4ET7A

Crystal structure of eph receptor 5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
174
structure length
174
Chain Sequence
NEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Eph receptor 5
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 5
total genus 25
structure length 174
sequence length 174
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4et7A00
3DYOA 2JE8A 5IFTA 2VMCA 3LE0A 1F4HA 3C8XA 1GOGA 2QQNA 2W9XA 2BZDA 2XQXA 4DUWA 2EIBA 4P00B 2W1QA 2VQUA 2QQKA 3OGSA 5B4XA 1K3IA 1O8PA 2XHNA 5LCWL 2W95A 3LPFA 3MUZ1 1UYYA 1XNTA 4W8JA 4ZY9A 4A45A 3IIIA 3T08A 5G04L 3OEAA 1OT5A 3FN9A 4QDSA 2QQJA 3F2ZA 3AC0A 3K77A 2ORXA 3A22A 3WSOA 1XPWA 2B9VA 2WZ8A 3EB7A 4ZXEA 3FL7A 5JXGA 4CU8A 2QQOA 2YFZA 4BDVB 1J84A 4TTGA 5EJ1B 2VCAA 4PT6A 3IDAA 4CUBA 4CVUA 2VZVA 4W50A 5DMYA 3MO4A 5DN2A 1KEXA 2LW8A 2E26A 2VOTA 2J1TA 3MV01 1W8OA 4CU7A 4LKSA 3ACHA 3HNBM 2WAAA 1JZ8A 2C26A 2WABA 5HXMA 3P1IA 3J7HA 3I97A 3T09A 2Z4FA 4D8MA 1UWWA 2J1RA 2YB7A 1UY4A 3E1F1 3CIHA 3WQBA 3I2JA 3VDCA 3UESA 2X05A 3ZM8A 5CYYA 1US3A 4QX0A 2L9LA 1W8NA 2V5DA 4P08A 3GXUA 4GZ9A 5I0DA 4OMCA 1CX1A 1GMMA 3OGRA 1DP0A 4ET7A 3VD3A 1OD3A 2KD7A 4BXSV 3HJRA 2ZEYA 4JKMA 4KI5M 3P6BA 2WN3A 5JMOA 1US2A 1UMIA 3ABZA 3T2PA 1GOHA 2VJXA 3FHQA 4A6OA 2QQIA 3W5MA 4KMQA 1UX7A 2E32A 3GM8A 2YG0A 3A21A 1JZ2A 5J1XA 1UY2A 5JR2A 1O59A 1IQDC 4DUVA 4QDRA 5LA0A 3SEEA 5IJRA 5CZKA 3PUIA 2VQTA 3ETPA 5A1AA 1UY0A 1JZ7A 1ULPA 1EUTA 5C7GA 2J22A 2WAOA 2Y6KA 2VZPA 3ACGA 1LNSA 2YC4A 3HN3A 4TXWA 3NJXA 5HPOA 3CDZB 1WKYA 2DCJA 1PX3A 2LS6A 2E33A 3JXSA 4FI9A 5G05L 3EYPA 3WF4A 3MBWA 3NJVA 5DQ0A 4Z2AA 1UMHA 2VTFA 1W9WA 3I2KA 2VZQA 3MV11 4RN5A 3THDA 4LHSA 4DEQA 4GWJA 1I5PA 1UY1A 3FHAA 3CKHA 2W1UA 3VDBA 1CZTA 3OG2A 3C7HA 2BERA 3K75B 3PUHA 2Y6HA 2W47A 4L0PA 4A3ZA 2W1SA 5DPNA 1NKGA 4OZOA 2VC9A 3OB8A 2Y6JA 2VZSA 4XUNA 3T0AA 2WN2A 3I2GA 1CZVA 3U37A 2HLEA 4HG6B 2JKXA 2V72A 1HN1A 1GQPA 3ACFA 2C4XA 4ARXA 5C70A 2WYSA 1GOFA 4QDQA 3HEIA 2VZUA 3C7EA 1K45A 1O8SA 1PMJX 4E8DA 5JUVA 2EICA 4GWIA 4DEVA 2W87A 1MPXA 2Y6GA 1XNAA 4QB6A 4AAXA 3LEIA 4OUEA 1KGYA 4QPWA 4ARYA 5F7UA 2ZXQA 3HPNA 3I2HA 3WNNA 1SDDB 3C7GA 1JU3A 1J83A 2VZOA 1YQ2A 3CMGA 5LA2A 4MGQA 4LQRA 1DLCA 4JHZA 3WF3A 1CZSA 4AG4A 1OH4A 2W94A 3W5NA 1WCQA 3T0BA 4CUCA 2Y64A 2W1WA 3HNMA 4M4PA 2J1UA 1SHWB 4BK4A 4M4RA 3WNLA 3BGAA 2VL4A 2WQ8A 1UZ0A 3K4DA 1NUKA 3K4AA 4A4AA 2J1SA 4KWUA 3VDAA 2YC2A 3SEPA 1D7PM 1H6XA 3T0DA 1TG7A 1UYXA 1GU3A 3I2IA 1NX9A 2ZEXA 1DYOA 1H6YA 3GDBA 5EJZB 1JYXA 2ZEWA 4W4ZA 4XUPA 3UNPA 4QAWA 4CUAA 2CDOA 4OYUA 1RYYA 2QQLA 4XUTA 4UI9L 1PMHX 5IYYA 1JU4A 1BHGA 4DXRA 2QBXA 4A44A 4P02B 2VZRA 3SKJE 3WNMA 1R64A 3WNPA 1SG3A 1L7RA 3SKVA 3THCA 3CQOA 2J1VA 2E31A 1JZ3A 3WEZA 2HYXA 2VO5A 2V4VA 2BGOA 3DYMA 2VM9A 2BGPA 2R7EB 2VR4A 2XOMA 4MGSA 4XUOA 1OF3A 3UETA 2J1EA 5B4NA 3LEGA 4LPLA 2ORZA 1K12A 4MADA 3IAPA 4MOAA 2VCBA 1CIYA 4BK5A 3T2OA 2WBKA 2VZTA 4XURA 3WNKA 4CU6A 2Y6LA 3MUY1 1EUUA 4JX0A 3ECQA 4QX2A 2PQSA 1OF4A 4A42A 3DYPA 1W9TA 3LPGA 4PF1A 4UAPA 3NNGA 1JYNA 2X09A 1UXXX 5FUIA 2C9KA 3NQHA 3WNOA 4XZUG 5JXHA 2W5FA 2YFUA 1JYWA 2JDAA 2WDBA 1W99A 2VCCA 3OGVA 2Y8KA 1JHJA 2CDPA 1JZ6A 3HNYM 3K46A 1ULOA 1TVGA 3WF0A 4ZZ5A 3I3BA 5JXJA 3VD9A 4XVHA 1UYZA 2OKXA 1L7QA 2RV9A 1UY3A 3BN6A 4XUQA 4IUGA 5IFPA 2WZEA 1JZ5A 5C71A 4PQQA 2ZEZA 4A41A 4DUXA 3I3DA 3A23A 3WF2A 1W0NA 2RVAA 3DECA 4YPJA 2B4KA 3A7QA 2VMFA 2VZ3A 2W46A 3I3EA 4MO3M 4BJ0A 2W3JA 3IAQA 4ZZ8A 1GNYA 1P8JA 1NAEA 2WO2A 2QQMA 2XONA 4JKLA 2WO3A 3LQCA 3NRUA 1JI6A 2WO1A 3WF1A 1XC6A 2EIEA 3IB3A 3VD5A 4DXSA 4D0QA 2J1AA 2X10A 3C7OA 4QX1A 2BBAA 4DXTA 2VMEA 2VMDA 3CZUA 5LA1A 2WUHA 3GGLA 5EIYB 2EIDA 3LEKA 2ID4A 3ACIA 1JYVA 1GUIA 3D3AA 4QB1A 3VD4A 4UOJA 1W9SA 3T2QA 4CU9A 3OBAA 4OMDA 3I2FA 3C7FA 3HOBA 4QB2A 4P5YA 2W91A 4E8CA 4QX3A 1K42A 1T2XA 2JD9A 3CZJA 4JKKA 1F4AA 2DCKA 4RYDA 5JXIA 1PX4A 3K4ZA 3VD7A 5IHRA 1JZ4A 2W92A 1UXZA 2DDUA 2VZ1A 2RJ2A 3OEBA 2J7MA
chains in the Genus database with same CATH superfamily
2BVBA 1LB2A 1O5UA 4RR3B 3M3IA 3ZYGA 4QXHA 2BWCA 4A2UA 2QUOA 3PMEA 1NA1B 3LE0A 4Q29A 2E51A 1QXPA 2JDKA 2OPWA 5F9TA 1QJX3 5HCBA 2PFWA 3RYPA 4C8DA 2A7AA 2WFF2 4C1WA 1KXGA 2XBO3 2EIBA 4P00B 2RS33 4ZU4A 2Q8EA 1O4ZA 1KFXL 2HWE3 1OQDA 5B4XA 1K3IA 1UN1A 2XHNA 1APNA 1AR63 1J1LA 1R082 4LUKA 3MUZ1 1UYYA 1XNTA 3VBOA 4A45A 2DBIA 5FYYA 1TE1B 1PNFA 2A3YA 2DVGA 2Y26A 3JZVA 3OEAA 4CXXA 5BNOC 2WZPP 4XILA 1V9U1 3F2ZA 4GALA 3QH7A 2ORXA 2A3XA 3DPRC 2VOVA 1PGL2 4AFDA 4PDWB 5F2SA 2JE9A 4H7LA 5GLZA 5CKNA 2B9VA 1JUHA 2HWC3 3AVRA 3EB7A 4IE6A 4QWNA 2R30A 3VHPA 4K6BA 1X50A 2YFZA 1R1ZA 2JG9B 4XBNA 4BDVB 4CU8A 3MLKA 1CVNA 1J84A 3B5LB 5JOZA 4QPIA 5FYBA 2IFRA 5DG1A 2PMWB 4Z92B 1H1AA 3ASIA 1RUF1 2JICA 5LY2A 2JG8C 3TNQA 1HXS3 3HMYA 1CAXA 3BI3A 4AHYA 4PBOA 1YIFA 1G86A 2E26A 1XYPA 2VOTA 1AR91 2PLV2 2RS12 4R9DA 5CNAA 5T52A 4AR2A 4L92A 1DDLA 5FZCA 3ZXKA 2P34A 3KF3A 2HWD2 4YM0A 3WD5A 2FZ2A 4EN0A 1F9KA 2C26A 4FAGA 1YI9A 1XNCA 4GWNA 3P1IA 1RUG3 4YG3A 3U1XA 1OFNA 4WV8A 4P9WA 1V0AA 5K0UA 1X82A 2FMYA 2ZOEB 1JODA 2R073 1UY4A 2XXZA 3E1F1 4M0HA 1HW5A 3VV1A 4B4QA 4UXAA 5CAZA 1UW8A 3I2JA 5FRAA 1QH7A 2X05A 2K2SA 4M0NA 2AYHA 2JD4A 1SMVA 2OUHA 4IV1A 1N3QA 5CYYA 1US3A 3OPZA 5IWFA 4XACA 4GH4C 4YZ2A 4EROA 3VBHA 3M2MA 1W8NA 1YQ5A 1YLLA 1BVVA 3GXUA 1OC1A 2B45X 4GZ9A 4Q4Y3 1IPKA 1YJKA 5I0DA 5LBCA 4OMCA 4QPYA 2QZ2A 1GMMA 1OKQA 2XQRA 1VBA1 1W3XA 4H7MA 1UIJA 4IV1B 4YVWA 4ET7A 2PHRA 2WFPA 5FY8A 3J8F3 3U4SA 3UKVA 1YWKA 1O4YA 2R32A 1VAMA 3JD72 4ISQA 4N43B 4XYXA 2KM2A 4WVMA 3WP3A 2ETEA 4NVPA 1D0HA 1MACA 4R9BA 3POEA 1NZIA 2EAKA 2H0BA 3LA2A 3PVNA 2CAVA 4Y20A 3MIDA 1LOCA 1QKQA 1W90A 1XSRA 2WN3A 3ZYHA 5BNNA 3IM0A 5FP8A 4N9HA 4XCAA 1UMIA 2ILMA 2VNVA 4ASLA 5F5AA 4YZ5A 3A0NA 1NZCA 3T2PA 4NAOA 2R062 5FZAA 3JBG1 1DQ5A 3RZKA 3ZMOA 4CEYB 3HQUA 4XMIA 5A70A 1O4TA 1ODMA 2XWJB 3W5MA 4KQ7A 1LKNA 2YG0A 3R4SA 3EO6A 5LBEA 4PBPA 3WQ7A 1OQEA 4DQAA 1UO9A 3N9PA 2K46A 1AYN1 3JD71 4Q0SA 3WW2A 4FOVA 4I02A 1FMD2 3U07A 1XXNA 2IVIB 3ZYJB 1RUF2 5F1RA 4J1WA 2OT7A 3SEEA 5IJRA 1W6NB 2JG9A 4D94A 2WNUA 1MZFA 4H2AA 4MLOA 4BB3A 1G8WA 5A1AA 1W9FA 2XJTA 4NO4A 4FP3A 1LEMA 2WZR1 4JDOA 1JZ7A 5KXDA 3UL2A 2TUNA 2WAOA 4B8EA 2Y6KA 4B1MA 4Q5OA 1LNSA 4NMIA 1VBD3 1BBT3 4D7YA 1VMJA 