2WWSA

Physalis mottle virus: natural empty capsid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
161
structure length
161
Chain Sequence
b'QSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
molecule tags Virus
source organism Physalis mottle virus
publication title Crystal Structure of the Physalis Mottle Virus
rcsb
total genus 26
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wwsA00
1NCQC 1AR83 4Q4V2 5BNOC 2RS32 1NCRC 1RUI3 1VB4A 1RUE1 1ND2A 1RUC2 2RR11 1AL21 3VBRC 2HWC2 5C9AC 1AYM3 1PO22 2MEV1 4CDWB 5CFCC 1VBD3 1ASJ1 2RS13 1HX6A 2DF7A 1R083 1X36A 4QPIA 1PIV2 2R063 1BBT3 1H8TB 4Q4V3 1MQTB 1IHMA 4PDWC 3VBUB 2RMU1 1EAH3 1AR63 3VBUA 4IV1A 3ZFEC 3CJIA 4IV1B 5LK7B 1VBB1 5JZGB 1POV0 3JD72 3LOBA 4Q4Y3 1V9U3 1AYN1 1FMD1 1RMU1 1PVC1 1RUC1 1HRV2 1RUH3 5ABJC 4Q4W2 4CDQB 5BNNA 1VRH1 2XBO2 1MQTC 1PO21 1ZBA2 1HXS2 4PDWB 4YVSA 4FSJA 1QJU1 2R073 4PDWA 1HXS3 4YVSB 1EV11 4EJRA 1B35A 1AR71 4JGZC 5C4WC 4FTEA 1MEC3 4WM8B 1ZBE2 4RR3C 1POV3 2X5IC 1V9U2 2PLV1 3ZFGC 1NG0A 4CEYA 2HWF1 1Z7S1 1RHI3 1ZBA3 2WS93 3VBRA 5A32A 1RUG3 1HRV1 2FZ2A 2XBO3 1HRI3 1RVF2 4WM7C 2WZR3 3NAPB 1VRH2 3ZFFB 2XBO1 1NCRA 1R082 1R1A1 1ND3A 1HXS1 3JD73 4GMP1 5C9AB 1Z7S3 4N43C 1EV12 1QQP1 3VBHA 4N43A 3VBHC 1VBA1 1K5MC 4CDWA 5C8CB 2BBVA 2WLPA 1PVC3 5D8AB 4Q4Y1 2VQ0A 4N53C 5D8AA 2PLV2 1ND3B 4AEDA 4WM8C 1R092 1QJZA 1VBD2 3M8LA 1TMF3 1PO23 3HAGA 1HRI1 5GKAC 1RUG1 4RQPB 4Q4X3 2HWC3 1OOPB 1RHI1 1OOPA 4JGYC 1BEV1 1R081 1NOVA 2BPA2 4GMP3 2BFUL 2BFUS 2ZAHA 4CDQA 1VBE2 2WZR1 2RMU3 4CEWB 4YVSC 1MEC1 4Q4V1 1A6CA 4RS5A 3VDDC 1OOPC 1RUE3 2WS91 4WM7A 1NCQB 1COV3 1R093 3VBOB 2BUKA 2RR12 2PLV3 1AL22 3ZXAC 5FOJB 1VBD1 3IDEA 1NA1A 2MEV3 5K0UA 1HRI2 3CJIC 3FBMA 5K0UB 1RUG2 1E57A 1ASJ2 4QPGB 5A32B 3DPRA 5L7OC 1VB2A 4WM7B 3VBSB 1H8TC 1EAH1 4CDUB 3VBOA 3DPRC 1BBT1 3TN92 2WZR2 1MQTA 4FTSA 5K0UC 1PGL2 2WS92 1AYN3 1QJY1 2Y26A 1RUJ1 1AYN2 2GSYA 4BCUA 5BNPB 3S6PA 4Y4YA 1C8M3 1D4M1 4Q4W1 1RUH2 1AL23 3ZFEA 2IZWA 2R061 5DDJ3 3VBUC 1NCRB 1NY72 1GFF2 1RUI1 1RUD1 4CDQC 1FOD3 1SMVA 1VBE3 1ZBE1 1B35C 1BBT2 3TN91 1AYM1 5ACA2 2HWB1 1PGL1 2HWF2 1OHFA 4AEDB 5BNNC 5C9AA 4RR3B 4Q4X2 2R041 4GH4A 5C4WB 1WCDJ 1RVF1 4N53A 1FOD1 3J8F2 2R043 2R062 5BNOA 5FMOS 1QQP2 1RUI2 1TME1 1RUD2 1ND2B 1AR82 1CJDA 1D4M3 1H8TA 1F2NA 1DDLA 4N43B 1AYM2 5J96B 3CJIB 1RUJ3 4QPGA 3NAPC 1QJY3 2HWB2 3ZFFC 5ACA1 1K5MB 1RUD3 5BNOB 5J98B 4JGZB 1R091 4Q4X1 4CDUC 4GMP0 3VBFA 2RS53 1FOD2 1RHI2 3J8F1 3VDDB 4RQPA 5AC93 3VDDA 1K5MA 4CDWC 3JB8A 5JZGA 1X33A 4JGZA 1AR93 1BEV3 2QQPA 3ZFEB 1NA1B 4JGYB 1VBA3 1MEC2 3VBFB 5CFDB 4CEWA 4RQPC 1COV1 4CEYB 2R072 1B35B 4IV3A 1BMV1 1VAKA 2HWE2 4CDUA 2ZZQA 1FPN1 4WM8A 1AR92 1AUYA 5BNNB 5D8AC 1C8M2 5CFDC 1HQNA 1W39A 4RHV1 2HWD2 3VBHB 1QJX1 1CD3G 4GH4B 4SBVA 3VBRB 1EAH2 4IV3B 1R1A3 2WFF1 3JBG2 2RM21 1TMF1 4YVWB 1ND3C 4CDXC 2RS31 4YVWA 1HRV3 1COV2 2RS12 1QJY2 1QJU3 2R071 1RUJ2 1RUE2 1BMV2 4GH4C 4FTBA 1FPN2 1PO13 1VBC3 3VBSC 2HWC1 1D4M2 2RS52 1RUH1 1POV1 1RB8G 1AR91 4IV1C 3ZFGA 1QQP3 1FMD3 1RMU3 1RUF3 2X5IB 4Y5Z0 4QPIB 4CDXA 4CDXB 2X5IA 1NY71 1AR73 1QJX2 4RR3A 4NWWA 2RS33 3J8F3 3VBOC 1RUF1 2RM23 2WFF3 2RM22 1TMF2 2RMU2 1PO11 1VBC1 2HWF3 1QJX3 1RUC3 4GB32 5C8CC 5ABJB 2RS11 1VBB2 1NA1C 3JD71 5ACA3 5ABJA 1VBB3 1OPOA 1FMD2 1RMU2 1PVC2 2R042 1ND2C 2RS51 1FPN3 1C8NA 4N53B 2ZTNA 1ZBA1 1NCQA 1QJU2 3DPRB 5DDJ2 1TME2 2GH8A 1PGW2 1AR72 4RHV3 1AR81 1RUF2 5L7OA 4QPIC 3JBG3 5CFCB 1M06G 4LLFA 4RS5B 5CFCA 1V9U1 1PO12 1VBC2 1AL0G 4GB31 2HWD3 1EV13 1Z7S2 3VBSA 4RFT0 5A33B 4IV3C 3TN93 1VRH3 5A33A 4QPGC 5L7OB 5FMOL 1RVF3 2TBVA 2HWE3 4YVWC 1R1A2 4RS5C 2XPJA 5DDJ1 2FZ1A 4NWVA 1PGW1 5AC91 5BNPA 1AR61 1VBA2 5JZGC 2WWSA 2RR13 4JGYA 1ZBE3 5CFDA 4Q4Y2 1F8VA 3VBFC 2HWE1 1ASJ3 4CEYC 4AEDC 5C8CA 3JB4C 2MEV2 4Q4W3 1PIV3 3NAPA 3ZFFA 1C8M1 3ZFGB 4RHV2 4Z92B 4CEWC 1BEV2 2HWD1 1TME3 4GB33 2HWB3 1PIV1 5BNPC 5C4WA 2WFF2 3JBG1 5AC92 1AR62 1VBE1
chains in the Genus database with same CATH superfamily
3U10A 5FZ4A 3VZMA 5K9YA 4Q4V2 3ECQA 2RS32 1NCRC 2I2SA 1OA4A 2Q30A 5GZEA 3S5QA 1RUI3 4XW3A 1AZDA 2P17A 4I3PA 4AHWA 4CYDA 5IWFA 1LHOA 3PU3A 5I8SA 1RUE1 3POFA 4QHOA 1IKQA 1UZ0A 4FVVA 4XQ4A 3A23A 3T1LA 4H2AA 1YFUA 5JXHA 1F5JA 2W92A 2KM2A 4CDWB 1VAVA 1X8EA 4N7IA 4QD2A 3JU9A 4YZ2A 3AXEA 4ZKTB 1YXWA 2C6SA 2RJ2A 1R083 2C5DA 2A75A 3FLRA 2OKXA 4AI0A 2ZHMA 5IT6A 5M0TA 3LD8A 1J58A 2VXRA 3P6BA 3PVNA 3T0AA 1J1LA 1J59A 1YNAA 4XBLA 5C3RA 1WLTA 4MGKE 1V6KA 2WUHA 4X8NA 1UY1A 1BBT3 4Q4V3 2WABA 5EYXA 1IHMA 3WQ1A 3WF0A 1JH5A 1AR63 1JOJA 2WJSA 3WVJA 5FKCA 4IV1A 1VAMA 2ZX4A 1EUUA 4AFCA 2MHFA 3WW1A 5FK7A 4XF4A 2OT7A 1K5JA 2ET1A 1VBB1 3AMMA 2VZ3A 1V9U3 4BQYA 1RMU1 3IMNA 3PDQA 4ZU4A 1K45A 1BYHA 2CNAA 2WT0A 2VBDA 5FLIA 3E97A 4QKBA 3S30A 2ENRA 2IXJA 5ABJC 4CDQB 5EWSA 2JKBA 5BNNA 3KB5A 1A34A 4Q26A 4TLFA 4DMIA 2XBO2 5JXIA 4XAAA 1MQTC 5CKMA 1PO21 3FLPA 2WA3A 5FBZA 3ZPOA 1HXS2 2I45A 1C57A 1E5RA 1H1MA 1YIPA 4XUPA 5APAA 4PDWA 2B8MA 2VOWA 3AP4A 4P14A 5EIYB 4LTAA 5IAXA 4XBNA 1AR71 2JD9A 2VULA 1WCKA 3I2JA 4LBQA 4NROA 2E7AA 1CAUA 4QXBA 4AEMA 1LU2A 4BH9A 2WN3A 2F6BA 4GWIA 3U4XA 4NPMA 