3LGRA

Xylanase ii from trichoderma reesei cocrystallized with tris-dipicolinate europium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title A dipicolinate lanthanide complex for solving protein structures using anomalous diffraction.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 54
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lgrA00
1ENXA 1REEA 4HKLA 4NPRA 2BWCA 2DCYA 3B5LB 2VULA 4XPVA 4H7MA 2B42B 3AKTA 3AMPA 3VL8A 2D97A 1XXNA 3ZSEA 1QH6A 1XNCA 3WT3A 1OA3A 1KS5A 2BW8A 2NQYA 4S2FA 3RI8A 4HKOA 1NLRA 2F6BA 1BCXA 1H4HA 1IGOA 1XNKA 3VHPA 3VZNA 3MF9A 2DFBA 1AXKA 4S2DA 3EXUA 3HD8B 1HV1A 3AMNA 3LB9A 3MFCA 2D98A 2QZ2A 3AMHA 1HIXA 3VZOA 3VHOA 1QH7A 2Z79A 2VGDA 3WQ1A 3WXPA 1REDA 1T6GC 3AKQA 1C5HA 2DCJA 3WP5A 3VGIA 3LGRA 2NLRA 3MF6A 2VG9A 1REFA 4IXLA 2JICA 3RI9A 3WQ0A 2B46X 1UU4A 4XQWA 5EJ3A 3WY6A 1XNDA 3VZLA 3WP4A 4XQDA 1H1AA 3VL9A 4S2GA 1H4GA 3AKPA 3AMQA 1W2UA 1OA4A 1BK1A 4S2HA 3MFAA 1XNBA 2JENA 3VZKA 1UU5A 3VHNA 3AMMA 3VZJA 2BVVA 3AKRA 3M4FA 3WR0A 1H0BA 5K7PA 3WX5A 3WP6A 1H8VA 1XYPA 1HV0A 2B45X 2QZ3A 1BVVA 2VUJA 2C1FA 4HK8A 2JEMA 2DFCA 2DCZA 1F5JA 4HK9A 1TE1B 3B7MA 5K9YA 1M4WA 3O7OA 3WP3A 2DCKA 1OA2A 4XQ4A 3VLBB 1OLQA 1XYOA 5HXVA 1C5IA 4HKWA 1UKRA 1PVXA 1XYNA 2BWAA 3VZMA 1OLRA 1UU6A 1KS4A 3WQ7A 3AKSA 1YNAA
chains in the Genus database with same CATH superfamily
2E53A 3RZLA 1AR82 4NPRA 1SACA 4XFHA 1Q8VA 1WLTA 1UL9A 3BVCA 1SPPB 3HR9A 4H7MA 1NZCA 2RMU2 1SDWA 5A3OA 3CMGA 4CUGA 1XXNA 2IC1A 1RXGA 1AR92 1D0HA 4BLJA 1VBA3 2KA3A 1XNCA 1UWWA 2QQVA 1VBC2 3QBQA 4LIUA 3UYJA 4CP9A 4D69A 4JRLA 1ZZBA 4LTAA 4GWNA 1K12A 3BTZA 2ETEA 2K0GA 4LBMA 1H9WA 3GJAA 1O4TA 3E5XA 1Y3TA 2HWC2 4BDVB 2CY6A 4XE9A 5C3PA 1GKBA 2OQ6A 4AG4A 1BMV2 1LTEA 3A21A 1LHVA 1XSRA 4C90A 4XETA 4B1MA 3NQHA 3ATGA 3H8UA 3GBFA 1OI6A 3AMNA 5LRSA 4Q4X3 3U11A 2VU9A 4XUPA 2QTWB 1MZFA 3KF5A 4GKXA 1DZTA 1HB1A 4XHBA 1SCSA 3S30A 4NRQA 1SLLA 1B09A 2ZGPA 1XU2A 3K46A 5FXZA 4CPBA 1O3SA 5FUIA 4Y1YA 1N1YA 5F3GA 5FY9A 3SKVA 4DOUA 4N53A 4R9AA 4YARA 2HYXA 3T2QA 3KT4A 1T6GC 1OSGA 4CEYB 5DAWA 5L19A 3WF0A 3OOXA 4FOYA 4HZFA 5IAVA 1OXCA 2P1BA 2UWAA 1W6PA 1X8EA 1RUE3 5FWEA 3W5MA 3ZFEC 2D6OX 1MS8A 3O1SA 1FXZA 1W0NA 1CZVA 2V5DA 3OF1A 3RJRA 2A71A 4KWLA 1QOSA 4P9LA 4TLFA 3B3QE 4WM7A 3N36A 3D3AA 3MIBA 3PURA 3ZN5A 2WIIB 5K0UC 5HCFA 4YRDA 4QGMA 4WM7C 2UURA 3AJYA 4LO4B 3SC7X 5H9QA 3EQEA 4CP0A 1Q3EA 5DAPA 1YCIA 4OFGA 3M70A 5FKCA 1GBGA 4JHTA 3POEA 4LBQD 1YYNA 1ZA4A 3OBTA 2BVVA 4I3PA 3AP5A 3O1TA 4ZXEA 3D4KA 2A70A 2TBVA 4Y1XA 2WC2A 4ES8A 2PHRA 2JG9A 2W1UA 3GDBA 4OLLA 3M3QA 3WX5A 4IV1B 4A6OA 1GQPA 2WWUA 1BEV3 2B45X 2ORZA 4CUCA 5FQ0B 3BODA 4CE8A 1S0JA 2BBAA 3LEGA 2J22A 5AVAA 5B4XA 3OEAA 2Y6FA 1EY2A 1ND2A 1UY4A 3H8OA 1M4WA 4XFGA 4UXAA 5LA9A 4HT1T 1OA2A 3N9MA 5DPNA 3ZN6B 3J4UH 1AXYA 2ZEWA 1HJGA 4XZUG 1R092 3C7HA 1ND2C 3AL6A 2D5HA 5LBBA 3NO8A 4D8MA 2RS33 1PVXA 4Q4V2 4LO8A 3RYPA 3PHMA 3S7EA 4HSLA 2QQKA 3ZIXA 1O3QA 1O3TA 4KU8A 1QJU1 1UU6A 1V6OA 1POQA 3VKOA 1WLWA 1YI9A 3N3HA 1HDKA 3B93A 4CCDA 2ZX2A 3BTYA 2JIJA 3RRDA 5IAXA 4TWTA 4RL7A 4J1XA 1ENSA 1S0IA 1PK6C 1VBB2 4IEQA 1Q8PA 2DV9A 1IOAA 4IV3B 4LNVA 2G9GA 3N9NA 4QKDA 3WDYA 3ZO0B 4Z2AA 3VDDB 5FOBB 2DF7A 1VBD1 4CSWA 1LRHA 4FPEA 4GALA 4Q2FA 3SKJE 1LHOA 4E4ZA 2RJKA 3EJKA 3VBSA 4YW1A 1S0DA 4E2GA 5FZ3A 1ZBE2 2MEV1 4QMAA 3IZOA 5ABJA 2VZVA 1ZZ9A 1H4HA 4PF5A 4FFHA 4AVSA 2UWCA 3H8RA 1RUH1 2AEZA 1K5MB 2VM9A 3VBSC 4CU9A 3R0RA 4XF4A 5IVVA 4OHYA 2V5YA 5ABJC 4ZS3A 1DHKB 4R52A 4COWA 2BRTA 1LENA 4XUQA 3S0MA 3V0AB 1CAXA 2VZOA 1SBEA 1XNAA 3KGLA 1D7PM 4EN9B 2LTNA 2XUEA 3OJBA 4XBQA 4QWNA 5FZEA 3ILFA 4CCLA 3AZZA 1Q43A 3SEPA 3ASIA 4BPZA 3VBUA 2DVFA 1SHWB 2HYKA 3FMGA 4IW3A 4JX0A 4KWKA 4WVZA 3LZZA 4XJ9A 4YVWB 3JD71 4FQZA 5LW9A 1TMF3 2QCSB 3ACIA 4KL1A 5I8YA 2OYZA 1FX5A 3OGJA 3VBUC 4L97A 2WQ8A 2HH9A 5A3NA 1HB3A 3ZYBA 1LHUA 5K8SA 4PIZA 1CONA 3E6DA 3PJQA 4Y5SA 4I0AA 4AR2A 1NAEA 1JU3A 3PIGA 2EXKA 4Y1ZA 1NLSA 1JW6A 5IFTA 3WY6A 4MGKE 2WO3A 3R4UA 3SISA 1JZ2A 1SLTA 2VMIA 4ARYA 4YG6A 1MEC1 3AYEA 1G8WA 5C7GA 3VL9A 3OPTA 4PQQA 2Z2SB 4DEVA 4YM2A 3TEWA 3ZXDA 1GOFA 3DYPA 3N7MA 2RM21 5GLVA 5A32B 4LO6B 2WNOA 1GNZA 3NSTA 3RVHA 5A70A 1OPMA 4IE6A 2DCTA 1UMZA 4QXBA 1URXA 2JG8C 2GNTA 2VZRA 1QF3A 4URTA 3WV6A 1KEXA 2QQLA 1PX4A 2WNVB 4YNIA 2RS52 4KH9A 1N3PA 2GALA 4EYUA 4RD7A 1LEMA 3FX3A 1DLCA 4YYOA 3TN93 1UOBA 2W0XA 3KS7A 4KBZA 4QX0A 5K7PA 3SEEA 4LK6A 4A45A 1OURA 3RZMA 2R063 3I7DA 3LD8A 1RTVA 2Q1ZB 4XIOA 5KR7A 1COV2 1Y43B 2ERFA 3OGGA 1O8SA 1CWPA 5IVFA 4P9JA 1OVSA 3ALQA 5EJZB 2RS12 1Z7S1 3GJBA 1YLLA 1V70A 4GMP3 2PHFA 1H8TA 2R073 4I01A 2VBDA 4KG8A 4NHKA 5FZ4A 1AYM1 1ULDA 2VZTA 3ZXLA 4HVQA 1A34A 3AB0A 5HXVA 1QJU2 1H8TC 2Y0IA 2XLGA 5FYIA 5HPOA 1AUYA 1YXWA 1LU1A 3ZFGC 5HCHA 5JXIA 4GJZA 4AQSA 1KQRA 5LA1A 3NJZA 4K21A 1UYXA 4C0BA 3IIIA 4XJUA 4AF9A 4HVRA 4AFMA 2WSVA 5ACA2 3VKFC 2VTXA 4RFRB 2ZHNA 1VBD2 2W1QA 5I91A 2VULA 1CX4A 3HN3A 2CTVA 3N35A 5D1IA 4A6SA 4BLIA 3AK0A 5KXEA 3ES1A 1OA3A 3GALA 4M3CA 4YZ3A 1GNYA 3Q8BA 5A3LA 4EN8B 2PHXA 4HBNA 3TRSB 1EAH3 1V6JA 5F3EA 3VDCA 4EWDA 1FNYA 1JZ8A 2YYOA 1YFUA 3ZYPA 