3KS7A 1SEFA 1V70A 1QOOA 5GZDA 3AM2A 3CBNA 3CJIC 2VAUA 1PHMA 4CP0A 3IDEA 1H0BA 4FI9A 5FK7A 3HBZA 5JOWA 3EYPA 1RJ7A 2BFUL 1A8DA 1POV0 3OSDA 2RHPA 3NJVA 5DQ0A 1CQ9A 2W08A 5FUPA 3ZYBA 1RUD3 5IATA 4IV1C 5FO7B 2CGPA 1DQ2A 4W6YA 1C4RA 2WZR2 3POWA 3VZLA 2GN3A 3MF6A 2BOJA 2VTXA 1JHNA 4CZSA 2O1QA 1IG3A 2ARCA 5FR3A 2EXIA 1A34A 4QKNA 3DCQA 1X36A 3S6PA 5LW9A 3ELNA 3C7HA 2BERA 3K75B 5C8CB 2DU1A 2V09A 3H8UA 2W47A 4MH0E 2CYFA 5KHKA 4MX3A 2DF7A 2ZGMA 4YW3A 4MGIE 4Q4V1 4NRQA 5FOBB 1VBE3 3OB8A 5LWBA 1LGCA 4AI0A 4LITA 2WN2A 2HKXA 3I2GA 3M4FA 1OOPA 1SZBA 5C8CC 4AFBA 4XMAA 4XIKA 3U37A 4HG6B 3BYWA 4FVVA 1Y7BA 2V72A 1FI2A 4GKYA 2BEOA 1CAVB 2BJSA 3QACA 3MFAA 5F3EA 3H7JA 4HK8A 3ACFA 2C4XA 1IG0A 1NCRB 4IEVA 4ARXA 5C70A 3MLLA 2WYSA 3OJBA 3AJYA 4AHWA 4PI0A 5E8AA 1GOFA 3DPRA 4CEWA 1GZTA 1GV9A 4FFHA 1PZ7A 3S7EA 5A3MA 1H30A 3ROUA 2VOXA 4UT5A 3C7EA 4CCCA 5FYCA 5J37A 2A73B 4PLNA 2ZGTA 4AQ2A 1QXJA 2XMLA 1Q5OA 5JUVA 2A6YA 4QHOA 4GWIA 5GLWA 5IK5A 3H50A 4QXKA 4Q4V3 2V5YA 5FY1A 1Y4WA 4LNVA 1AYM1 4JC1A 3GF6A 5F3CA 1AXYA 3OY8A 4SLIA 4JDNA 2PHLA 5BV6A 1W2OA 1EAH1 4LBNA 4TWTA 5FV3A 2B46X 1DQ1A 3R4DB 4QM9A 1RUJ1 4QPWA 5EQUA 1A3KA 1MS4A 1S0FA 4BYYA 5B2GB 1G9CA 3VB9A 3RZMA 2ZXQA 1V6IA 5F8PA 3I2HA 2YDEA 4IEZA 1SDDB 4R52A 1RC6A 2XLFA 5FZ7A 3CF6E 4JDMA 1N3OA 1DHKB 3NSTA 2VZOA 1YQ2A 3CHXA 4JTOA 1PNGA 3I59B 2HEVF 2XGXA 5BNPB 2WFF1 1DLCA 4LQRA 3H3ZA 4LBQD 1CZSA 4HBNA 3BPSA 1ZZ6A 5E16A 3NNMA 2W94A 3WCSA 1NLQA 5CVRA 5A3OA 3HNMA 5T5OA 1AX0A 5JDBA 2ZBJA 2ZA9A 3UK9A 4AI3A 1NA1C 1S0BA 1NCQA 4BE3A 5A6YA 1ND3A 4YG0A 4IV3B 1ZBA1 2XVKA 3MHZA 3GYDA 1MVQA 3KGZA 4CEYA 1F35A 4DS0A 4XJZA 1LOFA 5SV5A 2PHXA 2PYTA 4CEYC 4SBVA 4CDWA 3K4AA 5J3UA 3CNAA 1HB4A 3M3QA 3SEPA 4OUMA 1Q3EA 4BXFA 3KVBA 1SQ4A 4AAPA 1XE8A 2R072 3OPTA 5IUQA 3N7LA 1UYXA 1GU3A 2BOIA 3OOXA 1OI6A 4I0AA 1QWRA 1AR81 2Y33A 2ZEXA 2MPFA 1W8UA 3N9MA 3NJYA 4MGKE 1V00A 3OBRA 1ZNPA 1KS4A 3WHTA 3OGJA 1HJGA 2ZEWA 1D0GA 4CXWA 1RUD1 1RINA 2PQQA 4XUPA 5C4WA 2BPA2 3TRSB 2Y38A 1HN0A 3CL1A 1UCXA 5FYVA 4LHNA 1RYYA 2Y0OA 4XABA 2DCZA 4WVWA 4GH4B 2DWRA 2I07B 3H42B 3ENRA 1BHGA 1KJLA 1Q56A 2XR4A 2C1FA 3ILRA 4P02B 2VZRA 3QCWA 5FZ3A 2BDRA 2XG3A 1HDKA 3CO2A 1HB1A 2H6BA 2UWAA 1LCLA 2WA3A 4UFMA 2D5FA 1DQ6A 2ZGKA 1AHSA 2VW2A 4XEZA 3UV9A 1BMV2 3K3OA 2DUQA 2ARAA 2BGOA 4YRDA 1PGW2 2BGPA 1EV13 2DVDA 2VR4A 4XF9A 5CKQA 4WM7B 2XOMA 1I3HA 1O6UA 1ODNA 5JZGB 5FZBA 1QJZA 3VBSB 1O5LA 4IETA 2RG4A 3NMBA 5B4NA 2JIJA 3LEGA 3WDXA 4NOTA 2JB4A 1BXHA 3S5QA 3VBRC 4BXSV 5BNOA 1XB9A 3SISA 2VXJA 1K12A 3G6JB 1CAUA 1PZ8A 4RQPC 3IAPA 1WD4A 1U0AA 4RGGA 5KWRA 5LZ6A 1MR5A 4MOAA 2VCBA 2VH9A 4NWWA 5K4LA 5A7WB 5L9BA 4XDOA 2VZTA 4N9IA 5FZOA 3SXWA 5BPXA 3W58A 3WNKA 2WFF3 4AEMA 2DBNA 4JX0A 1DYKA 3DPRB 3VDDB 4CDQB 5BNPA 3GBWA 3ZXJA 5BNOB 1SCRA 3ORJA 2JB8A 4JGZC 1H2LA 1OD5A 1FMD1 4FPJA 4QKDA 4UAPA 5FY7A 3PVEA 3NNGA 5KR7A 1JYNA 3E6CC 3NQHA 1VALA 2RS51 4XZUG 5F37A 3AP4A 2GMPA 5DUUA 5A6ZA 1XRUA 5FUNA 5JXHA 2YFUA 4CA9A 2JDAA 5C8CA 2VCMA 3TWIA 2VECA 1UU4A 2LTNA 5FJKA 1JZ6A 1BKZA 1H1MA 3TNPB 4KG8A 3RYKA 2DV9A 2JDUA 1TVGA 4J6GA 5H9SA 3UT0A 4AZZA 2OA2A 5JSOA 5I0TA 5LEKA 1NT0A 2Q1ZB 3BODA 2P3YA 1VBE1 3AKSA 3I3BA 3LIGA 1UYZA 4JGZB 5FYMA 3UKTA 1WCKA 1TMF1 2ZGSA 1LU1A 2EALA 2XKPA 4NHKA 4X6QB 1J3QA 5DZGA 2WZEA 4Q27A 3WCRA 4CDQC 5IFPA 1JZ5A 5F3GA 5C71A 3RJ2X 4ONUA 1Q8VA 4ASKA 4XF0A 4RSUA 3RWNA 4AOCA 4NR1A 2ZEZA 2H0VA 3SHRA 2NLRA 4MXWB 5C9AC 4BQ4A 4N53C 1E5SA 1L3JA 1DGLA 4YPJA 3WF2A 4CP9A 4DXZA 4RQPB 2YHJA 3E6DA 3LKJA 4AI2A 4AQTA 2EIGA 2VZ3A 4COYA 3I3EA 1VBB3 1SLLA 1ND2C 4BJ0A 3VBRB 1UZVA 3AJZA 3MFCA 4UYBA 4HVQA 1UZYA 1JYIA 4IL7A 1NXD1 1LENA 4JKLA 4U36A 2UYBA 4GWMA 4Y1UA 1JI6A 3J7MA 2WO1A 4P9IA 3WVJA 5JZGC 4CDWB 2XKOA 3C2UA 3RSJA 4BLJA 1YO8A 4BMBA 1WBLA 4LBLA 4Q4V2 3IB3A 1SCSA 4ZONA 5FZDA 3ZXDA 2E7QA 4BQWA 3ZOIA 2G4IA 3POIA 2Q30A 3FMGA 2J1AA 1S0JA 4IE4A 2VVEA 3KQRA 5FZFA 1WW4A 4PDWA 4E2QA 3CLPA 4PIZA 1LGBA 3WQ0A 2BGCA 4IGOA 1NOVA 1ZZBA 2N7GA 4NHXA 4FPHA 4HN0A 4Y26A 2VVFA 3O7OA 4UW5A 5JI9A 3ILFA 3A0KA 1LR5A 1NYWA 4A6SA 2WSUA 3WDWA 1JYVA 4XQDA 1M4WA 4COWA 3TEXA 3AMPA 4LJHA 5BNNB 5L36A 1AJOA 4CU9A 4E4HA 4XC9A 5LB6A 2FMDA 1YUDA 4QB2A 1J3RA 1F8VA 4P5YA 2VGDA 3I4IA 4QX7A 1RVF3 2W91A 4XFIA 1Q8OA 2XLGA 2QNKA 1BCXA 1UNBA 2I74A 2RS32 2WNVC 3HD8B 3KQ4B 3BTZA 2DCKA 1OLRA 2O8OA 2HBUA 1W05A 4R4XA 1DLLA 4FBFA 1MZEA 1IPJA 4XAEA 5KXBA 3K4ZA 2DURA 1POV3 2BW8A 3ON7A 1SFYA 2YXSA 4P9JA 3BKZA 3PJQA 4XW3A 2AENA 2RJ2A 1Y9QA 2JENA 3OEBA 4DY5A 2WSVA 4CPBD 2GALA 4LBQA 1XE0A 1NLSA 1MS1A 4Y1YA 5A3WA 1CAVA 1H4HA 4FPFA 5A7WA 1RB8G 1PIV2 4COVA 1YFXA 4OUSA 5DXDA 1GOGA 5A33A 2QQNA 4LO4B 2BZDA 5GM0A 1PGW1 4HMZA 2OPKA 3ZIWA 3J7NA 4AHZA 5AVAA 4YVSC 3FUQA 1O8PA 3FBYA 4L97A 5IK8A 3MIEA 4CUGA 1WW5A 3WUCA 2W95A 1VBD2 3NV1A 2MEV2 3UKNA 2FDKA 1LODA 1W2NA 2GNDA 1OT5A 5H9RA 5HI0A 1WUVA 2ZX3A 4FSJA 2ZHNA 3AC0A 1ZRRA 1W06A 4IEUA 3A22A 1AR82 4Q2FA 1F5JA 1FV3A 1R081 4X8NA 1V9U3 1Y43B 4YG6A 5JXGA 1LJ7A 4NE9A 5F2WA 4Y1XA 3SITA 5FCCA 3WG1A 1HQNA 4YGBA 1WMFA 4YGDA 4TTGA 1BJQA 3BU0A 1DU3D 1GR3A 2JG8A 4IEYA 4UBGA 5EJ1B 4COUA 3OBTA 1FNYA 1AF9A 3SCHA 4V2VA 4ORFA 4LBOA 4N90A 1IS4A 1E57A 2JKBA 1R1A3 1ZA4A 1VRH3 2JDMA 3QD6A 5FZLA 5GZFA 5DN2A 4CEWB 2CGNA 4CCEA 1KEXA 3N4MA 1O3QA 2B5HA 4XCBA 1POQA 2J1TA 1K5JA 1K5MA 3EBRA 3MV01 3MF9A 4CU7A 2D43A 4Q4X3 1COV1 3LZZA 4LKSA 1NCRC 1S2EA 3ACHA 1VJ2A 2WS93 1KD7A 1U5XA 1XYNA 2YC0A 3HNBM 2OIIA 3LA3A 4FT8A 4XPVA 5FYSA 1AL23 5HXMA 4OHYA 1BYHA 2WQZC 1CX4A 1PVC2 5CFDB 3I97A 1CR7A 5F3IA 3POYA 1I5ZA 4PIXA 2XDVA 2XVGA 2RR11 3LCPA 1UWWA 2YB7A 4ZS2A 4Y5SA 3H9AA 2OQ7A 3PUQA 1DZRA 4CCOA 2BFUS 4NIDA 5T5JA 4AEJA 3WZ1A 2GN7A 4DY3A 1STMA 2DTWA 3ZMNA 1PVC3 3GBGA 4ZPIA 1COV2 1G6NA 3VZKA 5CADA 1LOFC 2IC1A 2V5DA 1RHI2 3FBMA 5CKMA 2YGLA 2DCTA 4RFRB 3ZXLA 1JOBA 3KD4A 3OGRA 1DP0A 1LECA 3DXUA 4Q4Y1 1UF2C 2KD7A 1NY72 1RUG2 1YFUA 3GZTB 1DQ0A 3KWVA 4I09A 4GKXA 4QGNA 1N1VA 4Y20B 1FPN3 1G9AA 4Q1PA 5DDJ3 3RFRA 4DINB 5I8TA 1RUE1 5TSWA 2NMOA 4LBKA 4LO8A 5FYTA 1ZBA3 5I8SA 2P3IA 5ANNA 4YW5A 5JMOA 2ADEA 2RDNA 3FC0A 2J42A 2OYZA 4F83A 2VJXA 4NIAA 4PCRA 5FBJA 3VKLA 1NQJA 3KHBA 1UKGA 1CWPA 5IVBA 2WLQA 2QQIA 1MZ5A 4KMQA 5FTTC 3GM8A 5KXEA 2OW4A 1UZZA 2WNEA 5FY5A 1M06G 1VBC2 5K7PA 2H6CA 2VMHA 3KCYA 