2WWSA

Physalis mottle virus: natural empty capsid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
161
structure length
161
Chain Sequence
QSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Physalis Mottle Virus
rcsb
source organism Physalis mottle virus
molecule tags Virus
molecule keywords COAT PROTEIN
total genus 26
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wwsA00
5J98B 1RUD1 4N43B 3VBSB 1NCQB 4N53A 1MQTB 4FTEA 4N53B 2HWF3 1AR71 2HWB3 2PLV3 1RUF3 4CEWB 3VBFA 5FMOL 3VDDC 4Q4W2 1QQP2 1AR91 1AYN1 1D4M3 1PIV2 1PO11 1AL22 1C8M2 1HRV1 1RUJ3 1SMVA 4WM7A 3VBRA 4RR3A 2RS33 1BEV3 4CDXA 1BBT3 1PGW2 3VBUA 1NCRC 4CEYA 1NCRA 5ABJA 3M8LA 1HXS2 1BEV1 1PO12 4FTBA 4RR3C 1VB2A 1RUC3 1QJU1 3JD73 2HWD2 3TN93 4RQPB 3VBHA 1AR82 3VBFB 1IHMA 4QPGA 1E57A 3VBHB 1Z7S2 1VRH1 1POV1 3FBMA 2WLPA 3VDDA 5CFCA 2Y26A 4Q4Y3 5A32A 1V9U3 3VBFC 5D8AA 2XBO3 2WZR2 5K0UB 1WCDJ 3NAPC 4SBVA 1PGL2 1FMD3 1RMU2 2BUKA 2WS93 2RS11 5BNPB 1TME3 2RR13 1QJX2 1V9U1 5BNOA 2XBO1 3ZFGB 2RR12 5ABJB 2GSYA 1VBE1 1RUI1 4GB33 1FPN2 5AC93 4QPGC 1EAH1 4CDWA 4RFT0 2RMU2 3ZFGC 4Q4Y2 3CJIC 1RVF3 2HWE1 1H8TC 4Q4W3 4CEYB 1C8M3 1PVC1 1ND2C 1PO21 4QPGB 1TMF2 5BNNC 2HWC1 5C9AC 1ZBA3 5L7OA 4N43C 4RHV3 3VBSA 1MQTA 1MQTC 3JBG3 5FOJB 4Q4W1 4RHV2 1TMF3 1VBA2 5BNNA 4Q4X1 5BNNB 1PO23 1AR62 1QJZA 1RUH2 3VBRC 4IV1A 2HWC3 5C4WA 1PO13 2HWE2 4GB32 5AC92 1HXS3 1AR72 1VBB2 2R063 1OOPA 1EV11 1RUJ2 1NCQA 5BNPA 1B35B 1PIV1 1B35A 1OHFA 2HWB1 1K5MB 2PLV1 1RUG3 3JB8A 1NCRB 1AL23 5A33A 1X36A 4WM8A 2X5IA 1B35C 2R071 1NA1B 1HQNA 5BNPC 4JGZB 1D4M2 1PIV3 1HRV3 5J96B 4RQPA 2WWSA 1RUJ1 5CFCC 1AL21 1RUF2 1OOPC 1POV3 1OPOA 4CDUC 4CDUA 2IZWA 4Y5Z0 5C8CA 4NWVA 1R1A3 2ZTNA 1RUE2 2RS13 2QQPA 1EV12 4IV1B 1TME1 5C9AB 2RR11 4Q4V3 4CDQA 1QJY2 1VBC3 4IV3A 4YVWA 1R1A1 1VRH3 4WM7C 1PGL1 4FTSA 1RMU1 5FMOS 4Y4YA 4Q4Y1 3DPRC 3ZFFB 1NCQC 2WS92 3J8F2 5LK7B 1V9U2 4BCUA 1QJX1 4GMP0 2WZR3 2HWE3 4WM7B 5CFDB 3CJIB 1VBE2 2FZ2A 1QQP1 1AR92 3DPRB 1RMU3 2BFUL 5A33B 1FPN1 3DPRA 2HWF2 4RHV1 5L7OB 1CD3G 5BNOB 2RMU1 2WFF2 2R041 1HRI3 1MEC2 1RUD3 1CJDA 2RM23 5L7OC 5DDJ3 1HRI2 2RMU3 2RM22 1RVF1 1F8VA 1C8M1 1PVC3 5CFCB 1R1A2 1OOPB 4YVSA 1RUH1 1PO22 2BFUS 3JBG2 5DDJ1 2RS51 3ZFFA 4CEWA 4NWWA 1FOD2 2HWD3 4RQPC 1VBB1 4Q4X3 2R072 1ASJ3 5C4WB 4JGYA 2RS32 1W39A 2R073 1NA1C 2HWF1 5D8AB 4JGZA 2BPA2 2HWD1 1ASJ1 1NY71 3VBOC 4Q4V2 1RUG2 4QPIA 1VRH2 1FMD2 4QPIB 1D4M1 4AEDC 4CDUB 1K5MA 2XBO2 3TN92 1AUYA 1ZBE2 4AEDA 3IDEA 1VBD1 1EAH2 1AYN2 1A6CA 4QPIC 3VBOA 2RS12 4IV1C 3HAGA 1AYM3 1FOD1 3VDDB 4CEYC 1FMD1 2WS91 1RUE1 4YVSB 1RHI3 5C8CB 4CDXC 1RUC2 3JD72 1AYM1 5A32B 3ZFFC 1ZBA2 1COV3 1QQP3 1POV0 2TBVA 1RUI3 4YVSC 5CFDA 5CFDC 1QJU2 1FPN3 2MEV1 4CDXB 1RB8G 5ACA2 1M06G 2GH8A 1Z7S1 1COV1 1ND3B 5GKAC 5BNOC 1BBT2 2VQ0A 4RR3B 2X5IC 2RM21 1ZBA1 2ZAHA 1NG0A 3LOBA 1RHI2 3VBUB 1VBA3 5D8AC 4FSJA 1AR63 1VAKA 2MEV2 2X5IB 1RUH3 4GH4A 2RS53 1RUF1 4GMP3 1AYM2 1RVF2 1C8NA 4LLFA 5C4WC 5JZGA 2R042 1AYN3 3JBG1 5DDJ2 5ACA1 3ZXAC 4EJRA 5ABJC 1RUG1 4PDWA 4RS5A 1TMF1 1R082 5K0UA 2RS31 4N43A 3VBSC 1TME2 1BBT1 5C9AA 4CDWB 4CEWC 1H8TB 1HXS1 1ND2A 5ACA3 1R083 5C8CC 2XPJA 1H8TA 1HRV2 1ND2B 3CJIA 1ND3A 2R061 1VBB3 1ASJ2 1NY72 1EV13 4CDWC 4WM8B 1AR93 1DDLA 2HWC2 1AR81 1QJU3 1PGW1 3TN91 1R081 3JB4C 3J8F3 1ZBE1 3ZFEA 3VBRB 1FOD3 3ZFEB 4WM8C 4Q4X2 4PDWC 4RS5C 1F2NA 1RUE3 4N53C 2HWB2 2PLV2 1AR83 2BBVA 4Q4V1 2R062 3NAPA 5JZGC 2WFF1 3ZFEC 3J8F1 1ZBE3 4PDWB 4RS5B 1BMV1 1VBD3 2MEV3 1MEC3 1HX6A 1VBD2 2DF7A 5JZGB 1RUC1 3JD71 1K5MC 1BEV2 1VB4A 4IV3B 4YVWB 1QJX3 2WFF3 3VBHC 4CDQB 2WZR1 1ND3C 1RUD2 4JGYB 1VBE3 4Z92B 1RHI1 1MEC1 4JGZC 4IV3C 4YVWC 1NA1A 4CDQC 1COV2 1R092 1VBC1 1BMV2 5K0UC 4JGYC 3VBUC 2R043 1HRI1 1RUI2 2FZ1A 1QJY1 1R093 4GH4B 1GFF2 1Z7S3 3ZFGA 1PVC2 1X33A 2RS52 4GMP1 1AL0G 4GB31 5AC91 1EAH3 3VBOB 4GH4C 1QJY3 1R091 1VBC2 3S6PA 2ZZQA 1NOVA 1AR73 4AEDB 3NAPB 1VBA1 1AR61
chains in the Genus database with same CATH superfamily
5C3QA 1SFPA 4BM8A 5J98B 2E7TA 4FPJA 1N3OA 4N53A 1JOBA 2HEWF 2VUCA 4QPWA 5A7SA 3AZVA 1WMDA 3WDXA 3ZYFA 2D40A 2PLV3 4CUGA 3RSJA 1YQ6A 5KR7A 3O1UA 4AVAA 5IK8A 4IW3A 4JRLA 3I2JA 3KF5A 5LBCA 1W28A 3V0BA 2VW2A 1QQP2 1NYWA 1YWKA 4E2QA 4BDVB 1D4M3 1JTZX 1H1IA 3PMEA 5IVYA 5IW0A 3VZNA 2LROA 5EYYA 1HRV1 5F3IA 1ZZ9A 2CSGA 3LA7A 2HEYF 3ZYHA 5HCHA 2ARAA 4QX1A 2WJSA 4P9GA 1E5IA 1OLQA 3HBZA 1BBT3 2FHRA 4G3YC 3SH5A 1PGW2 4JC1A 4LBOA 2VE1A 4TLGA 4A7YA 5IHRA 4P9LA 3VDAA 4CEYA 3KV4A 5F5AA 4BOWA 5FPAA 4NVPA 4TWTA 5JXIA 1GNHA 1HXS2 4XFHA 3SITA 3GZUC 4MADA 4OZXA 1DGRA 1YC61 4LXLA 3ZXGA 4B3NA 4C91A 4RR3C 3LIHA 1KDMA 2YBSA 1Y3TA 2HWD2 2Z69A 3SH3A 3RG0A 4COUA 3WQ1A 3CU7A 2WAOA 4HVRA 3GALA 1W3XA 2HYKA 3H7YA 1QXJA 1GKBA 1SHWB 4LO5B 4QPGA 4AQ6A 2JECA 2FMDA 3JUUA 3WG3A 3PVEA 2Q8CA 4Q4Y3 5JMOA 2YDEA 1SEFA 1D2SA 3T4VA 2VVFA 1QNWA 1W2AX 3OGVA 2IFRA 3KHBA 3MV11 4ZU4A 3M3QA 1AX1A 1MS8A 5F5QA 5D8AA 1A3KA 2KA3A 2Y0IA 5LK5A 3EXUA 1CPNA 2WUHA 4I0WB 4A3XA 4ES9A 2RS11 3J7MA 4UFIA 3HQRA 1AHSA 1LCLA 4JV4A 1GWLA 2ZX0A 3OBZA 4NIAA 1N3PA 5FZEA 5A3PA 1QJX2 2R1DA 3KV9A 3AMPA 1V6LA 2VMFA 4XPVA 3I2KA 1MS5A 