4XXAA

Crystal structure of a recombinant vatairea macrocarpa seed lectin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
235
structure length
234
Chain Sequence
SEVVSFSFTKFNPNPKDIILQGDALVTSKGKLQLTKVKDGKPVDHSLGRALYAAPIHIWDDSTDRVASFATSFSFVVEAPDESKTADGIAFFLAPPDTQPQKDGGFLGLFNDNKSIQTVAVEFDTFSNTWDPSARHIGINVNSIESMKYVKWGWENGKVANVYISYEASTKTLTASLTYPSNATSYIVSANVDLKSALPEWVRVGFSATSGLSRDHVETHDVLDWSFTSTLQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Seed lectin
publication title Crystal structure of a recombinant Vatairea macrocarpa seed lectin
rcsb
source organism Vatairea macrocarpa
total genus 53
structure length 234
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xxaA00
1CPMA 4BMEA 5GZGA 1JYIA 1SLAA 1W6MB 3WDTA 3AYAA 2DU0A 2ZGUA 4LBQD 3SH4A 2BQPA 2ZGQA 2VW0A 1OQ1A 2ZGTA 3LCPA 4XXPA 5DXDA 5E88A 3ZXFA 3N7MA 2WT1A 3M3QA 4FPKA 4XJZA 5DUUA 4ISRA 4AGVA 4ATEA 5H9RA 4FPLA 3FLPA 2DYCA 5DG1A 1MS4A 1S0EA 4R9DA 1D0HA 2A6WA 2DWRA 2AREA 1ULCA 2WQZC 1QKQA 5JOYA 2WSUA 3ZXEA 4WZFA 3SITA 2XB6C 3AZVA 3B00A 1UKGA 1IS6A 3VKMA 5IK7A 1IS4A 2JE7A 2NYYA 3AP5A 5GZCA 5JDBA 1SLIA 3FUQA 3POWA 4UW4A 3AFKA 3N35A 3RMYA 2ES3A 1Q8OA 5T5LA 4BQ1A 2P3IA 1AX2A 1C57A 3B3QE 2OUHA 1DYKA 1ULGA 4SLIA 2TEPA 3WDXA 4Q8LA 3HN1A 5SV8A 4GA9A 4AYUA 1VAMA 4YGEA 2A3XA 3V0BB 3GALA 3L2YA 1ONAA 3O12A 3OPZA 2A75A 2ENRA 3FUOA 3WHTA 2Z42A 4M01A 3AZZA 1DLLA 1HQWA 3ILRA 4NOTA 2ZGRA 5CA6A 1D2SA 3TAYA 1RIRA 5E8AA 2UURA 3WHUA 1S0IA 1CN1A 1FNYA 5GALA 3AZXA 1A8DA 3N36A 4FVVA 1DIWA 4FPFA 2KM2A 4CTEA 1GNHA 1C1LA 1HQLA 2VH9A 1J1TA 3AK0A 1GZCA 3D4KA 3NV3A 3ZYPA 2DURA 5DZEA 3OY8A 1W6QB 1GZ9A 3PVEA 1CONA 4HL0A 2A6ZA 3FFZA 4FQ4A 1N3OA 3OGGA 1MS8A 2AENA 4PCRA 4DQAA 1MZ5A 5DUXA 1VIWB 1LOCA 1Z0HA 3D5OA 1PZ7A 3N3HA 4FOQA 3M1HA 5HCFA 2R49A 1ULDA 1JBCA 3N7JA 2GMMA 2OVUA 3BOPA 1DQ5A 1ENQA 3WDVA 4AVTA 2DV9A 3PJQA 4XJ8A 2CNAA 1DQ0A 1PZ9A 3NV4A 4YFWA 1SBEA 1BKZA 2GNTA 1LOEA 1QOSA 1LHNA 1Q8VA 5EYYA 3AZWA 1IKQA 1QMJA 1V6KA 2WSVA 1AX0A 2VU9A 3KM5A 1MVQA 1Q8PA 1H9WA 1F31A 2UU8A 2YZ4A 3IPVA 1BZWA 1UZYA 1ULFA 1I1EA 2JECA 1LHOA 4FQZA 1N1SA 1AF9A 4ZKTB 1G9DA 2D6NA 1LOBA 3OBTA 2D3PA 1FNZA 1OFSA 1Z78A 2GN3A 4U2AA 4YG3A 1N1VA 1W0OA 2R0HA 3B01A 4Y1VA 1W6QA 2DTYA 1MS3A 2R0FA 1QF3A 3USUB 4I30A 1DQ4A 1CQ9A 3PMEA 4Q1RA 1UMZA 1S1AA 1WBFA 2GALA 4YGDA 3DGTA 2GNDA 3A0KA 4XJ9A 1UL9A 2A7AA 2DVGA 4Q1PA 1YYNA 2PHXA 5IK8A 3IMNA 4YG6A 3SISA 5JOXA 5FREA 4CRQA 4FPCA 5T55A 1QU0A 3BTAA 1ENRA 1FX5A 1V6MA 1WCSA 1LHWA 1CR7A 1O4YA 2A6VA 4C1WA 2PHFA 1HDKA 3MW3A 2UWCA 4LBJA 3R4UA 3SH3A 4D69A 2EXJA 1YXWA 1LU1A 2D43A 3AX4A 3WDYA 2C5DA 3OYWB 5GLWA 4Q8KA 5DG2A 3LSEA 4YZ2A 2DVDA 1V6JA 4RL7A 3VKNA 1SLCA 1AVBA 1GLHA 2CTVA 2DVFA 3A0NA 5JOWA 2ZMLA 3O5SA 4DFSA 1CVNA 3APBA 1O4ZA 2PHRA 2SLIA 1S0BA 1LESA 3IKWA 3ILFA 1LEMA 1S0FA 1DQ1A 1WW7A 2EXHA 3VKFC 1W0PA 1APNA 1I3HA 5GM0A 3HR9A 1WD4A 3FBYA 1CESA 5GJ6A 4DRVA 4FPYA 4H55A 4LBQA 1MS0A 1HLCA 4Y1XA 2ZHNA 1FV2A 1GKBA 3MPPG 4Q26A 3USUA 4Y1YA 5EXOA 1GBGA 1IS5A 2PHWA 2D6MA 3C2UA 4P14A 5KXDA 3POSA 1GZWA 3D6EA 4K1ZA 2DUOA 3FLTA 3VUOA 2WKKA 2D6LX 2YMZA 3RRDA 3WVJA 4GWNA 4JC1A 1W6NB 1V6OA 4FPOB 4DPNA 2WT2A 5HCAA 3ENRA 2DVBA 4GKXA 1ULEA 1SLTA 1UPSA 2A6YA 3O0XA 2D3RA 1W6OB 3AP6A 2E6VA 3AXDA 4XBQA 4Y1UA 4KBBA 4FPJA 4P9YA 2EAKA 2PHUA 5T50A 3V0AB 4YZ4A 3W58A 4PBPA 3TB0A 1JXNA 1Q8SA 2E7TA 3H0OA 3MEPA 3OJBA 2W68A 3DUIA 4Y22B 4YM2A 1AZDA 1W6MA 4NO4A 3SNMA 3BODA 5JLVA 2ZMKA 3ZSKA 2R1BA 2ZGOA 4YGCA 3ZSJA 4R9AA 1MZ6A 2OUJA 4XMAA 1QDCA 1YIFA 4XIKA 1LOGA 1QGLA 3ZYRA 4XTMA 2RHPA 4FOVA 4TYSA 4LBLA 4HANA 1VLNA 3JUUA 5IT6A 5F5QA 1LECA 1WBLA 5T54A 5GZDA 5T5JA 4YLZA 2ZBJA 3AZYA 3ILNA 2AH2A 1LJ7A 3B9CA 4P9XA 1BXHA 3MW2A 4YGBA 4AVVA 4PF5A 2ZKNA 1G9FA 1HKDA 1KDKA 1IKPA 3R05A 3PVNA 1OKQA 1ZM1A 3AYDA 2D44A 4XJWA 2R1DA 3I4IA 2DUPA 1S0DA 5CNAA 4Z8BA 1W6PB 1LCLA 1A3KA 3AYEA 3RG0A 3ZXKA 3V0BA 1W6OA 3RS6A 3POYA 2NP0A 2NMOA 2V73A 4L8QA 4YW2A 3VKLA 1NXD1 2ARBA 1LGBA 1QOOA 1URXA 2HYKA 2ZAAA 3IM0A 4K1YA 1GNZA 1LHVA 5DZFA 3WG2A 5JOZA 2A3WA 1B09A 2VW1A 4YW5A 2E53A 3B69A 2D7FA 2P2KA 4GWMA 5DUWA 3O0WA 4GXLA 1V6IA 4Y22A 1F5FA 3O0VA 3UL2A 1LTEA 1C1FA 1LODA 2JJ6A 2VXRA 4AVSA 1S0GA 2FHRA 1LENA 4XMIA 3QCWA 2GMPA 4PQ9A 3WCSA 2P34A 4ISQA 3QLQA 5DZGA 2WT0A 1VALA 1QNYA 5H9PA 1YI7A 3BIWE 4F83A 2AUYA 3R4SA 2CWSA 4Q27A 3WDUA 2CYFA 5L73A 2JE9A 3OBRA 4XDQA 3NV1A 1WW6A 4XBLA 2GNBA 1MS9A 1GSLA 2NZ9A 4BMBA 4YM3A 3CNAA 2CWMA 4ASMB 4XILA 1Y7BA 1DZQA 1N1YA 1AJKA 2A70A 5FRAA 4DS0A 4YZ5A 3UK9A 2D6OX 5LK5A 4XJUA 2Q5TA 1JHNA 1W6PA 3NWKA 4WVWA 1KITA 4LBNA 4C1XA 4YW3A 3W59A 1IOAA 1GICA 2WJSA 2UWAA 1X50A 1WUVA 3HMYA 4AGRA 3WG1A 1YRZA 5F9TA 4U36A 5EWSA 2NN8A 1LHUA 2G4IA 2PHTA 4RA0A 4XTPA 1DFQA 3A4UA 4PBOA 3N7KA 1JW6A 4XIOA 4XXAA 1V6LA 5E89A 5KXCA 4ATFA 3WDWA 2DTWA 1FYUA 1ZA4A 4YW1A 2DVAA 2YV8A 1AXKA 4BLJA 1EPWA 4WV8A 1JYCA 3UJQA 4XBNA 5DUVA 2VY0A 1LOFC 2EALA 1JUIA 4IQPA 2VW2A 2W39A 4UW5A 3WNXA 3T2TA 1C4RA 1SFYA 4YFZA 2D3SA 4XHXA 1F9KA 4M3CE 3ZVXA 2W08A 3WG4A 1GANA 2JDZA 4BOWA 1G86A 2ZZJA 1R1ZA 4XE9A 1KQRA 2A71A 2LALA 5CB7A 2P3JA 1S0CA 2DU1A 3OY8B 5GLZA 2I2SA 2C9AA 1GYKA 5T52A 4W65A 3ATGA 3AP4A 1SACA 