4AVVA 1YYNA 2DTWA 4CXXA 4NHKA 2JE7A 1SBEA 1V9U2 2A73B 3LCPA 4M3CA 4TWTA 1W8WA 1IG0A 3KV9A 3NWKA 1YCIA 2Y0OA 3LDBA 1O3RA 4E9KA 3ZN5A 1H4GA 1PZ7A 2XONA 4DUXA 3W5NA 4R9AA 5FZBA 2CAVA 3FE5A 1TEIA 3D5OA 1CAUB 5FP3A 4EQVA 2DDUA 2GC1A 2YBPA 1WWYA 4WM7C 2WZR3 3NAPB 1VRH2 2G19A 1IPKA 4IUGA 2E7QA 1OA3A 5BNQA 5A6ZA 4OHXA 4DY3A 3W5MA 3V56A 1ND3A 3D82A 1O91A 1HXS1 2IXIA 3V0AA 3D4KA 2RDSA 3UKNA 1D4VB 3JD73 3VBHA 2Y6FA 3UJQA 1F15A 1ONAA 5FYIA 4E4HA 1PNFA 1RUOA 5FPLA 1MR5A 4MVTA 2HKXA 4W6XA 3IT8A 3VBHC 2HEVF 1NYWA 1YO8A 5EP9A 4NIIA 1ZRRA 1RC6A 3BOPA 4EN0A 1EPWA 5FYHA 5FLJA 4GD4A 5T5OA 1Q8VA 3VHNA 1PZ8A 1OKOA 3IM0A 3IKWA 4AGRA 2LALA 4AEDA 4WM8C 4J25A 4YZ1A 1VBD2 4GAZA 1N1TA 1TMF3 4BQ2A 4OQ9A 1X7NA 2ZPXA 1TG7A 1LNSA 3AVRA 4OI2A 1KRIA 3JQXA 4BIOA 1JYXA 1XE7A 3MV01 4JZRA 5GZFA 2IWGB 3CZUA 2I07B 4JGYC 1BEV1 3CU7A 3LEIA 1W8FA 4QQHA 4ORFA 1KQRA 3R4UA 4E8DA 2CV6A 1LHVA 5T55A 1G6NA 2QFEA 4TXWA 1RUNA 2BFUS 4FQZA 2FDIA 1IOAA 1DCSA 5FREA 2E32A 3DECA 3WEZA 2K2SA 3O7OA 1W6PA 1V0AA 2WZR1 2QNKA 2XB6C 4LK7A 1X50A 4K40A 1I3HA 3MYXA 3PMEA 5L36A 3LIHA 2O0OA 3POEA 1GWMA 1OOPC 1DQ4A 1OD3A 1VR3A 5GLUA 4E27A 3AMNA 4PIXA 2IVIB 4TTGA 2PHDA 2RR12 4QXHA 2OZ6A 2J22A 3ZVXA 3LPFA 5FOJB 1ZA7A 2V09A 1Y9QA 4RD7A 4XZPA 1ACCA 1NA1A 1UKGA 2MEV3 3ETPA 4Z2AA 3VHOA 2W95A 3LEKA 3POBA 5T3NA 2GMEA 4JKMA 2VUAA 4WVVA 1GLHA 3FFZA 1GKBA 1ASJ2 4NR1A 3OUHA 3MZHA 1L7RA 1YHFA 2H0VA 4ARYA 1YQ5A 4I09A 4QPGB 3UYJA 3VBSB 1CN1A 3FN9A 4K9SA 3WY6A 3Q8FA 3ACIA 1C5IA 3T08A 5JAXA 3E6BA 1D0GA 2JDUA 3IDCB 5IATA 2WZR2 2P3JA 5KHGA 3AMQA 4BOWA 4LBKA 1FATA 1SHWB 4GQ7A 3K51A 1W0NA 4FTSA 5K0UC 1PGL2 1QJY1 3WLUA 1V6MA 3KVAA 1ZRFA 1H9PA 1WLWA 1I5ZA 3KQ4B 3ZPYA 4MGTA 2OPKA 1RJ7A 2QDNA 1C8M3 2ATFA 2VNRA 3U75A 1D4M1 4YGEA 2OW4A 3WW4A 2DV9A 2BWCA 3WF2A 2IZWA 4I0AA 1G7YA 3O0XA 5DDJ3 4DXSA 3WG1A 5DZEA 5F2WA 4P9YA 1NY72 4R4ZA 4P9IA 4QHZA 1Q8OA 3PUIA 4KL1A 5CIRA 1U5XA 4UYBA 5C5UA 2ZACA 5A6QA 4I2OA 4BQ3A 3LOIA 1ZBE1 3BU0A 2AH2A 2K46A 3UJOA 2B9UA 1AYM1 3IWZA 3POSA 4URTA 2JENA 3K75B 1X8MA 1UOFA 5FZAA 1CESA 3VHPA 1YC61 5ACA2 3WCRA 2JG8C 3K46A 4CCLA 3MIFA 3F95A 3DUIA 3WHTA 1GUIA 2HWF2 1OHFA 1PGL1 3OGGA 1Y9GA 1KXGA 1W6MA 4RR3B 2YUEA 1DU3D 3RPQA 2KXLA 4Q4X2 4YGDA 4GH4A 3U78A 4CPBA 5C4WB 1WCDJ 1O4ZA 4CVUA 3BB6A 1YRZA 1RVF1 3CLPA 4MHUA 2B4KA 3NNGA 3J8F2 4XILA 1GP5A 4KH9A 4QM8A 4GULA 1NLRA 1O6UA 2ZA9A 4YM2A 5FR3A 4IEUA 2E33A 3AJZA 2BVVA 3SLIA 5EQUA 1ULOA 2D6KA 2Y6LA 3FUQA 1QQP2 2EXJA 3WQBA 2YPDA 4SLIA 3VKMA 4A45A 3ABZA 5FZOB 5C6CA 1HJGA 1CJDA 5J37A 1CAXA 2AYHA 2V4VA 4LJHA 3U0ZA 3KT7A 2DVDA 3SMHA 3AKQA 5J96B 4XYXA 5JOXA 3N4MA 1D7PM 1VRBA 4GA9A 3U37A 2W91A 2F4PA 4PQQA 3TNPB 1DHKB 2GNTA 5BNOB 3BUCA 5FPXA 2O8QA 1OPMA 4QB2A 3W59A 4NVPA 4XXAA 1S0GA 1W90A 4LBNA 4L0PA 4LQRA 3MIDA 4Q4X1 2GDFA 2X05A 5FQ0B 4MV2A 4PCRA 4HG6B 4EN8B 2BW8A 1S2KA 2Z42A 2N7GA 3KV4A 1QXRA 3J8F1 4FP3A 1XE8A 1YQ8A 1SPPA 2WO3A 5FZMA 4NUBA 5A80A 5LY1A 1BKZA 2VQAA 5ERLA 4AI2A 4CDWC 2VUDA 5JZGA 3J7HA 2BGCA 1BEV3 5C8WA 4EWAA 5JOYA 2YG0A 2ZGOA 3NNFA 4AQSA 3RJRA 1HB1A 2UYAA 3TEYA 5CFDB 3IIAA 1DQ5A 2VCMA 4UBHA 3EXUA 3H0OA 4CEWA 4K6BA 2J1RA 2Y6KA 3VLBB 4CEYB 3LEMA 4LPLA 3M3CA 4N8MA 2ZGQA 4PHZA 2G4IA 5FPUA 4LBQD 1RYYA 3ZKYA 5IVEA 5IHRA 2K0GA 5G05L 3VKNA 1BMV1 1VAKA 3DKQA 1AHSA 4CDUA 4E4ZA 1IQDC 1RINA 4RL7A 4CXWA 5LBFA 1DQ1A 3N9PA 4WM8A 4C0BA 3OOXA 3ZDSA 1AR92 1XB9A 2XLAA 2A70A 2D40A 1Y3TA 1W39A 4LHNA 4CCMA 2HWD2 4Y1XA 2WWUA 3KMHA 1QF3A 4QGLA 1CD3G 1OLQA 4SBVA 3VBRB 4P02B 2Y64A 1W03A 1O4TA 3H50A 4IV3B 3RMXA 4EN7B 4HKOA 5C3SA 3CBNA 2VZ1A 1UU5A 2BTVC 5A7WA 1J3RA 2W1UA 3KZ4C 2FHRA 1OA2A 1W28A 1AX2A 1XNTA 4FPLA 1W6QB 3DN7A 4YVWB 1ND3C 1NZIA 4LIUA 4FI9A 5FYMA 3C3VA 4YM0A 2RS12 4BMEA 1RUJ2 1MVEA 4ITCA 4AR2A 3T30A 2QKDA 2A3YA 3KF3A 2XLGA 1UXZA 3LAGA 3O1OA 1BMV2 2CWSA 1YI7A 1WW7A 1FPN2 1E5SA 1PO13 1YJKA 3HQRA 3VBSC 2CGPA 2RS52 1RUH1 2V5YA 3OY8B 4CUBA 3LPGA 4HK9A 1XU2A 4QX8A 4TSVA 2WAOA 3B00A 4CU8A 2VGDA 3LWCA 1LHUA 1RMU3 3WDUA 2ZX0A 5JXGA 1AR73 2HLEA 2ZS6B 4AFDA 4D7YA 3VD5A 4Q0UA 4RN5A 4HSJA 2VTXA 4B4PA 3N3HA 4XDPA 3C7GA 5L9VA 4C8DA 2A1XA 3AZVA 1PO11 3K2OA 2HWF3 1QJX3 1YWKA 3MICA 2X53S 3PUHA 2RVAA 3DV8A 4QHBA 5ACA3 5ABJA 1VBB3 1OPOA 4IL7A 2UU8A 1RMU2 4UT5A 2R042 1DGRN 4ZY9A 2FCUA 1ZM1A 2RS51 4BHPA 1JYWA 4XZUG 2GP3A 3H1YA 4K1ZA 1C8NA 4LO8A 3EHKA 2ZTNA 2VOXA 4N53B 5DG2A 3WDVA 2JG9B 1J83A 2P3IA 4XHXA 3WP5A 1MS5A 1NCQA 4I02A 1QJU2 5A7NA 3CZJA 1ZREA 3PURA 1JS9A 3MO4A 4I30A 2LROA 1ZZ8A 1PGW2 5H9RA 1SBFA 5CEHA 1AR81 3Q8AA 3HBKA 3VZOA 3T0DA 2LM3A 2J7MA 5IUQA 4ZXEA 4ONUA 3VDCA 4B1LA 4M3CB 3JBG3 5EPAA 1OQEA 4CSWA 2VMFA 3NV2A 4LLFA 4XAEA 3ZYRA 2WT1A 4JAAA 2Z2SB 3FZ3A 4PI0A 4Q5OA 1H0BA 2PHWA 1WZXA 3UL2A 3AZZA 1EV13 2B42B 2A6ZA 4J1XA 3MW4A 4OLLA 2G1MA 4OZXA 2DCJA 2AGSA 5CG8A 3D0JA 4RFT0 4ASMB 1W2NA 3E6DA 2Y60A 3HR9A 3H8RA 5H9SA 3TN93 4KU7A 1VRH3 2D6PA 1J1TA 1DIWA 5F39A 1RVF3 2QQVA 4YWAA 3VZLA 1LB2A 4UF0A 5CAZA 1BVVA 5LRSA 1JYNA 4MUVA 1IS6A 2R6QA 3HNBM 3EQEA 5BYNA 5CA6A 4X6RB 1NE6A 1O7FA 2FZ1A 3CHXA 1PGW1 4NWVA 5FZ6A 4B7EA 3IMMA 4XUQA 5FYSA 4ES9A 1SZBA 2IXCA 5JZGC 3HNYM 2VMGA 4HN1A 5FZEA 