4XXAA

Crystal structure of a recombinant vatairea macrocarpa seed lectin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
235
structure length
234
Chain Sequence
SEVVSFSFTKFNPNPKDIILQGDALVTSKGKLQLTKVKDGKPVDHSLGRALYAAPIHIWDDSTDRVASFATSFSFVVEAPDESKTADGIAFFLAPPDTQPQKDGGFLGLFNDNKSIQTVAVEFDTFSNTWDPSARHIGINVNSIESMKYVKWGWENGKVANVYISYEASTKTLTASLTYPSNATSYIVSANVDLKSALPEWVRVGFSATSGLSRDHVETHDVLDWSFTSTLQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seed lectin
publication title Crystal structure of a recombinant Vatairea macrocarpa seed lectin
rcsb
source organism Vatairea macrocarpa
molecule tags Sugar binding protein
total genus 53
structure length 234
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xxaA00
4XILA 4XMIA 3QLQA 1HQWA 3IPVB 1SBEA 1V00A 2GN7A 1QOSA 1Z0HA 2ZGLA 1PZ8A 1QGLA 2DURA 4GWNA 4HANA 2ES3A 1AVBA 1OKQA 1N1VA 2CNAA 4MYEA 4SLIA 3VKMA 1FX5A 1WLDA 1CPMA 1HQLA 2V73A 4M3CA 3VKNA 3MW3A 3UK9A 2UWCA 4FPYA 1FYUA 2A6VA 2A71A 3SLIA 1VLNA 4WV8A 1QDCA 4FPLA 1W6OA 3GNEA 1LCLA 4FP2A 1W6QB 4CRQA 3HMYA 5EXOA 4TZDA 1FNZA 4TYSA 1QMJA 3WCSA 2PHTA 1QNWA 2DUQA 2JDZA 2UURA 2WJSA 4XJ8A 4YW2A 3AFKA 3AZYA 4LBKA 4PBPA 2ZMKA 2GNMA 1IS3A 3LSDA 4AVVA 1LOCA 5JOZA 4JRAA 3UJQA 1ULFA 4AVTA 1UZZA 4W65A 5IK8A 1X50A 4Q8KA 1FV2A 2ENRA 5JVVA 3ZPYA 1SLLA 4K21A 4XJUA 1MS5A 4GXLA 3I4IA 5T5LA 1SBDA 5T55A 4YW5A 3POWA 1ULDA 3D5OA 5KXBA 1G9DA 3RS6A 4YZ3A 4YFZA 1DIWA 3MW2A 5GLTA 1JBCA 3FUOA 4UW6A 4GKYA 2KM2A 3AP4A 5GLWA 3M3EA 1I3HA 1ULCA 1CR7A 1DQ1A 1D2SA 1GLHA 1ULGA 1O4YA 4FPHA 3ZSMA 1C1FA 1MZ5A 1UPSA 1V6LA 3INAA 2WNEA 4XJ9A 3FBYA 4Y22A 5JMCA 4Q1RA 1JN2P 1WW4A 2EF6A 2R1BA 4FOWA 3AXDA 2DVBA 1LOEA 4R9AA 1DZQA 3HR9A 1DQ0A 2GNTA 1I1EA 4NO4A 4FP3A 2OW4A 3PVOA 4Y24A 3AZVA 1SLBA 4C1XA 4FOYA 4GKXA 4XZPA 1KDMA 1Q8PA 4P9WA 1SLIA 4YLZA 3CNAA 1G9BA 2JD4A 3D6EA 2WT1A 3PVEA 1KRIA 1QNYA 2VU9A 3W58A 1AF9A 1G7YA 1VAMA 1WD3A 3N7KA 2EXJA 4LBJA 3B69A 4XHBA 4OZXA 1APNA 3WDVA 4ATFA 1KQRA 1N3OA 4K20A 5GZDA 5DXDA 2DYCA 3IKWA 1FNYA 4YZ4A 2NMNA 1V6MA 1W0PA 1JXNA 2ZGSA 4U36A 3U4XA 1QOTA 1S0GA 1MS0A 5SV8A 2W08A 4YW3A 5GZEA 2ZGQA 5BYNA 1S0JA 5E8AA 3ASIA 1G9AA 3I8TA 1YI7A 1LHOA 2E7QA 4M3CB 2D3RA 2DUOA 3VV1A 1IOAA 2JECA 2D3SA 3O5SA 5T52A 3AK0A 2FMDA 3HN1A 3BIWE 1LGNA 2ZGTA 3OBTA 4LBQB 2ZGNA 5DZEA 1UZYA 2YXSA 1JW6A 1FV3A 2AH2A 1Q8OA 3AJZA 1HDKA 4BLIA 2R0FA 4BMBA 1MZ6A 1WLCA 2P34A 3O0VA 3POYA 2GN3A 3APBA 1AJOA 4XJZA 3PMEA 4XBQA 1H9WA 3TB0A 1WBFA 4FPGA 4JC1A 1TEIA 3FLRA 3ILRA 3JUUA 4PF5A 4XTMA 1Q8QA 4YG3A 3IMNA 1YRZA 3USUA 5CNAA 3SH4A 3VUOA 3M3QA 4P9XA 4YM3A 2DU1A 1Q56A 3B00A 1KITA 1QOOA 4YG0A 2VXRA 2VW1A 3O0XA 1CIWA 2A6YA 1KJLA 2BQPA 3ZXEA 3OGGA 3POSA 1VALA 4YW4A 1JYIA 1URXA 3ZSJA 1O4ZA 3LCPA 4BQ1A 4YZ1A 2D7FA 3AP7A 4UW5A 3ZXFA 2GDFA 4Y1ZA 3JU9A 3B3QE 3ZVXA 4PBOA 1W6PA 1N3PA 5HCFA 1S0IA 3H0OA 3OYWA 1H9PA 3FFZA 4FPKA 4XHXA 3OPZA 3Q9OA 4YG6A 2A6WA 3MW4A 4XXPA 1GZWB 3N7LA 1MS9A 1SLAA 3ATGA 1XQNA 4LBQA 4Y22B 3SISA 1G9CA 3AZXA 2DU0A 5GZCA 4Q1PA 1SACA 2WT0A 3OJBA 2OUJA 3WG4A 2E53A 3IM0A 2WLQA 4UW3A 4DRVA 1V6JA 1BZWA 2OUHA 1DFQA 4ATEA 3MEPA 1LGCA 2D6LX 1W6NB 3A4UA 1ULEA 1LGBA 1Z78A 3AXEA 4IQPA 1RIRA 1SCRA 4ASMB 1YYNA 4YGDA 5GLZA 1CESA 1LENA 3ILNA 3SNMA 3R05A 4AGRA 1S0EA 3WCRA 2JE7A 4DRRA 3V0AB 4WZFA 1IS4A 1DQ6A 2D6KA 1YXWA 4YM0A 3T1MA 1W6MA 1U0AA 1S0BA 3WG1A 2A3YA 4BLJA 2ZZJA 1LHVA 5H9SA 1GKBA 1LHNA 1WW6A 2CY6A 4K1ZA 3SH5A 2AGSA 1AX2A 2ZGKA 3AYEA 4CTEA 5GZFA 4AGVA 3SITA 1GZWA 3AZZA 2FHRA 3ZSLA 1F9KA 1DYKA 4YFWA 2ZA9A 3L2YA 1N1SA 3FLPA 1BYHA 2ZMLA 2VW2A 3RMYA 1MS8A 2P2KA 4M01A 5FRAA 2DUPA 2YMZA 3NV2A 2D6OX 2YZ4A 3AYAA 4XDQA 1MS1A 5DZGA 3VKLA 4PCRA 3A0NA 1DLLA 2EXIA 4Y20B 4XTPA 1W6NA 5H9QA 4BOWA 2DVAA 1MR5A 4H55A 5T50A 5IK4A 2CYFA 1VIWB 1DQ5A 5DUUA 3WOGA 4FOVA 3RRDA 2PHFA 2UWAA 3USUB 1LU1A 3RQ0A 2WQZC 3V0AA 1A78A 4YGEA 1V6OA 2ZHMA 1AXZA 2E51A 4C1WA 1G9FA 2NYYA 3PVNA 2GNDA 3D4KA 1DQ2A 5KXCA 1FATA 2CL2A 2AR6A 3M3OA 1LULA 4GALA 1JUIA 3ILFA 5CAZA 4FQZA 3N35A 4FOQA 3N7MA 4CZSA 5DUVA 5DUWA 2A75A 1S0CA 2D44A 1KJRA 1AXYA 2SLIA 1QDOA 2H0BA 3O0WA 3M3CA 1W6PB 1GYKA 2UU8A 3OYWB 4ZXKA 1B09A 1F5FA 3FLTA 1GZCA 3M1HA 1UN1A 3OBRA 3AP9A 4Y1XA 3R4UA 1F31A 3AYDA 2C5DA 3ENRA 1LOBA 4Y26A 3W59A 1DGLA 1W0OA 2B7YA 3ZYPA 4NOTA 5E89A 4Y20A 2DV9A 4XE9A 1IS5A 1UKGA 1CQ9A 2D6MA 4XYXA 2D43A 2VY0A 5GZGA 3BTAA 1JHNA 1N1TA 1IKQA 1SLCA 4FPEA 3B01A 4Q27A 2A3XA 3N3HA 3WDUA 2A6XA 3AJYA 1NLSA 2PHUA 1EPWA 2JKBA 2A6ZA 3V0BB 3C2UA 1GZ9A 1IS6A 2W52A 2NMOA 2P3JA 4WVWA 2D6PA 2NN8A 2P37A 4XBLA 1AX1A 1LOAA 3WG2A 4GA9A 2E7TA 1W6MB 4DFSA 1LOFC 5DG1A 4RL7A 4Y1UA 1SLTA 2WSUA 1V6NA 3FUQA 1SFYA 3R4SA 1LEMA 3O12A 1OQ1A 2EXHA 4FQ4A 2ERFA 2OVUA 1S0DA 5JLVA 1YO8A 2ZGUA 2ZGOA 3DGTA 3SH3A 3WUDA 3WVJA 1WLWA 1DHKB 4P9YA 1IKPA 2GNBA 4Y1YA 5IK5A 4XMAA 4LBQD 2ZKNA 1A3KA 4XOGA 1WW7A 3V65A 2R16A 5GM0A 1LEDA 2XB6C 1BXHA 3GALA 3VKFC 5E88A 2EALA 5IT6A 2LALA 3UJOA 1FAYA 2AREA 3WG3A 2VH9A 5IUQA 1WUVA 1CVNA 2LTNA 2VUAA 2ARXA 2WT2A 1QF3A 3UL2A 3ZSKA 4FPOB 2V5YA 1BKZA 2TEPA 3T2TA 3WZ1A 4XIOA 1V6IA 1G86A 1J1TA 2DWRA 2SBAA 2NZ9A 3AP5A 3NV3A 4UW4A 1AJKA 1ENSA 3V0BA 1MACA 2CWSA 1DQ4A 3WUCA 3WHTA 2ZBJA 