3HAGA 3OY8A 3AXEA 4QXCA 1L7QA 4XF3A 3SCGA 3HQXA 1JYXA 1RUF1 1SMVA 4L8QA 4S2DA 3FL7A 2JD9A 3I3BA 4BB3A 1FT9A 1XSQA 2O14A 5ANQA 1YWKA 3SH5A 2GMMA 4IEPA 2WZR1 4GB33 3B69A 4MGTA 4GD4A 4NRPA 1DBNA 4AFDA 4CDXB 1EUTA 1O5UA 1AZDA 1TQ5A 2Z79A 5SV8A 2WZPP 1WKYA 2WFPA 2XXZA 5GZFA 5C8WA 1MS1A 3U0ZA 5FZDA 1CIWA 5IW0A 3NNFA 3T4HB 3FE5A 2WT1A 4JCKA 3A0KA 5FK7A 2QDRA 5JXGA 4JZRA 1JYNA 4PQ9A 1ND3C 5DUVA 1DGRN 3WDXA 2D6LX 3VBOA 2A6WA 4R9CA 5L9BA 4QX3A 3T08A 3LOIA 1AR73 2P3YA 4QQHA 4NIHA 2GN7A 3VBOC 1NE4A 4NAMA 1IZ3A 1NZIA 1ASJ3 1YJKA 1JZ6A 1XC6A 3AXDA 2VXJA 4FPJA 1AR63 2C24A 3BYWA 4M0NA 3VN4A 4OI0A 5FPAA 4UYBA 3VHNA 2AZ5A 2DURA 2ZEZA 4QQPA 3BTAA 2AACA 4G9SB 5T52A 3BIEA 1C8NA 1WA4A 2YV8A 2XVGA 2YZ4A 3ZFEB 4NHYA 2E31A 2G9ZA 2MHFA 2QFEA 2YG0A 4QM8A 1SDDB 3ACLA 4FVVA 4M3CE 1APNA 5EYXA 2EIBA 2W87A 5BUVA 3U1XA 2V4VA 3PL0A 2VH9A 3NAPA 4B29A 3BU7A 2YB7A 2VNRA 1U5IA 5FPBA 5K0UB 5DN2A 3GBGA 4WM7B 4OMDA 5BNNC 5F32A 4Q4Y3 2W39A 5FYUA 3NAPC 5DDJ2 5E89A 3WNXA 3NKGA 1GZWA 1VBA1 5L73A 1W04A 2HWB2 3JZVA 5D8AC 2Q8OA 1QQP2 2JDNA 1TVGA 2PHDA 1KRIA 4B4QA 4BQ4A 4XFFA 2W1SA 4ARXA 3D0SA 2QJVA 3RMYA 5FMOL 1WD4A 3GNEA 2ZOEB 3ZPOA 1BJQA 3X29B 1J1TA 2O8OA 2V72A 2WJSA 3WP4A 2XJVA 3DGTA 5B4NA 2WT0A 3HNMA 3FC0A 5JDBA 3GZTB 4ZZ5A 2PQSA 4L2NA 4KWUA 3RFRA 5C6CA 1U5YA 2RDRA 3UGFA 4ZXKA 2XPJA 1HQWA 4RGKA 1OQDA 2CWMA 4A7YA 5FLHA 1MACA 2W47A 1S2KA 3DV8A 3VL8A 2BV4A 2YGLA 4FPFA 3PVEA 4IESA 2GNMA 2JECA 2VBPA 3CHXA 4P9XA 4YG3A 5FYTA 1XNKA 3VHPA 5FBZA 5J96B 1UY1A 1RUE1 3MPPG 3MHZA 3O1RA 1UZ0A 3J9SA 4SBVA 4XHXA 3OPZA 3OCPA 1PK6B 2Y6LA 5FIXA 2VECA 1FOD3 1EPWA 1AF9A 5HV0A 3V0BB 2ZGRA 1JBCA 3ORJA 5F9TA 3KM5A 4JDMA 4M4PA 1E5HA 1PMJX 4JTNA 5A3WA 1QH7A 1R64A 4AW7A 5EJ1B 2E63A 4E27A 4HSJA 3OD4A 4LBJA 1REDA 5I0SA 1ZZ8A 2PXJA 2I74A 4BA6A 2D6PA 2DUQA 3VBSB 4NOTA 2WN3A 2WFF1 2DUOA 2JDKA 5JPMB 2Z69A 3J8F2 5ABJB 4IQPA 1OKQA 1HXS1 3JBG1 5LK5A 1Y4WA 1TZOA 4P9GA 1BEV1 3WOGA 2WBKA 3WNPA 1A3KA 1MZ6A 2JB4A 3I59A 4AGVA 2WLPA 1UXXX 3AZXA 4I3GA 3SXWA 4DINB 4CRQA 4OZXA 2WL1A 3NKTA 3QD6A 3PVOA 2FDFA 2VMHA 5IK7A 2X10A 5FXVA 5C4WB 4COVA 5I93A 2ARAA 1OA4A 1BK1A 4MHRA 4NR1A 3ZMNA 1IPJA 2DUPA 2Y6GA 3QH7A 2DVAA 4RHV2 2JENA 2JE7A 5DZFA 5FV3A 5LK7B 1X9TA 2HWF3 4PF1A 2RS31 2WAAA 2IXIA 4QB6A 1LJ7A 3THDA 1OQEA 5FZFA 1RMU1 1MVEA 4NVPA 4Q1PA 3VBUB 1R082 4Q1RA 4XCBA 1N3OA 3DEMA 4LQRA 2WQZC 4M0HA 3ZDVA 2JDUA 5FFOC 2GNBA 1NLQA 4GWIA 3V64A 3KHCA 4HK8A 1ZBA2 1VRH3 3TOJA 2C6SA 1VMJA 1Q5OA 2PA7A 2HWD3 3AZWA 4MX3A 4O7XA 2XJSA 4PBPA 4NIIA 4CTEA 2I45A 4OUSA 1G9AA 2ZACA 2BDRA 4Y4YA 5GZDA 3W9AA 1QOTA 5C70A 3ZN4A 3NNLA 4COUA 3SQOA 4Z2WA 1ZYBA 2JG8B 3ZMOA 4BK5A 1XYOA 2ET7A 3GBWA 2XR4A 5FP8A 3T09A 1YFXA 5HXMA 5JUVA 4GQ7A 2D6NA 2BWAA 5JOXA 1T6BX 2JIGA 4NIAA 2BU9A 2VC9A 4XABA 3HMYA 3K77A 1YC61 1LECA 2W91A 5T5PA 1PO22 3ZXEA 2ARBA 3O1VA 3LA7A 2BWCA 4MLOA 3H1WA 3ZKYA 5A7PA 5FYCA 1PM7A 4MO3M 3VDDA 1AL22 3AKTA 4JKMA 1LR5A 4DXTA 1VBE1 3APBA 3C8XA 2VPVA 3KV5A 4QX5A 4QKNA 4WV8A 4JAAA 4DQAA 2X53S 5FYSA 4E4DX 2VZQA 3VDDC 1H8TB 3WNNA 3P1IA 4S2FA 1BLZA 1C1LA 3HT2A 2VVDA 4YWAA 1WUVA 1RITA 3H1MA 4LBQB 2ZX3A 4UW3A 3ZFGB 3ZR5A 1Z78A 3NJVA 1TMF1 4NJ4A 3TEZA 3POYA 2H6CA 1DDLA 4JKLA 3WEZA 4Q4W3 3C7EA 4A7ZA 1G9BA 3VBFC 4ISRA 1SG3A 4QXKA 2VQ0A 4N90A 3T0BA 4AE2A 2ZHLA 3QCWA 2VQAA 3V0AA 1GWLA 1YI7A 3FUQA 1PIV2 5FZ7A 4MG2A 5IVEA 5FRAA 5J1XA 2BOIA 4LLFA 4U36A 4XUTA 2VGDA 4URAA 5I0RA 1QJZA 1J3RA 4Y1VA 5C9AB 2WFF2 2E26A 2VCMA 3BKZA 1UXZA 3AKQA 2EXHA 1EP0A 5EZWA 2ADEA 4LBLA 3HT1A 2UYAA 4XCAA 1HXS2 1RUI2 5FMOS 2D6KA 3JBG2 2X8KA 3VKMA 3FN9A 2G1MA 3TN91 3RWKX 1F15A 1W8UA 1WMDA 4OZOA 4IXLA 3HIFA 1BBT1 4LMFA 2R061 1HN0A 3SMHA 1VAMA 2ATFA 1JH5A 3KB5A 3ZXJA 1XNDA 4YFZA 1KFUL 4J25A 4D3WA 2W1WA 1Q8OA 1J3PA 2Q0AA 2WQ4A 2R071 4YLZA 3J7NA 3GZUC 4RA0A 5EFUA 3WVJA 4ZZ8A 3AKPA 3ZYIB 5LZ6A 1W2UA 2GMPA 1RIRA 4S2HA 2QQIA 5LWBA 2WNVA 2QKDA 3KCXA 1Q8SA 5FZ8A 2ZGUA 3LAGA 1FMD3 3EB7A 4W50A 3ENRA 4YW4A 1W8NA 3NV1A 1RUC2 3WW1A 3A7QA 3RZKA 1G9FA 2XL7A 1ND3B 5IWFA 3WR0A 2WNVC 1G7YA 1UIKA 2H0VA 5A1AA 1QKQA 5A1FA 5DUUA 5F3IA 2XJRA 4F3JA 4Q8LA 2XWBB 5CKNA 2B7YA 2ZZJA 2VUJA 4RFT0 2BQPA 4XF0A 5FO7B 2QQOA 1TME1 1KFXL 4DRVA 5FMDA 5HI0A 5FBJA 1PVC2 2DFCA 1NOVA 3VBOB 4DXSA 4O65A 1NG0A 2RR12 5GLZA 4AL9A 4XJZA 4LIVA 1PM4A 2Q30A 1JHNA 4XQ4A 4IDZA 3JQXA 4BH9A 1JZ3A 1ONAA 1FNZA 4C8DA 2TNFA 2W2IA 3DCQA 1S55A 1HB2A 5FY8A 1EAH1 2NMOA 3LPGA 1RL3A 1RVF1 1UKRA 5DZGA 5CNAA 2OUJA 4AEJA 3K4AA 1RYYA 2A73B 4O9GA 4H55A 3VKLA 5IK8A 1NYWA 5KXDA 3VDAA 5E88A 2Q5TA 3NV2A 1NUKA 5EWSA 3EYPA 3B9IA 1JZ7A 5FZ6A 2PLV3 2ZABA 2P3IA 5CFCA 4DUWA 4XEZA 5EHDA 5BXXA 3SITA 4AVAA 2EAKA 5GZCA 1VBE2 1XE7A 4OHZA 1PO11 1RUG1 5BNNB 3U4SA 5CFCC 5JMCA 3EO6A 1DCSA 4GB31 2IXLA 5BY5A 3NAPB 5GKAC 2VMGA 1AL0G 1GICA 1VAKA 3BCWA 4KBBA 4KU7A 1YQ8A 5D8AB 2PAEA 5A3PA 1QH6A 2SBAA 1D4M3 4AVCA 2VVEA 1OD3A 1CD3G 4XAAA 2XMLA 5KHIA 4H7LA 1GZWB 3HNYM 3IDCB 2VUDA 1X36A 5GLWA 4OVEA 2QQWA 2FDHA 3FFQA 5IATA 4KI5M 4M4RA 4Z92B 1ODMA 1UY0A 3V65A 1UOFA 1Y7BA 1RUD2 4ZY9A 4LKEA 3MIFA 4OI4A 1F2NA 4LO5B 3I3DA 2XJPA 3U07A 1RUOA 3IAQA 3POBA 5DAVA 3TNQA 1O91A 