3MW4A 1V6NA 3AJYA 1GV9A 1RITA 4TZDA 4YG0A 2V5YA 3FLRA 4LBMA 2GDFA 3AYCA 1UN1A 1DGLA 2YXSA 4Y1ZA 3OYWA 2AR6A 4BM8A 5GZEA 2WNEA 3INAA 2A3YA 3T1MA 1WD3A 1CPNA 4XHBA 1MR5A 2ZABA 3KQRA 3N7LA 3ZPYA 1WLCA 1WW5A 1FV3A 2D6PA 2ZMNA 4M3CB 3JU9A 4LBKA 3VV1A 3ZSLA 4FPGA 4Y20B 1YO8A 2XG3A 2ZACA 4M3CF 1KJLA 1G8WA 1WLDA 2H0BA 3AP9A 3M3CA 3M3OA 3ZXLA 2B7YA 2YY1A 5GLTA 1MVEA 3IPVB 4WVVA 1SCRA 1SLBA 1Q56A 4LBOA 1QDOA 2EXIA 3M2MA 4JRAA 4XZPA 1KRIA 5IK4A 1MACA 3I8TA 3UJOA 5KXBA 3ZXJA 1BQPA 4AGGA 4R9CA 1PZ8A 2R16A 5IUQA 1AX1A 1W6NA 2ZGLA 1QNWA 4M00A 4XJAA 4XYXA 3SH5A 1AXZA 1H30A 4UW3A 2A6XA 4UW6A 1N3PA 1G9BA 1WLWA 2ZHKA 1CJPA 1V00A 4K21A 2ERFA 5AVAA 1Q8QA 1XQNA 4ZXKA 1LULA 3U4XA 3Q9OA 3WZ1A 2P37A 4CZSA 4ITCA 4YW4A 1MS5A 4BPZA 1CIWA 2ARXA 3V0AA 3M3EA 3WLUA 2CL2A 2AGSA 1DBNA 3ASIA 2GNMA 1N3QA 3AXEA 4FP2A 1SLLA 4OZXA 1ENSA 1QOTA 3AJZA 2SBAA 3V64A 5GZFA 2FMDA 4M3CA 4FOYA 5T5OA 2E7QA 4FPEA 3T1LA 4MYEA 1LEDA 3V65A 5CBLA 4AWDA 1G9AA 4YM1A 4Y20A 3WUDA 2OW4A 1SBFA 4P9WA 4Y24A 1G9CA 1N1TA 2WLQA 3GNEA 2ZGSA 2ZGPA 1LGNA 1LU2A 2W52A 4DRRA 1KDMA 1AJOA 1G7YA 1U0AA 2AYHA 2NMNA 2NM1A 1A78A 2ZGKA 4K20A 3NV2A 2P3KA 1SBDA 1IS3A 2A5ZA 2ZA9A 4JCKA 5JMCA 1KJRA 2JKBA 2CY6A 2YROA 2ZHLA 1BJQA 1UAIA 3WG3A 5BYNA 3WOGA 1VAVA 2EIGA 4FOWA 4YZ3A 2DUQA 2VUAA 3VKOA 2UWBA 3RSJA 1AXYA 2JD4A 5HCBA 4LBQB 1NLSA 1SCSA 2ZGMA 5CAZA 2EXKA 1LOFA 2LTNA 4GKYA 5GLUA 3AP7A 4YM0A 5EYXA 3SLIA 3WV6A 1H9PA 2GMEA 4FP3A 1UX6A 1DHKB 4XOGA 3WUCA 1GZWB 1BYHA 5GLVA 1LOAA 1DYPA 1DQ2A 1FAYA 4FPHA 3ZSMA 2E51A 5H9SA 3RMXA 2GN7A 4Q2FA 3RQ0A 3IN9A 4YZ1A 1FATA 1DQ6A 4Y26A 1N47A 4R9BA 1UZZA 5KXEA 3PVOA 1JOJA 1TEIA 3LSDA 5IK5A 5JVVA 1S0JA 1WW4A 5H9QA 3WCRA 2D6KA 2ZGNA 5T5PA 1MS1A 4GALA 2PELA 2ZHMA 1JN2P 1RINA 1LGCA 4BLIA 2EF6A
chains in the Genus database with same CATH superfamily
4XACA 3VL9A 3IT8A 2FCTA 4BMEA 1JYIA 4YSFA 1W6MB 3KV6A 3LQCA 2DU0A 3SH4A 5L7OB 4XXPA 3LCPA 1OQ1A 3O14A 4FT8A 5E88A 3TRSB 3ZXFA 3OGRA 4B1MA 2WT1A 2XVLA 2X10A 4XJZA 4ISRA 1RGSA 1UYPA 3BGAA 2W95A 3FLPA 1MS4A 4R9DA 2DWRA 2WQZC 2AREA 4OHVA 3WP6A 2PLV1 2VULA 4NAMA 1RUF3 2GH2A 3SEPA 1DG6A 4V1PA 1UKGA 5LRRA 2NYYA 2AC1A 1SLIA 4W6WA 2Q8OA 4P9IA 4UW4A 4QQOA 3BU7A 5FZMA 1RMU3 3RMYA 4URAA 1O4TA 1Q8OA 1UXXX 5CISA 2QQLA 2P3IA 2VCAA 1F35A 1OVPA 4MADA 3RWNA 1PM7A 3ZN5A 4JAAA 4Q8LA 2OT7A 4OI1A 3WDXA 2Q30A 4GA9A 2W2IA 2VZ3A 1S2KA 5FYZA 2D93A 2LW8A 3L2YA 5FYUA 2YGMA 3UT0A 3J26N 5I0SA 3FUOA 1R1A3 3WHTA 4A4AA 2Z42A 4M01A 2P3YA 3GYDA 5L9VA 2JG9A 3AZZA 3RDIA 1HQWA 1QQP2 4K6BA 4NOTA 5LBBA 2UY9A 1I5ZA 3WP3A 5CA6A 1RIRA 1YFYA 3MBWA 3WHUA 4KQ7A 5AC93 5F3IA 4QPYA 2YB7A 1EAH1 3AZXA 2ET7A 3WNMA 3S7EA 4PDWB 2ZXQA 1DIWA 5A70A 3JCIA 4E2SA 3Q8BA 1GNHA 1C1LA 1Z7S3 1W3XA 2VH9A 3AK0A 1GZCA 3D4KA 3HBZA 4HG6B 3PTRB 4NHLA 4RQPC 4ARXA 1ODMA 4XFCA 5FXZA 4KG0A 4URTA 4HL0A 1BBT1 1K5MA 5FP7A 3RZJA 2XWBB 5DUXA 3T2OA 1Z0HA 1FT9A 3RWKX 2E9QA 5FDBA 3I7DA 3N3HA 4WM7A 3IDBB 3WF2A 4LKSA 3BALA 4RHV3 1TNRA 2X53S 4LA3A 5FY5A 5A3MA 1RUC2 3BOPA 4M0HA 1NCQC 3JXSA 3KWVA 2CNAA 4IEQA 1IG0A 2GNTA 5A33A 2WNUB 1PO22 4A41A 1Q8VA 3THDA 2VD7A 5LY2A 3GBGA 4Q0VA 3CLPA 4N90A 4DXRA 5EFUA 2XBO2 2IXJA 4MGKE 4LHLA 2VMHA 1AYN2 2WSVA 2VU9A 3MLLA 2VGDA 5C3PA 3ZXGA 2JIGA 3EHKA 4LLOA 1U5XA 2W1UA 5IJRA 1VBB1 4COVA 4EROA 2KA3A 5FYYA 4FQZA 4NHXA 1AF9A 1G9DA 5FPAA 1SQ4A 1RVF1 2GN3A 3WNOA 1HJFA 4Q4W3 2QQWA 3EYPA 5BNPA 5CKMA 4E27A 3OUHA 3B01A 4XF0A 1GQHA 5ANQA 2RS31 2JB8A 2VOTA 3PMEA 4Q1RA 2C0ZA 1HB2A 3PHMA 2BGPA 4ASKA 2Y0OA 1S1AA 1NZCA 4OI2A 4V2VA 5FK8A 2A7AA 2DVGA 3BOWA 4RQPB 1YYNA 3TN93 3JD71 4N43A 4YG6A 4NRQA 2VMGA 4CRQA 3UV9A 4XQWA 3RJRA 3UYJA 1LHWA 1CR7A 1CZTA 1WA4A 3ZFFC 3O1TA 1D2QA 2PHFA 2UWCA 4LBJA 4D69A 1ZRDA 3WDYA 2C5DA 1Q3EA 4LO6B 3VBSC 3ITQA 1QJX1 3BKZA 4AI3A 5LEKA 1RUF2 3M7AA 4A2UA 2WAAA 2O8QA 3KHBA 5HV4A 3FE5A 4W6XA 3LDBA 2ILMA 2OPKA 4JKLA 2C24A 2QQVA 5BNOC 3EBRA 3T08A 2Q0AA 4DOUA 1O4ZA 4IGOA 1JU4A 3BPSA 4OUEA 1K12A 3ROUA 5JIUA 5KHKA 1RMU2 1LAJA 2BZDA 3WW2A 3CL1A 4MO3M 1W0PA 1I6XA 2HEWF 2OX0A 4DRVA 2I45A 4DZGA 4Y1XA 1O5UA 3MPPG 1WCUA 3USUA 2HWE3 5EXOA 1VAKA 5JXIA 1R1A2 2VBPA 4CPBA 4P14A 5KXDA 1VJ2A 2XKOA 1O3SA 5DAXA 1HJGA 2D6LX 4CCJA 3WVJA 4XCBA 1K5JA 4GWNA 2RG4A 2OKXA 1W6NB 4YYOA 3E97A 1W8NA 5AC92 4FPOB 1UO9A 4DPNA 1FI2A 5HCAA 4GMP1 1ZZ9A 2LRPA 1ULEA 5JPNB 1SLTA 3ACGA 3OEAA 2A6YA 3MDPA 5IFPA 2ZZQA 1Z7S2 4Y1UA 4JV4A 3ZX7A 2IXHA 1ALYA 5K9YA 3WNPA 1VMJA 2GZWA 1OF4A 1ZBE1 5CFCC 2YGLA 4GZ9A 1AL21 4CP9A 3MUZ1 4LKFA 4PBPA 3WSOA 4AL9A 3THCA 3OJBA 4Y22B 5C8CC 2XVGA 4NRPA 4N7UA 4OCTA 1SZBA 3ZFFB 4CDUC 4B8EA 2ZMKA 3P3NA 4YGCA 4RHV2 4R9AA 4HSJA 1MZ6A 2MEV3 1QDCA 5KHJA 2FCUA 3A7QA 3MLKA 3VBSB 4HMZA 4XTMA 2RHPA 4SBVA 2JB4A 4FOVA 4TYSA 1MQTC 5FZLA 4UXAA 4YVSC 5BNOB 2BYVE 1UY0A 1WBLA 3PTYA 5JSPA 3POJA 4YLZA 3WW4A 4NMIA 2ZBJA 4BK4A 2G9ZA 3O1VA 1VRBA 1PIV1 2Y6GA 3MW2A 1CAUB 2VPVA 4MLOA 5DPNA 1HKDA 1TE1B 2XPJA 3VDBA 4C90A 3R05A 1TMF1 1RB8G 1XOYA 2GP3A 1LNSA 1GWLA 1UYYA 2DUPA 1ND2A 4RYDA 4Q4Y1 1YQ5A 5A32B 1W6PB 2VJXA 3ZFEB 4QX0A 1A3KA 3AYEA 2F17A 3RG0A 1NXMA 1W6OA 2Y26A 3POYA 2V73A 4LTAA 4COUA 2PTMA 4Q4W2 3KT1A 3T09A 4E4HA 2NQYA 2YBPA 1W2NA 4HPKA 1W2AX 