2X8KA 3VD3A 1OURA 4QQOA 1E5HA 5KXBA 4AWDA 2IVJA 1PMJX 2W1UA 1H2MA 1YJKA 1Z7S2 2PQQA 2VW2A 2ZGNA 3MLKA 5FCCA 4HN1A 4LOSA 3WNPA 1F35A 3WNLA 4UXAA 1GZTA 5L9VA 4PT6A 4D7YA 2F6BA 4ZS3A 3ZO0B 3RZLA 2Q1MA 1CZSA 2E9QA 3ZSJA 4AF9A 1EY2A 4AFCA 3HQXA 5IT6A 5IATA 1UY3A 1W8OA 5A3OA 3AMNA 2BYVE 2DVAA 2OIIA 4QB2A 4CEYB 1WCKA 3I7DA 5AFBA 3IDAA 4L11A 2G19A 4Y4YA 4JAAA 2JG8A 4Q8KA 1R64A 1I3HA 3M8LA 3MYXA 5JI7A 1KJRA 3SKVA 5AC92 5CKNA 4YVWA 4GULA 2VCCA 3RJ2X 2V73A 2WABA 3JB8A 3N9QA 5A7OA 3W5MA 1LEMA 1XE7A 3ORJA 4URTA 1J59A 2FBEA 4QWNA 1UOJA 3BGAA 5A80A 3B5LB 1VB2A 1DFQA 2WZEA 4BU2A 3T2TA 4E2GA 2VXRA 2X09A 2W2IA 3OUIA 3GDBA 1J3PA 2W68A 1DQ6A 2C9KA 2VW0A 1DCSA 1R1A1 3MO4A 5LB6A 3VKFC 2P37A 3TEYA 2VNGA 3OGRA 4R9DA 1S0GA 1Y7BA 2V4VA 3NQHA 4N8MA 3J4UH 3ZYGA 3ECQA 4GKYA 4YG3A 4CDXB 4AE2A 5A6YA 4Q4X3 4AHYA 2XDVA 3PIJA 1CIYA 4CP2A 4D7TA 5FZEA 4DB5A 1NCRA 5K9YA 2Y6JA 3BVCA 4RGKA 3PLQA 4LBQB 5I93A 3W9AA 3IWZA 1JZ2A 1UYZA 4HG6B 5C3RA 3MIDA 1AXZA 1VALA 4MXVA 2VR4A 2E63A 2YPDA 4HPKA 4KWLA 3QCWA 4LHNA 1FOD1 1TNRA 4OHVA 2O8OA 2VECA 3NAPB 2ADDA 4NHYA 4CUGA 4N7UA 5A1LA 5L36A 4RR3B 2EIDA 3MEPA 2ZHLA 4H2AA 4XILA 1YQ5A 4MXWA 2EXHA 4BWOA 1VAMA 2ORXA 3VBSB 5I0SA 1UD1A 5JOZA 1WW7A 4TSVA 2IWGB 2OW4A 4NMIA 1BZWA 2I2SA 2V09A 3CO2A 4MGTA 1UX6A 2WFF2 1C3HA 5A6XA 3OF1A 3OY8B 2PHRA 3K4DA 4OI0A 3UNPA 4S2FA 2V72A 3WCRA 1S0FA 2Z4FA 1C5HA 5JVVA 1ACCA 3U4SA 2R6QA 1HB2A 3MDPA 4TLGA 4CP9B 1W6MB 1LB2A 1W6PB 3LFIA 1NZIA 5EJZB 3BI3A 2KM2A 5IVBA 1OFSA 4IUGA 3VL9A 1AR83 4NHLA 3INAA 5EIYB 4ZHNA 3RI9A 1CAUA 1OXCA 2WO3A 1PNFA 2LRPA 4QB6A 3OPZA 3P1IA 5EYXA 3G7DA 3C7GA 5F2SA 4Z2WA 3AB0A 3H3ZA 1WW4A 4DY3A 5KHHA 4PIZA 4UOJA 3VBFA 2D6OX 4CDQB 1OD3A 3NV3A 4BQXA 3DN7A 3GJAA 4XF0A 3MZHA 1UCXA 4UYBA 2WAAA 4E4SA 2YBKA 3AP6A 4FPGA 2FD8A 5A3UA 1VLNA 3U0ZA 3VKLA 2O0OA 4R9CA 4JRAA 1G7YA 3NJXA 4LNVA 3RZZA 3POEA 1QJY3 2PAMA 2PQSA 4LXLA 4QAWA 1CJPA 2IFRA 4N9IA 2Y8KA 3THTA 5JPMB 2PFWA 1H2NA 1UY4A 1XOYA 1QXPA 2VOVA 4L0PA 1UL9A 2MNGA 3QLQA 1BJQA 3PU3A 3PUSA 1D4VB 3FC0A 2BZDA 4E8CA 4L99A 5I0TA 2GNBA 2DTYA 4LKEA 1OLME 1H2LA 3K4AA 1UPIA 2D6KA 1W28A 2CU5A 3IB3A 1XSRA 4N43B 4TWTA 3ZFFA 2FDHA 3LDRA 5JSPA 1PZ7A 4HFSA 4ASKA 4D6QA 2WAOA 2WLPA 5CFDC 2NP0A 2ATFA 2TUNA 4E4DX 5KR7A 4IXLA 2ZEZA 4M0HA 5T5JA 2VMHA 4UFMA 3VD4A 2YMZA 4HKLA 2LTNA 2QQUA 4KL1A 5A3LA 2AZ5A 3PVEA 5FZHA 4RYDA 3B00A 5C3SA 1QH7A 2GNTA 3SHRA 4O9EA 3MLJA 5A1FA 4A45A 2WN2A 5K0UB 4DXTA 3MIHA 2F4LA 3ZFEC 4LIVA 1MQTB 3WDTA 4DFSA 2BFUL 4LPLA 1A6CA 4UFIA 1COV3 2DFBA 2SLIA 1U5ZA 4IV1B 3U1XA 3UT0A 3VL8A 3VV1A 4FTBA 2VAUA 1HRI3 1UF2C 4QPGB 2JECA 3VZMA 1UZWA 2LROA 3I8TA 4Z82A 1YCIA 2FDKA 1AR73 2WLQA 2IXCA 5DZGA 1HQWA 1SQ4A 1BBT3 3L2HA 5A3TA 2GNMA 2IFWA 2ZOEB 5FP3A 5FZMA 2A75A 4IEUA 1LOAA 3IZOA 3W58A 3Q8BA 3LE0A 1CAVA 1HJFA 3GZEA 3PHMA 3VHNA 1TMF2 1WGPA 1Y9QA 2HWD1 2BVVA 5HV0A 2D97A 1GP4A 2GN7A 3WNMA 5CISA 4QB1A 2ET1A 1O4YA 5DG1A 1POQA 1QH6A 1HRV1 1OF3A 3V0AB 4D7SA 1GOFA 2B4KA 3ASIA 4Y1XA 1O4TA 4COWA 1UN1A 3ATGA 5IK4A 3ZSEA 3U78A 2QQJA 2X29A 1FATA 1ZNPA 1W0PA 2AEZA 1PVXA 1LOEA 1CJDA 1VAKA 4V1PA 5DDJ3 1ZRFA 2BGPA 1S55A 3FLPA 4XJ9A 3WUCA 5GKAC 1YXWA 5C33A 2FDJA 1ND2C 2AREA 4YRDA 3SXWA 1MVQA 2JB4A 4BQYA 1W6NA 1NQJA 5CVRA 3AJZA 2NZ9A 2XWBB 2EXIA 1UMZA 4CDWB 2MEV1 5LW9A 2FCUA 1VBC2 5IVYA 3RZHA 1D0GA 2GNDA 3OUHA 1BBT1 4XF4A 1KRIA 4AI9A 5FXWA 5C3PA 5DUUA 5G04L 1E57A 1Z7S3 3V56A 3AMQA 1DYPA 2OX0A 4QQHA 4BQ4A 3DPRB 1NX9A 2PAEA 3T2QA 1CX4A 4M0NA 2WWUA 2VO5A 3R0RA 1DYOA 5I8SA 2RS11 5C9AB 1MZFA 1I5ZA 3K3NA 2D6MA 1J3QA 1OC1A 5ACA1 4IV3C 1H0BA 2ZX1A 1IS5A 3DXUA 2FMYA 2JDKA 4DY5A 1OA3A 5AFEA 1Y9GA 4NRPA 4PLNA 2RDRA 5ISLA 4MH0E 2WQ4A 2G9FA 3C2UA 3OYWB 1ULGA 2E53A 1H8TA 2VQ0A 2DTWA 3WP4A 2BNOA 1QOOA 1DYKA 1PIV2 2Y6GA 1XU1A 4Y26A 3HOBA 3CJIB 4QPWA 1GV9A 1PX4A 4NO4A 1SLTA 2R49A 2CWSA 1JYCA 4L9BA 2BGCA 2O14A 4I09A 4LO6B 4CCEA 1QDCA 1WWYA 1Q43A 4Y20B 4EQVA 3GHNA 3VD7A 3EXUA 1C5IA 2I07B 5FYZA 1S2BA 2A7AA 2DV9A 1F8VA 2NM1A 3DF0A 1Z7S1 3K3OA 2CYFA 4ARXA 1DZTA 2TEPA 1N47A 1IPJA 1NA1B 1UU5A 3BB6A 3VBHB 5FPBA 1ND3B 2C24A 2VMEA 