2GZWA 2QCSB 5FZFA 3NNJA 4YLZA 1FX5A 1XPWA 2BGOA 2Q5TA 3M3EA 1LOAA 2VBPA 4ATEA 4HPKB 5DUVA 3JXSA 3ZXKA 1Q8QA 5E8AA 1PK6B 2GALA 1MS3A 2GH2A 2ZX3A 4YW2A 3WP4A 1LTEA 4LHSA 1W6OB 4LLOA 4P5YA 3K48A 2WNEA 5DZFA 3KHBA 3WDXA 4FPFA 2FDHA 4L8QA 3GM8A 4QQPA 5LZ6A 2BV4A 1RIRA 1UN1A 4QX3A 5B4NA 1PIV1 2IXKA 4QXCA 5C4WA 1SFNA 3LSDA 5IJRA 2WFF2 5HCAA 4KQ7A 2QUOA 1Q8SA 3QCWA 5KHHA 4AWDA 5HV0A 5DQ0A 4KGGA 5I91A 2WINB 2AUYA 4N9IA 4OHZA 2JB4A 2Q8EA 3FBYA 3ZM8A 3K4AA 1CX1A 2ZEXA 1NLSA 1W2UA 4A44A 3AKRA 2EXKA 5K8SA 1OLMA 2RJLA 2CDOA 3ON7A 3RI9A 1RUC2 4BQXA 4LNVA 2BGPA 2RR11 2NN8A 3VBRC 5JMCA 2VD7A 3H42B 4O65A 3PUAA 3HWJA 2DU1A 1AYM3 3R4SA 4OCTA 2JG8A 1UPSA 5CG9A 2VTFA 2YXSA 3GHMA 5FPZA 1ASJ1 1FT9A 3ASIA 4LBLA 1HX6A 2DF7A 4Y24A 3ZMNA 3C7EA 3ZYPA 4XTPA 4GKYA 5T5LA 1W0PA 2BOJA 2D6MA 3KT1A 1ZZBA 4BYYA 1VMFA 1GNYA 3V65A 1H8TB 4YG0A 2EF6A 2WT2A 4LEJA 1GBGA 3FUOA 1GYKA 4AI1A 3NV1A 5KXEA 3CJIA 5F3EA 5HCBA 2VVDA 5LK7B 4EZHA 4O9EA 5JZGB 3DF0A 3AP6A 3M4FA 3LOBA 1QNWA 2ARAA 1FMD1 2W5FA 1W2OA 1RUC1 3LFIA 5T54A 4L2NA 5DAXA 4JVAA 1GP4A 3ZSLA 3S0MA 4C1WA 1J3QA 4WV8A 1GNZA 2HYXA 1REDA 1LOBA 3LQCA 1ZBA2 4YVSA 3O1MA 1ZYBA 1XNDA 2LS6A 2R073 3O5SA 4H7LA 4IE4A 1EV11 3OPWA 2HJIA 3AMPA 3NNLA 4XFGA 5C4WC 4JGZC 4XFIA 5DUWA 2FDFA 4FTEA 5FXVA 2PHUA 4IQPA 1N3QA 4M4PA 5FK8A 1QU0A 3J7MA 5GLVA 3SC7X 1BHGA 3VGIA 2XL9A 3DXTA 4HT1T 5A3UA 2FD8A 2P3KA 1PMJX 2WRAA 4XACA 1H2KA 1S0EA 4L97A 3ZFGC 4HBNA 3GNEA 1MACA 2BNNA 1Z7S1 3HMYA 3V64A 4F83A 4EZ4A 1VP6A 2Q1MA 3WP6A 4LBJA 1Z0HA 1HRV1 3KCCA 5FO7B 2FZ2A 2W46A 1C3HA 2VAUA 4FCAA 3WXPA 1RVF2 5LA2A 1BXHA 2PA7A 5FMCA 2YFZA 3ZN4A 4YNIA 4M0NA 1JI6A 4RGKA 2WNVA 3FHIB 4DOUA 4BK5A 1R1A1 4UFIA 4HSLA 3B93A 3WNNA 4IE6A 2AENA 2BNOA 1Z7S3 2CWMA 2Z4FA 1EV12 1QQP1 3DYMA 3KV6A 3PU8A 4R9DA 5FIXA 2DUQA 5FZ9A 2DBIA 4N43A 2W3JA 1V6OA 3PVBB 2OS2A 1KD7A 1H30A 1OF3A 2R0FA 4RGGA 2ZGTA 5JCTA 1T2XA 4M3CF 2VU9A 3OEAA 2A3WA 5FAXA 5T5PA 4Q4Y1 2VQ0A 3KD4A 4N53C 3WX5A 2PLV2 3OBTA 3UKVA 1SLAA 4K21A 5FPAA 4XF0A 1R092 2QQLA 1ULCA 1XC6A 3GYDA 2O8OA 2OQ7A 2ZBJA 4LHKA 3M8LA 4BLIA 5A1LA 1NQJA 1VJ2A 5HXMA 1W06A 1JBCA 3E5XA 2VOKA 4HANA 4K3UA 1OOPB 2JG8B 4PLOA 4YG3A 1CAWA 1WUVA 3WW3A 1CGPA 3NSTA 3EYPA 1OT5A 1A8DA 3T2TA 4AG4A 4CCJA 1JTZX 5A1FA 4XOGA 2BPA2 2V4AA 3RG0A 2C4XA 2BVBA 3ZIWA 1V6IA 2WYFA 1UYPA 4CDQA 1OQDA 2H6CA 2ID4A 3RZJA 3GALA 3ACGA 2HBTA 1A6CA 4Q4V1 4RS5A 1VE0A 1Q3EA 3M3IA 4Q0PA 4AHYA 5AFEA 4QM9A 2ZAAA 3SNMA 2TNFA 2WS91 3BIEA 5IK8A 1WBFA 4CRQA 4WM7A 1R093 1COV3 2VMIA 1GWKA 3GHNA 4KWUA 1YI9A 3MPBA 1XSQA 1AL22 5A7PA 3EB7A 3IDEA 2YY1A 2R30A 4I0BA 5EJ3A 3RWKX 3WDYA 5IYYA 4OVEA 4PT6A 1AF9A 4WZCA 3UKTA 2XOMA 4Z8BA 1RUG2 2BQPA 2ZKLA 3W58A 2C9KA 1E57A 4IE7A 2W87A 1IPSA 1CVNA 1LECA 1JU4A 2ARCA 4O7XA 5F6LB 4P08A 4RYDA 5GZGA 5FZHA 4N90A 3RYPA 3MIEA 3KHCA 3ME2A 4WM7B 2W47A 4XMIA 1MS9A 3J9SA 4YW4A 3RJ2X 4XJ9A 1BBT1 4DRVA 3I54A 5E1RA 4C91A 3LKJA 1ZRIA 4KNCA 1NKGA 4D6RA 2VO5A 1WD3A 5F9TA 5FV3A 1QH7A 2XUEA 1MQTA 2P1BA 2WNVC 4AAXA 4BM8A 2X10A 2YC2A 3SKVA 2W08A 1JOBA 2Y26A 1RUJ1 1AYN2 1LOEA 4LO5B 4MYEA 4ZONA 1LEMA 3WHUA 2WL1A 5FCCA 4XFFA 1MZFA 5LA0A 3B02A 5KC5A 3N9MA 2RJKA 3POWA 2GC3A 3H3LA 1KS5A 2C0ZA 2VE1A 4M0HA 3RSJA 2CAUA 3ZDVA 4IDZA 4XFHA 5L19A 3GBGA 3R0RA 3PHMA 5F5QA 3ZLIA 4CCEA 1RUI1 1GZWB 3EJKA 2VZVA 3PUSA 4FXGB 3ZYHA 4CDQC 5FOBB 1PK6A 3AC0A 3JQWA 1VBE3 1BBT2 2XJTA 3TN91 3ZIXA 5A3PA 1PGSA 3MW3A 2W52A 3I59B 3OTFA 4CU6A 1AXZA 3FX3A 4WBBA 5JMOA 1NX9A 4I0WB 2HWB1 3WF4A 4EROA 2UY8A 1H9WA 1HDKA 2VZSA 1SDWA 5FY5A 5FY1A 3USUB 2ZHKA 3AZWA 1UD1A 4BE3A 2R041 2R1DA 4UBGA 3O0VA 4DPNA 2XJQA 4N53A 1YJLA 2DFCA 5A3MA 3MUZ1 4JRLA 5LEKA 1BJQA 2R043 2R062 4QAWA 1DYPA 5JSRA 1OC1A 2ZGMA 4XVHA 1OSGA 5FY9A 1HW5A 2PHRA 4ATFA 1RUI2 5FUPA 4IEPA 3GCXA 1DLLA 1WLCA 2Q8OA 3USUA 1ND2B 1AR82 4DXZA 4AVAA 3RZMA 2ZMKA 1JHJA 1SBDA 1XNBA 4Y22B 4BQ4A 2D6NA 3ILRA 4YYOA 1QGLA 5FY4A 1QOOA 2OYZA 1Z78A 4QPGA 1W8UA 2NZ9A 4IGOA 3PVOA 1K5MB 3A21A 1AX1A 3H8UA 1CIYA 2ZEYA 5L9BA 4FFIA 2CL2A 1F4HA 2VZPA 4XE9A 2V72A 3WSOA 3Q8EA 1REEA 2QQNA 4P00B 3MUY1 4IE0A 2QZ3A 4OUSA 5F3CA 1GMMA 2RS53 2WO1A 2ORXA 1FOD2 1RHI2 1APNA 3VDDB 4RQPA 5AC93 1GR3A 2WO7A 2ZJCA 1TQ5A 4URAA 3ILFA 3TYJA 3PJQA 3CEWA 1K5MA 2XHNA 1ENXA 2SLIA 4Z2WA 3NKGA 3MHZA 3AYAA 4JGZA 3CNAA 4NRMA 3S5AA 2F4LA 4AI8A 5A3NA 2QQPA 1OURA 3ZFEB 1NA1B 3HD8B 4JGYB 1JHNA 4CTEA 1VBA3 4MLOA 3GBFA 4P9LA 2OPWA 3BIWE 4C1XA 4RQPC 1RXGA 1COV1 5JUVA 2E31A 2P6CA 1E5HA 3C2UA 5F6KA 2ARXA 2VZTA 2JG9A 1UIKA 1U0AA 4A6OA 4DEVA 4AEJA 1N1YA 1GOGA 5FBJA 2B7YA 1WGPA 3K4ZA 3J26N 1CQ9A 2Z79A 3L2YA 1AUYA 1W9FA 3BTZA 1YQCA 5C71A 2XJPA 1ZZ7A 3ZXEA 1F31A 1D2SA 4IEVA 1AX0A 4XFCA 4QDSA 1GQGA 4B4RA 4YARA 3K77A 4R4XA 4R9CA 4XJWA 2WFPA 3NJYA 3OYWA 1DYOA 2CYFA 2WFF1 2RM21 2YV8A 5IVYA 3WZ1A 2GMPA 1OLRA 4AZZA 4FOYA 1W8OA 2J1UA 3HIFA 4XDOA 4CDXC 4OMCA 5DABA 2D44A 4EN6B 4PIZA 3Q9OA 4FFFA 1QJY2 3CMGA 3IAPA 2VMHA 5JR2A 3BTAA 3FLTA 2ZGRA 2W9XA 3WF1A 1G8WA 4FAHA 4AVTA 2ZGNA 1EPZA 1AXKA 1WW4A 1VBC3 1C1LA 1SG3A 4QB6A 1D4M2 2NMNA 1DP0A 1POV1 1O3TA 2Q8DA 2BOIA 3I3EA 1RB8G 2B39A 1QQP3 3SCGA 1RUF3 4A3ZA 4QPIB 2JDPA 2WWJA 