4LUMA

The crystal structure of the p132v mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
190
structure length
190
Chain Sequence
MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPVYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
publication title Correlated mutation analysis as a tool for smart library design to improve protein performance.
rcsb
source organism Pyrococcus furiosus
total genus 42
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lumA00
4QMAA 5I0TA 2P17A 4FAHA 5FPZA 4WBBA 3U0ZA 4R52A 3I59A 1O4TA 4QXKA 3E6DA 1CX4A 2GC1A 3USSA 2IXIA 3BU7A 1X8MA 1WGPA 2Q4SA 2UY9A 5AVPA 1XRUA 2PAMA 4LUMA 4IEYA 3SCGA 1ZZCA 2D93A 5JR7B 1RUOA 3BPZA 2Q30A 3LA3A 3ZDSA 2D5FA 2MPFA 2XHKA 1CAWA 4QGNA 4EWEA 2GC3A 4XFBA 3KCCA 4YRDA 3FWEA 4E2SA 1X82A 2BNMA 3ES1A 3NKTA 4I2OA 2H0VA 2CAVA 5FPXA 3MZHA 4XFHA 2WC2A 3LZZA 2PAEA 3WW4A 4HLTA 1V70A 2UYBA 3FZ3A 1LKNA 2FMYA 4PIYA 3RYPA 3SXWA 5LEJA 5FQ0A 1OD5A 1SEFA 1YWKA 3E5UA 2PHDA 2OPKA 1CGPA 4WZCA 2PAKA 3H3ZA 3MPBA 3U11A 3CL1A 4TLFA 1J58A 4IESA 4LA2A 3E97A 4IEXA 3KGLA 3SMHA 4HVOA 3EHKA 3ES4A 1WA4A 2EVXA 5EZWA 2OZJA 5EFUA 1UIJA 1CAXA 2QCSB 3QACA 4AVAA 2D40A 4IEWA 3RYKA 5KHIA 5KHJA 4I0BA 3RPQA 4QGLA 2VQAA 4KWLA 4XFFA 4H7LA 4JTNA 5T3NA 2WFPA 4HBNA 3HT2A 1OMIA 1RTVA 3E5XA 4HSLA 4MUVA 2C0ZA 2GC0A 2XGXA 1O3QA 4AVBA 4Q0SA 5KHKA 4F8AA 3H1MA 4EV0A 3NW4A 2QDRA 3H7YA 1O3TA 2MHFA 1H1IA 1ZRRA 3HIFA 4E2QA 5C8WA 5CVRA 1PM7A 3PVBB 3I59B 3JZVA 2BEOA 4MGZE 4P9GA 2PFWA 4Q0VA 3CEWA 4IEOA 2HJIA 3UKVA 2I45A 4FT8A 3DL3A 4BH9A 4ZU5A 4RD7A 3HT1A 5J7MA 4HSJA 1X7NA 4BIFA 3UKTA 4KU8A 3WW1A 1O3SA 3E6BA 4A2UA 4Z07A 2IC1A 4XFCA 1SQ4A 3WW2A 4MV2A 2FQPA 5BUVA 1NE4A 4L2NA 4LULA 5FLJA 3RZZA 1QY4A 3R6SA 3SCHA 3IDCB 3IDBB 5FQ0B 4ORFA 4BHPA 4OLLA 5I0SA 1CAVB 4AQ2A 3CO2A 4B29A 4LUKA 3WW3A 3EJKA 2XLGA 3CLPA 3D0SA 4MGKE 5I8YA 4PIZA 4EWAA 3I54A 3U10A 1YUDA 4HN0A 4IEVA 2MNGA 3FJSA 2BYVE 4HMZA 1DGRA 4I09A 4Z82A 1FXZA 2IXLA 4Q29A 5I91A 4JTOA 1NYWA 4YSFA 2H6CA 1CAXB 2EAAA 1XE7A 1YHFA 3NJZA 1ZNPA 1GQGA 3D82A 1EY2A 5LEKA 3ETQA 1VR3A 4EWDA 1OI6A 3PLQA 1CAVA 1ZREA 1Q5OA 2GC2A 5BY5A 4UXAA 1LRHA 5I8TA 3RYRA 3ELNA 5JSRA 1Y9QA 2Q1ZB 4IEUA 1YFWA 3C3VA 3H1WA 4IEZA 5J3UA 3M70A 3GBFA 5BXXA 3IWZA 1RL3A 1SFNA 4DINB 3BALA 2XL9A 5K8SA 1ZZ8A 2GH2A 1PMIA 3OCPA 2OA2A 4IEPA 1ZVFA 2XKPA 5HI0A 1DZTA 2B5HA 1YFYA 2V09A 1UPIA 2Z69A 3PNAA 3QOPA 1X8EA 4PIXA 1LB2A 3FX3A 4E2GA 4XF9A 4BYYA 1YFXA 3H8UA 5I0UA 2BNNA 4MGYE 2K0GA 2PYTA 4NVPA 2ZCWA 3M3IA 2OZ6A 1TQ5A 5FLHA 3H3UA 5I8SA 1Q43A 3KGZA 2OYZA 1UD1A 1NZCA 1ZX5A 1GQHA 4WVZA 4KL1A 1RGSA 3OGJA 2N7GA 4MZUA 4OFGA 4XF0A 2UY8A 4JVAA 1IPKA 1I5ZA 3NSTA 3RDIA 4J1WA 3KSCA 2PA7A 4LA3A 2VECA 4N9IA 4MX3A 2IXHA 4F7ZA 4HVRA 4MGIE 4FBFA 1ZRFA 4X6QB 1NXMA 2H6BA 2QJVA 5LRRA 2XKOA 2XLAA 4XF3A 2B9UA 3MYXA 2GU9A 1IPJA 1ZRDA 4ONUA 3IBMA 2D5HA 3OTFA 4XF4A 1O5LA 4KU7A 3IIAA 3BB6A 3EQEA 5KBFA 4QM8A 1J1LA 4CYDA 1RUNA 3L2HA 2CGPA 3FFQA 4I02A 1QWRA 1EYBA 2IXJA 3E6CC 3ST7A 5JAXA 1UCXA 4I0AA 1O5UA 5JSOA 4MH0E 3SHRA 4YARA 3CF6E 2CAUA 3HQXA 1ZZBA 4ZU7A 1U12A 1ZZ6A 2UYAA 4AQ6A 5E1RA 3E5QA 2GZWA 2DCTA 1YFUA 3GYDA 4XETA 3MDPA 4D7SA 1ZRCA 1DZRA 4HZFA 2ET1A 1JUHA 1CAUA 2PQQA 2ETEA 4I01A 4UBHA 2XL7A 4IERA 3LA2A 3EO6A 3TNPB 5JSPA 5J48A 2B8MA 3TNQA 3CJXA 4XFAA 2IXKA 1J3PA 2QVSB 2HKXA 5FLIA 4LTAA 1LR5A 2KXLA 4XFGA 4AVCA 3LOIA 4Q0QA 3SCFA 4QGMA 3KMHA 3OD0A 1EPZA 3OF1A 3UKNA 1H1MA 3BCWA 3NL1A 3O14A 4R8HA 1FT9A 2ATFA 5JCTA 4HN1A 4JV4A 4X6RB 4EROA 5FCCA 2BNOA 4META 3DN7A 1J59A 3FE5A 4QX5A 4O9GA 3H7JA 2ZKLA 3VHRA 1I6XA 3S0MA 4N9HA 2Q0AA 1J3QA 3LA7A 3G7DA 3S7EA 2Z2SB 5CADA 1UW8A 1VP6A 3LAGA 5FDBA 1Y3TA 5C6CA 1UIKA 2GAUA 3H1YA 3FHIB 4YNIA 3EBRA 5I0RA 4XFIA 4KWJA 5BPXA 1G6NA 4QM9A 3H50A 4Q0UA 5BV6A 1HW5A 2ET7A 5F1RA 4I3PA 3DV8A 4XEZA 4J1XA 4HVQA 5I93A 3NVCA 1OFNA 5E16A 1O3RA 2K9ZA 1XE8A 4ZU4A 3S7IA 1Q3EA 3ROUA 2BGCA 1EP0A 3D0JA 1FI2A 4UBGA 3RNSA 4O9EA 1ZZ7A 1YLLA 2XLFA 4LLOA 5KHHA 2PTMA 5D1IA 4FAGA 3B02A 1ZZ9A 4KWKA 1L3JA 1RC6A 4YYOA 2QNKA 1CAUB 3DKWA 2EA7A 1QXJA 4PJYA 4D7TA 5LRSA 2O8QA 1WLTA 2IXCA 1QXRA 2Y0OA 4AXOA 3I7DA 1NE6A 1DGWA 3LWCA 2PHLA 4IEQA 4GULA 4LEJA 4Q0PA 2F4PA 3N4MA 3H9AA 4IETA 3ACLA 2VPVA 2E9QA 1J3RA 2CV6A 2O1QA 1CAWB 5CU1A 4XF1A 4K8FA 5KHGA 1VJ2A 4L11A 1O7FA
chains in the Genus database with same CATH superfamily
2A1XA 3FFZA 2P17A 3J7HA 3M7AA 5DUWA 4NRPA 4QXHA 2ARAA 3M3OA 4FAHA 3WQ0A 1N3PA 5FYHA 3MW2A 5C9AA 1OA3A 3N7MA 5LW9A 4P9LA 5FZ9A 3RZGA 2YG0A 3HJRA 3P3PA 2RJLA 1RXGA 4LMFA 4AWDA 4EN0A 1CX4A 2YC0A 2IXIA 1X8MA 1WGPA 2Q4SA 3C8XA 5AVPA 3PJQA 2D6MA 4E4ZA 4ZHNA 1LHUA 3VBSC 3VBFB 1OVSA 1ZZCA 2G9FA 1KQRA 1WMDA 3KHCA 4WM8A 2ILMA 2XHKA 3SH3A 4DOUA 3ZYGA 1RHI1 4PBPA 4DY3A 1JZ4A 2BBVA 4JCKA 4LKFA 4LO6B 5F2WA 2XVLA 5A1FA 2VMHA 3POBA 4P08A 1GBGA 3OBTA 4CDWC 3ZO0B 2ZGMA 4YVWB 1W8HA 2G9ZA 3ES1A 4AVTA 2H0VA 3BYWA 2CAVA 4XC9A 4Q8LA 3MZHA 2VCAA 1IKQA 1M4WA 2RDSA 5GLWA 5K0UC 2VQTA 3LZZA 1AR61 2PAEA 2X53S 5DQ0A 3BTAA 2G4IA 4X8NA 5FYCA 1QJX3 4DQAA 1FOD3 1LKNA 3HVDA 3SXWA 5LEJA 5FMOS 2J7MA 4AAXA 4LBQA 5E8AA 3A23A 1G9CA 3HN1A 2D3PA 2J42A 2PHDA 1ENRA 2OPKA 