4XZPA 1US3A 2QDNA 4D69A 4CCKA 1GANA 5A32A 3HN3A 3FN9A 5FRAA 5E8AA 1QJX2 5IW0A 1CONA 1GP5A 2GC1A 3K77A 1P8JA 5DZEA 2YHJA 1FT9A 5DUVA 1WW6A 1KFUL 4ZU4A 4BK5A 2HH9A 2VC9A 2HEYF 2WKKA 5AC91 4OLLA 4CE8A 1AL21 1QJU2 1RUG2 1H6YA 2A3XA 5F3CA 3WSOA 3QACA 1SPPA 3WW3A 2Q8EA 1X8EA 4AVTA 4AG4A 3U07A 3DKWA 3DCQA 3K48A 2WFF3 4JGYB 2QUOA 1IZ3A 3PUQA 4LUMA 4D6SA 3T0DA 4WZFA 1CD3G 1RUH2 5JOXA 3ILFA 2Q1FA 5JAXA 1NCQA 4XF9A 4FP3A 5EV7A 2F17A 3UGHA 3VBOB 2ZHNA 5BNNC 4DEQA 1AYM1 4NRQA 4RS5C 2IXJA 2HEWF 2BWAA 1RJ7A 4BM8A 3BN6A 3KHCA 4AI8A 1RC6A 2R16A 5CEHA 3FBMA 4XFGA 1UIJA 3H0OA 4LO4B 1RB8G 1NT0A 3BTAA 4EWEA 1OLRA 2VQAA 3EMRA 2UURA 4ZU5A 3M3QA 5A7WB 4HVRA 3ZOIA 5CFCA 4DZGA 4XUQA 4KNCA 4UFHA 2O1QA 4XMIA 1XSQA 3H7YA 3SEEA 1Q8VA 2VZ1A 4R9BA 3GCWA 1X7NA 2P17A 4AHWA 1MS0A 1OFNA 1RUJ1 3AP4A 3D0SA 1YEWA 2CDPA 4DRRA 2A6YA 2ADEA 2WFF1 3JCIA 3PVBB 4AGGA 4OCTA 2D7FA 4LHKA 3W59A 1VRBA 1N3OA 3J7HA 1FMD2 4HKWA 1OH4A 2MPFA 1LR5A 5CB7A 1W04A 4XDQA 3WHUA 2DDUA 1POV3 4B3NA 1ULEA 4KG0A 5FOBB 4AFBA 1T2XA 4JRLA 3VUOA 5A7QA 3RYPA 1AF9A 3KF3A 1RUC3 3Q8EA 4IETA 4JVAA 2VMDA 4Q0QA 1H1AA 1H6XA 1H4HA 1PO12 4Q26A 4AFDA 1F15A 1PGSA 4JC1A 5L9RA 3N9OA 3KV6A 2DBNA 3RS6A 3VBUB 4WVZA 4XUNA 4KU7A 5FYYA 1D2SA 3WF3A 3WZ1A 1REFA 2FDFA 2LUWA 1W6QB 2Y34A 1JZ4A 1LODA 2A6VA 1R083 3I2HA 2VCMA 4K8FA 4CDUA 1ULPA 4FQZA 4P14A 4YM2A 4QU2A 3JBG1 1WLWA 3M70A 4YGEA 2JG8C 1XYOA 1F2NA 5AVAA 1PMIA 3B69A 4YVWC 3RZGA 2B9UA 3VD9A 1IOAA 3FBYA 3RFRA 5FQ0A 3CIHA 5F3IA 2CGOA 4QGMA 1BK0A 1W2NA 3ME2A 4MVTA 1CN1A 3GBFA 1PVC1 2C26A 1C8M2 1UPSA 2J1UA 5JOWA 2KD7A 3WNOA 5HCHA 2G9GA 5FXZA 1AR61 4FFFA 4GWJA 3ZXDA 5JWPA 1AR92 2EF6A 1HXS1 3ZXLA 4Q0PA 1W8ZA 2EALA 4EN9B 1R1A2 2R072 4FPJA 1ZZBA 4CU6A 4Z1VA 5FZBA 1U5IA 3RYRA 3CF6E 1Q8SA 4XCBA 3ZKYA 2JG9A 4HVOA 5BPXA 5EJ3A 3AYDA 4LULA 3BPSA 1NCRC 1TME2 1H1IA 4WM8A 4CUCA 1ENRA 5J37A 1W06A 3ETPA 4LUKA 5IK8A 1OQDA 2V4AA 5KHIA 3F95A 4XJAA 1XJAA 4UW6A 4XOGA 3H8UA 5EPAA 1Q8QA 2Y0OA 1GKBA 4TXWA 4LO7A 2VUCA 4XXAA 4ZS2A 1O7FA 3POSA 5LATA 3SCHA 4ES8A 2RE9A 3M3OA 3APBA 4MG2A 1DLLA 4IGOA 2VNVA 4QQ2A 4WVWA 4M3CB 4J25A 2RDQA 2RHPA 4BQ2A 4D94A 4Z2AA 3T4VA 1RUI2 1KITA 5C5UA 2RJKA 2OYZA 2WS92 5C8CB 1ZA4A 4FXGB 3WF0A 1VBC3 4WV8A 3S7EA 3O7OA 3K51A 4LK7A 3ZN6A 3O1PA 4Q0UA 3TOJA 3I2DA 4CCNA 3IT8A 4KMQA 5GJ6A 5JZGB 2AACA 2OVUA 4OHZA 4BOWA 4QX3A 4BMBA 2ZKLA 3OTFA 2DVFA 4QXCA 3U14A 1AL0G 4LQRA 4BIOA 5ABJB 3RMYA 1TMF1 3MI8A 5APAA 3E6CC 1F4AA 3JZVA 4M00A 5J09A 4ORFA 1CGPA 5LY2A 2B8MA 1LU2A 1GQPA 4KGQA 4G9SB 4AAXA 1PZ9A 4E4ZA 4QM8A 1WA4A 3AMMA 3VBFC 1GWLA 2RS51 2I74A 2W95A 4BLIA 3J7NA 1N1TA 4AFAA 1WBFA 1SLLA 3I2FA 1ZA7A 4PLMA 4IEPA 5F1RA 2NQYA 3WQ0A 2BDRA 2FDGA 3RI8A 4UBHA 3AZWA 2VH9A 1GLHA 3ZFGA 2YC0A 3HQRA 2QVSB 1PIV3 5EWSA 4K3UA 1MR5A 4XHXA 3LEIA 4FPOB 4EZ4A 1CPNA 2XWJB 4HKOA 3ZYPA 2Y6KA 3AFGA 2ZGKA 1SLAA 4OQ9A 4OHWA 3AP7A 1O5LA 4UF0B 5LA2A 4QGLA 4UAPA 2WC2A 4I0BA 5FYSA 4RGGA 3LA2A 1TQ5A 2PHLA 1YIFA 3CMGA 4O65A 4LLFA 4XJ8A 3TBDA 5CKMA 2VBBA 3OG2A 1QXJA 3KF5A 3O12A 4QQLA 3I54A 3ZFFC 2HWE1 3BOWA 3DXTA 4WVVA 1FYUA 3KWVA 3HVDA 2W94A 1ZM1A 4FP2A 2RM22 5FYIA 1LECA 2XJQA 5LBEA 4YZ1A 3DL3A 1M06G 2EIGA 4QD2A 1JU4A 1PMHX 5FZ0A 4FBFA 4FO9A 4RS5B 2WRAA 2WNVA 1MZ5A 2ZGQA 2QE3A 3WNKA 5ANQA 5C5TA 4CUAA 5H9SA 2C0ZA 4BHPA 1RUG3 3AK0A 2PHUA 3NJYA 3OB8A 1NQDA 4Q4W3 1K5MC 5E1RA 4TZDA 4YG0A 4CTEA 3FLTA 4RQPA 1Q3EA 2JICA 2XLGA 2J1TA 4OI2A 4P9WA 3RZJA 3HD8B 4QKDA 3HAGA 4GJYA 1C1LA 2HWB3 2CY6A 1SBFA 3S30A 3WP5A 3AYCA 5JXJA 3LA3A 1RUH3 5LBCA 2A5ZA 2Y38A 3WG4A 4JHZA 1VPHA 3B93A 1GFF2 5J48A 4C0HA 2E32A 5FZLA 3ZIXA 3NKTA 4HZFA 4QPIA 5FIXA 5FZCA 5FO8B 3I2IA 2XUMA 1TG7A 4GD4A 2JDNA 1ULCA 2ZKNA 3NNMA 1SEFA 5FP9A 5HXVA 4YWAA 2Y0IA 3RJRA 5AVPA 3WINE 1O3RA 5BNOB 1QJX1 1W8WA 2AYHA 4BJ0A 3O1VA 5FWJA 4CCJA 3MV01 4YVSB 3K4ZA 4AZZA 3NW4A 2HWD2 1LAJA 4HL0A 3VBRA 1Q56A 1XNKA 3OPWA 3HT2A 4NOTA 4XETA 4Z07A 1HRV2 4W50A 2PLV1 4NWWA 3VLBB 4A41A 1QJU1 1AZDA 4D6RA 3I3BA 1GBGA 5JXIA 1Z78A 3MF6A 1AX1A 2CDOA 1V6LA 5LWBA 4A7ZA 5A3MA 1SLCA 4B4PA 3S57A 2BFUS 4ASLA 4ZZ8A 1TEIA 2VMFA 1WD3A 