1RHI3 1DYPA 1MEC3 4TSVA 5JR2A 3A4UA 1O7FA 1WA4A 2EXKA 1VBB2 4I3PA 4AVTA 4DUVA 5LA0A 3KVAA 1QMJA 3JQXA 3OUJA 3G7DA 3HN1A 5CZKA 2W39A 2WC2A 2WQ4A 5C5UA 1AYN2 4LE3A 4LKEA 1TMF2 3B3QE 4OVEA 2HWF2 1W8ZA 4GMP3 1H8TA 1LOEA 1UY0A 3NO8A 3DL3A 3MLJA 1VP6A 2V4AA 4LBMA 3FZ3A 2LUWA 4L99A 3ACGA 2YC4A 4LK6A 2KR2A 2XH6A 4FPYA 1OVSA 3B9CA 3ZLIA 4HXCA 5GZEA 1WKYA 3SH4A 4Q0QA 4HKLA 1PX3A 3DUIA 1F5FA 4BQ3A 2E33A 3LFMA 3JXSA 1F31A 2CSGA 3OY8B 1B09A 5DABA 3SMHA 2XL7A 4XIOA 2Q5TA 3GZUC 3GJBA 4FP2A 4N43C 4BZ4A 5FPXA 1SPPA 1VRH2 1ZZ9A 1UMHA 4Z2AA 1GQHA 4BCUA 1NQDA 3OUHA 4URAA 3D82A 4O61A 4AVBA 1REFA 2VTFA 3VBHB 1EV12 2IXCA 2ZGQA 4QHBA 3WDUA 2P37A 5C3QA 4LBQB 4CDQA 1ULCA 1ZA7A 4PIYA 4JAAA 1I5PA 3FLTA 3OCPA 4LT5A 2VUJA 2W1UA 5FLHA 3KV4A 4YGCA 2PXJA 3WUDA 1A6CA 1AL21 3ZSKA 4L0PA 3I2OA 1OVPA 2ZJCA 2MHFA 4QXCA 1NKGA 1E5HA 1IZ3A 1YIPA 1RMU2 1ZBE1 2RM21 2RMU2 1QJY3 2ZPXA 1AR71 1SLCA 4Z82A 4AK3A 1CJDA 4UFJA 1CZVA 3JUUA 2FDHA 3RWKX 2Q4SA 2JKXA 4I0BA 1RTVA 1IOAA 1HN1A 2JIGA 3QBQA 1YRZA 2CL2A 2K9ZA 1S55A 2R042 1V6MA 1WLTA 3AZWA 5D2AA 4CCDA 2MNGA 1W8FA 4QDQA 1GICA 1W03A 3B7MA 5HV4A 5JOYA 1AR92 3ZIXA 4XF3A 1K45A 1C5IA 1Z7S3 1IHMA 4TLGA 4E4ZA 4E8DA 3HWJA 4D7TA 4X8PA 2W87A 1G7YA 1WMXA 1HV0A 2JG9C 1JUIA 4PJYA 1LHOA 1XNAA 4NJ4A 1S1AA 4AAXA 2VNGA 4OHZA 2SBAA 4YW6A 1CAUB 4WVVA 2JDPA 4UFHA 1AYM3 2ZTNA 1TZOA 5A6XA 1ND2A 3HPNA 3JU9A 1ZRCA 1GP4A 3LD8A 5FXXA 2WA4A 4FFFA 4IDZA 4GMP1 2RS13 4WM7A 3ZFEC 3OPWA 3OUIA 4P14A 1QGLA 4QQ2A 4AFMA 5C6CA 1COV3 3T0BA 4CUCA 2VMGA 1UZWA 4CDUC 1RMU1 4M4PA 2J1UA 3P3PA 1MS8A 4BK4A 1VRBA 1QHDA 1H9PA 2YGMA 4BH9A 3WOGA 3ZO0B 4CYDA 2VG9A 1NCQC 1WWYA 4RR3C 3MPPG 1RXFA 4C0HA 3BGAA 1V6NA 3ZXAC 5C8WA 2ZAAA 1A78A 5JWPA 1UZ0A 1NUKA 1RUC2 2X5IB 3JB8A 4KWUA 2GNTA 5A3PA 5IVVA 2RDRA 1ND3B 4NPLA 1GZWA 4AHXA 4Q4Y2 1NY71 1RUG1 2JE7A 3N9LA 4XE9A 5CFCA 1ZZCA 3ST7A 2AEYA 2C6SA 2ZABA 2GMEA 3IBMA 4QPGB 2YYOA 2G9FA 1NX9A 1YC61 2PHDA 1IS3A 3M3EA 3NAPA 5FREA 3LSEA 1IQAA 4MG2A 1H6YA 3GDBA 4AEKA 1EPWA 1VBE2 2EA7A 1AR93 4Y33A 1JYXA 1PO21 3VL9A 5L9VA 5LK5A 1FYUA 4YM1A 3VBOC 1NE4A 2A71A 1GNHA 2VBPA 2ERFA 3R05A 4QAWA 5F39A 5A32B 1GLHA 4EN9B 4Y3OA 2CDOA 4W6XA 5D8AB 5ABJA 3WW3A 3BIEA 3MIFA 1B35B 2V73A 3ZSEA 1FV2A 4AW7A 4IEPA 4JHTA 3GALA 3ES1A 3PHMA 1IKPA 5FDBA 2GH8A 4QPIB 2PN5A 1PIV3 3D0JA 4F3JA 2HBTA 1BZWA 1PZ9A 2YUEA 3SKJE 4FAHA 1RVF2 2YBSA 3VBUA 3ZPYA 5FQ0B 1R64A 4YW7A 1CONA 5FFOC 2A5ZA 1SG3A 5CFDA 2WNUC 3WNPA 2WL1A 3GHMA 2WINB 2J1VA 3CJXA 3GCXA 3KT7A 1Z7S1 3NVCA 3WEZA 4I0WB 1JZ3A 2V4VA 1W8HA 1VAVA 3DYMA 4EN6B 5K0UB 2F4PA 4EN8B 3ALQA 2VM9A 5J09A 3O1TA 2FD8A 3K51A 1IKQA 3MICA 4MGSA 1VLNA 1X33A 4ZS3A 4DRRA 5A7SA 5FXVA 4PHZA 1OA2A 1OOPB 2WR9A 4AVVA 3NKGA 4Q0PA 3PURA 2ORZA 4LPLA 4P9LA 2CGOA 5ERLA 1DIWA 5FP9A 3ZN6B 2QQVA 2OZ6A 4RQPA 3LF7A 4HN1A 4BK5A 1NLRA 3T2OA 2G1MA 4J25A 1OXCA 2OZJA 4NPRA 1YQ8A 2B39A 4NAMA 1O3TA 1C3HA 4LTAA 2FQPA 4YNIA 1G9BA 3PVBB 1MZ6A 3RYRA 3ECQA 2ZZQA 4QX2A 2YROA 5C3SA 1VBC1 3K2OA 1N1SA 1OLQA 1R091 1WMDA 4YM2A 2ZKNA 2PHFA 1AUYA 5KHJA 5FP7A 2WT2A 3EHKA 1UXXX 5A3NA 1S0IA 5ACA1 1QJFA 4I01A 3BB6A 3O14A 3H1MA 4S2GA 3PTYA 2PHWA 4JQRA 3MZHA 2FDFA 3VL8A 4G3YC 4FOYA 1DGWA 2E7AA 1RVF1 4O9EA 3MYXA 3O1UA 1FXZA 3VZMA 2Y8KA 3HNYM 5FPZA 3PUSA 4RS5B 2TEPA 4Y1VA 3K46A 5ABJC 5T3NA 1R1A2 1QXRA 1RUC3 3WF0A 4ZZ5A 2DUOA 1UYPA 4CP1A 5GKAC 2RV9A 1DF0A 3BN6A 1U5YA 2WWUA 1RUJ2 4IUGA 1HQWA 3O1MA 2BNOA 1UD1A 4TN7A 3U78A 3VBUC 2D6PA 3ZFFA 1QF3A 1KRIA 1UU5A 4A41A 5EXOA 5FJHA 2DFCA 2ET1A 5GZGA 3A23A 4MSVA 5LA9A 3ZSJA 4OI4A 4CDXB 4Z1VA 2Z42A 3A7QA 3AMMA 4QHZA 2BUKA 1UKRA 3BUCA 1EPZA 1RUF3 4ZZ8A 3POGA 2XHKA 1ULEA 1P8JA 1NAEA 2XONA 4K8RB 5T50A 2VU9A 3VHNA 2B8MA 1C5HA 1VPHA 1Y9MA 3NRUA 2LM3A 1YNAA 3HT1A 3K3NA 4FPCA 4N7IA 1C8M3 1FNZA 2VW0A 3AKQA 3ZFGB 2HJIA 4AGVA 3KMHA 4LHLA 1RUH3 5JZGA 3VD5A 4AGRA 4IEOA 3TYJA 3O0XA 2DVAA 1JS9A 3KT4A 5FQ0A 4D0QA 2AC1A 4Z2WA 2A1XA 5F5IA 1CAWA 2QTWB 2X10A 5C33A 4FXKB 4LIUA 4HVOA 4QQOA 3FWEA 3RMYA 3RMXA 1QDCA 2TNFA 4DXTA 1UAIA 2VMEA 1WCDJ 4GD4A 4XBQA 5AC93 5IAVA 2I2SA 1EAH3 2Q0AA 2WUHA 1D2QA 2EIDA 2PAMA 3N9NA 3NNLA 3WW1A 3AB0A 2D97A 3ME2A 5L9RA 5C3PA 5EP9A 3KF5A 3KV9A 3O1RA 5FMBA 2ID4A 1L7LA 2IXHA 1QJX1 2HEWF 4ZU7A 1PM4A 3R6SA 3HT2A 1ENRA 4B29A 5IAXA 3VD4A 4C1XA 4E2GA 5JAXA 1GKBA 2F17A 2CWMA 1R083 1AR62 1N1YA 3C7FA 4RL7A 3LEMA 5LK7B 1ZRDA 2BNMA 1HKDA 1N1TA 3J7LA 3ACLA 3T2TA 5FPAA 4BIFA 5DUWA 4E8CA 3SLIA 1LTEA 1T2XA 4HL0A 5CFCB 3O0VA 3H3UA 3VBUB 4LR4A 5GALA 5BUVA 2KXLA 5LRSA 5ACA3 4FOQA 1ASJ2 5IK4A 1KDKA 5CU1A 3ZFFB 1PGSA 4C90A 2K0GA 1JZ4A 5I93A 4YARA 4PI2A 1T6BX 2F6BA 3ZSMA 4XHBA 1MS9A 3TEYA 4XJ8A 1QNYA 2VZ1A 2Z5WA 3WLUA 2F4LA 3M3CA 5HV0A 3H0OA 3F95A 1AR61 4UF0A 2J7MA 4K20A 2QDNA 4QX8A 4RS5C 5ABJB 5L7OA 5K8SA 1G9FA 3OD4A 1SPPB 4IE7A 4JGYC 1X9PA 5I8YA 5IFTA 5L7OC 2VMCA 4YVWC 5EFUA 3LA7A 1RUOA 3ZN6A 3C8XA 3H3LA 3H1WA 3TEZA 4M3CA 2BU9A 3AL6A 2XQXA 3NAPC 4DUWA 4LULA 4DOUA 4TZDA 5FZ9A 4XJ9A 4XFHA 1TNFA 4IEXA 1YXWA 3AKTA 5C4WC 3M3OA 1GZWB 1H2MA 4MZUA 4ZY9A 3IIIA 4KH9A 5G04L 1N47A 1V6LA 3FN9A 2WWSA 1CIWA 4LBJA 4QDSA 2QQJA 3AMQA 1SBEA 3K77A 1IGOA 4XJUA 3ZYPA 2BP6A 2NQYA 3K48A 3WSOA 4M3CB 2GP5A 1EY2A 2WZ8A 3ILNA 3VBFB 4AWDA 3BTYA 3FL7A 5ISLA 4OQ8A 1DGRA 1DZQA 4OHWA 1E5IA 3QOPA 4FPLA 3ZVXA 1J59A 5T55A 2VCAA 5CBLA 4PT6A 4UFKA 3IDAA 1X8MA 2DFBA 4GA9A 4CVUA 1CAWB 1VBA3 4W50A 5I0UA 3VBFA 1BQPA 3IIAA 2D3PA 4XDQA 1R092 1SFNA 2ZGUA 5KHGA 2LW8A 2R061 2PHTA 3OYWB 4RHV1 4ASMB 3NV2A 4LO6B 1GBGA 4EE2A 4NROA 1W8OA 3AYDA 4G4FA 3ZFGA 1I9RA 4EV0A 1SBFA 4RD7A 4AVSA 5A32A 3USUB 2VVDA 2WAAA 2D6NA 1JH5A 4EZ4A 5K0UC 3B93A 4DMIA 4S2HA 4EJRA 2ZX0A 3T09A 2Z4FA 1MS5A 1Z7S2 3FX3A 2PAEA 4CPBA 3MEPA 4E27A 5F5CA 1PVXA 4EZHA 5FPLA 2DYCA 4JTNA 1OPOA 1LOGA 3U10A 1I1EA 3VDCA 4GJYA 3UESA 2TBVA 4GH4A 4UW6A 3SCFA 2O8QA 2R1DA 3ZM8A 2DVFA 3EQEA 3MI8A 3THPA 2AZ5A 3POSA 4HFSA 5FWJA 4P08A 5D8AC 1YHFA 2D3RA 5FLJA 3LFIA 2Z69A 1CX1A 2IXIA 4NWVA 5AVPA 1GFF2 1OD3A 3RRDA 1MQTB 3B9IA 5J7MA 1RMU3 5BXXA 5IK7A 3HJRA 3Q9OA 3VHRA 3U11A 4LXLA 3W9AA 3VKFC 2ZEYA 2D98A 4I3GA 4YZ1A 4JZRA 4KBBA 3P6BA 4Q4W1 4Z07A 4CRQA 4M00A 5KHIA 4I30A 1W8WA 1AR73 5FMCA 2ET7A 2CTVA 3AZXA 4HVRA 1LRHA 1GOHA 2XUEA 1RITA 2ZMNA 3FHQA 4OCTA 1H9WA 2WZR3 3N9OA 1UX7A 1VBA2 1NCQB 4CDXA 