2XBO3 2FCTA 1AR71 4DB5A 2D98A 2DVDA 4CDXA 4GA9A 3RPQA 1W99A 1NQJA 1WZXA 3C7FA 2DYCA 4MHUA 1PNFA 1ASJ1 1NA1A 3HOBA 3I2OA 1AR61 1KDKA 4CDXC 1C8M1 5FZ0A 2JDHA 1QJY3 1W6MB 1PGSA 5ANNA 5FUPA 5T3NA 4CU6A 5LA2A 5FAXA 2YC4A 4QQLA 5I0TA 2VOXA 3FBYA 5M0TA 2YPJA 2Y60A 1NA1C 1WD3A 1BBT2 4MADA 2RDQA 3VBRA 3N9OA 3MDPA 2HEWF 1W2TA 2TUNA 4K8RB 4BHPA 4D6QA 4XMIA 5DQ0A 2B46X 2WDBA 3USUB 1P8JA 2C9AA 2KM2A 2WS93 3KHBA 3VBRC 2QQPA 3M3OA 4E2SA 1JYIA 1UZVA 3VZLA 4ASLA 4JV4A 4XQDA 2ZX4A 1RGSA 1VR3A 2UY8A 4FOWA 2VZPA 3MO4A 3ZR6A 4Q4Y1 3DECA 5JOZA 3KZ4C 4TXWA 4JVAA 1J84A 2R49A 4LKFA 1O59A 1FPN3 4FPYA 4Y5TA 1WWYA 4IE5A 3LSDA 3H50A 4CCOA 1MS4A 5CEHA 3ZFEA 4AI3A 1LAJA 1JYVA 3PTYA 1RHI3 3ZOIA 4H14A 2ZGLA 1RJ7A 1PZ8A 3KQRA 3HEIA 4IGQA 5T55A 1N47A 1UO9A 1TME2 4OI1A 3QLQA 4P9WA 1OH4A 3WP6A 3I2IA 4FXGB 5K0UA 4XTPA 3T3YA 3WNMA 3LWCA 4Y3OA 4XXPA 1F35A 2OZJA 3I59B 2XG3A 4QDQA 5FZKA 1RVF2 1DGWA 2DCKA 3TEXA 4EN7B 1QIQA 4EWEA 3U4XA 3LDRA 3ILNA 2J42A 3WF3A 1HRI2 2W3JA 3POWA 1C5IA 2P3JA 3IM0A 2HWE2 5I0DA 5A3UA 4IEYA 1XYNA 1UCXA 4DZGA 4XYXA 2HKXA 2Z4FA 5FXXA 4PDWA 3R4SA 3JU9A 1V9U3 1ULGA 3S5QA 2R041 1PO12 1RUG2 5CKMA 3WG1A 5FO8B 4YW2A 2DVBA 2JX9A 5FY4A 5CAZA 1G9CA 1FOD1 3THCA 4P5YA 4PDWC 1LULA 2A6ZA 2XB6C 3WQBA 5FUNA 1AX0A 4BU2A 5ISLA 1X33A 4WVMA 5A6QA 4BMBA 1HRV3 1O6UA 2D97A 2WN2A 5A80A 5AC93 4JQRA 3TAYA 5GLUA 3INAA 1AJKA 3CJXA 1A8DA 3ZLIA 4A41A 1LOCA 1CJPA 5CKQA 1S0FA 2L9LA 2PAMA 2VMDA 4EZ4A 3M8LA 4MOAA 4BCUA 1R1A3 3O1UA 5FZCA 3D82A 3M7AA 4GH4B 1PK6A 1DGLA 2YGMA 2Y8KA 2Q8CA 1LGNA 3HVDA 1HB4A 1V6KA 2VO5A 4IEUA 3V0BA 3WD5A 2DVGA 5F3CA 2RDNA 1VP6A 1W0OA 3MFCA 3MLJA 1DQ0A 1CN1A 3UGGA 5EP9A 4CXWA 2XGXA 3RMXA 1C8M2 2V4AA 3AMHA 1PNGA 3ELNA 3IDBB 4CU8A 2WKKA 5C3QA 1EV11 4MH0E 4UWDA 3RNSA 2PYTA 4GULA 5BNOA 2EVXA 3ZXGA 2ZJCA 4L92A 1AYN1 1DIWA 2HWF1 2R1BA 4CVUA 1DGWX 2JDAA 1I5ZA 1GZTA 4P9YA 3VBFB 5BNOC 3ZVXA 3CNAA 1FYUA 1GZ9A 2VG9A 3WHUA 1H30A 3AP9A 5EYYA 4HPKA 2ZGSA 4B7EA 2OPKA 2GP5A 1OC1A 1VRH1 2VNGA 1DF0A 2ZGOA 3ST7A 2HWD1 2PMWB 4QDRA 2LROA 3GCXA 5C4WA 2WLQA 4M00A 2GNDA 4NMIA 2OUHA 4I0WB 2XVKA 4XBNA 1YUDA 4FAGA 3FHQA 3DPRC 3ACFA 1BZWA 1L7LA 4DRRA 5C4WC 2RG4A 2Y26A 1QJX3 1FI2A 4AXOA 1JS9A 3KVAA 3HN1A 2PQQA 3KCYA 1DQ1A 3J26N 4OHVA 1RUJ3 2QBXA 3K75B 5FPLA 1O7FA 4QT6A 1SFYA 1H8VA 2FDIA 3K3NA 4QQOA 2GC3A 3CL1A 1SLBA 2JEMA 3AL5A 1ST8A 3UKVA 2H6BA 4XDQA 3MUZ1 5FYYA 2B4KA 1BQPA 2JG8A 4UFMA 3AVRA 3KV6A 3N7LA 4FAHA 3RWNA 3WLUA 1JYTA 1JOPA 2VY0A 3KT7A 2WUHA 3IN9A 4HKWA 3RS6A 4QHBA 3FLTA 2R042 3NRUA 1S0GA 3IMMA 1N1TA 4N8MA 2E7QA 4UFLA 2VZ1A 4Q4W1 5FZOB 3KGZA 3GZEA 5BNPA 3OSDA 3NNJA 5F37A 5FP7A 1XE0A 4DPNA 3C3VA 2Y0OA 3IT8A 3SHRA 1RC6A 1US2A 2P6HA 4YGCA 1F8VA 5EXOA 2P17A 2HEVF 5BNPC 1AR83 2VCCA 1D4VB 2P4EA 3WNOA 3T30A 4LO7A 4Y4RA 1LEDA 1POV3 4YVSA 4AHZA 2FDJA 1YHFA 3SCFA 4PIYA 3OGRA 1MPXA 2RMU3 3IKWA 3ZFGA 4LBQA 1Y9GA 1AR93 4QAWA 4R4XA 4QX1A 4YVSC 4CCNA 4DY3A 1NKGA 5JI9A 1YJLA 2A1XA 2CAVA 1VBC3 4RGGA 4AAXA 3VHRA 1X9PA 4IE4A 1J1LA 4AI9A 1JMUB 2H0BA 5T54A 4NHLA 2D93A 1VALA 4CP2A 4YZ2A 3MF9A 2IWGB 1WLDA 2AH2A 2HWC3 2D3SA 1QXPA 2HBTA 4N7UA 1UKGA 5LB6A 3H3UA 5FOJB 5FPXA 3T0DA 3PDQA 5HCBA 2KD7A 3I2HA 5CFCB 1QGLA 4HN1A 1AXZA 3TYJA 3WHTA 1X82A 1ZREA 2DWRA 3O1OA 4CDWA 1EV12 3D5OA 3FLPA 2ZX1A 4LHNA 4CDQA 4K20A 4QX8A 3VD3A 4AI0A 1AYN2 3VHOA 5C9AA 3TBDA 2MEV2 5E6HA 4CDWC 4G3YC 5JSRA 4CDQC 1YQ2A 4ZKTB 4Y33A 1RUH2 2CHHA 3CDZB 1FMD1 1YO8A 2UY9A 4E4HA 3HNBM 4K8FA 5C9AC 1OT5A 4TYSA 5I8TA 2E51A 2JE9A 2WR9A 4HMZA 4J6GA 2XUMA 5KHHA 1SLCA 1LU2A 3KLSA 1FV3A 4D7TA 2XKOA 1WBFA 5J3UA 3LEMA 1WW7A 3CJIA 2JICA 4P5HA 1XOYA 3NV4A 1MQTC 5IK4A 3AZYA 1XRUA 3DYMA 1OF3A 4BK4A 4M3CF 1O3RA 1MS9A 3AZVA 1QXRA 1JYCA 1WW4A 4LEJA 4WZFA 5CIRA 2BERA 3ECQA 3CJIC 4JC1A 3WG3A 5IVJA 3CQOA 1EPZA 1QY4A 2HLEA 4XF9A 5FWJA 1H4GA 3RZJA 4QXHA 1LOAA 3N9PA 4FI9A 3JD72 4R9DA 3FUOA 4PLNA 3RQ0A 4NHMA 1XNBA 4Q26A 4Q27A 1I1EA 4PLMA 1D0GA 1NA1B 4LK7A 1JTZX 1ND3A 5CB7A 4B1LA 4BQ2A 3URFA 3AKRA 3MUY1 3ZYGA 2Q4SA 5HCAA 4IEOA 2HJIA 2PLV1 1JOBA 4C91A 2RE9A 3W59A 4D0QA 3VBRB 1J58A 1MS0A 1MS5A 1MEC2 3HBZA 3POIA 5GZGA 3N7JA 2KXLA 2G9FA 5LBEA 1LHWA 1JYWA 5F5CA 4E8CA 2DCZA 3NJXA 3P6BA 2RM22 2TEPA 3R4DB 4F7ZA 5FO9B 5K9YA 4NO4A 2BYVE 3ME2A 4BQ5A 4BQWA 4QU1A 2VOKA 3GXUA 3PUHA 4FP3A 4CUAA 3MICA 1MR5A 3T0AA 3BPSA 4COZA 3WNLA 3WDTA 1AHSA 3IAPA 4CU7A 1R093 4JQTA 1AJOA 1S0CA 2VTXJ 4ET7A 3WG2A 4Q4V3 1A78A 1W9SA 3PNAA 1CESA 1DYPA 3DN7A 1REEA 4EN6B 5BNNA 1Z7S2 3DXUA 4BXSV 1NE6A 2BFUL 1CAVA 2XBO1 2VOVA 3HJRA 4QHZA 4YZ5A 1FV2A 4XPVA 4EN0A 4FQ4A 1IKQA 1AYM2 5D8AA 3AM2A 1BYHA 1W90A 4KQ7A 1VBB3 2JB8A 3TB0A 4BQYA 2VZ3A 1DQ6A 2ZHKA 4FFGA 5DUXA 4OUEA 1OMIA 5JIUA 5LRRA 4Q29A 2WA4A 2NQYA 3UKNA 3O1MA 1QJY1 5JIAA 2F6BA 1H1MA 1ZVFA 1ZBE3 3WDVA 3MV11 3RYRA 4AEKA 3OBRA 1QOOA 1VIWB 4BIOA 3NV3A 3HD8B 4PDWB 2VCBA 5IJRA 2WS91 2P34A 2OS2A 3IWZA 2N7GA 3IBMA 4Q4X1 2EXIA 3OEBA 2GC1A 1GP6A 2YBSA 1JODA 1SFPA 2VNOA 3OYWB 2O1QA 2R1DA 3VDBA 3VZOA 3QACA 1RJ8A 4NWVA 3IMNA 1YFYA 2EAAA 1W6MA 2VBBA 1FPN1 2Y33A 4WVMB 3W5NA 4AWDA 5LEKA 2VW1A 4NPMA 4GMP0 1NY71 1RUF2 2Z5WA 2AR6A 4IE7A 1EYBA 2LUWA 