1JOJA 4NUBA 3ZLIA 1FMD3 4M4PA 3BPZA 2MEV2 1UXXX 5BNQA 4C90A 1SFYA 4LO5B 4PCRA 4RFRB 3RZKA 1W8NA 3HNYM 3ZSKA 1OUXA 4OHXA 3C3VA 4ATEA 3U10A 3VDDA 3PU8A 3PJQA 5KXDA 4ET7A 3S5QA 5JI9A 3ZXJA 4KQ7A 1XRUA 1VE0A 4XQDA 2OA2A 4AR2A 1RXGA 3ZM8A 2RS12 5C4WA 2B46X 3C7OA 3QOPA 3AVSA 4JDOA 4IQPA 2CSGA 4MLOA 4LT5A 4FPHA 1K45A 4AGRA 1B35A 2Q5TA 1SZBA 1ZZ7A 3NO8A 4A4AA 4DMIA 3UETA 2IZWA 2EAKA 3GBWA 4TLFA 4KG8A 4TYSA 5C70A 2XLAA 5G05L 4FOYA 3JB4C 5DN2A 4CEWA 3PUHA 2GP5A 1F4HA 1H8TC 2VNOA 1MPXA 2XL9A 1Z0HA 3FZ3A 4MGKE 2ZMKA 4XHBA 5D8AA 2I45A 2J1VA 5FO7B 4RFT0 4YW1A 5BNPB 3O1RA 2Z2SB 4ISRA 4XVHA 3ZKUA 2WA3A 4Y22A 1UWWA 4GH4C 1FNYA 1FMD1 5FZIA 1UZYA 2VPVA 2CTVA 5EZWA 4LOTA 4W65A 1PGW2 2IUWA 1HLCA 1BK1A 2JKBA 1C8M3 2PYTA 5FZ1A 4ZY9A 5A70A 3VDAA 3LEGA 2FDIA 2NLRA 1CAWB 4OZXA 2CNAA 2WQ8A 3WQBA 4E2SA 5HBAA 5K7PA 3VDCA 1E5IA 1PO11 4XJWA 5LRRA 1R1A3 3K2OA 2R073 3HMYA 1C57A 4ZZ5A 5FK8A 1BCXA 2WNUA 1R1ZA 1L3JA 1RINA 1A3KA 1ZRIA 2NMOA 3U75A 1HW5A 3GHMA 5F32A 4BE3A 1ULFA 3D5OA 3NMBA 5LY1A 3O5SA 3MIEA 4YZ2A 2DU0A 5I0RA 3KSCA 3BTXA 1QIQA 4M3CE 2BEOA 4MSVA 1QNYA 4LITA 1FOD3 3HNBM 4LE3A 1OLMA 2HWC2 4IEOA 5A1AA 5FYVA 5J3UA 3LZZA 1JUHA 2WZR1 1OLQA 2YDEA 2TNFA 1AL22 4GIQA 5FZFA 4BLJA 4AI0A 1GOGA 1HV1A 2Q1ZB 4K1ZA 1WLDA 2DF7A 4AXOA 1UU4A 1YO8A 3DGTA 2AGSA 1C8M1 2Q4SA 3IDEA 4FOQA 3TAYA 1JOPA 4CU7A 2X5IB 2Y26A 3H50A 5DQ0A 1OSGA 1XU2A 1RUI3 1AR91 4GZ9A 1DLCA 1NCQC 5FZOA 4AVAA 2E31A 3TB0A 2WS93 4HOOA 4CUBA 4GXLA 1YC61 2R071 1NAEA 5JMCA 1AYM2 1UIKA 4UBGA 4WM7A 2R30A 2DCKA 4N53A 1QWRA 2P6HA 2QBXA 2XG3A 3B9IA 3BU7A 3SCFA 3N4MA 5L19A 1TME1 4FQ4A 1OOPA 5FYMA 3T4HB 1KDMA 1W9FA 1J1TA 4NR1A 4N90A 2W0XA 1YI9A 2QZ2A 1UY2A 1JYWA 5CFCC 3BTZA 1NKGA 3ZIWA 2BBVA 3QBQA 3MFCA 2IXLA 2DCZA 2HYKA 4Q4Y2 1ASJ2 4HETA 4WZCA 1X33A 3H8RA 1PK6A 2EIBA 2W1QA 3AXEA 1RUJ2 4FFIA 5T5PA 3KLSA 4CYDA 4FTEA 2BQPA 4HBNA 5L7OA 4I0AA 1I5PA 4JGZA 3WP3A 2K9ZA 4FSJA 1RUI1 2RR12 2ERFA 2OUHA 4LE4A 2WS91 5LK7B 1QJFA 2R32A 1SLIA 1RUNA 1MS3A 5FKBA 4ATFA 1HN1A 2IC1A 2J1AA 4XDOA 5IVEA 2E6VA 3KHBA 3I3DA 1K5MB 2IVIB 2CAVA 3AL5A 3UL2A 2GMPA 2ZX4A 4PDWB 5JIUA 4MGIE 5FY7A 1EAH2 4YW6A 3WG2A 3B01A 2JDHA 5CG8A 3ZMOA 2WYFA 3M2MA 5IHRA 1YQ2A 2PXJA 4WBBA 2GC2A 3IAQA 3WQ1A 4NIGA 4CDUC 3AVRA 3E5XA 3HN1A 5B4XA 3BODA 1S1AA 4BDVB 4NPMA 3ZN5A 1QY4A 1YFWA 2TBVA 3JBG2 4CEYA 3H1WA 4COVA 4NVPA 2UY8A 4KBZA 5F5QA 4OMCA 5LEKA 4Y33A 5BYNA 1N1YA 3AYAA 5A3WA 4OHYA 3LPGA 5LBFA 3EHKA 1VB4A 3OGJA 2OZJA 3C7HA 4AEDC 4DS0A 1PVC2 1D4M2 1ZRRA 2J1EA 4IEVA 1FAYA 1KFXL 3FHQA 5IVJA 1EV12 5F37A 1AR62 2JJ6A 1UAIA 3ZYBA 3GZAA 3UKTA 1HXS2 1URXA 1YQ6A 1V6NA 1ZYBA 4OVEA 3VKNA 5DAPA 2F4PA 5IFPA 3H1YA 4LBJA 3AJYA 4GMP0 5JUVA 3HQUA 2XBO1 3J7LA 4BA6A 2FHRA 3NVCA 2HWF1 3UESA 4CDXA 1J83A 1XE0A 1JUIA 2JG9C 2RM21 3F2ZA 4DOUA 2JEMA 2XVLA 2H0BA 3N9LA 4XMAA 2DWRA 3FX3A 4WM8C 2ZHMA 3BCWA 4B7EA 4LBQA 1IGOA 2HWD3 3ZYFA 1MS5A 1BLZA 4LK6A 2P5BA 3RDIA 3VN4A 4XFBA 2GP3A 5F3EA 3BKZA 3PURA 4JZRA 4LTAA 3UJOA 1HRV3 3NAPA 3A0NA 3HIFA 2CGPA 4RR3A 3PIGA 2VBDA 3NL1A 2WNOA 4L8QA 1CQ9A 2BBAA 1Q8OA 3L2YA 3VBSA 3ZXAC 3USUB 4B8EA 2ZZJA 4TN7A 5A6ZA 3BUCA 1WUVA 2YC2A 5F5CA 2J42A 4YSFA 3OY8A 4RA0A 2FMDA 1YJLA 1PGL1 1QMJA 3USSA 2MEV3 2YFUA 5L9BA 4J1XA 4XDPA 4CP9A 2YFZA 3ES4A 1W6MA 1W6PA 4PF1A 3OOXA 4MV2A 4LO8A 4Y1ZA 5JLVA 4GH4B 2A6ZA 3JD72 2FCTA 2JKXA 3FUQA 2Q8DA 1CIWA 5A3PA 4NIHA 3WVJA 3V0BB 2OPKA 2RS13 3ROUA 1DZRA 1UO9A 4OI1A 5ACA3 1VP6A 1LESA 1IHMA 3I59B 4Y24A 4YG6A 3MLLA 1MEC1 1LOFA 1WA6X 2VE1A 4OUSA 2RS52 1NUKA 2GN3A 2UWBA 2VVFA 3ZDVA 2QQVA 4CDQA 2P6CA 2VZ3A 1V6IA 1OUSA 2P3JA 1H8VA 1X82A 1YHFA 3ALQA 1EUTA 5GZCA 3ZFGC 3NV2A 1GZWB 1ZBA2 4AEMA 2BRTA 2ARCA 3OBZA 3SITA 4A2UA 3ZYIB 2ZACA 2OQ6A 3TN92 1W0OA 3LSEA 2R1BA 5FXVA 3WDXA 4AI1A 1Q8PA 4RGAA 4XAEA 4JDMA 2LW8A 3D8CA 5LA0A 4Q27A 2C9AA 1AYN2 1RTVA 1ODNA 1YWKA 1XNAA 2VG9A 3P3NA 4LKSA 2A6WA 4EZHA 1G6NA 2D6LX 3EQEA 3NV1A 4GWNA 4XQ4A 4BK4A 2WBKA 2DBIA 2QCSB 1V6MA 2YBPA 4QM9A 2E7AA 5J1XA 4F7ZA 2YUEA 2WWJA 3IDCB 3WT3A 1G9BA 2JDMA 2HWE2 3KCXA 1FPN2 1V0AA 3O0VA 4N43A 5FPAA 3WR0A 4PI2A 1IQAA 