2PAKA 4NAMA 3LOBA 3VKOA 1LHNA 3H3ZA 3MV01 4OMCA 4EN9B 1BJQA 4TLFA 4MLOA 4IV3C 4XJWA 1PO23 3E97A 3PIGA 4XMIA 4CDUA 3OUHA 5DUUA 2JDNA 3J8F3 3FBMA 3NAPB 1W2NA 2AACA 4IGOA 1ODMA 2G1MA 5FP8A 1PZ8A 2I2SA 5LATA 3RQ0A 5JXHA 1BMV2 4TSVA 2JG9B 4NPMA 3ES4A 5A3WA 2EVXA 1BZWA 2X05A 4KWUA 5F5AA 5EZWA 1WCQA 3IN9A 3FLRA 1RUD2 1UYXA 1UMIA 4AVAA 1UXXX 2AREA 1YO8A 2IZWA 1W6QB 5C4WA 3RYKA 5KHIA 1V00A 1W3VA 4RS5B 4CPBD 2WNVC 2RE9A 2D43A 2XJVA 4I0BA 3RPQA 3WG3A 5DDJ3 4CEYB 4JQRA 1LEDA 1COV1 3MIBA 4QGLA 3ORJA 1AXKA 2ZGKA 4OUEA 4MO3M 2C26A 1MEC3 2BDRA 4HBNA 3U1XA 4CA9A 1JN2P 1OVPA 2VZVA 1AXYA 3AP5A 3OEAA 4OHXA 1ULDA 4RFRB 3WP6A 4K20A 4P9WA 3S5AA 4I30A 1VBB2 5JOWA 2BGPA 1QMJA 1G86A 4F8AA 2CNAA 2W94A 3VD7A 5LA0A 3FHAA 5GZEA 3H7YA 1O3TA 4UW3A 1VMHA 3U14A 1ZRRA 3N9OA 4NN0A 5FFOC 4RGKA 3Q9OA 2VZSA 1NCQB 3CJIC 2KA3A 4B4RA 1US2A 2QQJA 4R9CA 5CVRA 2QE3A 1OURA 3TN93 1PM7A 4OYUA 1OLME 4MGZE 4JQTA 3CHXA 2HWC3 5FZOB 3UT0A 3T0DA 5FMOL 3RWNA 4CP1A 1JZ3A 2XUEA 2QQLA 3CEWA 4P9XA 3I8TA 1TG7A 2HJIA 3WDXA 2RMU1 2I45A 3DL3A 4NJ4A 3VBSB 1S0FA 4FPCA 1H30A 5JIUA 4HSJA 4BIFA 2WSVA 1SDWA 2ZX1A 2VBDA 3P1IA 2D6KA 1BEV1 1PO12 4W65A 5HBAA 1IS6A 4Y5TA 5A3PA 4COYA 1AUYA 3AJZA 2GNMA 4CDWB 3B00A 3WW2A 3O1PA 3GZAA 3AKTA 4MV2A 3PMSA 5IVFA 4PHZA 4YM1A 2XB6C 3SKJE 2WNOA 1NE4A 1URXA 5K0UB 4LULA 5FO8B 3N3HA 5H9PA 1GNZA 2I07B 1M06G 3WZ1A 1T6GC 3IDCB 1ENQA 2F6BA 2WNEA 4FPYA 5FQ0B 4BHPA 2QZ2A 5L9RA 2VTXJ 1SZBA 1AX1A 3USUA 2HEYF 1D4M3 4EJRA 4LO4B 2ES3A 4K1YA 2WQZC 4LUKA 4OVEA 3EJKA 4QWNA 1GZWA 4QKBA 3WX5A 3AZXA 4IV3B 1ASJ1 2IVIB 3CU7A 1I1EA 2NP0A 2QQMA 4MGKE 4LBOA 4W6WA 3TEZA 2XDVA 3I2KA 1W9SA 3WF0A 4DNYA 2EIGA 3BI3A 1VBD3 1YUDA 1UN1A 1PMJX 2ZBJA 3OY8A 4HN0A 4LKEA 5EIYB 1VBA3 4I09A 4Z82A 1UZYA 1BBT2 1FXZA 4XYXA 3G6JB 4Q29A 5I91A 1ODNA 4B7KA 2HWF3 4GB33 4XQWA 2B9VA 2BQPA 4K7JA 4QHZA 5F3GA 3WNXA 1IHMA 4FTBA 1XE7A 1QNYA 2CU5A 4MYEA 5EJ3A 5IVEA 3JB4C 1ZNPA 2WNVB 4B3NA 2R072 3H8RA 4UWDA 1QU0A 2RS52 3L2YA 4A3XA 2B46X 5LBBA 4QQHA 3WDYA 5G04L 1GP4A 2JDMA 5FZAA 1CAVA 1APNA 1YQ8A 1LRHA 1POQA 3K51A 4N7IA 4LBLA 3WF2A 4LHNA 1WW4A 3ETPA 4RQPA 3KT1A 1YC61 1CQ9A 2C9KA 2GNTA 1EAH3 2JE9A 5A32A 3POWA 2XONA 2YGLA 3MW3A 4XHBA 1ND2A 1WMXA 1R083 5HXVA 1V6KA 1MS0A 3IWZA 1DP0A 4XUQA 5F5IA 5EJZB 1RL3A 1SFNA 3NJYA 2FMDA 3BALA 4XOGA 3AVSA 3POJA 2JX9A 3HAGA 3VZMA 4E4DX 5K8SA 1H4HA 1JXNA 4UT5A 3V65A 3CJIB 4QX2A 2VZOA 4TN7A 1N3OA 2VNVA 2VY0A 3Q8FA 4HL0A 2CWSA 2VVEA 4JGYC 3OCPA 1REFA 1NG0A 4IEPA 4QPWA 3J7MA 3AXEA 2BOJA 4CP0A 2JE7A 1LU2A 2B5HA 1HRI1 3ZFGC 1BMV1 3T1MA 4PF5A 3A0KA 2Z69A 1PNGA 2ZEWA 1DF0A 3N9MA 4ZXEA 1UL9A 4A42A 1W8ZA 4FOWA 5CG9A 3UGGA 3AZYA 4YGEA 2VOKA 1RUD1 4MHUA 5FYBA 2BNNA 3ZFEA 5M0TA 4XJZA 2WLQA 5FWJA 4FFHA 4XZUG 2NLRA 5FY4A 1LHVA 4CDXC 4GXLA 4Z1VA 1OLQA 1AJOA 4CU7A 1UD1A 2J1AA 2NYYA 5ABJA 5JPMB 2WDBA 1ZX5A 3KHBA 3O12A 1AZDA 4QX8A 5GZCA 1KDKA 2RM23 1RGSA 3OGJA 4LE4A 4M0HA 1UZ0A 3JBG3 4OFGA 4S2FA 4XF0A 2D6OX 3V0BB 4INDA 2UY8A 4CUCA 1CONA 4FOVA 2JDUA 3KSCA 2PA7A 5DAVA 4LA3A 2OKXA 3THPA 1VBB1 1AF9A 2PHFA 4QKDA 4AHZA 1FPN2 1Q8SA 4CU6A 3IMMA 1KFUL 2HBUA 2WZ8A 1K5JA 3B69A 2Y33A 4CXXA 4ET7A 5CFCA 5FP3A 4Y22A 5BNOA 5GZFA 1NXMA 2H6BA 2QJVA 3H3LA 4X8PA 5GZDA 1NQDA 2BGOA 1PZ9A 1DFQA 1IPJA 1AL0G 1GANA 2VTXA 5CKQA 4YM0A 4YW3A 2J1SA 1O5LA 3I49A 2A6ZA 1UNBA 3BGAA 3BB6A 4A44A 1SBEA 3VDDC 3T30A 3VBHA 1NLRA 4Q4X2 1RUNA 4DS0A 1H6XA 4AE2A 5FR3A 4LHLA 1YI9A 3WG4A 3TB0A 1A8MA 1RIRA 5FZ8A 3P6BA 2FDGA 1IGOA 2X29A 1UCXA 4EQVA 5C8CA 2FDJA 1O5UA 1PGSA 2NPIA 3KD4A 3KF5A 2HWE1 1PO11 5ANNA 1C1LA 3BPSA 3HQXA 1ZZBA 4Q2FA 3UL2A 4ZU7A 2PHUA 1OQ1A 2KM2A 5CAZA 5F8PA 1ZZ6A 4XVHA 1UY2A 5C33A 5E1RA 3E5QA 5FPAA 2HWB2 1WD3A 1XQNA 2UU8A 3GYDA 1XYNA 2GNDA 4JDOA 4L92A 2QTWB 3I2HA 1UMZA 1DZRA 3GBGA 1JYVA 3SC7X 2ET1A 1AL22 4E8DA 1JOBA 3ZYFA 2GN3A 4JKMA 2ETEA 3FL7A 2Y6FA 1TZOA 4I01A 4UBHA 3TEXA 3VKMA 1QJX1 4P14A 1UYZA 1FOD1 2VD7A 2WWJA 3EO6A 3VHNA 3F2ZA 2WT1A 5J48A 1JYCA 2XWJB 2ZGSA 1VPHA 3DYOA 2VNGA 3FUQA 4AHWA 1Q8PA 4V2WA 5FPLA 2EIDA 5HCBA 3WDVA 3B9IA 4XFAA 1PNFA 3ZKYA 1TMF3 4JGYB 2FDKA 1FMD2 2RS33 5FZMA 4A3ZA 1J3PA 4M4RA 2VQ0A 2ZGTA 1H2NA 4ISRA 3M3QA 4Y1YA 1SLIA 4GZ9A 4LHKA 4N53C 1REDA 1WZXA 1LR5A 1RVF2 4LTAA 2ORXA 4NRMA 5IWFA 3QD6A 3ZFGB 2VOTA 3LOIA 4XUTA 1QJU2 4KQ7A 3UV9A 1QNWA 3N7LA 1IZ3A 2DVDA 4DFSA 4ZS3A 2VMEA 4NR1A 5EQUA 3KMHA 3OD0A 1JHJA 2YDEA 4WM7A 3VBUC 5IK8A 1EPZA 2AC1A 1HQLA 2QQUA 3ZMOA 1NX9A 4R8HA 3V0AB 1EPWA 2RS51 4CDXB 4RFT0 2ATFA 4JX0A 1UOJA 1JH5A 3SISA 1GMMA 4HN1A 3ALQA 3MLKA 4H55A 4SLIA 4ZPIA 5KC5A 3OJBA 4C1XA 2LM3A 2EXHA 3VKLA 1S0JA 1PIV2 4EZ4A 4JDNA 3K3OA 2Q8DA 1UX7A 2W0XA 4FXKB 4Q27A 4L97A 3WT3A 3HN3A 4Q1RA 1VRH2 5CBLA 2BBAA 2OUHA 2PLV2 2WFF3 4O9GA 2CSGA 4DPNA 3KCXA 5J36A 5FPUA 3LQCA 4ASLA 1DQ5A 1Q56A 5FUNA 4CCMA 2DWRA 2Q0AA 3LKJA 3RVHA 1CVNA 3MUZ1 2DF7A 3KCYA 3LA7A 4QX7A 4YVWA 3S7EA 4DXSA 2PHWA 3K48A 2JKXA 4QDSA 2Q8EA 5CADA 1L7LA 3V56A 2C9AA 3VDAA 1UW8A 3LAGA 1U5XA 1UZVA 1Y3TA 2JECA 4BXFA 3H1YA 4AF9A 5ERLA 3FHIB 4YW1A 3BIWE 4P5YA 3TN91 3VKNA 2KD7A 2VGDA 1RJ8A 4UYBA 5FZLA 3N35A 3VDDB 1PX3A 1TNRA 2WN3A 4Q0UA 5BV6A 3VD5A 4FSJA 