5JOYA 1LHWA 3ZXLA 1UMZA 2D6NA 4XJAA 2JJ6A 5FREA 5HCAA 1YIFA 5HCBA 4LBMA 4BMEA 1BQPA 4DQAA 1ENQA 5EWSA 2PHXA 1UX6A 4XIKA 1DBNA 1ZA4A 1LOFA 2YV8A 1HLCA 2GMMA 3TAYA 1MVEA 3M2MA 1C1LA 3N7JA 3N36A 4AVSA 1BJQA 2PHRA 3WDXA 1Q8SA 5JOWA 1G8WA 3B9CA 4BM8A 2NP0A 5L73A 1LOGA 1VAVA 2AENA 1WBLA 3ZYRA 3KM5A 1ZM1A 1SCSA 5JDBA 4K1YA 5DUXA 5CA6A 5KXDA 1C4RA 3KQRA 1S1AA 4Q26A 1KDKA 4RA0A 4XBNA 1LESA 4DS0A 2EXKA 2CTVA 3OY8A 5GALA 3BOPA 5DG2A 2JE9A 1GV9A 2DTWA 3IPVA 2UWBA 4ISRA 5GLVA 1LJ7A 5T5JA 1JYCA 3OY8B 1LTEA 1UAIA 4YW1A 4AWDA 2WKKA 5KXEA 1GSLA 5T5OA 2PELA 2DVDA 1QKQA 3NWKA 1SBFA 2A5ZA 3AYCA 1N3QA 1DYPA 4M3CF 4R9BA 4WVVA 4U2AA 2A7AA 4Q8LA 1ENRA 1Y7BA 2ZHLA 5F5QA 2ARBA 2ZGRA 3VKOA 3ZXKA 1LECA 4Y1VA 5DZFA 5LK5A 1W6QA 2ZABA 2ZGPA 1S0FA 1HKDA 1Q8VA 2A70A 5EYYA 1GANA 1CONA 4AYUA 3RG0A 2HYKA 4Z8BA 3WDWA 4L8QA 3WV6A 1R1ZA 3ZXJA 1V6KA 4PQ9A 1D0HA 2W68A 1LODA 2E6VA 5AVAA 2PHWA 4FPJA 4M3CE 1PZ7A 4I30A 4XJWA 4ISQA 5GJ6A 3NV4A 4D69A 4YZ2A 3BODA 2P3IA 1MS3A 3QCWA 4JCKA 5IK7A 1RINA 4LBNA 4HL0A 4YM2A 2ZAAA 3WLUA 2R49A 2ZGMA 4F83A 2XG3A 1A8DA 2R1DA 2AYHA 3LSEA 4FPFA 4M00A 3AP6A 4YGBA 3WHUA 1UL9A 2EIGA 4ITCA 3AX4A 4KBBA 3DUIA 1AZDA 1GICA 1MVQA 1NXD1 1WCSA 1WW5A 2C9AA 2YY1A 4XXAA 5T54A 1AXKA 4YZ5A 3WDTA 5JOXA 1N47A 2RHPA 1GNZA 1RITA 4YGCA 3WNXA 5CBLA 1AX0A 2W39A 4ZKTB 1QU0A 1LHUA 1C57A 4FPCA 2CWMA 4AGGA 4FVVA 1N1YA 2NM1A 4Q2FA 3RSJA 2D3PA 3NV1A 4P14A 1OFSA 4BPZA 1PZ9A 2GMPA 4R9CA 1CPNA 1W6OB 3WDYA 4DPNA 2DVGA 1JOJA 2AUYA 2Z42A 3RMXA 2A3WA 1LU2A 2YROA 1GBGA 4R9DA 4LBLA 2G4IA 2WSVA 2GMEA 3A0KA 3IN9A 1CJPA 1ONAA 2DVFA 3PJQA 2DTYA 5H9RA 2I2SA 4LBOA 1GNHA 1H30A 1WD4A 4YM1A 5CB7A 4GWMA 2EAKA 5GLUA 2R0HA 5T5PA 3V64A 2Q5TA 5H9PA 2ZMNA 3MPPG 2ZACA 1MS4A 5F9TA 2VW0A 2ZHNA 2P3KA 3T1LA 1CN1A 2GALA 3AZWA 5EYXA 2ZHKA
chains in the Genus database with same CATH superfamily
3QOPA 5D1IA 3GZAA 4XILA 4XMIA 3QLQA 4BQ2A 3LAGA 4XAAA 1SBEA 1V00A 4LKDA 1H1AA 5FZHA 2ZGLA 1SDWA 5C5TA 2WC2A 3M70A 4H7LA 5LA2A 1N1VA 4SLIA 5J96B 2ETEA 4WM7C 2ILMA 4YW6A 5BNPC 1CPMA 3D0JA 3AL5A 5L19A 1NLRA 3WP3A 1QHDA 3J7MA 4LUMA 4EV0A 2UWCA 2ZXQA 3DYMA 2HWF2 3Q8AA 4Q0QA 3SLIA 2LM3A 1J84A 3OPWA 4WV8A 3VHNA 2VC9A 2DCKA 1QJX2 1DGRA 1ZZ6A 5EFUA 1O91A 4B8EA 5EXOA 4CRQA 2XLFA 2VNRA 3J7NA 3AFGA 4G3YC 4Z82A 4KU8A 3MV11 3ETQA 3S5QA 4NIHA 3IWZA 2JDZA 2HJIA 2WJSA 3KLSA 2E7AA 4UFJA 5FK8A 1JODA 1UCXA 1JS9A 2P6HA 1PO22 3LSDA 4CEYC 5TSWA 2B39A 1ULFA 1F4HA 1QJFA 5DAXA 3RZGA 2ENRA 5JVVA 4LUKA 2JG9C 4Q4X2 2WWUA 1HQNA 1PNGA 5EJ3A 4G9SB 4B1MA 5T5LA 5T55A 1PGSA 3MDPA 1RXFA 3D5OA 1EUTA 3NKGA 2QTWB 1A6CA 3POWA 4JQRA 4O9GA 4YZ3A 4R4ZA 5FPAA 5FYSA 3VDAA 3WF4A 4YFZA 2DFBA 3HEIA 4BK5A 1JBCA 3FUOA 3OBAA 2WZ8A 3M3EA 1ULCA 4PJYA 4AW7A 3OD0A 1D2SA 4FI9A 4MGYE 4WM7A 3W9AA 5BNPA 1RUG2 2BWCA 1US3A 3LQCA 1COV1 2WNEA 1PHMA 4LMFA 4BISA 5BV6A 2XOMA 1HRI2 1JZ8A 3BGAA 2BNNA 5JMCA 5FPXA 2EVXA 1NQDA 3AXDA 4QX3A 1NX9A 4BJ0A 1LOEA 4R9AA 3SHRA 2W46A 1ZRCA 5HI0A 5D8AB 2QUOA 4KI5M 1AYM2 3T08A 4QT6A 2VCAA 4FP3A 3BTXA 3KCXA 1XSRA 2HYXA 3HJRA 3PVOA 4P5YA 1CJDA 1OHFA 1POQA 2W92A 3GM8A 4C1XA 1SLBA 4BE3A 1K3IA 4FOYA 1VRH3 1O7FA 1KDMA 2IFRA 4LO5B 4P9WA 3RNSA 3WQ1A 3BI3A 3B7MA 1V0AA 1EAH1 4XFFA 4QQOA 3PVEA 1UOBA 1NA1C 4A7KA 4QU1A 5ANNA 3W58A 1JYWA 4HK8A 2JG9A 3LDRA 5LY1A 4Z07A 5CYYA 3VHPA 1NT0A 2VZRA 2MEV3 1N3OA 1Z7S3 4K20A 2XR4A 3Q8FA 2DYCA 3VBUC 4B1LA 3IKWA 2CV6A 3AMPA 2VVFA 4Q4V3 4CVUA 4M0HA 2RDRA 5SV8A 1MS0A 3RI9A 5BYNA 1S0JA 5I93A 4KWLA 3ASIA 1G9AA 4CSWA 3I8TA 5LA1A 1J83A 1FMD3 1NCQC 1O3TA 1YI7A 1MQTC 1W9FA 2JDYA 1IOAA 1CIYA 2C6SA 3O5SA 5JIAA 2HWD1 1XRUA 1OPOA 3HN1A 3ACGA 1RJ8A 5FV3A 1PMIA 4H14A 4LBQB 3WSOA 2GC3A 3HT2A 4BQ3A 3AL6A 3PURA 5DZEA 3P5BA 5EIYB 1RUF2 1UZYA 3JBG3 1JW6A 1RMU3 4HPKA 4XFHA 3DKQA 2LRPA 5FLHA 3LFIA 3O0VA 3H7YA 2GN3A 4S2DA 4UXAA 5E16A 4EQVA 1H9WA 1G6NA 1WBFA 4Q4Y2 4ZZ5A 3FLRA 5ERLA 3J7LA 2ZAHA 1VBA3 3IMNA 4YVWC 2ATFA 5LWBA 4YNIA 5FZCA 1UW8A 3VBHC 2JB8A 3B00A 4AG4A 3O0XA 1NA1A 1CIWA 1RHI1 3VD3A 1W8UA 3K77A 4AVVA 4GWIA 4M4RA 3PL0A 3POSA 4QHZA 5K0UB 2FDFA 1JYIA 4E4DX 1VBB1 2WO2A 3ACIA 3LCPA 2ADDA 3P6BA 1COV2 4J1XA 3QACA 4JVAA 3E6DA 4L92A 1H0BA 4RR3B 4IXLA 2XQXA 3N9OA 5FWJA 3JU9A 4D0QA 4PBOA 5CFCB 2CDPA 1RUD1 3PHMA 1DG6A 3Q8BA 1JH5A 3LA7A 3GF6A 1H9PA 3OPZA 3Q9OA 4JKMA 3CDZB 3MW4A 1VBE3 1H6YA 4MXVA 2I07B 1IG3A 3ATGA 4J25A 1MQTA 5LATA 4QPGB 3SISA 1G9CA 3AZXA 1DDLA 1OLRA 5JWPA 2RDSA 2DU0A 1AL0G 3TN92 4Y4YA 4JGZB 5KBFA 1JZ5A 3OJBA 2ZX4A 4DNYA 3WG4A 5DPNA 3RZZA 4QX0A 5A3TA 4DRVA 1V6JA 5LRRA 1BZWA 1EAH2 1DFQA 3OBZA 4CCMA 1AR93 4RGGA 1NCRC 1RL3A 1W6NB 3A4UA 3GJAA 1OLQA 4GQ7A 3HD8B 3PIJA 5A3OA 4ASMB 4ET7A 4WVMB 3BPZA 1CESA 2RJLA 3SNMA 2VBDA 4YVWA 1EY2A 3VHRA 3W5MA 3WCRA 4DRRA 3H1MA 1IS4A 3O14A 1H2MA 4RFRB 3VBHA 4C0BA 5FY4A 2E63A 5FAXA 2WAOA 3ZX7A 1UZWA 1S0BA 3WG1A 3SXWA 2A3YA 1RUJ3 4BLJA 4OCTA 1LHVA 3ECQA 1BLZA 3GBWA 3NJXA 2HWD2 1XNAA 1AX2A 1BK0A 2WINB 3AYEA 5J37A 3DPRB 3SITA 5IWFA 2R071 3GBGA 1US2A 3UYJA 3ME2A 1O3SA 2R041 1DYKA 1RGSA 3BVCA 3RI8A 2WNUB 1ZBE2 4QDRA 1YI9A 4KWKA 1MS1A 3PJYA 1Y9GA 3ST7A 3VKLA 1VBD1 1DLLA 1JYTA 4DZGA 4NMIA 4Y20B 2FD8A 3O1TA 1GR3A 3VB9A 2XPJA 2QQLA 