2ZEXA 2GAUA 1RUE1 3WW1A 2VTXA 3N9PA 3I3MA 1IPKA 1SCSA 3RYKA 4U36A 5IVCA 3Q8CA 4E9KA 2LM3A 3PNAA 4E4HA 5FPXA 2VVEA 3ACIA 2ZCWA 2WNVC 1WMXA 2HWC3 4FXKB 4P02B 3VHPA 5AC93 2J22A 3B02A 2VZUA 1AL23 2VJXA 3WLUA 1HDKA 2ARBA 2WQZC 5GZFA 1GQHA 1GP6A 2PHXA 1ONAA 3KVBA 4RQPC 5K0UA 3HBKA 3LIGA 2YY1A 3AKPA 4XTPA 1MQTA 1PGW1 4FPLA 2ILMA 4IV1A 4FT8A 1MZ6A 4BQWA 3BIWE 4ARYA 3ILRA 4QPGA 1I9RA 3IN9A 4KWJA 1STMA 3T09A 4AQ2A 5SV8A 2Z42A 4BQ5A 2XMLA 3BYWA 2KR2A 4QPIC 3H8XA 1T6BX 3GCXA 1AYM3 2WDBA 3N9NA 3POJA 1PHMA 5DZFA 2BP6A 2HBTA 4FPEA 1RUOA 2W3JA 4FAGA 4HK9A 5FJKA 4YNIA 4PBOA 3I2OA 3PTRB 3W5NA 4UW4A 1NXMA 5IVFA 1OT5A 1LU1A 1PZ8A 1SBDA 2R7EB 2P34A 1OI6A 1S0BA 4FPYA 2A73B 3VBRC 3CKHA 1H2KA 4X6QB 4NIIA 5GLZA 2BOIA 2HWC1 4E27A 1SG3A 2PLV2 4QHZA 3V0AA 2ENRA 2SBAA 2RG4A 3VZNA 4R4ZA 4Y3OA 4Q4Y3 1ASJ3 2QFEA 5A33B 1RUJ3 4XYXA 3NKGA 2WZ8A 1ZX5A 4PQQA 3O1OA 1OF4A 4FFHA 4Q0SA 1RHI2 3HPNA 5FY8A 3VDBA 5FOJB 5CYYA 4GWIA 2A3WA 2P2KA 1CAXB 4JHTA 3U11A 1JYIA 2ID4A 2BERA 2Y64A 3HWJA 1J3RA 1W9TA 4CDWA 3S5AA 1D7PM 1GU3A 4PHZA 5HCAA 3VDDC 2VZVA 1O8PA 4QXKA 2P1BA 2E51A 2DU1A 3QD6A 4LHLA 4OUMA 4H7MA 1BEV1 4HXCA 1X9PA 3TYJA 2EXJA 4AVVA 5FP4A 4D8MA 3DPRA 2YPJA 5F7UA 2JDUA 1VBD1 3EJKA 3S6PA 2WINB 5C4WC 5C9AA 4A6OA 2YGMA 1MACA 2DYCA 3LGRA 4JV4A 2W08A 4OZOA 1F31A 4WVMB 5FMOL 1B35C 3O1SA 4DIQA 1YFUA 1QF3A 4K7JA 2Q30A 4QDRA 4B1MA 2A3YA 4Q4Y1 5CADA 1ASJ1 3JBG3 1XPWA 3RZMA 3FJSA 3D82A 4E2QA 2PTMA 3IMNA 3OSDA 5FREA 3TNPB 2A1XA 4CEWC 2XPJA 5F5AA 4NAMA 3OYWA 3FFQA 3WG3A 4K40A 1O8SA 5D8AC 5CFDB 5LEJA 1WCUA 2QQKA 3AZYA 4FFGA 3IIAA 3VB9A 3ST7A 3CJIA 2RR11 3IIIA 3OGVA 3RMXA 4AK3A 2JWPA 3CNAA 4QX8A 1PVC3 2WFPA 3GALA 1DQ0A 3FHAA 4Y20A 1W99A 1W2OA 1AR63 3DYOA 5CG9A 1EV13 5IK7A 1KS5A 4IEYA 4QMAA 2ZX2A 4URAA 1HXS3 2O8QA 3WXPA 2VOWA 1OA2A 1PO22 1NA1A 3ZFEB 3VBHA 3WDVA 5EYYA 1ND3A 1EAH1 3AKTA 2WNUC 2EA7A 4YM3A 1RXFA 3N7LA 4AAPA 4LBKA 4R4XA 2BJSA 2YGLA 1JW6A 1T6GC 5A7PA 3PMSA 3BOPA 3TNQA 5E89A 1G86A 3ACHA 5FPLA 1VMJA 3H3UA 1DGLA 4Y1YA 3WQ7A 2NN8A 1BVP1 4D0QA 4DXRA 2ARXA 4W6WA 2GC0A 2XHKA 1LENA 1UY0A 1DQ5A 4BMEA 4EN0A 3P5BA 1VR3A 4A7YA 2C6SA 2VL4A 5GLTA 3LQCA 1RUD1 2WZR2 4JCKA 3CU7A 1QQP2 3UKVA 5IUQA 2WO7A 4N7IA 1CZTA 2GMEA 4EV0A 4NPRA 1FNZA 2AH2A 2NMNA 3LOBA 4DRVA 2JDZA 2YYOA 4I01A 4DUVA 3ZYHA 1XE8A 5KC6A 5CIRA 1D4M1 1SHWB 1TE1B 3FLRA 2EICA 3A22A 3H3LA 1X8MA 1EV11 2E33A 2HLEA 2J1SA 2VOXA 4JGYA 4XBNA 1ZZCA 2CGNA 2XXZA 4GMP1 1JYVA 4XUPA 4OYUA 4HT1T 4K21A 1EPWA 1HQLA 5DUWA 3VBOA 4WM7C 2ZBJA 3MUZ1 4K20A 1X9TA 4N53C 2QQOA 3KCYA 1ND2B 1N1SA 3GM8A 3CQOA 1LHOA 2WT2A 1MS1A 3S7IA 1TMF3 2W1WA 2XVKA 1UX7A 2UY9A 3IPVB 3M3CA 3PVOA 1SMVA 3DYPA 3WY6A 5JDBA 4GJZA 4META 2VQUA 2E7QA 5A7WA 1ZREA 4Q4V2 4P9YA 1WMFA 2RS53 4S2HA 3IAPA 1W2UA 1LJ7A 3KQ4B 1UOGA 4S2DA 1IG0A 1PK6C 2A71A 4GWMA 5I91A 4LBLA 1AX0A 4I3GA 4M3CF 1JTZX 4HK8A 3SC7X 4A44A 4G4FA 2Y6HA 4XFCA 4ZXEA 4QX7A 5KC5A 1ZBA3 4IV3B 1HN0A 5L7OC 3POYA 2D3PA 4JGZC 1SCRA 3POWA 3TN93 1DQ4A 5CU1A 3EYPA 4F8AA 4ONUA 2JE9A 1OPMA 3LF7A 1QKQA 1GOHA 4XE9A 4COUA 5HI0A 1GWKA 5JR7B 1SBEA 3FHIB 2ZEYA 3WX5A 4AQSA 3WW4A 2VNRA 3JD71 1VMFA 1V6OA 2JD4A 2H0VA 2QZ3A 4KGGA 4U2AA 5EJ1B 5F8PA 5J98B 3RGBA 1GUIA 4FPCA 3VBUA 3KV4A 2HWE3 1W6QA 1HB3A 4HVQA 5CBLA 1NE6A 3I97A 3ON7A 1RJ8A 4HMZA 4X6RB 4CEYC 1QJEA 3A23A 2D5HA 3VD5A 1GNHA 2R041 3O0XA 4MGQA 4MGZE 1ZBA1 5KWRA 5FYUA 2B5HA 4LKFA 1DIWA 4XPVA 3WF1A 3GF6A 3TN91 1DGRN 3FUOA 5JOYA 1X36A 4P08A 4QHOA 4XACA 5LZ6A 3JU9A 2J1RA 1U0AA 1AYN1 2GH8A 4AW7A 1W6OB 4G3YC 5C6CA 4FTSA 2QQPA 1VAVA 3E6BA 1W9SA 2XJRA 3GJBA 4GB32 1O59A 5LBBA 4P9JA 2PN5A 4AEDA 5FYHA 3ILNA 3SKJE 4FOVA 3X29B 3ZXGA 3RPQA 1AJKA 2XBO2 3MIGA 1FPN1 4AVCA 2HWF2 3WF4A 4CDXC 4XBLA 1QJX3 2C4XA 3C7FA 4NHKA 3PJYA 3VZKA 4NIDA 5BNNB 4Q1PA 1GR3A 4JTOA 1UXZA 3E97A 4Q1RA 4XABA 3SH4A 2VXJA 2VOTA 2CHHA 3NAPC 1UZZA 2PLV3 1LOBA 1QJU3 1WLTA 4RR3C 3FL7A 4QKFA 1DF0A 2QDRA 3POGA 2Z69A 4NJ4A 5FBZA 3VBSC 4XW3A 5C3OA 1XNDA 5IAXA 1G9DA 1PM7A 2XHNA 4XUOA 2QTWB 3FE5A 3SEPA 3ABZA 3IBMA 3WV6A 4H55A 1DG6A 4M3CA 3HBZA 1RHI3 4P9LA 5LA1A 4ES9A 4H3WA 