1GUIA 3Q8AA 4I3PA 2IUWA 5FZ6A 5GZGA 2WLPA 1FNZA 4UOJA 3U4XA 5FY9A 3TBDA 2DFBA 1OFNA 1P8JA 5E16A 3K4AA 4AEKA 2K9ZA 3LEMA 2VMDA 5DUXA 4BDVB 3NAPA 2D6LX 2ZHLA 3ROUA 3T0AA 4FPKA 1FI2A 1SHWB 4LITA 1ZZ7A 2JG9A 3K3NA 3KZ4C 3LSDA 3OYWB 1LGNA 3AX4A 3H8OA 1HX6A 4QPGC 1SLAA 3RGBA 2C24A 3B02A 3ON7A 3O0WA 2E7QA 4GAZA 2VOWA 1W6QA 1L3JA 1ND3C 1RUF3 5A3UA 5IHRA 3D5OA 1JYIA 1CIYA 3BODA 4CEYA 1QXJA 3U37A 3RSJA 4D7TA 2GP5A 3CZUA 4QAWA 1WLTA 4CEWC 3ZPOA 3I7DA 1NE6A 3PIJA 1HRV2 4L9BA 5IK7A 2R062 3PTRB 1D4M1 5FYVA 3H8XA 4GULA 2DUQA 1RYYA 2F4PA 5EV7A 3H9AA 4CP2A 4NHMA 4JRLA 4PQ9A 3ACLA 3AXDA 3U78A 1TEIA 2VPVA 4WVMA 4N53B 4UW5A 3GZTB 1W6NB 4AI8A 2CV6A 4JKKA 4URTA 1K12A 3K4DA 1CAWB 3SKVA 4LIUA 3WQ7A 2BW8A 5KHGA 4AI0A 2VUJA 1H4GA 4NOTA 3I2IA 3VBUB 2DU0A 4QMAA 4BE3A 3W9AA 5FMDA 1NCQA 1WKYA 4WBBA 5JXIA 3U0ZA 2V5DA 5FO7B 1WW6A 1RHI2 5A7WB 4QU2A 1POV3 4UAPA 4CRQA 1UU4A 2C5DA 2LROA 1O4TA 4HETA 5FZOA 3E6DA 2RS13 2F17A 5FO9B 5F6LB 1RUH3 1CD3G 2ID4A 5IFTA 2RV9A 2UY9A 3MW4A 5HCFA 2A6WA 3K2OA 4LUMA 4AFCA 1RB8G 2VOVA 3I3BA 4IEYA 4GJYA 3SNMA 1AL21 5LB6A 2D93A 5JR7B 3LA3A 2Y6LA 4NIHA 2D5FA 3IAQA 4YM2A 2CY6A 3N9QA 4K40A 4QGNA 3VBRC 3C7HA 2GC3A 1K5MC 5CFDB 1C8M3 1N3QA 1O4ZA 1OPMA 4QB6A 1JU4A 2W91A 4CDWA 4P00B 1W8WA 1HXS2 3JD73 4E4SA 2G9GA 1CPNA 4E2SA 4YVSC 2RDQA 1OOPA 1AYM2 1QJY2 1XE0A 1XOYA 2FCTA 1F31A 1LOEA 3JUUA 3DYMA 3Q8BA 4LPLA 3ZIWA 3WQBA 5K0UA 2XPJA 2WC2A 1LENA 3NO8A 3D4KA 1U5YA 3WW4A 4UF0B 1LOFC 2SLIA 4DZGA 2ZKNA 3QH7A 5FWEA 3RFRA 2HWD2 2YU2A 3NQHA 4KBBA 5FYZA 4WVVA 5FQ0A 1DYOA 3HNBM 1QJU1 4NPRA 3E5UA 3QBQA 3KV5A 3ZVXA 1ULCA 4Y20B 3MICA 1HN1A 4DUXA 4D0QA 1EV12 3CL1A 1L7QA 3VZJA 2QQIA 1WCDJ 3LEIA 4IESA 2QKDA 4LA2A 5EWSA 4K3UA 5JOYA 5F32A 1VBE2 4IEXA 1QEXA 3H42B 1YIPA 1COV2 2MEV2 1GICA 2OUJA 4OMDA 5FKCA 2RDRA 3SMHA 4BMBA 1QDCA 4DUVA 3AM2A 3WF3A 3M4FA 2ARBA 1PIV1 1ZBA2 2VNRA 5C5TA 1WA4A 1HJFA 5FZFA 4QPGB 1IS4A 1ULGA 1XNTA 1DYKA 1VRH1 4IEWA 1ND3B 1LNSA 2PLV1 4WVWA 4D69A 2RHPA 4OQ9A 4COZA 2R0FA 4V2VA 5IVBA 5G05L 5KXEA 5ISLA 1W9TA 1S4CA 3POEA 2ZS6B 4CEWB 4OQ8A 2ZMKA 3LDRA 3WD5A 4BLIA 4H7LA 4JTNA 4OUSA 3NNMA 1RUC3 2HEWF 2WFPA 4IV1A 2W1SA 1HV1A 4E8CA 4D94A 5E88A 2VCMA 2W68A 1UMHA 3E5XA 4HSLA 3D3AA 3RJRA 5DAPA 4MGQA 3J4UH 4GH4A 4KNCA 1AR83 3OPZA 1DBNA 1RUG2 1JZ8A 3TWIA 1O3QA 2EXJA 1ONAA 3VKFC 5KHKA 3GZUC 5L19A 3B3QE 1HDKA 3I4IA 3AYCA 5DAQA 5FP4A 1XNBA 2X5IA 4E2QA 1GP6A 4D6RA 3CJIA 4GMP3 2A5ZA 1S0GA 2VZQA 2OVUA 2YC4A 2Z4FA 2JD9A 3OGSA 1PGL2 5AFEA 4Q1PA 2XOMA 3HMYA 1YQCA 3HWJA 3PVBB 4IE0A 4PI0A 3A21A 3I59B 3URFA 3VN4A 1OXCA 4P9GA 1W8TA 1Q8QA 1FX5A 4KGGA 1PMHX 2V73A 1CPMA 2VH9A 3MF6A 4Q0VA 4P5HA 4BIOA 3T3YA 3VHOA 4RSUA 4AFBA 4FPHA 2E53A 1S0DA 4D6SA 3ABZA 1CN1A 2NZ9A 3HT1A 4LQRA 1A8DA 3KT7A 1AR73 1OKOA 2VC9A 5EXOA 4HOOA 2P34A 4LLFA 3VBRB 1SCRA 3E6BA 5K4LA 2A7AA 1K5MB 3FLTA 4NHLA 5A7OA 1STMA 3NNLA 5J37A 3RZKA 4FFGA 2ADEA 1SQ4A 1KITA 1LJ7A 2V5YA 3N7JA 4FO9A 2RDNA 2BFUL 1BLZA 2J1VA 1X33A 2WR9A 4IW3A 2QQPA 1HRV1 3AYDA 1C28A 2R061 3DUIA 3R05A 4YW5A 2VZPA 3BTXA 4YFWA 3THCA 4XACA 1ASJ2 2X8KA 3AL5A 4RHV3 3HPNA 2A71A 4FPGA 3ZKUA 1QY4A 2RS31 5D8AC 3SCHA 1S0EA 1WBFA 4ZKTB 3O1TA 4CCCA 3I2FA 1CZVA 5FYIA 2HH9A 2WO2A 5AC93 3KWVA 1BYHA 4P9JA 3JXSA 1LODA 2W52A 5T55A 5I0SA 4GWNA 5JWPA 4FP3A 3AMHA 4QHBA 3CIHA 3AYEA 4AQ2A 5LA1A 1RJ7A 4PI2A 1CX1A 3KQRA 1FYUA 4Q4Y3 4OHZA 2H0BA 4PCRA 4Q4V3 4V1PA 1IG3A 3DPRA 3W21A 4EWAA 5LK7B 3W58A 1XNAA 2R1BA 2RJ2A 3PVNA 5IVYA 4A7KA 4A41A 2VVDA 3FJSA 3KLSA 3ZYHA 4FPLA 4HMZA 1WLWA 5IAXA 1GV9A 2GMMA 4AFDA 3GHNA 1UF2C 2DCJA 4JTOA 4OI1A 1MS3A 1NYWA 3EB7A 2H6CA 5FZ3A 3LGRA 1CAXB 4BQYA 1CIWA 2OT7A 3AP7A 1O8PA 2Y6KA 3DXUA 4CCOA 1VAVA 1GQGA 2CDPA 5KXCA 3ZLIA 5SV8A 1AJKA 1MZFA 3WP4A 1UO9A 2FDIA 1VR3A 1MQTC 4ARXA 4UXAA 1HXS1 4D6QA 1PX4A 2Z79A 3C7EA 5DG1A 5I8TA 1AYM1 1QJY1 3RYRA 5C7GA 4JGZA 3WOGA 4IEUA 5EPAA 1QJEA 3C7GA 4MGSA 3FBYA 4EN7B 2JDHA 1LOGA 3ZXKA 2PHRA 4LXLA 1HRI2 2HWD1 4M3CA 2WNUA 1RMU3 1RUE3 5J3UA 5JZGC 3M70A 3WF1A 4M00A 3VD3A 4AHXA 3IAPA 1JODA 1NCRA 2XL9A 3TEYA 5E6HA 1K42A 2DFCA 2GH2A 2JJ6A 1TME2 2WINB 5F6KA 1W6PA 5FJHA 1EV11 1MS4A 3O5SA 4Q4W2 4JGYA 3WNLA 1UY3A 3ZX7A 2OA2A 1VBE1 4PF1A 4AI3A 3J9SA 4OI4A 5AVAA 3WHUA 4CVUA 2MEV1 2WO3A 5LK5A 3ZFGA 2XBO2 4YW4A 1YNAA 3I3DA 1R092 1UPIA 3T0BA 3VBOC 1BBT3 1ZBA1 4PIXA 4CU8A 1DCSA 2EIBA 3KV4A 1ZBE3 4G3YC 2YB7A 4XF9A 5JMCA 1C4RA 1XSRA 3H8UA 1QKQA 1JZ2A 2ZOEB 1LESA 2PYTA 2VMFA 3M3IA 1QOOA 5FY7A 4AEMA 1TQ5A 3D8CA 4M3CF 4GWMA 4OHYA 1LEMA 3AZWA 5C3QA 5I8SA 3OB8A 3KGZA 2OYZA 4M0NA 5TSWA 1NZCA 1RUI2 2Q8OA 5T5PA 4WVZA 3IM0A 3O7OA 4MZUA 2DTWA 1VAMA 1OF4A 1H8VA 1BHGA 1K3IA 5E89A 1ZRIA 1YYNA 1YIFA 3NSTA 1PVC3 2XQRA 2QQKA 2XJRA 4DRVA 2FBEA 5D8AB 1UOGA 1RUG1 2A6VA 2I74A 4UI9L 2IXHA 4RN5A 1GZCA 4HVRA 3W59A 4FBFA 5IJRA 4J25A 4NIDA 3SLIA 4BQ5A 1JTZX 2GMPA 2LW8A 1JYNA 1W6OB 4ATEA 3ZXLA 3JU9A 3HD8B 1PGL1 1HB1A 3IB3A 3T2PA 4G9SB 3TYJA 2HWE2 4OHWA 1VAKA 3IBMA 2ARXA 4KU7A 4QDRA 5DZGA 3VDCA 4AEDC 5BNPC 3LPGA 1OC1A 4CYDA 5A1AA 1WWYA 2IXJA 3ZXJA 3MIGA 1F4AA 2P2KA 4I0AA 4C0HA 5JSOA 4MH0E 3CF6E 2CAUA 1R1A3 4LO8A 3ZPYA 1QJX2 4R9BA 4D8MA 1FOD2 1JU3A 