2HYKA 3IM0A 3WG2A 4MSVA 1HXS1 2X8KA 1GNZA 1LHVA 1KD7A 1U12A 2DFBA 5ABJC 1JI6A 2N7GA 5F1RA 4QPGB 4PHZA 5FY8A 3CBNA 2HWD1 5CYYA 1SG3A 4MV2A 2HKXA 4EZ4A 5J1XA 5DUWA 1HN1A 3O0VA 1QJFA 3TN92 3RYPA 1ASJ3 2FHRA 1LENA 2VVDA 2AZ5A 1BEV3 2GMPA 2ZCWA 4PQ9A 4XMIA 5FMCA 3T30A 5CFCB 3TEWA 2P34A 5DZGA 2WT0A 1TQ5A 1YI7A 3VLBB 2C4XA 2AUYA 4M0NA 5C8CB 4Q27A 2WZR3 4CDUB 3OBRA 2P4EA 1XNAA 3ZR5A 2WA3A 1WW6A 2Y6LA 4FBFA 1MS9A 2QQMA 2QQKA 1O8SA 4YM3A 3HT2A 2CWMA 2EIDA 3JQWA 1MQTB 1O3RA 1XNDA 5AFBA 1ZBA1 5JZGA 1K3IA 1RUG1 2WRAA 4FTEA 3OBAA 3C3VA 3HQUA 3WF0A 1JHNA 5KWRA 1A6CA 1SFNA 1O8PA 4E8DA 3HIFA 2VUDA 2YC2A 3GXUA 5A3UA 5FXWA 1IOAA 3OUJA 2PHLA 4QGNA 2JWPA 3VHNA 3HMYA 1NE4A 2DBNA 1X36A 2HWE2 1T6GC 4QX7A 4K9SA 5FKCA 5EWSA 4ORFA 3BTZA 4CDQC 4RA0A 4WM8C 1DFQA 1H0BA 2CDOA 2CDPA 3K51A 3FFQA 4PBOA 1ULOA 4XDOA 3N7KA 1FOD3 3MPBA 1Y9GA 5E89A 4HFSA 3WX5A 4EN6B 5KXCA 5CFDA 5FZBA 5ABJB 3CKHA 3IDAA 4H14A 1VBE2 3H8RA 4JGZA 3KHCA 2VTFA 2DVAA 5L9BA 4WV8A 2XONA 3AVRA 4ZY9A 2VY0A 3AMQA 3LOBA 4IQPA 4UW5A 4C8DA 4QMAA 1GP6A 4CSWA 1E5RA 1HV1A 4YFZA 3M4FA 4AZZA 5I0RA 2W47A 1BHGA 1UF2C 5F5CA 1SDWA 1PNFA 2W08A 2BGCA 4FXKB 3TWIA 4S2FA 5DQ0A 1G86A 2VOVA 3E6DA 5GLZA 1GYKA 2D5FA 2VECA 4IGQA 4YPJA 2B45X 1EUUA 3OPWA 1RUE3 3WEZA 3ZIWA 4OI0A 2MEV2 1RITA 4LNVA 3AYCA 2WFF1 2W5FA 3OYWA 2AR6A 3EQEA 5FZ8A 1XSRA 4OMDA 3BU0A 2WNEA 3INAA 2A3YA 2BVBA 3U11A 3T1MA 4KWJA 4O65A 3RFRA 4QKNA 4XHBA 4O61A 3H9AA 1C5IA 4MGYE 2JG8C 4CYDA 5GKAC 1W99A 4XFGA 3N7LA 4UF0B 4CEYC 2ZMNA 1FXZA 2VZSA 4ARYA 4XAEA 4RN5A 4Z2AA 5IVCA 1UOJA 3D0SA 4ZHNA 2WO7A 4UYBA 3ZSLA 2YC0A 3KV9A 3NQHA 2RS51 2XG3A 1FMD3 1UCXA 5L9RA 1KJLA 2XGXA 4GJYA 1G8WA 3HJRA 3ZDVA 4LK6A 4FFFA 4I0WB 2Z5WA 4I2OA 1V0AA 2WZEA 2QNKA 1MZEA 4JGYA 3VBHA 4K7JA 1E5IA 4LBOA 1QDOA 3OGSA 4C91A 4WM8B 4XZPA 1EV13 5A80A 4QPIB 3ZFGB 1MACA 3I8TA 1RJ7A 3UJOA 5IK4A 1KRIA 3ZXJA 4AGGA 4K8FA 1PZ8A 2R16A 2RM21 5D8AC 1FPN3 2WS93 4QX8A 4P5YA 1QNWA 2H0VA 2PYTA 4XYXA 1AXZA 1F4HA 5C9AA 2A6XA 2WNVA 4I09A 1NZIA 1UY4A 4XZUG 4BQWA 5BNNA 3CJIC 4IEPA 3KF5A 2DCZA 4YRDA 4YNIA 4ZXKA 1Q8QA 1XQNA 1ASJ2 3VBUC 1KXGA 1LULA 4B4PA 3FHAA 1JHJA 1BEV2 3MIDA 2P37A 4CZSA 3VB9A 4YW4A 3FC0A 2R32A 2XHNA 1VB4A 4B3NA 4X8NA 4CUCA 2HWF3 1W0NA 3WLUA 2WNOA 4LE3A 4AEMA 2WO3A 3OCPA 2WZR2 5A3OA 4E4ZA 1JU3A 3V56A 4OZXA 1ENSA 4A44A 3PVBB 2QBXA 4NAOA 3V64A 3HNYM 1CAVB 4CDXC 3DYMA 1PK6B 3OSDA 5DMYA 2JDNA 4PLOA 1DGWX 1LEDA 2NPIA 5FP4A 4AWDA 4JRLA 4DINB 2B5HA 4Q0QA 1AR83 1SBFA 1G9CA 2WINB 4R8HA 4BU2A 4KWUA 4P08A 4EN8B 3VDAA 3ZYIB 2Y0IA 1ZZBA 5G05L 2JG8B 5A7WB 2ZGPA 1LU2A 2Y6HA 3OGJA 2NM1A 2NMNA 2AYHA 1Q5OA 3ES4A 4CEYB 2ZGKA 4CU8A 3DPRB 5C4WC 4AEKA 2P3KA 5FOBB 5JMCA 1IS3A 1M4WA 3LB9A 2YG0A 2CY6A 2ZHLA 4KL1A 4YW7A 3WG3A 1LKNA 1AR73 2YFUA 2BVVA 1VAVA 2EIGA 3RZMA 5JIAA 3RNSA 1IZ3A 2VUAA 3RSJA 1K42A 4MGZE 2VTXA 4LBQB 1NLSA 5BNQA 4QHOA 4PIZA 1LOFA 2R7EB 5EYXA 1FOD2 5FZHA 3UETA 2VQTA 4NHMA 3WV6A 3ZR6A 4FP3A 1UX6A 1RUD1 2ATFA 3NAPC 1O5LA 3WUCA 2Y34A 4NWVA 5D8AB 4NE9A 4J1XA 3CU7A 1VP6A 3U78A 4FXGB 2C6SA 1L7RA 3CJIB 4IEUA 2GN7A 4Q2FA 2FCVA 1GWMA 4B7EA 2CGPA 4YZ1A 1DQ6A 4Y26A 2RR11 3B7MA 3LEIA 1OQDA 1X8EA 2QVSB 3VBUB 4LHNA 2Y64A 4FTSA 2FMYA 5C5UA 3VHOA 1L3JA 2VBBA 3M3IA 5FYMA 3VBRA 4AG4A 2QQJA 4DUXA 1S0JA 1QXPA 5IVBA 4CXYA 2D6KA 1MS1A 4RS5C 3GM8A 4A42A 5FP3A 1DP0A 4OQ8A 1RUE2 2HWB3 2EF6A 1X8MA 3MFCA 3NKTA 3P5BA 3PMSA 5GZGA 5EJ1B 1OURA 5FQ0A 4GD4A 5C33A 4LBQD 2BQPA 4XFBA 2VW0A 2ZGTA 4QHBA 4KGGA 2FDHA 3M3QA 3DV8A 2EIBA 2PAEA 5JWPA 4F8AA 3EB7A 4XF3A 5EIYB 5DG1A 1S0EA 1S55A 1D0HA 2A6WA 2VZ1A 2VQAA 5JOYA 3VDCA 4BQ2A 1ZZ7A 4LO4B 5E1RA 3I2OA 5FZ7A 1QIQA 5IFTA 3VKMA 1IS4A 2JE7A 5JDBA 1UW8A 1UIKA 2YYOA 1FMD2 1VBC3 4JHZA 3AFKA 5DAPA 2ES3A 3VBFB 1C57A 4NPRA 2OUHA 4SLIA 1EV12 3LOIA 2ARCA 3H3UA 4Q29A 5C3SA 5A3TA 1UXZA 2A3XA 3V0BB 3GALA 5JAXA 1FPN2 1QJEA 2WS92 3NAPB 3WQBA 4PI0A 5FZ1A 4I01A 4GWIA 2ZOEB 2VNOA 3U4SA 2ARAA 3ILRA 2R061 1C8M1 3NSTA 3LWCA 5FZ6A 4H7LA 4MX3A 2UURA 3LPFA 2Q8EA 5GALA 1EY2A 4MVTA 1A8DA 1WGPA 1C3HA 3RZLA 4MUVA 4LO5B 1PGL1 4Z92B 3K3OA 2HWF2 4CTEA 2YPDA 3T4HB 3C7EA 3AB0A 4RS5B 3ALQA 3WXPA 2GSYA 1W6QB 1GZ9A 3PVEA 4QKDA 5FPZA 1MEC1 2DF7A 3FFZA 2AENA 2CAUA 2VVFA 3PUAA 1RUI3 2W9XA 1VIWB 1LOCA 5AFEA 3DEMA 1H8TB 1AR82 1KS5A 3LF7A 4FOQA 3M1HA 2R49A 1CD3G 2AEYA 4JDNA 3DXTA 1SPPA 5I91A 1IPJA 1JBCA 1VRH1 1TME1 3URFA 3FHIB 3HD8B 3UESA 3WDVA 1DQ5A 1ENQA 1S2BA 3E5QA 4AVTA 2DV9A 4IV3A 4DEVA 2F4PA 4ET7A 1PZ9A 2R043 2VCBA 4CCLA 5L7OC 1BKZA 4BYYA 1LOEA 3HN3A 4E4SA 1AR72 2X5IC 4P9JA 4C0BA 1W06A 3IBMA 3I2IA 1RXGA 1V6KA 1OPMA 4GB31 3ACIA 3W5NA 1AX0A 3KV5A 3KM5A 1MVQA 1Q8PA 2J1SA 2UU8A 4QU2A 3IPVA 5DDJ3 4IW3A 1BZWA 3U75A 1TZOA 4LKDA 4TWTA 1QJY3 3PIGA 5FK7A 2RS13 5E6HA 4XF4A 1HN0A 1AHSA 3DCQA 3PJYA 3OBTA 3WNLA 2WN3A 1NCRB 2D3PA 3D82A 1OFSA 3MV11 4HZFA 4U2AA 4XETA 3BYWA 4Y5TA 2GAUA 5FXVA 2IWGB 1N1VA 2R0HA 1RUH1 5FZ3A 3JBG3 1YIPA 2R0FA 2VR4A 4B29A 1GMMA 3ETPA 3EXUA 3P3PA 4XUQA 5CZKA 1CQ9A 1YHFA 2QDNA 1IG3A 2R073 3H3ZA 4E8CA 2RDRA 1WMDA 2GNDA 4IE5A 3D3AA 4XJ9A 1QJU3 4QWNA 4Q0UA 3VZOA 2PHXA 3I54A 2HWB2 2GU9A 3AVSA 1REDA 1RL3A 4MXWA 3TOJA 5FREA 3H8XA 2Y60A 1QU0A 1BLZA 