1O3SA 3A21A 4JQTA 5KBFA 5J1XA 5FIXA 3N3HA 1VBD1 1MS0A 5SV8A 4CCKA 4S2DA 2ZKLA 3LDBA 1O59A 3HIFA 4XBLA 5I0SA 4J1XA 1IQDC 5HCHA 3ZKYA 2X8KA 4QDRA 4WM8C 2VBDA 1FOD3 1HRI2 1ULDA 5DAQA 5JLVA 5FY9A 1W6OB 1KS5A 2OVUA 3PUIA 4A7ZA 1CD3G 2VQTA 4YZ4A 5FK8A 3ZFEB 3DN7A 1K5MC 4FTBA 5EPAA 4AEDC 2HWD1 4NHYA 4FPKA 1EUTA 5C7GA 1OH3A 1RUI2 1XYOA 1YQCA 2HWB2 2QCSB 3MIBA 1S0DA 3HN3A 3JD73 2FCTA 2NN8A 1RL3A 3CDZB 3NJXA 4LO5B 2DCJA 4XF4A 5HPOA 3WP5A 4WBBA 1H8TB 1SLBA 2XVLA 3AXDA 5BNQA 4AFCA 1VR3A 4NN0A 2Z2SB 1TME1 5G05L 4K9SA 4C91A 3KSCA 1MEC2 3WF4A 4MVTA 2XJUA 4BQXA 3I8TA 3MBWA 4M01A 3WW4A 1MQTC 2XJRA 2Y60A 1RUC1 4BU2A 4N43A 3EJKA 5LRRA 5CG9A 5FYZA 5A7PA 2VD7A 2XJVA 1RIRA 4ZU5A 5APAA 3I2KA 2VOWA 4XZPA 4COZA 4MGYE 4RN5A 4RR3A 3THDA 3TB0A 4DEQA 4NIHA 4BPZA 1XNBA 3I2DA 4Y24A 2VUDA 1IS5A 2NM1A 1GWLA 4DIQA 4MHUA 5I91A 3H1YA 4P5HA 5JMCA 2BQPA 1VB4A 3PUHA 1AR72 2Y6HA 3M7AA 1W0PA 4A3ZA 2W1SA 5DPNA 3T1LA 4O9GA 2PHUA 1WCSA 3PDQA 4GULA 5FYHA 3FE5A 2G19A 5C3RA 2VZSA 4MXWA 4GB33 3T0AA 2Y34A 4YW4A 5FLIA 1LAJA 3WY6A 3IWZA 2VULA 3MDPA 3LAGA 5A6QA 2CV6A 4C0BA 4AQ6A 1QJY1 2WT0A 1C8M1 2ZCWA 3PUAA 4N8MA 4DRVA 1W6PB 5BYNA 3T1MA 3HEIA 3EXUA 2VZUA 4M3CE 3BIWE 3L2YA 1BLZA 1PMJX 1OSGA 5DUVA 1NXMA 3B69A 4LMFA 3LGRA 2EICA 3W59A 3WINE 3J9SA 4AF9A 4DB5A 5FBZA 1HB3A 4LA2A 2UYAA 4OFGA 2E6VA 3DV8A 3N7JA 2EXHA 5FAXA 4DO0A 1ULGA 2Y6GA 3M8LA 5A1LA 4RFT0 5AFBA 4QB6A 1IS6A 3LEIA 3AVSA 1FPN2 3NWKA 4Y5TA 1H8TC 3RZLA 1C8M2 1JN2P 4Q4W3 5EYXA 1H2KA 3KT1A 4AFAA 3O1PA 5F7UA 3VZOA 1SLTA 3OF1A 2P4EA 3HVDA 4XDPA 5FPBA 3WX5A 4MUVA 2WRAA 1XNDA 3C7GA 3I7DA 1JU3A 1GP5A 4YW1A 1K5MB 4JVAA 3CMGA 3AFKA 3U0ZA 4QT6A 2WT1A 4MGQA 1ONAA 4YFZA 2ENRA 2B9UA 4JCKA 4JHZA 2GP3A 2ZGPA 4LKFA 4Q1RA 3NAPB 3U75A 2GSYA 4HPKB 3WF3A 3URFA 2R071 4AG4A 4WM8B 5HCAA 3W5NA 1WCQA 3RGBA 2W1WA 3QH6A 3RZJA 5IT6A 4UFIA 3SH3A 5KC6A 3SQOA 1LHUA 1U5ZA 1W2TA 2A3WA 3BU7A 1NA1A 4D6RA 5DMYA 2X5IA 2R043 2VL4A 3VKOA 1PGL1 2E9QA 2X29A 2ZHKA 3I54A 4Q4X1 3K4DA 3H8OA 4A4AA 1SLIA 3VDAA 2FDIA 3R0RA 4GB32 1ST8A 4PLMA 3KV5A 3S7IA 2YC2A 2AGSA 4QGMA 3KB5A 1D7PM 3VLBB 4GQ7A 2FZ1A 3S5AA 3V0BA 5E1RA 3T0DA 3N35A 5CFCC 1ZX5A 2VNOA 1UPIA 2CU5A 1NE6A 5FMOS 5FZ1A 1TME3 2EAAA 5A33B 2HWC1 2GDFA 2P2KA 1QJY2 1ZBA2 2RS31 1HV1A 2WNOA 5DDJ2 4CUAA 5FKBA 3WDYA 4OYUA 4URTA 3WDVA 3X29B 3BOWA 2VQ0A 3LSDA 4FO9A 3NW4A 4R9CA 4XUTA 3ZXEA 3EMRA 5BY5A 3WQ1A 1FOD2 1HRI3 2A6VA 1KFUL 5IYYA 4NPMA 1C1LA 2W52A 3AK0A 1RGSA 5EJ3A 2QBXA 4A44A 3GZAA 4AVAA 2ZS6B 4JGYA 4L8QA 4A3XA 1IPSA 3ZXFA 4LORA 1FPN1 2ZX4A 2DVBA 3E5XA 2XBO2 2GZWA 1L7RA 1OUSA 4GMP0 1PVC1 1PIV1 1DFQA 2R063 3FUOA 1OMIA 2R49A 2VO5A 4LE4A 3SC7X 3ZX7A 5C9AA 1WD3A 5CFDC 4AEDA 2IWGB 2FDGA 5FZIA 3ZFGC 2R7EB 4QM8A 3DGTA 4HONA 3J26N 1G9DA 5FO8B 1OF3A 1UPSA 4L9BA 4LOSA 3VUOA 2J1EA 1ENXA 2AUYA 3N36A 3AP9A 3ZSLA 1OUXA 1ZRFA 2PAKA 3BCWA 1T6GC 2R16A 2RDSA 5FYIA 1TME2 3WG4A 1PO11 4S2FA 1VMHA 4BA6A 4LHKA 3W20A 4MADA 4HETA 2CAUA 3UJOA 4CDXC 3WT3A 4XXAA 1CIYA 2D40A 5FKCA 3S30A 1QJX2 5AFEA 5L19A 4XURA 4WM8A 1SBDA 1OQ1A 3MUY1 4ZXKA 1EUUA 4KWKA 2NP0A 1OPMA 1ACCA 2WJSA 2GAUA 4EYUA 2ZGRA 2QQPA 2P3KA 3J4UH 3P5BA 5FXZA 1HRV3 3UGFA 4ATFA 1LEDA 1Q8QA 1OF4A 1REEA 1S2KA 1X7NA 2P6CA 3D6EA 1W9TA 4R8HA 3DXTA 2VXRA 2YBKA 1LGNA 4CSWA 1OLMA 3AXEA 4D6SA 2X09A 5FUIA 2C9KA 3WNOA 3AKPA 4FTSA 4YFWA 1H2NA 2D6LX 2A70A 4UFLA 2P1BA 5I0RA 2O14A 3APBA 4CCNA 2QQWA 3AYAA 2WDBA 1NG0A 1ASJ3 3OGVA 1DGWX 5L7OB 2GH2A 4Z8BA 5A80A 4JGYB 3WV6A 1E5RA 1D2SA 4Q26A 2X53S 3V65A 3L9JT 4B7KA 2AH2A 5JXJA 4XVHA 1HRV1 1PM7A 2OKXA 3JBG3 4YW2A 4NRPA 1W6MA 3VKNA 3S0MA 3TBDA 3UYJA 4A7YA 2RS53 4O65A 2GC3A 3RDIA 2UU8A 3DKWA 3ZFFC 1OA3A 2ZHLA 4PQQA 5IVCA 5IW0A 2C9AA 2ZGOA 1HIXA 3AX4A 2WNVB 1QQP1 4H14A 4KL1A 4N53A 4DUXA 1ZBE3 2RM23 3LDRA 1EAH2 4I2OA 3I59A 3DECA 2HYKA 2ZHMA 1Q8SA 4QX5A 4AI8A 2XJSA 2E63A 4W6WA 1LOAA 3Q8EA 1AJKA 3GNEA 1OOPC 2W3JA 3IAQA 1GNZA 1ENQA 1VE0A 3HQXA 3MW4A 4IE0A 4L11A 5F6KA 2QQMA 4K1ZA 5A7OA 4XETA 3ZDSA 4AE2A 2WO3A 5FPVA 3KM5A 2OQ6A 4DZGA 2IXJA 3VBRA 2P6HA 1XC6A 3NKTA 4OI2A 1GP6A 2XLAA 2EIEA 4EWAA 1D4VB 3BVCA 3PNAA 5FMDA 4IE5A 5FZ8A 5LY1A 2WO7A 3SNMA 1W39A 1WMEA 1ZZ8A 2A6XA 3ZYRA 4KWJA 2BV4A 2D7FA 2D5HA 2UY9A 3HBKA 3I3QA 4MYEA 5DAVA 2BNNA 4CDUA 5JIUA 4IQPA 4JV4A 1MS3A 5FZOB 3C7OA 4IXLA 4BOWA 4Q0UA 4KU7A 1S0GA 2JDZA 3Q8FA 4QPIC 4HPKA 1F15A 4XFBA 3KLSA 1ZBE2 2RM22 3AYCA 1Q8PA 1FX5A 3D5OA 4PLOA 1JW6A 1TQ5A 2RMU1 4X6RB 3LEKA 2YPJA 3AFGA 5FP3A 4CDWC 1CPNA 3ACIA 3CEWA 4IGQA 3VHOA 1PO22 1FAYA 1OURA 1V6KA 1XJAA 1C1FA 2QE3A 2YY1A 1A8MA 1GUIA 3D3AA 4LO7A 4Y22B 4D69A 3RZHA 1DBNA 3B00A 2GC2A 5T5LA 3DKQA 4B3NA 1JMUB 1OLME 3T2QA 3I2FA 4XTPA 3HOBA 5LEJA 5JR7B 4YLZA 1AYM2 4HANA 5FZ6A 2HWC2 1JBCA 5C9AB 2VMIA 1W6NA 4QX3A 1K42A 1GSLA 1HX6A 1V6OA 2JD9A 3CZJA 1GZ9A 4JKKA 4QPGC 4RYDA 4D7SA 1EP0A 5JXIA 4XJAA 1PX4A 1YFYA 2AR6A 2RR12 4QPGA 5CEHA 5FZ4A 4E4SA 3VD7A 5IHRA 3CU7A 1XBFA 4V1PA 2DDUA 4Y4YA 2CHHA 3N9QA 3BTAA 2RDQA 4WVZA 4RGAA 3DYOA 3AYEA 3M70A 3D4KA 1R1A1 5DZFA 2D44A 3KGLA 2ZX2A 2FCUA 2JE8A 3ATGA 1AX1A 2XBO1 3H8RA 5FYUA 3AL5A 4CDUB 4BWOA 1F4HA 2G9ZA 2OX0A 3FFZA 2W9XA 2CNAA 5A7QA 4MGZE 2W1QA 1AVBA 4JRAA 2VQUA 3R4UA 2QQKA 4UW3A 1H1IA 1S0EA 3OGSA 3V56A 3B01A 1I6XA 1AXZA 5IVEA 3PJYA 4HKWA 4UBHA 5LCWL 2YU2A 4OULA 1TMF3 3LPFA 4W8JA 5HBAA 2JEMA 3NJZA 5KC5A 3T08A 4EWDA 3PMSA 1GYKA 4TYSA 4QD2A 4Y22A 4QXBA 3T3YA 5FOJB 5ANQA 3E5QA 3OD0A 5JI7A 1DGRN 2IXKA 3JCIA 4LOTA 1XPWA 5KXCA 4QMAA 5LBFA 4ZXEA 3O1SA 2XJQA 2G9GA 2ZGNA 1OFSA 2QQOA 1JXNA 4KGQA 5DAXA 1RUD2 3WG3A 2PLV1 1QQP3 1YFWA 4IEQA 3RS6A 3VGIA 3Q8BA 1RUI1 2HWB1 3O12A 4AVCA 4CUBA 1QJEA 4PF5A 4HT1T 1VBB1 4FQZA 2VZVA 1ULFA 3Q8AA 2R6QA 1PO13 4OZXA 1S0CA 1YCIA 2SLIA 3MO4A 4A7KA 3ZKUA 4QKFA 4BQ1A 1QOSA 2MEV1 3N7MA 4P9YA 1LULA 3RG0A 1BEV3 5FZKA 1BBT2 1OA4A 4QQLA 5DAPA 2A6WA 4CE8A 3RZGA 2W0XA 4RHV3 1CGPA 5J48A 2GNMA 2WABA 4FPEA 4LLFA 5E6HA 3ETQA 2ZMKA 4JRLA 2RS11 5T5PA 4FQ4A 4BLIA 3FHIB 1QIQA 3J7HA 4TLFA 3UGGA 2CY6A 3ZFEA 2LROA 3T4HB 1D4M2 4D8MA 1W6OA 2BBVA 2IZWA 1AR83 1VAKA 4O7XA 2J1RA 3FJSA 2P3JA 3L2HA 1YJLA 2QZ3A 4BHPA 4H55A 4XJWA 3CIHA 3WQBA 1QH6A 1B35A 1HRV2 3TOJA 5JIAA 3UGHA 1HXS2 2WS91 1ZREA 1B35C 5FZHA 5FWEA 1UOJA 1QY4A 1R093 2L9LA 2Q1FA 4FFIA 4QX0A 5D1IA 3TN93 4AI9A 