2WWSA

Physalis mottle virus: natural empty capsid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
161
structure length
161
Chain Sequence
QSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN
publication title Crystal Structure of the Physalis Mottle Virus
rcsb
source organism Physalis mottle virus
total genus 26
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wwsA00
1RUH1 3S6PA 1V9U1 4CDWC 3VBHC 1TMF3 3NAPB 1RUG3 1ND3B 2HWB2 3DPRB 4Q4W1 5ACA2 3VBSB 1MQTA 1RUG2 2FZ2A 1RUI3 2HWF3 1QJZA 1VBE1 5J98B 3VDDC 5C4WC 2DF7A 1RUF1 1VBD1 1COV1 1MQTB 1BBT3 1HQNA 4QPGA 5FOJB 1BBT2 1IHMA 1VBA1 1R093 2RMU2 1RMU2 3JD73 4GB32 3J8F1 4WM8C 5A33A 1CJDA 1AYN1 4QPGB 4QPGC 4RS5C 2R072 1Z7S3 1RUE1 1D4M3 5A33B 1FPN1 1NCRA 4CEYC 3VBUA 1Z7S2 1D4M2 2WZR2 2XBO2 1HXS2 1QJU1 1X33A 1PO11 5D8AA 1ZBE3 4SBVA 1NCRB 2RR13 3VBUB 1H8TB 3ZFFC 2RS32 2ZTNA 1H8TC 2HWB1 5ACA1 2RS12 1VB2A 3VBFA 1PVC2 5D8AB 4AEDC 1QJX3 1QJY3 1AL0G 1QJX2 3VBFB 1RUJ3 5AC92 5BNOA 4YVWC 1AR73 1RUD3 2RMU1 4GH4A 1RMU1 4YVSC 5K0UC 4JGZA 4N53A 5BNOB 2R071 1RUH3 1V9U3 4RQPC 1BEV1 4GH4B 4JGZB 4Q4W3 1WCDJ 4N53B 2GSYA 2WZR1 5LK7B 5L7OC 1HXS1 4N43A 1VBE3 1VBC3 2ZZQA 4RHV2 1RUF3 1COV3 1VBE2 4PDWB 2HWE2 1VBB1 2RS31 4PDWC 1RUF2 1VBD2 4N43B 2RS11 5GKAC 1VBA3 1RVF2 5ABJC 1PVC1 3CJIA 1HRI2 1FOD2 3J8F3 1AYN3 3J8F2 1R1A2 1OOPC 1K5MA 4WM7A 1RUE3 5AC91 5BNPC 1FPN3 1EV12 1ASJ2 1NA1A 1QJU3 5C9AC 4WM7B 1PO13 1F8VA 3JBG2 4NWWA 3TN92 1EAH2 3VBRC 4CDUA 1B35A 1NA1B 1VRH2 2HWB3 4RR3C 5ACA3 4FTBA 4Q4Y2 3HAGA 3NAPC 1ND3C 3DPRC 3VBSC 2Y26A 4CDUB 1B35B 3JB4C 4RHV1 4GMP1 1RUC2 2HWE1 1AR92 1MQTC 3ZXAC 1QQP1 1RVF1 2RMU3 1HRI1 1RMU3 4GB33 1FOD1 1R1A1 2R073 4CEWA 1FMD2 1BEV3 4BCUA 1AR62 2X5IA 1BEV2 2RM22 1R082 2VQ0A 2WZR3 2R062 4Y5Z0 1EV11 1ASJ1 2XBO3 1HXS3 2BPA2 4IV3A 3JBG1 3TN91 1EAH1 3LOBA 1NG0A 2X5IB 1TME2 1F2NA 1VBB3 2RS33 1RHI2 1ZBA2 1VRH1 2RS13 4Z92B 1NCRC 1VBB2 1PO22 4IV3B 1OHFA 3VBUC 1PVC3 4Q4Y1 3IDEA 4QPIA 2R041 5D8AC 5CFCA 1AL22 2RS52 1RUC1 5BNNA 1AR91 5AC93 4QPIB 3VBFC 3VBOA 5C8CA 4Q4V1 1NY72 5CFCB 5BNNB 1HRV2 3VBOB 5C8CB 1FMD1 4CDXA 5JZGA 2FZ1A 5J96B 5BNOC 4FTSA 2XPJA 4FTEA 1AR61 4Q4X2 2RM21 1R081 1RUI1 2R061 4GH4C 4JGZC 4CDXB 4N53C 5JZGB 4RHV3 2MEV1 4GMP3 5DDJ2 1TME1 4GMP0 2HWE3 3ZFGA 1RHI1 1ZBA1 1HX6A 1RB8G 1VBD3 1PO21 1RVF3 5CFDA 1HRI3 1FOD3 4N43C 1QQP2 3ZFGB 2BUKA 4IV1A 2PLV1 3ZFEA 1R1A3 2WS92 4CDQA 2WFF2 1AL21 2RS51 5CFDB 1VAKA 5CFDC 4IV1B 3CJIB 3ZFEB 3CJIC 4CDQB 1EV13 1PIV2 1NCQA 1NY71 1ASJ3 3JBG3 1MEC2 2HWC2 3TN93 1M06G 1EAH3 4JGYA 1HRV1 1C8NA 1K5MB 1AYM2 1K5MC 4WM7C 1NCQB 1VRH3 1X36A 4Q4X1 3FBMA 1ND2A 1PGW2 2HWD2 4JGYB 1CD3G 4Q4Y3 4FSJA 1NA1C 4JGYC 3M8LA 4RFT0 1RUJ1 1AR82 5DDJ1 2R042 1RUC3 1ND2B 4CDUC 1B35C 4CDWA 1AR93 3VBHA 1C8M2 4Q4V2 1OPOA 4CDWB 3VBHB 2WS91 2WFF1 3VDDA 5C4WA 1FMD3 3JB8A 1TMF2 1AR63 1E57A 2RM23 1R083 2R063 1PIV1 2IZWA 3VDDB 5C4WB 1VBC1 2GH8A 1RUI2 2HWF2 4CEWB 4NWVA 1MEC1 2HWC1 4WM8A 4CEWC 2MEV3 1SMVA 4EJRA 1TME3 4RS5A 1AYM1 1RHI3 1ZBA3 2MEV2 2X5IC 1PO23 4LLFA 4WM8B 5FMOL 1PGW1 2HWD1 1R092 4CEYA 4RS5B 3JD72 4IV3C 2PLV3 1AR81 1AL23 2RS53 2PLV2 4CEYB 3ZFFA 1H8TA 5FMOS 1C8M1 4QPIC 1NOVA 4AEDA 1POV1 2QQPA 3ZFFB 1HRV3 5CFCC 1ZBE2 1PGL2 1DDLA 1GFF2 2RR12 5BNNC 1TMF1 1RUG1 4Q4X3 3VBOC 4AEDB 1W39A 5C8CC 4YVWA 2TBVA 4YVSA 5K0UA 2HWF1 1QJY2 5DDJ3 4CDXC 5JZGC 4YVWB 1VB4A 1BMV2 1RUJ2 1BBT1 4RQPA 2WLPA 4YVSB 5K0UB 4GB31 1R091 1AR72 1RUD2 1QQP3 2BFUL 3JD71 5L7OA 4RQPB 2WS93 2WFF3 3ZFGC 1RUH2 2ZAHA 1V9U2 1Z7S1 4PDWA 1D4M1 5A32A 4Q4W2 5L7OB 2XBO1 1PIV3 5ABJA 2BFUS 4IV1C 2WWSA 3ZFEC 1MEC3 2HWC3 4CDQC 5A32B 1VBC2 1ZBE1 1PGL1 1AYM3 2RR11 1COV2 1OOPA 5ABJB 1AUYA 5BNPA 1VBA2 2HWD3 1NCQC 1QJX1 1A6CA 1OOPB 1AYN2 5C9AA 1QJY1 1AR83 2R043 3VBRA 5BNPB 1BMV1 1RUE2 4RR3A 1FPN2 1ND2C 5C9AB 2BBVA 1C8M3 1AR71 1RUD1 3NAPA 4Q4V3 3VBRB 1ND3A 3DPRA 1POV3 1QJU2 3VBSA 1PO12 1POV0 4Y4YA 4RR3B
chains in the Genus database with same CATH superfamily
4F3JA 1RUH1 1LHVA 2H6BA 2PXJA 3A22A 1ODMA 1WBLA 3AYEA 3DECA 4FOQA 5APAA 3C7GA 5LRRA 3CEWA 1HN1A 4E27A 1ND3B 2DVFA 4P9JA 3ST7A 4BQXA 4LJHA 3MW2A 1MQTA 2OW4A 1HJGA 3POBA 2DURA 4J25A 3SQOA 2QDRA 1QHDA 3KVAA 4A44A 1YFUA 2JG8C 4AL9A 2Y38A 3ABZA 2Q8DA 3VDDC 2XHKA 1J84A 1W90A 3UESA 1MQTB 4IEYA 1HN0A 4XQWA 4WVZA 4MZUA 1UU6A 1ZYBA 5FOJB 3KCXA 2D44A 3T2OA 1IHMA 4DO0A 3C3VA 1NAEA 4XF9A 1RTVA 1RXFA 4LHNA 4NHLA 4JDMA 2AR6A 2NYYA 1YC61 4LK7A 4WM8C 4B4QA 1AYN1 5CKQA 1EPWA 2ZS6B 2GP3A 1YFXA 2EIDA 4KU8A 4LO8A 4NIIA 1YWKA 4AI0A 4Z82A 5GLZA 1Z7S3 2C9AA 1DBNA 2D7FA 3MIBA 1WW6A 1NCRA 5L36A 3H1YA 3VBUA 1Z7S2 5FZ9A 4XACA 3RJRA 4Q0QA 3GXUA 4BQ2A 3D6EA 2R30A 1ZZ7A 1HXS2 1OF4A 1X33A 4UW5A 1ZBE3 5F5QA 4BQ3A 3J7LA 1AJKA 1NCRB 3T09A 3VBUB 4PJYA 3ZFFC 2EIGA 3OPWA 4LHSA 4UW4A 2P3YA 4X6QB 2BW8A 5CVRA 3GHMA 2HWB1 1GKBA 1RC6A 3NNLA 5G04L 2EICA 4COWA 2YBSA 1SBDA 1ULEA 3VBFA 3VHPA 5GJ6A 3ZYRA 1OI6A 2ORZA 3RSJA 3BGAA 2XLAA 4RGGA 4XFFA 4Z2WA 2JDNA 2ZEYA 3RQ0A 3AP6A 3OGRA 4U36A 4Z2AA 3BIEA 1KITA 4YGDA 3HNMA 5A3NA 3VBFB 1KRIA 4AWDA 2WL1A 1NYWA 3ZIWA 5JOWA 3PVEA 5F2WA 1UKRA 5BNOA 2VZ3A 1W06A 3CIHA 4QGNA 