3BTAA 4MHUA 3ZDSA 2J1TA 2GC1A 3PUIA 1FX5A 2A73B 3PUHA 1UMHA 1PO11 4M4PA 4O9EA 3SH3A 5LCWL 4HBNA 2D43A 3RYKA 5GLWA 4Q8KA 3O1MA 1JZ6A 3LSEA 5ACA1 4YZ2A 1V6JA 5F2SA 1SLCA 3ACFA 1GLHA 4A7KA 1BMV2 1XC6A 5FOJB 3I2JA 2W1QA 4LHSA 3MF6A 3WF3A 3OOXA 5FUNA 3I3BA 1EP0A 5JOWA 2ZMLA 5HV0A 2KD7A 4D3WA 1VBC2 5FKBA 1W8TA 1V9U3 1XYNA 1VBA3 2EIEA 2PHRA 4B4QA 4I0AA 2JICA 3IKWA 2OA2A 2X5IB 5C6CA 1RUJ3 2PMWB 4CP2A 1W05A 3N9QA 1WW7A 2EXHA 1ZNPA 1PVC1 2WBKA 4QHZA 1APNA 1HB1A 1I3HA 1D4M1 1MPXA 1PM4A 1WD4A 1H1IA 3C7FA 3FBYA 4ONUA 3ELNA 2VBDA 4YVSB 2OZJA 4NN0A 1DYOA 3LZZA 1RHI3 1UYZA 2ZHNA 1FV2A 2WNUC 4L97A 4HLTA 3O1OA 1ZRCA 3BTYA 4CU6A 4HVRA 2D6MA 3C2UA 3F95A 3I49A 3HOBA 1GZWA 3POSA 2WN2A 3I59B 2WKKA 5FMOS 1VBD3 2YMZA 2QFEA 3LAGA 1BVVA 1R093 3OD4A 3T3YA 1HQNA 1M06G 3MZHA 2JDYA 3BB6A 3ENRA 4AHXA 3KVAA 2HH9A 2DVBA 3KV4A 4GKXA 5FPBA 5FZOB 3H8UA 4N8MA 5F6LB 2LROA 1W8WA 4JX0A 1US3A 3VDDB 2OQ6A 1YI9A 3AXDA 4XBQA 4KBBA 4XQ4A 4HKLA 4FI9A 2BBAA 3NVCA 1PMHX 3EJKA 3V0AB 4YZ4A 1X82A 1DGRN 1XE0A 3E5UA 1RUI2 1NCQA 3DUIA 3IWZA 4BZ4A 4NO4A 4OVEA 1GNYA 4XFHA 2R1BA 5FYVA 3ZSJA 3UNPA 5I8YA 3BUCA 1I9RA 2OUJA 4MOAA 1H2KA 4QQPA 3S30A 3B02A 5F2WA 1J3PA 5FPUA 3MGUA 2R042 3KQ4B 4CEWB 5IT6A 2QQUA 2XJRA 1LECA 4Q4X1 5KHIA 3CJXA 5T5JA 1S4CA 1JZ2A 5A3PA 3AZYA 4P5HA 4XFIA 1RXFA 2JDKA 2Q8CA 1UY1A 2E31A 4PF5A 5CIRA 3ZN6B 3N9MA 1WLTA 4FFGA 1KDKA 2RJKA 3LA7A 3UGHA 5FLIA 1E57A 3SKJE 3PVNA 5DDJ2 4QU1A 4OLLA 3SKVA 3WD5A 2QQNA 2D44A 5FO9B 4XFFA 1QJY2 1WKYA 3N9LA 2RS12 4AI1A 4AFAA 4HN0A 5CNAA 4Z8BA 3WP5A 2IXLA 3VD3A 1LCLA 5JXJA 1CX4A 1GU3A 2XJQA 4A3ZA 3W5MA 1JYVA 2NMOA 1DDLA 1UOBA 4QD2A 2ARBA 1URXA 2ZAAA 5B4XA 1HRI1 5DZFA 2VMEA 3H7YA 2A3WA 3J8F3 3I2GA 3JBG2 2VW1A 4I02A 5K4LA 3K46A 3ES1A 4QDQA 5FR3A 3ZXAC 3J7NA 2R072 2P2KA 4GWMA 4AFMA 4Y22A 4GXLA 5LA0A 4COZA 1C1FA 1QJU2 1JYXA 2WL1A 4KNCA 4RFRB 4AVSA 1PGW1 1S0GA 3DKQA 1LRHA 4OMCA 2J22A 2E7AA 1X9PA 2XR4A 4EN0A 3WCSA 3QLQA 5C5TA 4BB3A 5JUVA 2EVXA 3MF9A 1VALA 1O91A 4XF1A 1NA1C 5FMBA 4IE6A 4RFT0 1K5MC 2VMIA 5BNOA 1IPSA 4EN9B 4L99A 4ZZ5A 2G19A 2XWJB 1UY2A 2XOMA 3AMNA 1BCXA 2VE1A 3AKSA 3ME2A 4XBLA 2GNBA 1UMIA 5CVRA 4PLNA 4CCDA 1W9TA 1GSLA 1ZVFA 4WM7C 2JDMA 4BMBA 1JZ5A 2QKDA 3G6JB 3GJAA 4BE3A 4AW7A 4XILA 1B35C 1NX9A 1DZQA 1Y7BA 1N1YA 4NHKA 4YZ5A 2JDPA 2PHDA 1COV3 2HWC3 3HT1A 3UK9A 5HCHA 1V9U2 5LK5A 1ENXA 1VBA2 1JOBA 3O1UA 4OHZA 3HQRA 3CMGA 4X6RB 3S7IA 1RUJ2 2Q5TA 2B9UA 1W6PA 3NWKA 4N9IA 4O9GA 3IMMA 4L11A 4Y5Z0 2GC3A 4BK5A 1KITA 4QDSA 1UIJA 5FYTA 4C1XA 4QM9A 2JX9A 1U5YA 3W59A 4BXSV 2UWAA 5C3RA 1XPWA 4ES8A 1RHI2 5D21A 3ZSEA 1WUVA 2GH8A 3ZYGA 4IETA 4IE7A 1POV3 5E16A 1RJ8A 1YRZA 4CUGA 3DN7A 4OUSA 4QQ2A 4U36A 1NYWA 2FBEA 3HNMA 1LHUA 3DF0A 1VBD2 1POV0 1R092 2RJ2A 4XIOA 1V6LA 3NJXA 3PLQA 5FY4A 5FZKA 1UPIA 2JG9B 3RI9A 3WNNA 1OMIA 4LXLA 5LBEA 2QUOA 4DY5A 1AXKA 1EPWA 3UJQA 5DUVA 2VZPA 1HRV1 3ZFEC 4ZS3A 3WNXA 5C8CA 1Q43A 1O6UA 1SFYA 2D3SA 4XHXA 4HSLA 4M3CE 1XNKA 4D7TA 3VN4A 2GC0A 2VZOA 2JDZA 2NLRA 3LFMA 2PLV3 4QPGC 4XE9A 2L9LA 1WMEA 2A71A 1EUTA 2LALA 3DKWA 2DU1A 1VBE3 1GFF2 1NA1B 2C9AA 5T52A 1PMIA 2OXBA 4YW6A 3GCWA 1K5MB 2LS6A 4BISA 3AJYA 3MLJA 2WYFA 3GHNA 4TZDA 4YG0A 1OH3A 3FLRA 1WMFA 1UN1A 1W2TA 4WM7B 4LO7A 2UYBA 4LQRA 3MIFA 2XJUA 1W2UA 1B35B 1YQCA 2XUEA 2OYZA 1CPNA 1AR61 3RZZA 4H2AA 4CUAA 2FDJA 3RI8A 2EAAA 5A33B 4NPLA 4LBKA 1OLMA 3ST7A 1YEWA 2ZACA 5JSRA 3ECQA 3J7LA 4F7ZA 2BEOA 2RMU1 1WLDA 3FHQA 1H4GA 3LE0A 5I0UA 1EAH3 5KC6A 5FYBA 4IV1C 4L9BA 1CAWA 5EQUA 4COWA 1SCRA 5BXXA 1OOPA 1AR91 4ZONA 3SCFA 1X33A 3OF1A 5HXVA 5KXBA 2W87A 2P5BA 5FZIA 2WO1A 3J8F2 4IXLA 3PUQA 1BBT3 4TXWA 3USSA 1AX1A 4XJAA 3UKNA 4M00A 4EWEA 3KT4A 4UW6A 5C70A 3KCXA 2VZUA 3GZAA 2ZHKA 4JQTA 3HVDA 2ERFA 3J7HA 1IPKA 3K3NA 1YC61 4EE2A 2XL7A 1C28A 1W03A 4BCUA 3L2HA 1MS5A 4QXCA 2F6BA 5JXGA 3Q8EA 5J48A 2ARXA 3EMRA 3DYPA 2YPJA 4CVUA 2WLPA 2GNMA 3I2DA 1N3QA 5FWEA 1SLLA 3CHXA 1QOTA 3AJZA 1ZRIA 5GZFA 2W1WA 2FMDA 4FOYA 2E7QA 3FJSA 4G4FA 3DYOA 4S2DA 1WMXA 3ZOIA 5IVJA 3WUDA 5BPXA 2OW4A 4P9WA 4Y24A 3SCGA 1COV2 1N1TA 2HWC2 2VOKA 4LPLA 4Z1VA 2H6CA 3MV01 1VBB3 2ZGSA 4M4RA 5CU1A 4XF9A 2W52A 3J4UH 1AJOA 1G7YA 1U0AA 4DO0A 1T2XA 1Y9MA 3NV2A 1JS9A 4CDQA 1RVF3 5A6ZA 2A5ZA 4HOOA 2YBKA 4WM8A 4A6OA 1W8FA 1BJQA 1JTZX 4PI2A 4QB1A 3WOGA 2RS33 1R081 4FOWA 4YZ3A 2DUQA 1NY71 4IV1B 1XNBA 3ZYHA 1SCSA 3SC7X 2XMLA 5I8SA 5CAZA 2EXKA 4XUNA 2LTNA 1KGYA 1UD1A 3CEWA 3SLIA 1J59A 1H8VA 2GMEA 3JD73 1DHKB 4JQRA 4NROA 4D6SA 1ACCA 1DQ2A 5D2AA 2WZ8A 3AC0A 5IATA 4IL7A 3ON7A 2IC1A 4LUMA 4D6QA 2E51A 5H9SA 1O3TA 4GH4C 3RMXA 2IXIA 4LORA 2VC9A 4ZZ8A 3IN9A 5EPAA 1N47A 3ZFGC 4QPIC 4DUVA 1CAVA 4XCAA 3PVOA 1H2LA 1JUHA 1JOJA 1QJX3 3NW4A 4QX5A 2PLV2 2W92A 5IK5A 5JVVA 2HJIA 1YQ2A 1WW4A 3WCRA 1A8MA 2ZHMA 5A1AA 1LB2A 1RINA 2TNFA 4BLIA 4E2GA 1GOHA 1CPMA 3H42B 1QY4A 1XB9A 3VBOA 1AYM1 2BNNA 1SLAA 4CEYA 4BH9A 3WDTA 2CSGA 2ZGUA 4DMIA 2Q8DA 3B9IA 4KU7A 3GGLA 3GDBA 3N7MA 4Q4V1 4CP1A 5K0UC 4FPKA 2TUNA 5DUUA 2IUWA 4ATEA 2DDUA 5FZ9A 3I2FA 4XW3A 5H9RA 4CPBD 4QT6A 5DAVA 3ORJA 1J1LA 1ULCA 4CCNA 2Y6KA 3U14A 4WZFA 4NVPA 3SITA 1PK6C 4FAGA 4CCCA 3ZKUA 1IS6A 5LWBA 1Y9QA 2K9ZA 3POWA 1XRUA 3ZYJB 3WINE 