1W3XA 3PTYA 3NSTA 1LEDA 1PGL2 1IPSA 4COYA 5C8CA 5FZ7A 1UY1A 2HBUA 2VZPA 2W1SA 4W6YA 2VVDA 2QQNA 4A42A 4DEVA 1LHNA 3AXDA 5JZGA 2WWSA 1WD4A 1LGCA 2BVBA 3IKWA 3WDUA 2UYAA 1S2EA 3KT1A 4N9HA 5ABJA 1QJY2 1SLBA 4QX1A 3B94A 4BB3A 1W2AX 1JHNA 2PMWB 2JIGA 1JZ3A 3ZXFA 5FJHA 4IDZA 5L73A 4YGCA 4LBQD 1MEC2 1LOFC 4M01A 4XEZA 4MUVA 3H1MA 4EN6B 4CDQC 1ALYA 4OQ8A 3AZVA 4I0WB 1HQNA 4PLOA 4ZKTB 1RVF2 1XYPA 3G6JB 3BALA 4MOAA 5B4NA 2W46A 5A7SA 3B3QE 2CL2A 1TNFA 2XOMA 1RHI1 1WKYA 1TZOA 3LA7A 2VBPA 4EN8B 3OCPA 1NG0A 5IVVA 1GNYA 2B39A 2XLFA 1QJZA 1BHGA 1CESA 1LOCA 2IXIA 2ORZA 3ACFA 3K75B 2JG8B 4LLOA 4C0BA 3GNEA 5ANNA 5T3NA 1YI7A 5JMOA 4OUEA 1OVSA 1A8DA 3QH6A 2VTXJ 4UF0A 1JXNA 4YGBA 4YVWB 1JN2P 3OPTA 4GALA 5FR3A 3ZYRA 3J9SA 4YGDA 1PO13 4Q2FA 4ASMB 4UFJA 1IG3A 1XNTA 4EN7B 4QKBA 4DPNA 2W92A 1JZ6A 1WZXA 2UWAA 4N43C 1L7QA 4BCUA 4UFKA 3AP9A 1WMEA 1RUE2 4RSUA 3BU0A 3WDYA 4BYYA 2VCBA 4QQPA 3H42B 1FV2A 5BUVA 4RS5A 1AUYA 1F5JA 1S4CA 3BTYA 3T0AA 1OKQA 5FK7A 2WZR3 4FI9A 4DXZA 2P4EA 1NCRB 5FYCA 2EXKA 1JZ5A 1HB4A 1V9U1 2AUYA 2HEVF 4CVUA 5K0UC 4IE6A 1LHWA 2R062 2VZTA 4XFFA 1MQTC 4HPKB 3MUY1 2VD7A 4Z92B 2BUKA 3Q9OA 1LNSA 4IV1C 4YZ5A 4PI0A 1J1LA 2DVDA 5DAQA 5T50A 4MXWB 4QPGC 2ZGTA 5C71A 1AR93 3OJBA 1JYNA 3KD4A 1QGLA 1D0HA 3PUAA 1PO21 3KT4A 3CHXA 3DV8A 4XF1A 1RUF1 3KS7A 1CPMA 3O1TA 2VCAA 2W91A 1PM4A 1S0IA 2UYBA 5HCBA 5IWFA 4UW3A 4CRQA 1JZ7A 1DGWA 1W03A 2YROA 2RV9A 5BNOA 1NZCA 1RL3A 2XQXA 1TME3 2GH2A 3LDBA 4S2GA 2D40A 3ITQA 3AMPA 3CJXA 4YVSA 2PHFA 3OBAA 1LGBA 3OBRA 4Q8LA 3UK9A 3VZOA 2NYYA 2YC4A 1FX5A 4CCLA 5JR2A 4Q5OA 2YG0A 4PIXA 1QQP1 4Q4V3 4LR4A 1S2KA 2QNKA 2XQRA 3V65A 2H6CA 4Y1UA 2JXAA 3NNJA 4P9GA 1CAUB 1JOBA 3T2OA 2HYXA 2DVGA 2VGDA 4PQ9A 4X8PA 1REDA 1UNBA 2G9ZA 3O1MA 4JDNA 2DCTA 5FZ3A 1W9YA 1YNAA 3VBFB 5FXXA 1VRH2 4XBQA 4IGPA 2P3KA 3IMMA 4NROA 5FKCA 2Q8OA 5C7GA 4KH9A 2XKOA 4MZUA 4CDWC 5CA6A 3I2GA 3J8F2 4UI9L 2HKXA 1W3VA 3N7KA 5F5IA 1WW5A 1C28A 1OQ1A 4MX3A 1AXYA 4YM1A 4ZU7A 3OGSA 4YW5A 1PX3A 4CCOA 2ZGLA 1E5RA 2AEYA 4Y1VA 5LRSA 1BEV2 1HV0A 1HX6A 5BY5A 3H8OA 1Y43B 1VBB1 2C5DA 3DPRC 2DUPA 3GGLA 3OGGA 4XF3A 4ZXKA 2JB8A 1VBD2 1DU3D 3SQOA 4CA9A 5C9AC 2ZX3A 3HNMA 4W6XA 5FTTC 2EAAA 5DMYA 3GXUA 4Q4V1 1OKOA 4O9GA 1RITA 5I0UA 4XAAA 5FZ8A 1W05A 4EWAA 4L2NA 3H7JA 1CWPA 3WNNA 1WCSA 3SISA 2WT0A 3ZFFB 1LHVA 4CCCA 3EB7A 1I1EA 3S0MA 1AHSA 2VZQA 3PUIA 5BNPA 1AJOA 1OVPA 1QNWA 3ACLA 5FY4A 2ZZQA 1Y4WA 1C8NA 3ES1A 4IW3A 4AHZA 3ZX7A 3QH7A 3CJIC 5TSWA 1OQEA 2RMU2 5H9QA 1S0DA 2K46A 4DQAA 1LKNA 3MF9A 3DUIA 4QHBA 4YW3A 4FVVA 1ZZ9A 3AFKA 5T52A 1CAWA 4GB33 3MW2A 5A6QA 1ZRCA 2ETEA 5GM0A 2AC1A 1NA1C 5FMCA 4K9SA 2DURA 4C8DA 1OPOA 3E6DA 3VBHC 1ND3C 1UOFA 2XBO3 1EUUA 3MW3A 5JPNB 4IESA 4HONA 1NY71 2HWF3 3A4UA 2XJPA 1XYNA 4LEJA 5CAZA 2RM23 1QHDA 4IEXA 1NYWA 2X05A 5FMOS 1C1FA 3N36A 4CPBA 1A34A 3VGIA 1KGYA 2WNEA 3HJRA 1SFPA 3R4UA 4P00B 1JMUB 4QKNA 4GAZA 3I3EA 2Q8CA 4B1LA 1KQRA 5K8SA 4XTMA 5A3NA 3EO6A 1EP0A 2BOJA 2DCYA 1YYNA 3CDZB 4YZ4A 1V70A 1RUD2 1QOTA 2YZ4A 4AOCA 1MS9A 4Q4X1 2B45X 1CAVB 4OULA 3OD4A 2LALA 1UOBA 5EXOA 3MHZA 5CNAA 5FBJA 5I8TA 4NRMA 1UKRA 4YFZA 3LCPA 3UYJA 2WSUA 4IE5A 2BWCA 1W8HA 1NLQA 4BXSV 4XZUG 1BQPA 4JGYC 3WUDA 3WW2A 2X5IA 4GB31 3N35A 3B7MA 3SMHA 2WO2A 1MS8A 2VMCA 5GLVA 3VBOC 3KGZA 1JBCA 2R0FA 5DAVA 5FUNA 4B4RA 5FWEA 3VZLA 1O5UA 3P6BA 4KBBA 1W6NB 4F83A 1B09A 4JTNA 2BPA2 3POIA 1N3QA 1QXRA 2P3IA 4AHXA 4YZ3A 3R4SA 2RS32 2V5DA 4JKLA 4MGYE 4C1XA 3LDKA 2Y6FA 3H9AA 3OBTA 1MEC3 1RUC2 4LJHA 1GMMA 1POV0 1AR81 4AEKA 5HV4A 5KHKA 3CBNA 2GDFA 4AFMA 5HXMA 3VKMA 4XC9A 2KA3A 3FFZA 1RVF3 4PBPA 4A7KA 1UYYA 4JQRA 1OBNA 1LHUA 1V6JA 4I3PA 4J1WA 4UW5A 5DAXA 3HT1A 5GALA 1R082 5FZ6A 3THPA 4O61A 5FMBA 1F5FA 1G8WA 2PA7A 3IM0A 4B29A 2WJSA 4LBOA 1ST8A 1JS9A 1H8TB 3UJQA 5BV6A 2YU1A 3AC0A 2ZA9A 4R8HA 3TEXA 4H7LA 1XC6A 3D0JA 4YLZA 1MS4A 3RVHA 1K5MA 2K2SA 4DUWA 1ODMA 4PDWA 1QJY1 4AQ6A 3VBUC 3T30A 3T0BA 2YXSA 3THDA 1O6UA 4K8RB 3WOGA 2QJVA 3A7QA 2XJSA 5FAXA 3M7AA 1RMU2 1HIXA 1LTEA 1RUE3 3GZUC 3ZPOA 5KBFA 3TWIA 3AKSA 1GICA 5KXEA 1H9PA 1ENQA 1Y3TA 3CZUA 3J7MA 