2OXBA 4V1PA 5T50A 4LHSA 2CYFA 1NCRA 1OC1A 1VIWB 1RHI2 1VP6A 5FMDA 4XCAA 5FFOC 1E5IA 4FOVA 3JXSA 1UZ0A 2K9ZA 3HIFA 1LU1A 5FJHA 3V0AA 3VBUA 1OH3A 1VBB2 3AKTA 3TBDA 4IESA 1VMJA 2XBO3 1RUD2 4E2GA 3R4DB 3I2FA 1LULA 3BCWA 3M3OA 1JUIA 5CAZA 4E4HA 4FQZA 2ZOEB 4FOQA 4WM8A 5FYYA 3SEPA 3VBOC 1GQPA 3IAPA 3HNMA 2MNGA 4CXWA 5IATA 2VBBA 2D44A 1SFPA 5FQ0B 2SLIA 1QDOA 4UOJA 3MV01 2H0BA 4A6OA 3ITQA 1W6PB 2UU8A 4HK9A 3TYJA 2Y60A 3OYWB 4GJZA 2HEWF 4Z2WA 3M1HA 3I2DA 1CZTA 4AEMA 1UN1A 3ZYHA 2OYZA 3U4SA 4Y1XA 2B9VA 2C5DA 1XC6A 5CKNA 4WZCA 5F2WA 1JTZX 5I8TA 5JOZA 4IV3B 3WNNA 3VDCA 2WO3A 4LKSA 3W59A 1DGLA 1QJU1 4NOTA 5E89A 3LPGA 1IS5A 1WMXA 1H2KA 3ZFGC 1CQ9A 4AVAA 4HVRA 3ORJA 4IV1C 3KF5A 3H8XA 1N1TA 4I0BA 1H8VA 5C3PA 2C1FA 1EPZA 3B01A 2ZX0A 4HVOA 4Q27A 4ZXEA 2JENA 4BHPA 3EJKA 1CGPA 3K4ZA 1QJY2 4K7JA 5EP9A 3UETA 4OHWA 1JU3A 1ALYA 1H1IA 5BNOC 2JD9A 1GZ9A 4FAGA 3QH6A 2P3JA 2NN8A 1HXS1 4XUOA 4OI2A 4CYDA 4XFGA 1QY4A 4QXBA 3VZMA 4RL7A 2XONA 2R072 3NNFA 1XE7A 3T2OA 3B93A 1SZBA 2FDJA 3VBOA 3ZYJB 1BK1A 1S4CA 2ERFA 3FX3A 2ZGUA 3E97A 5F6KA 1WLWA 1DHKB 4A3XA 4BB3A 1KFUL 1VBD2 4QPIC 3U75A 4QQ2A 4LBQD 4XOGA 1BEV3 4MZUA 1WW7A 3V65A 1GWKA 2XB6C 2F17A 1RUC3 4D7YA 2V5DA 2Y64A 3GALA 2VZTA 4AVCA 2LALA 3UJOA 3T0DA 5K9YA 4BXFA 3WG3A 5JXIA 1V70A 2QCSB 4IE4A 3O1OA 2HWC1 3ZYBA 2LTNA 4AI2A 1RVF3 3PMSA 4LLFA 4TWTA 1F2NA 1QF3A 4NVPA 3UL2A 3ZFGA 3ZSKA 3GDBA 3CZUA 3I59A 5FXVA 1BKZA 5FY0A 4IV1A 1AR82 1G86A 4PLNA 2XVKA 3AP5A 3DV8A 3K3OA 3QD6A 2BZDA 1NAEA 1ENSA 1OOPB 2X5IB 4LJHA 3GHNA 2XVLA 3V0BA 2B4KA 2R061 4CU9A 4MGIE 5JOYA 2RM21 4AE2A 5A6XA 3MIGA 5BNOA 2D6NA 5FREA 4QWNA 1HRV3 1YIFA 5HCBA 4FFFA 1ASJ3 4JX0A 5EYXA 5EWSA 3I2HA 5FK7A 3VBSB 4FTBA 1DBNA 1CD3G 2B8MA 4XZUG 4L97A 2PHRA 4XAEA 1Q8SA 5JOWA 4PLMA 3WNPA 2NP0A 1VAVA 1QJU2 3F2ZA 1SCSA 4HLTA 3GYDA 4K1YA 5A6YA 2PYTA 5DUXA 1OA2A 1M06G 2C26A 4QPIA 5CU1A 2GC2A 4DS0A 1R081 2JKXA 4NHYA 2PAMA 5DG2A 2YGMA 4MOAA 1AYN1 2VNVA 2WDBA 3KZ4C 4E2SA 3MF6A 1LTEA 2W1SA 5HV0A 2WKKA 4IETA 3WNKA 1GSLA 4LHKA 1STMA 2PELA 1T2XA 2VMCA 3B9IA 1PO13 1HXS2 1VBC3 1N3QA 4QGNA 4CCNA 5LCWL 3SKVA 2A7AA 4MXWB 4Q8LA 1ENRA 2XDVA 2I74A 1YEWA 2YBSA 4EJRA 2GP3A 3MUY1 4QHOA 2ZABA 5LK5A 5A33B 4DOUA 4XPVA 1HKDA 2A70A 1KEXA 1GANA 1OFNA 2I45A 4Z8BA 2HYKA 4L8QA 4NHMA 3H7JA 4UT5A 3WV6A 4INDA 1ZBA3 4ASKA 3AKPA 5F5CA 5KHHA 1OUSA 1D0HA 4LK6A 2MPFA 3LIHA 3OUHA 4XVHA 4FPJA 4LO8A 3B94A 4I0AA 5FMOL 2JDKA 2BOIA 1V9U1 4KH9A 5F2SA 2RV9A 1O5UA 3ZN5A 2XJVA 3O1UA 1YFWA 1MS3A 1O8PA 1K5MB 4KMQA 3U07A 3KB5A 3LIGA 4LIVA 4IEXA 4YM2A 1VR3A 2R49A 3I3MA 2R1DA 4QKNA 4NROA 4UF0A 4ITCA 4LTAA 3KQ4B 2VCMA 3DUIA 1NXD1 3OSDA 4JTNA 2W95A 1WW5A 5CIRA 3NO8A 2YUEA 4GZ9A 4K8RB 3P3NA 3KT7A 1OVSA 3OEBA 1GNZA 2BWAA 5L9RA 5FYVA 1BHGA 2R062 2UYAA 5FZGA 4ZKTB 1RC6A 2RM22 3IZOA 2J7MA 2CWMA 3ZFEC 4FVVA 1N1YA 3MZHA 1K5JA 2IXHA 2BU9A 3AMQA 3D0SA 3EMRA 2D3PA 3LGRA 5EJZB 2W1UA 5LRSA 4KWUA 1OFSA 2E32A 1PZ9A 3T4HB 4Q4V1 4CPBD 2RS52 1ND2C 3FC0A 2RMU3 4BQWA 2AUYA 1OSGA 3IAQA 3RMXA 3JD73 1CAUA 1BBT3 3GCWA 4KQ7A 4DO0A 2MHFA 1FMD1 3FHIB 2WSVA 3T30A 1ONAA 4CCLA 5AFEA 5F1RA 2FQPA 2VNOA 2DTYA 2QVSB 1R1A2 2I2SA 1UXZA 1R082 1GNHA 3GBFA 4P00B 1WD4A 5KWRA 2AEZA 3JQXA 4Y3OA 2R0HA 3FN9A 1OA3A 3O7OA 5GLUA 3V64A 4X6RB 1AYN2 5JMOA 5JZGC 2VZOA 2EIDA 2VTXA 3PU8A 1RMU1 2ZACA 4QPYA 5CKQA 1UY0A 2WZR1 1HB1A 1HN1A 4ZU5A 4BYYA 2HWB3 1CN1A 5CKMA 3BALA 2VXJA 2ZHKA 3OUJA 4QXCA 3TNQA 1CZVA 4AFDA 3T09A 2GN7A 2HWE1 2OIIA 1Z0HA 2Q0AA 5CZKA 1S55A 2DURA 2O8OA 5FMOS 4SBVA 4MYEA 1RUNA 3RYRA 4RS5B 4I0WB 1WLDA 1DLCA 3WX5A 2V73A 4M3CA 3MW3A 5FYMA 4E9KA 5BNPB 1X8EA 3K4AA 4P9GA 3ZFEA 5K7PA 3S7IA 5F8PA 3THPA 3O1MA 1QDCA 4FPLA 4OMCA 3BU7A 2UY8A 1LCLA 4FP2A 5EQUA 1W6QB 4DB5A 3HMYA 4TZDA 1ND2A 1FNZA 1V9U2 3WNMA 2G1MA 4PLOA 3VBRB 2WRAA 4NHXA 1QXJA 2PHTA 1W8NA 2BDRA 2D98A 4A7YA 4YW2A 3PIGA 1VBE1 3AZYA 4QXHA 4PBPA 5F39A 1PVC1 2YC0A 2ZMKA 4AI9A 4DUWA 5BNNC 3J26N 1UIJA 4HN0A 3UJQA 1RUE1 4W65A 5IK8A 1X50A 1DCSA 4CEYB 3ZPOA 3GHMA 4Q8KA 3RZHA 3OGRA 5KR7A 1C8M3 3MICA 3IMMA 5JZGA 1I5ZA 2VUJA 3CBNA 5FZMA 3UGHA 4CDQB 2JG9B 2PLV3 4YW5A 2PTMA 1ULDA 1AR91 1XNKA 3RS6A 1X82A 4CUAA 5LB6A 4NE9A 1ZYBA 5GLTA 3S57A 4GIQA 1TMF3 1RJ7A 4GKYA 3AP4A 4GB33 5GLWA 3RJ2X 5J3UA 1DQ1A 4FPHA 1PIV1 1O4YA 2BRTA 1C1FA 5AC91 2Y8KA 3QBQA 3ZLIA 5FTTC 1V6LA 3J9SA 4XQWA 5A7WA 5F32A 3ROUA 1CAXA 1PK6C 4XJ9A 3FBYA 5G05L 4Y22A 4Q1RA 2RDQA 4CP1A 1LKNA 1WW4A 2EF6A 2W94A 2R1BA 3H50A 4QKDA 5KHKA 3DKWA 2XQRA 3KV4A 2VMIA 1DZQA 4HPKB 4HT1T 5L7OA 2Q30A 4NO4A 5HBAA 2Y6JA 3MLLA 2OW4A 5J7MA 1AR61 4F7ZA 3POGA 5B2GB 2WZR2 1RUH3 3AZVA 4OQ9A 5KHIA 1PMJX 4P08A 4XZPA 4AHXA 1ZZ8A 1Q8PA 3AB0A 1TME3 5BNNA 1JYXA 3D6EA 2WT1A 1W2UA 1C5HA 3H9AA 2JG8C 2HWE2 2Y6HA 2YFUA 4XQ4A 2VU9A 5FPBA 4MG2A 1AF9A 4AEDB 3N7KA 3B69A 2IZWA 4OZXA 3KS7A 4OHZA 4ATFA 1KQRA 1D4M2 4AAPA 5IVFA 3NMBA 2F4LA 4YZ4A 1Q3EA 1V6MA 2NMNA 3DN7A 1JXNA 2ZGSA 3MLKA 1FPN3 4GMP3 4AAXA 1EV13 1NZCA 3J8F3 4YW3A 5GZEA 4EN7B 5BPXA 2J1EA 2B42B 2D40A 4B29A 3U10A 1W8OA 2JDAA 4IW3A 3RZJA 4AHZA 1H8TB 3I2KA 2E7QA 3GZTB 3WP6A 3MIHA 2P1BA 1NCQB 1QJZA 2QKDA 3HBZA 1PK6A 3LB9A 1MQTB 5IYYA 4QXKA 1L7QA 3DXUA 3L2HA 1PVC2 4B4PA 