1EAH2 3N35A 5SV5A 4GMP3 4BQ1A 2ORZA 4K8RB 5T5LA 5KHGA 5FMOL 3B3QE 4TN7A 5EP9A 4AF9A 1JZ8A 1GP5A 4FO9A 4D7YA 1DYKA 1ULGA 4LK7A 2BW8A 2I74A 2WC2A 3CJIA 3DPRC 5FLHA 2TEPA 4BQ5A 2WWSA 2A1XA 5F3GA 5SV8A 1VAMA 4YGEA 4MXVA 4AXOA 5CKNA 1ZBE3 1BBT2 3KD4A 1F4AA 4IE4A 3ACLA 1AL23 1XE7A 2ENRA 2J42A 2JDAA 4NWWA 2Y6FA 3BCWA 3Q8FA 4HPKB 3SQOA 3ZKYA 4RGAA 3WW1A 3U0ZA 2VOWA 1OHFA 3LA2A 3WY6A 3WP4A 3H1WA 5LZ6A 5E8AA 4GH4B 1UNBA 3N9OA 5C8WA 1VB2A 1JYTA 2JKXA 4DXTA 1FNYA 2ZKLA 5A1FA 4RR3A 1RYYA 3N36A 4CDXA 5LRSA 3AMPA 1O7FA 1GOFA 3W21A 1X7NA 1HQLA 3RYRA 3N9PA 1J1TA 3NV3A 5J98B 4AFDA 5DZEA 3OY8A 5EJZB 3RJ2X 3RZGA 4LR4A 1CONA 5J36A 2A6ZA 4NUBA 3AL5A 4FQ4A 4JZRA 5F37A 1MS8A 1GP4A 1PIV3 2V4VA 1MZ5A 2JDHA 1SMVA 4CCEA 2XH6A 3D5OA 1QQP1 5C4WA 5FBZA 1PZ7A 1TMF3 5K0UB 2XJSA 4EYUA 1ULDA 1VBB2 5JSOA 4Q4Y3 4R52A 2OVUA 1JODA 4AEDA 3PJQA 1PNGA 1RVF2 3T0BA 1J3RA 3QOPA 2LUWA 3NV4A 4YFWA 3S5AA 2X09A 4AOCA 1HXS3 1LHNA 3GBFA 3HPNA 1IKQA 2BWAA 1QMJA 2RS32 3FX3A 1UKRA 2HWD3 3H50A 2B42B 1OLRA 4AK3A 4W8JA 3LEKA 4N9HA 1H9WA 1F31A 2YZ4A 1OVSA 2YBSA 2VZTA 1ULFA 1Y3TA 1G6NA 1DGWA 3JD72 3S6PA 2XVKA 3VBHC 3BI3A 1NKGA 1RUC1 1N1SA 2QE3A 3N9NA 4UWDA 4Y5SA 5FZDA 4ZKTB 1UOGA 1UX7A 3VBFC 4L0PA 5CFDB 3E6BA 1W0OA 4Y1VA 2QDRA 1PO21 3HQXA 2OQ7A 1W6QA 2ORXA 2WNVC 1I5PA 3AKRA 1UU5A 4I30A 3VGIA 2XBO1 4LULA 1QJX2 4W50A 5LATA 3SEEA 1UMZA 4Q0SA 1AYN1 1VE0A 4AI9A 1WBFA 2GALA 1OXCA 3DGTA 2QQOA 1QEXA 2FQPA 4Q1PA 1ZBA3 4UFIA 1RUG3 5IK8A 3IMNA 3OB8A 4CA9A 2VZQA 4FPCA 3LEMA 3GCXA 4INDA 3VZNA 1ND3A 1IQAA 1ENRA 5LA9A 4FAHA 1V6MA 1O4YA 5B2GB 1OC1A 4MGQA 5FZFA 4Z07A 4CDWC 3MW3A 4AHYA 2WUHA 3C7HA 1LU1A 3AX4A 5JCTA 4IEOA 4TSVA 3OYWB 2F4LA 4XVHA 2BRTA 4H7MA 5DG2A 5FZ4A 3K77A 1IHMA 1U5IA 2ZX1A 3LGRA 1UZVA 4XAAA 3U07A 4Z2WA 2XJTA 3A0NA 1CAXA 1YJKA 3O5SA 1VMHA 2WQ8A 1CVNA 1H8TC 2WAOA 4AAXA 1KS4A 1S0BA 2E32A 3ILFA 2JENA 1S0FA 5FO7B 4AI2A 2JDUA 4RGGA 3ZXDA 3VKFC 3B93A 5LB6A 5F8PA 5GM0A 3HR9A 2VTXJ 2WWUA 4FPYA 4H55A 4A6SA 4EWDA 4NIIA 1HLCA 1KEXA 1ZBE2 3IB3A 3IAQA 4A3XA 4JGYB 3VBHB 2V4AA 4LJHA 1AL22 1RUF1 4C0HA 3R4DB 2B39A 2QQIA 3D6EA 3NNMA 2DUOA 3FLTA 3H1YA 4V2WA 3VUOA 3RRDA 5DAQA 3MO4A 4UFKA 3WR0A 5AVPA 5C9AB 1H6XA 1L7LA 1XE8A 2WNVB 2WT2A 3JB4C 1RMU1 2XUMA 5JR2A 2O0OA 4XC9A 1UPSA 2WFF3 4JDMA 3NMBA 2D3RA 2FZ2A 1ZZCA 3AP6A 2PQQA 2E63A 4HKWA 5IYYA 3QACA 5JPMB 1XNCA 1NCRC 4P9YA 2EAKA 2PHUA 4RGKA 5A6QA 5T50A 4YVWC 3W58A 1UZ0A 1R1A1 1PIV2 1OA3A 3TB0A 1JXNA 2E7TA 5GJ6A 3H0OA 5A6YA 3Q8AA 2W68A 1QH7A 1AZDA 1W6MA 1TMF2 5L7OA 4Q0PA 2RS53 4GQ7A 3ZSKA 4CDWB 2FDIA 2JIJA 5AC91 1F2NA 2W1SA 5A7OA 2X5IA 4XIKA 1YIFA 2V5DA 4GIQA 4Q4Y2 1W2OA 2XHKA 4IEWA 1QGLA 3KGLA 2QTWB 4I3GA 1Z7S1 3ABZA 4LBLA 5A3WA 5F5QA 1HXS2 5T54A 5GZDA 1OT5A 5FLJA 2RM23 2AH2A 1JZ3A 2E33A 3B9CA 2HWD2 2VQ0A 3NJYA 4YGBA 4AVVA 1W8UA 1G9FA 2ZKNA 4OFGA 2RDQA 4K3UA 2ZX0A 3VD5A 2ZS6B 1YLLA 3ZM8A 1J83A 4XJWA 4CU9A 4RHV1 4OI4A 5J3UA 3K48A 1OPOA 5FZOA 4EWAA 5EZWA 3BIEA 2NP0A 1SHWB 4L8QA 3LDRA 3NNGA 2IZWA 2D98A 2W0XA 1NXD1 1LGBA 3H1MA 4K1YA 5FTTC 3OEBA 3BTXA 5JOZA 4CU7A 1YUDA 2E53A 2OIIA 3B69A 3IDEA 4PDWA 3OD0A 3G7DA 4TTGA 4PT6A 1LODA 3FWEA 1K45A 1ZBA2 2VOXA 1YFWA 1RUG2 3VBRB 1NQDA 3AKTA 2VNVA 3TBDA 3QCWA 2R6QA 2WR9A 2C1FA 3PL0A 4YVWB 5FP9A 4MGTA 4QQHA 4ISQA 2RJLA 4NR1A 4KWLA 5H9PA 1NAEA 2BOIA 3CF6E 1OKOA 2CWSA 2HLEA 4Q4W1 5JI9A 3WDUA 2BTVC 2CYFA 4HVOA 4XFAA 2BNOA 3M8LA 5FQ0B 3VDDC 3VD4A 4XDQA 4QDRA 2WIIB 2AEZA 5LW9A 2XLAA 3OUIA 1CWPA 3LIHA 3DXUA 1J58A 2NZ9A 3CDZB 4HKOA 5FZGA 3CNAA 4ASMB 1XSQA 3GJBA 5IHRA 4WVMB 4PJYA 4Y3OA 3CZUA 2BJSA 4DS0A 3BN6A 4HK8A 4HETA 2X29A 4P00B 3TN91 1W3VA 1RUD3 2O14A 5A6XA 1D7PM 2WNUA 4WVWA 4E2QA 2H6BA 1UZWA 3LEGA 2VUJA 3WQ0A 3J7MA 4DIQA 4HN1A 4XUPA 2VMCA 3T0DA 4YW3A 2MNGA 5G04L 5FYSA 1PX3A 1X50A 3MHZA 2ZX3A 2IXCA 2K0GA 2RR13 4AGRA 4CEWC 1AL0G 3X29B 1W9YA 4NHYA 2NN8A 2J1UA 1XBFA 2G4IA 2HEYF 1EPZA 5C71A 4N53C 1OI6A 3A4UA 4AHWA 4PF1A 1ZZ6A 3WQ1A 1RTVA 5BY5A 4XXAA 3MI8A 3ZYFA 4Z82A 1JZ4A 1YFXA 3WDWA 4QX1A 2DTWA 1FYUA 1ZA4A 3LDKA 4YW1A 4AFCA 1PVXA 1NG0A 2WFF2 1SEFA 1RUNA 3UKVA 2B8MA 1JYCA 1W39A 2G1MA 2RDSA 4XBNA 2EALA 4I3PA 1EYBA 2VW2A 1WCDJ 2P1BA 3MIGA 3KCYA 2KXLA 3T2TA 5I0DA 1F9KA 1C5HA 1YQ8A 3J9SA 5BV6A 2HWE1 4S2GA 4KWKA 4RQPA 3WG4A 2BWCA 3NNFA 4JHTA 5HI0A 4A45A 3CQOA 1KQRA 4FFIA 3IIAA 4FFHA 4XQDA 2P3JA 1S0CA 3AFGA 4HK9A 4W65A 2RS52 2VAUA 2VMDA 3ATGA 3R0RA 3AP4A 5JMOA 5EHDA 1V6NA 4W4ZA 1VBE1 2V5YA 2GDFA 4Y1ZA 1UWWA 3MYXA 4BM8A 3L9JT 5GZEA 4D6RA 4LLFA 1RC6A 1SPPB 3F2ZA 3W20A 1WD3A 3VD7A 3UGGA 2ZABA 1F5JA 3ZMNA 4D0QA 2OZ6A 2RM22 3ZPYA 4LOSA 1WLCA 4IV3B 1FV3A 4M3CB 4LMFA 1GR3A 1YWKA 2QCSB 3E5XA 5F32A 2R063 3FZ3A 1C8M3 5IVYA 3VV1A 5C3OA 2XJPA 4Y20B 1YO8A 4M3CF 3RVHA 1DLCA 2BPA2 1W8ZA 2H0BA 2MEV1 5T3NA 1Y43B 3M3OA 2W94A 1MVEA 4KH9A 3HNBM 3IPVB 2BU9A 4CCOA 2QZ3A 3A21A 2EXIA 5A7QA 5CG8A 4N53B 4BIOA 4CE8A 2RVAA 2PN5A 5LK7B 2D5HA 2DBIA 4UAPA 3HEIA 1U5ZA 5FXXA 1MEC3 1W6NA 2ZEXA 3DL3A 3SH5A 3ZYBA 1W04A 3TEXA 1CGPA 1G9BA 4OHWA 5LA1A 1JYWA 1NA1A 1V00A 2HEVF 2XJVA 2YC4A 5AVAA 3U4XA 1VRH3 5LY1A 1TME3 4RD7A 3WZ1A 5I8TA 1H1AA 4CUBA 3E6CC 5ISLA 1CIWA 2JG9C 3P1IA 4UFLA 2WABA 5FMDA 3M3EA 2Y8KA 