3VB9A 1MQTB 1XPWA 1U5IA 2UYAA 2JDKA 2DVAA 4B7EA 5F9TA 4D7SA 4KMQA 2D7FA 1N47A 1YCIA 3HEIA 2WS93 3T4VA 4NIIA 4Q8KA 1YI7A 4HPKB 3T2OA 3WDWA 5A7NA 2JG8A 2DCKA 1GWLA 1OH4A 2OS2A 2QZ3A 2W1UA 1DQ6A 2PQQA 2XJTA 3EXUA 3A0NA 4QX0A 3ZR6A 5J09A 3J8F2 5FXXA 5JZGB 2C6SA 3ENRA 3O1MA 4EE2A 3EMRA 2Y6HA 5D2AA 3WLUA 5JSPA 2QQNA 3B93A 2YHJA 1AYN1 1MS1A 2VU9A 1WW5A 4FQ4A 1OA4A 5H9SA 2R7EB 4S2HA 3ZXDA 2IXKA 3THDA 1S1AA 3PL0A 5FLIA 4CPBA 2ZGRA 1W6NA 3PHMA 3LEGA 5IK5A 4WM8C 5DDJ2 4C1WA 1H1AA 1GLHA 2JB8A 2W08A 4XFGA 3R0RA 3H0OA 3VBOB 4Q0QA 5APAA 3PUQA 5SV5A 1JHNA 3SCFA 4XW3A 3VBUA 4AAPA 5JDBA 3NMBA 3OD4A 1MEC2 3UKNA 3KVAA 3ATGA 3NL1A 1V0AA 4HK9A 5IVVA 2VBPA 1FT9A 5A7WA 4CU9A 2YC2A 4JV4A 3LSEA 5EYYA 1Z7S3 4X6RB 2VL4A 2NN8A 4NPLA 2HWB3 5FCCA 4ATFA 5FP7A 2VZRA 2BNOA 4META 4MG2A 4B8EA 4S2DA 1DLCA 2QQWA 2R043 1J59A 1JYXA 2YPDA 3FE5A 3NNFA 3UYJA 5C3RA 2WAAA 5A6QA 4NHKA 4U36A 5CB7A 3H7JA 3TN92 1OLMA 2ZKLA 1RUJ3 1W8NA 1XNDA 3ZFFA 3IT8A 3WCSA 1E57A 5CFDA 4AEJA 2XXZA 2HWC2 4AFMA 2FCVA 2WA3A 2Y34A 2YYOA 4AI1A 1AR93 1CJDA 2E32A 5DXDA 1O91A 4XUPA 4BLJA 3GBWA 4IUGA 1TME1 1WCUA 2Y6GA 4Q4W1 4BXSV 3NV2A 2WUHA 2XMLA 4MXWB 2TNFA 4BQWA 3WXPA 4YNIA 3RI9A 3EBRA 2WSUA 4AEDB 3VLBB 1RVF3 4KWJA 4XTMA 3IKWA 2XBO1 3AL6A 5BPXA 1LGBA 5BNPB 1R091 5HCAA 2CTVA 4CXWA 4B4PA 3O1RA 1BCXA 1HQNA 2WJSA 4Y20A 3M3EA 4H7MA 1S55A 1HW5A 3ZN6A 1VBC1 1BXHA 3AB0A 4AGGA 3DV8A 3OBRA 4CDQA 4J1XA 5JI7A 5BNNA 1OFSA 3GGLA 1WMFA 3NVCA 3W20A 4W8JA 2BWCA 3T2QA 3WF4A 2EXKA 4ZU4A 1XE8A 4XJUA 2VCBA 3S30A 3S7IA 2HLEA 2RR13 2BGCA 4YW2A 1QH7A 2GSYA 3AP9A 3EYPA 4EZHA 1VRBA 1RUI1 3VGIA 4UBGA 1O6UA 5EHDA 4GKYA 1NZIA 4BU2A 1V9U3 3JCIA 4LLOA 3VUOA 5D21A 1D4M2 2PTMA 3AMQA 4KGQA 5ANQA 1GP5A 1S0CA 2JB4A 4FAGA 3SEEA 1NY72 4KWKA 4O65A 1UAIA 1ND3A 3DCQA 5DN2A 5LWBA 2QNKA 4BK5A 5FYMA 2XVKA 2EA7A 4BQ1A 1SACA 3NKGA 3SQOA 5LRSA 2R1DA 4CEWA 5FOBB 1VBA2 1QXRA 2IXCA 1W28A 1CZSA 3J7LA 2XJQA 5C3OA 5HXMA 1DGWA 3LWCA 1HB3A 2HWF2 4GB32 4IEQA 4D7YA 5A3TA 3P5BA 4Q0PA 5CIRA 3MO4A 3T1LA 3APBA 4IETA 3WY6A 3NNGA 1GOFA 1ZA7A 2ZX0A 1J3RA 2W1WA 4WM8B 1XYPA 2PQSA 5DAWA 4XDOA 4FTSA 1JUIA 2OQ6A 2VULA 5CU1A 4K8FA 1D7PM 1GYKA 1X50A 2ZGQA 4M4PA 4L11A 3AKRA 3RWKX 4A2UA 3OBZA 1JOPA 1UX6A 4DXRA 5I0TA 3KV9A 5FV3A 4XJ8A 5A3NA 2ZMLA 2CWMA 4AQTA 1IKPA 1EUUA 5J96B 3ZN4A 5FPZA 1W03A 4C91A 1QGLA 4CCKA 4CCJA 4YFZA 4ZS2A 4IGPA 1NA1C 4YW6A 1REEA 3I59A 3AMMA 4LBNA 5LBEA 1E5RA 3RJ2X 1HJGA 2XUMA 2V72A 5FZ1A 4AW7A 5HV0A 1R082 3ZXEA 2FHRA 1GNHA 4UFLA 1G7YA 3USSA 3A22A 2WWSA 1S0IA 3OGRA 4LBQB 1DIWA 4HKLA 3WDUA 4CCNA 4CZSA 1OLRA 2BU9A 2EICA 3PJYA 4C8DA 2R16A 4XIKA 5C70A 1RINA 2PAMA 4JDMA 4A6SA 3LDBA 1JYTA 2D44A 3Q8CA 5JR2A 1RUOA 3BPZA 2Q30A 1PO21 1QJZA 1W0NA 4FCAA 3AK0A 4PDWC 4A7YA 4Z8BA 1GOHA 1LULA 2PHXA 1O59A 4QXCA 3ZXFA 5LY2A 3J8F1 1K5MA 4EWEA 4CUBA 4XFBA 4BJ0A 1H2MA 4YGCA 1ZYBA 2ZX2A 4BQXA 3ZDVA 1N1TA 2WZR3 1UU6A 4UFMA 4QB2A 4XURA 3UETA 4YRDA 3FWEA 1X82A 1XBFA 5IFPA 4AGVA 3I2GA 4I2OA 3NV4A 5FPXA 4OHVA 2PN5A 2IFWA 2ADDA 1V70A 2EIEA 4R4XA 4A4AA 4QPIC 1GOGA 5A6XA 1G9DA 4CCEA 4W6XA 3ACFA 1D0GA 3ACHA 4PIYA 5DDJ1 4NIAA 3RYPA 1N1SA 4AK3A 4MVTA 1YWKA 3ZYJB 1D2SA 1OUSA 2VW0A 2R49A 2UURA 2ZZQA 5IT6A 1CGPA 1KJLA 2RM22 3NJVA 3JBG2 2ZX3A 4Z2WA 3MPBA 2CGNA 3VBFA 2WN2A 1MEC1 5F3CA 3ZOIA 2BVVA 3O1OA 3HNMA 3ZYRA 3MV11 1W9WA 5GALA 4XAAA 1FV2A 2Z42A 2AUYA 3NNJA 2V4VA 3KGLA 1A78A 2WZPP 3KVBA 1SLLA 5GKAC 5JMOA 3AKPA 1WLCA 2RG4A 4HVOA 1U0AA 2BRTA 5LA2A 3RZMA 1HLCA 1TVGA 4Y3OA 2JENA 3PVEA 1CAXA 2VXRA 3AYAA 3QACA 2D40A 5FBZA 4FOYA 1AR63 2AEZA 3ASIA 1YQ6A 1SPPB 4Q5OA 1PVC1 2HBTA 2XHNA 2YV8A 1MZ5A 1SCSA 2YXSA 1GR3A 5FZEA 2HWC1 1OKQA 1OF3A 1YQ2A 3BOPA 2VQAA 4KWLA 4QX1A 4P9YA 1DGLA 1QOSA 4QXBA 1LHOA 2HYKA 5FOJB 4O7XA 4TLGA 4XDPA 2DV9A 3HT2A 1OMIA 1RTVA 4Y5SA 4MUVA 2B45X 3ZFEC 2C0ZA 1PK6C 3POSA 4AVBA 4ZZ5A 2A70A 4EV0A 3NW4A 3HNYM 2MHFA 2IFRA 3S5QA 2FDFA 2WO7A 2WT2A 1V6JA 2L9LA 1LOCA 1YQ5A 2VAUA 1OUXA 4P02B 3ILNA 2W92A 3UESA 5FREA 4RS5A 4XABA 2WAOA 4YGBA 5B2GB 2ZAAA 1NA1B 4Y1VA 4K21A 4Y24A 1QIQA 2JKBA 1COV3 4MADA 3X29B 2PFWA 3WV6A 3OPWA 3PUIA 2P6CA 4IEOA 1FV3A 3OOXA 1S2EA 3OG2A 5IVJA 1YRZA 1W06A 4FT8A 5CFCC 4LBJA 4RD7A 3WNPA 1OH3A 2ZGPA 1NY71 3K77A 4ZY9A 5BNOC 3BVCA 1X7NA 4PDWB 4W50A 5DZEA 3WP3A 4CTEA 2RS32 3BKZA 3WW1A 2ZEYA 1S0BA 1AX2A 3LE0A 5ACA1 1VBD1 2IC1A 2P5BA 2VW2A 2ZX4A 4FXGB 1LOBA 4XFCA 4YZ4A 1VBA1 3SH4A 5DMYA 3O0VA 5J98B 1Q8OA 2ENRA 2WYFA 4FOQA 4HK8A 2FQPA 2HWF1 1UY4A 1F5FA 2QDNA 4GB31 5BUVA 3J7NA 5HPOA 1ULEA 4L2NA 4BMEA 2EALA 3B9CA 5C3PA 2XJSA 3ACGA 4QPIB 3R6SA 4XQ4A 3IDBB 2UWBA 4ORFA 5LBCA 5FZCA 4OLLA 4RGAA 2ZZJA 4FP2A 1E5SA 5A33B 1CAVB 1QQP3 2RMU3 3CO2A 1J1TA 5CNAA 3VBSA 1W6OA 3WW3A 4XXAA 3UGHA 1B35C 3CLPA 3TOJA 3T4HB 1V6OA 2QBXA 1JOJA 4PIZA 1BEV3 2WFF2 1EAH1 3CBNA 3I54A 4FI9A 4NUBA 5A32B 4A45A 3WNOA 4IEVA 4BA6A 1R081 2MNGA 4AQSA 1DGRA 2DTYA 4EN8B 2VUAA 1H9PA 2IXLA 3VL8A 4NHXA 4YSFA 2EAAA 3WUCA 5A3MA 1WCKA 1GQPA 4A6OA 4XCAA 2LALA 3MFAA 2PHTA 5FUIA 3SH5A 3D82A 4FFFA 1C8NA 1EY2A 4LOSA 2K2SA 3ETQA 4JZRA 3SITA 4EWDA 1W99A 4W6YA 1OI6A 5FJKA 1KD7A 3AZVA 1YEWA 2DVGA 3IDAA 5BY5A 4Y33A 