2UU8A 2Z42A 2RR12 3O1VA 4FCAA 3C2UA 5ABJB 2BNNA 3VHOA 2WO1A 4GB33 1FPN2 2XLGA 4MZUA 4R9CA 2R32A 5AC93 1EAH1 1H9WA 4YW1A 3LA2A 1FI2A 3VKFC 4GAZA 3TB0A 2O0OA 1YJLA 4EROA 2RMU2 1DLLA 3GZAA 4Q4Y2 4CP1A 1RC6A 1YI7A 1H8TC 3N7MA 4CEYB 3NWKA 1VMHA 4L92A 2DCYA 4TSVA 3K4ZA 1G86A 4JZRA 3N9NA 4BQ5A 5L7OA 4ATEA 2WLQA 2XXZA 1PM7A 4RHV3 3VD5A 1DF0A 2PHLA 3POSA 2ZGKA 1V6NA 2ES3A 4CCJA 3MDPA 1URXA 4KU8A 4DXZA 3T3YA 4L8QA 1AX2A 3VHPA 5CBLA 2EA7A 5HV0A 1L7LA 1QJZA 1RUH2 3VZLA 4DY5A 4IV1A 1V6MA 2GZWA 4P5HA 5ANQA 5FP8A 4XUTA 5C4WA 4PI0A 3E5XA 3PVBB 4IE6A 1LOEA 1LGCA 1PO13 4GB32 5AC92 4EZHA 4Q27A 2H0BA 3KCXA 4YW6A 1VBB2 4MXVA 1QH6A 4LR4A 4UFMA 1SQ4A 4ES8A 1NE4A 4XOGA 3CMGA 1KS4A 2P2KA 1SLIA 3POFA 5JPMB 1HB4A 4XF0A 4M3CB 1B35B 3O0XA 5CB7A 1W9SA 2QQMA 4AI0A 1OHFA 1REFA 1UOBA 1V6KA 1WBLA 2HWB1 3SCGA 1AJKA 4DRVA 3DYPA 1RUG3 3ILFA 4JAAA 4ONUA 1NCRB 1AL23 2HBTA 3IPVA 3TEXA 3ZVXA 4GWNA 3TEWA 5KXCA 1W9FA 3UKNA 4QU2A 4HKLA 1B35C 1ENXA 2R071 1NA1B 1W8NA 1HQNA 3F2ZA 4ZKTB 2VMIA 1WGPA 5GLVA 2YB7A 4JGZB 1D4M2 1DQ4A 2YPDA 4CXYA 4PI2A 3FFZA 4YZ2A 2C24A 3AB0A 1RUJ1 5CFCC 1AL21 1P8JA 1UO9A 1HB2A 1ZZ6A 3ALQA 2OZJA 4LEJA 3MI8A 3DEMA 3W9AA 1B09A 3WDYA 4E8CA 3JQXA 3ENRA 5FPVA 4HKOA 1Q8OA 3TNPB 3G7DA 1CAXA 1CZTA 2C9AA 2D3PA 3C8XA 4R8HA 5J36A 1OD5A 2JDMA 2VZRA 2I2SA 1KITA 3AM2A 3OBAA 5C5UA 1TEIA 2Q8OA 2QQPA 4MGSA 4Y26A 2JEMA 4ZZ5A 4B7EA 1TME1 4JRAA 1LGNA 1QEXA 1ZNPA 2JG8C 2JIJA 3OPWA 4RSUA 5DABA 4IERA 3WF0A 2AGSA 2D6MA 2GP5A 5JIAA 1H2NA 1C5IA 2D3RA 5FPZA 4YPJA 5JCTA 5FZGA 1RMU1 3JZVA 1PMHX 3OY8B 3RWNA 2DFCA 3BTZA 1REDA 1G9BA 4A2UA 3KGZA 1JH5A 4QDQA 1Q8QA 1OH4A 1NCQC 2BERA 2WS92 3N7KA 1V9U2 3NW4A 4TN7A 5FJKA 5JAXA 3SEEA 3E1F1 5LA0A 3I2DA 3FC0A 3GBFA 3CJIB 4QQLA 1VBE2 2FZ2A 2XJSA 1QQP1 5CG9A 2QQWA 4ZHNA 3UKVA 3ZDSA 3RYKA 1RMU3 1FNYA 1W2OA 1FPN1 4H2AA 2WC2A 4QMAA 1Z78A 5FYTA 1JZ4A 2RMU1 4LOTA 5C3PA 2P5BA 1C4RA 1RUD3 3ZYPA 3QACA 1CAWB 2XKPA 2RM23 1QOSA 1VJ2A 2TUNA 5FYHA 4DFSA 1US3A 3IDCB 4BZ4A 1OF4A 4O65A 2RMU3 2QQKA 5FZOA 2UY9A 3MICA 4H55A 4AGRA 3ABZA 5FZMA 5CFCB 1IKQA 3JCIA 1OA2A 1R1A2 3M1HA 5C5TA 3POJA 3ST7A 5FZ0A 5HCAA 5CFDC 5JPNB 1U5IA 3ES4A 3JBG2 4R9DA 4HETA 1LOCA 1WKYA 2O14A 4N9IA 2OIIA 5LW9A 1FX5A 2VUAA 2CDOA 4RQPC 1LOAA 1VBB1 2VD7A 2YBKA 1QXRA 1BYHA 2R072 4Q4X3 1JYNA 1J1LA 1KRIA 1ASJ3 1W6PA 2PHFA 5IK4A 3WOGA 4Q0SA 1W39A 1ZX5A 2BGOA 2HBUA 3QH7A 1V6JA 1ULPA 2C1FA 3LGRA 3Q8CA 2HWF1 3N9PA 5D8AB 5FZBA 5A3NA 3B5LB 1LOFC 2W0XA 4LNVA 4ZU5A 4CTEA 1Q8PA 5F7UA 2A5ZA 4WBBA 4K21A 1CQ9A 2NPIA 3MGUA 4IDZA 1ASJ1 1NY71 1XNDA 2A71A 1IS3A 3G6JB 4Q8LA 2VGDA 4MUVA 3VBOC 5CG8A 2ZHMA 4ISRA 4NIDA 1VRH2 1FMD2 3MO4A 2Y6JA 2Q1MA 4YGCA 3A23A 1W0PA 4MGIE 3T09A 1K5MA 1VALA 2XBO2 4B4QA 4XABA 3TN92 1OD3A 1H2KA 3ZN6B 4BU2A 2QDRA 3W58A 1JXNA 1GNZA 1R64A 2UY8A 2VC9A 1XYOA 4CCNA 2SBAA 4XZUG 4LHNA 4FPLA 4BLJA 3VBOA 1WUVA 4COYA 5FKBA 5H9SA 1W2TA 4UW3A 2CU5A 1LOFA 2VXJA 4FPEA 3RFRA 5C3OA 4HG6B 3M70A 1UF2C 1FOD1 2GU9A 2OQ7A 5GLUA 5A3OA 5F37A 1G9FA 2WYSA 2XJRA 4PQ9A 4AEKA 4LTAA 4JKLA 3LOIA 1GOHA 2IVIB 2QQLA 3JD72 1KDKA 2LS6A 4QXHA 5A32B 2C5DA 4RN5A 2NN8A 1O5LA 3IBMA 3QCWA 4QHBA 2KM2A 1F5FA 4YVSC 2KD7A 2V73A 2ZEWA 3IT8A 3EB7A 3H3LA 2E6VA 4XFBA 1H0BA 4H3WA 2DV9A 4OVEA 4KWUA 3B94A 3LSEA 3IB3A 4O61A 4WZCA 2AYHA 4CCEA 5JI9A 4MXWA 3T4HB 4B29A 3BKZA 3AMNA 5I93A 1GZTA 5L9VA 4AHYA 2WAAA 2BQPA 2EICA 4Y3OA 4E9KA 1NG0A 1VAMA 3FLPA 1RHI2 1H1AA 5JMCA 1W0OA 4O9GA 4FSJA 4J1XA 4PCRA 3R6SA 4MGYE 3DN7A 4R4XA 4XUOA 3P5BA 1RXGA 3AKPA 4Q8KA 4RYDA 4CYDA 1H2LA 5A1FA 3A0NA 4KI5M 4PF1A 3AKTA 3BODA 4GMP3 1C1LA 4UAPA 3B93A 2QZ3A 3EJKA 1WLCA 3ASIA 1F35A 2D5FA 4EE2A 2WYFA 1Y9GA 2IWGB 3IAQA 1N1VA 2WINB 5JSRA 4P00B 4YW2A 5JZGA 4XQWA 4FAGA 2Y64A 5AVAA 4XE9A 4FXGB 3JBG1 1YNAA 4AE2A 1EPWA 1SPPA 2I07B 1FXZA 2GMMA 2P3JA 3RWKX 5ABJC 4HSLA 1R082 4HXCA 4XJUA 2XOMA 2ARXA 1W03A 2ZEZA 2XJQA 3HN3A 5L9RA 5T5JA 3UJQA 1TME2 3CZJA 1BBT1 4EZ4A 1LHVA 1OLRA 3AL6A 3AP9A 1OQ1A 5FXWA 3CQOA 3IIIA 2XJPA 4COVA 1H8TB 1ND2A 3LEMA 4DUXA 5I0DA 4YM3A 3HD8B 1HRV2 5FZ8A 1MZ5A 4K8RB 3RS6A 1IQDC 1WW5A 3IPVB 1YQ8A 5FZ9A 2NZ9A 2ET1A 5B2GB 4NHYA 2E33A 2BNOA 1DDLA 4AFDA 2WT0A 4TLFA 4LA3A 1AXKA 4G4FA 5B4NA 2OT7A 1PGW1 4W6YA 3ZPOA 3RZKA 4PJYA 4DXRA 2DCJA 3H8UA 3KT4A 3VBRB 4FT8A 1GWKA 1EPZA 1W90A 1GP5A 2H6CA 3NL1A 1H6YA 1YHFA 4BK4A 2UYBA 5IVBA 3BYWA 3WDVA 1RUE3 4XTMA 3WQBA 4OI0A 2PLV2 5EJZB 3HT1A 5FYBA 4ITCA 3SNMA 1GICA 5C3RA 2R062 1GOGA 3I2HA 1PMJX 4L2NA 4XF1A 4CU7A 1BMV1 1VBD3 3RQ0A 5EP9A 1D0HA 2H0VA 1DQ2A 2C9KA 1U5XA 2W95A 2DUQA 2I45A 2VZQA 2YU1A 2DF7A 5FYMA 1RUC1 3TRSB 4YSFA 3POGA 5JZGB 5KHGA 1S1AA 4X6QB 1VB4A 2PQQA 1QOOA 4QXBA 5FZOB 4AI9A 1QJX3 3VD4A 2V09A 2VBPA 3VBHC 3ZMNA 4GKXA 3WD5A 3FFQA 2BP6A 2Y33A 2RJKA 1RHI1 3HJRA 3OY8A 1GOFA 2E53A 4K9SA 2RHPA 2X29A 1COV2 3PUQA 2QJVA 1VBC1 5FZCA 3PUSA 3RPQA 1PNFA 1KS5A 1QKQA 3RZGA 4JGYC 4AFAA 1HRI1 1KJRA 4P9JA 4D6RA 3ETPA 2YGLA 2BNMA 2DUPA 5FP9A 1LGBA 3FHIB 3RDIA 4EWEA 5ISLA 4FOWA 3MPPG 5FY8A 3AYEA 4DO0A 1NZIA 4ZXEA 3OD4A 1GQHA 4LIUA 3ME2A 2Y6GA 4NN0A 1DG6A 2RDNA 1UU4A 3AJZA 3C7OA 1X33A 2QQNA 4E2GA 5JOYA 3VUOA 1GWMA 3WW1A 