2ZBJA 4HVOA 2IXCA 4IEVA 1REFA 4QB2A 5FZAA 3USUA 5HV4A 2Z42A 1UOGA 2Y6JA 4AOCA 5C71A 4DUXA 3F95A 4CDUA 2R30A 5A6XA 3OG2A 2WZR2 4RS5B 2YFZA 3H8XA 3BTXA 4YFWA 1XB9A 1J59A 2IXHA 1ZRCA 4I0BA 4ISQA 1WMFA 4CDUC 4KG0A 4L0PA 4CP1A 3L2HA 2GN3A 4ONUA 4DO0A 1LB2A 1YRZA 2W08A 1VMHA 3I4IA 4JGYA 4UBGA 3MBWA 3DYOA 2A6YA 2X5IA 3SH4A 5BNOB 4A2UA 3AMMA 3ZX7A 3H7JA 2P3KA 3B00A 5IVBA 4P00B 4V2WA 4MVTA 1AVBA 2XHKA 1V9U1 3BN6A 4JGYC 4G4FA 3VKNA 2RS53 2WWSA 5KXCA 2X5IC 5JXHA 2CV6A 1W0PA 3LCPA 5J36A 2PHLA 2NMNA 1XYPA 3JUUA 3N7KA 5K4LA 2GC0A 2QZ3A 3K3OA 2C5DA 2J1UA 4BXFA 3BU0A 1YIFA 4QPYA 4HPKB 2W94A 4Y20B 1COV3 1DQ4A 1NT0A 2VOWA 4ZU7A 1HRV1 1IS4A 1SLIA 2K2SA 3IB3A 4PHZA 4Z82A 2RS13 3DPRB 5GM0A 5AC91 4X6QB 1SEFA 4XFBA 3TWIA 2PN5A 3UJQA 4FPOB 1GWKA 1W2NA 1F5FA 4FOVA 4LR4A 1OUXA 4MV2A 5A3TA 3Q9OA 5B2GB 2A3WA 2AEYA 4XJ8A 5ERLA 4ZONA 2B39A 4DNYA 3AJZA 2VUCA 1AX2A 1QJU3 2DDUA 4Q0PA 1R1A1 1F31A 3H42B 1YNAA 4ES9A 1QDCA 4RYDA 5KC6A 2YBKA 4HKLA 1ACCA 4MGZE 3FBMA 1NXD1 2QNKA 5ACA3 5IVCA 2D3PA 1DYKA 2JDMA 1NCRC 4IUGA 1VBA2 3D8CA 4W6YA 3FLRA 1UZWA 3GYDA 2JD4A 1VBD3 4FOQA 1X7NA 4E8DA 3G7DA 1A6CA 4LULA 3JQWA 3I3QA 3MIHA 5GJ6A 3WF1A 3ZSMA 3GZAA 5L7OA 2LRPA 1S1AA 3W58A 1PGL1 1CAWA 4GH4A 4D7SA 1RINA 3MIGA 4W65A 4Q4X2 5L7OC 1IS3A 2I07B 2SLIA 4GH4C 4MXWB 5BNPB 4RN5A 4OULA 1GUIA 3W21A 4FPLA 4TSVA 1ZRFA 2QZ2A 1RB8G 5AVPA 4MUVA 4DY5A 2FMYA 4LE3A 4UW5A 4Z8BA 4C1WA 1ZM1A 3BPZA 3K4DA 2VZSA 1ULOA 4YVSB 2WNUA 2CAUA 1NY72 2IXJA 1LODA 2IUWA 3WQ1A 2Y38A 2VQUA 3WXPA 1QJX1 4OI2A 4QD2A 1XE8A 1IPSA 4DFSA 3KV9A 3OD0A 1RUE2 3VBFA 4Z1VA 3OTFA 2CGPA 3ZM8A 4IGPA 4B3NA 5JSOA 1RUJ1 2WNUC 3OB8A 4EZHA 2ZGNA 2W46A 3Q8CA 1ZA7A 2ZPXA 3LDBA 4FFFA 3OPWA 3WQ0A 2FDKA 4UW6A 2VAUA 4XQWA 4QU2A 3S5AA 2ZGKA 3GGLA 3TNPB 5FYVA 2FMDA 1QEXA 2GAUA 4D7YA 3PUQA 1W8TA 1H1AA 4AI2A 5F5IA 1C1FA 3NVCA 5FYBA 1WCDJ 1ZRIA 4CDWB 5A1LA 4CDQB 3L2YA 2E7AA 3DXTA 2HEYF 1H9PA 3FZ3A 1C28A 3OUHA 2WNEA 3EBRA 1J3QA 3VD5A 5EV7A 2WWJA 1VB2A 4O61A 3M4FA 4X6RB 4FTBA 1XJAA 3M3EA 3ZYRA 1BEV2 4META 3ETPA 1MQTB 5DG1A 3S7IA 2ZCWA 2G19A 4MGIE 5A7NA 4W6XA 4E4SA 3BOPA 3MYXA 1OBNA 1ULPA 3CJIB 5L9VA 5F5AA 2CDOA 3BUCA 5DMYA 4GMP1 3T2OA 4FFIA 3O7OA 3B01A 2XL9A 5F6LB 5JXJA 2VZUA 2W52A 1UPIA 4DMIA 1LNSA 4QKBA 2RS32 1XNTA 1U5ZA 4QX2A 1RMU2 5DDJ3 1AR91 3WUCA 3I8TA 2LS6A 4HN0A 3ZSLA 2HWB3 3VB9A 1VBC1 1S2EA 1GZCA 1W8ZA 3LIGA 1QQP3 1UYZA 2ARCA 4Q0QA 5FZOA 1N1VA 2A6VA 4Q8KA 1GOHA 5APAA 5CBLA 4EQVA 2D43A 4OHWA 2LM3A 3KMHA 3LSEA 3ZFFC 5H9PA 2BGCA 3AKSA 2QQJA 1GANA 3T2TA 5E8AA 3RJ2X 1BMV1 5JR7B 2K9ZA 4I30A 3LQCA 1W2OA 2ES3A 3VD4A 3OGSA 4KWJA 4E2QA 2VUAA 2OW4A 2B42B 2BJSA 1M06G 1V6MA 3AMPA 5IHRA 1ENQA 2OPWA 5DAXA 1GU3A 3AP7A 3M2MA 4X8PA 5CFDC 3CU7A 4OCTA 3SCHA 4A42A 2ID4A 4LA2A 3IPVB 1BVP1 4TTGA 4QPWA 1V0AA 1ULCA 2CWSA 4Y24A 4UI9L 3DF0A 2BBVA 4A7KA 2YDEA 4IEWA 1CJDA 2F4LA 1TG7A 3M3CA 4K6BA 2WINB 2DBNA 5C3SA 4XVHA 3WCRA 1US3A 1H2LA 1H2KA 2VMCA 2R7EB 1HV1A 5L9RA 2VOTA 1KXGA 2W5FA 1W05A 1TEIA 4XILA 5CADA 4D94A 3CBNA 5FYMA 1CAVB 3CLPA 3FFZA 5C3RA 5J09A 4LT5A 2D3RA 1DQ5A 5FZ9A 1FAYA 4F8AA 1TMF2 4ATEA 4K1ZA 4CA9A 4UFIA 1V00A 3OUJA 4BJ0A 2WO7A 4NAOA 3T2PA 2GC2A 5C3OA 2EIGA 4XTMA 2DU0A 4FTEA 1CX1A 1LCLA 2VNVA 1LGBA 3GHMA 4GAZA 2C26A 3J8F3 4RSUA 5LY2A 3RI9A 1UU4A 1B35A 5T50A 4EV0A 1KD7A 4Z07A 4AVVA 5F6KA 2WYSA 4QX7A 5FY0A 2YMZA 4BZ4A 1CIYA 2NZ9A 3KWVA 1B35C 3LA3A 1H2NA 3MI8A 1ULEA 4LJHA 5A7OA 5LEJA 3MLKA 1GQGA 3I2KA 4OYUA 3KF3A 1JHJA 1W6OA 2ILMA 5IVYA 4N7IA 1LOEA 5C33A 3GF6A 1OH3A 1QWRA 4X8NA 3DL3A 3TN92 4BMEA 4GZ9A 2PFWA 1R091 3S57A 4RHV3 5D2AA 2ZKNA 3UJOA 5FKBA 5KBFA 1WMEA 2R062 4IETA 4Q4V1 5A6ZA 3ZYHA 4AQTA 4PJYA 1R083 4Y1UA 3R05A 2D5FA 1JUIA 4FPGA 4YSFA 1F4HA 4XACA 2R072 4KGQA 4CDUB 1ZBA3 2Q8DA 4QGLA 1VBB1 2Y6KA 1VB4A 1ZRDA 1YFWA 2VCAA 5F5QA 1UMIA 3ZKUA 1S2BA 4XMAA 3POSA 4P02B 4UOJA 4N9IA 2C0ZA 3HBKA 5JOWA 1ULFA 2AGSA 3DKQA 4LUKA 4XOGA 4JGYB 2IFWA 4Y22B 4V2VA 1ZBE1 2ZEYA 3LFIA 3N9LA 2X5IB 5FP9A 3RG0A 5FXWA 4DXRA 3E5QA 1YQ5A 3A22A 1LHNA 1TNFA 1O4ZA 4O9EA 1RXFA 2A3XA 4CCJA 4KNCA 1BHGA 3PTRB 1W8FA 1Q56A 1GWMA 2A7AA 3OGVA 4LKDA 1PO23 2R16A 1W9YA 2J1RA 4KMQA 1JI6A 3CF6E 5LCWL 3LOBA 1NQDA 1MS3A 5JZGA 3U75A 2OIIA 1UY3A 2Q1MA 3MW2A 1AL23 2Y64A 1EAH2 1WW6A 5A7QA 3S6PA 1HW5A 3WT3A 1KS5A 1HQNA 1IPKA 5JZGC 1KITA 4GXLA 1IQDC 4XUNA 3CEWA 1BCXA 2RV9A 1HN1A 2XH6A 1ZX5A 1GP5A 1W8WA 3IDAA 3O14A 4N53C 1Q8QA 1W8OA 2J7MA 4ZHNA 4Q0VA 3THTA 4YW3A 4Q5OA 1OFNA 4WVVA 1GFF2 1GNHA 2VW0A 4M01A 4AI8A 2YU1A 1WCSA 1JZ4A 1G9DA 4GB32 4JHZA 4FXKB 4RQPA 1NCRB 4N43A 1QDOA 4BISA 3BB6A 3OYWA 3TEYA 1NXMA 3ILRA 3AC0A 4QM9A 3OBZA 2PTMA 3Q8EA 4IE0A 5GALA 4CEWA 3E97A 1W6QA 1PIV3 1OHFA 1V6NA 4RQPC 3UESA 4N43C 2XJUA 4BWOA 1IKPA 2W95A 3POGA 2BPA2 3G6JB 4CEWC 2R0FA 3MEPA 2ENRA 2MNGA 4JDNA 4XDOA 5C5UA 4QPIA 2DCJA 1W6NB 4UW4A 3WP5A 1IG0A 3CZUA 2WFF3 1GV9A 2YXSA 4PBOA 5L7OB 2CNAA 1QHDA 2RS51 1HXS3 1RUI3 1CAWB 3JBG3 2PELA 4QPIC 2E9QA 4RS5A 4HL0A 1AR72 1NCQA 4J1WA 4TN7A 4YW5A 1OLMA 3SNMA 4PIXA 2JG9C 3O5SA 4R9BA 3KT1A 1COV1 2VMFA 4RS5C 1ASJ2 5TSWA 1XQNA 4IGOA 4BE3A 1NCQC 1UIJA 2X09A 1AR62 1Z0HA 2RS11 