3RZLA 3CQOA 3R4UA 1CR7A 4H2AA 3CKHA 2B39A 3PURA 4IV3A 5JSRA 4Q26A 3ZSLA 1YFWA 4WM7C 5T50A 3ZFEB 1SLCA 2D3RA 1ULFA 1PK6B 2LUWA 1W0PA 3AMNA 1BQPA 2WYSA 3C3VA 3H1WA 3IZOA 4B1MA 2VR4A 2Z5WA 4QPYA 4B4QA 1W39A 4DEVA 4N43C 3WHTA 1GSLA 1DQ2A 1O8SA 4DINB 4K9SA 1F8VA 3MF9A 2RM21 3JBG1 4TZDA 5JOXA 1GWMA 5DZFA 4Z92B 1NLQA 1H0BA 3KQ4B 1MZEA 3M1HA 5FYTA 2ORZA 2AEYA 2WNVA 2VQUA 1IG0A 4L0PA 1C3HA 1QOTA 1UOFA 1HV0A 1RUF2 2JDZA 3WNKA 3ZM8A 4XHXA 2ZTNA 2BVBA 4Y26A 2W39A 1MS5A 4NMIA 1U5ZA 2E7TA 3VBOA 3QOPA 1W05A 2X10A 3ZYBA 4EN6B 1LB2A 2CHHA 2D97A 3E1F1 3FX3A 5FP9A 4BYYA 2GMEA 1YFXA 5I0UA 4MGYE 4NVPA 1IOAA 2F4LA 2OZ6A 4AGRA 4ES8A 1W3XA 3H3UA 5ACA3 2W87A 3KB5A 4LORA 1X9PA 3LEKA 1Q43A 2DUOA 3JQXA 4LBQD 1DU3D 4KL1A 5FZHA 4YG0A 3QH6A 2N7GA 2W5FA 1HKDA 4OULA 2ZABA 4QB1A 2JWPA 4JVAA 1CZTA 1WW7A 1I5ZA 3POIA 2AH2A 1YJLA 3RDIA 3NV1A 2TEPA 2JICA 2P3YA 1XU2A 3UGFA 4IQPA 3VL9A 3AMPA 1WLDA 4QX3A 5A6YA 2YROA 2R6QA 1XXNA 4MX3A 4TYSA 5CEHA 2RS12 4CCDA 2WT0A 1UPSA 1H2LA 2ZHNA 5F3IA 1NKGA 1OBNA 1RUH2 2ZGNA 4TXWA 2GDFA 3T2TA 1RUD3 1B35B 1OQEA 1LOAA 2GP3A 5LRRA 5GJ6A 4MXWA 4QKFA 1V6LA 4ONUA 1NLSA 2D5HA 3OTFA 4XF4A 5DUVA 5L7OC 1CWPA 1GKBA 2Q1MA 2JIGA 3HOBA 1C8M2 5FZ4A 5KBFA 3PUAA 4YVSB 2VUDA 2CGPA 3V0BA 4I02A 3ZXGA 3ZXAC 3U4SA 3ZYIB 3JD72 1JYWA 1BKZA 3JQWA 3VZLA 4LBKA 4ISQA 1H6YA 1TMF1 2TBVA 1DQ1A 4IXLA 5GM0A 1VBB3 3C7FA 1QH6A 4DXTA 4DEQA 1QHDA 2VNOA 4LBMA 2P1BA 2WQ4A 3NJXA 2A3WA 5F3EA 4AQ6A 2WWUA 1VLNA 1AYN2 2O14A 4XETA 3LB9A 1FNYA 3MEPA 3WP5A 1ZRCA 2WQ8A 5B4XA 4WM7B 5BYNA 1CESA 1AXZA 2Y8KA 3WDTA 1NCQC 2VM9A 1LU1A 3IPVB 4NAOA 4LIVA 3O1UA 4MHRA 2XL7A 3L9JT 4N43B 5LCWL 2AZ5A 4FTEA 4HKWA 2B8MA 1DHKB 3TNQA 1PGW2 3CJXA 3GF6A 1SG3A 1XB9A 2R32A 1IQDC 2IVJA 3MHZA 2WFF1 2HWE3 1PO13 3GM8A 3ILFA 4LK6A 5IVCA 4Y1ZA 4HG6B 2P4EA 3CNAA 3FLPA 4N90A 2E63A 4GA9A 4MOAA 4TTGA 4HKOA 1DYPA 1WBLA 3B94A 4COUA 1RUC2 4QGMA 1AX0A 1GWKA 4AZZA 5C5UA 2TUNA 3OF1A 1H1MA 3MGUA 3O14A 1OOPC 2ZXQA 1UYYA 4XILA 3T08A 3VDBA 1F15A 3N7KA 1AR82 1GNYA 2G19A 4GD4A 5C71A 3LF7A 4P9IA 4RR3C 3RZHA 1CJPA 5HV4A 2P3KA 3ZSEA 3BTYA 3ZR5A 3GCXA 4GALA 4EROA 1PZ7A 1GZTA 5FXZA 1SBDA 1JZ6A 4QQOA 4JKLA 1LGCA 3DGTA 4IE6A 4NHYA 3DN7A 2W47A 2BUKA 4BZ4A 2Q1FA 3KF3A 2GH8A 2X09A 2YY1A 3ECQA 1WCSA 3N9NA 4U2AA 1MS8A 4AR2A 2SBAA 5JI9A 2GNBA 2P6HA 5EYXA 3S0MA 3RG0A 4N9HA 4XJAA 5GLTA 1BK0A 1J3QA 1PVXA 4RA0A 1BVVA 5FY1A 5T5LA 4BPZA 1C1FA 1VBC2 4O61A 2Z2SB 3CMGA 3OEBA 5DG2A 5FDBA 1O4YA 5IAVA 3WVJA 2FD8A 3V0AA 5CISA 2R073 4RGGA 4CDXA 2RS53 1AR72 5C6CA 1G8WA 2GAUA 1RUF1 2D3SA 5L7OB 4CP9B 2ZHKA 1G6NA 4QM9A 4AI2A 2OX0A 4LHSA 5CYYA 2ET7A 5F1RA 1W0OA 4XEZA 2XQXA 1FATA 3M2MA 4RHV2 5IW0A 4IV1C 3PDQA 4DY5A 4HVQA 4IE4A 5I93A 1O3RA 2C1FA 4Y4RA 4UW4A 1GZ9A 1Z78A 5JUVA 2ZA9A 1EP0A 4GH4C 1H8TC 4FPEA 1W2UA 4AHYA 3C7OA 2W95A 4FPJA 5AC92 2VG9A 4Y1XA 5JXJA 4MXVA 3LIGA 1S2KA 4O9EA 4YGDA 4EYUA 1YLLA 4Z2AA 4BB3A 5BNQA 4GIQA 2JDPA 2YUEA 3MLJA 2VO5A 4ZXKA 2X5IC 2V4AA 1T6BX 4KH9A 2DURA 1ZZ9A 2ZGOA 1Z0HA 4ZZ8A 1RC6A 1HIXA 2W3JA 4Q4Y2 5F2SA 1SPPA 1CAUB 2DBIA 2E6VA 2FZ1A 4Q4V2 4XQDA 5JXGA 4R9DA 1QXPA 1POV1 4PJYA 3VDDA 4DXZA 3QCWA 1NOVA 1W8OA 2O8QA 3HBKA 3HBZA 5GLUA 2RS11 2NMOA 5FYSA 4ES9A 3DEMA 4AXOA 1RUH1 2J22A 2NMNA 3LDKA 3LPFA 4LT5A 2VMCA 3POFA 4LR4A 1QQP1 5FZIA 1OPOA 1VMFA 2WABA 1KS4A 4LEJA 5FPVA 5FY5A 2W1QA 3PUSA 3K4ZA 4PBOA 1W6MB 2E9QA 2EF6A 1XJAA 5L9VA 2VZTA 3AKQA 3R4DB 3BIEA 1POV0 2O1QA 5FYUA 3D6EA 4XF1A 1C8M1 4H14A 1XSQA 4HXCA 1VJ2A 3OYWA 1O7FA 1MVQA 1G9FA 3OUIA 3GHMA 3A7QA 4LO7A 3JD71 1WMEA 1S2BA 1OOPB 1JI6A 3W5MA 3HR9A 3GXUA 1PO22 1VIWB 4GWJA 5C9AC 4R52A 1NA1A 2DDUA 3FHQA 4M01A 2ZAHA 1LAJA 1HB2A 1FPN3 4RR3B 3BOWA 2Y0IA 4E9KA 4QXKA 3I3QA 2VOXA 1RMU2 1RUE2 5FK8A 1DG6A 2GC1A 5KXDA 2YZ4A 1HN0A 1UOBA 2WO1A 5LBFA 4BQ4A 5KR7A 4QQLA 1JZ5A 3BU7A 2BERA 2BOIA 3CZJA 1XRUA 2P37A 3RS6A 3SCGA 1E5HA 1US3A 3IMNA 4PDWA 4YZ5A 4N53A 3ZDSA 2MPFA 2VVFA 4A7ZA 1CAWA 1QF3A 4QKNA 3UJQA 1WD4A 3DPRC 4BK4A 3KCCA 4BQ2A 4JHTA 4Q4X3 2WIIB 3O1VA 3RMYA 3POYA 3ZN5A 5FBJA 4UFJA 1PGW1 1DQ0A 4OI2A 2BNMA 1ZBE2 3NKTA 3OGVA 2A6YA 5DPNA 5F37A 2Q8CA 3K75B 4XFHA 4QQPA 5A7QA 4KI5M 1NAEA 5H9QA 1W8UA 2OW4A 5T54A 5FXWA 2VZUA 2UYBA 4HLTA 4QPIA 3W5NA 3FZ3A 2FMYA 4UFHA 1KEXA 3DECA 4ASKA 4L8QA 2VZ3A 1OD5A 1SEFA 2RVAA 1MACA 2VW1A 1V6NA 4SBVA 5FK7A 5A33A 4WZCA 4LO5B 1RUC1 3M8LA 3U11A 1GFF2 1AL23 1H2KA 1UKGA 4IV1B 1AHSA 1J58A 4ASMB 4H3WA 4LKDA 4UW6A 3A4UA 4JGZC 1PVC2 3TEWA 4CDUC 3R4SA 4RYDA 2CGOA 3I2JA 1AR81 4GH4B 4DUWA 1H8TB 4UFIA 2P3JA 4W4ZA 1X9TA 2WNUC 5GLVA 1HQWA 2OQ7A 2VE1A 4NWWA 3EHKA 2Y64A 2VMIA 1JZ7A 3S6PA 2ZHMA 3I2DA 5F5QA 1Y4WA 1NCRC 5DABA 2B7YA 2OZJA 2X5IB 4JHZA 5EFUA 1UIJA 2WRAA 5A3OA 4GMP1 2QCSB 3ZSKA 1FMD3 1ST8A 2NQYA 1UYPA 5KHJA 4YZ3A 4UF0A 4XMAA 5C4WC 4XBLA 2YGMA 2J1RA 3LFIA 1D4VB 4UFKA 5FRAA 4Y4YA 1QJU3 3DKQA 2D6PA 4DIQA 1DQ4A 2JE8A 3QLQA 4IE7A 1IS5A 3GDBA 4XFFA 2Y60A 4QT6A 5I0DA 5T3NA 5KC6A 1A34A 3WSOA 1LECA 1A6CA 2O0OA 3AFKA 1UY1A 1YXWA 4GMP0 1UQXA 5FKBA 4LNVA 1AR71 1IS3A 4JAAA 1PK6A 5CKNA 2GC0A 1IQAA 3WINE 1R1A2 2XGXA 3K46A 3OUJA 4Q0SA 3VV1A 3PMEA 5FZDA 4S2GA 3H1MA 3BUCA 1PIV3 4YG3A 4WVMB 