2DDUA 4BQYA 1V6IA 5JXHA 4FQZA 4HPKB 4LO6B 1CAWA 3B7MA 4A42A 2Y6KA 2JIGA 3S6PA 1X7NA 4V1PA 3R4DB 4UYBA 3OUJA 1JODA 2WABA 2OUHA 4B8EA 1VBA1 3BUCA 3PMSA 4XDQA 3K51A 3KT1A 1UZWA 2A3WA 3SISA 4OFGA 3FUQA 1AJOA 4NIGA 2CGNA 3K75B 1J3QA 1VIWB 4N43B 4BA6A 1RUOA 3WX5A 1K45A 4FTEA 3HN1A 4TTGA 4IGOA 1AF9A 4M4PA 4W65A 4UOJA 2A6VA 1LOGA 2P4EA 4GKYA 4YARA 2HWB3 1K42A 1RJ7A 3VLBB 4CEWB 5FYCA 5F6KA 5FUPA 2AUYA 1V6OA 3DUIA 4QKFA 2Z5WA 3HMYA 3MF9A 5LBBA 4F83A 3VDDC 4AI3A 4H14A 2J42A 1L7QA 4LBQD 1SBFA 3FZ3A 5FY4A 3IZOA 5FZ6A 4UFJA 1DZQA 2GMEA 1JZ6A 1E5RA 3USUB 1RUJ3 1ENRA 4QWNA 5K4LA 1F4HA 4WM7A 2WA3A 2JKBA 4RR3A 1Q5OA 1RIRA 1W8OA 2VZSA 4Q1RA 2JG9C 5FPXA 1JYVA 3WHTA 3CKHA 3VBUA 2JDUA 1RYYA 2ZGNA 1XU2A 1KFXL 4NOTA 4Q26A 2VTXA 1CAXB 2RG4A 3DXTA 3R05A 1OMIA 3AZZA 2BZDA 3M8LA 4NROA 4A41A 2L9LA 3GHMA 2JDKA 3ZIXA 1D0GA 1PO12 5I0TA 3VD9A 1NLRA 4S2FA 1JZ8A 1TQ5A 1UZZA 1VB2A 2LM3A 2BGPA 3BPSA 4UF0B 5KXDA 5FY0A 5IJRA 1O4YA 1UY4A 5BPXA 3FHQA 1E57A 2CTVA 3FBMA 4AGVA 1POV1 1HKDA 4FVVA 5JSOA 2CHHA 4UI9L 1OSGA 4XUQA 2Y26A 3GGLA 5I8SA 2K9ZA 4A7ZA 4DEVA 5A32A 1ULFA 1UU6A 3UT0A 5C7GA 2DUOA 4GJZA 1IKPA 1V9U3 2A6ZA 2GALA 2DVBA 4EYUA 5C6CA 2XBO3 2P6CA 3IN9A 5DAWA 5K0UB 3NAPC 1FMD3 1RMU2 3WP3A 1VAVA 4BQ2A 3EYPA 4EN9B 1LNSA 3KT7A 4NR1A 3C3VA 3L9JT 2RR13 4B4RA 4XILA 1V9U1 2XBO1 1PHMA 2X10A 3WP4A 4FOVA 2GSYA 2XJUA 1VBE1 1RUI1 2YYOA 3I3DA 4YFWA 4AVSA 3WINE 4DS0A 3RZHA 3AX4A 3EO6A 1WLTA 2FCUA 4HZFA 4QPGC 5C33A 1DQ1A 1DGWX 2QDNA 3LDBA 1HN1A 4XBQA 3WNKA 2WT2A 2A6WA 2P17A 3FUOA 1CPMA 2BVVA 2YROA 4GALA 1HV1A 3CJIC 3WP5A 1F31A 2D6NA 4Q4W3 2Q4SA 1UKRA 5F6LB 2Y0OA 4YG0A 5DG2A 3BU0A 2OX0A 1PO21 2AEZA 2WN2A 4L97A 4QPGB 2JE7A 4LBNA 5DUWA 2ATFA 5BNNC 4IUGA 1OVSA 3NNGA 4U36A 4F3JA 5C9AC 5CU1A 4I0BA 1ZBA3 3UL2A 4Y1YA 1MQTA 1MQTC 4XF3A 4W50A 1QGLA 2AENA 2PQSA 4Q4W1 1TMF3 1VBA2 5BNNA 2ZGRA 4Q4X1 3O1RA 2A7AA 1PO23 3NJZA 4XW3A 3OF1A 1AR62 3AVSA 1GZWB 1W6OB 2IXHA 2VOWA 3WQ0A 2WKKA 3MLKA 2HWE2 1ACCA 3O1OA 2QQIA 1WCSA 1DQ5A 2CDPA 1BQPA 2VULA 3OCPA 4NO4A 4NPLA 2QZ2A 4JDMA 2EIBA 4YW4A 2G1MA 2ZGLA 3DECA 3S5AA 2ZGOA 4LE3A 4OHXA 1AXZA 1MS1A 1FATA 1CIYA 1XRUA 3NV3A 4OUSA 5FAXA 4YW3A 1RUJ2 2AACA 1QXPA 1NCQA 4Z2AA 3BN6A 3ECQA 1OKQA 2D43A 5BNPA 1BVVA 1G9CA 5LBFA 3KLSA 2V5DA 3KM5A 1MZFA 1K5MB 3POIA 4IEUA 3ZOIA 1W8WA 2J1SA 3FX3A 3VKMA 4XETA 2RDSA 2WQ8A 4E4HA 2A3XA 4CP2A 3JU9A 5A7OA 3APBA 3V65A 1W6NB 3HPNA 4S2DA 3PHMA 1A8MA 3FMGA 1W3VA 5JWPA 2O1QA 2EAAA 5J96B 4KQ7A 2X8KA 3H1YA 4IGQA 5F2SA 1OOPC 2VZVA 5FQ0A 1DQ0A 2W1UA 3N9LA 4Y22B 3B9IA 5FPUA 2ETEA 5KC6A 2IZWA 4I02A 4QD2A 5A6YA 1GQPA 3OYWA 3V64A 4WVVA 3D82A 3ZR5A 3ACHA 4Y5TA 5FXVA 1S0CA 3T08A 2E7QA 3WDUA 3BU7A 1HQWA 1EV12 3AP6A 3D4KA 4RD7A 4Q0PA 1I5PA 1ZZCA 1A34A 5C9AB 3ZXKA 4ZONA 2V72A 4Q4V3 4CDQA 2GC2A 2DCZA 3H8RA 5LCWL 4IV3A 4K8FA 4YVWA 4CXWA 4OMDA 1W2NA 1X9PA 1RUNA 3ZSJA 1VRH3 2YC4A 3JXSA 4LKDA 4WM7C 3BIEA 5FZ7A 4DINB 2BV4A 3J7HA 4Y4RA 1KFUL 2ZMLA 1HB3A 5JLVA 1F15A 4OHWA 4URTA 3ZXLA 5JVVA 4BCUA 4GMP0 2VOTA 2WZR3 2HWE3 3RGBA 2HLEA 4M0HA 1KJLA 5IVFA 3DPRB 1X50A 1H4GA 4GULA 4DMIA 3LEGA 1LRHA 2JB8A 2XHKA 3JQWA 5FMDA 2HWF2 2W52A 4QQ2A 3B02A 2ZX3A 3RZLA 4LOSA 5EYXA 5H9QA 1JU3A 2Q5TA 5CADA 1UY1A 5T55A 4E4DX 2R041 1FYUA 4FPYA 1MEC2 1NAEA 4QU1A 2ZMKA 4HONA 1CJDA 1W8FA 4MHRA 2JE9A 3N9OA 5FYVA 4B7KA 1W0NA 1IG0A 5L7OC 3SMHA 3VL8A 4AQSA 1O3RA 2NM1A 4BMEA 1HRI2 3P3NA 4LK7A 1F8VA 1C8M1 1A8DA 1OUSA 2UWAA 3MLLA 3VHNA 5KHHA 2YFUA 2Y34A 3KV6A 4RGKA 1OOPB 2HYXA 1QDOA 3MFAA 2Z4FA 1JHNA 2DU1A 2R6QA 1U12A 1SCRA 4NWWA 4CEWA 3ZMOA 4HL0A 5BNQA 2VO5A 5F5IA 4CPBD 5JDBA 5GZEA 4NHXA 4R9AA 2DCKA 1HLCA 1J58A 2VPVA 2ZPXA 2J1VA 3KQRA 4JGYA 5HV4A 5A7PA 3GDBA 1ENQA 5FJHA 3T2OA 5IVCA 1VMFA 4XAEA 5HBAA 2VQAA 5EWSA 1I9RA 2V4AA 4LHSA 4C1WA 1F4AA 2EXIA 3INAA 1ZA7A 1MACA 4HLTA 1XQNA 1OA3A 2FCTA 3DKWA 4CP9B 2ADDA 1G9DA 3HWJA 5A80A 4Q4V2 2J1AA 3ITQA 1N1YA 2AH2A 1WLWA 2ORZA 2Z79A 3FL7A 3BOWA 3KCYA 1IOAA 4QPIB 4NUBA 5DQ0A 3K2OA 5HCBA 1BLZA 4CDUB 2VU9A 5EPAA 1AUYA 5F3EA 3AVRA 3MUY1 4AEDA 5EQUA 4DUVA 1UZYA 4W6WA 3NQHA 1VBD1 2JDYA 1CVNA 4QHOA 1FT9A 4AK3A 4C90A 4I3PA 1X82A 4QPIC 4NPMA 5FPBA 3KGLA 4A7KA 3IAPA 5EFUA 5E1RA 4AEMA 3TAYA 1D2QA 1XC6A 2YPJA 3SKJE 4WVMA 2VG9A 3BTAA 1DCSA 4IEZA 4P08A 2CYFA 1JHJA 1JOPA 4UT5A 2QE3A 4C1XA 2AEYA 4CEYC 4Z1VA 2VM9A 3MEPA 4AQTA 4QPYA 1RHI3 1UW8A 3J4UH 1UOJA 2B8MA 4LPLA 3I3BA 4KMQA 5C8CB 3DYMA 4HOOA 4Y20A 1RUC2 2QNKA 4MH0E 4QM8A 3ZFFC 3R4UA 2CAUA 3H1MA 1SZBA 1V70A 3BTXA 1WW7A 3AKRA 4IEWA 4CA9A 3OPZA 3J7LA 2BTVC 2C26A 4CDXB 4YWAA 4XXPA 5ACA2 2WNVA 2DCTA 2PYTA 3OD0A 5IYYA 3AC0A 4BWOA 5GM0A 4BH9A 2B46X 1VE0A 2ZKLA 2VCAA 4FPFA 5GKAC 1CIWA 2ZGMA 4RFRB 3ZN6A 4D6QA 3ZM8A 1BBT2 5FP7A 3SQOA 3P1IA 5LA2A 5FMBA 3WSOA 3OUIA 2X5IC 3B69A 3LCPA 3WDWA 5HI0A 1VRBA 1KXGA 2D98A 1UL9A 4FPHA 4WVWA 4HK9A 1VBA3 2W68A 4O7XA 2MEV2 1W6NA 2WO3A 2QVSB 1SBDA 1RUH3 4HT1T 3J26N 4LORA 4XXAA 1VR3A 1OA4A 2DYCA 2GP3A 2RS53 2BRTA 3WLUA 2XWJB 2VUDA 2W39A 1GP4A 1AYM2 5GZGA 1W6QA 2ZBJA 3DL3A 1RVF2 3RMYA 2PAMA 3KCCA 3EQEA 5IWFA 1XXNA 3I54A 3CL1A 2ZCWA 3ZYJB 5JUVA 2F17A 5FZ4A 1JUIA 2VCMA 1LENA 4QB1A 