1QXJA 2AGSA 3MFAA 1B35A 1DBNA 1PX4A 3ASIA 4NPMA 1ZZ8A 3UKTA 1GOGA 3AXEA 4MXWB 4G9SB 3LA3A 4QXHA 4XEZA 3ZFFA 1H4HA 4GB33 2WYSA 4FPEA 4QPWA 4MGSA 4X8PA 5F39A 5IVEA 5CBLA 4WBBA 3VBSA 2D97A 4QGMA 1H1MA 1ASJ1 3GNEA 4JKMA 1RUD2 4ZU4A 2Q1FA 1BEV1 1OA2A 2HYXA 4DRRA 1ZYBA 1KDMA 2HBTA 1A78A 1OBNA 4K20A 4QKFA 1O3QA 5F5AA 2X05A 2FD8A 3VZKA 2FDFA 2J1AA 3RPQA 5IAVA 1CAUA 5IW0A 2WZR1 3POGA 5DABA 5LEJA 1WA6X 4L92A 4AFBA 3I3DA 1RUH3 2RR12 4IEXA 5IVVA 5LBCA 3NRUA 4KG8A 2UWBA 2D40A 3GZUC 4OUMA 1AUYA 3LFIA 3NJZA 4I0BA 5CKQA 4A7YA 5FUPA 5A32A 3ZFEA 3POIA 4QB2A 4GKYA 5GLUA 4HVQA 3AP7A 1H9PA 3JZVA 1GZWB 1BYHA 2ZEYA 1LOAA 5F3EA 5FY0A 5GLVA 3UGFA 4AR2A 5HPOA 2JEMA 4COYA 2PA7A 4QPGA 4BQYA 1FAYA 4FPHA 1UQXA 3ZSMA 1H6YA 2J1RA 3ZMOA 4FCAA 4UFJA 5FAXA 3RQ0A 1PO13 1ZREA 1FATA 1CIYA 4LUKA 4R9BA 2Q1MA 4DNYA 4GWJA 3ZO0B 3POFA 5KXEA 3S5QA 5BUVA 2BGOA 5ACA3 1TEIA 1YJLA 5FY1A 5CFCA 3I97A 3POBA 5H9QA 4OULA 5T5PA 5BNPC 4GALA 1HW5A 1FOD1 2PAMA 4LT5A 1QHDA 1F8VA 3JB8A 2BDRA 4CCKA 3THPA 1NCQB 4CDUA 1TG7A 3AYAA 4OQ9A 1PVC3 2ZGQA 5DXDA 1D4M3 1VPHA 4Y4YA 4XPVA 4XUTA 4PIYA 4AGVA 4N43C 4FPLA 2DYCA 2HBUA 1F15A 1MQTA 2XLFA 4N7IA 4IV1A 1QKQA 5ERLA 2WSUA 3ZXEA 5IAXA 4JTNA 4S2HA 2FDGA 2XB6C 3AZVA 3B00A 2R062 5J7MA 1C8M2 3C7OA 4RSUA 3AP5A 5GZCA 5M0TA 2EA7A 3FUQA 2JXAA 2IXKA 1RUE1 5F6KA 4W6YA 3C8XA 1AX2A 3KZ4C 4JDOA 1PGL2 4F3JA 2IFWA 4BDVB 3HN1A 3CO2A 1W28A 4GJZA 4AYUA 5I93A 4UI9L 5FYHA 1OQEA 1ONAA 3GF6A 3O12A 3OPZA 1MEC2 2A75A 1XU1A 2J1VA 5FBJA 2Z2SB 5ABJA 1X9TA 1DLLA 4IUGA 4NJ4A 5A3LA 4NIHA 2ZGRA 1OUSA 1D2SA 3TAYA 4DXSA 1WCQA 1FMD1 4CXWA 1S0IA 1CN1A 2GC2A 4QXBA 4AQ6A 1VRH2 2CAVA 1TME2 3AM2A 2FDKA 4FVVA 1WZXA 1XU2A 1Y4WA 2WO2A 3FN9A 3MUY1 4FPFA 4QAWA 2KM2A 4DXZA 3ZYPA 1EV11 1KFXL 5BNPB 2DURA 4WZCA 4Q4X3 3P6BA 1GUIA 3OTFA 1FPN1 2WS91 1N3OA 3OGGA 4GB32 2G9FA 4PCRA 4DQAA 2BFUL 3FBMA 2XXZA 4IESA 4IEYA 1QJZA 5FY9A 3WW3A 1CJDA 5HCFA 4TLFA 4NRMA 1IQDC 1D0GA 1A34A 4N43B 4PQQA 2VNGA 3VD9A 1NQJA 2GMMA 1W9WA 3N7JA 1CZVA 3ZPOA 1PHMA 1ZX5A 1BK0A 2HWF1 4UF0A 4XJ8A 3IZOA 1DQ0A 4ZS2A 1GQPA 1SBEA 3U37A 4BQ3A 1HRI3 1QOSA 1RUH2 5EYYA 1DZTA 3AZWA 1DU3D 3MIHA 5LA2A 2B4KA 4E9KA 5FV3A 3FL7A 4IEVA 1AR81 3MICA 4GH4A 2YFZA 3QH7A 4AHZA 1UZYA 4LO8A 3WNKA 1I1EA 3ZFGA 2JECA 1E5SA 1LHOA 1OOPC 4QPIA 5EV7A 4OZOA 1UYXA 5KR7A 2D6NA 1LOBA 4EJRA 4WVZA 4TLGA 1FNZA 1GZTA 1Z78A 2ZX2A 4XDPA 4YG3A 2VCMA 2Z4FA 2O8OA 2ZEWA 1PO12 3MIBA 3QBQA 2DTYA 4UFHA 1ND2C 1MS3A 1AR71 4JVAA 4QB6A 5FZAA 3I2KA 1QF3A 3USUB 4OYUA 1DQ4A 4LITA 5ACA2 2VUCA 4NIDA 3D8CA 4AEJA 3O1RA 4YGDA 4FTBA 3A0KA 1UL9A 1C8NA 1OFNA 1VR3A 5F5IA 5K0UA 5A7PA 5FPVA 2ADEA 5FUIA 2B46X 2W91A 1OLQA 1QH6A 3SISA 5JOXA 3BVCA 4DY3A 4JTOA 1CX1A 4UT5A 5FY7A 1WWYA 5T55A 2YDEA 1PVC2 3JQXA 2G9GA 1D4M2 1NLRA 1WCSA 1PK6A 2A6VA 3WQ7A 2W3JA 4C1WA 1HDKA 4OHYA 3R4UA 2EXJA 1YXWA 4BQ4A 4DEQA 5L36A 2DCKA 2B9VA 4BJ0A 2VL4A 1DF0A 3EO6A 1IGOA 2DVDA 4RL7A 3VKNA 4ZPIA 4CP9B 3ETQA 1XNTA 5A7WA 1AVBA 2JG8A 2CTVA 2O1QA 4YWAA 2DVFA 5A3NA 3DPRA 2ZAHA 1JMUB 4DFSA 2HWB1 1W8HA 3APBA 2SLIA 4X6QB 1GWKA 1LESA 4AVAA 1LEMA 4DB5A 3QH6A 1DQ1A 3W9AA 4IEZA 1HV0A 1YFUA 1CESA 1JYNA 1HRV3 1MZFA 1OD3A 4IE0A 5JZGC 4LBQA 3IAPA 3VZMA 1CAWB 1JH5A 1KFUL 1MS0A 2VG9A 3B5LB 5K7PA 1GKBA 4Q26A 4Y1YA 1OOPB 1GBGA 3PU3A 1IS5A 1NLQA 4HONA 2PHWA 2WFPA 1BMV1 5FP8A 5A1LA 1UY3A 4K1ZA 4LOTA 5D8AA 3VZLA 1UU4A 4HXCA 5FCCA 3NL1A 2DFCA 1ZA7A 4JC1A 4ES9A 1VBC1 2CGOA 1GQGA 4GAZA 1J84A 5FYCA 1V6OA 4G3YC 5DN2A 3RGBA 1ND2B 5F7UA 4GMP0 3S0MA 2VXJA 3I3EA 4CXXA 2UY8A 3O0XA 3VBUA 1QWRA 1W6OB 2BUKA 2JE8A 3A23A 4UFMA 2E6VA 5FZCA 1TNFA 2VCCA 4EN7B 4AQ2A 1BK1A 2VVEA 2Y6JA 1AR63 4FPJA 4P9GA 4Q4X2 5CFDC 1OH4A 3THTA 2VQUA 2V09A 4D8MA 2CHHA 2XQRA 1J3QA 4JGZC 1Q8SA 3MEPA 4YM2A 2LM3A 5FZ0A 4KI5M 3VBOC 4LIVA 3BODA 3GZEA 4XURA 2CU5A 3SNMA 1XXNA 2WQ4A 5JLVA 2ZGOA 4ZU5A 2RMU3 3AMMA 4DUWA 1OUXA 4XMAA 5FJKA 3PIJA 1OSGA 4AVCA 1LOGA 3KF3A 3ZYRA 4ZU7A 4K40A 1AR93 3KS7A 1HB4A 4PLMA 5KBFA 4HANA 1VLNA 1US2A 3JUUA 4ZXEA 3LPGA 3VL8A 2I07B 4EV0A 1HRI2 2E26A 5JI7A 5FWJA 2ETEA 3O7OA 3VHRA 5JXHA 3ILNA 1UOFA 4CDQB 1LJ7A 4P9XA 4LIUA 1BXHA 1RUI1 5FFOC 4D94A 3I3QA 5LASA 1DGRA 1IKPA 3VBFA 4BIFA 3E1F1 2RDNA 1OKQA 1ZM1A 2KR2A 3AYDA 3Q8CA 4AQSA 5JZGB 3PURA 2R1DA 3HAGA 3I4IA 1PGW2 1S0DA 2GP5A 3A22A 1O59A 3AL6A 3KGZA 4J25A 5DAWA 1W9SA 2YUEA 3ZXKA 3V0BA 3S57A 3RS6A 3NAPA 1XJAA 1H2MA 2DCTA 4UBGA 2R041 4YW2A 1HX6A 3VKLA 3CZJA 5HXMA 1QOOA 2C26A 1DCSA 4LE4A 5CEHA 1B09A 4FSJA 2V72A 2J7MA 4YW5A 4NIAA 3T2PA 1OA4A 1RUOA 2XKPA 1UU6A 2D7FA 2ZPXA 4JGYC 2XQXA 3O0WA 1V6IA 2RE9A 4LKEA 1F5FA 4RR3C 3UL2A 1LTEA 2JJ6A 5DDJ1 3HBKA 2QQPA 4CDWA 2W46A 3O1SA 1CZSA 2VXRA 3NO8A 5F3CA 5J96B 1QJY1 2RS11 4AAPA 4B7KA 4RS5A 4B4RA 2P6CA 5KHHA 3IIIA 5C9AC 2ZX4A 4JGZB 3SCHA 4MGIE 5BNNC 5CG9A 5KC5A 1QNYA 3BIWE 3POEA 3R4SA 1ODNA 4F83A 2UYAA 5L73A 2Z69A 2JE9A 3KCCA 3VBOB 1SDDB 4A7ZA 1H8TA 3JBG1 1HB3A 3KSCA 3NV1A 5FJHA 1R083 4KMQA 2FZ1A 5ANNA 1YCIA 2WWJA 1OLME 2R071 1NUKA 2QJVA 3SMHA 1AJKA 1QJU1 2A70A 2ID4A 5FRAA 3WF1A 4AI0A 5FPXA 2D6OX 4AEDC 3H7JA 4OHXA 5FZEA 4XJUA 2XLGA 2DCJA 3FMGA 4Y33A 4AQTA 5B4NA 4IERA 3T4VA 3VZJA 3GZTB 2K46A 1HRV2 4LBNA 