4QWNA 3U37A 3RZGA 2XQRA 3KV5A 3NW4A 1WMEA 1U5ZA 1O91A 1RMU1 4XEZA 4YVSC 4JGZA 2JDYA 2DUQA 2NQYA 4HKWA 1JYNA 2OQ6A 1HV1A 1W3VA 3J4UH 3AXEA 3NL1A 5BNOB 5LB6A 2G9GA 2OX0A 1LEDA 1OVPA 3WF0A 4BDVB 2F4PA 1V9U3 2YGMA 1LOBA 1BEV1 2VMCA 2Y64A 3V56A 4JGZB 4Q4W3 3E6BA 1EY2A 4WV8A 2PQSA 5KHKA 1O4YA 2WZR1 1QEXA 4IW3A 3E6CC 4Q8KA 4M0HA 4XF1A 2WDBA 1IQAA 4YRDA 4LKDA 2UY9A 5IK7A 2ZZQA 1SQ4A 2BZDA 1SACA 1COV3 4O61A 4HK9A 4AFDA 2Y6GA 4LUMA 5GKAC 1VBA3 5ABJC 1DGWX 4NHMA 3WR0A 5DG1A 1A8DA 4ZONA 1HRI2 2D3PA 4UWDA 3WF3A 3J8F3 5HI0A 1MS5A 1UCXA 2W5FA 5LCWL 4JKKA 2BRTA 2ZEWA 1JZ8A 3AYCA 1DZQA 1ZZBA 5JXHA 2FCTA 3J8F2 1CAVA 5GZEA 4XFAA 4EWEA 1FYUA 1LOCA 2YGLA 4OVEA 3B5LB 1H2KA 4UI9L 1CAVB 4QXCA 3RYPA 1NA1A 4YW2A 5DXDA 5T5PA 4H55A 4CPBD 2J1UA 1PO13 4D7SA 4EN8B 4BE3A 4URTA 2G9ZA 3OUIA 5JI7A 2FD8A 1SFPA 4DMIA 2WNUA 2WUHA 1LOGA 2CNAA 4I30A 1NZCA 2F6BA 2PHWA 4YW7A 1B35A 2DWRA 1NA1B 1Q8PA 2JECA 2QE3A 2Y60A 3AXDA 3U78A 4CUBA 5ACA3 3WG3A 1I3HA 1RGSA 2Y6FA 2CAVA 4Q4Y2 5FYHA 5IW0A 1D7PM 1WCUA 1E5IA 2WNUB 2Z2SB 5LASA 3IPVA 2RJKA 5HCHA 1IPKA 1B35B 2Z79A 1LRHA 4L8QA 4KGQA 1TEIA 2PHRA 4YZ1A 4AAPA 1S0JA 2GMEA 3NNGA 2H6CA 3OGSA 4FPYA 1RUC2 3EHKA 5HPOA 1UXZA 1DCSA 5JPNB 1KFUL 1GUIA 1V6KA 3IPVB 3N7JA 3U4SA 1UOFA 4FOYA 3RZZA 5GZFA 2Y0OA 1F5FA 2RMU3 4GXLA 1GBGA 4XQ4A 4GKXA 3N9OA 5GALA 3FFQA 2Q1FA 3SKJE 4Z8BA 4CE8A 4AQ2A 1IS4A 2G19A 2YV8A 5B2GB 2R073 2P6HA 5CBLA 2WYFA 5KXCA 3M7AA 1POQA 1AX1A 1REDA 3KLSA 4HVRA 1VJ2A 1EUTA 1NLQA 2CY6A 2RV9A 3K2OA 4QHOA 1O8PA 2HKXA 4Q0UA 1JOPA 3KWVA 4Y5Z0 3TBDA 1ASJ1 1RINA 4GJZA 3BODA 4LIUA 5IWFA 1QOTA 5FP7A 3WNXA 5F32A 2PTMA 3TN91 1EAH1 3GCXA 5IYYA 2VZTA 2JD9A 3WUDA 2B7YA 3RS6A 4LBLA 3SMHA 4OI1A 1A8MA 1YIFA 1G9CA 1S0DA 1OHFA 2D93A 3IT8A 5E88A 3RYKA 3KZ4C 1WKYA 2VJXA 2ZMNA 4BK5A 2CGPA 3J7NA 4QPIA 1TNFA 3ZSMA 3VZLA 4Q1PA 2CWSA 5IFTA 1KXGA 1V70A 1AL22 2VC9A 1O7FA 2KM2A 3HD8B 5LATA 4JCKA 3KHCA 1DHKB 2ZXQA 3D3AA 2ZHKA 4K1ZA 4LO4B 4C1WA 5AC93 1DQ5A 2ZX3A 5A6QA 4QPIB 3VBOA 3FZ3A 4NIDA 2ET1A 3HNBM 1F15A 2YFZA 4Q0VA 5ERLA 3ITQA 4GQ7A 1NY72 4HN0A 3H3ZA 4Y5SA 5JLVA 3WP5A 3ZVXA 1OA2A 2XGXA 3N36A 4C0HA 4JRLA 1J3RA 4QX7A 1HB3A 3KHBA 4CUAA 4XFGA 4CU8A 3VBOB 1C28A 1LODA 1O8SA 3O0XA 1GZCA 1YO8A 1FMD1 3PIJA 4N8MA 3ZKUA 5J96B 4META 3SKVA 3ZXJA 4AVVA 4FTSA 1DQ2A 3BI3A 4Q0SA 2NZ9A 1AR61 4Q4X2 1R081 5A1FA 1WZXA 1UY3A 2I07B 3AVRA 5FYZA 2DUOA 3VV1A 3S5QA 1NXMA 4YGCA 4ZU7A 4XZPA 4RHV3 4GMP3 5F5IA 5H9SA 5I91A 3U10A 4D6SA 5EP9A 2HWE3 3AZVA 1Y9QA 1RHI1 1ZBA1 2VNGA 4LBQD 3POGA 4NUBA 4EZHA 5FY9A 3N9LA 4IE5A 2ZGOA 5DAXA 1O5LA 1W8NA 1N47A 1W6MA 3ZYPA 3FUOA 3L2YA 2A6YA 2BUKA 2Y0IA 3ZFEA 1S0FA 1QIQA 2VW1A 5FXWA 5IVEA 2WS92 3B00A 4UFKA 1GZWA 3I2DA 4DOUA 4PLOA 4OHWA 1W6MB 2DCJA 3O0WA 5FYIA 3MLLA 3SNMA 4AVSA 4LA3A 1OURA 1XJAA 5FZ6A 3CJIB 3IIAA 4CCOA 3ZFEB 4L97A 3RFRA 5JI9A 1NE4A 1HB1A 2ZHNA 4OI0A 1X50A 4QKFA 4TZDA 1LCLA 2R0FA 3EO6A 3BKZA 2P2KA 3AM2A 3JBG3 5I8SA 2HWC2 5I0SA 1GMMA 5CG8A 4YGEA 1K5MB 2ZX4A 4NRQA 4PIYA 1ONAA 1AYM2 3CU7A 5H9QA 2ARXA 5FO7B 1VRH3 4IE0A 3MLJA 5FBJA 4JTNA 3FBMA 3UNPA 1WWYA 1IPJA 1ND2A 2E33A 3HBKA 5CYYA 4JGYC 1PVXA 2VMDA 4PF1A 3AX4A 3VZKA 4BU2A 3SHRA 3J7MA 3DF0A 5BV6A 4RFT0 5DDJ1 1BK1A 4ARXA 2R042 3OB8A 4L9BA 4FQZA 1ND2B 2WSVA 4LOSA 4CDUC 1CPMA 2PHFA 3P3NA 4GWMA 3VBHA 4CDWA 3OG2A 3MICA 1LULA 2FQPA 5IUQA 1W6NB 3CZJA 1WD4A 3LDKA 4BH9A 1CESA 3RZLA 1CWPA 3ATGA 3AKQA 4GALA 2XQXA 4CDWB 3VBHB 2OKXA 3W58A 4A2UA 1CQ9A 3KVBA 4RL7A 5T5JA 3WHTA 1YJLA 1G8WA 1K5JA 4FPJA 1N3QA 1TMF2 1UF2C 2OZ6A 3I54A 1YRZA 1LGBA 1OF3A 2H0VA 4C0BA 1E57A 2RM23 2JXAA 2ZAAA 3H8UA 4OUEA 5TSWA 1PIV1 1G7YA 1SLTA 1O3SA 3WW3A 5LRSA 3ELNA 4ASMB 2GH8A 4CEWB 3GBFA 4H7LA 4NWVA 5DZFA 5FZCA 4YGBA 4EJRA 2YFUA 4TTGA 1A3KA 4RS5A 2W47A 4MO3M 4XABA 2BVVA 3ACFA 3H1WA 3LD8A 4TLFA 2MHFA 1JZ6A 1PO23 3U11A 2XJTA 4B29A 1RYYA 5LA9A 3JQXA 1JBCA 1K3IA 1YQCA 2OYZA 4OZOA 4RS5B 1ULPA 2YG0A 5FTTC 4IV3C 3PJQA 3SISA 1OQEA 1GV9A 1ZZ6A 1LHUA 2FCVA 4CCDA 4ONUA 2E31A 1AR81 4HT1T 3E5UA 3NV3A 5C5UA 1AF9A 2A6WA 3URFA 1D0GA 4LOTA 2JWPA 4A7KA 2PHTA 3MIHA 3UV9A 5K7PA 5T5LA 5CIRA 1SFYA 2P5BA 4QPWA 3E6DA 3CO2A 4DIQA 4DRVA 1XC6A 1V0AA 1NOVA 3ES4A 3V0BA 1HQLA 3A4UA 2D6KA 4AEDA 4LBNA 1WW5A 3ACIA 2R0HA 3NKGA 2QQPA 5JR2A 4HSJA 2FDIA 1UW8A 3O5SA 1QH7A 1NXD1 1GFF2 2RR12 4Q26A 4DNYA 3ACLA 3LDRA 1S0BA 4LIVA 4B4RA 4P9LA 3V0BB 4AEDB 5C8CC 2A6ZA 2WSUA 4IQPA 3APBA 4YVWA 4W4ZA 2XUEA 4LHKA 3KM5A 4HL0A 3ILFA 2BWAA 2K2SA 2VCMA 3FN9A 2EXJA 4IEWA 5JPMB 1JZ3A 2JKXA 4XF3A 1O4TA 2CV6A 3AK0A 4XILA 1QJY2 1VP6A 3JZVA 4R4ZA 2K9ZA 3FLRA 1WMXA 1DZRA 1YFYA 1VB4A 1OA4A 3L2HA 4H3WA 4YVWB 1RUJ2 4JDOA 5FUNA 2YU1A 4FAGA 1BMV2 2XLGA 2WLPA 3POIA 2I2SA 2YMZA 1ZRDA 2GN7A 1DLLA 3U0ZA 1PX4A 2JDUA 2HJIA 1AR72 2OUJA 1OLRA 4XUTA 3EBRA 4XF0A 3TEWA 4CCEA 3BU7A 2WFF3 1RUH2 4D6RA 3E5QA 4QQHA 4MX3A 3A0KA 2KD7A 5FIXA 5LA1A 3POSA 5A32A 1UIKA 3CL1A 3RZMA 4YARA 5FZGA 2VM9A 4BM8A 2C9KA 1JHJA 3D5OA 4YFZA 1FXZA 3AZXA 3TYJA 4MVTA 3PUHA 3VKOA 1HW5A 4CDQC 4UF0A 2W52A 5A32B 1PMHX 1VBC2 1IOAA 2EAKA 1PGL1 1X9PA 1PK6A 3AFKA 4FPCA 4UFMA 2FDJA 5DZGA 4XFHA 1AUYA 3LKJA 5EFUA 4FXGB 4AQ6A 