2Z5WA 3ZYGA 2EALA 4H55A 4XQDA 4XQWA 3QLQA 3SH4A 1QJX2 1T6BX 2YU1A 3KWVA 1W8NA 2RS33 3DGTA 3ENRA 4O61A 4RR3A 4V1PA 5FQ0A 3B7MA 1W6NA 3RS6A 5IVJA 4IETA 2PAMA 4NPRA 1QJEA 2VVEA 5FRAA 2RM22 1DGLA 3QD6A 4RGAA 1DLCA 1TMF2 1WKYA 3GZUC 5FUNA 3TWIA 2LRPA 5SV5A 3AP5A 2V5DA 3KM5A 1HIXA 3D0SA 2OA2A 3WNOA 3ZMOA 5CADA 5EZWA 1NA1C 3SCHA 1W3VA 4JDNA 3RWNA 2G9FA 2E26A 1IS4A 2W68A 4XUOA 1HN1A 5FZOA 4CU9A 1G9CA 4FPKA 1S4CA 1ND2C 3D6EA 4JTNA 3EBRA 1UNBA 3VHRA 4ZXKA 3RMYA 3RYKA 1UY0A 1ULEA 1O3SA 3KCYA 3NNMA 3HT1A 4WVMB 3WNXA 2VCBA 4N9HA 2YDEA 5JI7A 4FAGA 2JB8A 4G3YC 4Z07A 4NHYA 3I2HA 1TVGA 2GH8A 1TME2 2F17A 3J7NA 1UU6A 5FXZA 1V00A 1QMJA 1RUF2 4AGVA 3AXDA 4FP2A 4QPIC 2ZEWA 4OUMA 5JR7B 5EXOA 5KR7A 5CFCA 1N1SA 2R7EB 4AE2A 2JJ6A 4BJ0A 2P6HA 2OQ6A 3OUJA 3CF6E 5LA1A 2R1BA 3HQXA 4D6SA 3R4DB 2A6XA 1DZQA 2GP5A 1XU1A 1Y9MA 4ISQA 2AEZA 4HKLA 3VBSA 1KFUL 2GNMA 3AM2A 4GJZA 1KS4A 4JTOA 5KXCA 5A3TA 5EV7A 5A33A 3ATGA 1IGOA 4B7KA 3OD0A 4Q0VA 5L7OB 1GWLA 3IDAA 2TBVA 4IXLA 4MX3A 4XPVA 3I2GA 1WA6X 5FZGA 4RS5C 1SFPA 2AR6A 2VW1A 4LO7A 5I8YA 1Q5OA 5IFTA 2YGLA 1JZ2A 1SPPB 4YW6A 4Z1VA 1BK0A 5DDJ1 1HKDA 4Y1UA 3RZGA 2OUJA 1BCXA 1AR61 3MFAA 1VBA2 2D3RA 4BZ4A 3S7IA 2RR13 3B9CA 3O1VA 4NRQA 1XJAA 1WMFA 1ZBE3 4LULA 1OKQA 2JDNA 2QQJA 5IK5A 1US2A 3T4HB 5FZ7A 2A71A 3QBQA 2X09A 2W94A 4IEZA 4KG8A 1ASJ3 1ZZCA 3A22A 1S2BA 4Q8LA 2A6VA 2DUPA 3I59A 3JB4C 3LEGA 1D2QA 2MEV2 5FYVA 5IVCA 4OHYA 3NAPA 2EIBA 2LTNA 1C8M1 3ZFGB 1GQHA 1HB3A 1W8HA 2GC0A 1BVP1 2JDAA 4CEWC 1TME3 1X82A 4GB33 2Q1FA 4X6QB 4DUWA 5KBFA 1EUTA 3QH6A 5CU1A 5BNPC 4QU1A 3GGLA 3GBWA 4HMZA 4OMDA 2WKKA 5DUXA 3FWEA 1ENRA 1AR62 1NT0A 3WF3A 3Q8CA 1ULFA 1JW6A 5IFPA 4M3CE 4W4ZA 2VOTA 3N7JA 4QKDA 2WAAA 5I0TA 3VUOA 1VB4A 1BK1A 1LGBA 3KLSA 4BWOA 3WNLA 4NIHA 3L9JT 1ND2A 4AEKA 1WBLA 5FDBA 1AL21 1LHNA 4ZS3A 3GCWA 2UWCA 4EWDA 3I2OA 3KSCA 5C9AC 4KWJA 1KGYA 1MZEA 3LGRA 1ZZ6A 1G9AA 1G9FA 1PO22 2MEV1 3OY8A 5H9PA 1TNRA 1G86A 4NAOA 2BRTA 2RS13 1GP6A 3MIBA 1X36A 3R6SA 4B4QA 2QQIA 2J1VA 5DAPA 3RNSA 1BLZA 5SV8A 3VN4A 4QX0A 4YW5A 1IPJA 2R063 3I3MA 1JYVA 3F2ZA 1MQTB 1WW5A 2VR4A 4M00A 5JOZA 1DGWA 1EAH3 1S0IA 3HOBA 4K8RB 5DAVA 3VBUA 1H1AA 1V6NA 3NVCA 5FZ0A 4Y1ZA 3JD72 3B9IA 4Q4Y3 1AYN1 2IXLA 1NZCA 1UMIA 2VNVA 4YGBA 4F7ZA 1ENSA 2AC1A 1NLQA 5CNAA 1NXMA 3NQHA 3H7YA 1YQ2A 2WBKA 1VRH1 1SACA 3G6JB 3U11A 4MOAA 5LASA 4QU2A 5F5IA 2B5HA 4FSJA 3P1IA 4GIQA 4QX2A 1QJU1 3OEBA 1HXS3 4NHMA 4O9GA 4Z82A 4YVSB 5J1XA 3BPZA 5C3OA 3MIGA 3CKHA 4JCKA 4UFMA 1MEC3 3RZLA 3O12A 5FMDA 3CL1A 3OPTA 4IGQA 1WMXA 3N35A 1DQ2A 1R1ZA 4LORA 2X5IC 3CDZB 1CZVA 3TRSB 1X9TA 1NG0A 2GAUA 2P2KA 2YFUA 3RZHA 3NJXA 2JDZA 1B09A 2KD7A 2MPFA 1FV2A 2C26A 1ZBA3 2J1AA 3VBRA 1QH6A 5A32A 1RUG3 1XBFA 4LBQB 1JYIA 2ETEA 1JOPA 3NMBA 3ST7A 4D6QA 1ZA4A 1W2AX 4GWJA 2HH9A 2WNVB 2W1SA 4KWLA 2CGOA 2XBO1 5FZKA 4XF1A 4ARXA 2QJVA 2WLQA 4GMP1 4UF0B 4D7SA 5C9AB 1MS1A 4P9WA 3EMRA 3NKTA 5GZCA 5C5TA 1CR7A 3ZSMA 1HJFA 5A6YA 1OFSA 2JXAA 1K5MC 3AMHA 3IZOA 2VCCA 3PVEA 5C8CB 2BBVA 4GWNA 1ZVFA 1S55A 3RZKA 4YFZA 4W6WA 1J3PA 2B9VA 3MI8A 1UYZA 2QE3A 2VZOA 3N7MA 3PIGA 5D8AA 5DG1A 3H8XA 1O3QA 1JXNA 3B3QE 1ND3B 4XFBA 4E4DX 3BYWA 3ZYIB 2RDNA 4ISRA 1QJZA 4CP0A 1L3JA 1OQ1A 5BPXA 2V73A 3BKZA 4MO3M 1PO23 2E63A 1HRI1 5GKAC 3PUQA 3DEMA 4PF1A 4RQPB 1DFQA 5FY0A 4A3XA 2ZEZA 4XJ8A 1OVPA 2HWC3 2YBSA 1UKRA 2DTYA 5FZ1A 5ISLA 1RHI1 4BXFA 1OOPA 2D7FA 1W6OA 2UY9A 2IUWA 1ZZ9A 2Y6GA 1V70A 2XUMA 3ZKUA 2BP6A 2BFUL 1YUDA 3NV3A 4HONA 2ZAHA 4Y20B 5B2GB 2PAKA 4XJAA 1VBE2 4D3WA 1W9SA 2A6YA 4AGGA 4TZDA 4XFAA 1MEC1 2PFWA 1MS4A 5EHDA 5T50A 4HETA 1FYUA 1QNYA 3VDDC 5C3QA 2DVFA 3SQOA 3BGAA 2YROA 4EWEA 1WA4A 5FZDA 2QQOA 5JVVA 1NCQB 2PELA 4JDOA 4JQTA 1ST8A 2WO2A 5GLZA 3ALQA 1GQPA 3VBOB 2BUKA 2XKOA 2PLV3 4XJZA 1VBD1 1VPHA 4YGCA 3SCFA 1L7LA 2P4EA 2VNGA 5K0UA 1HRI2 3W9AA 3G7DA 1I1EA 1XQNA 2ILMA 3FBMA 1Q43A 2EXIA 3NJVA 5F2SA 5JSPA 5A6XA 1K12A 1W9TA 5LBBA 5G04L 3O14A 4LA3A 2Y33A 4YSFA 4NRPA 1GOHA 1X9PA 2YZ4A 3I3QA 4DNYA 4XC9A 1SQ4A 4W8JA 4A2UA 2A7AA 1H8TC 1W04A 3VBOA 5F7UA 1PK6C 3L2HA 4W50A 1OH3A 4E2QA 1N3PA 5KHJA 4IW3A 4I3GA 3PLQA 4CCCA 3OG2A 4COWA 4FXKB 1PM7A 2XVLA 3N7KA 2ZHNA 3O1SA 4G9SB 3AVSA 5CB7A 2WZ8A 3C8XA 4MADA 4GZ9A 4QX1A 4DXRA 2GSYA 1DZRA 5HV4A 2BDRA 2Q1ZB 3GJBA 4INDA 1JZ6A 4Y4YA 4NO4A 3RYRA 4Q4W1 1WCUA 4AI9A 2WC2A 1AL23 1QOSA 3ACLA 3LE0A 3N9OA 3ZFEA 5I93A 1PHMA 1H6YA 1FV3A 1HB2A 1U12A 4NJ4A 3WDWA 5CISA 2CGNA 3BTXA 3WW2A 2PHTA 5IAVA 1GFF2 3O0WA 4YM3A 2AZ5A 4TLGA 5C3PA 2OVUA 4IEWA 1XRUA 3MF6A 2BNMA 2D5FA 2DVBA 1SMVA 1QOTA 4K8FA 2CHHA 2JEMA 4CUCA 3NRUA 4NAMA 3AYDA 4QGNA 1JYCA 3V0BA 1UY4A 1JN2P 2AEYA 2R16A 1OBNA 3FL7A 3MLJA 3OPZA 3HPNA 4DQAA 3IAQA 5FP7A 2Y6JA 1U5YA 4RSUA 4AEDB 5BNNC 1MZ6A 5HXVA 4UW4A 4ZS2A 2HYKA 3MW2A 5LY2A 1CAXB 3WUDA 4COZA 4WVMA 3X29B 4IGPA 4DS0A 5BUVA 1UIJA 2PHFA 3AFKA 1QDCA 4OZOA 3ZYBA 4AQ6A 5KC6A 4M01A 5H9QA 3OGVA 2ZX2A 2XGXA 4CXYA 1UMHA 2VNOA 4V2WA 5FUIA 5BNOA 4W65A 1OFNA 4COYA 3A7QA 1A8MA 4L11A 3MV11 4Q1RA 5EJZB 1SCRA 1W0OA 5F32A 1PZ9A 1TME1 1H6XA 2J1SA 2SBAA 2VW2A 1D4M3 1H8TA 3BPSA 1LOFC 4OHWA 1QY4A 3EO6A 4N43B 3WQ0A 1AYM2 1GOFA 1MVQA 3VV1A 