5GZCA 2LALA 5FY4A 3VDDA 1VIWB 4RS5A 3J8F1 1EV11 1U5IA 4UWDA 3VBHC 3AZZA 3VBOB 1RUJ3 2VUCA 3GHNA 4OLLA 1QQP2 5JOXA 5AC91 2VQAA 3VD3A 4LUMA 3GJAA 4FPGA 2JDYA 2D93A 1PMIA 1AL22 3U4XA 1SFPA 5LASA 4JKMA 4KI5M 3TAYA 3RI9A 1UL9A 1BK0A 4Q4X2 5A3LA 2EVXA 2Q1MA 2D6MA 4QQHA 1XQNA 3USUA 1HXS1 2CWSA 2WS92 3ZN5A 1S2BA 1US2A 3T30A 2UURA 1GZCA 2BTVC 3ABZA 2UWCA 2LRPA 4A6OA 3INAA 4B1LA 4YSFA 3ITQA 3LOIA 1CAXB 2E32A 4AEDB 2QKDA 5JPNB 4IV3C 3WHUA 2JJ6A 1JZ2A 3M1HA 1W3VA 4IV3A 4LA3A 4YGEA 1UY2A 2ZGLA 2VPVA 1QNWA 2QDRA 4MHRA 1D4M1 2VW1A 3WR0A 4BM8A 1W8TA 3MGUA 1YYNA 4CCLA 4QGLA 5BNPC 2GMMA 2R0FA 4IW3A 4XFFA 3V0AB 3ETPA 2Q8DA 1J3PA 3AZVA 5IVJA 1W6MB 3I3MA 1BBT1 1FOD1 4H3WA 1KDMA 4WZCA 2Q8OA 1ULPA 2PA7A 2J22A 2ZACA 3JB4C 1VMFA 2VZPA 4HOOA 5A3UA 4AI1A 1JTZX 1C57A 1YQ6A 1RHI1 2HWD3 1MEC1 4TXWA 4XFGA 4NRMA 2EXJA 3MW3A 2LS6A 2UY8A 4XQWA 1GWKA 5EZWA 2JECA 5DAWA 4AXOA 2ATFA 1AXKA 4HKOA 4Y4RA 4FTEA 4NHMA 1XU1A 3V64A 1W6QA 4W65A 1X8EA 4HK9A 1Y9GA 4NIIA 4BQYA 1W0OA 2E53A 4UF0B 3PL0A 4E4DX 4G9SB 1PO23 3LDKA 2RJLA 3N7KA 1W9WA 1XOYA 2VZQA 1XU2A 3AP5A 5CB7A 3MV11 2NMNA 4B7EA 4LHSA 4AYUA 2FHRA 4GWJA 4QU2A 2Z79A 3ZXGA 2R041 3AMHA 4XQ4A 2B7YA 5AC92 1XNKA 1UY1A 2UWBA 3FHAA 3WXPA 4AQSA 3CKHA 3VDBA 1CZTA 1Z78A 3OG2A 2JX9A 4KGGA 1Q43A 4BQ2A 5K9YA 4HSJA 3WNXA 4GAZA 4OZOA 4NIGA 1W04A 2BRTA 4IEWA 2VC9A 3OGGA 2Y6JA 3BALA 4DFSA 4XUNA 2GU9A 3IMNA 5JSPA 1URXA 2YU1A 4FFGA 3USSA 1EYBA 1TEIA 2HLEA 5EYYA 1SDWA 1XE7A 3P3NA 4GIQA 5JCTA 1GQPA 3H7YA 3OYWA 2C0ZA 2RJKA 4Q8LA 2VOKA 1ALYA 1WLWA 3HAGA 4IERA 4CP2A 1LHWA 2VNRA 5HCFA 1AYN3 5CG8A 3IT8A 5GLUA 3AKRA 5HXVA 4CEWC 1O8SA 3ZYIB 1X9TA 2Q8CA 1SACA 3LWCA 4K21A 2JDHA 2WKKA 1ZRIA 4DEVA 4ES9A 1RUH2 2QVSB 2OXBA 3SCGA 1AZDA 1MPXA 1UU6A 3NNFA 3IN9A 2QFEA 5FO9B 4MXVA 1UIKA 4OUEA 3CJIB 3VBFC 1W28A 1VRH1 1UMZA 1Z0HA 2YV8A 4OI1A 2IXLA 4HZFA 3LB9A 4Q8KA 4ATEA 1KGYA 3B94A 4ARYA 4M3CF 3VKMA 1V6JA 3E5UA 1SLAA 1VB2A 1ZZ7A 2ZZJA 3MIHA 4KWLA 1PK6A 2PLV3 5GLVA 4YZ3A 1GQGA 2HEYF 3WNNA 4EWEA 1VBC3 5C4WB 1JYTA 3VBSA 1LU2A 5JPMB 1J83A 3NV3A 5CIRA 1QDOA 5FZMA 5LA2A 1JOJA 2NPIA 1TNRA 1LOBA 4BQ5A 1OH4A 2E7TA 4NUBA 1U12A 1MQTA 2PTMA 2Y64A 4CP9B 4RGKA 1KQRA 1JOPA 1WLDA 3V0BB 5T54A 4YVWB 1SHWB 4OQ9A 4LK7A 4XFCA 4M4RA 1CESA 4BIOA 3RZZA 3WNLA 2C5DA 1RJ8A 2HH9A 3ZDVA 2FDJA 4AL9A 1YI7A 4KG0A 3IDBB 2WQ8A 3FFQA 4E9KA 4XF1A 2RS52 4Q4W2 1F2NA 2J1SA 1W6PA 3IDCB 3RI8A 3FLPA 4V2WA 4B4PA 1C8NA 1HQLA 1FATA 1H6XA 4CTEA 2W2IA 5C3OA 5C5TA 5GLTA 2B42B 2XB6C 4YYOA 1TG7A 4MGTA 3I2IA 3RQ0A 3O0WA 5DDJ1 1DYOA 3TN91 2XPJA 5DZEA 2A6ZA 3ZPOA 3U14A 1WBFA 4HSLA 5H9QA 1XSQA 3DEMA 4XFAA 4YVSA 5EJZB 1KJRA 2O0OA 2DU0A 4N7UA 1DQ4A 3T4VA 1H4GA 1OKOA 3OBZA 4QQPA 4W4ZA 3UNPA 3IPVA 2WYFA 3OTFA 3C3VA 3AZYA 1S4CA 2XWBB 2QQLA 3KZ4C 1H8VA 4UI9L 3RNSA 4YM3A 1RUNA 5FXWA 1DCSA 1PMHX 1JU4A 1DG6A 1CN1A 1WW7A 3MW2A 3W21A 4BMEA 1W6QB 2GNBA 2DCYA 3FLRA 1RUH1 1LHVA 4DXRA 1ZVFA 3AP6A 1JZ8A 2W68A 5FZGA 3MIGA 3WNMA 4RA0A 4B4RA 3KV6A 2Y0IA 5FZEA 4ITCA 3SKVA 4Y5Z0 3THCA 3CQOA 2E31A 4KU8A 1O3RA 2IUWA 2HYXA 2ZAHA 3NNJA 3PVOA 3MPBA 4QKBA 2R0HA 2YMZA 4OHXA 4PQ9A 5L73A 1DZTA 4FXGB 1J58A 1WCUA 2XJPA 3O5SA 4XUOA 1D4M3 2A75A 2NZ9A 3IZOA 4LIVA 3UETA 1GWMA 3LIHA 4BISA 1JYCA 3POFA 5E88A 1BVP1 1POV1 3KCXA 3CJIA 4FCAA 4ES8A 2OS2A 2D3SA 3I49A 5F32A 4CXYA 2RE9A 2JG8B 3WDTA 1N3PA 1QJU3 1RUE2 4R4ZA 4KBZA 3ZN4A 4GJZA 3WP4A 5JVVA 3ZR6A 2HWF3 2WBKA 2RR13 5M0TA 3POBA 3O1VA 3TN92 2BYVE 5DG2A 3Q8CA 4LEJA 1PO12 5KHHA 2Y6LA 4CU6A 1ENSA 1HB2A 3PIGA 5A1FA 3QLQA 4PDWC 3NV4A 3UJQA 2ES3A 1QJU2 1AX2A 1FMD3 1RUE3 2C24A 1WA6X 2JWPA 3RVHA 2PQSA 4ZHNA 5F6LB 4A42A 3DYPA 4JGZA 3LPGA 4FOWA 1LHNA 1WGPA 2P17A 4WZFA 1YEWA 2D6KA 4P9XA 4PF1A 4YWAA 1HJFA 1O91A 3LOBA 2VY0A 4YVSB 5FMOL 2R1BA 1RUI3 2HWB3 4META 2GC1A 5J36A 5D21A 2W5FA 3PIJA 2HWF1 1WZXA 2IVJA 2YBPA 1JYWA 2BVVA 4Q0VA 1W99A 2BWAA 2VCCA 2HWE1 4K40A 5FY0A 1JHJA 1UOGA 2CDPA 3GBFA 4OHVA 1WW6A 2DUPA 3E97A 4XXPA 2DTYA 4FPOB 2WLPA 3POJA 1ULOA 5F5QA 5E89A 5EWSA 3RJRA 1ASJ1 2QQUA 1W2AX 1CPMA 3O1OA 3VD9A 4CCMA 1L7QA 4K1YA 3D0SA 1UY3A 4XHXA 1UQXA 3RPQA 3JQWA 4R9AA 2IFWA 1J1TA 1Y3TA 4XUQA 3WP6A 3ZR5A 3BOPA 1ZYBA 4F8AA 3VDDC 5D8AA 1QEXA 3KHCA 5A7NA 3VZJA 5EV7A 3WG2A 2D6OX 4K3UA 4QU1A 2EF6A 2JDNA 3I3DA 5GJ6A 2YZ4A 2WWJA 2XUMA 1W0NA 2RVAA 3BTXA 3AP7A 2B4KA 5DUXA 3VZNA 2VMFA 5FZ0A 5FP4A 1CJPA 2W46A 2WIIB 4HLTA 4MO3M 4AGGA 1OBNA 3J8F2 4INDA 1BEV2 1GNYA 1PK6C 4CCJA 2WO2A 3THTA 5BNNC 1W2UA 3LQCA 3VBSC 5JSRA 2QJVA 1BMV1 4EQVA 3TEWA 2FBEA 1C28A 3WF1A 4WM7C 4D6QA 3V0AA 2AREA 3IMMA 3JBG2 5IVFA 1UOFA 3PU8A 5CA6A 1ZM1A 3PU3A 1V9U2 2Y6FA 3PLQA 4K7JA 4DXSA 4GB31 4LKDA 4UW4A 4WVMB 2ZX1A 4OI0A 4IESA 2WNUB 1QU0A 3GCWA 1FT9A 3AMNA 4NHLA 5CISA 4ZKTB 3BPZA 3H8XA 1HLCA 2OUJA 1WLCA 3B02A 2BBAA 4QX1A 3KCCA 4XOGA 4F7ZA 3ZYFA 1QJU1 2VMDA 3CZUA 5LA1A 5J96B 3GGLA 5EIYB 2AACA 3HQRA 1HRI1 2KA3A 4Y1ZA 2ADDA 2VUAA 3S57A 3IPVB 1GANA 5J98B 1BK1A 5FPUA 4QB1A 2PELA 4RHV2 2FCVA 4DNYA 2VTXJ 2MEV3 2RMU3 3GZEA 1PK6B 5ACA2 2ARBA 4UOJA 1NCRA 1KITA 1W9SA 1ND2B 2YPDA 2ZMLA 3OBAA 4OMDA 5IVYA 5LATA 3VN4A 3NL1A 2I45A 2P5BA 3D8CA 5EHDA 4L2NA 4XTMA 2JXAA 1RXGA 1OHFA 1UX6A 1W9YA 2VBBA 2WNVA 4IGPA 4N53B 5A3TA 3ES4A 2HWE2 2AEZA 4LLOA 2XL9A 3PTRB 1F4AA 3HR9A 5H9PA 1REDA 3SH5A 2NYYA 2VE1A 4ISRA 3DF0A 1QOTA 4EN7B 2W92A 4DPNA 1UXZA 1ND3C 3E6BA 2GC0A 4E2SA 4D3WA 3IKWA 4GXLA 1BEV1 2X5IC 4MV2A 1MVEA 4P9GA 1UOBA 1LESA 1AL0G 2ARXA 4KNCA 4U2AA 5LBBA 4K8FA 4XAAA
chains in the Genus database with same CATH topology