3OBAA 1W9FA 1Y9QA 1GP4A 2IFRA 4K3UA 3MFAA 3KQ4B 4UBHA 3LEIA 5F2SA 4IEZA 4AQ2A 4BQ1A 2DU1A 1GOGA 4NIDA 4EROA 1WA6X 1RMU3 2WNUB 3D0JA 2FD8A 2UU8A 1YEWA 2V73A 4WBBA 5DZEA 1RUC3 1XPWA 2A6XA 5J37A 2XLFA 2BNNA 3C7OA 2XHNA 1HV0A 2EALA 1V6IA 2NN8A 3AYDA 1DG6A 5ACA1 4Y20A 3U10A 4Q4Y2 1O4YA 1N1SA 5DAQA 2XONA 3MLLA 3DPRA 4B7KA 4E9KA 3JXSA 4HK9A 5DABA 2YFUA 3N9QA 1PVC3 5FLIA 2FZ2A 1IS6A 5FCCA 1DZRA 5FR3A 3AFKA 2RR13 3I54A 3MIEA 2JE8A 5JR2A 4LLOA 3VBHA 4L11A 4K1YA 5L36A 4XFCA 2JJ6A 3UKTA 3VZMA 3H9AA 2DBIA 2W9XA 2ORXA 4I02A 4FBFA 3VBHC 1CR7A 4FPHA 1KS4A 4QQ2A 3B7MA 4XW3A 3WUDA 3JB4C 2ADDA 4LITA 5LATA 1E5IA 2ZEXA 5BYNA 4W4ZA 3PMEA 3I3EA 4HANA 3RDIA 5SV5A 3UNPA 1IS5A 3B02A 4NRMA 2JDPA 1UOJA 3E6BA 1ODNA 1AX1A 5AFEA 4LBKA 1VBE3 4RR3A 4TLGA 2VR4A 4P9IA 4QGNA 4AEDA 4GJYA 1UX6A 4AI1A 3ES4A 2YPDA 1OLME 4PI2A 3H3LA 5T5JA 3I2DA 4RR3C 1NLRA 2CYFA 2BGOA 4V1PA 5F2WA 1Y9MA 4AEDC 3VD9A 4P14A 3WG4A 1DP0A 2WO2A 3ZFFB 3KVBA 4OUMA 4GIQA 3VD7A 1GSLA 5FMCA 4LBOA 1AXKA 1ZZ6A 2WABA 1FOD2 4MXWA 1WGPA 2OQ7A 4UFKA 3THPA 1RUD3 5JI7A 2E32A 1K45A 4LXLA 3WSOA 3A4UA 3C2UA 4FPKA 4CCEA 2JKXA 2B9VA 3AYAA 2DTYA 5CISA 5JCTA 3MGUA 1UAIA 1XU1A 1I3HA 3GCWA 2VW2A 5CFDB 4AVBA 3BALA 3POFA 4AVTA 2CGOA 3USSA 1G6NA 3B94A 2WYFA 5JOYA 4WM8A 4AFBA 3MIDA 2WSUA 3PVNA 3WCSA 4HETA 1LOBA 2XJTA 3FWEA 3WF2A 4XFAA 1PMHX 2BNOA 3PVBB 3C7GA 2FCVA 5E1RA 4WM8C 1DYOA 1GQHA 3LGRA 2EIEA 1WW5A 2NLRA 2ZS6B 3NW4A 4MGSA 5I8SA 1YIPA 5A7SA 4QPGA 4RGAA 1S4CA 3UK9A 1WCQA 3I3MA 2UYBA 2CSGA 2VVFA 1BBT3 5A7WB 3O1PA 4MZUA 2WZEA 3RGBA 2OT7A 3ETQA 4WVWA 1G86A 4QPGC 4MGQA 1FATA 2WA3A 1UY2A 1W3VA 1UW8A 3WINE 1OPOA 5F1RA 3WNKA 1JU4A 3IIAA 3Q8FA 3VV1A 2HWF2 4MYEA 1GLHA 1K5JA 4DUVA 5DDJ1 4AQ6A 2FQPA 5GZEA 2HWB1 5BPXA 3ZDSA 5KHGA 2PHUA 3EMRA 3OUIA 3GM8A 1X50A 1QQP1 4LORA 3VZJA 1QU0A 1W3XA 1OD5A 5JLVA 1UYYA 1W9TA 1MQTA 5IT6A 3SLIA 5KC5A 4INDA 2NM1A 1PGW1 2RJ2A 3LFMA 4QB1A 4XIKA 1VRH2 4A3ZA 2HWD2 1L3JA 1BVVA 3K4ZA 1TME3 3NNGA 1JN2P 4XF1A 5JVVA 2VE1A 5IUQA 4D6RA 1SLAA 2YHJA 2ZXQA 3ON7A 4WZCA 1F5JA 1B35B 2ZMKA 3O0VA 4YZ1A 1U12A 4LBNA 5FZ1A 1KGYA 3P3NA 3LIHA 3BOWA 1D2SA 4FTSA 3J7MA 2CGNA 3CIHA 1VLNA 4QDSA 1W03A 2VL4A 4GWMA 5FJKA 1RVF3 2JDZA 2EF6A 5C8CA 3P3PA 4UT5A 1DLLA 1W6OB 1HRI3 2B9UA 3A23A 4FP2A 3LKJA 4UF0A 2FZ1A 3I2GA 5FTTC 5FZHA 2HWE3 1DU3D 2GSYA 5DUWA 3UGHA 5C8CC 4HXCA 3WQ7A 1ENXA 3ACHA 1OOPA 2ZAAA 4F83A 3MPBA 1ZRRA 4B8EA 1PO13 1RUG3 2O8QA 1QMJA 1A8MA 1VRBA 3JB8A 2GP3A 1CAUA 4L9BA 1ZZCA 4LOTA 5H9RA 4JRAA 1OOPC 3U14A 2P5BA 3WDUA 4ZU4A 3IPVA 5EPAA 1JZ5A 2JKBA 1D4M1 2BW8A 1CGPA 4XC9A 1H6YA 2J1TA 5G05L 3RI8A 1SQ4A 4HKOA 4LHKA 4YM3A 4W6WA 3T4VA 4CP9B 4Q4W2 1LOGA 2WAOA 2ZMLA 3ZIWA 5EIYB 2AUYA 3AFGA 4EJRA 2XDVA 2BGPA 3PIJA 1VAVA 1U5XA 1JUHA 1JOJA 4AGRA 2ET1A 3EXUA 1CVNA 4I09A 3J8F1 3LEKA 3AYCA 5JSPA 4CUBA 2EA7A 5CYYA 1UQXA 2AREA 3A0NA 5F8PA 2E6VA 2OZ6A 2IVIB 4ATFA 5F7UA 5FZLA 2D6MA 4CCCA 4COYA 3H0OA 1HIXA 4OMCA 1RUNA 3RZHA 1HQLA 3GHNA 1JXNA 2VMEA 4QKFA 3DUIA 5JZGB 1H1IA 1L7RA 1PZ9A 1C8M3 2BOJA 3T1LA 1U0AA 2J1EA 4UFHA 1W06A 2ZMNA 4N53B 4YW7A 2J1AA 1C5HA 1WMXA 2R6QA 3VGIA 1J83A 4DXZA 4ORFA 1D2QA 5FZMA 4RHV1 1YQ6A 4MXVA 1GYKA 4W8JA 1QXJA 4XXAA 1IQAA 4Q0SA 1S0BA 1W6PB 1R081 1BXHA 3ZXFA 4SLIA 1W28A 5EJ3A 3WDWA 1N3QA 4A4AA 2B5HA 2BTVC 1PMIA 2O0OA 1GMMA 4C1XA 3PUAA 4HG6B 4RQPB 4YGDA 1ZBA1 2FDGA 4N43B 1YQCA 1K3IA 5JPNB 1EUUA 2R32A 4YZ4A 4LA3A 4S2GA 3AMQA 1X8MA 3K2OA 2AYHA 1FMD2 4CEWB 1OVPA 1R1ZA 2W92A 1W6QB 1HKDA 1GR3A 3RYKA 4FCAA 5LY1A 5LBFA 1UU5A 2YBPA 1PGW2 3NJYA 1POV0 4JGZA 1RHI1 2Y6HA 3KSCA 4XJWA 3V56A 4AGGA 4K40A 4QPIB 4XUOA 1MVQA 1CPNA 5FY7A 5IYYA 4QHOA 2ZZQA 5JMOA 3MZHA 2P6CA 1DGRA 1PZ7A 2ZTNA 4XJAA 4R4ZA 1SPPA 2A75A 1BKZA 2RJLA 4JGZC 5G04L 4YPJA 3RZGA 2X29A 1SZBA 2JG9B 4N9HA 1CQ9A 4A3XA 2BEOA 1E5RA 1I5PA 1PO21 2W68A 1NCQB 3CKHA 2BUKA 2VXRA 3AP4A 4AK3A 1OQ1A 2WRAA 1V6LA 1K42A 2YROA 3BGAA 3H1YA 2RHPA 1AL21 1ND2B 3IDEA 1W2AX 2BNMA 3O12A 2R0HA 1E5SA 2QE3A 2D40A 4Y22A 4UAPA 4HFSA 3ZYJB 5J48A 4AEMA 4PLOA 4FSJA 2PLV2 3N4MA 1NX9A 2RVAA 5KHJA 4ASKA 2XWJB 2R043 3FHAA 3JCIA 2PHTA 4Y26A 5FPZA 3ZSJA 4AAPA 4AZZA 4XAEA 3ABZA 4CCMA 2IVJA 4EE2A 2P2KA 3I2FA 5I0UA 3ACGA 4K9SA 1QNYA 2WZ8A 2OA2A 1STMA 1H2MA 2QQMA 1QNWA 1KJRA 3B5LB 4HLTA 4LKSA 4LUMA 4NIGA 5IFPA 1D4M2 1PIV1 4JDOA 2QQNA 1I9RA 2ZGQA 3B9CA 4R8HA 3RSJA 4CEYA 4GKYA 5A33B 2VTFA 3WZ1A 2B8MA 4ZU5A 1I6XA 5KWRA 2YU2A 4ITCA 2ZA9A 3KCCA 2QDNA 4OHXA 2F4PA 5FZBA 3PU8A 5T5OA 1VPHA 3WW3A 1PX3A 2BZDA 3VBHB 4CEYC 4B4RA 4AHWA 4H2AA 2YUEA 2LALA 2CL2A 3WF4A 1RUI1 4NN0A 1CZSA 1WCKA 4BIFA 1DQ2A 2ZHMA 1NCRA 2XBO2 2EXJA 1ENRA 2XQRA 3E1F1 3I49A 2GH2A 3LB9A 3UL2A 4YG0A 3NMBA 3UT0A 4IL7A 1O8PA 3NL1A 5FZIA 3LDKA 2XJQA 5FK8A 3UV9A 4EWAA 4L99A 4AHXA 2OX0A 1WLCA 1EV13 1CAXB 1QJY2 1ZNPA 4IERA 3SH3A 3ZPYA 5LA0A 3FHIB 1HJFA 5J7MA 4RR3B 5FY5A 1W6NA 1AYN3 3CZJA 4LPLA 2OKXA 4NWWA 4AEDB 2BP6A 5J98B 4AHYA 1QJFA 2MEV3 4PT6A 2FHRA 4IEXA 2XLAA 3O0XA 1RUH3 2IZWA 3ITQA 5F39A 1OF4A 4IV1A 2XOMA 5EQUA 2ARXA 1IHMA 1RUC1 3MF6A 2WS92 2XVLA 5FQ0A 2J1SA 1C4RA 2HBUA 3HPNA 2VD7A 4AFCA 4IV1C 1UN1A 5LBCA 4NE9A 1ZZ7A 2XKPA 