4A7YA 5BNPA 3EJKA 1W0PA 3N35A 2HWD3 1OLME 4UF0B 4O9GA 1H6XA 3ZR5A 1PK6B 2IC1A 3VKMA 1QJX1 3ZXEA 3OTFA 5FQ0A 4P9GA 1GANA 1SLCA 1AYN2 1AX0A 4UFHA 4AI3A 5FZFA 4A42A 4ASLA 3VBRA 5BNPB 2J1AA 2SLIA 4NHKA 1W05A 2XXZA 5JOXA 2WT1A 1JMUB 1JTZX 5DABA 3ZXDA 2VQTA 2W87A 3M3EA 4ZS3A 2F17A 2VBBA 2W1SA 1C8M3 2C24A 2V73A 3MLKA 3MUY1 4K7JA 4Q4V3 3HQRA 3VBRB 4DY3A 3UYJA 3NV4A 3VBSA 2ADDA 3MW3A 1POV0 1S4CA 2YROA 3LFIA 2W91A 3TNPB 4DXRA 4EN6B 3JXSA 4YLZA 1LKNA 2E32A 4CCJA 3S6PA 5CISA 2EALA 4JDNA 4MGIE 5ANQA 4XDOA 1WCKA 2GC1A 2OS2A 1I5PA 2HWB2 1PGSA 2D40A 2P37A 1P8JA 1DGRN 4HXCA 4LBMA 3UJQA 3VBSB 3PMEA 1AZDA 4FPHA 2A3WA 3LEMA 4M3CA 2W2IA 2AENA 3IZOA 3PLQA 2DTWA 1DU3D 3B69A 1Q5OA 1RUI3 2P34A 2HWF3 3A7QA 4OHXA 4UAPA 2A73B 3KGZA 4I01A 2QQUA 4YZ5A 5IK8A 2B45X 3WQ0A 1OFNA 2VXJA 3GGLA 3K51A 4OCTA 1PMIA 1YIPA 1RUF1 1BCXA 4JV4A 5I8TA 2D98A 4XE9A 1STMA 1BBT3 3KCCA 1OBNA 4M3CB 4NOTA 2LTNA 1MS4A 3ZM8A 1TE1B 1BBT2 1J3QA 3C7FA 1R093 4QXHA 1RMU2 3JD73 4GB32 3UT0A 3VDBA 4XCBA 4XZUG 1J3PA 4P9YA 1LOFC 3WT3A 1M4WA 4YG0A 1ALYA 3J7HA 4YG3A 4E8CA 2LRPA 5IK4A 2OUHA 4QXBA 3LB9A 4KH9A 1GQHA 3I2GA 4Y1VA 2WZR2 4CPBA 3ZXLA 5A3UA 2NLRA 3PVOA 3KV6A 3M4FA 3FLPA 3LQCA 3USUA 2DCTA 4ZU4A 5D8AA 1HIXA 1SCSA 2LM3A 2W1UA 3IB3A 3T1MA 1H8TB 3WNOA 5FPLA 2WR9A 3Q8AA 1ZRRA 2P6CA 3MIFA 2XHNA 5GZDA 4EROA 5FUIA 3USUB 3TEYA 3T2TA 5A7WA 5D8AB 4WVWA 3RI8A 3VN4A 1WCQA 4ZPIA 5EJZB 3Q9OA 1AL0G 4E4ZA 1T6BX 3MO4A 1JHNA 3DV8A 4TYSA 5FZBA 4DXSA 4QQ2A 5A7WB 1GWLA 4CTEA 4HPKA 1UY4A 4I3GA 4QB6A 2D6OX 3OY8A 1CAWA 3R6SA 2WO2A 4AVBA 1RUD3 4GH4A 2WLQA 3P5BA 5K0UC 3D82A 1W6OA 1YNAA 2B5HA 5C3QA 4LK6A 1YI9A 2TNFA 3HOBA 1XNCA 4DB5A 3W9AA 1OLMA 3U75A 3MIDA 4AG4A 1UZWA 3OY8B 1CAWB 3EMRA 1UX7A 2NM1A 5EIYB 4NPMA 4GH4B 2VU9A 2C26A 2KR2A 2WAAA 2X10A 3RVHA 1W6OB 4QMAA 1S2BA 5LW9A 3I2KA 1A78A 5T50A 4OMCA 4XBLA 4Y24A 3AL5A 2HYXA 2IXLA 5EV7A 4EN9B 4N43A 1VBE3 1VIWB 2GN3A 3SC7X 1QJEA 3N3HA 2DVDA 3I7DA 4AHZA 1VBE2 4PDWB 3ZMNA 2XJRA 4X8PA 1VBB1 2RS31 1KDKA 1MVEA 1AXZA 1XNTA 3H0OA 1VBD2 4N43B 1SBEA 2RS11 2WNOA 3KT7A 4LQRA 3ILNA 3WP6A 1PVC1 1H2NA 2BYVE 1H4HA 3CZUA 1X8EA 1UMZA 2FMDA 2W08A 3WUCA 4LEJA 2BWCA 4AQTA 4CZSA 2A75A 4FFIA 4KNCA 4YW4A 5FZOA 1O6UA 1CJPA 4IEZA 4XBQA 1J83A 4PT6A 3HBZA 2E7QA 2AACA 2J1TA 2GC2A 3IAQA 4WM7A 1RUE3 5EHDA 1SLAA 4FCAA 3DGTA 2C5DA 2B42B 1FPN3 1CX1A 3VLBB 3B94A 3WV6A 4LKFA 2ATFA 1W28A 3E1F1 4FPFA 5FZOB 3MIEA 4P9XA 4K6BA 1ASJ2 1DQ4A 1Y3TA 4B7KA 1QJU3 5A3MA 2VOVA 4WM7B 3FLTA 4NWWA 1ZZCA 3TN92 1EAH2 4E4SA 1JN2P 3GJAA 2VCCA 3LA7A 1UYYA 1GWMA 2Q1ZB 3VZNA 4PBPA 3H8XA 5IFPA 3KB5A 4D6QA 4PI0A 4KU7A 4FTBA 1GYKA 2W0XA 3HAGA 3AC0A 3NAPC 1LGNA 4IEQA 1H6YA 3DPRC 4MGSA 3AZZA 2HBTA 3ZDSA 4CU9A 1KFXL 5LY1A 4KBZA 3JB4C 4ARYA 4LBQA 1WLWA 5L73A 4DUXA 1YQ8A 2PELA 1BKZA 1US3A 5FYYA 2JG9A 1CAUA 4AYUA 2A3XA 5IVCA 1XRUA 1XU2A 1RVF1 2W1WA 4J6GA 3ZXAC 2GZWA 2Q0AA 3HPNA 4LBQB 4GULA 1FOD1 2JEMA 4XJUA 2ADEA 1CAUB 2JG9B 1R1A1 2CSGA 4MOAA 2JE8A 1DG6A 1CZSA 1FMD2 4IUGA 2HYKA 3ZYFA 5KC6A 1OKQA 1MS0A 2ZX0A 1AR62 2X5IA 2B9UA 1R082 2VQ0A 5JSOA 1JUIA 1EV11 4FPKA 1HXS3 4DFSA 3IMNA 2BPA2 2DCZA 1APNA 3KQ4B 3ZR6A 2ZMLA 5IJRA 3LOBA 1NG0A 2X5IB 4N7IA 4YM1A 1XB9A 3DXUA 3AMNA 4P9IA 1C5HA 1RHI2 1ZBA2 3M3IA 3WDUA 2GU9A 5DUXA 1QGLA 4ATFA 3IDCB 2VZRA 2LUWA 5CNAA 2A71A 2ZGTA 4Q1RA 3N9PA 4XMAA 1GP6A 5FXZA 3ACHA 3AVSA 4W6WA 5JSRA 5I0TA 1OFSA 3ZO0B 1X8MA 2WC2A 1LECA 5LBEA 3PMSA 3OEAA 5B4NA 4QB1A 3N9MA 3R05A 4LKEA 1RJ7A 1AXYA 2DVBA 4A4AA 4COVA 1AR91 3LIHA 1OD5A 4AZZA 1RXGA 4XUOA 1SLLA 5FY7A 3SLIA 2JICA 4Q4V1 3K4DA 2O8QA 3RDIA 1WBFA 1YFWA 3H7JA 4ZZ5A 4N90A 4IESA 2OA2A 2VMGA 3LOIA 3SXWA 5JZGA 3OEBA 4ZY9A 2ZBJA 1JW6A 3I3DA 4KG0A 3BOPA 1MR5A 3I2JA 5JAXA 5L9VA 2UWAA 5JSPA 1JH5A 1OQDA 1RUI1 1UU4A 2OT7A 2R061 2VCBA 3GBWA 4YZ3A 1Q8QA 5A33A 2XJQA 4XJWA 2AC1A 2BQPA 4N53C 3BOWA 3VDCA 2G9FA 5JZGB 4NR1A 1PZ7A 4HLTA 5EJ1B 1EPZA 4IE7A 2MEV1 5DDJ2 3VGIA 3ZXFA 1TME1 4R4XA 5L9RA 1SDDB 3S5AA 5DZEA 1L3JA 4HN1A 1H1AA 4FVVA 2Y6HA 4XDQA 5CA6A 2W3JA 4A3XA 5LA0A 5CFDA 2E7TA 2R49A 3VHOA 4K9SA 3O1VA 1HRI3 4INDA 4FFFA 4LE3A 4Q0PA 1QQP2 4CCCA 4IV1A 1XYNA 3O14A 2VGDA 4NIGA 1VMHA 2WJSA 2RS51 5B4XA 5CFDB 1XE7A 4ITCA 4PLMA 3D8CA 4IV1B 1VPHA 1ZNPA 3GYDA 1WCSA 3WF2A 3CJIC 4CA9A 1PIV2 2HEVF 2ZGUA 5DAPA 1JODA 5T3NA 4CP9A 3KGLA 1URXA 2CAUA 2JX9A 4YG6A 5L9BA 3WNKA 3L9JT 4LMFA 1HRV1 1JUHA 3IM0A 1CZVA 1ZRCA 4RR3B 5FRAA 5F1RA 5FJHA 4YM0A 1K5MC 1NT0A 2WO7A 3SITA 4CP9B 3POWA 4M0NA 4QX0A 2B46X 3EXUA 4Q4Y3 2XONA 4FSJA 1YYNA 3WQ7A 5IK5A 3WVJA 4OHVA 4CXXA 2B8MA 4QHBA 5JMCA 2GALA 3N7MA 5J3UA 3LGRA 3MZHA 4EN7B 2FDHA 3EYPA 1AR82 2VO5A 1N1YA 1OPMA 4QX3A 1FV3A 4BLIA 1RUC3 1WA6X 1YCIA 3WNMA 3KT1A 3N9NA 4IGPA 2AZ5A 3K46A 3NQHA 5C5TA 4NVPA 3POEA 4FFGA 4LBOA 2BGCA 2O14A 4QAWA 2YDEA 1HV0A 1WW7A 2CDOA 3PHMA 2V72A 3BTZA 5K8SA 3S0MA 2J1SA 2JG8A 2UY8A 4NHYA 3I2IA 3VDDA 1SG3A 4KWJA 1OLQA 1MZEA 1C4RA 2XUMA 2O8OA 2D5FA 3CF6E 3TEXA 3VD7A 3KD4A 2VMFA 4IGQA 1UMHA 4WZFA 5JWPA 4ET7A 2JG8B 3VDDB 4NRMA 4ZXKA 3AB0A 3H50A 2NN8A 5J1XA 4D69A 4WM8A 1MEC1 4S2HA 4CEWC 5H9RA 2IVIB 2IXCA 1OC1A 3F95A 4QHZA 4XC9A 5KHJA 4R9DA 