4XMAA 3SLIA 2ENRA 1WLDA 1H1MA 3SC7X 1W8TA 3FLTA 4IEVA 4XFIA 2FCVA 1RUG1 4PDWA 4LIVA 4LULA 4RS5A 4QX5A 2N7GA 2Q8DA 3USUA 2QTWB 3ACLA 1UIKA 3H1WA 4N43A 2BW8A 1W8UA 1YXWA 4XFCA 4ZY9A 3VBSC 5C71A 1REEA 2JG9A 5H9RA 3ZX7A 5DMYA 4CDWB 3OBRA 4FFHA 5FBJA 2P3KA 1HXS1 1W6MA 2VJXA 5C8CC 5FLHA 4EN8B 2R061 4LKSA 1ZRDA 3TYJA 4K7JA 1PZ7A 1EV13 4MYEA 4CUCA 5DPNA 3O1TA 2ZABA 2ET7A 4WM8B 4CDWC 3SCHA 5FV3A 3AKQA 3U11A 2PAEA 2Y6LA 1GYKA 3JB4C 1YFYA 4L0PA 3W20A 5FYSA 3ZFEA 1UKGA 2WQZC 4IETA 2VZ1A 2XMLA 3GCXA 3NJYA 4WM8C 3THCA 4Q4X2 4PDWC 4RS5C 3W21A 1F2NA 3HQUA 2HWB2 2XVKA 2CGPA 3POBA 4COZA 4IE5A 2BBVA 1SLLA 4WZFA 2DVDA 4JHZA 2AZ5A 3PJQA 1F9KA 1GU3A 2PHRA 4AHWA 1YI9A 4AI1A 3I8TA 2VZUA 2G4IA 2IXIA 4XCAA 2XG3A 3MIBA 4M3CF 4I3GA 4DNYA 5A3MA 5FO8B 1ZRFA 2BYVE 4D0QA 4AWDA 2WZPP 2E26A 1NXD1 2MEV3 2VOVA 1ONAA 1XB9A 2W5FA 4MX3A 5FZDA 3K48A 1K5MC 4A4AA 3MFCA 4IV3B 4NHKA 2VMGA 4XIOA 4YVWB 3HQXA 3PUAA 5FY5A 4CDQB 2W2IA 4ZU7A 3SKVA 3K4DA 4P9WA 2B39A 5A6ZA 3E5UA 2PN5A 5DAXA 4W8JA 2VL4A 4N90A 1IQAA 1VBE3 4Z92B 3C7GA 2W1QA 3THPA 3A7QA 2YG0A 5LBEA 2J1EA 2B4KA 3H42B 4JDNA 1TNFA 1XYPA 1OUXA 2WQ4A 3AYCA 4RL7A 3ZXFA 5K0UC 3AFKA 5D21A 4XFFA 4A6OA 2GAUA 2VXRA 4KGGA 3NMBA 3PTRB 3ZSEA 3M3CA 1R093 1UCXA 1WMFA 1XYNA 2A75A 4GH4B 1GFF2 4I01A 3X29B 2E51A 2ARCA 1Z7S3 3CIHA 3U07A 2R49A 4QGNA 3PVOA 2JDPA 2DBIA 3MIHA 1J59A 1QH7A 1GZ9A 2YC2A 3PNAA 1YO8A 1AL0G 2XVGA 4GB31 5AC91 1QHDA 1EAH3 3VBOB 1GR3A 4AR2A 4BK5A 1OFSA 4GH4C 2Q1FA 1R091 4CVUA 2GC0A 2XR4A 3AZXA 5KXEA 4JKKA 3CEWA 1VLNA 5A3TA 2ZZQA 2PXJA 4Y1UA 1AR73 4AEDB 2EVXA 3BVCA 3CZUA 3V0AB 5I0SA 4UW4A 3BIWE 3M7AA 4MV2A 4IE7A 1AR61 1DBNA 2D5HA 2WNUB 3DF0A 3UK9A 4PQQA 3WV6A 5A70A 5JOZA 1PK6A 1UD1A 3S5QA 1PK6C 4BXSV 1W9TA 1MQTB 4IEXA 4MGQA 4YM2A 4AAXA 2HWF3 1AR71 2E63A 3WT3A 1RUF3 2XJVA 3VBFA 2QFEA 3C7EA 3ZFGA 4CUBA 1W06A 3HR9A 4HFSA 3ZSMA 3VZMA 1O3SA 2EXKA 1KQRA 2FBEA 1O5UA 1CN1A 1TG7A 1LB2A 4Q4W2 3IKWA 1AR91 1ULGA 1AYN1 2VCBA 4EQVA 1PIV2 1PO11 3I49A 5EIYB 3GJBA 2VY0A 1C8M2 4QKNA 5M0TA 3RJRA 5FK7A 1S0GA 2F4PA 5F3CA 4FPCA 1SMVA 3THDA 2RS33 1BEV3 2AC1A 4PBOA 4CDXA 3MYXA 1PMIA 2D6KA 2JG8A 3BTYA 4I2OA 4H7MA 1QJFA 1OBNA 2ZJCA 2YBPA 1MVEA 1OPMA 3K3OA 3PL0A 1DZTA 5LA9A 4BMBA 3T0DA 5J3UA 1C28A 1NCRA 1QY4A 5ABJA 1E5HA 1L7RA 3PJYA 3WF3A 2VZ3A 3M3IA 5A7QA 1BEV1 2JENA 3GBGA 1YIFA 4FTBA 3B01A 3AYDA 1NQDA 3PVNA 3JD73 1QJU1 5BV6A 2ARBA 3TN93 3KZ4C 3PIJA 4LBLA 5CEHA 2O8OA 5IUQA 1AR82 1QMJA 4L11A 1IHMA 3VBHB 1Z7S2 1VRH1 2WT1A 2ZX2A 2WLPA 3C7FA 3NV4A 4F7ZA 5CFCA 4D69A 1Y7BA 3WUCA 4BXFA 1ALYA 4QX8A 5E88A 4YM1A 1LTEA 2VW0A 3MW4A 5BY5A 2A3YA 4Y20B 4PLMA 4EV0A 2ZGSA 5J7MA 3WEZA 1WCDJ 4SBVA 1PGL2 1AX0A 3LZZA 2DU0A 5T5PA 4LE4A 3OGGA 2BUKA 2WS93 2H6BA 3K46A 3N36A 4AHXA 2IC1A 3H9AA 3T0AA 5BNPB 1TME3 1W99A 1UYZA 3LF7A 1TZOA 2D6PA 2GC1A 1A78A 2VMHA 3N7JA 4RGGA 4IL7A 5DAPA 4ATFA 3HNBM 3ROUA 3I59B 3ZFGB 2IVJA 3AYAA 5CKNA 2Y60A 1C3HA 4W4ZA 3FWEA 3ZN4A 5AVPA 2NP0A 3D6EA 4CDWA 3MIEA 4RFT0 2A73B 2DVAA 4OI1A 4CUAA 1S0EA 4X6RB 3NNMA 1WD4A 5HXVA 1JN2P 4XC9A 3W5NA 4P02B 3VDCA 3ZFGC 5J1XA 3K3NA 4AG4A 4XZPA 1DYOA 1C8M3 2CNAA 5CNAA 1JZ5A 4YW7A 2P6HA 3AZWA 3M4FA 3VHRA 1AXYA 1Q8SA 4JX0A 4Y22A 1TMF2 2D97A 2EXJA 1GLHA 4BYYA 3H3UA 4N43C 4PLNA 3VBSA 5A6XA 1I1EA 2DWRA 3JBG3 2ZGPA 3UGHA 5FOJB 4E8DA 5IAXA 4LQRA 5EJ1B 2B5HA 4FO9A 3T2TA 4RHV2 1KEXA 2GMPA 4XAAA 3WF2A 4FBFA 3RYRA 3VBRC 5IK7A 3T30A 3EHKA 5KWRA 1W6PB 2VQTA 5EXOA 5DUXA 5FYUA 5C70A 2C6SA 2ZAAA 2KXLA 2F6BA 5E89A 2RDQA 4B4PA 4I09A 4EN6B 1ZA4A 1AR72 2KR2A 1DIWA 1US2A 2G19A 2J1TA 1SLAA 3B00A 3GJAA 5FMCA 1OOPA 2VOKA 4LLOA 4DEQA 1O6UA 3AL5A 3DXUA 3MW3A 4XYXA 1Y9MA 1SFNA 2DURA 3B3QE 5FXZA 1HV0A 2DTWA 2JG9B 4K1ZA 1PIV1 4KNCA 4XDPA 2OXBA 4LBQA 4N7UA 5FY9A 5LRRA 4AI8A 2WFPA 4Z8BA 2VAUA 3O0VA 3VL9A 5T50A 3TBDA 3IM0A 2K46A 5LA1A 2WDBA 4LMFA 4WM8A 3UETA 1JZ7A 4MXWB 3TOJA 2X5IA 4FXKB 3D0JA 1L3JA 2BOIA 1OI6A 1UYYA 1UU5A 3MUZ1 5BNPC 1PIV3 5LY1A 1CWPA 1WCUA 2WNOA 4YZ4A 4RQPA 3N9QA 3O14A 2BDRA 1LU2A 2IXLA 4A44A 3MHZA 2WNVC 5IATA 1DLCA 3AK0A 4DOUA 2CV6A 1YFWA 1GQGA 4AYUA 4TYSA 4CDUC 3UGGA 5T5LA 1D4VB 3VD3A 2JKXA 3B9CA 3NNFA 2D44A 2J7MA 4JKMA 5C8CA 1RL3A 1UY0A 2JX9A 2JWPA 4Q0QA 2XDVA 4NWVA 4RA0A 1LODA 5A3UA 2CAVA 1CAUA 4LA2A 4HMZA 4DPNA 5I8TA 1R1A3 3KD4A 2Q8EA 5LEKA 2ZTNA 3N3HA 4WVZA 5A6QA 2PHXA 3POEA 1RUE2 3LE0A 2RS13 4UWDA 2YFZA 3V56A 4I30A 4KBZA 1LECA 1NKGA 1NXMA 2XJTA 2QCSB 3WNLA 1MZ6A 2FDJA 2NMNA 2Z2SB 3NKGA 1QJY2 1MS4A 1VBC3 2ZZJA 5CVRA 3P3PA 4QDRA 3WVJA 2PHTA 4DB5A 4NHLA 1R1A1 4J1WA 3D3AA 2ZX1A 4GIQA 3U0ZA 5FRAA 1PGL1 4FTSA 5HCFA 3OJBA 2VMEA 2RJLA 2YC0A 4ZZ8A 3KHCA 5FMOS 3IMMA 4UBHA 5FIXA 4OMCA 5G05L 5LK7B 3ZYGA 2OS2A 3GBWA 4QX3A 4AFMA 5CKQA 4AVCA 2XUMA 3LWCA 4GA9A 3OGSA 3ZKYA 2P1BA 1AR92 4YZ1A 5A33B 2BFUL 3MBWA 4YGDA 4ARYA 4CU8A 4FP3A 4FI9A 4BIFA 1YRZA 4RHV1 4CP0A 3UESA 3I2FA 1G8WA 3VDBA 5BNOB 3WW3A 3ETQA 3LDRA 5FZHA 2D6OX 4GQ7A 3O7OA 2WFF2 4NHMA 3WCSA 4NIHA 2VNGA 4DQAA 1QU0A 1BHGA 4ASKA 3VZKA 1GUIA 3NNLA 2JD9A 2PHUA 5FYZA 3WNOA 5FZFA 1HQLA 2FDKA 1RVF1 5F9TA 3V0AA 2WNUA 1PVC3 1SLCA 3DKQA 5FZ1A 2DBNA 1HDKA 5FCCA 3AP4A 2E9QA 2PTMA 