3J7HA 3ZN6A 2QQUA 4BM8A 1FPN2 3MW3A 4ASMB 1PVC1 3H3ZA 4BQ3A 3Q8AA 2C4XA 2QVSB 2RR11 4DEQA 3I97A 1RHI2 4LE4A 1H6XA 3LPFA 4BQXA 4KGGA 2E33A 2NP0A 4H3WA 2CU5A 4WM8B 1DZQA 3AX4A 3M3IA 3PU3A 3JD73 4D6SA 1MZEA 4DIQA 1W9WA 1E57A 1OKOA 1KJLA 2QUOA 4Q0UA 4XDPA 1H0BA 1OUSA 5FREA 4PI0A 4CXXA 3DKWA 4QPGB 4IV3A 4NPLA 2C9KA 1O5LA 2BFUS 1VJ2A 4LHLA 1OFSA 5FP3A 1MEC3 3K48A 1TE1B 5CA6A 4IV3C 2D44A 2F17A 2P37A 1C3HA 5BV6A 1VMFA 5E16A 3U37A 4A44A 2RM23 1F4AA 3P5BA 5CU1A 4P08A 4CZSA 1C57A 3O0WA 1OLQA 1K5MA 2JXAA 4C0HA 2LW8A 1V9U2 2GDFA 4YM1A 5FMBA 3VUOA 5FY1A 3PUSA 1UNBA 3AVSA 2AENA 1OLRA 3HQRA 3PJYA 3NNMA 1UX7A 1K5MC 2UWBA 1MZ5A 2Q1FA 2ZAHA 1RUD1 3LF7A 5FP4A 1CZTA 4YM0A 3E5UA 3LA2A 5CVRA 5FPUA 3ROUA 5CG9A 4XFIA 4DS0A 1HRV2 2DCYA 1SFNA 2ZKLA 3FJSA 5BNQA 2X05A 5AC92 1Z7S3 1AR81 2V09A 5CZKA 5DG2A 3POJA 3ZSKA 5HBAA 1POV1 2A3YA 4MGYE 3ZSEA 5CG8A 1AYM3 1LOFA 1UD1A 4YVWA 3L9JT 2A5ZA 3ZXKA 2RMU1 1DFQA 4CPBD 3ZFFA 3LE0A 3W20A 4M3CB 1R1A2 2OXBA 1IGOA 2GH8A 2WT2A 4LOSA 1LOFC 4YGBA 1XBFA 4NUBA 4JTOA 4YVWC 4BOWA 5JWPA 5C8CB 4GWJA 2PHWA 3VZNA 2VQTA 1W39A 2CDPA 2DFBA 4UF0B 2NYYA 4ZS2A 3OY8B 2HWC1 4MSVA 2FBEA 4FPCA 5DXDA 3KD4A 2PAKA 4YGEA 5FYZA 3WW2A 5FPVA 5AFBA 2NPIA 1UF2C 2ZGMA 5D21A 5CFDA 4XBLA 1LGCA 1OOPB 5A33A 4HOOA 5A32A 2K46A 1HLCA 4AYUA 4BYYA 2G4IA 4NHXA 1CAUB 1UZYA 3K51A 4YW6A 5GLTA 3MV01 2AC1A 5FZGA 5T5LA 2BVBA 1ALYA 5KHKA 1PGL2 1WCUA 1PHMA 5H9SA 2Q8EA 1CPMA 1UPSA 2EICA 3R6SA 3UETA 1UYPA 5C5TA 4NROA 2FCUA 1BK0A 3KV4A 5A7WA 3PMSA 3BI3A 1RUF3 4PCRA 4U2AA 3EHKA 2ZGTA 2DTWA 4CXYA 4B4PA 1T2XA 1SBDA 4Y5Z0 2KR2A 3PUIA 4CYDA 3I2JA 2XQXA 4LHSA 1UZZA 1UMHA 2WZR3 1LKNA 1F9KA 3ZXAC 4CCKA 1HX6A 1QJX2 2WO1A 2RDSA 1KDMA 5FYHA 2D7FA 4OQ9A 5A6YA 5A3MA 3E6CC 2Y34A 2EIDA 3VZKA 3WW4A 1RUJ2 1S0EA 1HRI1 3CO2A 2VJXA 2GMEA 3QH6A 4JKKA 2HWE1 1SBFA 4K7JA 1QJEA 4ZPIA 4XURA 1TNRA 1VE0A 3QOPA 3PLQA 4TZDA 2E7TA 3HQUA 3M1HA 2ZX0A 3AP6A 4XZPA 5FJHA 2C1FA 2MPFA 4FT8A 5LASA 3T1MA 4I2OA 5FLJA 3ZYFA 2YC0A 2GZWA 3U78A 3RZZA 2YC2A 2OVUA 4UFJA 1WBLA 3BIWE 3D6EA 3WP3A 2IXKA 3F2ZA 2I2SA 3VLBB 2GU9A 1IG3A 4AFAA 2J1VA 3HWJA 1W8HA 4OQ8A 5JAXA 4FO9A 5FDBA 3J7LA 5IK5A 1SCRA 2JDYA 1LESA 2JWPA 3NWKA 3H7YA 4HONA 2YY1A 4JGZB 3MW4A 5KXBA
chains in the Genus database with same CATH topology
2E53A 1AR82 4NPRA 1SACA 4XFHA 1Q8VA 1WLTA 1UL9A 3HR9A 4H7MA 1NZCA 2RMU2 1SDWA 1XXNA 2IC1A 1AR92 1D0HA 4BLJA 1VBA3 2KA3A 1XNCA 1VBC2 3QBQA 4D69A 4JRLA 1ZZBA 4LTAA 4GWNA 2ETEA 2K0GA 4LBMA 1H9WA 1O4TA 3E5XA 1Y3TA 2HWC2 2CY6A 4XE9A 1GKBA 4AG4A 1BMV2 1LTEA 4C90A 1LHVA 4XETA 3ATGA 3H8UA 3GBFA 1OI6A 3AMNA 5LRSA 4Q4X3 3U11A 2VU9A 1MZFA 4GKXA 1DZTA 3S30A 4XHBA 1SCSA 1SLLA 1B09A 2ZGPA 1XU2A 1O3SA 4DOUA 4Y1YA 1N1YA 4N53A 4R9AA 4YARA 3KT4A 1T6GC 1OSGA 4CEYB 5L19A 4FOYA 4HZFA 2UWAA 1W6PA 1X8EA 1RUE3 3ZFEC 2D6OX 1MS8A 1FXZA 3OF1A 3RJRA 2A71A 4KWLA 1QOSA 4P9LA 4TLFA 3B3QE 4WM7A 3N36A 3MIBA 3ZN5A 2WIIB 5K0UC 5HCFA 4YRDA 4QGMA 4WM7C 2UURA 3AJYA 4LO4B 4CP0A 5H9QA 3EQEA 1Q3EA 1YCIA 4OFGA 3M70A 1GBGA 4LBQD 1YYNA 1ZA4A 3OBTA 2BVVA 4I3PA 3AP5A 3D4KA 2A70A 2TBVA 4Y1XA 2WC2A 4ES8A 2PHRA 2JG9A 4OLLA 3M3QA 3WX5A 4IV1B 1BEV3 2B45X 5FQ0B 3BODA 1S0JA 5AVAA 1EY2A 1ND2A 1M4WA 4XFGA 4UXAA 4HT1T 1OA2A 3ZN6B 3J4UH 1AXYA 1R092 1ND2C 2D5HA 3NO8A 2RS33 1PVXA 4Q4V2 4LO8A 3RYPA 3PHMA 3S7EA 4HSLA 3ZIXA 1O3TA 1O3QA 4KU8A 1QJU1 1UU6A 1V6OA 3VKOA 1WLWA 1YI9A 3N3HA 1HDKA 3B93A 2ZX2A 3RRDA 4TWTA 4RL7A 4J1XA 1ENSA 1S0IA 1PK6C 1VBB2 4IEQA 1Q8PA 2DV9A 1IOAA 4IV3B 4LNVA 2G9GA 3WDYA 3ZO0B 5FOBB 3VDDB 2DF7A 1VBD1 1LRHA 4FPEA 4GALA 4Q2FA 1LHOA 4E4ZA 2RJKA 3EJKA 3VBSA 4YW1A 1S0DA 4E2GA 1ZBE2 2MEV1 4QMAA 5ABJA 4AVSA 1ZZ9A 1H4HA 4PF5A 2UWCA 1RUH1 1K5MB 3VBSC 3R0RA 4XF4A 4OHYA 2V5YA 5ABJC 1DHKB 4R52A 4COWA 1LENA 3S0MA 3V0AB 1CAXA 1SBEA 3KGLA 4EN9B 2LTNA 3OJBA 4XBQA 3ILFA 3AZZA 1Q43A 3ASIA 4BPZA 3VBUA 2DVFA 4WVZA 2HYKA 3FMGA 4ZXKA 4KWKA 3SXWA 4YVWB 3LZZA 4XJ9A 3JD71 4FQZA 1TMF3 2QCSB 4KL1A 5I8YA 2OYZA 1FX5A 3OGJA 3VBUC 4L97A 5K8SA 1LHUA 4PIZA 1CONA 3E6DA 3PJQA 4I0AA 4Y1ZA 2EXKA 1NLSA 1JW6A 3WY6A 4MGKE 3R4UA 3SISA 1SLTA 2VMIA 4YG6A 1MEC1 3AYEA 1G8WA 3VL9A 2Z2SB 4YM2A 3ZXDA 5A33B 5GLVA 3N7MA 2RM21 5A32B 5I93A 4LO6B 1GNZA 3NSTA 1OPMA 2DCTA 1UMZA 1URXA 2JG8C 2GNTA 3WV6A 1QF3A 4URTA 2WNVB 4YNIA 2RS52 4KH9A 1N3PA 2GALA 4RD7A 1LEMA 3FX3A 4YYOA 3TN93 2W0XA 3KS7A 5K7PA 2R063 3I7DA 1RTVA 2Q1ZB 4XIOA 1COV2 1Y43B 2ERFA 3OGGA 4P9JA 3ALQA 2RS12 1Z7S1 1YLLA 1V70A 4GMP3 2PHFA 1H8TA 2R073 4I01A 4KG8A 4NHKA 1AYM1 1ULDA 3ZXLA 4HVQA 3AB0A 5HXVA 1QJU2 1H8TC 2Y0IA 2XLGA 1AUYA 1YXWA 1LU1A 3ZFGC 4AQSA 1KQRA 3NJZA 4K21A 4C0BA 4XJUA 4AF9A 4HVRA 4AFMA 2WSVA 5ACA2 3VKFC 2ZHNA 1VBD2 5I91A 2VULA 1CX4A 2CTVA 3N35A 5D1IA 4BLIA 3AK0A 5KXEA 3ES1A 1OA3A 3GALA 4M3CA 4YZ3A 5A3LA 4EN8B 2PHXA 4HBNA 3TRSB 1EAH3 1V6JA 4EWDA 1FNYA 2YYOA 1YFUA 3ZYPA 3HAGA 3OY8A 3AXEA 4XF3A 3SCGA 3HQXA 1RUF1 1SMVA 4L8QA 4S2DA 1FT9A 3SH5A 1YWKA 2GMMA 4IEPA 2WZR1 4GB33 3B69A 1DBNA 4AFDA 4CDXB 2Z79A 1O5UA 1AZDA 1TQ5A 5SV8A 2WZPP 2WFPA 5C8WA 5GZFA 1MS1A 3U0ZA 1CIWA 3FE5A 2WT1A 4JCKA 3A0KA 2QDRA 4PQ9A 1ND3C 5DUVA 1DGRN 