3AMHA 3I3MA 1GICA 2WJSA 4L2NA 3ZIXA 5FYIA 3ZN4A 4QX2A 3C7GA 3M70A 3WG1A 2BERA 5F9TA 2Y38A 1BVP1 2VNRA 5CADA 2PHTA 4XTPA 3GHMA 2BP6A 2ET1A 2PQSA 5C7GA 4XABA 4P9LA 1JW6A 1NCRA 1S2EA 1V9U1 4Q5OA 1VBA1 4ATFA 1OD5A 1RUJ1 2WZPP 1AYM3 1OF3A 3DECA 4YVWA 5IVFA 4R4XA 2PFWA 3SXWA 2YV8A 1E5HA 4BLJA 5APAA 4PIXA 3TYJA 1LOFC 3U10A 1JUIA 4Q4V3 2W39A 4RR3B 3KT7A 1C4RA 2ZEZA 4CDXB 1AR62 5TSWA 1RHI1 5JR7B 1REEA 4LEJA 3ZVXA 2OPWA 1GANA 3RZKA 4BOWA 3K2OA 2ZZJA 2XDVA 1R1ZA 1W90A 4R4ZA 3PUSA 4WVMA 2BNMA 3OY8B 2EICA 5CB7A 5BNNB 2I2SA 1VBD1 3U1XA 1ZRFA 5D1IA 2MHFA 1QXRA 1R091 4BQXA 5L19A 1DZRA 1ND3C 1SACA 2RMU2 3MW4A 3KLSA 3PDQA 3QD6A 1GV9A 3I2HA 5C4WB 3H8OA 3VBRC 4LBMA 3AKPA 3ZLIA 1DGLA 2YXSA 5EJ3A 3NKGA 1AR92 4IGPA 3LIGA 4J1WA 1ST8A 1H2NA 1MR5A 2TBVA 3K4AA 3KQRA 3LKJA 4HT1T 2Z79A 4AEDB 1YQ6A 3PU8A 4AE2A 5FO8B 1WW5A 3T0AA 2D6PA 2ADDA 4EQVA 1R64A 3HWJA 2PAKA 4MHRA 2BOJA 3JU9A 4EZHA 1PGSA 4Y4RA 1POQA 2XL9A 4FPGA 1LR5A 4BHPA 1ULPA 5J37A 4YVSA 2AACA 1ZRRA 2BFUS 1PMJX 3AP9A 3M3CA 3IDCB 2B7YA 2P17A 3OG2A 2YY1A 3ZXLA 5J09A 1NT0A 3K75B 3K4DA 4WVVA 5GLTA 3BPZA 3OBZA 1SLBA 1Q56A 1P8JA 4XUOA 2P6HA 1NOVA 4JRAA 3M2MA 4LA2A 4QXKA 1VMFA 2RV9A 3I59A 1BQPA 4R9CA 1D4VB 1XYPA 2K2SA 5IUQA 5IK7A 2ZGLA 4CCMA 4IDZA 3CIHA 3PNAA 1H30A 2ZTNA 1T6BX 4UW3A 3NJVA 5C3QA 1N3PA 4KGQA 3NNJA 1QQP3 1WLWA 2VMFA 4BXFA 2CV6A 1CJPA 3WT3A 4QX3A 4K21A 1W9FA 2DCYA 2VO5A 4H3WA 3VDDA 3VHPA 3T2QA 1XYOA 4QKBA 3Q9OA 4B1LA 4ITCA 3KVBA 4BPZA 3LD8A 1YNAA 5FPLA 2YHJA 5A7NA 3V0AA 2CL2A 2J1EA 4J6GA 2OS2A 4YARA 4QM8A 3K4ZA 4UOJA 4FP2A 3ACHA 1TVGA 3J8F1 1ND3B 2SBAA 3KMHA 4MH0E 1R082 4M3CA 2R30A 1NY72 3NNLA 5T5OA 3TEZA 5HBAA 3T1LA 4MYEA 3V65A 4MZUA 5I0TA 4AI8A 2VZRA 2QZ2A 4QQLA 4YM1A 3WF4A 1G9AA 4UBHA 4Y20A 5IWFA 2WDBA 2WLQA 4O7XA 4AVBA 3OPTA 4ASLA 4CEWA 1LGNA 4CP0A 1RUC3 4P02B 2Q4SA 3N4MA 4JKKA 1CAXB 2VZVA 1WCKA 3TNPB 4KBZA 1SBDA 4JCKA 2ZA9A 4N53A 1KJRA 2JKBA 3RZHA 2YROA 2MPFA 3ZN6A 1PO23 2JD9A 1UAIA 1STMA 5BYNA 5K8SA 3D0JA 4BWOA 3O1PA 4NIGA 3VKOA 2XBO3 2PXJA 2WA4A 4KU8A 1AXYA 1AYN3 2JD4A 4IV3C 2C9KA 2CGNA 1NE6A 2ZGMA 5HCBA 5LBFA 3H3LA 2BV4A 4GULA 4YM0A 1COV1 1V70A 2HWC1 4BA6A 1SFPA 3MIEA 3TEYA 3GBWA 1HIXA 2Q1ZB 3AKQA 3KB5A 2IFRA 4XOGA 2YU2A 1L7QA 1AYM2 1DYPA 4D7SA 2YU1A 4E4DX 4Q4V2 2Y33A 5A7SA 2IVJA 2VM9A 5FIXA 3TNQA 1JZ7A 4QGLA 1POV1 1UZZA 3R6SA 4PDWC 2ZJCA 1JOPA 1W8OA 3LSDA 3SHRA 4MG2A 3OGVA 2IVIB 4LHKA 3B94A 2ZGNA 4META 2PELA 2BBVA 1JN2P 1LGCA 1REFA
chains in the Genus database with same CATH topology
3VL9A 3IT8A 4BMEA 1JYIA 4YSFA 1W6MB 2DU0A 3SH4A 5L7OB 4XXPA 3LCPA 1OQ1A 3O14A 4FT8A 5E88A 3TRSB 3ZXFA 2WT1A 2XVLA 4XJZA 4ISRA 1RGSA 3FLPA 1MS4A 4R9DA 2DWRA 2WQZC 2AREA 4OHVA 3WP6A 2PLV1 2VULA 1RUF3 2GH2A 1DG6A 4V1PA 1UKGA 5LRRA 2NYYA 1SLIA 4W6WA 2Q8OA 4P9IA 4UW4A 4QQOA 3BU7A 1RMU3 3RMYA 1O4TA 1Q8OA 2P3IA 3RWNA 1PM7A 3ZN5A 4JAAA 4Q8LA 3WDXA 4OI1A 2Q30A 4GA9A 1S2KA 2D93A 3L2YA 2YGMA 3J26N 5I0SA 3FUOA 1R1A3 3WHTA 2Z42A 4M01A 3GYDA 2JG9A 3AZZA 3RDIA 1HQWA 1QQP2 4K6BA 4NOTA 2UY9A 1I5ZA 3WP3A 5CA6A 1RIRA 1YFYA 3WHUA 4KQ7A 5AC93 4QPYA 1EAH1 3AZXA 2ET7A 3S7EA 4PDWB 1DIWA 3JCIA 4E2SA 1GNHA 1C1LA 1Z7S3 2VH9A 3AK0A 1GZCA 3D4KA 3HBZA 4NHLA 4RQPC 4XFCA 4KG0A 4URTA 4HL0A 1BBT1 1K5MA 2XWBB 5DUXA 1Z0HA 1FT9A 2E9QA 5FDBA 3I7DA 3N3HA 4WM7A 3IDBB 3BALA 4RHV3 1TNRA 2X53S 4LA3A 5A3MA 1RUC2 3BOPA 4M0HA 1NCQC 2CNAA 4IEQA 2GNTA 5A33A 2WNUB 1PO22 1Q8VA 3GBGA 4Q0VA 3CLPA 4N90A 5EFUA 2XBO2 2IXJA 4MGKE 4LHLA 2VMHA 1AYN2 2WSVA 2VU9A 3MLLA 2VGDA 3ZXGA 3EHKA 4LLOA 1U5XA 1VBB1 4COVA 4EROA 2KA3A 4FQZA 1AF9A 1G9DA 1SQ4A 1RVF1 2GN3A 4Q4W3 5BNPA 4E27A 3B01A 4XF0A 1GQHA 2RS31 3PMEA 4Q1RA 2C0ZA 3PHMA 2Y0OA 1S1AA 1NZCA 4OI2A 2A7AA 2DVGA 3BOWA 4RQPB 1YYNA 3TN93 3JD71 4N43A 4YG6A 2VMGA 4CRQA 3UV9A 4XQWA 3RJRA 1LHWA 1CR7A 1WA4A 3ZFFC 1D2QA 2PHFA 2UWCA 4LBJA 4D69A 1ZRDA 3WDYA 2C5DA 1Q3EA 4LO6B 3VBSC 1QJX1 4AI3A 5LEKA 1RUF2 3M7AA 4A2UA 2O8QA 3FE5A 4W6XA 2ILMA 2OPKA 5BNOC 3EBRA 2Q0AA 4DOUA 1O4ZA 3ROUA 5KHKA 5JIUA 1RMU2 3WW2A 3CL1A 1W0PA 1I6XA 2HEWF 4DRVA 2I45A 4DZGA 4Y1XA 1O5UA 3MPPG 3USUA 2HWE3 5EXOA 1VAKA 1R1A2 4P14A 5KXDA 1VJ2A 2XKOA 1O3SA 2D6LX 3WVJA 4GWNA 1W6NB 4YYOA 3E97A 5AC92 4FPOB 4DPNA 5HCAA 1FI2A 4GMP1 1ZZ9A 1ULEA 5JPNB 1SLTA 2A6YA 3MDPA 2ZZQA 1Z7S2 4Y1UA 4JV4A 3ZX7A 2IXHA 1ALYA 5K9YA 2GZWA 1ZBE1 5CFCC 2YGLA 1AL21 4PBPA 3OJBA 4Y22B 5C8CC 2XVGA 4N7UA 3ZFFB 4CDUC 4B8EA 2ZMKA 3P3NA 4YGCA 4RHV2 4R9AA 4HSJA 1MZ6A 2MEV3 1QDCA 5KHJA 3MLKA 3VBSB 4HMZA 4XTMA 2RHPA 4SBVA 4FOVA 4TYSA 1MQTC 4UXAA 5BNOB 2BYVE 1WBLA 3PTYA 5JSPA 4YLZA 3WW4A 2ZBJA 1PIV1 3MW2A 1CAUB 2VPVA 4MLOA 1HKDA 1TE1B 2XPJA 4C90A 3R05A 1TMF1 1RB8G 2DUPA 1ND2A 4Q4Y1 5A32B 1W6PB 3ZFEB 1A3KA 3AYEA 3RG0A 1NXMA 1W6OA 2Y26A 3POYA 2V73A 4LTAA 4COUA 2PTMA 4Q4W2 3KT1A 2NQYA 4HPKA 2HYKA 3IM0A 3WG2A 4MSVA 1HXS1 2X8KA 1GNZA 1LHVA 1KD7A 1U12A 2DFBA 5ABJC 5F1RA 2N7GA 4QPGB 2HWD1 4MV2A 2HKXA 5DUWA 3O0VA 3TN92 3RYPA 1ASJ3 2FHRA 1LENA 2VVDA 2AZ5A 1BEV3 2GMPA 2ZCWA 4PQ9A 4XMIA 5CFCB 2P34A 5DZGA 2WT0A 1TQ5A 1YI7A 3VLBB 4M0NA 2AUYA 5C8CB 4Q27A 2WZR3 4CDUB 3OBRA 2WA3A 1WW6A 4FBFA 1MS9A 4YM3A 3HT2A 2CWMA 3JQWA 1MQTB 1XNDA 5AFBA 1ZBA1 