3DYOA 2JE8A 5IFTA 2VMCA 3LE0A 1F4HA 3C8XA 1GOGA 2QQNA 2W9XA 2BZDA 2XQXA 4DUWA 2EIBA 4P00B 2W1QA 2VQUA 2QQKA 3OGSA 5B4XA 1K3IA 1O8PA 2XHNA 5LCWL 2W95A 3LPFA 3MUZ1 1UYYA 1XNTA 4W8JA 4ZY9A 4A45A 3IIIA 3T08A 5G04L 3OEAA 1OT5A 3FN9A 4QDSA 2QQJA 3F2ZA 3AC0A 3K77A 2ORXA 3A22A 3WSOA 1XPWA 2B9VA 2WZ8A 3EB7A 4ZXEA 3FL7A 5JXGA 4CU8A 2QQOA 2YFZA 4BDVB 1J84A 4TTGA 5EJ1B 2VCAA 4PT6A 3IDAA 4CUBA 4CVUA 2VZVA 4W50A 5DMYA 3MO4A 5DN2A 1KEXA 2LW8A 2E26A 2VOTA 2J1TA 3MV01 1W8OA 4CU7A 4LKSA 3ACHA 3HNBM 2WAAA 1JZ8A 2C26A 2WABA 5HXMA 3P1IA 3J7HA 3I97A 3T09A 2Z4FA 4D8MA 1UWWA 2J1RA 2YB7A 1UY4A 3E1F1 3CIHA 3WQBA 3I2JA 3VDCA 3UESA 2X05A 3ZM8A 5CYYA 1US3A 4QX0A 2L9LA 1W8NA 2V5DA 4P08A 3GXUA 4GZ9A 5I0DA 4OMCA 1CX1A 1GMMA 3OGRA 1DP0A 4ET7A 3VD3A 1OD3A 2KD7A 4BXSV 3HJRA 2ZEYA 4JKMA 4KI5M 3P6BA 2WN3A 5JMOA 1US2A 1UMIA 3ABZA 3T2PA 1GOHA 2VJXA 3FHQA 4A6OA 2QQIA 3W5MA 4KMQA 1UX7A 2E32A 3GM8A 2YG0A 3A21A 1JZ2A 5J1XA 1UY2A 5JR2A 1O59A 1IQDC 4DUVA 4QDRA 5LA0A 3SEEA 5IJRA 5CZKA 3PUIA 2VQTA 3ETPA 5A1AA 1UY0A 1JZ7A 1ULPA 1EUTA 5C7GA 2J22A 2WAOA 2Y6KA 2VZPA 3ACGA 1LNSA 2YC4A 3HN3A 4TXWA 3NJXA 5HPOA 3CDZB 1WKYA 2DCJA 1PX3A 2LS6A 2E33A 3JXSA 4FI9A 5G05L 3EYPA 3WF4A 3MBWA 3NJVA 5DQ0A 4Z2AA 1UMHA 2VTFA 1W9WA 3I2KA 2VZQA 3MV11 4RN5A 3THDA 4LHSA 4DEQA 4GWJA 1I5PA 1UY1A 3FHAA 3CKHA 2W1UA 3VDBA 1CZTA 3OG2A 3C7HA 2BERA 3K75B 3PUHA 2Y6HA 2W47A 4L0PA 4A3ZA 2W1SA 5DPNA 1NKGA 4OZOA 2VC9A 3OB8A 2Y6JA 2VZSA 4XUNA 3T0AA 2WN2A 3I2GA 1CZVA 3U37A 2HLEA 4HG6B 2JKXA 2V72A 1HN1A 1GQPA 3ACFA 2C4XA 4ARXA 5C70A 2WYSA 1GOFA 4QDQA 3HEIA 2VZUA 3C7EA 1K45A 1O8SA 1PMJX 4E8DA 5JUVA 2EICA 4GWIA 4DEVA 2W87A 1MPXA 2Y6GA 1XNAA 4QB6A 4AAXA 3LEIA 4OUEA 1KGYA 4QPWA 4ARYA 5F7UA 2ZXQA 3HPNA 3I2HA 3WNNA 1SDDB 3C7GA 1JU3A 1J83A 2VZOA 1YQ2A 3CMGA 5LA2A 4MGQA 4LQRA 1DLCA 4JHZA 3WF3A 1CZSA 4AG4A 1OH4A 2W94A 3W5NA 1WCQA 3T0BA 4CUCA 2Y64A 2W1WA 3HNMA 4M4PA 2J1UA 1SHWB 4BK4A 4M4RA 3WNLA 3BGAA 2VL4A 2WQ8A 1UZ0A 3K4DA 1NUKA 3K4AA 4A4AA 2J1SA 4KWUA 3VDAA 2YC2A 3SEPA 1D7PM 1H6XA 3T0DA 1TG7A 1UYXA 1GU3A 3I2IA 1NX9A 2ZEXA 1DYOA 1H6YA 3GDBA 5EJZB 1JYXA 2ZEWA 4W4ZA 4XUPA 3UNPA 4QAWA 4CUAA 2CDOA 4OYUA 1RYYA 2QQLA 4XUTA 4UI9L 1PMHX 5IYYA 1JU4A 1BHGA 4DXRA 2QBXA 4A44A 4P02B 2VZRA 3SKJE 3WNMA 1R64A 3WNPA 1SG3A 1L7RA 3SKVA 3THCA 3CQOA 2J1VA 2E31A 1JZ3A 3WEZA 2HYXA 2VO5A 2V4VA 2BGOA 3DYMA 2VM9A 2BGPA 2R7EB 2VR4A 2XOMA 4MGSA 4XUOA 1OF3A 3UETA 2J1EA 5B4NA 3LEGA 4LPLA 2ORZA 1K12A 4MADA 3IAPA 4MOAA 2VCBA 1CIYA 4BK5A 3T2OA 2WBKA 2VZTA 4XURA 3WNKA 4CU6A 2Y6LA 3MUY1 1EUUA 4JX0A 3ECQA 4QX2A 2PQSA 1OF4A 4A42A 3DYPA 1W9TA 3LPGA 4PF1A 4UAPA 3NNGA 1JYNA 2X09A 1UXXX 5FUIA 2C9KA 3NQHA 3WNOA 4XZUG 5JXHA 2W5FA 2YFUA 1JYWA 2JDAA 2WDBA 1W99A 2VCCA 3OGVA 2Y8KA 1JHJA 2CDPA 1JZ6A 3HNYM 3K46A 1ULOA 1TVGA 3WF0A 4ZZ5A 3I3BA 5JXJA 3VD9A 4XVHA 1UYZA 2OKXA 1L7QA 2RV9A 1UY3A 3BN6A 4XUQA 4IUGA 5IFPA 2WZEA 1JZ5A 5C71A 4PQQA 2ZEZA 4A41A 4DUXA 3I3DA 3A23A 3WF2A 1W0NA 2RVAA 3DECA 4YPJA 2B4KA 3A7QA 2VMFA 2VZ3A 2W46A 3I3EA 4MO3M 4BJ0A 2W3JA 3IAQA 4ZZ8A 1GNYA 1P8JA 1NAEA 2WO2A 2QQMA 2XONA 4JKLA 2WO3A 3LQCA 3NRUA 1JI6A 2WO1A 3WF1A 1XC6A 2EIEA 3IB3A 3VD5A 4DXSA 4D0QA 2J1AA 2X10A 3C7OA 4QX1A 2BBAA 4DXTA 2VMEA 2VMDA 3CZUA 5LA1A 2WUHA 3GGLA 5EIYB 2EIDA 3LEKA 2ID4A 3ACIA 1JYVA 1GUIA 3D3AA 4QB1A 3VD4A 4UOJA 1W9SA 3T2QA 4CU9A 3OBAA 4OMDA 3I2FA 3C7FA 3HOBA 4QB2A 4P5YA 2W91A 4E8CA 4QX3A 1K42A 1T2XA 2JD9A 3CZJA 4JKKA 1F4AA 2DCKA 4RYDA 5JXIA 1PX4A 3K4ZA 3VD7A 5IHRA 1JZ4A 2W92A 1UXZA 2DDUA 2VZ1A 2RJ2A 3OEBA 2J7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYO A;  2JE8 A;  5IFT A;  2VMC A;  3LE0 A;  1F4H A;  3C8X A;  1GOG A;  2QQN A;  2W9X A;  2BZD A;  2XQX A;  4DUW A;  2EIB A;  4P00 B;  2W1Q A;  2VQU A;  2QQK A;  3OGS A;  5B4X A;  1K3I A;  1O8P A;  2XHN A;  5LCW L;  2W95 A;  3LPF A;  3MUZ 1;  1UYY A;  1XNT A;  4W8J A;  4ZY9 A;  4A45 A;  3III A;  3T08 A;  5G04 L;  3OEA A;  1OT5 A;  3FN9 A;  4QDS A;  2QQJ A;  3F2Z A;  3AC0 A;  3K77 A;  2ORX A;  3A22 A;  3WSO A;  1XPW A;  2B9V A;  2WZ8 A;  3EB7 A;  4ZXE A;  3FL7 A;  5JXG A;  4CU8 A;  2QQO A;  2YFZ A;  4BDV B;  1J84 A;  4TTG A;  5EJ1 B;  2VCA A;  4PT6 A;  3IDA A;  4CUB A;  4CVU A;  2VZV A;  4W50 A;  5DMY A;  3MO4 A;  5DN2 A;  1KEX A;  2LW8 A;  2E26 A;  2VOT A;  2J1T A;  3MV0 1;  1W8O A;  4CU7 A;  4LKS A;  3ACH A;  3HNB M;  2WAA A;  1JZ8 A;  2C26 A;  2WAB A;  5HXM A;  3P1I A;  3J7H A;  3I97 A;  3T09 A;  2Z4F A;  4D8M A;  1UWW A;  2J1R A;  2YB7 A;  1UY4 A;  3E1F 1;  3CIH A;  3WQB A;  3I2J A;  3VDC A;  3UES A;  2X05 A;  3ZM8 A;  5CYY A;  1US3 A;  4QX0 A;  2L9L A;  1W8N A;  2V5D A;  4P08 A;  3GXU A;  4GZ9 A;  5I0D A;  4OMC A;  1CX1 A;  1GMM A;  3OGR A;  1DP0 A;  4ET7 A;  3VD3 A;  1OD3 A;  2KD7 A;  4BXS V;  3HJR A;  2ZEY A;  4JKM A;  4KI5 M;  3P6B A;  2WN3 A;  5JMO A;  1US2 A;  1UMI A;  3ABZ A;  3T2P A;  1GOH A;  2VJX A;  3FHQ A;  4A6O A;  2QQI A;  3W5M A;  4KMQ A;  1UX7 A;  2E32 A;  3GM8 A;  2YG0 A;  3A21 A;  1JZ2 A;  5J1X A;  1UY2 A;  5JR2 A;  1O59 A;  1IQD C;  4DUV A;  4QDR A;  5LA0 A;  3SEE A;  5IJR A;  5CZK A;  3PUI A;  2VQT A;  3ETP A;  5A1A A;  1UY0 A;  1JZ7 A;  1ULP A;  1EUT A;  5C7G A;  2J22 A;  2WAO A;  2Y6K A;  2VZP A;  3ACG A;  1LNS A;  2YC4 A;  3HN3 A;  4TXW A;  3NJX A;  5HPO A;  3CDZ B;  1WKY A;  2DCJ A;  1PX3 A;  2LS6 A;  2E33 A;  3JXS A;  4FI9 A;  5G05 L;  3EYP A;  3WF4 A;  3MBW A;  3NJV A;  5DQ0 A;  4Z2A A;  1UMH A;  2VTF A;  1W9W A;  3I2K A;  2VZQ A;  3MV1 1;  4RN5 A;  3THD A;  4LHS A;  4DEQ A;  4GWJ A;  1I5P A;  1UY1 A;  3FHA A;  3CKH A;  2W1U A;  3VDB A;  1CZT A;  3OG2 A;  3C7H A;  2BER A;  3K75 B;  3PUH A;  2Y6H A;  2W47 A;  4L0P A;  4A3Z A;  2W1S A;  5DPN A;  1NKG A;  4OZO A;  2VC9 A;  3OB8 A;  2Y6J A;  2VZS A;  4XUN A;  3T0A A;  2WN2 A;  3I2G A;  1CZV A;  3U37 A;  2HLE A;  4HG6 B;  2JKX A;  2V72 A;  1HN1 A;  1GQP A;  3ACF A;  2C4X A;  4ARX A;  5C70 A;  2WYS A;  1GOF A;  4QDQ A;  3HEI A;  2VZU A;  3C7E A;  1K45 A;  1O8S A;  1PMJ X;  4E8D A;  5JUV A;  2EIC A;  4GWI A;  4DEV A;  2W87 A;  1MPX A;  2Y6G A;  1XNA A;  4QB6 A;  4AAX A;  3LEI A;  4OUE A;  1KGY A;  4QPW A;  4ARY A;  5F7U A;  2ZXQ A;  3HPN A;  3I2H A;  3WNN A;  1SDD B;  3C7G A;  1JU3 A;  1J83 A;  2VZO A;  1YQ2 A;  3CMG A;  5LA2 A;  4MGQ A;  4LQR A;  1DLC A;  4JHZ A;  3WF3 A;  1CZS A;  4AG4 A;  1OH4 A;  2W94 A;  3W5N A;  1WCQ A;  3T0B A;  4CUC A;  2Y64 A;  2W1W A;  3HNM A;  4M4P A;  2J1U A;  1SHW B;  4BK4 A;  4M4R A;  3WNL A;  3BGA A;  2VL4 A;  2WQ8 A;  1UZ0 A;  3K4D A;  1NUK A;  3K4A A;  4A4A A;  2J1S A;  4KWU A;  3VDA A;  2YC2 A;  3SEP A;  1D7P M;  1H6X A;  3T0D A;  1TG7 A;  1UYX A;  1GU3 A;  3I2I A;  1NX9 A;  2ZEX A;  1DYO A;  1H6Y A;  3GDB A;  5EJZ B;  1JYX A;  2ZEW A;  4W4Z A;  4XUP A;  3UNP A;  4QAW A;  4CUA A;  2CDO A;  4OYU A;  1RYY A;  2QQL A;  4XUT A;  4UI9 L;  1PMH X;  5IYY A;  1JU4 A;  1BHG A;  4DXR A;  2QBX A;  4A44 A;  4P02 B;  2VZR A;  3SKJ E;  3WNM A;  