3I8TA 3GDBA 4DXZA 4LTAA 2ZACA 2R32A 2XL7A 1JI6A 5KHHA 4LLFA 4WM8B 1KEXA 1PGW1 3GALA 3CKHA 5FMBA 1OUXA 1UXXX 2P3JA 3GBGA 3GM8A 4LT5A 3QH7A 2PLV3 4FOVA 3OF1A 5E16A 4Z1VA 5C6CA 2WNVC 1AL23 2NMNA 4JTOA 4AFAA 2PLV2 1OA3A 2OPKA 2DU1A 4XUNA 3ZFFA 1LAJA 3W20A 3KCYA 5A6ZA 1GICA 2X53S 4GKYA 1HKDA 2VG9A 3PVNA 1UQXA 4EN0A 3LZZA 4XFBA 4QKDA 1UPIA 3J26N 5FYMA 4XJAA 1SEFA 4QM9A 4XTMA 3ZFFB 5HCFA 5CFCC 4QU2A 1GWKA 3WSOA 1PGL2 4A3ZA 1DDLA 4NJ4A 2VMEA 1W9TA 3E97A 2XJPA 3HEIA 3WW1A 2ZGQA 3HWJA 2JD4A 4AVAA 5BNNC 4Q4X3 4UBHA 3ZSLA 5A3LA 1X7NA 3HN1A 4JHTA 4HVOA 5FYBA 2TBVA 3AFGA 4JHZA 2WZEA 2ZZJA 4RSUA 4YVSA 4CU7A 5HXMA 3WDVA 4WVMA 4XETA 1J59A 3NO8A 1BVP1 1W8HA 4CDXC 1U0AA 5FY8A 4LA2A 1DFQA 3J9SA 5HV0A 4JRAA 1W0NA 4F83A 4BYYA 1W2AX 4YVSB 4FPOB 2AUYA 2B4KA 3KT4A 4YW3A 3NKTA 1IQDC 4WVMB 1WD3A 3WD5A 2YBKA 2BFUL 2RE9A 3NSTA 4CCMA 5A80A 2XB6C 4I0WB 4CUCA 1LR5A 1S0GA 2O1QA 3ETPA 2WS93 2DBIA 2I74A 2L9LA 5A6XA 2Q5TA 2JDAA 5I0RA 2ZHMA 1QXRA 4KGGA 3ZFGC 2BP6A 5LZ6A 2ZAHA 1C1FA 2J1EA 2ENRA 2CTVA 3AP7A 3PIGA 1Z7S1 2PAKA 2UWBA 1PM4A 3MGUA 1RJ8A 3VKFC 3ZYBA 2DV9A 3LSDA 4E4DX 2A1XA 5ABJA 3I49A 2N7GA 4XJZA 5A7QA 2VD7A 3A23A 4IETA 2HWC3 1GZWB 1IG0A 3WP4A 3WQ1A 4AR2A 4D94A 1ZRFA 3VL8A 1ZREA 2WZ8A 3BVCA 1ZBE1 1S0EA 2CDPA 2IUWA 2I45A 1AYM3 3IKWA 3OGVA 2WZPP 5ABJB 2VZ1A 3RGBA 4EV0A 4YSFA 5CKNA 1LNSA 4AFBA 3OYWA 3R4DB 2YXSA 1NCQC 4UBGA 3VD9A 3C2UA 4TLGA 5F3EA 3BB6A 3TOJA 3I2OA 4W6XA 2QNKA 1GQGA 4QX1A 2FBEA 1CONA 3BPZA 5F3IA 4FP3A 1I1EA 2R043 1EP0A 3LWCA 1JU4A 1OXCA 2JE9A 3OYWB 4D0QA 4IE6A 2Q1MA 2CWMA 3PURA 4Y3OA 3FHAA 4CUGA 4LXLA 4TSVA 2DTYA 1ZRIA 2G4IA 1FATA 1PZ8A 1S0CA 4TWTA 5T5OA 3R4UA 3NJVA 4YWAA 3NWKA 5GM0A 1DYPA 3AMPA 4IGOA 4UOJA 1POV3 1UOBA 5DQ0A 1XU1A 1AVBA 1DYOA 2PHDA 3PTRB 4ISQA 4NAOA 2JJ6A 3DYMA 5HCBA 3GZTB 3MF6A 1V9U1 4R9BA 1EUUA 1TMF3 3KSCA 1RUG3 1L7LA 3C7OA 1DIWA 2GAUA 4Q4W1 4XXAA 1D0HA 1SLBA 1G9BA 1RUG2 4RGAA 5C33A 2ES3A 4IDZA 4FXKB 2QFEA 2FZ2A 2Q4SA 3THCA 1S55A 1T2XA 2VVFA 2J22A 1GOFA 3RJ2X 4EE2A 1YQ5A 4I0AA 1BK0A 1GP4A 2JIGA 5FBZA 5J98B 5C4WC 4BQYA 2RJLA 1G6NA 2DF7A 5IVVA 5DAVA 1COV1 2YUEA 3AYDA 4DPNA 1RL3A 3AP9A 4QPGA 1V6IA 1LHOA 1VAMA 4DXTA 4PHZA 1B09A 3I2FA 1U12A 1WLTA 1VBA1 3AKTA 4Q2FA 1MZ6A 3QCWA 2J1VA 3INAA 3J8F1 1GLHA 1WUVA 2XJUA 2Y6LA 1J1LA 4NAMA 5FP8A 1UN1A 1H9PA 4QPGB 3ES1A 3LPFA 1QKQA 1U5XA 3SCFA 3GCWA 2RVAA 3T30A 1GZ9A 1FT9A 1QNWA 3B7MA 3DYPA 3ZOIA 2OQ7A 2CHHA 3ASIA 1D4M3 4AVTA 5JR7B 5JDBA 3UKNA 4HMZA 5A33B 3CQOA 4ZZ8A 3CNAA 3PUAA 3SCGA 3WP3A 2IXIA 4CEYC 2RJ2A 1D4M2 2CGNA 2XWJB 2XBO2 3THDA 1W3XA 1PO11 5LK5A 4L0PA 5KHGA 1ULCA 4XPVA 2Z42A 3AMMA 2V4VA 3Q8FA 3I3QA 2RR13 4N9HA 4QQLA 5F39A 2LROA 3SH4A 3KV4A 5FY5A 3WNLA 3N7KA 2RS32 2ZTNA 4MXWA 4XVHA 1H8TC 4C90A 2FMYA 2VCAA 5ACA1 2RS12 5IT6A 1VB2A 4MHUA 4E8DA 4XIKA 3WG4A 5A3PA 1PVC2 1XOYA 4LO7A 2WKKA 4M3CF 3P3PA 5F6LB 5BXXA 1YXWA 4X6RB 1QJY3 4MXWB 3U07A 2XH6A 3WG1A 3X29B 1DF0A 1XNKA 3SCHA 1RUJ3 3RYRA 4CU6A 1QDCA 5LA2A 1BZWA 1KD7A 1LHNA 1NLRA 2A3YA 2D3SA 1UYZA 2P17A 1RUOA 2VVDA 4PLNA 3Q8BA 1AR73 1F4HA 2D6LX 2RMU1 4XJ8A 1MS1A 1UY2A 1V6LA 1Q43A 2WAOA 1DGLA 2J42A 3OBAA 4V2VA 4YYOA 2VL4A 2ZX2A 2R071 4QGLA 1RUH3 2XLFA 2X05A 4IEXA 4JQTA 4RQPC 2DFCA 3RRDA 3BTYA 4IE4A 4I02A 4K21A 1WCDJ 2XMLA 5FYCA 5ISLA 2KA3A 2ZOEB 3I4IA 1QXJA 1QOSA 2GSYA 3IDBB 5LK7B 4AXOA 2JDKA 1C1LA 4NN0A 2VBPA 5L7OC 2JIJA 4RFRB 5EZWA 3F2ZA 1VBC3 3RG0A 2ZEZA 3HN3A 2QTWB 4BXSV 1YHFA 3HT2A 1W04A 3ORJA 4PDWC 1TVGA 3AZWA 4ZHNA 3H8RA 1CAXA 2ZGMA 3V65A 1RVF2 2WABA 3DKQA 4QQPA 3W5NA 1FOD2 3T0BA 3VZOA 1AYN3 1UX6A 3G7DA 4P5HA 1CAXB 4HG6B 1R1A2 3G6JB 1VRBA 4AOCA 1IKPA 1OOPC 4ES8A 5FFOC 4W65A 5DUVA 2UYAA 3R4SA 4OQ9A 1F9KA 5AC91 1K12A 2ZMKA 3S57A 4XHBA 2PAEA 3OBTA 2VZQA 3C8XA 3HT1A 3N9QA 1EV12 5FQ0B 4CCKA 4COZA 4F8AA 1FV2A 5C9AC 2YC0A 3RMYA 4H14A 4LPLA 1F8VA 1YQ6A 1WW4A 3BIWE 3GZEA 3WDWA 4EQVA 2BERA 3ZXGA 4CDUA 3NJZA 1V6MA 2HWB3 4RR3C 3TB0A 4KMQA 1LESA 1W6PA 3WF1A 4DUVA 5C70A 4C91A 2IFWA 3RNSA 2FDGA 2ID4A 3MF9A 4LULA 1ND3C 4QPYA 4QX2A 4N7UA 3D0JA 1BQPA 2VUAA 3WW2A 2P1BA 4CDUB 1UKGA 4BZ4A 1W6PB 3MI8A 1OH4A 4RHV1 1Y9MA 4GMP1 4AEMA 3U1XA 5FR3A 4HKOA 1E5SA 2IFRA 2CU5A 2HWE1 5A3OA 5D1IA 1AR92 1TZOA 1W03A 1VR3A 1MQTC 4MXVA 5BNQA 2GC3A 4GWJA 4AFMA 1PX3A 1RMU3 4GB33 4PBOA 3WOGA 5F7UA 1XYOA 3NV2A 2QQKA 2VY0A 5A3WA 4Y1YA 4P9WA 1G86A 1S1AA 4GA9A 3P1IA 5FUPA 5LEJA 2FDFA 2R1DA 5LBBA 5A7NA 1BEV3 4QT6A 2W68A 1JYTA 4BK4A 1QU0A 4HOOA 3PUSA 1BEV2 3WG2A 4XBNA 4HZFA 3TWIA 2WZR3 2C0ZA 3VKNA 2R062 1UYXA 2O0OA 3I97A 5F5CA 1WLDA 3MV01 2BEOA 4CP2A 4AFCA 3O1RA 4LITA 4IV3A 1OUSA 4NROA 3JBG1 4A7ZA 5G05L 4ATEA 3JCIA 3W21A 2VTXJ 1MZ5A 2VZUA 3H7YA 1TME2 5DAQA 1F2NA 1W2TA 2QQLA 5JXIA 4OZXA 1U5YA 1VRH1 2PN5A 1WMFA 4Z92B 1NCRC 4FI9A 4HANA 1IS5A 1OMIA 2VVEA 2BOJA 4IV3B 4YPJA 2VULA 3VBUC 3H9AA 3AKSA 4RGKA 4CYDA 4M4PA 3MW4A 2R041 4XURA 1Q56A 2C1FA 2RS52 5FWJA 4OQ8A 2ET7A 1UO9A 1YJKA 2EXKA 2WQ8A 1UU5A 3POFA 4FPLA 2WBKA 4Y1UA 1ENXA 4E4HA 2UWCA 4AEKA 1ULDA 4X8NA 2GDFA 3VBFC 3HMYA 3TAYA 5C8CA 3CJXA 4HSLA 4NE9A 3ZPOA 3ZYHA 5IVFA 1WLCA 3KQRA 4QDSA 2E53A 4YW6A 1NUKA 1JZ4A 1KDMA 2OVUA 