5KC6A 4ZY9A 3WR0A 4QQHA 1R092 3U11A 4UWDA 4EE2A 1Q8OA 1RUE2 4N7UA 1AL21 3IB3A 2P34A 4URAA 2WBKA 3ZFFB 2OZ6A 3NQHA 4CUBA 3PMEA 1L3JA 3HPNA 4BXSV 1OI6A 1NE6A 1F35A 3BOWA 5A32B 1YRZA 3USUA 3SH4A 4P9XA 2VR4A 4GH4B 3M4FA 4YG0A 2ZEYA 2QQUA 2VW1A 2Y6LA 1O3QA 2JG8A 2QJVA 3VBHB 2BQPA 2VZUA 1PIV2 3CMGA 3OGGA 1JOPA 1VALA 5AC92 4YW4A 4OHYA 3IDAA 1URXA 1W8FA 5FZ8A 4UBHA 4UW5A 1POV3 4CU7A 4LHLA 4LITA 4PT6A 2WNVC 1S0IA 3CEWA 1MZFA 3DYPA 2YHJA 1EUUA 4XXPA 3M7AA 1XPWA 3C8XA 3CLPA 5FO7B 1OD5A 1XQNA 3VD9A 1QXRA 5JXGA 3FHAA 3S7EA 4NIGA 1AR62 3C7EA 1HW5A 1JZ3A 1HJFA 1OQEA 2ID4A 4LK7A 1OUXA 1XOYA 3LOBA 2X29A 3C7GA 5FCCA 3TRSB 5DAVA 3W5NA 2D6LX 1NXMA 3VZNA 1AR73 3NRUA 4CDUA 1LGBA 2Y6KA 1SCRA 1NCRB 5E1RA 4YVSC 2WWSA 1LENA 3T4VA 3HWJA 1BVP1 4XABA 2VGDA 2JE7A 3V0AB 2HBUA 4WZFA 3N9LA 3WQ0A 2Y33A 5FP4A 5IVBA 2D6KA 4KG0A 3T1MA 1U0AA 4CP9B 1YFXA 3A22A 4LPLA 5ABJA 3AKSA 2E26A 5LZ6A 3THDA 2VOTA 2ZZJA 3M3IA 1DYOA 5H9SA 4N53C 2VUDA 1IPSA 1LHNA 1ZA7A 5FZKA 2CY6A 4AFMA 4K1ZA 3SH5A 1ZREA 2AGSA 4OYUA 1RUI3 2FDHA 3JZVA 1MEC1 4XACA 3WW3A 3SQOA 5GZFA 4CTEA 1HB4A 4AGVA 3VL8A 4FXGB 2RE9A 1GZWA 2WNVA 1XU2A 3ZSLA 3ETPA 1WMDA 4HMZA 1N1SA 1HRV1 3FLPA 5IVCA 1AL22 4JQTA 5A80A 3H8RA 5FRAA 1PGW1 1W05A 3D3AA 4PCRA 5FO9B 3PDQA 4JGYC 4LULA 4ZS3A 1X9PA 1X7NA 1W99A 3AVRA 1W9TA 2ZKLA 4BOWA 1NG0A 5A7SA 2DVAA 5FMBA 2P3YA 4MUVA 5IK4A 5C4WC 1DQ5A 1J58A 3TEWA 4N8MA 2XH6A 3RZKA 1HB2A 4LT5A 1W8TA 2PHFA 3Q8EA 2VCCA 4YVSA 4TLFA 4AEJA 4C90A 1A78A 2Y34A 3BKZA 1V6OA 2ZHMA 4KG8A 4OMDA 3EXUA 2E51A 2XLAA 4C1WA 4GWJA 3BUCA 3PVNA 3D4KA 2W87A 3FWEA 3FZ3A 3ILFA 1PO11 1OQDA 4NPRA 4WBBA 5JXHA 2V4VA 4DXZA 3MYXA 4LR4A 2A75A 4N53A 3VBOB 4CCEA 1HIXA 1AXYA 1GP5A 1KJRA 3KD4A 5IW0A 3N4MA 1ODMA 2IXJA 3M3CA 2VCBA 4AFBA 1UOJA 3EYPA 3DCQA 3IIAA 2VVEA 1GNYA 3AP9A 3OBRA 3R4UA 2WS93 4QM9A 1XYNA 3GJBA 3PUHA 5LBCA 1ZBA1 4QAWA 1WCQA 5DDJ3 4HETA 4Y26A 3UGFA 4OUEA 1W0OA 3A23A 3PUQA 4ZZ8A 5KHJA 4JGYA 4J1WA 2WYSA 1W8HA 5E6HA 2VTXJ 5A1FA 2D43A 3J4UH 3I3BA 3ZFGB 1DGWX 3HVDA 1IKQA 4C8DA 4CCCA 4NIIA 3N3HA 1NY71 5C4WA 1XBFA 5J48A 2A6XA 2GH8A 2WL1A 1NLSA 1OF4A 2GH2A 1EPWA 4NUBA 4QX7A 3O1RA 2A6ZA 2AACA 3C2UA 3V0BB 2VZ3A 3AC0A 4K3UA 4XETA 2D6PA 4LA3A 1W90A 3CKHA 4XBLA 3GZUC 2WZPP 5BNOB 1W6MB 1W3XA 2WR9A 1MEC2 4DFSA 2CHHA 2XL9A 5EJ1B 3SKJE 3K48A 2HEYF 4ZS2A 1Y9QA 4A41A 3KHCA 3K3NA 1OQ1A 1QQP3 1UX7A 2QNKA 4FQ4A 1S0DA 1SPPB 1W03A 5FLJA 3SCHA 5HV4A 4RQPC 2BBAA 3DGTA 3WUDA 3I2OA 3VD4A 4P9YA 3I97A 4ARXA 2VOXA 1IKPA 2GNBA 1W39A 3BU0A 1REEA 1XXNA 4JDMA 3ZN4A 3E1F1 3JD71 5GM0A 5A7PA 1LEDA 5FZOA 2XJQA 1BBT1 4QPIB 4COZA 4H7MA 1ND3C 3NKTA 4AXOA 3S6PA 1ACCA 3LDBA 2EALA 2BJSA 2HEVF 4F8AA 1WCDJ 2AREA 2WN3A 3AVSA 1WUVA 3W20A 2B5HA 2RDNA 3DECA 3K51A 4W6YA 1CVNA 4QX2A 4XDOA 4W4ZA 5FZ3A 2Q8CA 4QB1A 3NVCA 5JSRA 3ZN6A 2ZX2A 4FPOB 2V5YA 4Y33A 1ZVFA 4ZU7A 3T2TA 4XIOA 3HQRA 2BFUL 4HXCA 2AC1A 4LEJA 1J1TA 3NV3A 2HWB1 2P17A 1AJKA 2YGLA 2WWJA 1F8VA 1LNSA 4UFMA 4XFBA 1MACA 1LHWA 4CP0A 1UMZA 3LE0A 4R8HA 4XJAA 3EBRA 4LXLA 4LBMA 4BMEA 4WM8C 4C91A 1YJLA 2DF7A 4DQAA 1ENQA 4MHRA 1UX6A 4CDWA 2ZCWA 1HLCA 1YQ5A 5FKCA 2ET1A 4RHV3 3X29B 3N7JA 4N43C 1Y9MA 3G6JB 1BJQA 2JEMA 3WDXA 5I8YA 4BM8A 1AHSA 1WKYA 2B45X 4RQPA 5JSPA 2VM9A 1XYOA 4MGZE 4YARA 3E5UA 4QU2A 3UGGA 5FOBB 2BP6A 4Q0SA 3HAGA 2EXKA 4XUPA 5GALA 3ZIWA 2BNMA 4IEWA 3D8CA 1ND3A 3OTFA 5F3GA 3VBFB 1OA4A 5GLVA 4CU8A 4W6XA 1NY72 1S2BA 2Y6GA 1UAIA 1J3PA 4CUGA 1UMIA 3OG2A 4H2AA 2JB4A 5T5OA 1LR5A 3WW1A 1K45A 2HWF3 3D82A 3GCXA 4TXWA 3OB8A 4CA9A 4Y5SA 4UFIA 4R9BA 5CG8A 4U2AA 1QJX3 4NWWA 4XHBA 1Q5OA 2KD7A 3EHKA 1Y7BA 4FT8A 5F5QA 2ARBA 3RFRA 2ZGRA 5J1XA 2RS31 3FFQA 1L7RA 1OLMA 1D0GA 2H6BA 5EYYA 5I0SA 3RG0A 2WA3A 1UY2A 1GOGA 1CAUB 1PO23 1R1ZA 2EIEA 4LORA 3K2OA 2G19A 2W68A 3OGJA 1W06A 1P8JA 2BFUS 2Z69A 4Q4X3 4S2HA 4ISQA 2ORZA 3NV4A 4K40A 5GJ6A 4N43A 4D69A 4UBGA 5IK7A 1RINA 2Q4SA 3KGLA 4AQSA 1IPKA 4LBNA 4HL0A 2RR11 2ZAAA 3WLUA 4F83A 2WFF1 4M00A 3LSEA 1KS5A 3AP6A 2LROA 4EWEA 3S5AA 1UL9A 2EIGA 2RS11 5AVPA 3VD7A 1GICA 1WCSA 4YWAA 1RUH1 5HCHA 1AXKA 1HN0A 3DEMA 1FOD1 3BPSA 5LBBA 5ACA1 5JIUA 1RITA 1RUG3 4PQQA 4LOSA 3WNXA 5CBLA 4OULA 2QQPA 2P5BA 2J1UA 3HT1A 1E57A 1HRI3 1QU0A 2VNGA 1LHUA 4IEYA 4RFT0 5FIXA 4FPCA 3SCFA 3P3PA 3KWVA 4LE3A 4Q2FA 2QDRA 4P14A 4KWJA 4BPZA 4AHYA 3I3EA 2GMPA 1AYM3 1B35B 1OURA 4GMP1 3WDYA 3WF0A 3J8F1 4Q4W1 3N9PA 4AQ6A 2J42A 2VQ0A 5CFDB 3IIIA 2A3WA 3S30A 3G7DA 2Q1MA 3HNBM 2A1XA 2YC2A 2R042 3IN9A 1E5HA 3UV9A 1UU6A 4V2WA 2X05A 2DVFA 2WNOA 3PJQA 5H9RA 2Z2SB 4EWAA 3O1VA 2PHLA 4GWMA 2EAKA 3B5LB 3IDEA 3EB7A 4OUMA 1F5JA 4IEVA 5DMYA 2Q5TA 4OFGA 2DCYA 5H9PA 5C3SA 3LZZA 3UT0A 3WY6A 1E5RA 1MS4A 4AVBA 5B4NA 3CJIC 2DBNA 5JZGB 4AF9A 3OY8B 4TYSA 4JHZA 4P9JA 5FBZA 3IPVB 3N9MA 4MHUA 5LBFA 5IFTA 3UNPA 2A73B 3KCCA 5CFCC 1C8NA 1QGLA 2ZJCA 3T3YA 4GWNA 4HANA 5IAXA 3WNLA 4COWA 2RS32 1FX5A 5C9AC 1ZRIA 3KV9A 3OUIA 3CU7A 1RB8G 2QE3A 4IGQA 2FCUA 4O61A 2XHKA 1R64A 1DZRA 2J1TA 3UK9A 3ZO0B 4EROA 1RUF3 4OZOA 5CVRA 1FYUA 2A6VA 2ZX3A 3JB4C 2VVDA 1VLNA 3ES1A 2FBEA 1W6OA 3KV6A 1ZRRA 4E4ZA 1W3VA 3PUAA 4NHKA 1VPHA 3Q8CA 4Q4Y3 2GP5A 2DUQA 4XEZA 2UURA 4XJ8A 4BK4A 2RR12 3OPTA 4XUNA 1TVGA 