1HB4A 1Y43B 2YC0A 3UT0A 3CJIB 3USSA 4F8AA 1RUJ3 5ACA1 3SKJE 1QJY3 3ZFFC 1RUD3 2ZGSA 2QVSB 1W2TA 4UW6A 3RZZA 2JDKA 1R091 4ZHNA 4OQ8A 3MGUA 4NIDA 2VPVA 4UFLA 4CDUC 2NQYA 3H7JA 1LR5A 3TB0A 1U5ZA 3VBFA 1DF0A 2GN3A 3QACA 1F9KA 2VXJA 5J36A 5LRRA 3POGA 2BJSA 4BLJA 4YPJA 1LESA 4NIGA 4IEXA 3VDDA 3ELNA 3P3NA 1XYNA 3HQUA 1FNYA 3O1PA 2ERFA 2JECA 4ZZ8A 5FP8A 1X33A 4AK3A 2YMZA 1S0FA 5JDBA 4B1MA 3WUCA 2KR2A 2QQMA 4A4AA 3AL6A 4LITA 1JZ5A 3BTYA 3VBFB 4DFSA 5FYBA 5F3IA 4LBOA 4YW3A 5L9RA 1SLBA 3N9LA 5JIAA 2TUNA 4JQRA 1GICA 1OXCA 4P5HA 3WG4A 4UOJA 3FFQA 1JZ8A 1UY2A 1PVXA 4IV3A 4MGQA 1UW8A 2HWE2 1GSLA 1FPN1 1UF2C 4CUGA 4W6YA 4AVSA 4EYUA 4ES8A 5E88A 2H0BA 4GKXA 1OI6A 1YQ6A 4RA0A 4XF9A 5LWBA 4DRRA 1CAVB 3DXUA 1V6LA 5BNNB 5D8AC 1C8M2 2XJRA 5CFDC 3CJXA 4QPYA 4QB1A 4LK6A 4RHV1 1IZ3A 1PNGA 4LKSA 4XCBA 1N47A 5AFBA 4HFSA 1FNZA 1YLLA 2DCYA 3ZOIA 1EAH2 1SCSA 3B5LB 4HZFA 4JDMA 3MPPG 1R1A3 3MIHA 3PMSA 1ZX5A 3AKSA 3JBG2 4KI5M 4D69A 3H8OA 4DO0A 3A0NA 5T52A 1V6JA 5B4XA 1R64A 4DINB 1DGWX 1W99A 1UAIA 2QQKA 2RS31 3A0KA 5FWEA 5BXXA 4BXSV 1ZRCA 1FAYA 2Y0IA 3OCPA 2R49A 4FOQA 1QJU3 1UZZA 2OX0A 1YIFA 3GJAA 3M1HA 3VKFC 1RUE2 2HBUA 3KGLA 1XE0A 4JX0A 1UYYA 2DYCA 3M3OA 4GH4C 4OHVA 5FP4A 4AVBA 3DCQA 1LAJA 5BY5A 4XIOA 2NMOA 3THCA 3H9AA 2WSVA 3U1XA 3AX4A 3MEPA 4TN7A 1NUKA 1CAWB 2XVKA 3MLKA 4OI4A 2YB7A 4WZFA 1AR91 5FP9A 3VZKA 2QZ2A 2XL7A 5DAQA 4CDXA 1SLTA 4Y5Z0 3E1F1 2D3SA 2X5IA 5KHIA 4META 2VQUA 1H2MA 2QQUA 2WNUC 1QXPA 3J8F3 5CKNA 2H6BA 3T2QA 4QMAA 2XMLA 1SDDB 3I3DA 4WVWA 1EYBA 2LW8A 2VTXJ 5D21A 3THDA 4XEZA 3SH3A 3VKOA 2W0XA 2EXHA 2WDBA 4AFBA 1NE4A 1RUC3 4GB32 3GXUA 2MNGA 2P34A 3M70A 1HLCA 1L7QA 1I6XA 2D93A 1VBB2 2RS11 1JUIA 2ARBA 3JD71 2BZDA 4JC1A 4UFHA 5GLTA 2E53A 3VDAA 5D2AA 1US3A 3N7LA 1FI2A 5F1RA 5A70A 3ZR5A 3OD4A 3IN9A 5GM0A 5DXDA 3RQ0A 3I49A 1QWRA 1FPN3 1QHDA 1SEFA 3AJYA 5HI0A 4C0HA 2VUJA 4UW3A 4ZPIA 1LKNA 3KT4A 3DPRB 4YM1A 1TE1B 3ZXGA 2FMYA 3B69A 1WD4A 1UX7A 2Y8KA 1AR72 3NV4A 4RHV3 1LENA 1W8TA 3JUUA 4LOTA 4MHRA 5GALA 4QDQA 3NW4A 3ES1A 3SXWA 4EE2A 4KG0A 4H7MA 1EP0A 2YHJA 1IQAA 5TSWA 4QQLA 5CFCB 3VKLA 2VMDA 2O1QA 1V9U1 3ES4A 1PO12 4CCDA 4HN0A 3WD5A 1UU4A 2DWRA 1OLME 4GB31 2ORZA 5T5JA 4CP9A 4AI3A 1SLLA 3AKPA 3LA2A 4GXLA 3WG2A 1LULA 3PL0A 2EICA 5A33B 1Y4WA 4IV3C 2ZCWA 1UO9A 2ZMNA 4FPYA 4QPGC 3H1MA 5FMOL 3V0AB 1A3KA 1ZRDA 3UNPA 5JWPA 3O1RA 4XHBA 1UOBA 4YVWC 4A6SA 2PAEA 3HVDA 3VD7A 2XQRA 1GZCA 1UCXA 4N7UA 3WT3A 5BNPA 1DZTA 4QXKA 1GNHA 3IBMA 1NAEA 3HT2A 2WWSA 2Q8CA 2YGMA 1JMUB 4KBBA 4JGYA 5HCHA 4QX7A 4J6GA 3TNQA 3T0BA 3VDBA 1F8VA 3M2MA 4G4FA 4MXWB 4E8CA 3VBFC 2WQ8A 1KJRA 1DQ0A 4JKKA 4LKFA 5LEJA 4LBMA 2Z69A 4QWNA 4NN0A 1RGSA 1CJPA 1VLNA 2XWJB 1LODA 4L92A 4AEDC 4CEYC 4K7JA 4LA2A 5C8CA 4ZU5A 3SH5A 3WNMA 1HV1A 4AHZA 5LW9A 1PIV3 3ZFFA 5JPMB 1CWPA 4XCAA 1WMDA 4Z92B 1HQWA 1CZSA 3DKWA 3OF1A 2D98A 1BEV2 4FPCA 1QIQA 4GJYA 1H4HA 2QBXA 2ZABA 2WIIB 2OIIA 1Q8PA 2XJUA 3TAYA 2KA3A 2XWBB 2K9ZA 2P37A 4P9GA 4AQTA 1TNFA 4XETA 1VBE1 2UYBA 3S57A 1BZWA 1NCQC 1QJFA 1AR83 4XUNA 2A6WA 3THTA 4BIFA 4CCNA 5BNOC 3INAA 1MZ5A 4P9JA 4LE4A 2JIJA 5FLHA 2EIGA 4D7TA 3AYEA 1UXXX 1LJ7A 2VUCA 5FWJA 5K7PA 3MBWA 2WNUB 2XKPA 4TYSA 1W6NB 1PX3A 4DUVA 4IEQA 3PJYA 4XF3A 2HWC2 3MF9A 3RGBA 3SEPA 3I2FA 3VB9A 4MGYE 2D6LX 3T4VA 3DYOA 1PM4A 5LBCA 2WZEA 1OD5A 5CFCC 1VBD3 3RDIA 3OGRA 3KGZA 1GZTA 3AP7A 4LKEA 4QPIA 2VC9A 5J48A 1N3OA 5EJ1B 4DB5A 3C7FA 1UWWA 1CZTA 1PIV2 4Y33A 1Y7BA 2BU9A 2X8KA 2BBAA 4Y5SA 1WLDA 1J84A 5FYTA 2VOVA 4PDWC 2W2IA 3VBUB 2RMU1 2FDKA 5GLWA 1LOCA 1PX4A 4PIYA 4AXOA 3ZFEC 5I0DA 4IV1B 1KDMA 4OI0A 1W9WA 4AQ2A 1POV0 1YEWA 4YG6A 5FY7A 1PVC1 1UZYA 1HRV2 4NOTA 1UY3A 1RUH3 2J1EA 2ZHLA 4MGSA 4Q4W2 4Y20A 3WR0A 5I0SA 2PYTA 1JZ4A 2BWAA 3KQRA 2J1TA 2C9AA 5JLVA 5IVVA 2I74A 5FYUA 4PBOA 2R0HA 4PDWB 2GN7A 1W05A 2YC4A 2XLFA 1M4WA 2EIEA 4MGIE 2EA7A 2VVFA 4UI9L 4YW1A 4EJRA 1ALYA 2VQTA 4MH0E 1B35A 2ZGPA 2PMWB 2GC2A 2RDRA 1H8VA 3KV5A 3ACHA 3ROUA 4BISA 4WM8B 4HL0A 1ZBE2 5EYYA 4CE8A 4RR3C 5J3UA 1K42A 1POV3 2JD4A 3WCSA 1IS3A 3I7DA 3FHAA 1ZNPA 3RVHA 2PLV1 2RHPA 5KXDA 3HN1A 5LCWL 5IK7A 1O4YA 1S0CA 2Y6HA 2HWF1 4XURA 4CEYA 2A5ZA 1N1VA 1RHI3 1XNCA 2WS93 1KDKA 3UGHA 3AYCA 5FO9B 1F35A 4AFAA 2XBO3 1HRI3 1W6QA 4BB3A 5A7OA 3E6CC 3ZSJA 1T6GC 4BQ5A 1LU1A 3RFRA 1WCSA 3ZFFB 3GZTB 5FZ8A 4Y26A 1NCRA 5CKQA 1R082 4BU2A 2FBEA 3QH7A 2VMEA 2XH6A 3DYPA 2OUHA 2Y38A 3QOPA 4FFGA 2ES3A 1H2LA 2ZGKA 4MGZE 4IEYA 4N43C 4V2VA 2ZGLA 2PXJA 3IB3A 1GANA 2WR9A 3C7OA 2NYYA 1VBA1 2E7TA 4ZU7A 4S2DA 2DFBA 2NM1A 3CIHA 3PTYA 4UAPA 4CDWA 2WLPA 1JZ3A 2DCTA 1PVC3 3BOWA 2JE9A 3FC0A 2FQPA 4FPHA 4Q27A 3MFCA 5D8AB 1OF4A 5FMBA 2VM9A 3HBZA 3HN3A 3M7AA 2CY6A 1REFA 3VZJA 3ZN6B 1IG3A 3S7EA 2XG3A 5FZ3A 5KWRA 3T2OA 2Y34A 4FPOB 3HAGA 4AW7A 4PBPA 2JG9C 2QQWA 1RUG1 4Q4X3 2GNDA 3ETQA 3LDKA 4QT6A 3BU7A 1XYPA 2WQ4A 4PLMA 5FZIA 1R081 1NOVA 2CTVA 2YPJA 4GMP3 3KCXA 3AK0A 5A7SA 2XVGA 3H1WA 4CA9A 4S2HA 4QPWA 5C7GA 5IVFA 4XJUA 1SLIA 2DURA 4XUTA 3VL8A 4FPJA 1PMIA 3AFGA 2RMU3 1C28A 4CEWB 4YVSC 4AAPA 3LZZA 1OUXA 3N9QA 1KEXA 4BPZA 4FFHA 4QKNA 4XXPA 1Q56A 1UQXA 5DZGA 2BYVE 1RUE3 1LGNA 3NO8A 1QDOA 