4W50A 1W9WA 4L2NA 5A7OA 3C7EA 4NRPA 4I2OA 5J48A 1HRV2 4XUQA 3QBQA 5E1RA 1US2A 4AGVA 3ZN6A 4O7XA 5C8CB 2QQNA 2VAUA 5FLHA 4A41A 3QOPA 4HPKB 5BNOC 1GR3A 2XPJA 1ULGA 3FC0A 3VL9A 1BJQA 2RM21 3UGFA 2QDNA 5BUVA 5J36A 5JOZA 1L7QA 4JGZC 3RZKA 3ZN6B 5K4LA 2EVXA 4Q27A 3TNQA 4BQ4A 4C1XA 1QDOA 4IEUA 5FYUA 3WW4A 1GNYA 1XNAA 1RITA 1VE0A 1WA4A 2YC2A 4YZ4A 5J37A 2XG3A 4D7TA 4FQ4A 4AGRA 4M00A 4NPRA 4Q8LA 1VBD3 2GH2A 2VE1A 1PO21 2HEYF 1AXKA 1F31A 1LENA 1XXNA 4FP2A 4KWKA 5FZ3A 3HQXA 4KG8A 3LFMA 3RZJA 4UXAA 4XAAA 3RWKX 5DUUA 4OI4A 3ZN4A 4CDQA 2BNMA 2QCSB 4BMEA 4FAHA 5F3GA 4L92A 1VAKA 1FI2A 5FY4A 5CFDC 1GU3A 1DP0A 2J1RA 2WWUA 3HJRA 3NMBA 4Y22A 2ZGLA 2VQAA 4CDQB 3M3OA 4KI5M 5FZ1A 1ASJ3 3QLQA 1MEC2 4XYXA 3TN93 5JIUA 1EAH3 1G9FA 1N1SA 4HFSA 4XXPA 4Y5TA 4EWDA 3U4XA 1ULFA 1C8NA 2W92A 1UZVA 2VQUA 4Y22B 5F6KA 3M1HA 2XVKA 5IAXA 2ZGRA 4MGQA 4AAXA 3NRUA 2OPWA 2BDRA 2VECA 3I3BA 5FJKA 2IXJA 2LW8A 4R9CA 1PGW2 1X9TA 1YI7A 1CD3G 4Y26A 2ZHLA 1NA1C 5FK8A 1KJLA 1W2NA 2XJSA 3DUIA 3NNFA 4M01A 5I93A 3VHRA 3UGGA 3WHUA 2VZSA 1RUJ1 2WNUC 3CHXA 1G9DA 1B35C 2EA7A 4NO4A 3I59A 4QB2A 5CB7A 4P02B 4XFCA 1LOAA 1RIRA 3ALQA 1Q8VA 4GZ9A 2QZ2A 4I3PA 4XIOA 4QDQA 3MYXA 1CX4A 2QUOA 4E2QA 4AW7A 2AEYA 1OPOA 1AHSA 5DG2A 3I59B 3K75B 3LCPA 3PDQA 2BVBA 2WNEA 1UZYA 2X09A 2WFF1 1LOEA 1AX2A 1XE8A 2VOKA 1FMD3 2AYHA 1MS3A 4PI2A 5DUWA 3WNNA 5I8YA 1JYWA 4I09A 4CCLA 1C3HA 5CKMA 1AR63 4Z07A 5FZIA 5JUVA 1R083 1W8TA 1JYXA 3O1UA 4RD7A 2XR4A 2R1BA 2IZWA 3M3QA 5A70A 5JXJA 1D2SA 4PIXA 1VBC1 1JOBA 2ZKLA 3RWNA 2SBAA 3LIGA 3K77A 5FMCA 3JQWA 1MS8A 5FREA 3R0RA 3ZIXA 2VZPA 5AVPA 1TG7A 3K3OA 5FPUA 1D4VB 1LOFA 3WZ1A 1O3QA 1UWWA 1JYVA 3BU0A 1RHI3 1ZBA3 1Z78A 2ILMA 2W9XA 2YBPA 5FV3A 5FZ7A 5FDBA 3NJXA 5DN2A 2LALA 2GNTA 2GMMA 2XJVA 4OUMA 5FLJA 5FMOL 2HWD1 2NMOA 1UNBA 1KQRA 1VAVA 2DYCA 5FKCA 5C3SA 1DQ1A 3VHNA 2YYOA 4OHYA 1D2QA 1CZTA 4JC1A 4EZ4A 1PHMA 3HQUA 4AE2A 2VTXA 5LEKA 3KV9A 2Z69A 5GLVA 4DQAA 3WX5A 1X82A 2W94A 3KF3A 4LE4A 4MSVA 1CPNA 1QJFA 4FPEA 1XE0A 4IEVA 2Z5WA 1ZZ8A 1C8M1 4QPIC 4QKBA 2Z4FA 2VUCA 4IEPA 1BLZA 5FYVA 5EJ3A 3U14A 1ST8A 1MS9A 5FZLA 1OD3A 1ZBE2 2PMWB 2X8KA 5FZHA 2G1MA 2WQ4A 3WQBA 3VBOC 1IS6A 5FZ8A 1KGYA 1PMJX 2JENA 1JOJA 4YZ2A 2YPDA 1HB2A 4NPLA 1CVNA 4OYUA 3MV11 5K0UA 2HWF1 3B02A 2UURA 3O1OA 3KS7A 1BVVA 2DFBA 2VW0A 4G3YC 5DDJ3 2HLEA 1TQ5A 5ANNA 2Q8EA 4LKSA 3VDAA 3ZSEA 2KXLA 4AGGA 1KS5A 3GNEA 1BBT1 3M3CA 2TUNA 1WGPA 3PU8A 4AI8A 5K0UB 4F7ZA 4MGZE 3FHQA 4GB31 4MUVA 3UGHA 1R091 4QGMA 1QQP3 3AZYA 3JD71 3AYAA 1SBFA 4HK8A 1NX9A 2BGOA 2A7AA 4ZS2A 4AEJA 2QJVA 4YW5A 1GP5A 1LHWA 5FZEA 2NP0A 1IZ3A 2ZA9A 3MPPG 1H1MA 1S2EA 2YU2A 4RYDA 3MHZA 1V9U2 2WT0A 4R8HA 5GZGA 4XF4A 1BYHA 4Q4W2 2EXIA 3MFAA 5E89A 1SDWA 1SPPA 1PIV3 2ETEA 5FYSA 2BFUS 2WIIB 5FZDA 3USSA 1YEWA 2QVSB 2DBNA 1NE6A 5BYNA 3ZFEC 2PAMA 3T08A 1TNRA 2JB4A 3QACA 2W95A 1Q3EA 2WINB 2MPFA 3GJBA 1SPPB 2ZGNA 1COV2 2VW2A 2ZKNA 2JDHA 1VMJA 2ZGPA 4QKNA 5FXVA 4YW1A 1A34A 3CLPA 3OBRA 4YNIA 3VD5A 1L7RA 3UETA 4JX0A 4RN5A 1VBA2 4AHYA 1W6QA 4IXLA 2IVJA 4LNVA 4BPZA 2DDUA 1T6GC 5FY0A 3IDAA 5FK7A 1AR83 5LBCA 4L11A 4JZRA 3SEPA 4D3WA 2VZVA 4BIFA 2Q8OA 2ZPXA 4A6OA 1OSGA 3OGGA 1W6QB 3ZKYA 1E5HA 2YHJA 3JUUA 4BJ0A 4XFIA 1PNFA 2EF6A 1ND2C 2CYFA 2LS6A 5IVBA 3DN7A 3LE0A 1RUD1 2WO3A 3NAPA 2WYSA 3DPRA 3OPZA 4JAAA 3H3LA 4ASKA 3MUZ1 3ME2A 3ROUA 1PO12 4Y4YA 5A7PA 1GOHA 4TXWA 2QQWA 4GAZA 2XKPA 4KWUA 4HKLA 4CDWC 3VBHC 3H42B 3AMQA 3HVDA 1FNZA 3NAPB 3LAGA 3DPRB 2BU9A 5ACA2 4LBKA 5FZ0A 1NKGA 1I6XA 1MACA 3AMHA 2XVGA 3ZSKA 2F4LA 1WMDA 3H1MA 1UD1A 3FX3A 1DYKA 1QJZA 2RDSA 2Q30A 2IXKA 5FAXA 3HR9A 1VBE1 4W6YA 3FE5A 3PTYA 1ULOA 1VBD1 4H2AA 3S7EA 5FWEA 5JIAA 1HQNA 5AFBA 3T4HB 3SH5A 1QXPA 4B4PA 3A0NA 2Q8CA 4C8DA 2WA4A 4COUA 1W8OA 1C5IA 5M0TA 2VNVA 3BTXA 3OCPA 4S2GA 2RMU2 5CADA 1DZTA 2Y8KA 4MGKE 2VOWA 5FZAA 5C71A 2V5YA 4FPGA 4O65A 1CJDA 4IERA 4HVQA 4K1YA 2ZGSA 5GLUA 4QPGC 3IMMA 4RS5C 4MG2A 2R072 3ZYJB 5A1AA 5KHIA 1G9AA 4LR4A 3POJA 4COYA 1W2OA 3S30A 1RUE1 4EWAA 2E26A 3WDXA 2P3KA 1FPN1 2EIEA 5EQUA 2VR4A 3T3YA 4BWOA 1ACCA 3FJSA 4GJYA 1QWRA 1QJU1 3MFCA 5F3CA 4EYUA 2MNGA 3P6BA 4LO6B 2HEWF 1SZBA 2VNOA 2JDPA 4SBVA 5I0DA 1UYPA 3W5MA 5E6HA 4UT5A 1YQ2A 3NVCA 3LEGA 4MHRA 2D97A 3B9CA 2A5ZA 1FNYA 4QX8A 4AEDC 4UW3A 1QJX3 3GHNA 3WCSA 3WY6A 4KBBA 3T4VA 5FY1A 5GZCA 3VUOA 4HBNA 1QJX2 2VUJA 4G9SB 1Y7BA 4FT8A 2D3RA 1I5ZA 2VUDA 1QH6A 2V5DA 3AJZA 4M4RA 1GSLA 1S2KA 5AC92 4YVWC 3ACGA 4XHXA 1HJFA 4HETA 3ZYIB 4K3UA 4S2DA 2EIBA 5D21A 4N53A 3K48A 3UKTA 3K3NA 2QBXA 3UJOA 4CRQA 1H30A 5C3PA 4YM2A 4B3NA 3WDYA 2WWJA 1W0OA 2A6XA 2WA3A 1S0IA 3NNMA 3CMGA 3VD4A 3TRSB 4N53B 3H3UA 3WF4A 3AKRA 2TEPA 3OD4A 4Y1XA 3LSEA 2H0BA 4P00B 4AQSA 4BLJA 1HXS1 5BY5A 5IATA 3EB7A 1QMJA 2FCUA 5LBFA 3DCQA 1DGRA 2GNMA 3LEIA 2VNRA 3PL0A 2IXHA 4RHV2 5IVYA 1RUF3 4UYBA 2HWE2 3DEMA 3VD3A 4CVUA 5FZKA 5JVVA 2VOTA 4IEOA 3RPQA 1RUF2 4FFHA 2W39A 4FOWA 3MBWA 5FXXA 2QQJA 3DKWA 1GNHA 1O3TA 4XMIA 4BHPA 3CJIA 4DRRA 4QDRA 4AF9A 3FWEA 4K20A 5SV5A 1DGWA 1ZVFA 5A1LA 1O59A 1PK6C 3T1LA 4BA6A 5KC5A 3AKPA 2A6VA 2QQVA 2VH9A 5HXVA 5FZMA 4JQRA 1K5MA 4J1XA 5BNPC 3LF7A 1HQWA 2YY1A 