2WFF2 4LBKA 3H1WA 1LRHA 1OXCA 1LOCA 2VMGA 2XJPA 1GOHA 1YFUA 2RS12 2BOJA 4JRAA 3LWCA 4QQPA 1W8ZA 5IVYA 5LA9A 4D6QA 4D7TA 1FV2A 3H8UA 2XGXA 2ET7A 4GMP0 4IERA 5HXMA 3KCYA 3TEYA 1UY3A 1Q43A 1FOD2 1MS5A 4K21A 5T3NA 5JXJA 4DY5A 1SG3A 5ACA2 1COV3 3CJIA 4S2GA 1AR71 1F15A 4Q0PA 2JDNA 2JWPA 3AKQA 5FPLA 1DIWA 2QBXA 3MW2A 4XF4A 3BYWA 2XUEA 3VZLA 1QJEA 4QQLA 4UW6A 5FZDA 3T0BA 1I3HA 2X8KA 3DPRC 5EV7A 2E33A 5C8CC 2N7GA 5CFCA 2BPA2 4COVA 1GLHA 3KVAA 2O8QA 2PQQA 5C9AA 1MZ5A 1IHMA 3H3LA 3FE5A 4Q4W2 3I49A 3POIA 3INAA 3TN93 3H1YA 5DN2A 3VGIA 2WNUC 2ZX1A 4CEWB 4Q29A 1CWPA 1PK6B 2B46X 4FOWA 2IXKA 3NL1A 1EAH3 3HR9A 5G04L 2X10A 1DZTA 2Y38A 3I2JA 4D6RA 2ZS6B 5JI7A 1JZ4A 4XFCA 2JIJA 4Y24A 1L7LA 3TNPB 1FT9A 3B02A 4A3ZA 5B4XA 4WVMA 4M0NA 3CNAA 2XJUA 1G9BA 1UYPA 3C3VA 4CCDA 2W47A 1LB2A 2OQ6A 1POV0 4PDWC 2HWC2 1G7YA 1HJGA 1VAMA 1WD3A 1YWKA 2BGCA 2EXJA 2W1WA 2JG8B 2XUMA 3I2GA 4LBJA 4LA2A 3RWKX 4FBFA 4G4FA 2LW8A 5DXDA 4XUQA 3LDKA 2HWD3 1S2EA 4RSUA 5JCTA 1W0PA 1VRH1 2C9KA 2VZSA 4U36A 5FP3A 3U4XA 1XE8A 2FDKA 1S0GA 1OH4A 2YBKA 3TWIA 2ZGQA 5E8AA 5A1AA 3ACHA 3DPRA 5C8CA 3GXUA 2C4XA 5DQ0A 1I6XA 4CP2A 4DIQA 1LHOA 2D3RA 1ZBE3 2MEV1 1TZOA 4IV3C 1Z7S1 2WO1A 4I09A 3VV1A 5A6QA 3MFCA 5T52A 2WNUA 3OBTA 5LA0A 2ZGNA 5A6ZA 1NLQA 1YHFA 2YXSA 1H6XA 1FV3A 2AH2A 4FTEA 2C24A 1HDKA 3TEXA 5C3RA 2R32A 1A34A 2R0FA 2XVGA 1RHI3 2FZ1A 3POYA 3RGBA 1AJOA 3QH7A 1NKGA 3ALQA 3ZMNA 2XHNA 5LEJA 1JU4A 4ZPIA 4XTMA 1VBB3 4YG3A 4IE6A 5L36A 3MF9A 4CXYA 4OQ8A 1ZNPA 5DDJ1 3VUOA 3JBG1 1RUD3 1QOOA 5F5AA 2IFWA 4NRMA 4QB6A 4YW7A 4XFAA 1UU5A 4PDWA 3LEKA 4OHXA 4A44A 1HV1A 1ZZ9A 2IUWA 3NNLA 3POJA 2FDGA 3ZSJA 4LE4A 1VBA1 4QKFA 2EAAA 4IEUA 3AP7A 4OI4A 3ZXFA 5FQ0A 2GDFA 4Y1ZA 3U1XA 3HNYM 3ZVXA 5A3PA 1W6PA 1N3PA 1X8MA 3OYWA 3FFZA 4FPKA 4JAAA 4WM7B 4YG6A 4DUXA 2A6WA 1GZWB 2CGOA 2WNVB 1MS9A 5A3WA 2D5HA 1CZSA 2WQ8A 4IV3A 3ON7A 3WP5A 4BZ4A 1ZX5A 4IE7A 1NZIA 5JAXA 2VUCA 2Z4FA 4NAMA 5JR7B 5L7OC 4FCAA 4CCKA 2JDPA 2OUJA 1CAVA 2E53A 3IM0A 3JCIA 2BW8A 2JDHA 2OUHA 3J7HA 4ATEA 2IWGB 3MEPA 5FOJB 4JTOA 3I7DA 1Z78A 1QJY3 3AXEA 3UESA 4C0HA 2CAUA 1FI2A 2WZEA 3PUIA 1W2TA 5GLZA 3RDIA 2BGPA 3ILNA 5IHRA 4A2UA 4AGRA 1S0EA 5BNQA 4KNCA 4XF1A 4A45A 1VRH2 1OD3A 5FY8A 3MFAA 4Y4RA 4BU2A 1DQ6A 2R073 1YXWA 2VZQA 1D4VB 2XJTA 1LAJA 1XE0A 4E2QA 1SDDB 3POFA 1OVPA 1H4GA 1O8SA 1X33A 4Q0UA 4QD2A 1HB3A 2MEV2 2ORXA 4LIUA 3OF1A 1Z7S2 1QXPA 2PHDA 5CISA 3ZR6A 4AL9A 1VBD3 4N53B 2ZGKA 2F4PA 3ZYIB 4Q4V2 4EZ4A 4CU6A 5IVJA 3AZZA 1WWYA 5K4LA 2PFWA 2ZA9A 2W9XA 4YFWA 4AK3A 3K46A 5LK7B 1XSQA 2ZMLA 1RUJ1 1FMD2 2OZJA 4IUGA 1MS8A 2P2KA 4QPWA 4AEKA 2D6OX 1SEFA 1U12A 2YZ4A 3AYAA 5FUIA 1KXGA 5DZGA 5JR2A 3CQOA 2UYBA 5DAWA 4XTPA 4MGKE 1AR83 3JBG2 4JGYB 4K9SA 4AQ2A 1RMU2 3ZKUA 5C7GA 2WQ4A 1MR5A 2K2SA 3CO2A 1DGWA 4N9HA 1WMFA 3FMGA 2Q8EA 3WOGA 3LA2A 4BH9A 4NHLA 4DEQA 3VZKA 1WCUA 4GAZA 5C4WB 4PF1A 2WQZC 3O1SA 2VJXA 4YGEA 1VBA2 5DAQA 5C3QA 1AUYA 3ZDVA 1NA1B 2NYYA 5C3OA 5C8WA 5FO8B 1DQ2A 1FATA 1OF3A 3ELNA 4GALA 4FTSA 1QEXA 1I5PA 3WF3A 3N35A 3L9JT 3LKJA 3NNMA 4CZSA 3VBUB 1RXGA 1GUIA 1BMV1 1QJU3 1S0CA 1ULPA 1XNBA 1W28A 3HOBA 1D2QA 1OBNA 4DXTA 2W91A 3ZYGA 3FL7A 4UYBA 4XUTA 4ZXKA 1B09A 1GZCA 2AEYA 2XBO1 4JRLA 5F7UA 3KF3A 3AYDA 3VZJA 1GZTA 3ENRA 1RUOA 4Y5TA 4Z1VA 5F3IA 2ZEZA 1LOBA 1VBE2 2KXLA 3ZYPA 3JB8A 1CAWA 5I8SA 2DV9A 5JPNB 2HKXA 4BCUA 1UKGA 1XB9A 1YCIA 3MI8A 4CDUC 1HXS3 4URTA 1VMFA 2D6MA 3BTAA 3AMMA 1JHNA 2HH9A 3URFA 1SLCA 1AR92 3AJYA 5EPAA 5M0TA 4OI0A 4AI0A 4TTGA 5FXXA 2JKBA 4YVWB 4EYUA 2PN5A 1J59A 1GP4A 1IS6A 4WVWA 2VULA 5FZ1A 5ABJC 4JDNA 1AX1A 1LOAA 1RUG1 2E7TA 2GC1A 5BUVA 1WGPA 3O1PA 3A21A 3KGZA 5DG1A 4Y1UA 4J6GA 3EO6A 4B4QA 5FZ0A 2B9UA 2V72A 4MH0E 1V6NA 3R4SA 1SFYA 1LEMA 2DDUA 1JUHA 3LEIA 3O12A 4DXSA 3U0ZA 1RUJ2 2G9ZA 1YO8A 3NNGA 4LO7A 2ZGOA 5FLIA 2JIGA 2O14A 3SH3A 3ZDSA 4MADA 2LUWA 4Y1YA 5FP8A 4RQPB 4O65A 5IK5A 5I0UA 2CGNA 4MGSA 2ZKNA 2L9LA 3VDDC 2VG9A 4UFKA 4AHWA 4LQRA 1BXHA 3WW2A 1NYWA 3VKFC 3RWNA 5E88A 2V4AA 1O3RA 3ZIXA 1ND3B 1JHJA 2R063 1Y3TA 4X8PA 2EIBA 2RM23 4RS5C 2VUAA 4AFAA 2WAAA 2WT2A 1PNFA 4MSVA 5FR3A 5C6CA 4HSLA 1BEV1 4TLGA 3PTYA 2TEPA 1GMMA 3WZ1A 2YU1A 1TNRA 1RUC1 4CCOA 2DWRA 4LO6B 2RS53 1PX4A 4XW3A 1BCXA 1VRBA 3ZXAC 1UKRA 2KA3A 2CWSA 5J09A 3WHTA 1SFNA 4CDXC 1BMV2 3VBRC 1RVF1 1NE4A 4Z92B 2JJ6A 4PIXA 4ZHNA 3BB6A 5FMCA 1R1A3 3H3ZA 1R083 2PHXA 5I0RA 4P9LA 1ZA4A 2YV8A 2XBO2 2GMMA 4WM8B 3TAYA 4EN8B 4EN6B 2YPJA 3M2MA 1AYN3 1C1LA 2WABA 4MLOA 3N36A 1RUF1 3MUZ1 4UI9L 3A7QA 1G8WA 1YC61 2P6CA 3B9CA 2WN2A 4XDPA 1LOGA 2WIIB 4N43B 2O0OA 3TOJA 3KM5A 1ZM1A 2VL4A 4HBNA 2J1RA 4NWVA 4CDQC 5FDBA 5JDBA 5CA6A 4LO4B 2DBIA 1ASJ1 1C4RA 3KQRA 4A42A 1S1AA 1KDKA 4RA0A 4Q4Y1 1LESA 4OVEA 4XBNA 3VDDA 2CTVA 3ZOIA 3BOPA 1RYYA 1GV9A 2JE9A 4BQYA 2XXZA 4W6WA 1UOFA 3SCGA 3KT4A 3LD8A 2DTWA 4I3PA 1XNTA 2UWBA 2Y6FA 4ISRA 2ADEA 3THTA 4UAPA 5T5JA 1S2KA 2QQIA 5FY7A 5KXEA 4QMAA 4AWDA 3KV5A 3NSTA 4NN0A 5I91A 4RS5A 1J3RA 4NIDA 4E27A 1QKQA 1SBFA 5ISLA 4ES9A 2A5ZA 3AYCA 4IGPA 2OS2A 4ONUA 1DYPA 4OHVA 1OMIA 1J1LA 4BQ5A 4LHNA 5F37A 3OGVA 4HONA 4X8NA 1V9U3 1LECA 3MGUA 3ZXKA 4DXRA 4Y1VA 3PLQA 1W6QA 1H1MA 1H2NA 2VMFA 4CDXA 1CONA 4IEPA 3VBRA 2Q1FA 