3RRDA 3WP3A 3ZSKA 4CCOA 1UPIA 4FPGA 3U4SA 2XR4A 5IVBA 1D0HA 4LUKA 3UETA 4JHTA 2UWBA 4UFKA 5F5AA 1KFXL 5A3OA 3W21A 3T2PA 3ZXAC 1AXYA 4R52A 4UXAA 4CP2A 1S1AA 5DMYA 3CJIC 5K0UB 1UOJA 2FDJA 2YU2A 1H1IA 2JE8A 5JIUA 4LOSA 3SHRA 4BQ1A 4HKWA 2QDRA 4NIAA 1OVSA 1O5LA 2Q0AA 3WNPA 4BQWA 5ANNA 3WG3A 5L7OC 4Q0SA 3DPRA 5A32B 5LBEA 1VB2A 1OMIA 1ULDA 1YFYA 3FHQA 1EAH1 4UWDA 5HCFA 4CDUB 3O1UA 4C90A 3AZYA 3DPRC 3WINE 1LEDA 4FPEA 3HEIA 5FYYA 3TN92 4L9BA 5IK4A 1NQDA 4BA6A 3M3QA 4E2GA 2JDYA 2GMMA 3BI3A 1LHWA 1ODMA 3LA7A 3T3YA 3LFMA 1OUSA 1ULGA 3U07A 2VJXA 5I0RA 2WS92 4LO6B 1AYN3 4DEQA 3P5BA 2VY0A 4WVZA 3OB8A 5E89A 1LOGA 4BCUA 5CZKA 5FZLA 5BNPB 4XABA 4COVA 1UZWA 5D1IA 4QGMA 5FFOC 3S6PA 5FO8B 4BDVB 1RUH2 4NMIA 4OULA 5JSOA 4LT5A 4K1YA 2R061 4Q8KA 3VBUC 1NCRB 4QDRA 1AVBA 4A41A 4AHXA 2WA4A 3OGJA 5F3GA 1JU3A 1UMZA 2D3PA 1LCLA 3ZX7A 1RUD1 3J7LA 5BV6A 2VW0A 1QXJA 1FOD3 1ODNA 2FCTA 2W1QA 4B3NA 3GF6A 2IC1A 4X8PA 1B35C 3UGGA 1GU3A 3OSDA 3UV9A 5FY8A 4R9BA 3APBA 2CSGA 5JXJA 3ZN6A 4JRAA 3Q8BA 2AREA 5C9AA 1UL9A 3B94A 4DIQA 1GZWA 2WNOA 2NPIA 1KITA 3D3AA 1VIWB 3I3BA 1OH4A 3LB9A 4DZGA 3BN6A 2VBBA 3FJSA 1FOD1 4PQ9A 4Q1PA 4A7YA 4CZSA 4CU7A 2E9QA 4YW7A 1IS5A 1QEXA 1WW6A 3LF7A 5HPOA 3POYA 3A4UA 3IPVB 1VMHA 4IEOA 5FMOS 3ZXJA 2VH9A 3I4IA 2TEPA 3BVCA 2D43A 3I2KA 4IE5A 1DG6A 1RUD2 2FMDA 1MS8A 1HQLA 4ASLA 5JOWA 4FBFA 3WNKA 3ZSEA 1F2NA 1WMEA 1DDLA 5A7QA 1VMJA 1W3XA 2JDMA 3CQOA 4HXCA 2EAAA 2VL4A 3GDBA 4YZ3A 3WV6A 4GWMA 1W9YA 5DUUA 1IKPA 4ZZ5A 2O14A 3NAPC 2HWB2 1CPMA 2JIGA 2OXBA 4LMFA 3J4UH 3IPVA 5J98B 1C5HA 4JGZB 3GZEA 4A7ZA 3ZO0B 5FYCA 3W20A 3THPA 3JZVA 3SISA 1I5PA 2VG9A 3VZNA 4MG2A 1RL3A 4QQOA 4GMP0 5C70A 2XDVA 3FMGA 4B8EA 2WSUA 4QKFA 4XTMA 4Y22A 5A1AA 3I97A 1DBNA 2UWAA 3AKTA 4IESA 4XDQA 5CYYA 2L9LA 5LB6A 4E4SA 4FOVA 3AZXA 1LOFA 3T09A 4A7KA 4KU8A 5J7MA 3U14A 4H3WA 3JB8A 1H2NA 2JICA 1DGRA 1AR93 2X29A 4L99A 3N9NA 2GU9A 1CPNA 4D0QA 3OJBA 1JYTA 4Y4RA 3ACFA 4S2GA 3BODA 5AVPA 4YZ5A 1MEC2 2YBKA 2ET7A 1GV9A 1O8PA 4FOWA 1W6PB 4LUMA 1CX4A 1F5FA 3LA3A 4S2FA 4MXWA 3OBAA 4CPBD 2DCKA 2R072 3LDRA 2C1FA 2EIDA 3K3OA 5HBAA 2VZUA 1B35B 3ITQA 4OUEA 4OYUA 2WYSA 1SFYA 3CO2A 5AVAA 4Q29A 5DAWA 2ZZQA 4Q2FA 3ZXDA 3BALA 5A3LA 3UESA 2VZQA 5EFUA 1JODA 2E6VA 2XHKA 2HEWF 3OBZA 3KVBA 5I8TA 5FJHA 2DVGA 1CAVA 1LRHA 3ZXFA 3E5UA 1HQNA 4YRDA 2CDPA 3URFA 2WN2A 3VBHB 2ZGUA 1QJX1 2PTMA 4MZUA 2FDGA 4K20A 2HEYF 4GH4B 2RG4A 3P3PA 4I01A 2P3YA 2WZPP 4COUA 4UW5A 2QTWB 3TEXA 4RFRB 1PMHX 2VMCA 4AL9A 5J09A 1TMF1 5FYZA 3MLLA 3NL1A 4HVOA 1UZVA 2UURA 3MDPA 2E51A 3VD4A 4YVWA 1HRV3 4B29A 4P9XA 3VD9A 4GALA 5I0UA 1COV2 1QKQA 3E5QA 2R071 4HOOA 2NLRA 1VALA 2ADEA 2W39A 3I8TA 4PLNA 4AOCA 3TBDA 5A3WA 1UYXA 1G9BA 2AACA 4LXLA 3VD3A 3WDTA 1UX6A 4FTBA 4AYUA 2HWC1 3OYWB 3TEZA 2J42A 2DVAA 2BEOA 4PF5A 1UOGA 3T1MA 4NPLA 2C24A 3ZYJB 4CCKA 4IV1C 3ZFGA 1FMD3 1KJLA 2CU5A 2X5IB 3AP9A 3UGFA 4JHZA 5FXWA 4CDXB 1YFXA 1NY71 2D6OX 2IXHA 2XXZA 1EY2A 3OGSA 4NHLA 4PI2A 3SITA 3WOGA 4R8HA 1S0DA 1XNAA 3KS7A 4NWWA 2BERA 3IIIA 5FJKA 3VBOC 2ZX1A 4HVRA 5KXBA 3TEWA 1HV0A 1RUF1 4HPKA 2RM23 4UFJA 4ET7A 4OI1A 1CIWA 2WFF3 3C7HA 1CONA 3LSEA 4IERA 2IFRA 5F8PA 1AJOA 1C1FA 2PHXA 1O59A 1RXFA 2RMU2 2DU0A 2XJSA 1S2EA 1VBC1 4FQ4A 4H14A 4AF9A 3V0BB 1NXD1 2RE9A 1LGCA 1XXNA 5C8CC 1AJKA 4CUAA 2ZXQA 5ABJB 5C33A 2B46X 4J1WA 1RITA 3SEEA 2EAKA 2RV9A 3AL5A 1FMD2 4U2AA 1PVC2 2ZOEB 4Q0QA 1URXA 4EN9B 5DN2A 1FXZA 4Y5TA 3WQ7A 3H3ZA 4LO4B 2ZKNA 2FCVA 3DL3A 4LHLA 3OBRA 5DPNA 2XQXA 4Y1VA 4LE3A 4QX5A 1ZBA1 3RI8A 4OFGA 2PHLA 4YFWA 5KHKA 1P8JA 5DDJ2 2WQZC 4HK8A 4NE9A 2D5HA 3B01A 5F5CA 3OUIA 1DYKA 2P5BA 5FZCA 1DQ6A 1MPXA 5FXXA 4DXTA 3ILNA 2WNUA 2ZZJA 1XOYA 5L7OA 4MSVA 3I2DA 2JWPA 4ASKA 4EV0A 1JZ7A 1M06G 1S0JA 2JKXA 4RS5B 2IFWA 1VBC2 5F37A 4NHXA 3PNAA 1U5IA 1AL0G 3H3UA 3LIGA 4JKLA 4KMQA 3TOJA 3K4DA 2HWD3 3ZR6A 1TZOA 5CVRA 1GZ9A 1ULPA 1WCQA 1Z7S2 2R32A 3POJA 3AB0A 4FT8A 5A7WB 4CP9B 5ANQA 1W8ZA 2D97A 2G9ZA 1K3IA 4XIKA 4M4RA 3UK9A 4HLTA 5LATA 1C4RA 1XYOA 2PQSA 3I2IA 4Y1YA 1I9RA 2RDQA 2HWE3 5E16A 5IW0A 1O8SA 3D8CA 4BK4A 4MXVA 1R1A2 4KBZA 3ZYFA 4YZ4A 5JI9A 5L73A 2XPJA 3GZAA 2DUOA 5FPBA 4LR4A 4PJYA 1MS0A 2LUWA 2GNBA 3O1TA 5GJ6A 1F4AA 5AC91 4JV4A 2B45X 2NP0A 5FKBA 2XJVA 4U36A 4A42A 3IDBB 2VZRA 2PN5A 2VCAA 5E6HA 2IVJA 4XBQA 2Q4SA 5CFDA 2JDHA 3ZXLA 4Q4Y2 4AVCA 4D94A 2JX9A 1W6MB 4FO9A 4E2SA 5CBLA 3BCWA 5JPNB 3HNMA 2DCZA 4AFMA 2HWE1 1POQA 1RJ8A 4QQ2A 2YYOA 4DY5A 3ORJA 2EVXA 1XSRA 2DBNA 4LIVA 1STMA 1E5IA 3VL9A 4CP1A 1XNKA 1RTVA 5FTTC 4Q4W3 3N36A 4Y3OA 1O5UA 3PTRB 3K3NA 3PIJA 3KF5A 3POIA 3JCIA 1ENQA 4KGQA 4RHV2 4F3JA 2HWD1 2ADDA 4BMBA 1HN0A 1JUHA 2VECA 4LKDA 5K4LA 2W1WA 1YFWA 1BQPA 2A3XA 2G9GA 2HWB3 2PQQA 3HJRA 4XMAA 3NJZA 5GZDA 4KWKA 5LK5A 1SLCA 4D8MA 1S0BA 3R05A 2OZJA 5LA9A 3JBG1 4HVQA 5AC92 5FPVA 2ZMLA 1A78A 1G9DA
chains in the Genus database with same CATH topology