3OGRA 3O1MA 3WHUA 2ZX4A 2OKXA 5JXGA 1PO22 1W05A 3ES1A 2BFUS 3AMMA 4MVTA 4YZ3A 4UW6A 4ARXA 3ZFFA 5DAQA 1CR7A 2C0ZA 4LT5A 1FOD2 3H3ZA 2GC3A 1ZYBA 4FQ4A 1Q3EA 4OUEA 5E16A 2HWD3 4D94A 4HANA 3K4AA 2LRPA 5CISA 1ULEA 2SLIA 2PAKA 5L73A 5C4WB 4W6XA 1LR5A 3E6BA 3M3EA 3QD6A 2BBAA 2R073 4YM0A 5EHDA 4C8DA 4D7SA 4S2GA 1MS0A 5FY1A 2YU2A 2UURA 3GNEA 1Y9QA 3A0KA 2BPA2 2HWD1 3L2HA 4S2HA 1JBCA 2Y38A 4U2AA 5I0RA 3A22A 3KF3A 1RXFA 2X09A 1UZVA 1RUG2 2OZ6A 3ZXEA 2P3YA 4AGGA 4COWA 2R7EB 2WL1A 1D4M1 4UFLA 4AEDC 3D8CA 1LEMA 2VVDA 4HVOA 2D93A 4ASMB 5B4XA 2QQOA 3AXEA 1JU4A 5G04L 1Z0HA 5SV5A 5FP3A 4M3CE 4ASLA 3IDEA 3GCWA 1AYN2 2GNMA 3J7NA 4IEOA 4UFKA 1A6CA 2GNBA 2VNRA 4Z82A 1XNCA 5EV7A 5A7WA 3ACIA 4D8MA 1CJPA 5JIUA 5JXJA 5A3WA 3ZDVA 4XQ4A 2RS12 4IV1C 3HAGA 1ZZ8A 4PBPA 4JCKA 5KHJA 3WG4A 3KB5A 1UIJA 1XSQA 4R9BA 2VMCA 5FZAA 4E4ZA 1BK1A 2QBXA 1FMD1 1WW4A 4QM9A 3E6CC 1RUE1 2A6YA 2WIIB 4YVSB 2PHWA 3U14A 4AAPA 2IXKA 4AVBA 1GSLA 1UAIA 3PLQA 3ZKUA 1COV3 3WF1A 1R1ZA 2IXJA 2VMDA 3E97A 1BKZA 1NQJA 1S0IA 4Q1PA 3U1XA 3ZYIB 4MG2A 1QQP3 1POV0 3NV1A 1RUI3 5CFDA 1WW6A 2ZGTA 1EP0A 2YV8A 1QJU2 1YQCA 2B9UA 3GZTB 3NV2A 1FPN3 4ZS2A 1WD3A 2W92A 1HJGA 3T1MA 1RB8G 1GNYA 1S2BA 1OH3A 1S0JA 3BOPA 4O9EA 5A3LA 2GH8A 5T54A 2E31A 1LHOA 4P14A 1Z7S1 1COV1 3WDTA 1UMZA 1JYXA 2WNEA 1UOGA 3ZSKA 5JR2A 3PURA 2BWCA 5FO9B 3FN9A 1MS3A 2UWBA 4KWJA 4DRRA 2XL7A 1G6NA 2JXAA 2VQ0A 4NRQA 1H2MA 4RR3B 3LIGA 3I3MA 2FD8A 4R52A 2RM21 1ZBA1 4MOAA 5FREA 4GD4A 5DG1A 5T5OA 3FHAA 4EWDA 3Q9OA 3LOBA 2RDRA 4WVMB 5D8AC 4CU9A 4BQ3A 5E8AA 1AR63 1K5JA 1VAKA 4NRPA 5T3NA 1UYPA 5FWJA 5FTTC 4E27A 4JDOA 2XKOA 4LUKA 4XHXA 4KG0A 5A7WB 1STMA 2TEPA 3DGTA 1C1FA 2W08A 3MV01 3VKLA 2W9XA 4JTNA 4NE9A 5L36A 2GNTA 1W6QB 1RUF1 4AFCA 1T6BX 5FQ0B 2OVUA 5FPLA 1WBFA 4XJAA 1QWRA 4XCBA 4XTPA 1C8NA 3THTA 3L2YA 1OVPA 4K20A 2K2SA 4AZZA 4OHVA 1AYN3 1UOFA 2B45X 4LBJA 2OA2A 5BXXA 5IVVA 3U37A 1X8MA 3TNQA 4INDA 3BCWA 2XHNA 4EJRA 1I6XA 5KHIA 1CAVA 5K7PA 4JQRA 2B9VA 4XHBA 2RS31 4C0BA 1PK6B 2R16A 1UQXA 5J48A 5C9AA 4HN0A 4A45A 2D7FA 1YFXA 3ZN5A 4JHTA 4N8MA 3AXDA 3CJIA 1ND3A 1ULOA 5F8PA 2VZOA 4JTOA 4XVHA 2J1UA 2CY6A 2W91A 4QXKA 4MGZE 1LJ7A 5GLTA 1WA4A 2AREA 1PX4A 4MGKE 2HWC2 4ZS3A 3S30A 1QJU3 4ET7A 2GH2A 1ZZBA 4DUWA 3TN91 2PELA 2BWAA 4BJ0A 1ZRRA 3VD7A 4CCOA 4HBNA 3J8F3 4MO3M 1N1SA 1ZBE1 4C0HA 1J3PA 1FOD3 3D0SA 4NRMA 1PVXA 5CZKA 4Y1ZA 1CX4A 3LA3A 3H7JA 4DXTA 4LKEA 3R0RA 1PZ8A 5DXDA 5J09A 4N53C 3RJ2X 1O59A 4B1MA 3U10A 3KSCA 4Q4V1 1XOYA 4D7YA 4K40A 5J37A 3NAPA 2QQUA 1O8PA 5JZGC 2JDHA 3S7IA 2JD4A 2AR6A 2WFF1 2JICA 1QDCA 4E4SA 3J8F1 3ATGA 1ZBE3 4G9SB 4PHZA 3Q8FA 4ZPIA 4CCDA 2EIDA 3TWIA 4Q2FA 3HIFA 3H8XA 4X8PA 4AW7A 2D3SA 2ZA9A 3WUDA 1VBD2 1ZRCA 4P5YA 1HN0A 1BEV2 4OUMA 4TZDA 3NJXA 4AOCA 4QT6A 2VTFA 2ILMA 1AZDA 2VH9A 2WFF3 2G9FA 2WZR1 4PT6A 2YGMA 2WA4A 3I4IA 1ND3C 4V2VA 5DUVA 4YFZA 1SBEA 4JGYB 3EBRA 3K77A 1Q8VA 1NLQA 4CPBA 3MF6A 4JGZC 1DFQA 2VUJA 2QQVA 1IS5A 1NA1A 4LKFA 1UY2A 3GZEA 4I0AA 4LHLA 3MLJA 5FBZA 3S0MA 1O4TA 1R092 2RV9A 3QH6A 4H7LA 1MR5A 2VZTA 1PNGA 2XB6C 2R043 4M00A 3VBUC 4NPRA 1DQ6A 4CCMA 3HNYM 2NMOA 2W1WA 2V4VA 5FWEA 1RUI2 4DY3A 4AI2A 5IVEA 3WNNA 2FDFA 3BALA 2E7AA 4QB2A 4Z2WA 3I59A 4GMP1 1W9YA 1WCQA 2RS52 4KWKA 1QJEA 3QBQA 5D1IA 3NVCA 1M4WA 1JZ3A 4EN7B 4V2WA 1WMXA 2FDGA 5AFBA 1ST8A 1LHUA 2EXHA 4QX7A 3CO2A 4XUPA 2VCCA 3LB9A 1X8EA 3PU3A 2ZEYA 1LU1A 1PX3A 1KD7A 3Q8BA 2BVBA 2WZEA 4QDSA 3DYOA 4QGMA 1MZEA 3A4UA 3OEBA 4XQDA 2YUEA 4XJZA 3U4XA 3NAPB 1FAYA 1RITA 4KGQA 2MHFA 5D2AA 1UN1A 2YHJA 3OB8A 4M01A 3RMXA 3KVAA 4CSWA 4GZ9A 1RUD1 4X8NA 3WR0A 2Y6FA 2TNFA 3VBSB 1NCQB 4KBBA 1O3TA 4YRDA 4N53B 1JMUB 3ON7A 1IPSA 4OCTA 1O91A 1ZVFA 3OTFA 3ZIWA 5EJ3A 1OXCA 4YG6A 5FP4A 5FMOL 2Q0AA 4LBQB 5CA6A 4OULA 1UNBA 1PGSA 4GJYA 1U0AA 4HSJA 5JR7B 2NLRA 1LESA 1X9TA 4J6GA 1KGYA 3CBNA 1AL22 4LK6A 1WCKA 4TXWA 2EF6A 2XWBB 3I3QA 1YIPA 3FLRA 4YLZA 5AFEA 2ZGUA 5EZWA 4HVQA 4IEYA 3VBRA 1S0BA 3N7LA 3FE5A 3HEIA 3WP6A 4OQ8A 3WNXA 5LB6A 4HPKA 3U4SA 1H8VA 5DUUA 4P9IA 5ERLA 1DGWA 4RGAA 2YMZA 2HH9A 1MS9A 2JDAA 3ORJA 1NCRC 4QKDA 1DHKB 3U78A 2D6LX 5FYYA 1IPJA 1CAUB 2B7YA 1UMHA 2K0GA 4CE8A 4BQ1A 3KQ4B 3UKTA 4EN0A 4UXAA 1XE8A 3AMHA 4XJ9A 1RUC3 3AFGA 3WG2A 2YXSA 2IUWA 2X05A 1BZWA 3I2IA 5L19A 1OLME 4RQPB 4FPKA 3Q8AA 4A3ZA 3VBHA 3VZJA 3OOXA 3LPFA 3VBFB 1QOTA 2ORXA 4JQTA 1PM4A 3W5MA 3VDDA 3LAGA 1YYNA 3AMQA 3AP5A 1ZZ7A 1K3IA 5FZIA 3VN4A 4XJWA 4FPOB 3FJSA 4IXLA 1BVP1 1J1TA 1LULA 5ANNA 5FFOC 5GLWA 1QIQA 1EY2A 2VQUA 3VBFC 5A1LA 1F5JA 2WZR2 2QKDA 5DN2A 4NMIA 5FO7B 2OUJA 3E5QA 3FBYA 3I2OA 2B42B 2P34A 5IK5A 2EIEA 4E2SA 1DYKA 4K3UA 4LO8A 3T2QA 5JOWA 1VP6A 5KC5A 1VMJA 1LOBA 3WXPA 1YJKA 2JG8B 1FV3A 3NJVA 3BGAA 3BPZA 3RZZA 1LHNA 2OW4A 5BNOA 3H0OA 3UJOA 4EWAA 5A1AA 4J25A 1U5YA 4OZOA 2WZ8A 1BCXA 1HIXA 1JI6A 4PF5A 4CP9A 3I7DA 2ADEA 1VPHA 1S0DA 1YQ2A 4LHKA 5KXBA 4OQ9A 1I3HA 1SG3A 3ZXJA 3WCRA 4CCCA 4NJ4A 3LFIA 1RVF3 2HWE1 1PVC1 1ND2C 2MNGA 4SLIA 1GZCA 3M3OA 1RINA 1Y43B 2HWC1 4BB3A 3F95A 1OURA 5FUIA 1IS6A 1JW6A 1S0FA 4JVAA 4Y33A 3RVHA 1NE6A 1XE0A 5LRSA 3ZFFB 5IAVA 3SCFA 2F4LA 2G9GA 3R4SA 3D5OA 5GJ6A 3HOBA 3T2PA 