3WDWA 2QQOA 3K4DA 3CL1A 4UFHA 3ZXJA 1W04A 2QQNA 1VBC1 5FUPA 1JYVA 3R6SA 3N9NA 2PHWA 4M3CE 1UD1A 1PZ7A 4N90A 4XJWA 3TN91 3NAPC 2YU2A 4KL1A 4YZ2A 3BODA 2P3IA 4CEYA 2QQMA 4JCKA 3ZSEA 1KS4A 4W8JA 4AEDC 5FYZA 2BUKA 1PX3A 4LKFA 3E6BA 4XF3A 4CDQA 2XG3A 1A8DA 3V56A 2AYHA 4FPFA 4NRQA 2W0XA 4QKBA 2IXLA 2J1AA 4ORFA 4FO9A 4RN5A 4YGBA 2VOWA 5JSOA 5FYUA 3AX4A 1ZZBA 1BEV2 4KBBA 2CGPA 1AZDA 1PM4A 2YY1A 5T54A 1RUC2 3MHZA 2GC0A 2WO7A 4WVZA 2H6CA 3WDTA 1CX4A 1UQXA 1W2NA 2CDOA 4RYDA 5F3CA 3VDBA 3MIEA 1AX0A 2W39A 2E9QA 1H8TC 3I59B 3NJVA 3NNJA 1RVF2 1C57A 1XNDA 4IV1B 4B7EA 4MX3A 1SQ4A 5ANQA 3MIFA 3NV1A 2Q8OA 3VL9A 5C70A 1OPMA 1CPNA 1W6OB 2VZ1A 2BGOA 4Q5OA 4DPNA 3LF7A 2DVGA 3NJYA 1A8MA 4JKKA 1LU2A 1UF2C 3ZFFC 2WZR3 2YROA 1GBGA 4LKEA 4R9DA 5FYIA 4CDWC 5KC5A 4LBLA 5FZBA 2G4IA 5FYTA 4AOCA 2CAVA 2GMEA 3A0KA 1CJPA 1HRV2 1ZBE1 1W9WA 1ASJ2 1IQAA 4KU7A 4LBOA 2HWE3 5CB7A 3C7HA 3KSCA 1PGW2 3ES4A 4GH4C 3NAPA 5FYBA 2WFPA 1DU3D 2QZ3A 3MPPG 1D4M3 2RMU1 4IL7A 4DINB 5FPUA 4AEDA 1UWWA 2C0ZA 2QDNA 2VW0A 1UYZA 3WT3A 3T1LA 1VMHA 2OPKA 2VPVA 1YUDA 3AZWA 5FZ4A 4Y5Z0 2K0GA 3CJIB 3U14A 3ZMOA 3OCPA 4IEOA 1HQWA 4QX1A 1KFXL 3WQBA 1QOSA 1PZ8A 2ES3A 1AVBA 1OKQA 3WEZA 1ZRDA 1MZEA 2CNAA 3VKMA 1J3QA 5FKBA 1HQLA 3LFMA 5FJKA 1H8TA 1UMHA 3WXPA 4QM8A 3VKNA 5C9AB 5A7NA 4IEQA 1NCQA 2BTVC 1PVC3 2QFEA 4K8FA 4FPYA 1PO12 1R093 2A71A 4MVTA 1VBC2 4IGOA 3VZOA 2YC4A 1RUE3 1REFA 2VQUA 3CZJA 3GNEA 1GQGA 3NJZA 4HOOA 1WMEA 4QDQA 5FZ6A 4AQTA 3PU3A 5JI9A 4O7XA 2VE1A 1QMJA 2WA4A 4MO3M 2QQKA 2YB7A 3WCSA 4D7SA 3HN3A 3ZFFA 1QNWA 2D93A 3AFKA 3POEA 1UY4A 1W8WA 4OLLA 1KD7A 2GNMA 1IS3A 4COYA 1ZBA2 2EA7A 2IVJA 4HN1A 1BVVA 5A32A 3RZMA 1C3HA 3PNAA 4AVTA 1UZZA 2VOVA 4A7ZA 4GH4A 1UOGA 3T0AA 3ZPYA 1PIV3 1SLLA 4XJUA 4GXLA 5CEHA 5AC93 3WNOA 3ZXDA 3I4IA 1SBDA 1X9TA 4UF0B 5KXBA 1I9RA 1G9DA 1QIQA 1IQDC 1VB4A 1QJY1 2K46A 3ZKYA 2DCZA 2J22A 4O9EA 4FFIA 2KM2A 4XC9A 5FPZA 2BYVE 2BEOA 1CR7A 2VMDA 1ULGA 3ZSMA 2VQAA 5A3UA 1C8M1 4K6BA 5C8CB 2CSGA 2PLV1 1UPSA 1DF0A 1AR63 1W9SA 2ARCA 3UKNA 4EZHA 1W0NA 5C71A 1UO9A 3FHQA 2OT7A 2QQWA 1JN2P 3U37A 3RJRA 5D8AC 4BIFA 1TMF1 5CADA 2DCJA 4GB31 2DVBA 4XURA 1JYNA 1DQ0A 2GNTA 1YQ6A 4IDZA 2PMWB 1I1EA 2O1QA 1YIPA 4JDOA 4OI1A 2RMU2 1YQ2A 4E4SA 4CXXA 3JD72 3SEEA 3C7FA 1BBT2 1D7PM 3AM2A 4RGKA 4NIAA 3T2PA 3ZXGA 2OQ7A 1EP0A 3KMHA 4GKXA 4YLZA 3RSJA 1SLIA 2JD4A 2VOKA 3FJSA 4CUCA 3C7OA 5A1LA 1QNYA 1KRIA 4S2FA 1CX1A 3H8OA 1APNA 3WDVA 2R7EB 1VJ2A 1AR81 4PDWB 4CP9A 5GZDA 4BA6A 1UNBA 1H4HA 2VTFA 3DL3A 1FNYA 1TQ5A 2UY9A 5FP7A 1YNAA 1JZ7A 2HWB2 4LLOA 4L99A 5J98B 1QOTA 1T6BX 1TME1 2XWBB 2W08A 5IVEA 2XWJB 4FFGA 4GULA 3BN6A 2IXIA 1GU3A 4AI1A 1U5YA 1AL23 5EHDA 4COUA 3WINE 2XKOA 5GKAC 2CU5A 2J1SA 1GWMA 4M3CB 3I3QA 2DUOA 4P02B 4PIYA 1GOFA 5FP9A 5I0DA 2W1QA 3H42B 2JECA 2W5FA 1XJAA 2D3SA 4LOTA 5FZEA 3AK0A 2FMDA 3ZFEB 2VD7A 3BIWE 4RGAA 1DGRN 1LGNA 2ZGTA 3MPBA 3EQEA 1FPN1 2TNFA 4ZONA 1EYBA 1NOVA 1EV11 3WQ7A 4E8CA 5D8AA 1REDA 2RG4A 1H2LA 1ND2B 2FCTA 3AJZA 4BLIA 1CAVB 4BMBA 1MZ6A 1WLCA 5LASA 3APBA 1XU1A 4XJZA 4KBZA 4XBQA 3TB0A 3U78A 5A3MA 4FPGA 4JC1A 2ARAA 1TEIA 2G9FA 3ILRA 3JUUA 4PF5A 1ZZCA 1Q8QA 4XQDA 2OKXA 5F5IA 4FAHA 1YJKA 2R6QA 1C5IA 2RVAA 5CNAA 3ZM8A 1DP0A 3M3QA 3W21A 4AFCA 4YM3A 2DU1A 1Q56A 1KITA 5LW9A 2VXRA 3MIDA 1SMVA 4GD4A 5K0UC 2FZ2A 2A6YA 1KJLA 4IEZA 2VO5A 3ZXEA 4TSVA 1C8M2 4RR3C 2VAUA 2PLV2 1O4ZA 1NQJA 4BQ1A 4YZ1A 2D7FA 4EWDA 1GP6A 1VE0A 3B3QE 5HCFA 1PVXA 1TMF2 3H0OA 4GB32 3CJXA 4XHXA 4QPGC 3N7LA 3ABZA 3KT1A 3ACLA 3LA3A 5A7WB 1SLAA 1CAXB 4JGZC 4Y22B 4LBQA 3ACFA 4A6SA 1IG0A 3DF0A 5GZCA 4Q1PA 1O5LA 1SACA 2WT0A 1POV1 4N9IA 4QX5A 1Y43B 1NUKA 1KGYA 3AMHA 3OD4A 3R0RA 4PIZA 4V2VA 3JQWA 3MLJA 2WLQA 4UW3A 2VMEA 5FYCA 3ZR5A 5L7OB 2XMLA 1LGCA 4B4RA 1ULEA 4IQPA 2RJKA 4ARYA 1RIRA 1ODNA 2DFCA 2Y26A 1YYNA 4YGDA 1PM7A 5BNNB 2PAKA 3R05A 1RUH2 1MPXA 5A3NA 1MEC3 2VMHA 1TME2 3NW4A 4M4PA 4YM0A 1W6MA 2PXJA 1UY1A 2OPWA 2WLPA 4QB2A 5BXXA 5K0UA 4B7KA 3UKTA 3ZYFA 4D6SA 3USSA 1YLLA 1GKBA 2QQJA 1E5SA 4GJYA 4RR3A 2R30A 3IBMA 1ENXA 1SPPA 1WW6A 2GZWA 2RS51 3K75B 3N9QA 4P5HA 4HKOA 5FY9A 2PQSA 4QGLA 4AI3A 1PGL1 1FPN2 3MIBA 4XF9A 1EV12 4YYOA 3J8F2 3VHOA 2FHRA 3LEGA 1F9KA 2ZZQA 3H3UA 2FDIA 3L2YA 4MGTA 4QPGA 5FZ9A 1BYHA 1T6GC 1R1A1 2VW2A 3RMYA 2NLRA 4M01A 3VBFC 2DUPA 2YMZA 2E31A 3NV2A 4JGZA 5K8SA 4NR1A 4XDQA 5JUVA 3OEAA 5FPVA 1UZVA 4DMIA 3A0NA 4LNVA 1RUI1 1CAWB 2EXIA 5HPOA 1W6NA 2ZTNA 4QDSA 5H9QA 4E8DA 2IXCA 5I0TA 2GU9A 4CCJA 4H55A 3I54A 1GFF2 4META 2QZ2A 5BY5A 1OKOA 4NAOA 1GQHA 2IC1A 5DUUA 5FXZA 1QH7A 5FZ7A 1JOBA 3RRDA 5C5UA 2UWAA 1JMUB 3USUB 3RQ0A 1QH6A 3PVBB 5FZAA 5APAA 4MV2A 1UXXX 5HXVA 4AR2A 2BV4A 1W2OA 1AXZA 1FXZA 1X36A 5LY2A 1G9FA 2KR2A 3CIHA 2GNDA 2F6BA 2YYOA 3LEMA 5KXCA 2CL2A 2AR6A 2TBVA 2TUNA 4YRDA 2JXAA 3N7MA 5DUVA 5DUWA 5IFPA 4QGMA 3O0WA 2ZPXA 1GYKA 4FFHA 4PI0A 2NQYA 5DABA 5FXWA 3POBA 3FLTA 1F5FA 1GWLA 2JDMA 2XL7A 5D2AA 1F31A 1O59A 1ULOA 1WZXA 3UKVA 5JPMB 2HLEA 2B7YA 3VBFA 2W2IA 4Y20A 4FSJA 4XE9A 4I02A 5D21A 3SMHA 4QHBA 3WF2A 4MGQA 2JICA 4XYXA 4CE8A 2VY0A 2Q1ZB 4NPMA 4F3JA 5GZGA 4NJ4A 4CDUB 3E6CC 4ASLA 4FPEA 2YBPA 2WS91 2FCVA 5IJRA 2A3XA 4DUVA 3WDUA 1AR72 3LOIA 