2QDRA 3NRUA 1H1IA 2AYHA 4QPGA 2JDYA 1ZM1A 3HIFA 4AFAA 4YZ2A 2WS92 1VRH3 2ZACA 2BZDA 3I97A 5L9BA 3ZIXA 2C4XA 2PLV3 4RHV1 5C8WA 5C9AB 1DGRN 3BN6A 4XDQA 1C5HA 1XC6A 4XXPA 1FAYA 5ACA2 1VBD2 3JZVA 2DCZA 2BEOA 1XU1A 3MIHA 4URAA 3NWKA 5LY1A 4YPJA 4AI9A 5AC91 3KT4A 3WUDA 2QQOA 2ZGUA 5FZKA 1SLTA 3OPTA 5L36A 2QUOA 1SLBA 3UKVA 5FTTC 1KGYA 4BH9A 4ZU5A 2DVBA 4LKSA 3KM5A 3LFMA 5J7MA 4LJHA 1AVBA 5C3SA 4FPOB 4Q4Y1 3UKTA 4KU8A 3ACIA 4Q4V1 1O3SA 2B4KA 3C2UA 4XZPA 2E51A 3DPRB 4GQ7A 4Z07A 1KJRA 1MS9A 4J6GA 4QU1A 5EP9A 3I2OA 5JIAA 1JMUB 4FQZA 3ZSJA 1DDLA 4JRAA 2ZJCA 5JPNB 1MZ6A 4R4ZA 1PM4A 2IWGB 3Q8EA 1OT5A 1OQDA 4Y1UA 5FLJA 3AKSA 3ZSMA 4K8RB 3U07A 5LA9A 1EAH2 5FZGA 3RZZA 2LS6A 4I0WB 5F39A 3WCRA 2R30A 2VTFA 4WZFA 4XBQA 3PVOA 1XNCA 3AP6A 1Z7S2 2K46A 2PMWB 3GJAA 3RRDA 4B29A 4QHOA 5LZ6A 1SFYA 2VZ1A 1B35A 2XLGA 5GLZA 4YM3A 2R042 3D0SA 1OSGA 4JGZB 1F35A 4CDUB 5I8YA 3VBRA 2WKKA 1ULPA 1R1ZA 2FCUA 3U10A 1J84A 5B4NA 2J1EA 1I3HA 2JG8C 3ILRA 1MR5A 1RUJ2 4G4FA 4M3CB 1NQJA 1RMU1 1RUE1 1V6IA 2WNUB 4KG8A 5FMBA 2BYVE 4DO0A 1TE1B 4NWVA 4YVSA 1HRV3 1IPSA 4LOTA 2R063 1AR92 1KDMA 1NCRB 1X36A 2E7AA 2YMZA 3N9LA 4CSWA 4C90A 1VB4A 1W6PB 1YHFA 3NJZA 1LOFA 5C4WB 5KXBA 2DYCA 1UU5A 1UZZA 5LEKA 2NM1A 1K45A 3IIIA 4QD2A 1W04A 1JW6A 2BP6A 4XPVA 5FPBA 2D6NA 5T5JA 2AGSA 3I3EA 1BK1A 1ENXA 3PLQA 5H9RA 3UJOA 1ZREA 1Q5OA 2GC2A 3PU3A 4D3WA 1BBT1 4YLZA 5EJ1B 1HB4A 1OD3A 1ZBE1 2BWAA 3ELNA 1SBFA 1Y9QA 2Q1ZB 4RQPC 4DB5A 2A6XA 2WA4A 3O0XA 1KFXL 2UWAA 3T09A 1RHI3 2JEMA 3MPPG 2R071 3IPVA 4IEZA 4QQ2A 5T5OA 5A70A 4OZXA 1ND2C 3AC0A 2RR12 4IGQA 3GBFA 2BJSA 4N43A 3DF0A 5BXXA 4F83A 2WL1A 1T2XA 5FMCA 1W2AX 2CL2A 1V9U2 3DYPA 1ZZ8A 3ZMNA 4XCBA 5IATA 1SDDB 1SFPA 3BTZA 4AVVA 2CDOA 1PMIA 2EXIA 4CCLA 5A1LA 5IK4A 1VALA 1LHWA 1B09A 2DVFA 1JBCA 1MPXA 1ZVFA 2XKPA 5FXVA 2DUPA 5HI0A 2VJXA 1DZTA 4PT6A 3NV3A 4C0BA 2ZMNA 1RXFA 1YFYA 2V09A 3PNAA 4GJZA 4N8MA 3ZFFC 4BQ3A 4LK7A 1HXS3 1WUVA 2OIIA 5CFDC 1X8EA 3LD8A 4E2GA 1AYM3 1QJY3 4KG0A 3P3NA 1UY0A 5FZBA 1GU3A 2K0GA 2DBNA 5CKMA 2ZCWA 3HQUA 1LCLA 2ERFA 5FLHA 2HWD3 1VB2A 3J26N 1F9KA 2BTVC 2ARCA 5ABJC 1UKRA 1GQHA 2VXJA 1J83A 1QDOA 5JVVA 1UXZA 3BU0A 2A73B 3S57A 2WBKA 1EV13 1W9FA 1IPKA 3OBAA 1G9BA 1VBE3 4Y5Z0 4J1WA 4CDQC 5BNNC 2VECA 2B42B 2AR6A 2MEV3 2YU1A 1NT0A 4N9IA 4PLNA 5K7PA 3AVRA 1R1A1 4AVSA 2J1TA 4F7ZA 2JD4A 1ZBA3 3B5LB 4K6BA 4MGIE 3USUB 3WG2A 3TAYA 3WR0A 1ZRFA 2XJUA 4X6QB 1KRIA 2YBPA 1GZWB 2WS91 2XJPA 1TMF2 4BISA 3HQRA 2XKOA 2XLAA 4NO4A 4WV8A 4XF3A 2B9UA 3MYXA 4COWA 4NE9A 3MFCA 2QFEA 2GU9A 2FZ2A 2E31A 1ZRDA 2JG8B 3PU8A 3POGA 2YFZA 3PUHA 5L7OA 3FN9A 3OY8B 4CP9A 3VHPA 3IIAA 3EQEA 1FPN1 2GN7A 3AFGA 4QM8A 4YG6A 5CG8A 1J1LA 2D98A 2E26A 3B01A 4N7UA 5FY8A 3VBHC 3L2HA 1JS9A 1MVEA 2LRPA 2WZR2 3FFQA 3LCPA 3LIHA 5CA6A 1QWRA 1EYBA 4MSVA 4PQQA 3E6CC 2PELA 2VUCA 1ZA4A 3ST7A 4QDQA 5JAXA 1ULOA 4AOCA 5A7SA 2HEVF 5C8CC 5D8AA 3WNMA 3SHRA 1L7RA 2LTNA 2XWBB 1W2TA 1RUG3 4YARA 4FPFA 4I3GA 1D0HA 5KWRA 1D2QA 1U12A 1N1VA 2DCYA 2YFUA 4YZ1A 3GNEA 4ZONA 2GZWA 2DCTA 1YFUA 4XIOA 4Q4X1 3MDPA 2XG3A 4XUOA 3MIEA 3ZYPA 3UK9A 4K1ZA 2XH6A 4XUNA 1OHFA 1C5IA 1OA2A 4RQPB 4OCTA 1Y9GA 4FFIA 4HZFA 3V64A 1JUHA 1F2NA 2AENA 2YBSA 3WNNA 1W9YA 3RI8A 1CAUA 2W46A 1ND2B 1I5PA 1W2OA 1Y43B 4IERA 3LA2A 3I3MA 4E4HA 4AYUA 2QQVA 3TNPB 4DRRA 1WA6X 1Z7S1 3MBWA 2UWCA 5FYYA 4JC1A 5AFBA 3MI8A 2HWB1 1DGWX 3WG1A 5LASA 5K9YA 2W2IA 2OXBA 4OUMA 2R041 4COVA 1VMJA 5IYYA 3VZOA 2QVSB 3MLLA 1F4HA 1AR62 4MGTA 2HKXA 1W6MA 3INAA 4CUAA 5F5CA 1QJFA 1MQTA 1RUJ1 3O1SA 2KXLA 5CZKA 2OPWA 4RL7A 2W9XA 4HONA 2Q5TA 3ZFFB 1C57A 4AVCA 5A3LA 2VMGA 1NUKA 2GALA 2VCCA 1AR91 2Y6JA 2XVGA 1UZWA 4XAEA 5JOZA 3U75A 3B7MA 1ASJ3 1KXGA 2HYXA 2Y38A 4GKXA 2BV4A 3BCWA 3SEPA 4HPKA 1I9RA 2WZEA 1FMD1 2ZPXA 5JZGA 4RR3A 5JCTA 2VBBA 3RZJA 2BPA2 5ABJB 1RVF1 5FUPA 5F7UA 2R0HA 2A3YA 4TWTA 3UNPA 3THTA 3MIDA 4GWIA 4XTPA 1Y7BA 1AYN3 3WQ1A 3FC0A 2CYFA 4YW7A 3ZN6B 1A3KA 4HANA 1UWWA 4NIGA 1DLLA 3VBFC 4QX5A 4CDQB 5BNNB 2XR4A 1SMVA 1TNFA 2YPJA 5FAXA 4CUGA 5FZ7A 2O8OA 3VHRA 3VZNA 3GJBA 1ACCA 4XE9A 4B1LA 3FMGA 4BCUA 4CE8A 1I6XA 2RR11 4DMIA 1R64A 1PHMA 4IDZA 5J1XA 3AP4A 2BFUS 1V9U1 3G7DA 5CFCB 5IUQA 4YVWC 4HFSA 3IDEA 4Y22B 5JLVA 5BNOB 3AJYA 1LTEA 1VP6A 2ZGLA 4R9AA 4OI0A 1UIKA 5FIXA 1YJKA 3KS7A 2P3IA 5I0RA 1E5IA 4XFIA 1VE0A 5HCHA 3RMXA 5A6ZA 3VBHB 4YWAA 3H50A 4NRQA 2J1UA 2ZEXA 3MUY1 3PTYA 4FVVA 1ENSA 1H9WA 4OZOA 2RJKA 3VD9A 3JB8A 3N9PA 4XBNA 3VD4A 1W8FA 4KBZA 4HT1T 5C8CB 3VZKA 4BOWA 3F95A 3KV6A 2E33A 2YBKA 1BVP1 2A3XA 1HRI3 2ZEZA 1Q3EA 2KR2A 1H8TA 3NAPC 3D0JA 3AZZA 4M3CE 5A80A 5FZ0A 3RNSA 4IE5A 3TRSB 2JDAA 2JIJA 2JG9C 2XLFA 2FDHA 1G9AA 5KHHA 4F3JA 1QQP2 1TME3 2RMU2 4CXYA 5FY0A 4XJ9A 2DU1A 5D1IA 4IL7A 4Q4W3 4ARYA 3OGGA 3ITQA 2JXAA 3WEZA 1N1YA 4YYOA 1DZQA 3GZEA 4L99A 1ALYA 4PLMA 4RS5C 1BEV2 3DKWA 4AEDA 3M3CA 3ME2A 5BNPA 2XBO3 4CEYC 4LE3A 1R093 1F5JA 1NXD1 1EUTA 2Y0OA 1RITA 4BWOA 3FUOA 2A75A 3GCWA 3CDZB 1VBC3 2PHLA 3OSDA 5T52A 1KS5A 5L73A 1Y9MA 4ITCA 4BM8A 3GALA 4NROA 3N4MA 1W90A 4PLOA 1V6MA 1XNKA 4AL9A 1Q8VA 3N36A 1XYOA 2PXJA 4AG4A 1RUI3 2Y26A 3DXTA 5DAXA 3MIFA 5A7PA 4E27A 2WZR1 2EAKA