1R64 A;  3WNP A;  1SG3 A;  1L7R A;  3SKV A;  3THC A;  3CQO A;  2J1V A;  2E31 A;  1JZ3 A;  3WEZ A;  2HYX A;  2VO5 A;  2V4V A;  2BGO A;  3DYM A;  2VM9 A;  2BGP A;  2R7E B;  2VR4 A;  2XOM A;  4MGS A;  4XUO A;  1OF3 A;  3UET A;  2J1E A;  5B4N A;  3LEG A;  4LPL A;  2ORZ A;  1K12 A;  4MAD A;  3IAP A;  4MOA A;  2VCB A;  1CIY A;  4BK5 A;  3T2O A;  2WBK A;  2VZT A;  4XUR A;  3WNK A;  4CU6 A;  2Y6L A;  3MUY 1;  1EUU A;  4JX0 A;  3ECQ A;  4QX2 A;  2PQS A;  1OF4 A;  4A42 A;  3DYP A;  1W9T A;  3LPG A;  4PF1 A;  4UAP A;  3NNG A;  1JYN A;  2X09 A;  1UXX X;  5FUI A;  2C9K A;  3NQH A;  3WNO A;  4XZU G;  5JXH A;  2W5F A;  2YFU A;  1JYW A;  2JDA A;  2WDB A;  1W99 A;  2VCC A;  3OGV A;  2Y8K A;  1JHJ A;  2CDP A;  1JZ6 A;  3HNY M;  3K46 A;  1ULO A;  1TVG A;  3WF0 A;  4ZZ5 A;  3I3B A;  5JXJ A;  3VD9 A;  4XVH A;  1UYZ A;  2OKX A;  1L7Q A;  2RV9 A;  1UY3 A;  3BN6 A;  4XUQ A;  4IUG A;  5IFP A;  2WZE A;  1JZ5 A;  5C71 A;  4PQQ A;  2ZEZ A;  4A41 A;  4DUX A;  3I3D A;  3A23 A;  3WF2 A;  1W0N A;  2RVA A;  3DEC A;  4YPJ A;  2B4K A;  3A7Q A;  2VMF A;  2VZ3 A;  2W46 A;  3I3E A;  4MO3 M;  4BJ0 A;  2W3J A;  3IAQ A;  4ZZ8 A;  1GNY A;  1P8J A;  1NAE A;  2WO2 A;  2QQM A;  2XON A;  4JKL A;  2WO3 A;  3LQC A;  3NRU A;  1JI6 A;  2WO1 A;  3WF1 A;  1XC6 A;  2EIE A;  3IB3 A;  3VD5 A;  4DXS A;  4D0Q A;  2J1A A;  2X10 A;  3C7O A;  4QX1 A;  2BBA A;  4DXT A;  2VME A;  2VMD A;  3CZU A;  5LA1 A;  2WUH A;  3GGL A;  5EIY B;  2EID A;  3LEK A;  2ID4 A;  3ACI A;  1JYV A;  1GUI A;  3D3A A;  4QB1 A;  3VD4 A;  4UOJ A;  1W9S A;  3T2Q A;  4CU9 A;  3OBA A;  4OMD A;  3I2F A;  3C7F A;  3HOB A;  4QB2 A;  4P5Y A;  2W91 A;  4E8C A;  4QX3 A;  1K42 A;  1T2X A;  2JD9 A;  3CZJ A;  4JKK A;  1F4A A;  2DCK A;  4RYD A;  5JXI A;  1PX4 A;  3K4Z A;  3VD7 A;  5IHR A;  1JZ4 A;  2W92 A;  1UXZ A;  2DDU A;  2VZ1 A;  2RJ2 A;  3OEB A;  2J7M A; 
#chains in the Genus database with same CATH topology
 2BVB A;  1LB2 A;  1O5U A;  4RR3 B;  3M3I A;  3ZYG A;  4QXH A;  2BWC A;  4A2U A;  2QUO A;  3PME A;  1NA1 B;  3LE0 A;  4Q29 A;  2E51 A;  1QXP A;  2JDK A;  2OPW A;  5F9T A;  1QJX 3;  5HCB A;  2PFW A;  3RYP A;  4C8D A;  2A7A A;  2WFF 2;  4C1W A;  1KXG A;  2XBO 3;  2EIB A;  4P00 B;  2RS3 3;  4ZU4 A;  2Q8E A;  1O4Z A;  1KFX L;  2HWE 3;  1OQD A;  5B4X A;  1K3I A;  1UN1 A;  2XHN A;  1APN A;  1AR6 3;  1J1L A;  1R08 2;  4LUK A;  3MUZ 1;  1UYY A;  1XNT A;  3VBO A;  4A45 A;  2DBI A;  5FYY A;  1TE1 B;  1PNF A;  2A3Y A;  2DVG A;  2Y26 A;  3JZV A;  3OEA A;  4CXX A;  5BNO C;  2WZP P;  4XIL A;  1V9U 1;  3F2Z A;  4GAL A;  3QH7 A;  2ORX A;  2A3X A;  3DPR C;  2VOV A;  1PGL 2;  4AFD A;  4PDW B;  5F2S A;  2JE9 A;  4H7L A;  5GLZ A;  5CKN A;  2B9V A;  1JUH A;  2HWC 3;  3AVR A;  3EB7 A;  4IE6 A;  4QWN A;  2R30 A;  3VHP A;  4K6B A;  1X50 A;  2YFZ A;  1R1Z A;  2JG9 B;  4XBN A;  4BDV B;  4CU8 A;  3MLK A;  1CVN A;  1J84 A;  3B5L B;  5JOZ A;  4QPI A;  5FYB A;  2IFR A;  5DG1 A;  2PMW B;  4Z92 B;  1H1A A;  3ASI A;  1RUF 1;  2JIC A;  5LY2 A;  2JG8 C;  3TNQ A;  1HXS 3;  3HMY A;  1CAX A;  3BI3 A;  4AHY A;  4PBO A;  1YIF A;  1G86 A;  2E26 A;  1XYP A;  2VOT A;  1AR9 1;  2PLV 2;  2RS1 2;  4R9D A;  5CNA A;  5T52 A;  4AR2 A;  4L92 A;  1DDL A;  5FZC A;  3ZXK A;  2P34 A;  3KF3 A;  2HWD 2;  4YM0 A;  3WD5 A;  2FZ2 A;  4EN0 A;  1F9K A;  2C26 A;  4FAG A;  1YI9 A;  1XNC A;  4GWN A;  3P1I A;  1RUG 3;  4YG3 A;  3U1X A;  1OFN A;  4WV8 A;  4P9W A;  1V0A A;  5K0U A;  1X82 A;  2FMY A;  2ZOE B;  1JOD A;  2R07 3;  1UY4 A;  2XXZ A;  3E1F 1;  4M0H A;  1HW5 A;  3VV1 A;  4B4Q A;  4UXA A;  5CAZ A;  1UW8 A;  3I2J A;  5FRA A;  1QH7 A;  2X05 A;  2K2S A;  4M0N A;  2AYH A;  2JD4 A;  1SMV A;  2OUH A;  4IV1 A;  1N3Q A;  5CYY A;  1US3 A;  3OPZ A;  5IWF A;  4XAC A;  4GH4 C;  4YZ2 A;  4ERO A;  3VBH A;  3M2M A;  1W8N A;  1YQ5 A;  1YLL A;  1BVV A;  3GXU A;  1OC1 A;  2B45 X;  4GZ9 A;  4Q4Y 3;  1IPK A;  1YJK A;  5I0D A;  5LBC A;  4OMC A;  4QPY A;  2QZ2 A;  1GMM A;  1OKQ A;  2XQR A;  1VBA 1;  1W3X A;  4H7M A;  1UIJ A;  4IV1 B;  4YVW A;  4ET7 A;  2PHR A;  2WFP A;  5FY8 A;  3J8F 3;  3U4S A;  3UKV A;  1YWK A;  1O4Y A;  2R32 A;  1VAM A;  3JD7 2;  4ISQ A;  4N43 B;  4XYX A;  2KM2 A;  4WVM A;  3WP3 A;  2ETE A;  4NVP A;  1D0H A;  1MAC A;  4R9B A;  3POE A;  1NZI A;  2EAK A;  2H0B A;  3LA2 A;  3PVN A;  2CAV A;  4Y20 A;  3MID A;  1LOC A;  1QKQ A;  1W90 A;  1XSR A;  2WN3 A;  3ZYH A;  5BNN A;  3IM0 A;  5FP8 A;  4N9H A;  4XCA A;  1UMI A;  2ILM A;  2VNV A;  4ASL A;  5F5A A;  4YZ5 A;  3A0N A;  1NZC A;  3T2P A;  4NAO A;  2R06 2;  5FZA A;  3JBG 1;  1DQ5 A;  3RZK A;  3ZMO A;  4CEY B;  3HQU A;  4XMI A;  5A70 A;  1O4T A;  1ODM A;  2XWJ B;  3W5M A;  4KQ7 A;  1LKN A;  2YG0 A;  3R4S A;  3EO6 A;  5LBE A;  4PBP A;  3WQ7 A;  1OQE A;  4DQA A;  1UO9 A;  3N9P A;  2K46 A;  1AYN 1;  3JD7 1;  4Q0S A;  3WW2 A;  4FOV A;  4I02 A;  1FMD 2;  3U07 A;  1XXN A;  2IVI B;  3ZYJ B;  1RUF 2;  5F1R A;  4J1W A;  2OT7 A;  3SEE A;  5IJR A;  1W6N B;  2JG9 A;  4D94 A;  2WNU A;  1MZF A;  4H2A A;  4MLO A;  4BB3 A;  1G8W A;  5A1A A;  1W9F A;  2XJT A;  4NO4 A;  4FP3 A;  1LEM A;  2WZR 1;  4JDO A;  1JZ7 A;  5KXD A;  3UL2 A;  2TUN A;  2WAO A;  4B8E A;  2Y6K A;  4B1M A;  4Q5O A;  1LNS A;  4NMI A;  1VBD 3;  1BBT 3;  4D7Y A;  1VMJ A;  3KS7 A;  1SEF A;  1V70 A;  1QOO A;  5GZD A;  3AM2 A;  3CBN A;  3CJI C;  2VAU A;  1PHM A;  4CP0 A;  3IDE A;  1H0B A;  4FI9 A;  5FK7 A;  3HBZ A;  5JOW A;  3EYP A;  1RJ7 A;  2BFU L;  1A8D A;  1POV 0;  3OSD A;  2RHP A;  3NJV A;  5DQ0 A;  1CQ9 A;  2W08 A;  5FUP A;  3ZYB A;  1RUD 3;  5IAT A;  4IV1 C;  5FO7 B;  2CGP A;  1DQ2 A;  4W6Y A;  1C4R A;  2WZR 2;  3POW A;  3VZL A;  2GN3 A;  3MF6 A;  2BOJ A;  2VTX A;  1JHN A;  4CZS A;  2O1Q A;  1IG3 A;  2ARC A;  5FR3 A;  2EXI A;  1A34 A;  4QKN A;  3DCQ A;  1X36 A;  3S6P A;  5LW9 A;  3ELN A;  3C7H A;  2BER A;  3K75 B;  5C8C B;  2DU1 A;  2V09 A;  3H8U A;  2W47 A;  4MH0 E;  2CYF A;  5KHK A;  4MX3 A;  2DF7 A;  2ZGM A;  4YW3 A;  4MGI E;  4Q4V 1;  4NRQ A;  5FOB B;  1VBE 3;  3OB8 A;  5LWB A;  1LGC A;  4AI0 A;  4LIT A;  2WN2 A;  2HKX A;  3I2G A;  3M4F A;  1OOP A;  1SZB A;  5C8C C;  4AFB A;  4XMA A;  4XIK A;  3U37 A;  4HG6 