2W9XA 3GZTB 4XUTA 1RVF1 2J7MA 5A32B 1JYXA 2R042 3ETQA 2K0GA 3M4FA 2BNMA 5DXDA 1UYPA 5FPVA 4MYEA 4P9IA 5HCFA 2JE7A 1VIWB 2IXKA 4GQ7A 1O3QA 5F9TA 1DBNA 1ULDA 4QT6A 1U12A 2R063 1SDDB 2D3RA 5FZDA 2Z79A 2XUEA 3WP6A 4BQ3A 1K42A 5HPOA 1YQ8A 2N7GA 3UV9A 4AI3A 5JSOA 2D5FA 3KCCA 2R1DA 4I2OA 1O3SA 1BVVA 1QDOA 1YUDA 2ZXQA 1SPPB 2VM9A 4C91A 1UKGA 1G9AA 1DP0A 3VHRA 3E1F1 1QEXA 1XBFA 4P5YA 1S0CA 4IERA 3KZ4C 5FDBA 1A8MA 4C1WA 3MV11 1BXHA 1COV1 2VZSA 4O7XA 4CZSA 3LKJA 1GYKA 1HRI1 3LOIA 1G9FA 2CWMA 1NCQB 2VUDA 5EFUA 1KJLA 1AR71 1DQ2A 1Y9MA 2EVXA 2XVGA 1R092 4TTGA 4RL7A 3L9JT 4OFGA 2V5YA 2DVBA 4EE2A 3MICA 3MGUA 2HJIA 3DEMA 3RNSA 4F3JA 2VUAA 1EPZA 2E7TA 2FZ2A 3AZXA 3SH5A 1V00A 4YYOA 4KWUA 1W0NA 2UU8A 3USUA 4DINB 2R061 5ERLA 4Q29A 5C3QA 1J84A 1PNGA 3ZVXA 2D93A 3SH3A 4DXSA 1CR7A 2ZAAA 5CFCB 1N3PA 4AQTA 3BIEA 2DUQA 1VRH3 1QOSA 4GKXA 1VBA2 2GZWA 1F9KA 5EP9A 3V64A 3LFMA 5FMDA 3RQ0A 1GQGA 2XJUA 1KXGA 3AKQA 2A6XA 3Q8AA 5DDJ1 4EJRA 1OMIA 2QQIA 1QU0A 5E16A 5C8CC 3J8F3 4QX2A 3TEWA 3KV5A 5FZKA 1YFXA 1E5SA 3PL0A 4OMDA 4INDA 5JZGC 3WDWA 1N1VA 4XFHA 4E8DA 1BEV3 3MPPG 4XFIA 3ZMNA 4GH4A 5JIAA 5ABJC 1JZ8A 2W52A 1HKDA 2E26A 2GC3A 1BYHA 3A21A 3AM2A 3LEMA 1VBD3 3T1LA 3V0BA 1AVBA 2BV4A 2FQPA 4K1YA 2OUJA 4HLTA 3I59A 4QXHA 2ZGPA 4HSLA 1NLRA 1Q5OA 2XR4A 5D1IA 2WR9A 5B2GB 2XB6C 4QXBA 4FPKA 2PAKA 1SDWA 4JKMA 3WD5A 1FXZA 5FPUA 4B4QA 5LCWL 3PMEA 3T08A 3ENRA 1O91A 2ZGRA 5FLHA 1D2QA 3E5UA 1GZWA 4CDUB 5H9PA 3FWEA 5JXHA 2D44A 1VRH1 3LEKA 2JENA 2W87A 2RR13 2JE8A 4ZPIA 2RMU3 2Z5WA 1U5YA 4W8JA 4XJUA 3J8F1 4KU8A 3RG0A 1S0JA 1IS6A 2W5FA 1UZVA 2RJLA 3IDBB 1BMV2 2DUOA 1X50A 4Y5TA 3VZJA 4FPFA 3NNFA 5FQ0B 5FZ9A 4Q4W2 2QKDA 2JD9A 1OHFA 3POBA 4YFWA 4AEDB 1EAH3 1NE4A 3NNLA 4XXPA 4PF5A 3OUJA 1VBE2 2HWB2 1UMHA 4IE7A 2MHFA 5FZ4A 5FY0A 2YU2A 3N7JA 3FMGA 4UT5A 5F3GA 3OEAA 2OPWA 2KXLA 1L7LA 2VQTA 3AX4A 4IE4A 3ZR5A 5FLIA 4XCAA 4LIUA 4NPLA 3AL6A 4Y5SA 3VHOA 3OD0A 1KEXA 1RUD3 2JG9B 4YM0A 3KV9A 1JH5A 4RHV2
chains in the Genus database with same CATH topology
2X53S 1V9U2 4WM8B 3E5QA 1A78A 4P9XA 5FPZA 1KDKA 2RMU1 4LBMA 1YIPA 1D4M3 3N3HA 2C1FA 2XL7A 1WMDA 1UU6A 4GMP3 3MW4A 5J96B 2CAUA 3ZDSA 1XQNA 4Q0VA 3GYDA 1SACA 1RUF2 4Y5Z0 3R05A 3T1MA 1RIRA 1EYBA 1O4ZA 2JX9A 1IKPA 2VOKA 3AYEA 3J26N 3WHTA 1UW8A 1ZBE2 4FOWA 5BNOC 4BH9A 5T54A 1LOGA 4L92A 3WNXA 3TRSB 4YVSC 1REEA 4RD7A 1O3TA 2RS33 4ITCA 3ZN6B 2NPIA 3PVNA 4AYUA 1OA4A 2D6PA 1YFYA 3ZXEA 5E88A 2ZS6B 5BXXA 5GZEA 4LA2A 4IEWA 5A33A 3CL1A 4H14A 3AMHA 3NJZA 4GA9A 4SBVA 3P3PA 3ZSLA 2XJVA 3LB9A 4CP0A 5DG2A 2ZGSA 2VULA 2A70A 1CAXA 4IEQA 4HSJA 4LA3A 2XGXA 4YW4A 3ZFGB 4EWDA 1GNZA 2D98A 3AKRA 5I8YA 3NWKA 4IL7A 2CV6A 1H30A 2ES3A 1DGRA 1OD5A 1OOPC 3JD73 1VBB2 1ZVFA 3SCGA 2XJTA 2ZX0A 3ZXKA 1DHKB 2GU9A 3RWNA 2ZHKA 2RS31 4NWVA 1POV1 2ZABA 4CP1A 1RMU3 2ZJCA 3MIBA 5GLWA 4WVMA 1G9CA 1RUC1 4QPYA 5J36A 3LSDA 1J58A 2Q0AA 4J6GA 3KM5A 1SFNA 1NOVA 3D6EA 1U5XA 4AVBA 2R043 5SV5A 2WL1A 1ENXA 3AP5A 1NXD1 5CFDA 5BNPC 3ZN4A 1R081 2ET7A 4KWKA 1APNA 3KGLA 1MZEA 2VMGA 3B9CA 4R52A 2WNVB 3JQWA 1FOD2 1AYN3 1W39A 3WG1A 1ZZ8A 4AEJA 4BZ4A 1LRHA 4IEZA 1GZCA 3LAGA 2B7YA 4XFAA 4RQPB 4COZA 1M4WA 1V6KA 4K6BA 4QX5A 1IS4A 3ZFEA 3KB5A 3KMHA 1FPN3 1KS4A 1NY72 3M3EA 1RMU1 4NHMA 3VKOA 4XQWA 1R093 4QPIB 5T5LA 5KHGA 3KT7A 5KHJA 3CLPA 4FCAA 4L97A 3UKNA 2WT1A 2YV8A 1FV3A 5GZGA 1IS3A 1C4RA 4BIFA 1LCLA 4PJYA 2BW8A 4Q4X2 3U4XA 3I4IA 2ZGUA 1GSLA 5J7MA 2D6NA 4XIOA 3VBRB 4AVSA 2X5IC 1NLSA 1WBLA 4DNYA 3JUUA 1VBA3 3JQXA 2B42B 4I02A 2ZGMA 4P5HA 4I30A 3M3IA 4D3WA 2D43A 2ZPXA 2WZPP 2ZMNA 1ND2A 2XKPA 4YW2A 3O14A 5IK5A 2GALA 1R091 3IPVA 1VBC1 3SNMA 4B7KA 1AX2A 3VDDB 1H1MA 1BKZA 4AGVA 4XIKA 3RSJA 1AR82 2GSYA 4A3XA 2ZMLA 5KXCA 5GLUA 1WLCA 2ZTNA 5C4WB 5F6KA 2BNNA 2FZ1A 4IV3A 1B35B 3N7MA 2VUJA 1VBA1 1H9WA 5JCTA 2AENA 1MVEA 3URFA 4X8NA 3MIFA 2R0HA 2VU9A 4CEWB 4EROA 1DQ1A 1DGWX 1DZQA 5D8AB 5T5OA 1H4GA 2GMMA 3M1HA 3O0WA 2ZAHA 1PIV1 2VY0A 4Y22B 2WIIB 1GZ9A 3D4KA 4OI4A 5LK5A 4ISQA 4PDWC 2DFCA 2PHTA 1VBE3 1I6XA 5F6LB 5FLJA 1KD7A 5T55A 3GBGA 1YRZA 2W39A 5JSRA 3CEWA 2G4IA 