5FCCA 3IIIA 5KBFA 1LTEA 3OOXA 3NJYA 3VB9A 1JYIA 3ZYGA 1GQPA 4DUWA 4YM3A 1IG3A 4KL1A 3UK9A 3JBG2 5FKBA 3VKLA 5J09A 4DEQA 2D43A 3VBRC 3AP4A 2AH2A 3O1PA 4K8FA 3Q8CA 5FZ4A 4BQ1A 1Y9GA 5FPZA 3WCRA 2QQIA 1I9RA 1VRH2 4Y1ZA 2OXBA 5DPNA 4Y20A 5T52A 1CIYA 1NZIA 1ZM1A 2QZ3A 4CP0A 4OI2A 4NIHA 1W6NA 3VBSC 2Y26A 3NNJA 1XQNA 3BYWA 4MGYE 2UU8A 4OUSA 2ZJCA 4Y20B 3Q8EA 1H2MA 2XOMA 4OHZA 2ERFA 3OGJA 4LLOA 2J7MA 3AJYA 5FO9B 1ENQA 1QQP1 1XSRA 1XNDA 2D6NA 2VXRA 2Y34A 5FMDA 2HBUA 4E2SA 4DS0A 1PNGA 1HRI1 4DEVA 2P3IA 4PQ9A 4MH0E 4XW3A 2GC0A 5KWRA 1JXNA 5AVAA 2WO1A 1Q8OA 4CEWA 3IAPA 5JOYA 1DQ0A 3D4KA 1GOGA 2YZ4A 1H2LA 3B3QE 4GWNA 4JKMA 1REEA 3WDTA 5EXOA 5E8AA 4BCUA 5KR7A 2RM22 1OT5A 4Q5OA 2GP5A 3THTA 1H9WA 2XBO3 1LU1A 3MIGA 2ZGKA 5JMOA 5FOBB 1CR7A 1SFNA 2BGPA 2VPVA 3ZPYA 1J58A 4OULA 1VLNA 5J7MA 4LHLA 2WNVA 5A7SA 1UY1A 4V2WA 3SH3A 1ZZ9A 2D6MA 1VBB3 2D6PA 2RS33 2JKBA 2Y33A 2B39A 3OPTA 1UZ0A 3PUIA 1ZA4A 4O9EA 4UW6A 2VMIA 1ZX5A 1W9YA 2RS13 2XDVA 1W99A 4G4FA 4N9IA 1VBB2 1PO22 4B7EA 3T0DA 1PVC3 3ETQA 4Q4Y1 3RI9A 4DZGA 4CXYA 2WNVB 3PU3A 3IDEA 2W1QA 2BNNA 4XAEA 1FX5A 2IWGB 4QX5A 2E63A 2RDRA 5FPAA 3K4AA 1QY4A 2PYTA 2VZOA 4M3CE 1LU2A 5D8AC 4E9KA 2DVAA 3I3MA 5CFCA 3B93A 4MV2A 4LO5B 1K45A 3ZSJA 1EYBA 2A70A 1RUC1 4QXKA 4NIAA 1H1IA 3SEEA 3WNPA 5BNNA 4K8RB 1OVSA 1REFA 3EQEA 1LJ7A 2QKDA 3VZMA 4BISA 1W9SA 5CFCB 3UL2A 1CIWA 1U5IA 5JCTA 3MDPA 2C4XA 3D0SA 4R9AA 3ENRA 3M2MA 2OIIA 4AVCA 1QOOA 5BNNB 3RZHA 4OLLA 5F37A 3WLUA 3E5XA 4FO9A 4ES9A 5HCAA 4U2AA 2ZABA 4CDXA 5JXGA 3K4ZA 2FZ1A 5IAVA 1O3RA 2JDZA 3TEZA 4FTEA 2PFWA 1W8FA 4DINB 5IHRA 2ZCWA 5EPAA 3H8OA 4NHXA 5CU1A 1W8UA 1PZ9A 1W8ZA 1YLLA 2R7EB 4GH4C 5EYXA 1JYCA 3GZUC 5BPXA 5FPXA 4CDXB 3PVBB 3B9IA 1C57A 1QNYA 2WQZC 5T54A 4UFIA 4FBFA 3FUQA 4CXWA 2FDKA 4BB3A 1HLCA 3ECQA 2E6VA 1F35A 2FHRA 1DLCA 2BOIA 2PHXA 1F5JA 2ORXA 4GMP0 3ZFGA 5DMYA 1Z0HA 1HX6A 1RB8G 1XSQA 2OZJA 5GLTA 1V6NA 1RVF3 3DYOA 3OD0A 4QM8A 4UFLA 3V0AA 4KQ7A 5FPBA 2AEZA 4AK3A 1NQDA 3BTAA 4AI9A 1FOD3 4N43C 2B9VA 2ZX1A 3ZFGB 3T2QA 1YUDA 3ZN5A 2PLV1 1HDKA 1R1A3 1UMIA 4MGTA 2WFF2 5CAZA 1AL21 3V0AB 2HH9A 4Q29A 1UZZA 3FL7A 3RMXA 2EXHA 4ZXEA 5FYTA 2YB7A 4J1WA 1EV13 1UIJA 4S2FA 1NCQA 1NY71 1N1TA 4XTPA 5H9PA 1XNBA 3T0AA 3QD6A 4PCRA 3WXPA 3A21A 2DVGA 4P5YA 5CZKA 1M06G 4JGYA 3OSDA 4L99A 3ZMOA 1UY0A 1J1TA 5I0UA 1UL9A 4WBBA 3POYA 4WM7C 1HB4A 3ZDVA 4ORFA 1NCQB 1X36A 1Y4WA 1SLIA 1MPXA 4Q4X1 5HBAA 5FP3A 2PQQA 4JGYB 2HWD2 2AREA 2PA7A 3DL3A 4QD2A 3B01A 1XPWA 1OQ1A 4D7YA 1GNZA 1V6OA 3M8LA 5EWSA 1ZA7A 2WRAA 1H4GA 2P4EA 3O7OA 1K42A 2DU0A 2WN2A 5T55A 4JVAA 1AR93 1PM7A 3AP5A 5AFEA 4QU1A 1W8WA 4CSWA 5SV8A 3IBMA 3N7LA 1IKQA 4MYEA 4Y4RA 4DY5A 1C8M2 2BBAA 4GD4A 4Q4V2 3BUCA 4V1PA 4JKLA 4RA0A 4ZU5A 2WS91 2X29A 1JZ7A 1SHWB 2JDMA 2RDQA 5C4WA 4A6SA 3JB8A 2E7AA 1MZFA 4MADA 5D2AA 5A6YA 1NQJA 3W59A 1MVQA 2JG9C 2R6QA 1E5RA 4BQWA 1OKOA 4E2GA 5FP4A 4BXFA 5C8WA 2R063 3ZX7A 1KJRA 3O1SA 3LA2A 5C4WB 1ENRA 4ZKTB 4SLIA 1RUI2 4P08A 2HWF2 2K46A 2HWC1 1XBFA 2D5HA 2MEV3 1SMVA 1UOGA 1N3OA 2C6SA 2UYBA 2Y6KA 1TME3 1AYM1 5A3TA 2MEV2 5F8PA 2QQMA 3HNYM 2X5IC 3O0VA 4B1MA 3CBNA 5F9TA 2AGSA 4AI1A 1R092 4CEYA 1CGPA 3BPSA 3JD72 3THPA 1LGCA 3M70A 2GMPA 3OJBA 3OUHA 3KF5A 5K9YA 3LDBA 1AJOA 1H8VA 1ODNA 2RS53 3I2HA 1LB2A 3PJYA 3MPBA 2DCYA 3IWZA 5FPVA 4CEYB 3BCWA 1DQ6A 4XOGA 2K0GA 1H8TA 2GNBA 5FMOS 3WINE 4AHXA 2WN3A 3WEZA 5LWBA 4PIZA 2CGOA 1IGOA 4IL7A 4B8EA 1POV1 2Y6JA 1N3PA 3IN9A 3VZJA 3GF6A 1HRV3 4A45A 5GLWA 2E9QA 5IVJA 1KS4A 3CDZB 1O4ZA 4I0BA 3LEKA 1TMF1 4PQQA 5FP9A 3UKVA 1RUG1 1W39A 2JB8A 4H7MA 4GWIA 4BOWA 2V09A 3C7HA 3OUJA 2ARAA 3N4MA 3V64A 1SCRA 2ARBA 4OFGA 5EYYA 2YC4A 3FBYA 5KXDA 1F4AA 4PF5A 4MLOA 3O1MA 4AI2A 1GZTA 5L19A 1Y43B 5JZGC 4LORA 5CEHA 2W46A 2XL9A 1UAIA 3LA3A 1W2UA 4K40A 4XQDA 4RQPA 3O12A 3T2PA 4BIOA 4URAA 3ILRA 1R1ZA 3NV1A 2XKOA 2RDNA 4WZCA 2V4AA 2CL2A 1BXHA 3KMHA 3BALA 2XWBB 1IS3A 2ARCA 2VMHA 1RUD2 4TN7A 1O5UA 2ZEXA 4CCNA 5CG9A 2VBDA 3ZXKA 5L7OA 4RQPB 4ISRA 4QQOA 1JZ2A 3BN6A 3FMGA 3DXTA 2WT2A 4LUKA 3JU9A 3PNAA 3I3EA 4D8MA 4PDWA 1D4M1 2E51A 4XUPA 5L7OB 1UOJA 1Q8SA 4W8JA 2BNOA 2XBO1 2XVLA 2YPJA 1RUNA 3QH6A 1BHGA 1W9FA 2BJSA 2WWSA 4IV1C 4NMIA 4YFWA 5C3OA 1JU3A 1MEC3 4GIQA 1NLSA 4XCAA 2BV4A 3MEPA 4P14A 1N1VA 1R64A 1ENSA 4XJ9A 5F5AA 4XDPA 2RR11 1OOPA 3AL6A 1XYPA 5FLIA 3ZLIA 2DCKA 4B1LA 2GNDA 5F2SA 4R52A 2VOXA 1LEMA 2PHUA 1FAYA 4UFJA 2EAAA 2RHPA 5KXEA 2WFPA 5DAWA 1A6CA 1VALA 1OOPB 2QQOA 1JS9A 3LPGA 3FFZA 3PUQA 1QJY1 2R16A 5C7GA 3FHIB 5C3RA 5C9AA 4BMBA 2DUPA 5FO8B 1OH3A 2BTVC 4WVVA 1UPSA 4Y33A 4AHWA 1IPSA 1BMV1 1QF3A 3O1TA 1RUE2 2RG4A 1CN1A 3ON7A 4RR3A 3HIFA 3OBZA 1FPN2 5HV4A 5C9AB 1V6JA 4LBJA 2JE7A 2VTFA 5KXBA 1JZ5A 2BBVA 1V00A 1AR71 4BQ5A 4KWLA 1H0BA 1ND3A 4CP1A 4HONA 2NPIA 4OMDA 1QJU2 3S7IA 2PHLA 5LY2A 1VMFA 3GZAA
chains in the Genus database with same CATH topology