chains in the Genus database with same CATH topology
3FFZA 2P17A 5DUWA 3M7AA 4FAHA 3M3OA 3WQ0A 1N3PA 3MW2A 5C9AA 1OA3A 3N7MA 4P9LA 3P3PA 2RJLA 4AWDA 4EN0A 1CX4A 2YC0A 2IXIA 1X8MA 1WGPA 2Q4SA 5AVPA 3PJQA 2D6MA 4E4ZA 1LHUA 3VBSC 3VBFB 1ZZCA 2G9FA 1KQRA 1WMDA 4WM8A 2ILMA 2XHKA 3SH3A 4DOUA 3ZYGA 1RHI1 4PBPA 4DY3A 2BBVA 4JCKA 4LO6B 2XVLA 2VMHA 1GBGA 3OBTA 4CDWC 3ZO0B 2ZGMA 4YVWB 3ES1A 4AVTA 2H0VA 2CAVA 3MZHA 4Q8LA 5GLWA 1IKQA 1M4WA 5K0UC 3LZZA 1AR61 2PAEA 2X53S 3BTAA 2G4IA 4X8NA 1QJX3 4DQAA 1FOD3 1LKNA 3SXWA 5LEJA 5FMOS 4LBQA 5E8AA 1G9CA 3HN1A 2D3PA 2PHDA 1ENRA 2OPKA 2PAKA 3LOBA 3VKOA 1LHNA 3H3ZA 4EN9B 1BJQA 4TLFA 4MLOA 4IV3C 4XJWA 1PO23 3E97A 4XMIA 4CDUA 5DUUA 3J8F3 3NAPB 3FBMA 1BMV2 1PZ8A 2I2SA 3RQ0A 4TSVA 2JG9B 3ES4A 2EVXA 1BZWA 5EZWA 3IN9A 3FLRA 1RUD2 4AVAA 2AREA 1YO8A 2IZWA 1W6QB 5C4WA 3RYKA 5KHIA 1V00A 4RS5B 2WNVC 2RE9A 2D43A 2XJVA 4I0BA 3RPQA 3WG3A 5DDJ3 4CEYB 4JQRA 1LEDA 1COV1 3MIBA 4QGLA 1AXKA 2ZGKA 1MEC3 4HBNA 1JN2P 1AXYA 3AP5A 4OHXA 3WP6A 1ULDA 4K20A 4P9WA 4I30A 1VBB2 5JOWA 1QMJA 1G86A 4F8AA 2CNAA 5GZEA 3H7YA 1O3TA 4UW3A 1ZRRA 4NN0A 5FFOC 3Q9OA 1NCQB 3CJIC 2KA3A 4B4RA 4R9CA 5CVRA 2QE3A 3TN93 1PM7A 4MGZE 2HWC3 5FMOL 3RWNA 4CP1A 3CEWA 4P9XA 3I8TA 3WDXA 2HJIA 2RMU1 2I45A 3DL3A 3VBSB 1S0FA 4FPCA 1H30A 5JIUA 4HSJA 4BIFA 2WSVA 1SDWA 2ZX1A 2D6KA 1BEV1 1PO12 4W65A 5HBAA 1IS6A 4COYA 1AUYA 3AJZA 2GNMA 4CDWB 3B00A 3WW2A 3GZAA 3AKTA 4MV2A 3PMSA 4YM1A 2XB6C 1NE4A 1URXA 5K0UB 4LULA 5FO8B 3N3HA 5H9PA 1GNZA 2I07B 1M06G 3WZ1A 1T6GC 3IDCB 1ENQA 2F6BA 2WNEA 4FPYA 5FQ0B 4BHPA 2QZ2A 1AX1A 3USUA 2HEYF 1D4M3 4EJRA 4LO4B 2ES3A 4K1YA 2WQZC 4LUKA 4OVEA 3EJKA 1GZWA 3WX5A 3AZXA 4IV3B 1ASJ1 3CU7A 1I1EA 2NP0A 4MGKE 4W6WA 4LBOA 4DNYA 2EIGA 1VBD3 1YUDA 1UN1A 2ZBJA 3OY8A 4HN0A 1VBA3 4I09A 4Z82A 1UZYA 1BBT2 1FXZA 4XYXA 3G6JB 4Q29A 5I91A 4B7KA 2HWF3 4GB33 4XQWA 2BQPA 4K7JA 3WNXA 1IHMA 4FTBA 1XE7A 1QNYA 4MYEA 5EJ3A 3JB4C 1ZNPA 2WNVB 4B3NA 2R072 1QU0A 2RS52 3L2YA 4A3XA 2B46X 4QQHA 3WDYA 1CAVA 1APNA 1LRHA 3K51A 4N7IA 4LBLA 4LHNA 1WW4A 4RQPA 3KT1A 1CQ9A 2GNTA 2JE9A 1EAH3 5A32A 3POWA 2YGLA 3MW3A 4XHBA 1ND2A 1R083 5HXVA 1V6KA 1MS0A 3IWZA 1RL3A 1SFNA 2FMDA 3BALA 4XOGA 2JX9A 3HAGA 3VZMA 4E4DX 5K8SA 1H4HA 1JXNA 3V65A 3CJIB 1N3OA 2VY0A 4HL0A 2CWSA 2VVEA 4JGYC 3OCPA 1REFA 1NG0A 4IEPA 3AXEA 4CP0A 2JE7A 1LU2A 2B5HA 1HRI1 3ZFGC 1BMV1 3T1MA 4PF5A 3A0KA 2Z69A 1PNGA 1DF0A 1UL9A 4FOWA 5CG9A 3AZYA 4YGEA 2VOKA 1RUD1 2BNNA 3ZFEA 4XJZA 2WLQA 2NLRA 1LHVA 4CDXC 4GXLA 4Z1VA 1OLQA 1AJOA 5ABJA 1UD1A 2NYYA 5JPMB 1ZX5A 5GZCA 3O12A 1AZDA 1KDKA 2RM23 1RGSA 3OGJA 4LE4A 4M0HA 3JBG3 4OFGA 4S2FA 4XF0A 2D6OX 3V0BB 4INDA 2UY8A 1CONA 4FOVA 3KSCA 2PA7A 4LA3A 3THPA 1VBB1 1AF9A 2PHFA 4AHZA 1FPN2 1Q8SA 1KFUL 3B69A 5CFCA 4Y22A 5BNOA 5GZFA 1NXMA 2H6BA 2QJVA 4X8PA 5GZDA 1NQDA 1PZ9A 1DFQA 1IPJA 1AL0G 1GANA 4YM0A 4YW3A 1O5LA 2A6ZA 3BB6A 1SBEA 3VDDC 3VBHA 1NLRA 4Q4X2 1RUNA 4DS0A 4AE2A 4LHLA 1YI9A 3WG4A 3TB0A 1A8MA 1RIRA 1IGOA 2X29A 1UCXA 5C8CA 1O5UA 1PGSA 2NPIA 3KD4A 2HWE1 1PO11 1C1LA 3HQXA 1ZZBA 4Q2FA 3UL2A 4ZU7A 2PHUA 1OQ1A 2KM2A 5CAZA 1ZZ6A 5C33A 5E1RA 3E5QA 2HWB2 1WD3A 1XQNA 2UU8A 3GYDA 1XYNA 2GNDA 4JDOA 4L92A 1UMZA 1DZRA 3GBGA 2ET1A 1AL22 2GN3A 2ETEA 4I01A 4UBHA 3VKMA 1QJX1 4P14A 1FOD1 3VHNA 3EO6A 2WT1A 5J48A 1JYCA 2XWJB 2ZGSA 2VNGA 3FUQA 1Q8PA 5HCBA 3WDVA 3B9IA 4XFAA 1PNFA 1TMF3 4JGYB 1FMD2 2RS33 1J3PA 2VQ0A 2ZGTA 1H2NA 4ISRA 3M3QA 4Y1YA 1SLIA 4LHKA 4N53C 1REDA 4LTAA 1LR5A 1RVF2 3ZFGB 3QD6A 3LOIA 3UV9A 1QJU2 4KQ7A 1QNWA 3N7LA 1IZ3A 2DVDA 4DFSA 4NR1A 3VBUC 3KMHA 3OD0A 2YDEA 4WM7A 5IK8A 1EPZA 1HQLA 3ZMOA 4R8HA 3V0AB 1EPWA 2RS51 4CDXB 4RFT0 2ATFA 3SISA 1JH5A 4HN1A 3ALQA 3MLKA 4H55A 4SLIA 5KC5A 3OJBA 4C1XA 2LM3A 2EXHA 3VKLA 1S0JA 1PIV2 4JDNA 2W0XA 4FXKB 4Q27A 4L97A 3WT3A 4Q1RA 1VRH2 5CBLA 2OUHA 2PLV2 2WFF3 4O9GA 4DPNA 3KCXA 5J36A 4ASLA 1DQ5A 1Q56A 2DWRA 2Q0AA 3LKJA 1CVNA 2DF7A 3KCYA 3LA7A 4YVWA 3S7EA 2PHWA 3K48A 5CADA 3V56A 2C9AA 1UW8A 3LAGA 1U5XA 1Y3TA 2JECA 3H1YA 4AF9A 3FHIB 4YW1A 3BIWE 3TN91 3VKNA 2VGDA 1RJ8A 3N35A 3VDDB 1TNRA 4Q0UA 5BV6A 4FSJA 4I3PA 5GZGA 2WLPA 1FNZA 3U4XA 3TBDA 2DFBA 1OFNA 5E16A 4AEKA 2K9ZA 5DUXA 3NAPA 2D6LX 2ZHLA 3ROUA 4FPKA 1FI2A 1ZZ7A 2JG9A 3LSDA 3KZ4C 3OYWB 1LGNA 3AX4A 1HX6A 4QPGC 1SLAA 3B02A 3O0WA 2E7QA 2VOWA 1W6QA 1L3JA 1ND3C 1RUF3 3D5OA 1JYIA 3BODA 4CEYA 1QXJA 4D7TA 3RSJA 1WLTA 4CEWC 3I7DA 1NE6A 1HRV2 4L9BA 5IK7A 2R062 1D4M1 4GULA 2DUQA 2F4PA 5EV7A 3H9AA 4CP2A 4NHMA 4JRLA 4PQ9A 3ACLA 3AXDA 1TEIA 2VPVA 4N53B 4UW5A 3GZTB 1W6NB 4AI8A 2CV6A 4URTA 1CAWB 3WQ7A 2BW8A 5KHGA 4AI0A 2VUJA 1H4GA 4NOTA 3VBUB 2DU0A 4QMAA 4BE3A 3W9AA 1NCQA 4WBBA 3U0ZA 5FO7B 1WW6A 1RHI2 4QU2A 1POV3 4CRQA 1UU4A 2C5DA 1O4TA 4HETA 3E6DA 2RS13 5FO9B 5F6LB 1RUH3 1CD3G 2UY9A 3MW4A 5HCFA 2A6WA 4LUMA 4AFCA 1RB8G 2VOVA 4IEYA 3SNMA 1AL21 2D93A 5JR7B 3LA3A 2D5FA 4YM2A 2CY6A 4K40A 4QGNA 3VBRC 2GC3A 1K5MC 5CFDB 1C8M3 1N3QA 1O4ZA 1OPMA 4CDWA 1HXS2 3JD73 4E4SA 2G9GA 1CPNA 4E2SA 4YVSC 1OOPA 1AYM2 1QJY2 3L9JT 3JUUA 1F31A 1LOEA 3ZIWA 5K0UA 2XPJA 2WC2A 1LENA 3NO8A 3D4KA 1U5YA 3WW4A 1LOFC 2SLIA 4DZGA 2ZKNA 3QH7A 2HWD2 4KBBA 