3AZZA 1XNCA 2WSVA 2UWCA 2WNUB 1LGNA 1DDLA 5GZDA 3WCSA 2H6BA 4RHV3 2D3SA 5FFOC 1V9U3 1RGSA 3EBRA 4YARA 4BPZA 1W6OA 1BMV1 2WA4A 2PHWA 1AXKA 1RUG1 2IXHA 4Q4W1 5DUXA 1PO23 1LULA 2ZGOA 1RUF3 2OZ6A 3HR9A 4HANA 1COV2 1VBE1 2HWB1 4HN0A 3R4DB 3ZSMA 1HRI2 1WCDJ 1RUH1 1ZBE3 4R9AA 1AR72 4Z8BA 1S0EA 2PELA 1CVNA 4WM7B 5BNNA 1BBT2 4N53B 3ZPYA 1ZZ6A 1ZRDA 4QGNA 1ENSA 1QQP3 2AR6A 4RHV1 3RRDA 5C8WA 1OOPB 1XXNA 1FI2A 3MFAA 3R6SA 4LBNA 3SLIA 1YLLA 5ACA2 3ZYJB 3LWCA 2DCJA 4FAHA 3NV4A 1IKQA 4BQ1A 1PK6B 2VW1A 4PIYA 5DDJ2 1XNBA 2BTVC 1VJ2A 3MPBA 3A0KA 3KQRA 5L7OB 4SLIA 4NN0A 4JGZB 5FO9B 3ELNA 1ZBE1 4AI2A 2XH6A 2VMIA 1VBB3 2PHDA 4XJZA 2X8KA 4QQOA 5KXBA 4AWDA 1H2MA 1YJKA 1Z7S2 2PQQA 2VW2A 2ZGNA 3MLKA 5FCCA 4HN1A 4UXAA 4D7YA 2F6BA 3ZO0B 2Q1MA 2E9QA 3ZSJA 4AFCA 1EY2A 3HQXA 5IT6A 4CEYB 3AMNA 2BYVE 2DVAA 2OIIA 1WCKA 3I7DA 5AFBA 4L11A 4Y4YA 4JAAA 2JG8A 4Q8KA 3M8LA 1I3HA 3MYXA 5JI7A 1KJRA 5AC92 4YVWA 4GULA 3RJ2X 2V73A 3JB8A 1J59A 1LEMA 1XE7A 4URTA 2FBEA 3B5LB 1VB2A 1DFQA 3T2TA 4E2GA 2VXRA 1J3PA 2W68A 1DQ6A 2VW0A 1R1A1 3VKFC 2P37A 2VNGA 4R9DA 1S0GA 1Y7BA 3J4UH 3ZYGA 3ECQA 4GKYA 4YG3A 4CDXB 4AE2A 4Q4X3 4AHYA 5K9YA 4DB5A 4CP2A 4D7TA 1NCRA 3PLQA 4LBQB 5I93A 3W9AA 3IWZA 3MIDA 1AXZA 1VALA 4MXVA 4P9JA 2E63A 4HPKA 4KWLA 4LHNA 3QCWA 4OI1A 1FOD1 1TNRA 4OHVA 2O8OA 2VECA 3NAPB 5L36A 4N7UA 4RR3B 3MEPA 4XILA 2ZHLA 4MXWA 4BWOA 2EXHA 1VAMA 3VBSB 5I0SA 1UD1A 5JOZA 1WW7A 4TSVA 2IWGB 2OW4A 1BZWA 2I2SA 2V09A 3CO2A 1UX6A 2WFF2 1C3HA 4OI0A 3OF1A 3OY8B 2PHRA 4S2FA 3WCRA 1S0FA 1C5HA 5JVVA 2R6QA 3MDPA 1W6MB 1LB2A 1W6PB 2KM2A 1OFSA 3VL9A 1AR83 4NHLA 3INAA 3RI9A 1CAUA 1PNFA 3OPZA 5EYXA 3G7DA 4Z2WA 3AB0A 3H3ZA 1WW4A 4DY3A 5KHHA 4PIZA 3VBFA 2D6OX 4CDQB 3NV3A 3DN7A 4XF0A 3MZHA 1UCXA 4E4SA 3AP6A 4FPGA 1VLNA 3U0ZA 3VKLA 2O0OA 4R9CA 4JRAA 1G7YA 4LNVA 3RZZA 1QJY3 2PAMA 1CJPA 2IFRA 4N9IA 3THTA 5JPMB 2PFWA 1H2NA 1JYIA 5H9RA 1QXPA 2VOVA 1UL9A 2MNGA 3QLQA 1BJQA 1D4VB 3FC0A 4L99A 5I0TA 2GNBA 2DTYA 1H2LA 1UPIA 2D6KA 4N43B 4TWTA 3ZFFA 5JSPA 1PZ7A 4HFSA 5CFDC 2WLPA 2NP0A 2ATFA 2TUNA 4E4DX 4IXLA 5T5JA 4M0HA 2VMHA 2YMZA 4HKLA 2LTNA 4KL1A 5A3LA 2AZ5A 3PVEA 3B00A 1QH7A 2GNTA 3SHRA 4O9EA 3MLJA 5K0UB 3MIHA 3ZFEC 1MQTB 3WDTA 4DFSA 2BFUL 1A6CA 2SLIA 2DFBA 1COV3 1U5ZA 4IV1B 3VL8A 3VV1A 4FTBA 1HRI3 1UF2C 4QPGB 2JECA 3VZMA 3I8TA 4Z82A 1YCIA 1AR73 2WLQA 2IXCA 5DZGA 1HQWA 1SQ4A 1BBT3 3L2HA 2GNMA 2IFWA 2ZOEB 2A75A 4IEUA 1LOAA 3W58A 1CAVA 3VHNA 3PHMA 1TMF2 1WGPA 1Y9QA 2HWD1 2BVVA 2D97A 2GN7A 2ET1A 1O4YA 5DG1A 1QH6A 1HRV1 3V0AB 4D7SA 3ASIA 4Y1XA 5IK4A 1O4TA 4COWA 1UN1A 3ATGA 3ZSEA 2X29A 1FATA 1ZNPA 1W0PA 5DDJ3 1PVXA 1LOEA 1CJDA 1VAKA 4V1PA 1ZRFA 1S55A 3FLPA 4XJ9A 3WUCA 5GKAC 1YXWA 5C33A 1ND2C 2AREA 4YRDA 3SXWA 1MVQA 1W6NA 1NQJA 5CVRA 3AJZA 2NZ9A 2XWBB 2EXIA 1UMZA 4CDWB 2MEV1 1VBC2 1D0GA 2GNDA 1KRIA 1BBT1 4XF4A 5DUUA 1E57A 1Z7S3 3V56A 3AMQA 1DYPA 4QQHA 3DPRB 2PAEA 1CX4A 4M0NA 3R0RA 5I8SA 5C9AB 2RS11 1MZFA 1I5ZA 2D6MA 1J3QA 5ACA1 4IV3C 1H0BA 2ZX1A 1IS5A 2FMYA 4DY5A 1OA3A 5AFEA 4PLNA 4MH0E 2WQ4A 2G9FA 3C2UA 3OYWB 1ULGA 2E53A 1H8TA 2VQ0A 2DTWA 3WP4A 2BNOA 1QOOA 1DYKA 1PIV2 1XU1A 4Y26A 3CJIB 1GV9A 4NO4A 1SLTA 2R49A 2CWSA 1JYCA 4L9BA 2BGCA 4I09A 4LO6B 1QDCA 1Q43A 4Y20B 3GHNA 3EXUA 1C5IA 2I07B 1S2BA 2A7AA 2DV9A 1F8VA 2NM1A 3DF0A 1Z7S1 2CYFA 1DZTA 2TEPA 1N47A 1IPJA 1NA1B 1UU5A 3BB6A 3VBHB 1ND3B 4XZPA 4D69A 2QDNA 1GANA 5A32A 5FRAA 5E8AA 1QJX2 1CONA 2GC1A 5DZEA 2YHJA 1FT9A 5DUVA 1WW6A 1KFUL 4ZU4A 2HEYF 2WKKA 5AC91 4OLLA 1AL21 1QJU2 1RUG2 2A3XA 3QACA 3WW3A 1X8EA 4AVTA 4AG4A 3U07A 3DKWA 3K48A 2WFF3 4JGYB 2QUOA 1IZ3A 4LUMA 4WZFA 1CD3G 1RUH2 5JOXA 3ILFA 5JAXA 1NCQA 4XF9A 4FP3A 5EV7A 3VBOB 2ZHNA 5BNNC 1AYM1 4RS5C 2IXJA 2HEWF 2BWAA 1RJ7A 4BM8A 4AI8A 1RC6A 2R16A 3FBMA 4XFGA 1UIJA 3H0OA 4LO4B 1RB8G 3BTAA 4EWEA 1OLRA 2VQAA 2UURA 4ZU5A 3M3QA 4HVRA 5CFCA 4DZGA 4KNCA 2O1QA 4XMIA 3H7YA 1Q8VA 4R9BA 3S0MA 1X7NA 2P17A 4AHWA 1MS0A 1OFNA 1RUJ1 3AP4A 3D0SA 4DRRA 2A6YA 2WFF1 3JCIA 4AGGA 3PVBB 2D7FA 4LHKA 3W59A 1N3OA 1FMD2 4HKWA 2MPFA 1LR5A 5CB7A 4XDQA 3WHUA 1POV3 4B3NA 1ULEA 4KG0A 