5JZGA 1RUG1 4FTEA 3C3VA 1JHNA 5KWRA 1A6CA 1SFNA 3HIFA 1IOAA 2PHLA 4QGNA 3VHNA 3HMYA 1NE4A 1X36A 2HWE2 1T6GC 4K9SA 5EWSA 4ORFA 4CDQC 4RA0A 4WM8C 1DFQA 1H0BA 3K51A 4PBOA 3FFQA 3N7KA 1FOD3 3MPBA 5E89A 3WX5A 4HFSA 4EN6B 5KXCA 5CFDA 5ABJB 4H14A 1VBE2 4JGZA 2DVAA 4WV8A 2VY0A 3AMQA 3LOBA 4IQPA 4UW5A 4QMAA 1HV1A 4YFZA 3M4FA 5I0RA 1UF2C 1SDWA 1PNFA 2W08A 2BGCA 4FXKB 3TWIA 4S2FA 1G86A 2VOVA 3E6DA 5GLZA 1GYKA 2D5FA 2VECA 2B45X 1RUE3 3ZIWA 4OI0A 2MEV2 1RITA 4LNVA 3AYCA 2WFF1 3OYWA 2AR6A 3EQEA 2WNEA 3INAA 2A3YA 2BVBA 3U11A 3T1MA 4KWJA 4XHBA 3H9AA 1C5IA 4MGYE 2JG8C 4CYDA 5GKAC 4XFGA 3N7LA 4CEYC 2ZMNA 1FXZA 3D0SA 3ZSLA 2YC0A 2RS51 2XG3A 1FMD3 1UCXA 2XGXA 1KJLA 1G8WA 4I0WB 2Z5WA 4I2OA 2QNKA 1MZEA 4JGYA 3VBHA 4K7JA 4C91A 4LBOA 1QDOA 4WM8B 4XZPA 1EV13 3ZFGB 4QPIB 5IK4A 1MACA 3I8TA 1RJ7A 3UJOA 1KRIA 3ZXJA 4AGGA 4K8FA 1PZ8A 2R16A 2RM21 5D8AC 1FPN3 2WS93 1QNWA 2H0VA 2PYTA 4XYXA 1AXZA 5C9AA 2A6XA 2WNVA 4I09A 5BNNA 3CJIC 4IEPA 2DCZA 4YRDA 4YNIA 4ZXKA 1Q8QA 1XQNA 1ASJ2 3VBUC 1KXGA 1LULA 4B4PA 1BEV2 3MIDA 2P37A 4CZSA 4YW4A 3FC0A 2R32A 1VB4A 4B3NA 4X8NA 2HWF3 3WLUA 4LE3A 4AEMA 3OCPA 2WZR2 4E4ZA 3V56A 4OZXA 1ENSA 3PVBB 3V64A 1CAVB 4CDXC 1PK6B 4PLOA 1DGWX 1LEDA 2NPIA 4AWDA 4JRLA 4DINB 2B5HA 4Q0QA 1AR83 1SBFA 1G9CA 2WINB 4R8HA 4EN8B 3ZYIB 2Y0IA 1ZZBA 2JG8B 2ZGPA 1LU2A 3OGJA 2NM1A 2NMNA 2AYHA 1Q5OA 3ES4A 4CEYB 2ZGKA 3DPRB 5C4WC 4AEKA 2P3KA 5FOBB 5JMCA 1IS3A 1M4WA 3LB9A 2CY6A 2ZHLA 4KL1A 3WG3A 1LKNA 1AR73 2BVVA 1VAVA 2EIGA 5JIAA 3RNSA 1IZ3A 2VUAA 3RSJA 4MGZE 4LBQB 1NLSA 5BNQA 4PIZA 1LOFA 5EYXA 1FOD2 3WV6A 4NHMA 4FP3A 1UX6A 1RUD1 2ATFA 3NAPC 1O5LA 3WUCA 4NWVA 5D8AB 4J1XA 3CU7A 1VP6A 4FXGB 3CJIB 4IEUA 2GN7A 4Q2FA 4B7EA 2CGPA 4YZ1A 1DQ6A 4Y26A 2RR11 3B7MA 1OQDA 1X8EA 2QVSB 3VBUB 4LHNA 4FTSA 2FMYA 3VHOA 1L3JA 3VBRA 3M3IA 4AG4A 1S0JA 1QXPA 2D6KA 1MS1A 4RS5C 1RUE2 2HWB3 2EF6A 1X8MA 3MFCA 3NKTA 3PMSA 5GZGA 5FQ0A 5C33A 4LBQD 2BQPA 4XFBA 2VW0A 2ZGTA 4QHBA 4KGGA 3M3QA 3DV8A 2PAEA 5JWPA 4F8AA 4XF3A 5DG1A 1S0EA 1S55A 1D0HA 2A6WA 2VQAA 5JOYA 1ZZ7A 4LO4B 5E1RA 3VKMA 1IS4A 2JE7A 5JDBA 1UW8A 1UIKA 2YYOA 1FMD2 1VBC3 3AFKA 2ES3A 3VBFB 1C57A 4NPRA 2OUHA 4SLIA 1EV12 3LOIA 3H3UA 4Q29A 2A3XA 3V0BB 3GALA 5JAXA 1FPN2 2WS92 3NAPB 4I01A 2ZOEB 2VNOA 3ILRA 2R061 1C8M1 3NSTA 3LWCA 4H7LA 4MX3A 2UURA 5GALA 1EY2A 4MVTA 1A8DA 1WGPA 1C3HA 4MUVA 4LO5B 1PGL1 4Z92B 2HWF2 4CTEA 3AB0A 4RS5B 3ALQA 3WXPA 2GSYA 1W6QB 1GZ9A 3PVEA 5FPZA 1MEC1 2DF7A 3FFZA 2AENA 2CAUA 2VVFA 1RUI3 1VIWB 1LOCA 5AFEA 1H8TB 1AR82 1KS5A 4FOQA 3M1HA 2R49A 1CD3G 4JDNA 5I91A 1IPJA 1JBCA 1VRH1 1TME1 3URFA 3FHIB 3HD8B 3WDVA 1DQ5A 1ENQA 1S2BA 3E5QA 4AVTA 2DV9A 4IV3A 2F4PA 1PZ9A 2R043 5L7OC 1BKZA 4BYYA 1LOEA 4E4SA 1AR72 2X5IC 4P9JA 4C0BA 3IBMA 1V6KA 1OPMA 4GB31 1AX0A 3KM5A 1MVQA 1Q8PA 2UU8A 4QU2A 4YVSC 3IPVA 5DDJ3 1BZWA 4TWTA 1QJY3 2RS13 4XF4A 1AHSA 3PJYA 3OBTA 3D82A 1NCRB 2D3PA 4HZFA 1OFSA 4XETA 5A3LA 4U2AA 2GAUA 2IWGB 1N1VA 2R0HA 1RUH1 3JBG3 1YIPA 2R0FA 4B29A 3EXUA 3P3PA 1CQ9A 1YHFA 2QDNA 2R073 3H3ZA 1WMDA 2GNDA 4XJ9A 1QJU3 4Q0UA 3VZOA 2PHXA 3I54A 2HWB2 2GU9A 1REDA 1RL3A 4MXWA 3TOJA 5FREA 1QU0A 3BTAA 3ZDSA 2GC1A 1FX5A 2A73B 1PO11 3SH3A 4O9EA 4HBNA 2D43A 3RYKA 5GLWA 4Q8KA 3LSEA 5ACA1 4YZ2A 1V6JA 1SLCA 1BMV2 1GLHA 4A7KA 5FOJB 3MF6A 1EP0A 5JOWA 2ZMLA 4D3WA 1VBC2 1V9U3 1XYNA 1VBA3 2PHRA 4B4QA 4I0AA 2JICA 3IKWA 2OA2A 2X5IB 5C6CA 1RUJ3 4CP2A 1WW7A 2EXHA 1ZNPA 1PVC1 1APNA 1I3HA 1D4M1 1WD4A 1H1IA 3FBYA 4ONUA 3ELNA 4YVSB 2OZJA 4NN0A 3LZZA 1RHI3 2ZHNA 1FV2A 2WNUC 4L97A 4HLTA 1ZRCA 4HVRA 2D6MA 3C2UA 3POSA 1GZWA 3I59B 2WKKA 5FMOS 1VBD3 2YMZA 2QFEA 3LAGA 1BVVA 1R093 3OD4A 1HQNA 1M06G 3MZHA 3BB6A 4AHXA 3ENRA 2DVBA 4GKXA 3H8UA 5F6LB 3VDDB 1YI9A 3AXDA 4XBQA 4KBBA 4XQ4A 4HKLA 3NVCA 3EJKA 3V0AB 4YZ4A 1X82A 1DGRN 3E5UA 1RUI2 1NCQA 3DUIA 3IWZA 4BZ4A 4NO4A 4OVEA 4XFHA 2R1BA 3ZSJA 5I8YA 1I9RA 2OUJA 1H2KA 4QQPA 3S30A 3B02A 1J3PA 3MGUA 2R042 4CEWB 5IT6A 2XJRA 1LECA 4Q4X1 5KHIA 3CJXA 5T5JA 3AZYA 4P5HA 4XFIA 4PF5A 5CIRA 3ZN6B 1WLTA 1KDKA 2RJKA 3LA7A 5FLIA 1E57A 3PVNA 5DDJ2 4OLLA 3WD5A 2D44A 5FO9B 4XFFA 1QJY2 2RS12 4AI1A 4AFAA 4HN0A 5CNAA 4Z8BA 3WP5A 2IXLA 1LCLA 1CX4A 2XJQA 2NMOA 1DDLA 4QD2A 2ARBA 1URXA 2ZAAA 1HRI1 5DZFA 3H7YA 2A3WA 3J8F3 3JBG2 2VW1A 4I02A 3ES1A 3ZXAC 4AFMA 2R072 2P2KA 4GWMA 4Y22A 4GXLA 4COZA 1C1FA 1QJU2 2WL1A 4KNCA 4AVSA 1PGW1 1S0GA 1LRHA 2E7AA 4EN0A 3WCSA 3QLQA 2EVXA 3MF9A 1VALA 1O91A 4XF1A 1NA1C 4RFT0 1K5MC 2VMIA 5BNOA 4EN9B 4L99A 2XWJB 3AMNA 4XBLA 1BCXA 3AKSA 1O3RA 3ME2A 5CVRA 2GNBA 4PLNA 1ZVFA 1GSLA 4WM7C 4BMBA 2QKDA 3G6JB 4BE3A 4AW7A 4XILA 1B35C 1Y7BA 1DZQA 1N1YA 4NHKA 4YZ5A 2PHDA 1COV3 2HWC3 3HT1A 3UK9A 1V9U2 5LK5A 1ENXA 1VBA2 4OHZA 4X6RB 3S7IA 1RUJ2 2Q5TA 2B9UA 1W6PA 3NWKA 4N9IA 4O9GA 4L11A 4Y5Z0 2GC3A 1KITA 1UIJA 4C1XA 4QM9A 2JX9A 1U5YA 3W59A 2UWAA 4ES8A 1RHI2 3ZSEA 3ZYGA 1WUVA 2GH8A 4IETA 5E16A 1POV3 1RJ8A 1YRZA 3DN7A 4OUSA 4QQ2A 4U36A 1NYWA 2FBEA 1LHUA 3DF0A 1VBD2 1POV0 1R092 4XIOA 1V6LA 3PLQA 3RI9A 1UPIA 2JG9B 1OMIA 4DY5A 2QUOA 1AXKA 1EPWA 3UJQA 5DUVA 1HRV1 3ZFEC 3WNXA 5C8CA 1Q43A 1SFYA 2D3SA 4XHXA 4HSLA 4M3CE 1XNKA 4D7TA 3VN4A 2GC0A 2JDZA 2NLRA 2PLV3