3U10A 3VZMA 5K9YA 4Q4V2 3ECQA 2RS32 1NCRC 2I2SA 1OA4A 2Q30A 5GZEA 1RUI3 4XW3A 1AZDA 2P17A 4I3PA 4AHWA 4CYDA 1LHOA 5I8SA 1RUE1 1IKQA 4FVVA 4XQ4A 3T1LA 1YFUA 1F5JA 2KM2A 4CDWB 1VAVA 1X8EA 4N7IA 4QD2A 3JU9A 4YZ2A 3AXEA 4ZKTB 1YXWA 1R083 2C5DA 2A75A 3FLRA 2ZHMA 5IT6A 1J58A 2VXRA 3PVNA 1J1LA 1J59A 1YNAA 4XBLA 1WLTA 4MGKE 1V6KA 4X8NA 1BBT3 4Q4V3 5EYXA 1IHMA 3WQ1A 1JH5A 1AR63 1JOJA 2WJSA 3WVJA 4IV1A 1VAMA 2ZX4A 4AFCA 2MHFA 3WW1A 4XF4A 2ET1A 1VBB1 3AMMA 1V9U3 1RMU1 3IMNA 4ZU4A 3S30A 1BYHA 2CNAA 2WT0A 5FLIA 3E97A 2ENRA 2IXJA 5ABJC 4CDQB 5EWSA 2JKBA 5BNNA 3KB5A 4Q26A 4TLFA 4DMIA 2XBO2 1MQTC 1PO21 3FLPA 2WA3A 5FBZA 1HXS2 2I45A 1C57A 1YIPA 1H1MA 4PDWA 2B8MA 2VOWA 3AP4A 4P14A 4LTAA 4XBNA 1AR71 2VULA 1WCKA 4LBQA 4BH9A 2E7AA 1CAUA 4AEMA 1LU2A 2F6BA 3U4XA 4AVVA 1YYNA 2DTWA 4NHKA 2JE7A 1SBEA 1V9U2 2A73B 3LCPA 4M3CA 4TWTA 3NWKA 1YCIA 2Y0OA 1O3RA 4E9KA 3ZN5A 1H4GA 1PZ7A 4R9AA 2CAVA 3FE5A 1TEIA 3D5OA 1CAUB 2GC1A 4WM7C 2WZR3 3NAPB 1VRH2 1IPKA 2E7QA 1OA3A 5BNQA 4OHXA 4DY3A 3V56A 1ND3A 3D82A 1O91A 1HXS1 2IXIA 3V0AA 3D4KA 3UKNA 1D4VB 3JD73 3VBHA 3UJQA 1ONAA 1PNFA 1RUOA 1MR5A 4MVTA 2HKXA 4W6XA 3IT8A 3VBHC 2HEVF 1NYWA 1YO8A 1ZRRA 1RC6A 3BOPA 4EN0A 1EPWA 5FLJA 5T5OA 1Q8VA 3VHNA 1PZ8A 3IM0A 3IKWA 4AGRA 2LALA 4AEDA 4WM8C 4YZ1A 1VBD2 1N1TA 1TMF3 1X7NA 2ZPXA 4OI2A 1KRIA 3JQXA 4BIOA 1XE7A 5GZFA 2IWGB 2I07B 4JGYC 1BEV1 3CU7A 4QQHA 4ORFA 1KQRA 3R4UA 2CV6A 1LHVA 5T55A 1G6NA 2QFEA 1RUNA 2BFUS 4FQZA 1IOAA 5FREA 2K2SA 3O7OA 1W6PA 2WZR1 2XB6C 2QNKA 1X50A 4K40A 1I3HA 3MYXA 3PMEA 5L36A 2O0OA 1OOPC 1DQ4A 1VR3A 5GLUA 4E27A 3AMNA 4PIXA 2PHDA 2RR12 2OZ6A 3ZVXA 5FOJB 2V09A 1Y9QA 4RD7A 4XZPA 1NA1A 1UKGA 2MEV3 3VHOA 5T3NA 2GMEA 4WVVA 2VUAA 1GLHA 3FFZA 1GKBA 1ASJ2 4NR1A 3MZHA 1YHFA 2H0VA 4QPGB 4I09A 3VBSB 1CN1A 4K9SA 3WY6A 1C5IA 5JAXA 3E6BA 1D0GA 3IDCB 2WZR2 2P3JA 5KHGA 3AMQA 4BOWA 4LBKA 1FATA 4GQ7A 3K51A 4FTSA 5K0UC 1PGL2 1QJY1 3WLUA 1V6MA 1ZRFA 1H9PA 1WLWA 1I5ZA 3ZPYA 2OPKA 1RJ7A 2QDNA 1C8M3 2ATFA 2VNRA 1D4M1 4YGEA 2OW4A 3WW4A 2DV9A 2BWCA 2IZWA 4I0AA 1G7YA 3O0XA 5DDJ3 3WG1A 5DZEA 4P9YA 1NY72 4R4ZA 4P9IA 1Q8OA 5CIRA 4KL1A 1U5XA 2ZACA 3LOIA 1ZBE1 2AH2A 3UJOA 2B9UA 1AYM1 3IWZA 3POSA 4URTA 2JENA 1X8MA 1CESA 3VHPA 5ACA2 3WCRA 2JG8C 3MIFA 3DUIA 3WHTA 1PGL1 2HWF2 1OHFA 3OGGA 4RR3B 1KXGA 1W6MA 2YUEA 1DU3D 3RPQA 2KXLA 4Q4X2 4YGDA 4GH4A 5C4WB 1WCDJ 1O4ZA 3BB6A 1YRZA 1RVF1 3CLPA 3J8F2 4XILA 4KH9A 4QM8A 4GULA 1NLRA 2ZA9A 4YM2A 4IEUA 3AJZA 2BVVA 3SLIA 2D6KA 3FUQA 1QQP2 2EXJA 4SLIA 3VKMA 5C6CA 1CJDA 5J37A 1CAXA 2AYHA 3U0ZA 3KT7A 2DVDA 3SMHA 3AKQA 5J96B 4XYXA 5JOXA 3N4MA 4GA9A 2F4PA 3TNPB 1DHKB 2GNTA 5BNOB 5FPXA 2O8QA 1OPMA 3W59A 4NVPA 4XXAA 1S0GA 4LBNA 4Q4X1 3MIDA 2GDFA 5FQ0B 4MV2A 4PCRA 4EN8B 2BW8A 1S2KA 2Z42A 2N7GA 1QXRA 3J8F1 4FP3A 1XE8A 1BKZA 2VQAA 4AI2A 4CDWC 5JZGA 2BGCA 1BEV3 5C8WA 4EWAA 5JOYA 4AQSA 2ZGOA 3RJRA 2UYAA 5CFDB 3IIAA 1DQ5A 4UBHA 3EXUA 3H0OA 4CEWA 4K6BA 3VLBB 4CEYB 3M3CA 2ZGQA 2G4IA 4LBQD 2K0GA 3VKNA 1BMV1 1VAKA 4CDUA 1AHSA 4E4ZA 1RINA 4RL7A 1DQ1A 4WM8A 4C0BA 3ZDSA 1AR92 2XLAA 2A70A 2D40A 1Y3TA 1W39A 4LHNA 2HWD2 4Y1XA 3KMHA 1QF3A 4QGLA 1CD3G 1OLQA 4SBVA 3VBRB 3RMXA 1O4TA 3H50A 4IV3B 4EN7B 4HKOA 1UU5A 2BTVC 1J3RA 3KZ4C 2FHRA 1OA2A 1AX2A 4FPLA 1W6QB 3DN7A 4YVWB 1ND3C 3C3VA 4YM0A 2RS12 4BMEA 1RUJ2 1MVEA 4ITCA 2QKDA 2A3YA 2XLGA 3LAGA 1BMV2 2CWSA 1YI7A 1WW7A 1FPN2 1PO13 3VBSC 1YJKA 2CGPA 2RS52 1RUH1 2V5YA 3OY8B 4HK9A 1XU2A 4TSVA 3B00A 2VGDA 3LWCA 1LHUA 1RMU3 3WDUA 2ZX0A 1AR73 2ZS6B 4AFDA 4D7YA 4Q0UA 4HSJA 4B4PA 3N3HA 3AZVA 1PO11 2HWF3 1QJX3 1YWKA 3MICA 2X53S 3DV8A 4QHBA 5ACA3 5ABJA 1VBB3 1OPOA 4IL7A 2UU8A 1RMU2 2R042 1DGRN 1ZM1A 2RS51 4BHPA 3H1YA 4K1ZA 1C8NA 4LO8A 3EHKA 2ZTNA 2VOXA 4N53B 5DG2A 3WDVA 2JG9B 2P3IA 4XHXA 3WP5A 1MS5A 1NCQA 4I02A 1QJU2 1ZREA 4I30A 1ZZ8A 1PGW2 5H9RA 1SBFA 1AR81 3VZOA 2LM3A 5IUQA 4ONUA 4M3CB 3JBG3 1OQEA 3NV2A 4LLFA 3ZYRA 2WT1A 4JAAA 2Z2SB 3FZ3A 1H0BA 2PHWA 3UL2A 3AZZA 1EV13 2B42B 2A6ZA 4J1XA 3MW4A 4OLLA 4OZXA 2DCJA 2AGSA 5CG8A 3D0JA 4RFT0 4ASMB 3E6DA 3HR9A 5H9SA 3TN93 4KU7A 1VRH3 2D6PA 1J1TA 1DIWA 1RVF3 3VZLA 1LB2A 5CAZA 1BVVA 5LRSA 4MUVA 1IS6A 2R6QA 5BYNA 3EQEA 5CA6A 4X6RB 1NE6A 1O7FA 2FZ1A 4NWVA 1PGW1 4ES9A 4B7EA 2IXCA 5JZGC 2VMGA 4HN1A 2GZWA 2QCSB 4YLZA 1FX5A 2Q5TA 3M3EA 1LOAA 4ATEA 4HPKB 5DUVA 3ZXKA 1Q8QA 5E8AA 1PK6B 2GALA 1MS3A 2GH2A 2ZX3A 4YW2A 3WP4A 1LTEA 1W6OB 3K48A 2WNEA 5DZFA 3WDXA 4FPFA 4L8QA 4QQPA 1RIRA 1UN1A 1PIV1 2IXKA 5C4WA 1SFNA 3LSDA 5HCAA 2WFF2 4KQ7A 2QUOA 1Q8SA 3QCWA 5KHHA 4AWDA 4KGGA 5I91A 2WINB 2AUYA 4N9IA 4OHZA 3FBYA 1NLSA 1W2UA 5K8SA 3AKRA 2EXKA 2RJLA 3RI9A 1RUC2 4LNVA 2RR11 2NN8A 3VBRC 5JMCA 3HWJA 2DU1A 1AYM3 3R4SA 2JG8A 1UPSA 5CG9A 2YXSA 3GHMA 5FPZA 1ASJ1 1FT9A 3ASIA 4LBLA 1HX6A 2DF7A 4Y24A 3ZMNA 3ZYPA 4XTPA 4GKYA 5T5LA 1W0PA 2D6MA 3KT1A 1ZZBA 4BYYA 3V65A 1H8TB 4YG0A 2EF6A 2WT2A 4LEJA 1GBGA 3FUOA 1GYKA 4AI1A 3NV1A 5KXEA 3CJIA 5HCBA 2VVDA 5LK7B 4O9EA 5JZGB 3DF0A 3AP6A 3M4FA 3LOBA 1QNWA 1FMD1 1RUC1 5T54A 4L2NA 4JVAA 3ZSLA 3S0MA 4C1WA 1J3QA 4WV8A 1GNZA 1REDA 1LOBA 1ZBA2 4YVSA 1ZYBA 1XNDA 4H7LA 2R073 3O5SA 1EV11 2HJIA 3AMPA 4XFGA 5C4WC 4JGZC 4XFIA 5DUWA 4FTEA 2PHUA 4IQPA 1N3QA 1QU0A 5GLVA 3VGIA 2XL9A 4HT1T 2P3KA 1H2KA 1S0EA 4L97A 3ZFGC 4HBNA 3GNEA 1MACA 2BNNA 1Z7S1 3HMYA 3V64A 4F83A 1VP6A 2Q1MA 3WP6A 4LBJA 1Z0HA 1HRV1 3KCCA 5FO7B 2FZ2A 1C3HA 4FCAA 3WXPA 