4WVVA 5FQ0A 1QJU1 4NPRA 3E5UA 3QBQA 3ZVXA 1ULCA 4Y20B 3MICA 1EV12 3CL1A 3VZJA 1WCDJ 4IESA 2QKDA 4LA2A 5EWSA 4K3UA 5JOYA 1VBE2 4IEXA 1YIPA 1COV2 2MEV2 1GICA 2OUJA 3SMHA 4BMBA 1QDCA 3AM2A 3M4FA 2ARBA 1PIV1 1ZBA2 2VNRA 1WA4A 4QPGB 1IS4A 1ULGA 1DYKA 1VRH1 4IEWA 1ND3B 2PLV1 4D69A 4WVWA 2RHPA 4COZA 2R0FA 5KXEA 2ZS6B 4CEWB 2ZMKA 3WD5A 4BLIA 4H7LA 4JTNA 4OUSA 1RUC3 2HEWF 2WFPA 4IV1A 1HV1A 4D94A 5E88A 2W68A 3E5XA 4HSLA 3RJRA 3J4UH 4GH4A 4KNCA 1AR83 3OPZA 1DBNA 1RUG2 3TWIA 1O3QA 2EXJA 1ONAA 3VKFC 5KHKA 3GZUC 5L19A 3B3QE 1HDKA 3I4IA 3AYCA 1XNBA 2X5IA 4E2QA 3CJIA 4GMP3 2A5ZA 1S0GA 2OVUA 1PGL2 5AFEA 4Q1PA 3HMYA 3PVBB 3HWJA 3I59B 3VN4A 3URFA 4P9GA 1Q8QA 1FX5A 4KGGA 2V73A 1CPMA 2VH9A 3MF6A 4Q0VA 4P5HA 4BIOA 3VHOA 4RSUA 4AFBA 4FPHA 2E53A 1S0DA 1CN1A 2NZ9A 3HT1A 1A8DA 3KT7A 1AR73 5EXOA 2P34A 4LLFA 3VBRB 1SCRA 3E6BA 2A7AA 1K5MB 3FLTA 4NHLA 5J37A 1SQ4A 1KITA 1LJ7A 2V5YA 3N7JA 4FO9A 4WVMA 2BFUL 4AHWA 1X33A 2QQPA 1HRV1 3AYDA 1C28A 2R061 3DUIA 3R05A 4YW5A 4YFWA 1ASJ2 2X8KA 4RHV3 2A71A 4FPGA 1QY4A 2RS31 5D8AC 3SCHA 1S0EA 1WBFA 4ZKTB 5AC93 4P9JA 1BYHA 1LODA 2W52A 5T55A 5I0SA 4GWNA 5JWPA 4FP3A 3AMHA 4QHBA 4AQ2A 3AYEA 1RJ7A 3KQRA 1FYUA 4Q4Y3 4OHZA 2H0BA 4PCRA 4Q4V3 4V1PA 4EWAA 3DPRA 5LK7B 3W58A 2R1BA 3PVNA 4A7KA 2VVDA 3FJSA 3KLSA 4FPLA 4HMZA 1WLWA 1GV9A 2GMMA 4AFDA 3GHNA 1UF2C 2DCJA 4JTOA 4OI1A 1MS3A 1NYWA 2H6CA 3LGRA 1CAXB 1CIWA 3AP7A 1VAVA 1GQGA 5KXCA 5SV8A 1AJKA 1MZFA 3WP4A 1VR3A 1MQTC 4UXAA 1HXS1 5I8TA 2Z79A 5DG1A 1AYM1 1QJY1 3RYRA 4JGZA 3WOGA 4IEUA 3FBYA 4EN7B 3ZXKA 1LOGA 2PHRA 1HRI2 2HWD1 4M3CA 2WNUA 1RMU3 1RUE3 5J3UA 5JZGC 3M70A 4M00A 4AHXA 1NCRA 2XL9A 2DFCA 2GH2A 2JJ6A 1TME2 2WINB 5F6KA 1W6PA 1EV11 1MS4A 3O5SA 4Q4W2 4JGYA 3ZX7A 2OA2A 1VBE1 4AI3A 3J9SA 4OI4A 5AVAA 3WHUA 2MEV1 5LK5A 3ZFGA 2XBO2 4YW4A 1YNAA 1R092 1UPIA 3VBOC 1BBT3 1ZBA1 4PIXA 1ZBE3 4G3YC 4XF9A 5JMCA 1C4RA 3H8UA 1QKQA 2ZOEB 1LESA 2PYTA 3M3IA 1QOOA 4AEMA 1TQ5A 3D8CA 4M3CF 4GWMA 4OHYA 1LEMA 3AZWA 5I8SA 3KGZA 2OYZA 4M0NA 5TSWA 1NZCA 1RUI2 2Q8OA 5T5PA 4WVZA 3IM0A 3O7OA 4MZUA 2DTWA 1VAMA 1H8VA 5E89A 1YYNA 1YIFA 3NSTA 1PVC3 4DRVA 2XJRA 2FBEA 5D8AB 1RUG1 2A6VA 2I74A 2IXHA 1GZCA 4HVRA 3W59A 4FBFA 3SLIA 1JTZX 2GMPA 1W6OB 4ATEA 3ZXLA 3JU9A 3HD8B 1PGL1 4G9SB 3TYJA 2HWE2 4OHWA 1VAKA 3IBMA 2ARXA 4KU7A 5DZGA 4AEDC 5BNPC 4CYDA 2IXJA 3ZXJA 3MIGA 2P2KA 4I0AA 4C0HA 5JSOA 4MH0E 3CF6E 2CAUA 1R1A3 4LO8A 3ZPYA 1QJX2 4R9BA 1FOD2 1MQTB 1U5IA 2UYAA 2DVAA 4B7EA 5F9TA 4D7SA 2D7FA 1N47A 1YCIA 2WS93 4Q8KA 1YI7A 4HPKB 3WDWA 2JG8A 2DCKA 2QZ3A 2XJTA 3EXUA 5FBZA 5ACA3 1DQ6A 2PQQA 5J09A 5JZGB 3A0NA 3J8F2 3ENRA 3WLUA 5JSPA 3B93A 2YHJA 1AYN1 1MS1A 2VU9A 1WW5A 4FQ4A 1OA4A 5H9SA 4S2HA 3ZXDA 2IXKA 1S1AA 5FLIA 2ZGRA 1W6NA 3PHMA 5IK5A 4WM8C 5DDJ2 4C1WA 1H1AA 1GLHA 2W08A 4XFGA 3R0RA 3H0OA 3VBOB 4Q0QA 5SV5A 1JHNA 3SCFA 4XW3A 3VBUA 5JDBA 3OD4A 1MEC2 3UKNA 3ATGA 3NL1A 4HK9A 1FT9A 4JV4A 3LSEA 5EYYA 1Z7S3 4X6RB 2NN8A 2HWB3 5FCCA 4ATFA 2BNOA 4META 4B8EA 4S2DA 2R043 1J59A 3FE5A 4NHKA 4U36A 5CB7A 3H7JA 3TN92 2ZKLA 1RUJ3 1XNDA 3ZFFA 4AEJA 3IT8A 3WCSA 1E57A 5CFDA 4AFMA 4A7ZA 2HWC2 2WA3A 2YYOA 4AI1A 1AR93 1CJDA 5DXDA 4BLJA 1O91A 3GBWA 1TME1 4Q4W1 3NV2A 4MXWB 2TNFA 3WXPA 4YNIA 3RI9A 3EBRA 2WSUA 4AEDB 3VLBB 1RVF3 4KWJA 4XTMA 3IKWA 2XBO1 5BPXA 5BNPB 1LGBA 5HCAA 1R091 2CTVA 4B4PA 1BCXA 1HQNA 2WJSA 4Y20A 3M3EA 4H7MA 1S55A 1HW5A 3ZN6A 1VBC1 1BXHA 3AB0A 4AGGA 3DV8A 3OBRA 4CDQA 4J1XA 5JI7A 5BNNA 1OFSA 1WMFA 3NVCA 2BWCA 2EXKA 4ZU4A 1XE8A 4XJUA 3S30A 3S7IA 2RR13 2BGCA 4YW2A 1QH7A 2GSYA 3AP9A 1RUI1 3VGIA 4UBGA 4GKYA 1V9U3 3JCIA 4LLOA 3VUOA 1D4M2 2PTMA 3AMQA 4KGQA 1S0CA 4FAGA 1NY72 4KWKA 1UAIA 1ND3A 2QNKA 4BQ1A 2XVKA 2EA7A 1SACA 3NKGA 5LRSA 2R1DA 4CEWA 5FOBB 1VBA2 1QXRA 2IXCA 2XJQA 1DGWA 3LWCA 2HWF2 4GB32 4IEQA 4D7YA 4Q0PA 5CIRA 3T1LA 3APBA 4IETA 3WY6A 2ZX0A 1J3RA 4WM8B 1XYPA 4FTSA 1JUIA 5CU1A 2VULA 4K8FA 1GYKA 1X50A 2ZGQA 4L11A 3AKRA 4A2UA 1UX6A 5I0TA 4XJ8A 2ZMLA 2CWMA 4AQTA 1IKPA 5J96B 3ZN4A 5FPZA 4C91A 1QGLA 4YFZA 1NA1C 3RJ2X 1REEA 3I59A 3AMMA 4LBNA 2XUMA 4AW7A 1R082 3ZXEA 2FHRA 1GNHA 1G7YA 3USSA 2WWSA 1S0IA 4LBQB 3WDUA 1DIWA 4HKLA 4CZSA 1OLRA 3PJYA 2R16A 4XIKA 1RINA 2PAMA 4JDMA 2D44A 1RUOA 3BPZA 2Q30A 1PO21 1QJZA 4PDWC 4FCAA 3AK0A 4A7YA 4Z8BA 1LULA 2PHXA 3ZXFA 3J8F1 1K5MA 4EWEA 4XFBA 1H2MA 4YGCA 1ZYBA 2ZX2A 1N1TA 2WZR3 1UU6A 4YRDA 3FWEA 1X82A 4I2OA 4AGVA 3NV4A 5FPXA 4OHVA 2PN5A 2IFWA 4R4XA 1V70A 4QPIC 1G9DA 4W6XA 1D0GA 5DDJ1 4PIYA 3RYPA 1N1SA 4AK3A 4MVTA 1YWKA 3ZYJB 1D2SA 2VW0A 2R49A 2UURA 2ZZQA 5IT6A 1CGPA 1KJLA 2RM22 3JBG2 2ZX3A 4Z2WA 3MPBA 2CGNA 3VBFA 1MEC1 2BVVA 3ZYRA 5GALA 1FV2A 2Z42A 2AUYA 3KGLA 2WZPP 1A78A 1SLLA 5GKAC 3AKPA 1WLCA 4HVOA 1U0AA 1HLCA 2JENA 3PVEA 1CAXA 2VXRA 3AYAA 3QACA 2D40A 4FOYA 1AR63 3ASIA 1PVC1 2YV8A 1MZ5A 1SCSA 2YXSA 1GR3A 2HWC1 1OKQA 3BOPA 2VQAA 4KWLA 4P9YA 1DGLA 1QOSA 1LHOA 2HYKA 5FOJB 2DV9A 3HT2A 1OMIA 1RTVA 4MUVA 2B45X 3ZFEC 2C0ZA 1PK6C 3POSA 4AVBA 2A70A 4EV0A 3NW4A 2MHFA 2IFRA 2WT2A 1V6JA 1LOCA 3ILNA 5FREA 4RS5A 5B2GB 4YGBA 2ZAAA 1NA1B 4Y1VA 4K21A 4Y24A 2JKBA 1COV3 3X29B 2PFWA 3WV6A 4IEOA 1FV3A 1YRZA 4FT8A 5CFCC