3WDXA 2D6LX 3VBOA 2A6WA 4R9CA 3LOIA 1AR73 4QQHA 2GN7A 3VBOC 1NE4A 1IZ3A 1ASJ3 1YJKA 3AXDA 4FPJA 1AR63 4M0NA 3VN4A 4OI0A 3VHNA 2AZ5A 2DURA 4QQPA 3BTAA 4G9SB 5T52A 1C8NA 1WA4A 2YV8A 2XVGA 2YZ4A 3ZFEB 4QM8A 2MHFA 2QFEA 3ACLA 4FVVA 4M3CE 1APNA 5EYXA 5BUVA 2VH9A 3NAPA 4B29A 3BU7A 2VNRA 1U5IA 5K0UB 3GBGA 4WM7B 5BNNC 4Q4Y3 2W39A 3NAPC 5DDJ2 5E89A 3WNXA 3NKGA 1GZWA 1VBA1 5L73A 2HWB2 2Q8OA 3JZVA 5D8AC 1QQP2 2PHDA 1KRIA 4B4QA 4XFFA 3D0SA 2QJVA 5FMOL 1WD4A 3GNEA 2ZOEB 1BJQA 3X29B 1J1TA 2O8OA 2WJSA 3WP4A 2XJVA 3DGTA 2WT0A 3FC0A 5JDBA 3GZTB 4L2NA 5C6CA 1U5YA 2XPJA 1HQWA 1OQDA 2CWMA 4A7YA 5FLHA 1MACA 3VL8A 1S2KA 3DV8A 2YGLA 4FPFA 3PVEA 4IESA 2GNMA 2JECA 4P9XA 4YG3A 1XNKA 3VHPA 5FBZA 5J96B 3MPPG 1RUE1 3J9SA 4SBVA 4XHXA 3OPZA 3OCPA 1PK6B 2VECA 1FOD3 1EPWA 1AF9A 3V0BB 2ZGRA 1JBCA 5F9TA 3KM5A 4JDMA 4JTNA 1QH7A 4AW7A 2E63A 4E27A 4HSJA 3OD4A 4LBJA 1REDA 5I0SA 1ZZ8A 2I74A 4BA6A 2D6PA 2DUQA 3VBSB 4NOTA 2WFF1 2DUOA 5JPMB 2Z69A 3J8F2 5ABJB 4IQPA 1OKQA 1HXS1 3JBG1 5LK5A 4P9GA 1BEV1 3WOGA 1A3KA 1MZ6A 3I59A 4AGVA 2WLPA 3AZXA 4I3GA 4DINB 4CRQA 4OZXA 2WL1A 3NKTA 3QD6A 3PVOA 2VMHA 5IK7A 5C4WB 4COVA 1OA4A 1BK1A 4NR1A 3ZMNA 1IPJA 2DUPA 3QH7A 5DZFA 2DVAA 4RHV2 2JENA 2JE7A 5CADA 5LK7B 2HWF3 2RS31 2IXIA 1LJ7A 1OQEA 1RMU1 1MVEA 4NVPA 4Q1PA 3VBUB 1R082 4Q1RA 1N3OA 4M0HA 2WQZC 5FFOC 2GNBA 3V64A 4HK8A 1ZBA2 1VRH3 3TOJA 1Q5OA 2PA7A 2HWD3 3AZWA 4MX3A 4PBPA 2XJSA 4CTEA 2I45A 4OUSA 1G9AA 2ZACA 4Y4YA 5GZDA 3W9AA 1QOTA 3ZN4A 4COUA 4Z2WA 1ZYBA 2JG8B 3ZMOA 1XYOA 2ET7A 3GBWA 1YFXA 4GQ7A 2D6NA 2BWAA 5JOXA 3HMYA 1LECA 5T5PA 1PO22 3ZXEA 2ARBA 3LA7A 2BWCA 4MLOA 3H1WA 1PM7A 3VDDA 1AL22 3AKTA 1LR5A 1VBE1 3APBA 2VPVA 4QX5A 4WV8A 4JAAA 4DQAA 2X53S 4E4DX 3VDDC 1H8TB 4S2FA 1C1LA 3HT2A 2VVDA 1WUVA 1RITA 3H1MA 4LBQB 2ZX3A 4UW3A 3ZFGB 1Z78A 1TMF1 3POYA 2H6CA 1DDLA 4Q4W3 4A7ZA 1G9BA 3VBFC 4ISRA 4QXKA 2VQ0A 4N90A 4AE2A 2ZHLA 3QCWA 2VQAA 3V0AA 1YI7A 3FUQA 1PIV2 5FRAA 4LLFA 4U36A 2VGDA 5I0RA 1QJZA 1J3RA 4Y1VA 5C9AB 2WFF2 3AKQA 2EXHA 1EP0A 5EZWA 4LBLA 3HT1A 2UYAA 5FMOS 1HXS2 1RUI2 3VKMA 2D6KA 3JBG2 2X8KA 3TN91 1WMDA 4IXLA 3HIFA 1BBT1 2R061 3SMHA 1VAMA 2ATFA 1JH5A 3KB5A 3ZXJA 1XNDA 4YFZA 1KFUL 4D3WA 1Q8OA 1J3PA 2Q0AA 2WQ4A 2R071 4YLZA 5EFUA 3GZUC 4RA0A 3WVJA 3AKPA 3ZYIB 1W2UA 2GMPA 1RIRA 4S2HA 2WNVA 2QKDA 3KCXA 1Q8SA 2ZGUA 3LAGA 1FMD3 3ENRA 4YW4A 3NV1A 1RUC2 3WW1A 1G9FA 2XL7A 1ND3B 3WR0A 2WNVC 1G7YA 1UIKA 2H0VA 1QKQA 5DUUA 2XJRA 4F3JA 4Q8LA 2XWBB 2B7YA 2ZZJA 2VUJA 4RFT0 2BQPA 4XF0A 5FO7B 1TME1 1KFXL 4DRVA 5HI0A 1PVC2 2DFCA 1NOVA 3VBOB 1NG0A 2RR12 5GLZA 4XJZA 2Q30A 1JHNA 4XQ4A 3JQXA 4BH9A 1ONAA 1FNZA 2TNFA 1S55A 1EAH1 2NMOA 1RL3A 1RVF1 1UKRA 5DZGA 5CNAA 2OUJA 4AEJA 2A73B 5IK8A 4O9GA 4H55A 3VKLA 1NYWA 5KXDA 5E88A 2Q5TA 3NV2A 5EWSA 3B9IA 2PLV3 2ZABA 2P3IA 5CFCA 4XEZA 5BXXA 4AVAA 3SITA 2EAKA 5GZCA 1VBE2 1XE7A 4OHZA 1PO11 1RUG1 5BNNB 5CFCC 5JMCA 3EO6A 4GB31 2IXLA 5BY5A 3NAPB 5GKAC 2VMGA 1AL0G 1GICA 1VAKA 3BCWA 4KBBA 4KU7A 5D8AB 2PAEA 1QH6A 2SBAA 1D4M3 4AVCA 2VVEA 1CD3G 5KHIA 4H7LA 1GZWB 3IDCB 5GLWA 1X36A 4OVEA 3FFQA 4Z92B 3V65A 1Y7BA 1RUD2 3MIFA 4OI4A 1F2NA 4LO5B 2XJPA 3U07A 1RUOA 3TNQA 1O91A 2XBO3 4DB5A 1AR71 2D98A 2DVDA 4CDXA 4GA9A 3RPQA 1NQJA 2DYCA 1PNFA 1ASJ1 1NA1A 1AR61 1KDKA 4CDXC 1C8M1 5T3NA 1QJY3 1W6MB 1PGSA 5FAXA 4QQLA 5I0TA 2VOXA 3FBYA 2YPJA 1NA1C 1WD3A 1BBT2 3VBRA 3MDPA 2HEWF 2TUNA 4BHPA 4XMIA 2B46X 3USUB 2C9AA 2KM2A 2WS93 3VBRC 2QQPA 3M3OA 4E2SA 1JYIA 3VZLA 4ASLA 4JV4A 4XQDA 2ZX4A 1RGSA 1VR3A 2UY8A 4FOWA 4Q4Y1 5JOZA 3KZ4C 4JVAA 2R49A 4FPYA 1FPN3 3LSDA 3H50A 1MS4A 3ZFEA 4AI3A 3PTYA 1RHI3 4H14A 2ZGLA 1RJ7A 1PZ8A 3KQRA 5T55A 1N47A 1TME2 4OI1A 3QLQA 4P9WA 3WP6A 4FXGB 5K0UA 4XTPA 3LWCA 4XXPA 2OZJA 3I59B 2XG3A 1RVF2 1DGWA 2DCKA 4EN7B 3U4XA 4EWEA 3ILNA 1HRI2 3POWA 1C5IA 2P3JA 3IM0A 2HWE2 4IEYA 1XYNA 1UCXA 4DZGA 4XYXA 2HKXA 4PDWA 3R4SA 3JU9A 1V9U3 1ULGA 2R041 1PO12 1RUG2 3WG1A 5FO8B 4YW2A 2DVBA 2JX9A 5CAZA 1G9CA 1FOD1 4PDWC 1LULA 2A6ZA 2XB6C 1AX0A 1X33A 4WVMA 4BMBA 1HRV3 2D97A 5AC93 4JQRA 3TAYA 5GLUA 3INAA 1AJKA 3CJXA 1A8DA 1LOCA 1CJPA 1S0FA 2PAMA 3M8LA 4BCUA 1R1A3 3D82A 3M7AA 4GH4B 1PK6A 1DGLA 2YGMA 1LGNA 1V6KA 4IEUA 3V0BA 3WD5A 2DVGA 1VP6A 1W0OA 3MFCA 3MLJA 1DQ0A 1CN1A 2XGXA 3RMXA 1C8M2 3AMHA 3IDBB 1PNGA 3ELNA 2WKKA 1EV11 4MH0E 3RNSA 2PYTA 4GULA 5BNOA 2EVXA 3ZXGA 2ZJCA 4L92A 1AYN1 1DIWA 2HWF1 2R1BA 1DGWX 1I5ZA 4P9YA 3VBFB 5BNOC 3ZVXA 3CNAA 1FYUA 1GZ9A 2VG9A 3WHUA 1H30A 3AP9A 5EYYA 4HPKA 2ZGSA 4B7EA 2OPKA 1VRH1 2VNGA 2ZGOA 1DF0A 3ST7A 2HWD1 5C4WA 2WLQA 4M00A 2GNDA 2OUHA 4I0WB 2XVKA 4XBNA 1YUDA 4FAGA 3DPRC 1BZWA 4DRRA 5C4WC 2Y26A 1QJX3 1FI2A 4AXOA 3HN1A 2PQQA 3KCYA 1DQ1A 3J26N 4OHVA 1RUJ3 1O7FA 4QT6A 1SFYA 1H8VA 4QQOA 2GC3A 3CL1A 1SLBA 2JEMA 3UKVA 2H6BA 4XDQA 1BQPA 2JG8A 3N7LA 4FAHA 3RWNA 3WLUA 2VY0A 3KT7A 3IN9A 4HKWA 3RS6A 4QHBA 3FLTA 2R042 1S0GA 1N1TA 2E7QA 4Q4W1 5BNPA 3KGZA 4DPNA 3C3VA 2Y0OA 3IT8A 3SHRA 1RC6A 4YGCA 1F8VA 5EXOA 2P17A 2HEVF 5BNPC 1AR83 1D4VB 4LO7A 1LEDA 1POV3 4YVSA 4AHZA 1YHFA 3SCFA 4PIYA 2RMU3 3IKWA 3ZFGA 4LBQA 1AR93 4R4XA 4YVSC 4DY3A 5JI9A 1VBC3 1YJLA 2CAVA 4RGGA 