1RVF2 1BXHA 2PA7A 3ZN4A 4YNIA 4M0NA 2WNVA 3FHIB 4DOUA 1R1A1 4HSLA 3B93A 4LLOA 2AENA 2BNOA 1Z7S3 2CWMA 1EV12 1QQP1 4R9DA 2DUQA 4N43A 1V6OA 3PVBB 1KD7A 1H30A 2R0FA 4RGGA 2ZGTA 5JCTA 4M3CF 2VU9A 2A3WA 5FAXA 5T5PA 4Q4Y1 2VQ0A 3KD4A 4N53C 3WX5A 2PLV2 3OBTA 3UKVA 1SLAA 4K21A 4XF0A 1R092 1ULCA 3GYDA 4LHKA 2O8OA 2ZBJA 4BLIA 3M8LA 1NQJA 1VJ2A 1JBCA 3E5XA 2VOKA 4HANA 4K3UA 1OOPB 2JG8B 4PLOA 4YG3A 1CAWA 1WUVA 3WW3A 1CGPA 3NSTA 1A8DA 3T2TA 4AG4A 1JTZX 4XOGA 2BPA2 3RG0A 3ZIWA 2BVBA 1V6IA 4CDQA 1OQDA 2H6CA 3GALA 4Q4V1 1A6CA 4RS5A 4AHYA 3M3IA 1Q3EA 4Q0PA 5AFEA 4QM9A 2ZAAA 3SNMA 2TNFA 2WS91 5IK8A 1WBFA 4CRQA 4WM7A 1R093 1COV3 2VMIA 3GHNA 1YI9A 3MPBA 1AL22 3IDEA 2YY1A 2R30A 4I0BA 5EJ3A 3WDYA 4OVEA 4WZCA 1AF9A 3UKTA 4Z8BA 1RUG2 2BQPA 2ZKLA 3W58A 1E57A 5F6LB 4I2OA 1CVNA 1LECA 5GZGA 4N90A 3RYPA 3MIEA 3ME2A 4WM7B 4XMIA 1MS9A 3J9SA 4YW4A 3RJ2X 4XJ9A 1BBT1 4DRVA 3I54A 5E1RA 4C91A 3LKJA 4KNCA 1WD3A 5F9TA 1QH7A 4BM8A 1MQTA 2WNVC 2W08A 2Y26A 1RUJ1 1LOEA 1AYN2 4LO5B 4MYEA 1LEMA 3WHUA 2WL1A 5FCCA 4XFFA 1MZFA 3B02A 5KC5A 2RJKA 3POWA 2GC3A 1KS5A 2C0ZA 4M0HA 3RSJA 2CAUA 4XFHA 5L19A 3GBGA 3R0RA 3PHMA 5F5QA 1RUI1 1GZWB 3EJKA 5FOBB 4FXGB 4CDQC 1PK6A 3JQWA 1VBE3 1BBT2 2XJTA 3TN91 3ZIXA 1PGSA 3MW3A 2W52A 3I59B 3OTFA 1AXZA 3FX3A 4WBBA 4I0WB 2HWB1 4EROA 2UY8A 1H9WA 1HDKA 1SDWA 3USUB 2ZHKA 3AZWA 1UD1A 4BE3A 2R041 2R1DA 4UBGA 3O0VA 4DPNA 2XJQA 4N53A 1YJLA 2DFCA 5A3MA 4JRLA 5LEKA 1BJQA 2R043 2R062 1DYPA 5JSRA 2ZGMA 1OSGA 1HW5A 2PHRA 4ATFA 1RUI2 4IEPA 1DLLA 1WLCA 2Q8OA 3USUA 1ND2B 1AR82 4DXZA 4AVAA 2ZMKA 1SBDA 1XNBA 4Y22B 2D6NA 3ILRA 4YYOA 1QGLA 1QOOA 2OYZA 1Z78A 4QPGA 2NZ9A 3PVOA 1K5MB 1AX1A 3H8UA 2CL2A 4XE9A 1REEA 2QZ3A 4OUSA 2RS53 1FOD2 1RHI2 1APNA 3VDDB 4RQPA 5AC93 1GR3A 2ZJCA 1TQ5A 3ILFA 3TYJA 3PJQA 3CEWA 1K5MA 1ENXA 2SLIA 4Z2WA 3NKGA 3AYAA 4JGZA 3CNAA 4AI8A 2QQPA 3ZFEB 1NA1B 3HD8B 4JGYB 1JHNA 4CTEA 1VBA3 4MLOA 3GBFA 4P9LA 3BIWE 4C1XA 4RQPC 1COV1 3C2UA 5F6KA 2ARXA 2JG9A 1UIKA 1U0AA 4AEJA 1N1YA 2B7YA 1WGPA 3J26N 1CQ9A 2Z79A 3L2YA 1AUYA 2XJPA 1ZZ7A 3ZXEA 1F31A 1D2SA 4IEVA 1AX0A 4XFCA 4B4RA 1GQGA 4YARA 4R4XA 4R9CA 4XJWA 2WFPA 3OYWA 2CYFA 2WFF1 2RM21 2YV8A 3WZ1A 2GMPA 1OLRA 4FOYA 4CDXC 3HIFA 2D44A 4EN6B 4PIZA 3Q9OA 1QJY2 2VMHA 3BTAA 3FLTA 2ZGRA 1G8WA 4FAHA 4AVTA 2ZGNA 1EPZA 1AXKA 1WW4A 1VBC3 1C1LA 1D4M2 2NMNA 1POV1 1O3TA 1RB8G 2B39A 1QQP3 3SCGA 1RUF3 4QPIB 2Z5WA 3ZYGA 2EALA 4H55A 4XQDA 4XQWA 3QLQA 3SH4A 1QJX2 4RR3A 2RS33 3DGTA 3ENRA 5FQ0A 4V1PA 3B7MA 1W6NA 3RS6A 4IETA 2PAMA 4NPRA 2VVEA 5FRAA 2RM22 1DGLA 3QD6A 4RGAA 1TMF2 3GZUC 3TWIA 5SV5A 3AP5A 3KM5A 1HIXA 3D0SA 2OA2A 3ZMOA 5CADA 5EZWA 1NA1C 3SCHA 4JDNA 3RWNA 1IS4A 2W68A 2G9FA 1G9CA 4FPKA 1ND2C 3D6EA 4JTNA 3EBRA 3VHRA 4ZXKA 3RMYA 3RYKA 1O3SA 1ULEA 3KCYA 3HT1A 4WVMB 3WNXA 4N9HA 2YDEA 5JI7A 4FAGA 4G3YC 4Z07A 1TME2 2GH8A 1UU6A 1V00A 1QMJA 1RUF2 4AGVA 3AXDA 4FP2A 4QPIC 4OUMA 5JR7B 5EXOA 5CFCA 1N1SA 4AE2A 2JJ6A 3CF6E 2R1BA 3HQXA 3R4DB 2A6XA 1DZQA 1XU1A 4ISQA 4HKLA 3VBSA 1KFUL 2GNMA 3AM2A 1KS4A 4JTOA 5KXCA 5EV7A 5A33A 3ATGA 1IGOA 4B7KA 3OD0A 4Q0VA 5L7OB 2TBVA 4IXLA 4MX3A 4XPVA 4RS5C 2AR6A 2VW1A 4LO7A 5I8YA 1Q5OA 2YGLA 4Z1VA 5DDJ1 1HKDA 4Y1UA 2OUJA 1BCXA 1AR61 3MFAA 1VBA2 2D3RA 4BZ4A 3S7IA 2RR13 3B9CA 1WMFA 1ZBE3 4LULA 1OKQA 5IK5A 2A71A 3QBQA 4IEZA 4KG8A 1ASJ3 1ZZCA 1S2BA 4Q8LA 2A6VA 2DUPA 3I59A 3JB4C 1D2QA 2MEV2 4OHYA 3NAPA 2LTNA 1C8M1 3ZFGB 1GQHA 2GC0A 1BVP1 4CEWC 1TME3 1X82A 4GB33 4X6QB 5KBFA 3QH6A 5CU1A 5BNPC 3GBWA 4HMZA 2WKKA 5DUXA 3FWEA 1ENRA 1AR62 1ULFA 1JW6A 4M3CE 3N7JA 5I0TA 3VUOA 1VB4A 1BK1A 1LGBA 3KLSA 4BWOA 3L9JT 1ND2A 4AEKA 1WBLA 5FDBA 1AL21 1LHNA 4EWDA 2UWCA 3KSCA 5C9AC 4KWJA 1MZEA 3LGRA 1ZZ6A 1G9AA 1G9FA 1PO22 2MEV1 3OY8A 5H9PA 1TNRA 1G86A 2RS13 3MIBA 1X36A 3R6SA 4B4QA 3RNSA 5SV8A 3VN4A 4YW5A 1IPJA 2R063 1MQTB 1WW5A 4M00A 5JOZA 1DGWA 1EAH3 1S0IA 3VBUA 1H1AA 1V6NA 3NVCA 4Y1ZA 3JD72 3B9IA 4Q4Y3 1AYN1 2IXLA 1NZCA 4YGBA 4F7ZA 1ENSA 5CNAA 1NXMA 3H7YA 3G6JB 1VRH1 1SACA 3U11A 4QU2A 2B5HA 4FSJA 4GIQA 1QJU1 4Z82A 1HXS3 4NHMA 4O9GA 4YVSB 3BPZA 3MIGA 4JCKA 1MEC3 3O12A 3CL1A 3N35A 1DQ2A 1R1ZA 2X5IC 3TRSB 1NG0A 2GAUA 2P2KA 2JDZA 1B09A 2MPFA 1FV2A 1ZBA3 3VBRA 1QH6A 5A32A 1RUG3 4LBQB 1JYIA 2ETEA 3ST7A 1ZA4A 2WNVB 4KWLA 2CGOA 2XBO1 4XF1A 2QJVA 2WLQA 4GMP1 4D7SA 5C9AB 1MS1A 4P9WA 3NKTA 5GZCA 1CR7A 3ZSMA 1OFSA 2JXAA 1K5MC 3AMHA 3PVEA 5C8CB 2BBVA 4GWNA 1ZVFA 1S55A 4YFZA 4W6WA 1J3PA 3MI8A 5DG1A 2QE3A 3N7MA 5D8AA 1O3QA 1JXNA 3B3QE 1ND3B 4XFBA 4E4DX 3ZYIB 4ISRA 1QJZA 4CP0A 1L3JA 1OQ1A 5BPXA 2V73A 1PO23 2E63A 1HRI1 5GKAC 4RQPB 1DFQA 4A3XA 4XJ8A 2HWC3 1UKRA 2DTYA 1RHI1 1OOPA 2D7FA 1W6OA 2UY9A 1ZZ9A 1V70A 2XUMA 2BFUL 1YUDA 3NV3A 2ZAHA 4Y20B 5B2GB 2PAKA 4XJAA 1VBE2 4D3WA 2A6YA 4AGGA 4TZDA 4XFAA 1MEC1 2PFWA 1MS4A 5T50A 4HETA 1FYUA 1QNYA 3VDDC 2DVFA 2YROA 4EWEA 1WA4A 5JVVA 1NCQB 2PELA 4JDOA 5GLZA 3ALQA 3VBOB 2BUKA 2XKOA 2PLV3 4XJZA 1VBD1 4YGCA 3SCFA 2VNGA 5K0UA 1HRI2 3W9AA 3G7DA 1I1EA 1XQNA 2ILMA 3FBMA 1Q43A 2EXIA 5JSPA 3O14A 4LA3A 4YSFA 2YZ4A 4DNYA 1SQ4A 4A2UA 2A7AA 1H8TC 3VBOA 1PK6C 3L2HA 4E2QA 1N3PA 5KHJA 4I3GA 3PLQA 4COWA 4FXKB