4BHPA 5BNNB 1CGPA 1N3QA 4UW5A 2LTNA 1J84A 5F2WA 2HWC3 2VW1A 4GWJA 1NT0A 2ZACA 2ZEXA 4BQWA 1ENSA 3HT2A 2A6XA 1OLMA 1HXS3 1YFUA 2HEVF 4YZ5A 3AP7A 1HJFA 3IWZA 1POQA 2R063 1NLSA 3GM8A 2BU9A 4P9YA 1EV11 2OPKA 3H50A 4M4RA 4XJ8A 1IGOA 3OPTA 2IXCA 3WY6A 3WQ7A 4Y24A 4GWIA 2XH6A 4LITA 5CIRA 4MGTA 3GXUA 1B35A 1LEDA 2PLV1 3OGJA 1BK0A 1UXZA 3JB8A 3O12A 4BISA 3IIAA 1O8SA 2GNDA 1WA6X 1X36A 5A33A 2MPFA 4META 1SCSA 2ZOEB 3S7EA 2XL9A 2GN7A 5JOXA 1HRV3 4UF0A 3WNPA 3W59A 2WWJA 2WWSA 4AVTA 2OQ6A 5FLIA 1RUF2 1TE1B 2VR4A 3MIFA 3UNPA 1POV3 3LKJA 2RJ2A 4LJHA 5FOBB 1OPOA 4IE0A 3RRDA 2R30A 3UV9A 1O4ZA 1LAJA 1N47A 1APNA 1SDDB 2PHDA 5FLJA 4YW5A 4CDUA 4Y5Z0 4QHZA 3OYWB 4XUNA 4NIIA 2CL2A 2GN3A 1O7FA 1H6XA 1SPPB 5LATA 1NX9A 2PMWB 1XNBA 3Q8EA 4LO7A 2RE9A 4NAMA 4QKBA 3RYPA 2J22A 3KV5A 1W04A 4IEPA 1SACA 1NUKA 5IFPA 4LUMA 1G7YA 4IV1B 4QX2A 4ZXKA 3T1LA 4R4ZA 1IS4A 2RR11 5LWBA 2XONA 4FOQA 2ZGQA 3C7HA 2NQYA 5F39A 3NNJA 2JB4A 2ZS6B 1E5SA 2LW8A 2JDZA 1RGSA 4N7IA 1DGLA 2WRAA 1MPXA 4Y4YA 1S2EA 3KWVA 3DPRC 4Q4Y1 4AVVA 2DVFA 1IPKA 1IG3A 4HN1A 4OYUA 4QQHA 1D7PM 3J8F2 2ID4A 4PIYA 1QJX1 2EAKA 5I91A 5F1RA 1LKNA 2FDHA 4WM7B 5CFDB 4DIQA 4YGEA 1W8ZA 2P37A 1OT5A 2NYYA 4BPZA 3DPRA 4D3WA 4F8AA 1YQ5A 4KL1A 1DZRA 1H9PA 4OHZA 5L7OB 5JSPA 2PFWA 4KH9A 1XU1A 4XF9A 2WWUA 4Y5SA 5A7NA 1CD3G 1H30A 1T6GC 3RI9A 1WZXA 1UX6A 3N9MA 3VB9A 4B1LA 3HNMA 3O1SA 2GDFA 1HRI3 3I2GA 5CKMA 1RJ8A 4BE3A 4D6SA 2QQJA 1DP0A 3ILNA 4A6SA 5FZ3A 5FY7A 4OI4A 5BYNA 5DDJ3 1U5ZA 3USSA 3OBTA 5CAZA 1LHWA 2Y6HA 2RM22 4PLOA 3VKNA 4L9BA 2ZHKA 1CAVB 5DZEA 3ZR6A 1WMEA 1Y4WA 4YVSA 1RUH1 1BJQA 2FQPA 2W3JA 3MPBA 1ODNA 1XE7A 1JS9A 2ZKNA 2RS51 4Q0VA 4XURA 5DDJ1 3CJXA 3GHNA 3WG1A 5GZCA 2UWCA 1UY3A 2IFWA 2VVEA 3OUHA 4DXSA 3U75A 4HKWA 4KG8A 5JI7A 2DVGA 2JJ6A 1ULDA 1S55A 1YEWA 2RS32 2WBKA 4Q5OA 3MIGA 3V0BB 1YCIA 4Y1VA 5L9BA 1NA1C 2OPWA 3CDZB 4JGZA 5F3GA 4AL9A 5LZ6A 3NRUA 1GP6A 3T0BA 2YY1A 4XMIA 5I8YA 1FNZA 2DFBA 1XJAA 2Y8KA 4QPIA 2WNVB 1UMIA 1W8HA 3POYA 2PA7A 3LDKA 3ACGA 3RZMA 4OLLA 1J3RA 2ERFA 1ZBE2 2R1BA 1UXXX 5DZGA 3LFMA 1JZ2A 1YLLA 1EAH2 4QQOA 4IGPA 3MIDA 1JYIA 1NZCA 3PUHA 3CHXA 1OKOA 2JDNA 3ZXDA 4OHYA 3AZYA 5F32A 1BXHA 3P6BA 1UZ0A 1AYM3 3OEAA 1UPIA 3ZLIA 2BJSA 4ISQA 2VZPA 2LUWA 3PU8A 5FUNA 1XPWA 4DZGA 4N9HA 3OSDA 2Q30A 3VDDB 3QOPA 3AJYA 2WS91 3DCQA 1W6OA 3SH4A 4AXOA 2FDIA 1WWYA 3CLPA 1SFYA 1S4CA 3CNAA 5K9YA 2BEOA 5LASA 1CX1A 5BUVA 2BOJA 2WSVA 3WZ1A 4CDXC 1IZ3A 5T52A 1AYM1 4XF4A 2ZHLA 1HW5A 1ZBA2 1CESA 1AVBA 3LEIA 3S57A 3N35A 3RNSA 1UX7A 2TBVA 4BQXA 4AEJA 4URAA 1V00A 3GF6A 1EUTA 1O3QA 2MEV1 4BLIA 1GBGA 5KBFA 3N4MA 2EIGA 1JUHA 2XGXA 4XBLA 1JYWA 5SV8A 1M06G 2J1RA 5CYYA 1EYBA 1XNAA 2VECA 3SHRA 4D7TA 1ND3B 3KS7A 4AFBA 4XIKA 2W46A 3KVBA 4QXCA 3SXWA 4P9XA 5BNOC 2A70A 2VNOA 1Q43A 2EALA 1V0AA 4CRQA 1C57A 3NSTA 3RZJA 4FPGA 1JYCA 5I0UA 1S2KA 2LALA 1TNRA 2ZAHA 4XBNA 3ZYBA 3HBKA 1W9WA 3TEYA 3VBUB 5IT6A 2VBBA 2R0FA 3ACFA 5GLZA 2VNVA 4CCKA 1CONA 1YUDA 2X5IB 1SLBA 5IFTA 2CWSA 1SDWA 4YYOA 4ORFA 3IDAA 3LEKA 4GH4A 5TSWA 1MVQA 5C8WA 3VKOA 2A1XA 4GXLA 2W87A 3PIGA 5K8SA 1UWWA 4MLOA 1Q56A 1GANA 1XSRA 1C5HA 2WR9A 5F5CA 1H4HA 5APAA 5FZKA 3RI8A 4HK8A 4LLFA 1ZREA 3HVDA 1PZ9A 3LD8A 3ZSLA 4GWMA 5C4WC 2R042 1QNYA 4AHZA 2P3IA 4IESA 4M0NA 3NKTA 5DDJ2 5ACA1 1DYPA 3ZXAC 4QQPA 4PIXA 4CU6A 3H8OA 3I97A 5H9PA 1TMF1 2WO7A 4AQ2A 5K0UA 3SEPA 5IVJA 3ELNA 4FAHA 1XNKA 3LQCA 3PDQA 4OI2A 4M3CA 2XQRA 3OG2A 2HKXA 1W6MB 4CEWC 4BIOA 5ACA3 5HXMA 2XPJA 1R083 2YZ4A 1CZSA 1H8TA 1ND2B 3VZOA 2FMYA 3AKSA 1K12A 3UGFA 1VBB3 2UYAA 2W1SA 1ASJ2 1NY72 3IMNA 5FZLA 2QUOA 3PTYA 2G9ZA 3M2MA 2O8QA 4CCLA 4QX0A 1AR93 2BGCA 2DTYA 3UYJA 5GZDA 5LEJA 1AR81 2ZXQA 2W47A 4XACA 3MW2A 5FK8A 3WNMA 4XDOA 1R081 4K1YA 2WO2A 1ZM1A 4KWLA 1I5ZA 3WW4A 1XBFA 1OC1A 3J9SA 4K6BA 1ZRIA 4IEQA 3URFA 1UPSA 1DGRN 5LY2A 3ILRA 3ZFEB 1HB1A 4UBGA 4FOYA 3VGIA 4Q0UA 3PUIA 3MZHA 4YNIA 1AR83 1T2XA 4XFGA 2W94A 3A21A 1ODMA 3O5SA 4QB6A 2XVLA 3EMRA 4KU7A 3LPGA 4LBKA 1OF3A 5GZFA 4QAWA 3ZFEC 3O1PA 4PIZA 4PDWB 4RS5B 2VTXJ 2X53S 2RVAA 3WW2A 3ZYRA 5HPOA 3BI3A 3IDBB 4L99A 5FR3A 1MEC3 1GZWA 1HX6A 1UYXA 2Q1ZB 2XLFA 1SLTA 3JD71 5GALA 2XLAA 2VOXA 5DZFA 1GV9A 2JE8A 1ULCA 3E6DA 4LBMA 4QGLA 2R0HA 4IQPA 1J83A 4MHUA 4XFAA 1N1TA 1RUD2 3GYDA 2WN3A 4FFFA 3TEZA 4FP2A 2CGOA 4WV8A 5FYIA 4MSVA 2ZHNA 3ZO0B 1W2UA 1MEC1 5FDBA 4IV3C 4YVWC 4IE4A 2HJIA 2VBDA 1CZVA 2WSUA 4CDQC 4FFIA 3BB6A 3WF4A 1G9AA 1BMV2 2XUEA 1RTVA 3KMHA 2XQXA 4LO4B 4YGBA 1XNTA 1TVGA 4AF9A 5FXXA 2FZ1A 3ZPYA 3O0WA 3CF6E 1QJY1 4NAOA 1JOJA 1GMMA 2CWMA 4YG3A 1PVC2 5FKCA 4XEZA 4BQ4A 2OYZA 4FFGA 3POWA 4CZSA 5C3SA 1OQDA 3NO8A 3I3EA 5E6HA 2WNUC 5DAVA 1JYTA 5KHKA 1QF3A 1QJY3 1VBC2 2V5YA 3QLQA 1FV2A 3DV8A 2E32A 3VV1A 1NOVA 1DU3D 2I74A 1OQEA 4Z07A 2C4XA 4Y1XA 4CXXA 1EUUA 1OFNA 2ZMNA 4UFHA 3LSDA 4Q29A
chains in the Genus database with same CATH topology