3VHRA 1J1LA 4CP2A 5T54A 2H0BA 4NHLA 2D93A 1VALA 4YZ2A 3MF9A 2IWGB 1WLDA 2AH2A 2HWC3 2D3SA 1QXPA 4N7UA 1UKGA 3H3UA 5FOJB 5FPXA 5HCBA 5CFCB 1QGLA 4HN1A 1AXZA 3TYJA 3WHTA 1X82A 1ZREA 2DWRA 4CDWA 1EV12 3D5OA 3FLPA 2ZX1A 4LHNA 4CDQA 4K20A 4AI0A 1AYN2 3VHOA 5C9AA 3TBDA 2MEV2 4CDWC 4G3YC 5JSRA 4CDQC 4ZKTB 1RUH2 1FMD1 1YO8A 2UY9A 4K8FA 5C9AC 4TYSA 5I8TA 2E51A 2JE9A 4HMZA 4J6GA 5KHHA 2XUMA 4D7TA 1SLCA 1LU2A 3KLSA 1FV3A 2XKOA 1WBFA 5J3UA 1WW7A 3CJIA 2JICA 4P5HA 3NV4A 1MQTC 5IK4A 3AZYA 1XRUA 1O3RA 4M3CF 1MS9A 3AZVA 1QXRA 1JYCA 1WW4A 4LEJA 4WZFA 5CIRA 3ECQA 3CJIC 4JC1A 3WG3A 1EPZA 1QY4A 4XF9A 1H4GA 1LOAA 3JD72 4R9DA 3FUOA 4PLNA 3RQ0A 4NHMA 1XNBA 4Q26A 4Q27A 1I1EA 4PLMA 1D0GA 1NA1B 1JTZX 1ND3A 5CB7A 3URFA 3AKRA 3ZYGA 2Q4SA 5HCAA 4IEOA 2HJIA 2PLV1 4C91A 2RE9A 3W59A 3VBRB 1J58A 1MS0A 1MS5A 1MEC2 3HBZA 5GZGA 3N7JA 2KXLA 2G9FA 1LHWA 2DCZA 3R4DB 2RM22 2TEPA 4F7ZA 5FO9B 5K9YA 4NO4A 2BYVE 3ME2A 2VOKA 4FP3A 3MICA 1MR5A 4COZA 3WDTA 1AHSA 1R093 1AJOA 1S0CA 3WG2A 4Q4V3 1A78A 3PNAA 1CESA 1DYPA 3DN7A 1REEA 4EN6B 5BNNA 1Z7S2 1NE6A 2BFUL 1CAVA 2XBO1 2VOVA 4YZ5A 1FV2A 4XPVA 4EN0A 4FQ4A 1IKQA 1AYM2 5D8AA 3AM2A 1BYHA 4KQ7A 1VBB3 3TB0A 5JIUA 1DQ6A 2ZHKA 5DUXA 1OMIA 5LRRA 4Q29A 2WA4A 2NQYA 3UKNA 1QJY1 5JIAA 2F6BA 1H1MA 1ZVFA 1ZBE3 3WDVA 3RYRA 4AEKA 3OBRA 1QOOA 1VIWB 4BIOA 3NV3A 3HD8B 4PDWB 2WS91 2P34A 3IWZA 2N7GA 3IBMA 4Q4X1 2EXIA 2GC1A 3OYWB 2VNOA 2O1QA 2R1DA 3VZOA 3QACA 1RJ8A 4NWVA 3IMNA 1YFYA 2EAAA 1W6MA 1FPN1 4WVMB 4AWDA 5LEKA 2VW1A 4GMP0 1NY71 1RUF2 2Z5WA 2AR6A 1EYBA 2LUWA 2ZBJA 4HVOA 2IXCA 4IEVA 1REFA 3USUA 2Z42A 4CDUA 2R30A 2WZR2 4RS5B 4YFWA 1J59A 2IXHA 1ZRCA 4I0BA 4ISQA 1WMFA 4CDUC 4KG0A 4CP1A 3L2HA 2GN3A 4ONUA 1LB2A 1YRZA 2W08A 3I4IA 4JGYA 4UBGA 2A6YA 2X5IA 3SH4A 5BNOB 4A2UA 3AMMA 3ZX7A 3H7JA 2P3KA 3B00A 4MVTA 1AVBA 2XHKA 1V9U1 4JGYC 3VKNA 4G4FA 2RS53 2WWSA 2X5IC 2CV6A 1W0PA 3LCPA 5J36A 2PHLA 2NMNA 1XYPA 3JUUA 3N7KA 2GC0A 2QZ3A 2C5DA 1YIFA 4QPYA 4HPKB 4Y20B 1COV3 1DQ4A 2VOWA 4ZU7A 1HRV1 1IS4A 1SLIA 2K2SA 4Z82A 2RS13 3DPRB 5GM0A 5AC91 4X6QB 1SEFA 4XFBA 3TWIA 2PN5A 3UJQA 4FPOB 4FOVA 4MV2A 1F5FA 4LR4A 3Q9OA 5B2GB 2A3WA 4XJ8A 2B39A 4DNYA 3AJZA 1AX2A 1QJU3 4Q0PA 1R1A1 1F31A 1YNAA 4ES9A 1QDCA 5KC6A 4HKLA 4MGZE 3FBMA 2QNKA 1NXD1 5ACA3 2D3PA 1DYKA 1NCRC 1VBA2 3D8CA 4W6YA 3FLRA 3GYDA 2JD4A 1VBD3 4FOQA 1X7NA 3G7DA 1A6CA 4LULA 3JQWA 3MIHA 5GJ6A 3ZSMA 3GZAA 5L7OA 3W58A 1S1AA 1PGL1 1CAWA 4GH4A 4D7SA 1RINA 3MIGA 4W65A 4Q4X2 5L7OC 1IS3A 2I07B 2SLIA 4GH4C 4MXWB 5BNPB 4OULA 4FPLA 4TSVA 1ZRFA 2QZ2A 1RB8G 5AVPA 4MUVA 4DY5A 2FMYA 4LE3A 4UW5A 4Z8BA 4C1WA 1ZM1A 3BPZA 4YVSB 2WNUA 2CAUA 2IXJA 1NY72 1LODA 3WQ1A 3WXPA 2Y38A 1QJX1 4OI2A 4QD2A 1XE8A 4DFSA 3OD0A 3VBFA 1RUE2 4Z1VA 2CGPA 3OTFA 4B3NA 5JSOA 1RUJ1 2WNUC 2ZGNA 2ZPXA 3WQ0A 4UW6A 4XQWA 4QU2A 2ZGKA 3TNPB 2FMDA 2GAUA 4D7YA 1H1AA 4AI2A 1C1FA 3NVCA 1WCDJ 4CDWB 4CDQB 3L2YA 2E7AA 2HEYF 1H9PA 3FZ3A 1C28A 2WNEA 3EBRA 1J3QA 5EV7A 1VB2A 3M4FA 4X6RB 4FTBA 3M3EA 3ZYRA 1BEV2 4META 1MQTB 5DG1A 3S7IA 2ZCWA 4MGIE 4W6XA 4E4SA 3BOPA 3MYXA 3CJIB 4GMP1 3O7OA 3B01A 2XL9A 5F6LB 2W52A 1UPIA 4DMIA 2RS32 1U5ZA 5DDJ3 1RMU2 3WUCA 1AR91 3I8TA 3ZSLA 4HN0A 2HWB3 1VBC1 3RMYA 1GZCA 4Q0QA 4Q8KA 1QQP3 1N1VA 2A6VA 5CBLA 2D43A 4OHWA 2LM3A 3KMHA 3LSEA 3ZFFC 5H9PA 2BGCA 3AKSA 1GANA 3T2TA 5E8AA 3RJ2X 1BMV1 5JR7B 2K9ZA 4I30A 2ES3A 4KWJA 4E2QA 2VUAA 2OW4A 2B42B 1M06G 1V6MA 3AMPA 1ENQA 3AP7A 3M2MA 4X8PA 5CFDC 3CU7A 3SCHA 4LA2A 3IPVB 1BVP1 1ULCA 2CWSA 4Y24A 3DF0A 2BBVA 4A7KA 2YDEA 4IEWA 1CJDA 3M3CA 4K6BA 2WINB 3WCRA 1H2LA 1H2KA 1HV1A 1KXGA 1TEIA 4XILA 4D94A 1CAVB 3CLPA 3FFZA 5J09A 4LT5A 2D3RA 1DQ5A 4F8AA 1FAYA 1TMF2 4ATEA 4K1ZA 1V00A 2GC2A 2EIGA 4XTMA 2DU0A 4FTEA 1LCLA 1LGBA 3GHMA 4RSUA 3J8F3 3RI9A 1UU4A 1B35A 5T50A 4EV0A 1KD7A 4Z07A 4AVVA 5F6KA 2YMZA 4BZ4A 3MI8A 2NZ9A 3LA3A 1B35C 1H2NA 1ULEA 5LEJA 3MLKA 1GQGA 1W6OA 2ILMA 4N7IA 1LOEA 5C33A 3GF6A 4X8NA 1QWRA 3DL3A 3TN92 4BMEA 2PFWA 1R091 4RHV3 3UJOA 2ZKNA 5KBFA 1WMEA 2R062 4IETA 4Q4V1 4AQTA 4PJYA 1R083 4Y1UA 3R05A 2D5FA 1JUIA 4FPGA 4YSFA 2R072 4KGQA 4CDUB 1ZBA3 4QGLA 1VBB1 1VB4A 1ZRDA 1YFWA 5F5QA 1S2BA 4XMAA 3POSA 4N9IA 2C0ZA 5JOWA 1ULFA 2AGSA 4LUKA 4XOGA 4JGYB 2IFWA 4Y22B 1ZBE1 2X5IB 3RG0A 3E5QA 1LHNA 1TNFA 1O4ZA 4O9EA 2A3XA 4KNCA 1Q56A 2A7AA 1PO23 2R16A 3LOBA 3CF6E 1NQDA 1MS3A 5JZGA 2OIIA 2Q1MA 3MW2A 1AL23 1EAH2 1WW6A 3S6PA 1HW5A 3WT3A 1KS5A 1HQNA 1IPKA 5JZGC 1KITA 4GXLA 3CEWA 1BCXA 2XH6A 1ZX5A 3O14A 4N53C 1Q8QA 4Q0VA 3THTA 4YW3A 1OFNA 4WVVA 1GFF2 1GNHA 2VW0A 4M01A 4AI8A 1WCSA 1G9DA 4GB32 4RQPA 4FXKB 1NCRB 4N43A 1QDOA 3BB6A 3OYWA 1NXMA 3ILRA 4QM9A 2PTMA 5GALA 4CEWA 3E97A 1W6QA 1PIV3 1OHFA 1V6NA 4RQPC 4N43C 2XJUA 4BWOA 1IKPA 3G6JB 4CEWC 2R0FA 3MEPA 2MNGA 2ENRA 4JDNA 4QPIA 2DCJA 1W6NB 4UW4A 3WP5A 2WFF3 1GV9A 2YXSA 4PBOA 5L7OB 2CNAA 1QHDA 2RS51 1HXS3 1RUI3 1CAWB 3JBG3 2PELA 4QPIC 2E9QA 4RS5A 4HL0A 1AR72 1NCQA 4J1WA 4YW5A 3SNMA 4PIXA 2JG9C 3O5SA 4R9BA 3KT1A 1COV1 4RS5C 5TSWA 1ASJ2 1XQNA 4BE3A 1NCQC 1UIJA 1AR62 1Z0HA 2RS11 1Y9QA 2IFRA 4K3UA 3MFAA 4UBHA 4IEZA 4AQ2A 4BQ1A 2DU1A 4EROA 1RMU3 2WNUB 3D0JA