5FOBB 4AFBA 4JRLA 3VUOA 3RYPA 1AF9A 1RUC3 4IETA 4JVAA 4Q0QA 5AVPA 4AFDA 1H1AA 1H4HA 1PO12 4Q26A 1PGSA 4JC1A 3RS6A 3VBUB 4WVZA 4KU7A 1D2SA 3WZ1A 1REFA 2LUWA 1W6QB 1LODA 2A6VA 1R083 4CDUA 4K8FA 4FQZA 4P14A 4YM2A 4QU2A 3JBG1 1WLWA 3M70A 4YGEA 2JG8C 1XYOA 1F2NA 5AVAA 1PMIA 3B69A 4YVWC 2B9UA 1IOAA 3FBYA 5FQ0A 2CGOA 4QGMA 4AEDA 3ME2A 4MVTA 1CN1A 3GBFA 1PVC1 1C8M2 1UPSA 5JOWA 2G9GA 1AR61 3ZXDA 5JWPA 1AR92 2EF6A 1HXS1 3ZXLA 4Q0PA 2EALA 4EN9B 1R1A2 2R072 4FPJA 1ZZBA 4Z1VA 1U5IA 3RYRA 3CF6E 1Q8SA 2JG9A 4HVOA 5BPXA 5EJ3A 3AYDA 4LULA 1NCRC 1TME2 1H1IA 4WM8A 1ENRA 5J37A 5IK8A 4LUKA 1OQDA 5KHIA 4XJAA 4UW6A 4XOGA 3H8UA 1Q8QA 2Y0OA 1GKBA 4LO7A 4XXAA 3SCHA 4ES8A 1O7FA 3POSA 2RE9A 3M3OA 3APBA 1DLLA 4QQ2A 4WVWA 4M3CB 2RHPA 4D94A 1RUI2 1KITA 5C8CB 2RJKA 2OYZA 2WS92 1ZA4A 4FXGB 1VBC3 4WV8A 3S7EA 3O7OA 3K51A 3ZN6A 4Q0UA 3TOJA 3I2DA 3IT8A 5GJ6A 5JZGB 2OVUA 4OHZA 4BOWA 4BMBA 2ZKLA 3OTFA 2DVFA 4BIOA 5ABJB 1AL0G 3RMYA 1TMF1 3MI8A 3E6CC 3JZVA 4M00A 5J09A 4ORFA 1CGPA 2B8MA 1LU2A 4KGQA 4G9SB 1PZ9A 4E4ZA 4QM8A 1WA4A 3AMMA 3VBFC 2RS51 2I74A 4BLIA 1N1TA 4AFAA 1WBFA 1SLLA 4PLMA 4IEPA 5F1RA 2NQYA 3WQ0A 3RI8A 4UBHA 3AZWA 2VH9A 1GLHA 3ZFGA 2YC0A 2QVSB 1PIV3 5EWSA 4K3UA 1MR5A 4XHXA 4FPOB 1CPNA 2XWJB 4HKOA 3ZYPA 3AFGA 2ZGKA 1SLAA 4OHWA 3AP7A 1O5LA 4QGLA 2WC2A 4I0BA 4RGGA 3LA2A 1TQ5A 2PHLA 1YIFA 4XJ8A 3TBDA 4LLFA 1QXJA 3O12A 4QQLA 3I54A 3ZFFC 2HWE1 3BOWA 4WVVA 1FYUA 1ZM1A 4FP2A 2RM22 1LECA 2XJQA 4YZ1A 3DL3A 1M06G 2EIGA 4QD2A 4FBFA 4FO9A 4RS5B 2WNVA 1MZ5A 2ZGQA 2QE3A 5H9SA 2C0ZA 4BHPA 1RUG3 3AK0A 2PHUA 4Q4W3 1NQDA 5E1RA 1K5MC 4TZDA 4YG0A 4CTEA 3FLTA 4RQPA 1Q3EA 2JICA 2XLGA 4OI2A 4P9WA 3HD8B 3HAGA 1C1LA 2HWB3 2CY6A 1SBFA 3S30A 3WP5A 3AYCA 3LA3A 1RUH3 2A5ZA 2Y38A 3WG4A 3B93A 1GFF2 5J48A 4C0HA 3ZIXA 3NKTA 4HZFA 4QPIA 5FO8B 2XUMA 1ULCA 2ZKNA 3RJRA 1SEFA 5HXVA 1O3RA 2Y0IA 3WINE 5BNOB 1QJX1 2AYHA 4YVSB 3NW4A 2HWD2 4HL0A 3VBRA 1Q56A 1XNKA 3HT2A 4NOTA 4XETA 4Z07A 1HRV2 2PLV1 4NWWA 3VLBB 1QJU1 1AZDA 1GBGA 1Z78A 3MF6A 1AX1A 1V6LA 4A7ZA 5A3MA 1SLCA 4B4PA 2BFUS 4ASLA 1TEIA 1WD3A 1JOJA 1FMD3 3BPZA 2MEV2 5BNQA 4C90A 1SFYA 4LO5B 4PCRA 3ZSKA 4OHXA 3C3VA 4ATEA 3VDDA 3PJQA 5KXDA 5JI9A 3ZXJA 4KQ7A 1XRUA 4XQDA 2OA2A 2RS12 5C4WA 2B46X 4JDOA 3QOPA 4IQPA 4MLOA 4LT5A 4FPHA 4AGRA 1B35A 2Q5TA 1ZZ7A 3NO8A 4DMIA 5JOYA 2IZWA 2EAKA 3GBWA 4TLFA 4KG8A 4TYSA 2XLAA 4FOYA 3JB4C 4CEWA 2VNOA 1H8TC 2XL9A 3FZ3A 4MGKE 1Z0HA 4XHBA 5FO7B 2ZMKA 3ST7A 5D8AA 2I45A 5BNPB 4RFT0 4YW1A 2Z2SB 4ISRA 2WA3A 4Y22A 4GH4C 1FNYA 1FMD1 1UZYA 2VPVA 2CTVA 5EZWA 4W65A 1PGW2 1HLCA 1BK1A 2JKBA 1C8M3 2PYTA 2NLRA 1CAWB 4OZXA 2CNAA 4E2SA 5HBAA 5K7PA 1PO11 4XJWA 5LRRA 1R1A3 2R073 3HMYA 1C57A 1BCXA 2WNUA 1R1ZA 1L3JA 1RINA 1A3KA 2NMOA 1HW5A 3GHMA 4BE3A 1ULFA 3D5OA 3O5SA 3MIEA 4YZ2A 2DU0A 5I0RA 3KSCA 4M3CE 2BEOA 4MSVA 1QNYA 1FOD3 4LE3A 2HWC2 4IEOA 5J3UA 3LZZA 1JUHA 2WZR1 1OLQA 2YDEA 2TNFA 1AL22 4GIQA 4BLJA 4AI0A 2Q1ZB 1HV1A 4K1ZA 1WLDA 2DF7A 4AXOA 1UU4A 1YO8A 3DGTA 2AGSA 1C8M1 2Q4SA 3IDEA 4FOQA 3TAYA 2X5IB 2Y26A 3H50A 1OSGA 1XU2A 1RUI3 1AR91 1NCQC 4AVAA 3TB0A 2WS93 4GXLA 2R071 5JMCA 1AYM2 1UIKA 4UBGA 4WM7A 2R30A 2DCKA 4N53A 1QWRA 3B9IA 2XG3A 3BU7A 3SCFA 3N4MA 5L19A 1TME1 4FQ4A 1OOPA 1KDMA 1J1TA 4NR1A 4N90A 2W0XA 1YI9A 2QZ2A 5CFCC 3ZIWA 2BBVA 3QBQA 3MFCA 2IXLA 2DCZA 2HYKA 4Q4Y2 1ASJ2 4HETA 4WZCA 1X33A 1PK6A 3AXEA 1RUJ2 5T5PA 3KLSA 4CYDA 4FTEA 2BQPA 4HBNA 5L7OA 4I0AA 4JGZA 3WP3A 2K9ZA 4FSJA 1RUI1 2RR12 2ERFA 2OUHA 4LE4A 2WS91 5LK7B 2R32A 1SLIA 1RUNA 1MS3A 4ATFA 2IC1A 2E6VA 1K5MB 2CAVA 3UL2A 2GMPA 2ZX4A 4PDWB 5JIUA 4MGIE 1EAH2 3WG2A 3B01A 5CG8A 3ZMOA 3M2MA 4WBBA 2GC2A 3WQ1A 4CDUC 3E5XA 3HN1A 3BODA 1S1AA 3ZN5A 1QY4A 1YFWA 2TBVA 3JBG2 4CEYA 3H1WA 4COVA 4NVPA 2UY8A 5F5QA 5LEKA 5BYNA 1N1YA 3AYAA 4OHYA 3EHKA 1VB4A 3OGJA 2OZJA 4AEDC 4DS0A 1PVC2 1D4M2 1ZRRA 4IEVA 1FAYA 1KFXL 1AR62 1EV12 2JJ6A 1UAIA 3GZAA 3UKTA 1HXS2 1URXA 1V6NA 1ZYBA 4OVEA 3VKNA 2F4PA 3H1YA 4LBJA 3AJYA 4GMP0 2XBO1 4BA6A 2FHRA 3NVCA 2HWF1 4DOUA 4CDXA 2JG9C 1JUIA 2RM21 2JEMA 2XVLA 2H0BA 4XMAA 2DWRA 3FX3A 4WM8C 2ZHMA