4BM8A 5J98B 2E7TA 4FPJA 1N3OA 4N53A 2HEWF 3AZVA 1WMDA 3WDXA 2D40A 2PLV3 3RSJA 4AVAA 5IK8A 4JRLA 3V0BA 2VW2A 1QQP2 1NYWA 1YWKA 4E2QA 1D4M3 1JTZX 1H1IA 3PMEA 3VZNA 5EYYA 1HRV1 1ZZ9A 3LA7A 2HEYF 2WJSA 4P9GA 1OLQA 3HBZA 1BBT3 2FHRA 4G3YC 3SH5A 1PGW2 4JC1A 4LBOA 4A7YA 4P9LA 4CEYA 4BOWA 4NVPA 4TWTA 1GNHA 1HXS2 4XFHA 3SITA 3GZUC 4OZXA 1DGRA 3ZXGA 4B3NA 4C91A 4RR3C 1KDMA 1Y3TA 2HWD2 2Z69A 3SH3A 3RG0A 4COUA 3WQ1A 3CU7A 4HVRA 3GALA 2HYKA 3H7YA 1QXJA 1GKBA 4LO5B 4QPGA 4AQ6A 2JECA 2FMDA 3JUUA 3WG3A 3PVEA 4Q4Y3 2YDEA 1SEFA 1D2SA 2VVFA 1QNWA 4ZU4A 2IFRA 3M3QA 1AX1A 1MS8A 5F5QA 5D8AA 1A3KA 2KA3A 2Y0IA 5LK5A 3EXUA 1CPNA 4I0WB 4A3XA 4ES9A 2RS11 1AHSA 1LCLA 4JV4A 2ZX0A 1N3PA 1QJX2 2R1DA 3AMPA 1V6LA 4XPVA 1MS5A 2UU8A 2Z42A 2RR12 4FCAA 3C2UA 5ABJB 2BNNA 3VHOA 4GB33 1FPN2 2XLGA 4MZUA 4R9CA 2R32A 5AC93 1EAH1 1H9WA 4YW1A 3LA2A 1FI2A 3VKFC 3TB0A 2O0OA 1YJLA 4EROA 2RMU2 1DLLA 3GZAA 4Q4Y2 4CP1A 1RC6A 1YI7A 1H8TC 3N7MA 4CEYB 3NWKA 4L92A 2DCYA 4TSVA 1G86A 5L7OA 4ATEA 2WLQA 4RHV3 1PM7A 1DF0A 2PHLA 3POSA 2ZGKA 1V6NA 2ES3A 3MDPA 1URXA 4KU8A 4DXZA 4L8QA 1AX2A 3VHPA 5CBLA 2EA7A 1QJZA 1RUH2 3VZLA 4DY5A 4IV1A 1V6MA 2GZWA 4P5HA 5C4WA 3E5XA 3PVBB 1LOEA 1LGCA 1PO13 4GB32 5AC92 4Q27A 2H0BA 3KCXA 1VBB2 4MXVA 1QH6A 4LR4A 1SQ4A 4ES8A 1NE4A 4XOGA 1KS4A 2P2KA 1SLIA 5JPMB 4XF0A 4M3CB 1B35B 3O0XA 5CB7A 4AI0A 1OHFA 1REFA 1V6KA 1WBLA 2HWB1 3SCGA 4DRVA 1AJKA 3ILFA 1RUG3 4JAAA 4ONUA 3ZVXA 1NCRB 1AL23 3IPVA 4GWNA 5KXCA 3UKNA 4QU2A 4HKLA 1B35C 1ENXA 2R071 1NA1B 4ZKTB 1HQNA 2VMIA 1WGPA 5GLVA 4JGZB 1D4M2 1DQ4A 3FFZA 4YZ2A 3AB0A 1RUJ1 5CFCC 1AL21 1ZZ6A 3ALQA 2OZJA 4LEJA 3MI8A 3W9AA 1B09A 3WDYA 3JQXA 3ENRA 4HKOA 1Q8OA 3TNPB 3G7DA 1CAXA 2C9AA 2D3PA 4R8HA 5J36A 1OD5A 2I2SA 1KITA 3AM2A 1TEIA 2Q8OA 2QQPA 4Y26A 2JEMA 4B7EA 1TME1 4JRAA 1LGNA 1ZNPA 2JG8C 4RSUA 4IERA 2AGSA 2D6MA 5JIAA 1H2NA 1C5IA 2D3RA 5FPZA 5JCTA 1RMU1 3JZVA 3OY8B 3RWNA 2DFCA 1REDA 1G9BA 4A2UA 3KGZA 1JH5A 3ZFFB 1Q8QA 3N7KA 1NCQC 2WS92 3NW4A 1V9U2 5JAXA 3I2DA 3FC0A 3GBFA 3CJIB 4QQLA 1VBE2 2FZ2A 2XJSA 1QQP1 5CG9A 3UKVA 3ZDSA 3RYKA 1RMU3 1FNYA 1FPN1 2WC2A 4QMAA 1Z78A 2RMU1 1C4RA 1RUD3 3ZYPA 3QACA 1CAWB 2XKPA 2RM23 1QOSA 1VJ2A 2TUNA 4DFSA 3IDCB 4BZ4A 2RMU3 2UY9A 3MICA 4H55A 4AGRA 5CFCB 1IKQA 3JCIA 1OA2A 1R1A2 3M1HA 3ST7A 5HCAA 5JPNB 1U5IA 3ES4A 3JBG2 4R9DA 4HETA 1LOCA 4N9IA 2OIIA 1FX5A 2VUAA 4RQPC 1LOAA 1VBB1 1KRIA 4Q4X3 1QXRA 1BYHA 2R072 1J1LA 1ASJ3 1W6PA 2PHFA 5IK4A 3WOGA 4Q0SA 1W39A 1ZX5A 3QH7A 1V6JA 2C1FA 3LGRA 2HWF1 5D8AB 3B5LB 1LOFC 2W0XA 4LNVA 4ZU5A 4CTEA 1Q8PA 2A5ZA 4WBBA 4K21A 1CQ9A 2NPIA 3MGUA 1ASJ1 1NY71 1XNDA 2A71A 1IS3A 3G6JB 4Q8LA 2VGDA 4MUVA 3VBOC 5CG8A 2ZHMA 4ISRA 1VRH2 1FMD2 2Q1MA 4YGCA 1W0PA 4MGIE 1K5MA 1VALA 2XBO2 4B4QA 3TN92 1H2KA 3ZN6B 2QDRA 3W58A 1JXNA 1GNZA 2UY8A 1XYOA 2SBAA 4LHNA 4FPLA 4BLJA 3VBOA 1WUVA 4COYA 5H9SA 4UW3A 1LOFA 4FPEA 3M70A 1UF2C 1FOD1 2GU9A 5GLUA 1G9FA 2XJRA 4PQ9A 4AEKA 4LTAA 3LOIA 3JD72 1KDKA 5A32B 2C5DA 2NN8A 1O5LA 3IBMA 3QCWA 4QHBA 2KM2A 1F5FA 4YVSC 2V73A 3IT8A 2E6VA 4XFBA 1H0BA 4H3WA 2DV9A 4OVEA 3B94A 3LSEA 4WZCA 2AYHA 5JI9A 4MXWA 4B29A 3AMNA 5I93A 4AHYA 2BQPA 4E9KA 1NG0A 1VAMA 3FLPA 1RHI2 1H1AA 5JMCA 1W0OA 4O9GA 4FSJA 4J1XA 4PCRA 3R6SA 4MGYE 3DN7A 4R4XA 4Q8KA 3AKPA 4CYDA 1H2LA 3A0NA 3AKTA 3BODA 4GMP3 1C1LA 3B93A 2QZ3A 3EJKA 1WLCA 3ASIA 2D5FA 2IWGB 1N1VA 2WINB 5JSRA 5JZGA 4YW2A 4XQWA 4FAGA 5AVAA 4XE9A 4FXGB 3JBG1 1YNAA 4AE2A 1EPWA 2I07B 1FXZA 2GMMA 2P3JA 5ABJC 4HSLA 1R082 4XJUA 3UJQA 2ARXA 5T5JA 2XJQA 1TME2 1BBT1 1LHVA 1OLRA 3AP9A 1OQ1A 4COVA 2XJPA 1H8TB 1ND2A 4YM3A 3HD8B 1HRV2 1MZ5A 3RS6A 1WW5A 3IPVB 2NZ9A 2ET1A 5B2GB 2BNOA 1DDLA 4AFDA 2WT0A 4TLFA 4LA3A 1AXKA 4G4FA 4W6YA 1PGW1 4PJYA 2DCJA 3H8UA 3KT4A 3VBRB 4FT8A 1EPZA 2H6CA 3NL1A 1YHFA 2UYBA 4OI0A 3WDVA 1RUE3 4XTMA 2PLV2 3HT1A 4ITCA 3SNMA 1GICA 2R062 4L2NA 4XF1A 1BMV1 1VBD3 3RQ0A 1D0HA 2H0VA 1DQ2A 1U5XA 2DUQA 2I45A 4YSFA 2DF7A 5JZGB 1RUC1 3TRSB 5KHGA 1S1AA 4X6QB 1VB4A 2PQQA 1QOOA 1QJX3 2V09A 3VBHC 3ZMNA 4GKXA 3WD5A 3FFQA 2RJKA 1RHI1 3OY8A 2E53A 4K9SA 2RHPA 2X29A 1COV2 2QJVA 1VBC1 3RPQA 1PNFA 1KS5A 1QKQA 4JGYC 4AFAA 1HRI1 1KJRA 4P9JA 2YGLA 2BNMA 2DUPA 1LGBA 3FHIB 3RDIA 4EWEA 4FOWA 3MPPG 3AYEA 3OD4A 1GQHA 3ME2A 4NN0A 1DG6A 3AJZA 1UU4A 1X33A 4E2GA 5JOYA 3VUOA 3WW1A 1V6IA 4FQZA 4HPKB 4LO6B 1CAWA 3B7MA 3S6PA 1X7NA 4V1PA 3R4DB 2OUHA 4B8EA 1VBA1 3PMSA 4XDQA 3K51A 3KT1A 3SISA 2A3WA 4OFGA 3FUQA 1AJOA 2CGNA 1J3QA 1VIWB 4N43B 4BA6A 1RUOA 3WX5A 4FTEA 3HN1A 1AF9A 4W65A 2A6VA 1LOGA 4GKYA 4YARA 2HWB3 1RJ7A 3VLBB 4CEWB 5F6KA 2AUYA 1V6OA 3DUIA 4F83A 2Z5WA 3HMYA 3MF9A 3VDDC 4AI3A 4H14A 4LBQD 1SBFA 3FZ3A 1DZQA 2GMEA 3USUB 1RUJ3 1ENRA 4WM7A 2WA3A 2JKBA 4RR3A 1Q5OA 1RIRA 4Q1RA 2JG9C 5FPXA 3WHTA 3VBUA 2ZGNA 1XU2A 1KFXL 4NOTA 4Q26A 1CAXB 3R05A 1OMIA 3AZZA 3M8LA 3GHMA 3ZIXA 1D0GA 1PO12 5I0TA 1NLRA 4S2FA 1TQ5A 1UZZA 1VB2A 2LM3A 5KXDA 1O4YA 5BPXA 1E57A 2CTVA 3FBMA 4AGVA 1POV1 1HKDA 4FVVA 5JSOA 1OSGA 2Y26A 5I8SA 2K9ZA 4A7ZA 5A32A 1ULFA 1UU6A 2DUOA 1IKPA 1V9U3 2A6ZA 2GALA 2DVBA 5C6CA 2XBO3 3IN9A 5K0UB 3NAPC 1FMD3 1RMU2 3WP3A 1VAVA 4EN9B 3KT7A 4NR1A 3C3VA 3L9JT 2RR13 4B4RA 4XILA 1V9U1 2XBO1 1PHMA 3WP4A 4FOVA 2GSYA 2XJUA 1VBE1 1RUI1 2YYOA 4YFWA 4AVSA 3WINE 4DS0A 3AX4A 3EO6A 1WLTA 4HZFA 4QPGC 5C33A 1DQ1A 1DGWX 2QDNA 4XBQA 2WT2A 2A6WA 2P17A 3FUOA 1CPMA 2BVVA 2YROA 4GALA 1HV1A 3CJIC 3WP5A 1F31A 2D6NA 