4F3JA 1RUH1 1LHVA 2H6BA 3AYEA 4FOQA 1WBLA 3X29B 5J36A 5LRRA 4E27A 3CEWA 1ND3B 2DVFA 4P9JA 3ST7A 3MW2A 1MQTA 2OW4A 2DURA 2QDRA 1QHDA 1YFUA 2JG8C 2Y38A 3VDDC 2XHKA 1MQTB 4IEYA 4XQWA 4WVZA 4MZUA 1UU6A 1ZYBA 5FOJB 3KCXA 2D44A 1IHMA 3C3VA 4XF9A 1RTVA 4LHNA 4NHLA 4JDMA 2AR6A 2NYYA 4WM8C 4B4QA 1AYN1 1EPWA 2ZS6B 1YFXA 4KU8A 4LO8A 4AI0A 1YWKA 4Z82A 5GLZA 1Z7S3 2C9AA 1DBNA 2D7FA 3MIBA 1WW6A 1NCRA 5L36A 3H1YA 3VBUA 1Z7S2 3RJRA 4Q0QA 3D6EA 2R30A 1ZZ7A 1HXS2 1X33A 4UW5A 1ZBE3 5F5QA 1AJKA 1NCRB 3VBUB 4PJYA 3ZFFC 2EIGA 4UW4A 4X6QB 2BW8A 5CVRA 3GHMA 2HWB1 1GKBA 1RC6A 4COWA 1SBDA 1ULEA 3VBFA 3VHPA 5GJ6A 3ZYRA 1OI6A 3RSJA 2XLAA 4RGGA 4XFFA 4Z2WA 3RQ0A 3AP6A 4U36A 1KITA 4YGDA 3VBFB 1KRIA 4AWDA 2WL1A 1NYWA 3ZIWA 5JOWA 3PVEA 1UKRA 5BNOA 4QGNA 3NW4A 1WMEA 1U5ZA 1O91A 1RMU1 4XEZA 4YVSC 4JGZA 2NQYA 2DUQA 4HKWA 1HV1A 3J4UH 3AXEA 3NL1A 5BNOB 2G9GA 1LEDA 2F4PA 1V9U3 2YGMA 1LOBA 1BEV1 3V56A 4JGZB 4Q4W3 3E6BA 1EY2A 4WV8A 5KHKA 1O4YA 2WZR1 3E6CC 4Q8KA 4M0HA 4XF1A 1IQAA 4YRDA 2UY9A 5IK7A 2ZZQA 1SQ4A 1SACA 1COV3 4HK9A 4AFDA 5GKAC 1VBA3 5ABJC 1DGWX 4NHMA 3WR0A 5DG1A 1A8DA 1HRI2 2D3PA 3J8F3 5HI0A 1MS5A 1UCXA 3AYCA 1DZQA 1ZZBA 3J8F2 1CAVA 5GZEA 4XFAA 4EWEA 1FYUA 1LOCA 2YGLA 4OVEA 3B5LB 1H2KA 1CAVB 3RYPA 1NA1A 4YW2A 5DXDA 5T5PA 4H55A 1PO13 4D7SA 4EN8B 4BE3A 4URTA 5JI7A 4DMIA 2WNUA 1LOGA 2CNAA 4I30A 1NZCA 2F6BA 2PHWA 2JECA 1B35A 1NA1B 1Q8PA 2DWRA 2QE3A 3AXDA 5ACA3 3WG3A 1I3HA 1RGSA 2CAVA 4Q4Y2 2Z2SB 2WNUB 3IPVA 2RJKA 1IPKA 1B35B 2Z79A 1LRHA 4L8QA 4KGQA 1TEIA 2PHRA 4YZ1A 1S0JA 2GMEA 2H6CA 4FPYA 1RUC2 3EHKA 5JPNB 1KFUL 1V6KA 3IPVB 3N7JA 4FOYA 3RZZA 5GZFA 2Y0OA 1F5FA 2RMU3 4GXLA 1GBGA 4XQ4A 4GKXA 5GALA 3FFQA 4Z8BA 4AQ2A 1IS4A 2YV8A 5B2GB 2R073 5CBLA 5KXCA 3M7AA 1AX1A 1REDA 3KLSA 4HVRA 1VJ2A 2CY6A 2HKXA 4Q0UA 4Y5Z0 3TBDA 1ASJ1 1RINA 3BODA 1QOTA 3WNXA 2PTMA 3TN91 1EAH1 3WUDA 2B7YA 3RS6A 4LBLA 3SMHA 4OI1A 1A8MA 1YIFA 1G9CA 1S0DA 1OHFA 2D93A 3IT8A 5E88A 3RYKA 3KZ4C 2ZMNA 2CGPA 4QPIA 1TNFA 3ZSMA 3VZLA 4Q1PA 2CWSA 1KXGA 1V70A 1AL22 3HD8B 1O7FA 2KM2A 4JCKA 1DHKB 4K1ZA 4LO4B 2ZHKA 4C1WA 5AC93 1DQ5A 2ZX3A 4QPIB 3VBOA 3FZ3A 2ET1A 4Q0VA 4GQ7A 1NY72 4HN0A 3H3ZA 5JLVA 3WP5A 3ZVXA 1OA2A 2XGXA 3N36A 4C0HA 4JRLA 1J3RA 4XFGA 3VBOB 1C28A 1LODA 3O0XA 1GZCA 1YO8A 1FMD1 5J96B 4META 3ZXJA 4AVVA 4FTSA 1DQ2A 4Q0SA 2NZ9A 1AR61 4Q4X2 1R081 2I07B 2DUOA 3VV1A 1NXMA 4YGCA 4ZU7A 4XZPA 4RHV3 4GMP3 5I91A 5H9SA 3U10A 2HWE3 3AZVA 1Y9QA 1RHI1 1ZBA1 2VNGA 4LBQD 2ZGOA 1O5LA 1N47A 1W6MA 3ZYPA 3FUOA 3L2YA 2A6YA 2BUKA 2Y0IA 3ZFEA 1S0FA 2VW1A 2WS92 3B00A 4DOUA 1GZWA 3I2DA 4PLOA 4OHWA 1W6MB 2DCJA 3O0WA 3MLLA 3SNMA 4AVSA 4LA3A 3CJIB 3IIAA 5JI9A 3ZFEB 4L97A 1NE4A 2ZHNA 4OI0A 1X50A 4TZDA 1LCLA 2R0FA 3EO6A 2P2KA 3AM2A 3JBG3 5I8SA 2HWC2 5I0SA 5CG8A 4YGEA 1K5MB 2ZX4A 4PIYA 1ONAA 1AYM2 3CU7A 5H9QA 2ARXA 5FO7B 1VRH3 3MLJA 4JTNA 3FBMA 1IPJA 1ND2A 4JGYC 1PVXA 3AX4A 3VZKA 3SHRA 3DF0A 5BV6A 4RFT0 5DDJ1 1BK1A 2R042 4L9BA 4FQZA 1ND2B 2WSVA 4CDUC 1CPMA 2PHFA 3P3NA 4GWMA 3VBHA 4CDWA 3MICA 1LULA 2FQPA 5IUQA 1W6NB 1WD4A 4BH9A 1CESA 3ATGA 3AKQA 4GALA 4CDWB 3VBHB 3W58A 4A2UA 1CQ9A 4RL7A 5T5JA 3WHTA 1YJLA 1G8WA 4FPJA 2OZ6A 1N3QA 1TMF2 1UF2C 3I54A 1YRZA 1LGBA 2H0VA 4C0BA 1E57A 2RM23 2JXAA 2ZAAA 3H8UA 5TSWA 1PIV1 1G7YA 1SLTA 1O3SA 3WW3A 5LRSA 3ELNA 4ASMB 2GH8A 4CEWB 3GBFA 4H7LA 4NWVA 5DZFA 4YGBA 4EJRA 1A3KA 4RS5A 2BVVA 3H1WA 4TLFA 2MHFA 1PO23 3U11A 2XJTA 4B29A 3JQXA 1JBCA 2OYZA 4RS5B 5FTTC 4IV3C 3PJQA 3SISA 1OQEA 1GV9A 1ZZ6A 1LHUA 4ONUA 1AR81 4HT1T 3E5UA 3NV3A 1AF9A 2A6WA 3URFA 1D0GA 4A7KA 2PHTA 3MIHA 3UV9A 5K7PA 5T5LA 5CIRA 1SFYA 3E6DA 3CO2A 4DRVA 1NOVA 3ES4A 3V0BA 1HQLA 3A4UA 2D6KA 4AEDA 4LBNA 1WW5A 3NKGA 2R0HA 2QQPA 4HSJA 1UW8A 3O5SA 1QH7A 1NXD1 1GFF2 2RR12 4Q26A 4DNYA 3ACLA 1S0BA 4B4RA 4P9LA 3V0BB 4AEDB 5C8CC 2A6ZA 2WSUA 4IQPA 3APBA 4YVWA 4LHKA 3KM5A 4HL0A 3ILFA 2BWAA 2K2SA 2EXJA 4IEWA 5JPMB 4XF3A 1O4TA 2CV6A 3AK0A 4XILA 1QJY2 1VP6A 3JZVA 4R4ZA 2K9ZA 3FLRA 1DZRA 1YFYA 1VB4A 1OA4A 3L2HA 4H3WA 4YVWB 1RUJ2 4JDOA 4FAGA 1BMV2 2XLGA 2WLPA 2I2SA 2YMZA 1ZRDA 2GN7A 1DLLA 3U0ZA 2HJIA 1AR72 2OUJA 1OLRA 3EBRA 4XF0A 3BU7A 2WFF3 1RUH2 3E5QA 4QQHA 4MX3A 3A0KA 3POSA 5A32A 1UIKA 3CL1A 4YARA 4BM8A 3D5OA 4YFZA 1FXZA 3AZXA 3TYJA 4MVTA 3VKOA 1HW5A 4CDQC 2W52A 5A32B 1VBC2 1IOAA 2EAKA 1PGL1 1PK6A 3AFKA 4FPCA 5DZGA 4XFHA 1AUYA 3LKJA 5EFUA 4FXGB 4AQ6A 4A7YA 5BNPA 3EJKA 1W0PA 3N35A 2HWD3 4O9GA 1PK6B 2IC1A 3VKMA 1QJX1 3ZXEA 3OTFA 5FQ0A 4P9GA 1GANA 1SLCA 1AYN2 1AX0A 4AI3A 4ASLA 3VBRA 5BNPB 2SLIA 4NHKA 5JOXA 2WT1A 1JTZX 3ZXDA 3M3EA 1C8M3 2V73A 3MLKA 4K7JA 4Q4V3 3VBRB 4DY3A 3NV4A 3VBSA 3MW3A 1POV0 2YROA 3TNPB 4EN6B 4YLZA 1LKNA 3S6PA 2EALA 4JDNA 4MGIE 1WCKA 2GC1A 2HWB2 2P37A 1PGSA 2D40A 3UJQA 4EWAA 1DGRN 4LBMA 3VBSB 3PMEA 1AZDA 4FPHA 2A3WA 4M3CA 2AENA 3PLQA 2DTWA 1DU3D 3B69A 1Q5OA 1RUI3 2P34A 2HWF3 4OHXA 2A73B 3KGZA 4I01A 4YZ5A 5IK8A 2B45X 3WQ0A 1OFNA 3K51A 1PMIA 1YIPA 1RUF1 1BCXA 4JV4A 5I8TA 2D98A 4XE9A 4M3CB 1BBT3 3KCCA 4NOTA 2LTNA 1MS4A 1TE1B 1BBT2 1J3QA 1R093 1RMU2 3JD73 4GB32 1J3PA 4P9YA 1LOFC 3WT3A 1M4WA 4YG0A 1ALYA 4YG3A 5IK4A 2OUHA 3LB9A 4KH9A 1GQHA 4Y1VA 2WZR2 3ZXLA 2NLRA 3PVOA 3M4FA 3FLPA 3USUA 2DCTA 4ZU4A 5D8AA 1HIXA 1SCSA 2LM3A 3T1MA 1H8TB 1ZRRA 3MIFA 5GZDA 4EROA 3USUB 3T2TA 5D8AB 4WVWA 3RI8A 3VN4A 3Q9OA 1AL0G 4E4ZA 1JHNA 3DV8A 4TYSA 4QQ2A 4CTEA 4HPKA 4I3GA 2D6OX 3OY8A 1CAWA 