2PHUA 4HVQA 4FXKB 1B35C 2EICA 3RPQA 4R4XA 4XCBA 4ZU4A 3I3DA 4EN0A 2W52A 2NMOA 4DY3A 5CFDC 2P37A 4YSFA 4L0PA 1PGL2 3GZEA 5F6LB 3DXTA 4GA9A 3WG2A 4CPBA 1UPIA 1LOFC 5ABJB 2X53S 1HX6A 1SLTA 2WSUA 2YG0A 1IGOA 3FUQA 3T2QA 3DYOA 4BQ4A 2EXHA 5JLVA 2OVUA 4H3WA 4D3WA 5FZIA 2Q8DA 1O6UA 1JZ6A 2WUHA 3WVJA 3P1IA 1YFYA 3FBMA 2BVVA 4AI8A 1RUI2 5FZFA 1OLME 4XMAA 1A3KA 1WLTA 1ZRFA 1W9YA 2R16A 4D94A 5L9BA 2VQTA 2XJSA 3I2IA 5EZWA 3VDDB 3WW4A 3RVHA 1SHWB 5IT6A 1QQP1 1FAYA 2ZEWA 2BBVA 4DEVA 3TEZA 2VH9A 5IUQA 4A4AA 4QX8A 3KHBA 5LEKA 3F95A 2LS6A 2Y0IA 2ARXA 3CHXA 4X6QB 1D4M1 3HQUA 2JDUA 2Z79A 1OOPC 3PUSA 1UU4A 1V6IA 2G9GA 2X5IC 3MO4A 4W50A 3KVBA 2NZ9A 2SBAA 4UW4A 3PTRB 4KGQA 4JV4A 4YVSB 2BNOA 4EN9B 1DQ4A 3IT8A 3WUCA 1B35A 2ZBJA 2W3JA 3IDBB 2VZPA 3ZXLA 1ST8A 1O4TA 2GAUA 5CFDA 3VBSC 2R043 3RZLA 5HCAA 3E5XA 2GSYA 2AZ5A 1BQPA 2OA2A 4CDXB 4OUSA 3VLBB 1JI6A 1F4AA 1U5ZA 4XIKA 4XFIA 1LOFA 2HBTA 4PHZA 1MVEA 1RTVA 4AVSA 5AFBA 5SV5A 1R091 2P4EA 2RJ2A 3VD5A 1WA4A 5L73A 2AENA 3ZYRA 1WBLA 2XLGA 3OGSA 1K42A 1JZ2A 2WYFA 3BIEA 2XKPA 2ZEXA 5KXDA 4JKLA 2D97A 1XNCA 4Q26A 1C28A 5IVVA 4BIOA 3OY8A 4BWOA 3THCA 5A70A 1TE1B 3BTZA 4RHV1 2WS92 3IPVA 1W2AX 2RS33 1LJ7A 1JYCA 5DDJ2 2VZVA 3HBKA 4YW1A 4D8MA 1YQCA 4HKWA 2DVDA 2XJRA 2Z5WA 3NWKA 1HV0A 4R52A 4JHTA 1UYXA 4CEWC 4L2NA 5FY5A 2V09A 1OOPA 4M3CF 4WVVA 2X5IA 4Z2AA 1VB2A 4NRPA 2Y0OA 2VECA 4HZFA 2QQVA 2ZHLA 3VKOA 5DZFA 2ZGPA 4L9BA 2D5FA 1S0FA 4BQXA 1Q8VA 4AYUA 4JZRA 1TG7A 2RR13 2YDEA 1ZZ7A 3VBSA 2WFF3 4N7IA 2HWF1 1V6KA 3IDCB 4PQ9A 3RYKA 2RS13 5FY1A 2YPDA 2BVBA 1LODA 2E6VA 1QJX1 5AVAA 4XF0A 5C33A 4I30A 1K5MC 3M8LA 4TN7A 5F3EA 1FOD3 1UYYA 2OX0A 3QCWA 1QQP2 4L11A 3NAPB 5ACA3 5CG9A 2ZGMA 5FYHA 3RYPA 3LPFA 1U5XA 1XYPA 1IZ3A 5A7OA 1PO21 4UFLA 2VBPA 5FZOB 3WHUA 5IAVA 4PI2A 2X09A 5LBEA 3BTYA 1MVQA 1WCKA 2C9AA 5FWEA 3VN4A 4XXAA 3WD5A 4Q4X1 5DAPA 3WP4A 4B3NA 4YZ5A 4HFSA 5JOXA 2IVIB 1N47A 5KHGA 1WA6X 3CF6E 2RHPA 4IE0A 4Q4W3 4YGCA 4P9IA 3ZN6B 2BERA 2NPIA 4IE5A 4I01A 5L9VA 3S0MA 1IPJA 1OT5A 2PA7A 4I2OA 3AMNA 1QWRA 4AGGA 4MXWA 2NM1A 1PMHX 4CEWA 4ES8A 1M4WA 4I3GA 3GGLA 5A33A 4NPLA 2J1VA 4HKLA 1Y4WA 2FMYA 4R9CA 2JX9A 1JOJA 2Z42A 4RD7A 5FUNA 1TNFA 3OOXA 1HRI1 1VAKA 5J36A 4CDWB 4HG6B 2H0VA 1YQ8A 1U5IA 3AKRA 1K12A 1H30A 1UIKA 4YM1A 3MBWA 2HWC3 1K5MA 5T5PA 2PAEA 4RHV2 1AYM1 5A7QA 2JE8A 4YPJA 3SC7X 2ZMNA 3HQXA 4KGGA 4AZZA 4BDVB 5FZLA 2YFZA 4HSJA 5F9TA 3WF1A 2ZHNA 5A3LA 2P3KA 3E5QA 2GALA 5FBJA 2DCTA 4Q0VA
chains in the Genus database with same CATH topology
3QOPA 5D1IA 3GZAA 4XILA 4XMIA 3QLQA 3LAGA 1SBEA 1V00A 1H1AA 2ZGLA 1SDWA 2WC2A 3M70A 4H7LA 1N1VA 4SLIA 5J96B 2ETEA 4WM7C 2ILMA 5BNPC 1CPMA 3D0JA 5L19A 1NLRA 3WP3A 1QHDA 4LUMA 4EV0A 2UWCA 2HWF2 4Q0QA 3SLIA 2LM3A 3VHNA 4WV8A 2DCKA 1QJX2 1DGRA 1ZZ6A 5EFUA 1O91A 4B8EA 5EXOA 4CRQA 2XLFA 2VNRA 3AFGA 4G3YC 4Z82A 4KU8A 3ETQA 3IWZA 2JDZA 2HJIA 2WJSA 3KLSA 2E7AA 1UCXA 1PO22 3LSDA 4CEYC 5TSWA 2B39A 1ULFA 2ENRA 5JVVA 4LUKA 2JG9C 4Q4X2 1HQNA 1PNGA 5EJ3A 4G9SB 5T5LA 5T55A 1PGSA 3MDPA 3POWA 3D5OA 3NKGA 4JQRA 1A6CA 5JIUA 4O9GA 4YZ3A 4R4ZA 4YFZA 2DFBA 1JBCA 3FUOA 3M3EA 1ULCA 4PJYA 4AW7A 3OD0A 1D2SA 4MGYE 4WM7A 3W9AA 5BNPA 1RUG2 2BWCA 1COV1 2WNEA 1PHMA 5BV6A 1HRI2 2BNNA 5JMCA 5FPXA 2EVXA 1NQDA 3AXDA 1LOEA 4R9AA 3SHRA 1ZRCA 5HI0A 5D8AB 2QUOA 1AYM2 4QT6A 4FP3A 3KCXA 3PVOA 1CJDA 1OHFA 4C1XA 1SLBA 4BE3A 4FOYA 1VRH3 1O7FA 1KDMA 2IFRA 4LO5B 4P9WA 3RNSA 3WQ1A 3B7MA 1EAH1 4XFFA 4QQOA 3PVEA 1NA1C 4A7KA 3W58A 4HK8A 2JG9A 4Z07A 3VHPA 2MEV3 1N3OA 1Z7S3 4K20A 2DYCA 3VBUC 3IKWA 2CV6A 3AMPA 2VVFA 4Q4V3 4M0HA 5SV8A 1MS0A 3RI9A 5BYNA 1S0JA 5I93A 4KWLA 3ASIA 1G9AA 3I8TA 1FMD3 1NCQC 1O3TA 1YI7A 1MQTC 1IOAA 3O5SA 5JIAA 2HWD1 1XRUA 1OPOA 3HN1A 1RJ8A 1PMIA 4H14A 4LBQB 2GC3A 3HT2A 5DZEA 1RUF2 1UZYA 3JBG3 1JW6A 1RMU3 4HPKA 4XFHA 5FLHA 3O0VA 3H7YA 2GN3A 4S2DA 4UXAA 5E16A 1H9WA 1G6NA 1WBFA 4Q4Y2 3FLRA 2ZAHA 1VBA3 3IMNA 4YVWC 2ATFA 4YNIA 1UW8A 3VBHC 3B00A 4AG4A 3O0XA 1NA1A 1CIWA 1RHI1 3POSA 5K0UB 1JYIA 4E4DX 1VBB1 3LCPA 4J1XA 4JVAA 3VBUA 1COV2 3QACA 4L92A 3E6DA 1H0BA 4RR3B 4IXLA 3JU9A 4PBOA 5CFCB 1RUD1 3PHMA 1DG6A 1JH5A 3LA7A 3GF6A 1H9PA 3OPZA 3Q9OA 3MW4A 1VBE3 4MXVA 2I07B 3ATGA 1MQTA 4QPGB 3SISA 1G9CA 3AZXA 1DDLA 1OLRA 5JWPA 5KBFA 2DU0A 1AL0G 3TN92 4Y4YA 4JGZB 3OJBA 2ZX4A 4DNYA 3WG4A 3RZZA 4DRVA 1V6JA 5LRRA 1BZWA 1EAH2 1DFQA 1AR93 4RGGA 1NCRC 1RL3A 1W6NB 3A4UA 1OLQA 4GQ7A 3HD8B 4ASMB 4WVMB 3BPZA 1CESA 2RJLA 3SNMA 4YVWA 1EY2A 3VHRA 3WCRA 4DRRA 3H1MA 1IS4A 3O14A 1H2MA 3VBHA 4C0BA 2E63A 5FAXA 3ZX7A 1S0BA 3WG1A 3SXWA 2A3YA 1RUJ3 4BLJA 1LHVA 3ECQA 3GBWA 2HWD2 1AX2A 2WINB 3AYEA 5J37A 3DPRB 3SITA 2R071 3GBGA 1O3SA 3ME2A 2R041 1DYKA 1RGSA 3RI8A 2WNUB 1ZBE2 1YI9A 4KWKA 1MS1A 3PJYA 3ST7A 3VKLA 1VBD1 1DLLA 4DZGA 4Y20B 1GR3A 2XPJA 4V1PA 5T50A 1NCRA 1VIWB 1VP6A 2CYFA 1RHI2 5FFOC 4FOVA 2K9ZA 3HIFA 1LU1A 3V0AA 1VBB2 3AKTA 3TBDA 4IESA 2XBO3 1RUD2 4E2GA 3R4DB 3M3OA 1LULA 3BCWA 1JUIA 5CAZA 4FQZA 2ZOEB 4FOQA 4WM8A 3VBOC 2MNGA 2D44A 5FQ0B 2SLIA 1QDOA 2H0BA 1W6PB 2UU8A 4HK9A 3TYJA 3OYWB 2HEWF 4Z2WA 3M1HA 3I2DA 4AEMA 1UN1A 2OYZA 4Y1XA 2C5DA 4WZCA 1JTZX 5I8TA 4IV3B 3W59A 1DGLA 1QJU1 4NOTA 5E89A 