4Q4W3 2Q4SA 1UKRA 5F6LB 2Y0OA 4YG0A 5DG2A 5DUWA 1PO21 4QPGB 4L97A 2JE7A 4LBNA 2ATFA 5BNNC 4U36A 4F3JA 5C9AC 5CU1A 4I0BA 1ZBA3 3UL2A 4Y1YA 1MQTA 1MQTC 4XF3A 1QGLA 2AENA 4Q4W1 1TMF3 1VBA2 5BNNA 2ZGRA 4Q4X1 2A7AA 1PO23 3NJZA 4XW3A 3OF1A 1AR62 1GZWB 1W6OB 2IXHA 2VOWA 3WQ0A 2WKKA 3MLKA 2HWE2 1WCSA 1DQ5A 1BQPA 2VULA 3OCPA 4NO4A 4YW4A 2QZ2A 4JDMA 2ZGLA 2ZGOA 4LE3A 4OHXA 1AXZA 1MS1A 1FATA 1XRUA 4OUSA 3NV3A 5FAXA 4YW3A 1RUJ2 1QXPA 1NCQA 3ECQA 1OKQA 2D43A 5BNPA 1BVVA 1G9CA 3KLSA 3KM5A 1MZFA 1K5MB 4IEUA 3FX3A 3VKMA 4XETA 2A3XA 4CP2A 3JU9A 3APBA 3V65A 1W6NB 4S2DA 3PHMA 1A8MA 3FMGA 5JWPA 2O1QA 2EAAA 5J96B 4KQ7A 2X8KA 3H1YA 1OOPC 5FQ0A 1DQ0A 4Y22B 3B9IA 2ETEA 5KC6A 2IZWA 4I02A 4QD2A 3OYWA 3V64A 4WVVA 3D82A 1S0CA 3WDUA 2E7QA 3BU7A 1HQWA 1EV12 3AP6A 3D4KA 4RD7A 4Q0PA 1ZZCA 5C9AB 3ZXKA 4Q4V3 4CDQA 2GC2A 2DCZA 4IV3A 4K8FA 4YVWA 1RUNA 3ZSJA 1VRH3 4WM7C 4DINB 1KFUL 2ZMLA 5JLVA 4OHWA 4URTA 3ZXLA 5JVVA 4BCUA 4GMP0 2WZR3 2HWE3 4M0HA 1KJLA 3DPRB 1X50A 1H4GA 4GULA 4DMIA 1LRHA 2XHKA 3JQWA 2HWF2 2W52A 4QQ2A 3B02A 2ZX3A 5EYXA 5H9QA 2Q5TA 5CADA 5T55A 4E4DX 2R041 1FYUA 4FPYA 1MEC2 2ZMKA 1CJDA 4B7KA 2JE9A 5L7OC 3SMHA 3VL8A 4AQSA 1O3RA 2NM1A 4BMEA 1HRI2 3P3NA 1F8VA 1A8DA 1C8M1 2UWAA 3MLLA 3VHNA 5KHHA 1OOPB 1QDOA 3MFAA 1JHNA 2DU1A 2R6QA 1U12A 1SCRA 4NWWA 4CEWA 3ZMOA 4HL0A 5BNQA 5JDBA 5GZEA 4R9AA 2ZPXA 2DCKA 1HLCA 1J58A 2VPVA 3KQRA 4JGYA 1ENQA 5HBAA 2VQAA 5EWSA 1I9RA 4C1WA 2EXIA 3INAA 1MACA 4HLTA 1XQNA 1OA3A 3DKWA 1G9DA 3HWJA 4Q4V2 1N1YA 2AH2A 1WLWA 2Z79A 3KCYA 3BOWA 1IOAA 4QPIB 4CDUB 5HCBA 2VU9A 1AUYA 4AEDA 1UZYA 4W6WA 1VBD1 4AK3A 1CVNA 4C90A 1FT9A 4I3PA 1X82A 4QPIC 3KGLA 4A7KA 4AEMA 5EFUA 5E1RA 3TAYA 1D2QA 2YPJA 4WVMA 2VG9A 3BTAA 4IEZA 2CYFA 4CEYC 2QE3A 4C1XA 4Z1VA 3MEPA 4AQTA 4QPYA 1RHI3 1UW8A 3J4UH 2B8MA 5C8CB 4Y20A 1RUC2 2QNKA 4MH0E 4QM8A 3ZFFC 3R4UA 2CAUA 3H1MA 1V70A 1WW7A 3AKRA 4IEWA 3OPZA 2BTVC 4CDXB 4XXPA 5ACA2 2WNVA 2DCTA 2PYTA 3OD0A 4BWOA 5GM0A 4BH9A 2B46X 2ZKLA 4FPFA 5GKAC 1CIWA 2ZGMA 3ZN6A 1BBT2 2X5IC 3B69A 3LCPA 3WDWA 5HI0A 1KXGA 2D98A 1UL9A 4FPHA 4WVWA 4HK9A 1VBA3 2W68A 2MEV2 1W6NA 2QVSB 1SBDA 1RUH3 4HT1T 3J26N 4XXAA 1VR3A 1OA4A 2DYCA 2RS53 3WLUA 2XWJB 2W39A 1AYM2 5GZGA 1W6QA 2ZBJA 3DL3A 1RVF2 3RMYA 2PAMA 3KCCA 3EQEA 1XXNA 3I54A 3CL1A 2ZCWA 3ZYJB 1JUIA 1LENA 4XMAA 3SLIA 2ENRA 1WLDA 1H1MA 3FLTA 4IEVA 4XFIA 1RUG1 4PDWA 4LULA 4RS5A 4QX5A 2N7GA 3USUA 3ACLA 1UIKA 3H1WA 4N43A 2BW8A 4XFCA 1YXWA 3VBSC 1REEA 2JG9A 5H9RA 3ZX7A 4CDWB 3OBRA 2P3KA 1HXS1 1W6MA 5C8CC 5FLHA 4EN8B 2R061 1ZRDA 3TYJA 4K7JA 1PZ7A 1EV13 4MYEA 2ZABA 2ET7A 4WM8B 4CDWC 3SCHA 3AKQA 3U11A 2PAEA 1GYKA 3JB4C 1YFYA 3ZFEA 1UKGA 2WQZC 4IETA 4WM8C 4Q4X2 4PDWC 4RS5C 1F2NA 2HWB2 2XVKA 2CGPA 4COZA 2BBVA 1SLLA 4WZFA 2DVDA 2AZ5A 3PJQA 1F9KA 2PHRA 4AHWA 1YI9A 4AI1A 3I8TA 2G4IA 2IXIA 5FO8B 2XG3A 3MIBA 4M3CF 4I3GA 4DNYA 5A3MA 1ZRFA 2BYVE 4AWDA 2WZPP 1NXD1 2MEV3 2VOVA 1ONAA 4MX3A 3K48A 1K5MC 3MFCA 4IV3B 4NHKA 2VMGA 4XIOA 4YVWB 3HQXA 4ZU7A 4CDQB 4P9WA 2B39A 3E5UA 2PN5A 4N90A 1IQAA 1VBE3 4Z92B 3THPA 4JDNA 1TNFA 1XYPA 2WQ4A 3AYCA 4RL7A 3ZXFA 5K0UC 3AFKA 4XFFA 2GAUA 2VXRA 4KGGA 3ZSEA 3M3CA 1R093 1UCXA 1WMFA 1XYNA 2A75A 4GH4B 1GFF2 4I01A 3X29B 2E51A 1Z7S3 3U07A 2R49A 4QGNA 3PVOA 3MIHA 1J59A 1QH7A 1GZ9A 3PNAA 1YO8A 1AL0G 2XVGA 4GB31 5AC91 1QHDA 1EAH3 3VBOB 1GR3A 1OFSA 4GH4C 1R091 2GC0A 5KXEA 3AZXA 3CEWA 1VLNA 2ZZQA 4Y1UA 1AR73 4AEDB 2EVXA 3V0AB 5I0SA 4UW4A 3BIWE 3M7AA 4MV2A 1AR61 1DBNA 2D5HA 2WNUB 3DF0A 3UK9A 3WV6A 5JOZA 1PK6A 1UD1A 1PK6C 1MQTB 4IEXA 4YM2A 2HWF3 1AR71 2E63A 3WT3A 1RUF3 2XJVA 3VBFA 2QFEA 3HR9A 4HFSA 3ZSMA 3VZMA 1O3SA 2EXKA 1KQRA 2FBEA 1O5UA 1CN1A 1LB2A 4Q4W2 3IKWA 1AR91 1ULGA 1AYN1 1PIV2 1PO11 2VY0A 1C8M2 3RJRA 1S0GA 2F4PA 4FPCA 1SMVA 2RS33 1BEV3 4PBOA 4CDXA 3MYXA 1PMIA 2D6KA 2JG8A 4I2OA 4H7MA 2ZJCA 1MVEA 1OPMA 4BMBA 1DZTA 5J3UA 1C28A 1NCRA 1QY4A 5ABJA 3PJYA 3M3IA 1BEV1 2JENA 3GBGA 1YIFA 4FTBA 3B01A 3AYDA 1NQDA 3PVNA 3JD73 1QJU1 5BV6A 2ARBA 3TN93 3KZ4C 4LBLA 2O8OA 5IUQA 1AR82 1QMJA 4L11A 1IHMA 3VBHB 1Z7S2 1VRH1 2WT1A 2ZX2A 2WLPA 3NV4A 4F7ZA 5CFCA 4D69A 1Y7BA 3WUCA 1ALYA 5E88A 4YM1A 1LTEA 2VW0A 3MW4A 5BY5A 2A3YA 4Y20B 4PLMA 4EV0A 2ZGSA 5J7MA 1WCDJ 4SBVA 1PGL2 1AX0A 3LZZA 2DU0A 5T5PA 4LE4A 3OGGA 2BUKA 2WS93 2H6BA 3N36A 4AHXA 2IC1A 3H9AA 5BNPB 1TME3 2D6PA 2GC1A 1A78A 2VMHA 3N7JA 4RGGA 4IL7A 4ATFA 3ROUA 3I59B 3ZFGB 3AYAA 1C3HA 3FWEA 3ZN4A 5AVPA 2NP0A 3D6EA 4CDWA 3MIEA 4RFT0 2A73B 2DVAA 4OI1A 1S0EA 4X6RB 1WD4A 5HXVA 1JN2P 3ZFGC 4AG4A 4XZPA 1C8M3 2CNAA 5CNAA 3AZWA 3M4FA 3VHRA 1AXYA 1Q8SA 4Y22A 1TMF2 2D97A 2EXJA 1GLHA 4BYYA 3H3UA 4N43C 4PLNA 3VBSA 1I1EA 2DWRA 3JBG3 2ZGPA 5FOJB 2B5HA 4FO9A 3T2TA 4RHV2 2GMPA 4FBFA 3RYRA 3VBRC 5IK7A 3EHKA 5KWRA 1W6PB 5EXOA 5DUXA 2ZAAA 2KXLA 2F6BA 5E89A 4B4PA 4I09A 4EN6B 1ZA4A 1AR72 1DIWA 3B00A 1SLAA 1OOPA 2VOKA 4LLOA 3MW3A 4XYXA 1SFNA 2DURA 3B3QE 1HV0A 2DTWA 2JG9B 4K1ZA 1PIV1 4KNCA 4LBQA 4N7UA 5LRRA 4AI8A 2WFPA 4Z8BA 3O0VA 3VL9A 5T50A 3TBDA 3IM0A 4WM8A 4MXWB 3TOJA 2X5IA 4FXKB 3D0JA 1L3JA 1OI6A 1UU5A 5BNPC 1PIV3 4YZ4A 4RQPA 3O14A 1LU2A 2IXLA 2WNVC 3AK0A 4DOUA