3R6SA 4AVBA 1RUD3 4GH4A 2WLQA 5K0UC 3D82A 1W6OA 1YNAA 2B5HA 1YI9A 2TNFA 1XNCA 4DB5A 3W9AA 4AG4A 3MIDA 3OY8B 1CAWB 2NM1A 4GH4B 2VU9A 1W6OB 4QMAA 1S2BA 1A78A 5T50A 4XBLA 4Y24A 5EV7A 2IXLA 4EN9B 4N43A 1VBE3 1VIWB 2GN3A 3N3HA 2DVDA 3I7DA 4AHZA 1VBE2 4PDWB 3ZMNA 2XJRA 4X8PA 1VBB1 2RS31 1KDKA 1MVEA 1AXZA 3H0OA 1VBD2 4N43B 1SBEA 2RS11 3KT7A 3ILNA 3WP6A 1PVC1 1H2NA 2BYVE 1H4HA 1X8EA 1UMZA 2FMDA 2W08A 3WUCA 4LEJA 2BWCA 4AQTA 4CZSA 2A75A 4KNCA 4YW4A 1CJPA 4IEZA 4XBQA 3HBZA 2E7QA 2GC2A 4WM7A 1RUE3 1SLAA 4FCAA 3DGTA 2C5DA 2B42B 1FPN3 3VLBB 3B94A 3WV6A 2ATFA 4FPFA 3MIEA 4P9XA 4K6BA 1ASJ2 1DQ4A 1Y3TA 4B7KA 1QJU3 5A3MA 2VOVA 4WM7B 3FLTA 4NWWA 1ZZCA 3TN92 1EAH2 4E4SA 1JN2P 3LA7A 2Q1ZB 3VZNA 4PBPA 3KB5A 4KU7A 4FTBA 1GYKA 2W0XA 3HAGA 3NAPC 4IEQA 1LGNA 3DPRC 3AZZA 3ZDSA 1KFXL 3JB4C 4LBQA 1WLWA 5L73A 2PELA 1BKZA 2JG9A 1CAUA 4AYUA 2A3XA 1XRUA 1XU2A 1RVF1 4J6GA 3ZXAC 2GZWA 2Q0AA 4LBQB 4GULA 1FOD1 2JEMA 4XJUA 2JG9B 1CAUB 1R1A1 1DG6A 1FMD2 2HYKA 5KC6A 1OKQA 1MS0A 2ZX0A 1AR62 2X5IA 2B9UA 1R082 2VQ0A 5JSOA 1JUIA 1EV11 4FPKA 1HXS3 4DFSA 3IMNA 2BPA2 2DCZA 1APNA 2ZMLA 3LOBA 1NG0A 2X5IB 4N7IA 4YM1A 3AMNA 4P9IA 1C5HA 1RHI2 1ZBA2 3M3IA 3WDUA 2GU9A 5DUXA 1QGLA 4ATFA 3IDCB 2LUWA 5CNAA 2A71A 2ZGTA 4Q1RA 4XMAA 4W6WA 5JSRA 5I0TA 1OFSA 3ZO0B 1X8MA 2WC2A 1LECA 3PMSA 3R05A 1RJ7A 1AXYA 2DVBA 4COVA 1AR91 1OD5A 1SLLA 3SLIA 2JICA 4Q4V1 2O8QA 3RDIA 1WBFA 1YFWA 3H7JA 4N90A 4IESA 2OA2A 2VMGA 3LOIA 3SXWA 5JZGA 2ZBJA 1JW6A 4KG0A 3BOPA 1MR5A 5JAXA 2UWAA 5JSPA 1JH5A 1OQDA 1RUI1 1UU4A 2R061 3GBWA 4YZ3A 1Q8QA 2XJQA 4XJWA 2BQPA 4N53C 3BOWA 5JZGB 2G9FA 4NR1A 1PZ7A 4HLTA 1EPZA 2MEV1 5DDJ2 3VGIA 3ZXFA 1TME1 4R4XA 5DZEA 1L3JA 4HN1A 1H1AA 4FVVA 4XDQA 5CA6A 4A3XA 5CFDA 2E7TA 2R49A 3VHOA 4K9SA 1HRI3 4INDA 4LE3A 4Q0PA 1QQP2 4IV1A 1XYNA 3O14A 2VGDA 2WJSA 2RS51 5CFDB 1XE7A 4ITCA 4PLMA 3D8CA 4IV1B 1ZNPA 3GYDA 1WCSA 3CJIC 1PIV2 2HEVF 2ZGUA 5T3NA 3KGLA 1URXA 2CAUA 2JX9A 4YG6A 3L9JT 1HRV1 1JUHA 3IM0A 1ZRCA 4RR3B 5FRAA 5F1RA 4YM0A 1K5MC 3SITA 3POWA 4M0NA 2B46X 3EXUA 4Q4Y3 4FSJA 1YYNA 3WQ7A 5IK5A 3WVJA 4OHVA 2B8MA 4QHBA 5JMCA 2GALA 3N7MA 5J3UA 3LGRA 3MZHA 4EN7B 1AR82 1N1YA 1OPMA 1FV3A 4BLIA 1RUC3 1YCIA 3KT1A 2AZ5A 4NVPA 4LBOA 2BGCA 2YDEA 1HV0A 1WW7A 3PHMA 5K8SA 3S0MA 2JG8A 2UY8A 3VDDA 4KWJA 1OLQA 2XUMA 1C4RA 1MZEA 2O8OA 2D5FA 3CF6E 3KD4A 4WZFA 5JWPA 2JG8B 3VDDB 4ZXKA 3AB0A 3H50A 2NN8A 4D69A 4WM8A 1MEC1 4S2HA 4CEWC 5H9RA 2IXCA 5KHJA 4R9DA 3I8TA 4DXZA 4LTAA 2ZACA 2R32A 2XL7A 5KHHA 4LLFA 4WM8B 1PGW1 3GALA 2P3JA 3GBGA 4LT5A 3QH7A 2PLV3 4FOVA 3OF1A 5E16A 4Z1VA 5C6CA 2WNVC 1AL23 2NMNA 4JTOA 4AFAA 2PLV2 1OA3A 2OPKA 2DU1A 3ZFFA 3KCYA 1GICA 2X53S 4GKYA 1HKDA 2VG9A 3PVNA 4EN0A 3LZZA 4XFBA 1UPIA 3J26N 4XJAA 1SEFA 4QM9A 4XTMA 3ZFFB 5HCFA 5CFCC 4QU2A 1PGL2 1DDLA 3WW1A 3E97A 2XJPA 5BNNC 2ZGQA 3HWJA 2JD4A 4AVAA 4Q4X3 4UBHA 3ZSLA 5A3LA 1X7NA 3HN1A 4HVOA 2TBVA 3AFGA 4RSUA 2ZZJA 4YVSA 3WDVA 4WVMA 4XETA 1J59A 3NO8A 1BVP1 4CDXC 1U0AA 4LA2A 1DFQA 3J9SA 4JRAA 4F83A 4BYYA 4YVSB 4FPOB 2AUYA 3KT4A 4YW3A 3NKTA 4WVMB 1WD3A 2BFUL 2RE9A 3NSTA 2XB6C 4I0WB 1LR5A 1S0GA 2O1QA 2WS93 2I74A 2Q5TA 5I0RA 2ZHMA 1QXRA 4KGGA 3ZFGC 2ZAHA 1C1FA 2ENRA 2CTVA 3AP7A 1Z7S1 2PAKA 2UWBA 3MGUA 1RJ8A 3VKFC 2DV9A 3LSDA 4E4DX 5ABJA 2N7GA 4XJZA 4IETA 2HWC3 1GZWB 3WP4A 4D94A 3WQ1A 1ZREA 1ZRFA 3VL8A 1ZBE1 1S0EA 2I45A 1AYM3 3IKWA 2WZPP 5ABJB 4EV0A 4YSFA 4AFBA 3OYWA 3R4DB 2YXSA 1NCQC 4UBGA 3C2UA 3TOJA 3BB6A 4W6XA 2QNKA 1GQGA 2FBEA 1CONA 3BPZA 4FP3A 1I1EA 2R043 1EP0A 3LWCA 2JE9A 3OYWB 2Q1MA 2CWMA 4TSVA 2DTYA 5T5OA 1FATA 1PZ8A 1S0CA 2G4IA 4TWTA 3R4UA 3NWKA 5GM0A 1DYPA 3AMPA 1POV3 1XU1A 1AVBA 2PHDA 4ISQA 2JJ6A 5HCBA 3GZTB 3MF6A 1V9U1 4R9BA 1TMF3 3KSCA 1RUG3 4XXAA 1DIWA 2GAUA 4Q4W1 1D0HA 1SLBA 1G9BA 1RUG2 4RGAA 5C33A 2ES3A 4FXKB 2QFEA 2FZ2A 2Q4SA 1S55A 2VVFA 3RJ2X 4I0AA 5FBZA 5J98B 5C4WC 2RJLA 1G6NA 2DF7A 1COV1 2YUEA 3AYDA 4DPNA 1RL3A 3AP9A 4QPGA 1V6IA 1LHOA 1VAMA 1B09A 1U12A 1WLTA 1VBA1 3AKTA 4Q2FA 1MZ6A 3QCWA 3INAA 3J8F1 1GLHA 1WUVA 2XJUA 5A33A 1J1LA 1UN1A 1H9PA 4QPGB 3ES1A 1QKQA 1U5XA 3SCFA 1GZ9A 1FT9A 1QNWA 3B7MA 3ASIA 1D4M3 4AVTA 5JR7B 5JDBA 3UKNA 4HMZA 5A33B 3CNAA 3SCGA 3WP3A 4CEYC 2IXIA 1D4M2 2CGNA 2XWJB 2XBO2 1PO11 5LK5A 5KHGA 1ULCA 4XPVA 2Z42A 3AMMA 4N9HA 2RR13 4QQLA 3SH4A 3N7KA 2RS32 2ZTNA 4MXWA 4C90A 1H8TC 2FMYA 5ACA1 2RS12 5IT6A 1VB2A 4XIKA 3WG4A 1PVC2 4LO7A 2WKKA 4M3CF 3P3PA 5BXXA 1YXWA 4X6RB 1QJY3 4MXWB 3U07A 2XH6A 3WG1A 1DF0A 1XNKA 3SCHA 1RUJ3 3RYRA 1QDCA 1BZWA 1KD7A 1LHNA 1NLRA 2A3YA 2D3SA 2P17A 1RUOA 2VVDA 4PLNA 1AR73 2D6LX 4XJ8A 2RMU1 1MS1A 1V6LA 1Q43A 1DGLA 4YYOA 2ZX2A 2R071 4QGLA 1RUH3 2XLFA 4IEXA 4RQPC 2DFCA 3RRDA 4I02A 4K21A 1WCDJ 2KA3A 2ZOEB 3I4IA 1QXJA 1QOSA 2GSYA 3IDBB 5LK7B 4AXOA 1C1LA 4NN0A 5L7OC 5EZWA 3RG0A 1VBC3 1YHFA 3HT2A 4PDWC 3AZWA 1CAXA 2ZGMA 3V65A 1RVF2 4QQPA 1FOD2 3VZOA 1AYN3 1UX6A 3G7DA 4P5HA 1CAXB 1R1A2 3G6JB 1IKPA 1OOPC 4ES8A 5FFOC 4W65A 2UYAA 3R4SA 1F9KA 5AC91 2ZMKA 4XHBA 2PAEA 3OBTA 3HT1A 4COZA 1EV12 5FQ0B 4F8AA 1FV2A 5C9AC 2YC0A 3RMYA 4H14A 1F8VA 1WW4A 3BIWE 3WDWA 3ZXGA 4CDUA 3NJZA 1V6MA 2HWB3 4RR3C 3TB0A