1IS5A 1H2KA 3ZFGC 1CQ9A 4AVAA 4HVRA 4IV1C 1N1TA 4I0BA 1H8VA 2C1FA 1EPZA 3B01A 2ZX0A 4HVOA 4Q27A 4BHPA 2JENA 1CGPA 3EJKA 1QJY2 4K7JA 4OHWA 1ALYA 1H1IA 5BNOC 1GZ9A 4FAGA 3QH6A 2P3JA 2NN8A 1HXS1 4OI2A 4CYDA 4XFGA 1QY4A 3VZMA 4RL7A 2R072 1XE7A 3B93A 3VBOA 3ZYJB 1BK1A 2ERFA 3FX3A 2ZGUA 3E97A 5F6KA 1WLWA 1DHKB 4A3XA 1KFUL 1VBD2 4QPIC 4QQ2A 4LBQD 4XOGA 1BEV3 4MZUA 1WW7A 3V65A 2XB6C 1RUC3 4D7YA 4AVCA 3GALA 2LALA 3UJOA 5K9YA 3WG3A 1V70A 2QCSB 2HWC1 2LTNA 4AI2A 1RVF3 3PMSA 4LLFA 4TWTA 1F2NA 1QF3A 4NVPA 3UL2A 3ZFGA 3ZSKA 3I59A 1BKZA 4IV1A 1AR82 1G86A 4PLNA 2XVKA 3AP5A 3DV8A 3QD6A 1ENSA 1OOPB 2X5IB 3GHNA 2XVLA 3V0BA 2R061 4MGIE 5JOYA 2RM21 4AE2A 3MIGA 5BNOA 2D6NA 5FREA 1HRV3 1YIFA 5HCBA 5EYXA 1ASJ3 5EWSA 3VBSB 4FTBA 1DBNA 1CD3G 2B8MA 4L97A 2PHRA 1Q8SA 5JOWA 4PLMA 2NP0A 1VAVA 1QJU2 1SCSA 4HLTA 3GYDA 4K1YA 2PYTA 5DUXA 1OA2A 1M06G 4QPIA 5CU1A 2GC2A 4DS0A 1R081 2PAMA 5DG2A 2YGMA 1AYN1 3KZ4C 4E2SA 3MF6A 1LTEA 2WKKA 4IETA 1GSLA 4LHKA 2PELA 3B9IA 1PO13 1HXS2 1VBC3 1N3QA 4QGNA 2A7AA 4MXWB 4Q8LA 1ENRA 2I74A 5A33B 4EJRA 5LK5A 2ZABA 4DOUA 4XPVA 1HKDA 2A70A 2I45A 1GANA 1OFNA 4Z8BA 2HYKA 4L8QA 4NHMA 3H7JA 3WV6A 4INDA 1ZBA3 3AKPA 5KHHA 1D0HA 2MPFA 4FPJA 4LO8A 3B94A 4I0AA 5FMOL 4KH9A 1V9U1 3ZN5A 1O5UA 2XJVA 1YFWA 1MS3A 1K5MB 3U07A 3KB5A 4IEXA 4YM2A 1VR3A 2R49A 2R1DA 4ITCA 4LTAA 3DUIA 1NXD1 4JTNA 1WW5A 5CIRA 3NO8A 2YUEA 3P3NA 3KT7A 1GNZA 2BWAA 2UYAA 2R062 4ZKTB 1RC6A 2RM22 2CWMA 3ZFEC 4FVVA 1N1YA 3MZHA 3RSJA 2IXHA 3AMQA 3D0SA 5LRSA 2D3PA 3LGRA 1OFSA 1PZ9A 4Q4V1 2RS52 1ND2C 3FC0A 2RMU3 2AUYA 1OSGA 3RMXA 3JD73 1CAUA 1BBT3 4KQ7A 2MHFA 1FMD1 3FHIB 2WSVA 1ONAA 5AFEA 5F1RA 2FQPA 2VNOA 2DTYA 2QVSB 1R1A2 2I2SA 1R082 1GNHA 3GBFA 5KWRA 1WD4A 3JQXA 5GLUA 2R0HA 1OA3A 3O7OA 3V64A 4X6RB 1AYN2 5JZGC 4QPYA 1RMU1 2ZACA 2WZR1 4ZU5A 4BYYA 2HWB3 1CN1A 3BALA 2ZHKA 3TNQA 4AFDA 2GN7A 2HWE1 2OIIA 1Z0HA 2Q0AA 1S55A 2DURA 2O8OA 5FMOS 4SBVA 4MYEA 1RUNA 3RYRA 4RS5B 4I0WB 1WLDA 3WX5A 2V73A 4M3CA 3MW3A 4E9KA 5BNPB 1X8EA 4P9GA 3ZFEA 5K7PA 3S7IA 3THPA 1QDCA 4FPLA 3BU7A 2UY8A 1LCLA 4FP2A 1W6QB 4DB5A 3HMYA 4TZDA 1ND2A 1FNZA 1V9U2 4PLOA 3VBRB 1QXJA 2PHTA 2D98A 4A7YA 4YW2A 1VBE1 3AZYA 4PBPA 1PVC1 2YC0A 2ZMKA 5BNNC 3J26N 1UIJA 4HN0A 3UJQA 1RUE1 4W65A 5IK8A 1X50A 4CEYB 4Q8KA 3GHMA 1C8M3 3MICA 5JZGA 1I5ZA 2VUJA 4CDQB 2JG9B 2PLV3 4YW5A 2PTMA 1ULDA 1AR91 1XNKA 3RS6A 1X82A 1ZYBA 5GLTA 4GIQA 1TMF3 1RJ7A 4GKYA 3AP4A 4GB33 5GLWA 3RJ2X 5J3UA 1DQ1A 4FPHA 1PIV1 1O4YA 1C1FA 5AC91 3QBQA 5FTTC 1V6LA 3J9SA 4XQWA 3ROUA 1CAXA 1PK6C 4XJ9A 3FBYA 4Y22A 4Q1RA 4CP1A 1LKNA 1WW4A 2EF6A 5KHKA 2R1BA 3H50A 3DKWA 2VMIA 1DZQA 4HPKB 4HT1T 5L7OA 2Q30A 4NO4A 5HBAA 3MLLA 2OW4A 5J7MA 1AR61 4F7ZA 5B2GB 2WZR2 1RUH3 3AZVA 5KHIA 4XZPA 4AHXA 1ZZ8A 1Q8PA 3AB0A 1TME3 5BNNA 3D6EA 2WT1A 1W2UA 1C5HA 3H9AA 2JG8C 2HWE2 4XQ4A 2VU9A 1AF9A 4AEDB 3N7KA 3B69A 2IZWA 4OZXA 3KS7A 4OHZA 4ATFA 1KQRA 1D4M2 4YZ4A 1Q3EA 1V6MA 2NMNA 3DN7A 1JXNA 2ZGSA 3MLKA 1FPN3 4GMP3 1EV13 1NZCA 3J8F3 4YW3A 5GZEA 4EN7B 5BPXA 2B42B 2D40A 4B29A 3U10A 4AHZA 1H8TB 2E7QA 3GZTB 3WP6A 3MIHA 1NCQB 1QJZA 2QKDA 3HBZA 1PK6A 3LB9A 1MQTB 4QXKA 3L2HA 4B4PA 1PVC2 5KC6A 3WR0A 4QQHA 1R092 3U11A 1Q8OA 1RUE2 4N7UA 1AL21 2P34A 3ZFFB 2OZ6A 3PMEA 1L3JA 1OI6A 1NE6A 3BOWA 5A32B 1YRZA 3USUA 3SH4A 4P9XA 4GH4B 3M4FA 4YG0A 2VW1A 1O3QA 2JG8A 2QJVA 3VBHB 2BQPA 1PIV2 3OGGA 1VALA 5AC92 4YW4A 4OHYA 1URXA 4UBHA 4UW5A 1POV3 4LHLA 2WNVC 1S0IA 3CEWA 1MZFA 2YHJA 4XXPA 3M7AA 3CLPA 5FO7B 1OD5A 1XQNA 1QXRA 3S7EA 1AR62 1HW5A 1OQEA 3LOBA 2X29A 5FCCA 3TRSB 2D6LX 1NXMA 3VZNA 1AR73 4CDUA 1LGBA 1SCRA 1NCRB 5E1RA 4YVSC 2WWSA 1LENA 3HWJA 1BVP1 2VGDA 2JE7A 3V0AB 4WZFA 3WQ0A 2D6KA 4KG0A 3T1MA 1U0AA 1YFXA 5ABJA 3AKSA 2ZZJA 3M3IA 5H9SA 4N53C 1LHNA 1ZREA 2CY6A 4AFMA 4K1ZA 3SH5A 2AGSA 1RUI3 3JZVA 1MEC1 3WW3A 4CTEA 5GZFA 4AGVA 3VL8A 4FXGB 2RE9A 1GZWA 2WNVA 1XU2A 3ZSLA 1WMDA 4HMZA 1N1SA 1HRV1 3FLPA 1AL22 5FRAA 1PGW1 4PCRA 5FO9B 4JGYC 4LULA 1X7NA 2ZKLA 4BOWA 1NG0A 2DVAA 4MUVA 5IK4A 5C4WC 1DQ5A 1J58A 2XH6A 4LT5A 2PHFA 4YVSA 4TLFA 4AEJA 4C90A 1A78A 1V6OA 2ZHMA 4KG8A 3EXUA 2E51A 2XLAA 4C1WA 3PVNA 3D4KA 3FWEA 3FZ3A 3ILFA 1PO11 1OQDA 4NPRA 4WBBA 4DXZA 3MYXA 4LR4A 2A75A 4N53A 3VBOB 1HIXA 1AXYA 1KJRA 3N4MA 3KD4A 2IXJA 3M3CA 4AFBA 3IIAA 2VVEA 3OBRA 3AP9A 3R4UA 2WS93 4QM9A 1XYNA 1ZBA1 5DDJ3 4HETA 4Y26A 1W0OA 5KHJA 4JGYA 4J1WA 2D43A 3J4UH 3ZFGB 1DGWX 1IKQA 5J48A 3N3HA 1NY71 5C4WA 2A6XA 2GH8A 2WL1A 1NLSA 2GH2A 1EPWA 2A6ZA 3V0BB 3C2UA 4K3UA 4XETA 2D6PA 4LA3A 4XBLA 3GZUC 2WZPP 5BNOB 1W6MB 1MEC2 4DFSA 2XL9A 3K48A 2HEYF 1Y9QA 1OQ1A 1QQP3 4FQ4A 2QNKA 1S0DA 3SCHA 5FLJA 4RQPC 3DGTA 3WUDA 4P9YA 2VOXA 1IKPA 2GNBA 1W39A 1REEA 1XXNA 4JDMA 3ZN4A 3JD71 5GM0A 1LEDA 2XJQA 1BBT1 4QPIB 4COZA 4H7MA 1ND3C 3NKTA 4AXOA 3S6PA 4F8AA 2EALA 2HEVF 1WCDJ 2AREA 1WUVA 2B5HA 3K51A 4W6YA 1CVNA 3NVCA 5JSRA 3ZN6A 2ZX2A 4FPOB 2V5YA 1ZVFA 4ZU7A 3T2TA 4XIOA 2BFUL 4LEJA 1J1TA 3NV3A 2HWB1 2P17A 1AJKA 2YGLA 1F8VA 4XFBA 1MACA 1LHWA 4CP0A 1UMZA 4R8HA 4XJAA 3EBRA 4C91A 4LBMA 4BMEA 4WM8C 4DQAA 1YJLA 2DF7A 1ENQA 1UX6A 4CDWA 2ZCWA 1HLCA 2ET1A 4RHV3 3X29B 3N7JA 4N43C 3G6JB 1BJQA 2JEMA 3WDXA 5I8YA 4BM8A 1AHSA