B;  3BYW A;  4FVV A;  1Y7B A;  2V72 A;  1FI2 A;  4GKY A;  2BEO A;  1CAV B;  2BJS A;  3QAC A;  3MFA A;  5F3E A;  3H7J A;  4HK8 A;  3ACF A;  2C4X A;  1IG0 A;  1NCR B;  4IEV A;  4ARX A;  5C70 A;  3MLL A;  2WYS A;  3OJB A;  3AJY A;  4AHW A;  4PI0 A;  5E8A A;  1GOF A;  3DPR A;  4CEW A;  1GZT A;  1GV9 A;  4FFH A;  1PZ7 A;  3S7E A;  5A3M A;  1H30 A;  3ROU A;  2VOX A;  4UT5 A;  3C7E A;  4CCC A;  5FYC A;  5J37 A;  2A73 B;  4PLN A;  2ZGT A;  4AQ2 A;  1QXJ A;  2XML A;  1Q5O A;  5JUV A;  2A6Y A;  4QHO A;  4GWI A;  5GLW A;  5IK5 A;  3H50 A;  4QXK A;  4Q4V 3;  2V5Y A;  5FY1 A;  1Y4W A;  4LNV A;  1AYM 1;  4JC1 A;  3GF6 A;  5F3C A;  1AXY A;  3OY8 A;  4SLI A;  4JDN A;  2PHL A;  5BV6 A;  1W2O A;  1EAH 1;  4LBN A;  4TWT A;  5FV3 A;  2B46 X;  1DQ1 A;  3R4D B;  4QM9 A;  1RUJ 1;  4QPW A;  5EQU A;  1A3K A;  1MS4 A;  1S0F A;  4BYY A;  5B2G B;  1G9C A;  3VB9 A;  3RZM A;  2ZXQ A;  1V6I A;  5F8P A;  3I2H A;  2YDE A;  4IEZ A;  1SDD B;  4R52 A;  1RC6 A;  2XLF A;  5FZ7 A;  3CF6 E;  4JDM A;  1N3O A;  1DHK B;  3NST A;  2VZO A;  1YQ2 A;  3CHX A;  4JTO A;  1PNG A;  3I59 B;  2HEV F;  2XGX A;  5BNP B;  2WFF 1;  1DLC A;  4LQR A;  3H3Z A;  4LBQ D;  1CZS A;  4HBN A;  3BPS A;  1ZZ6 A;  5E16 A;  3NNM A;  2W94 A;  3WCS A;  1NLQ A;  5CVR A;  5A3O A;  3HNM A;  5T5O A;  1AX0 A;  5JDB A;  2ZBJ A;  2ZA9 A;  3UK9 A;  4AI3 A;  1NA1 C;  1S0B A;  1NCQ A;  4BE3 A;  5A6Y A;  1ND3 A;  4YG0 A;  4IV3 B;  1ZBA 1;  2XVK A;  3MHZ A;  3GYD A;  1MVQ A;  3KGZ A;  4CEY A;  1F35 A;  4DS0 A;  4XJZ A;  1LOF A;  5SV5 A;  2PHX A;  2PYT A;  4CEY C;  4SBV A;  4CDW A;  3K4A A;  5J3U A;  3CNA A;  1HB4 A;  3M3Q A;  3SEP A;  4OUM A;  1Q3E A;  4BXF A;  3KVB A;  1SQ4 A;  4AAP A;  1XE8 A;  2R07 2;  3OPT A;  5IUQ A;  3N7L A;  1UYX A;  1GU3 A;  2BOI A;  3OOX A;  1OI6 A;  4I0A A;  1QWR A;  1AR8 1;  2Y33 A;  2ZEX A;  2MPF A;  1W8U A;  3N9M A;  3NJY A;  4MGK E;  1V00 A;  3OBR A;  1ZNP A;  1KS4 A;  3WHT A;  3OGJ A;  1HJG A;  2ZEW A;  1D0G A;  4CXW A;  1RUD 1;  1RIN A;  2PQQ A;  4XUP A;  5C4W A;  2BPA 2;  3TRS B;  2Y38 A;  1HN0 A;  3CL1 A;  1UCX A;  5FYV A;  4LHN A;  1RYY A;  2Y0O A;  4XAB A;  2DCZ A;  4WVW A;  4GH4 B;  2DWR A;  2I07 B;  3H42 B;  3ENR A;  1BHG A;  1KJL A;  1Q56 A;  2XR4 A;  2C1F A;  3ILR A;  4P02 B;  2VZR A;  3QCW A;  5FZ3 A;  2BDR A;  2XG3 A;  1HDK A;  3CO2 A;  1HB1 A;  2H6B A;  2UWA A;  1LCL A;  2WA3 A;  4UFM A;  2D5F A;  1DQ6 A;  2ZGK A;  1AHS A;  2VW2 A;  4XEZ A;  3UV9 A;  1BMV 2;  3K3O A;  2DUQ A;  2ARA A;  2BGO A;  4YRD A;  1PGW 2;  2BGP A;  1EV1 3;  2DVD A;  2VR4 A;  4XF9 A;  5CKQ A;  4WM7 B;  2XOM A;  1I3H A;  1O6U A;  1ODN A;  5JZG B;  5FZB A;  1QJZ A;  3VBS B;  1O5L A;  4IET A;  2RG4 A;  3NMB A;  5B4N A;  2JIJ A;  3LEG A;  3WDX A;  4NOT A;  2JB4 A;  1BXH A;  3S5Q A;  3VBR C;  4BXS V;  5BNO A;  1XB9 A;  3SIS A;  2VXJ A;  1K12 A;  3G6J B;  1CAU A;  1PZ8 A;  4RQP C;  3IAP A;  1WD4 A;  1U0A A;  4RGG A;  5KWR A;  5LZ6 A;  1MR5 A;  4MOA A;  2VCB A;  2VH9 A;  4NWW A;  5K4L A;  5A7W B;  5L9B A;  4XDO A;  2VZT A;  4N9I A;  5FZO A;  3SXW A;  5BPX A;  3W58 A;  3WNK A;  2WFF 3;  4AEM A;  2DBN A;  4JX0 A;  1DYK A;  3DPR B;  3VDD B;  4CDQ B;  5BNP A;  3GBW A;  3ZXJ A;  5BNO B;  1SCR A;  3ORJ A;  2JB8 A;  4JGZ C;  1H2L A;  1OD5 A;  1FMD 1;  4FPJ A;  4QKD A;  4UAP A;  5FY7 A;  3PVE A;  3NNG A;  5KR7 A;  1JYN A;  3E6C C;  3NQH A;  1VAL A;  2RS5 1;  4XZU G;  5F37 A;  3AP4 A;  2GMP A;  5DUU A;  5A6Z A;  1XRU A;  5FUN A;  5JXH A;  2YFU A;  4CA9 A;  2JDA A;  5C8C A;  2VCM A;  3TWI A;  2VEC A;  1UU4 A;  2LTN A;  5FJK A;  1JZ6 A;  1BKZ A;  1H1M A;  3TNP B;  4KG8 A;  3RYK A;  2DV9 A;  2JDU A;  1TVG A;  4J6G A;  5H9S A;  3UT0 A;  4AZZ A;  2OA2 A;  5JSO A;  5I0T A;  5LEK A;  1NT0 A;  2Q1Z B;  3BOD A;  2P3Y A;  1VBE 1;  3AKS A;  3I3B A;  3LIG A;  1UYZ A;  4JGZ B;  5FYM A;  3UKT A;  1WCK A;  1TMF 1;  2ZGS A;  1LU1 A;  2EAL A;  2XKP A;  4NHK A;  4X6Q B;  1J3Q A;  5DZG A;  2WZE A;  4Q27 A;  3WCR A;  4CDQ C;  5IFP A;  1JZ5 A;  5F3G A;  5C71 A;  3RJ2 X;  4ONU A;  1Q8V A;  4ASK A;  4XF0 A;  4RSU A;  3RWN A;  4AOC A;  4NR1 A;  2ZEZ A;  2H0V A;  3SHR A;  2NLR A;  4MXW B;  5C9A C;  4BQ4 A;  4N53 C;  1E5S A;  1L3J A;  1DGL A;  4YPJ A;  3WF2 A;  4CP9 A;  4DXZ A;  4RQP B;  2YHJ A;  3E6D A;  3LKJ A;  4AI2 A;  4AQT A;  2EIG A;  2VZ3 A;  4COY A;  3I3E A;  1VBB 3;  1SLL A;  1ND2 C;  4BJ0 A;  3VBR B;  1UZV A;  3AJZ A;  3MFC A;  4UYB A;  4HVQ A;  1UZY A;  1JYI A;  4IL7 A;  1NXD 1;  1LEN A;  4JKL A;  4U36 A;  2UYB A;  4GWM A;  4Y1U A;  1JI6 A;  3J7M A;  2WO1 A;  4P9I A;  3WVJ A;  5JZG C;  4CDW B;  2XKO A;  3C2U A;  3RSJ A;  4BLJ A;  1YO8 A;  4BMB A;  1WBL A;  4LBL A;  4Q4V 2;  3IB3 A;  1SCS A;  4ZON A;  5FZD A;  3ZXD A;  2E7Q A;  4BQW A;  3ZOI A;  2G4I A;  3POI A;  2Q30 A;  3FMG A;  2J1A A;  1S0J A;  4IE4 A;  2VVE A;  3KQR A;  5FZF A;  1WW4 A;  4PDW A;  4E2Q A;  3CLP A;  4PIZ A;  1LGB A;  3WQ0 A;  2BGC A;  4IGO A;  1NOV A;  1ZZB A;  2N7G A;  4NHX A;  4FPH A;  4HN0 A;  4Y26 A;  2VVF A;  3O7O A;  4UW5 A;  5JI9 A;  3ILF A;  3A0K A;  1LR5 A;  1NYW A;  4A6S A;  2WSU A;  3WDW A;  1JYV A;  4XQD A;  1M4W A;  4COW A;  3TEX A;  3AMP A;  4LJH A;  5BNN B;  5L36 A;  1AJO A;  4CU9 A;  4E4H A;  4XC9 A;  5LB6 A;  2FMD A;  1YUD A;  4QB2 A;  1J3R A;  1F8V A;  4P5Y A;  2VGD A;  3I4I A;  4QX7 A;  1RVF 3;  2W91 A;  4XFI A;  1Q8O A;  2XLG A;  2QNK A;  1BCX A;  1UNB A;  2I74 A;  2RS3 2;  2WNV C;  3HD8 B;  3KQ4 B;  3BTZ A;  2DCK A;  1OLR A;  2O8O A;  2HBU A;  1W05 A;  4R4X A;  1DLL A;  4FBF A;  1MZE A;  1IPJ A;  4XAE A;  5KXB A;  3K4Z A;  2DUR A;  1POV 3;  2BW8 A;  3ON7 A;  1SFY A;  2YXS A;  4P9J A;  3BKZ A;  3PJQ A;  4XW3 A;  2AEN A;  2RJ2 A;  1Y9Q A;  2JEN A;  3OEB A;  4DY5 A;  2WSV A;  4CPB D;  2GAL A;  4LBQ A;  1XE0 A;  1NLS A;  1MS1 A;  4Y1Y A;  5A3W A;  1CAV A;  1H4H A;  4FPF A;  5A7W A;  1RB8 G;  1PIV 2;  4COV A;  1YFX A;  4OUS A;  5DXD A;  1GOG A;  5A33 A;  2QQN A;  4LO4 B;  2BZD A;  5GM0 A;  1PGW 1;  4HMZ A;  2OPK A;  3ZIW A;  3J7N A;  4AHZ A;  5AVA A;  4YVS C;  3FUQ A;  1O8P A;  3FBY A;  4L97 A;  5IK8 A;  3MIE A;  4CUG A;  1WW5 A;  3WUC A;  2W95 A;  1VBD 2;  3NV1 A;  2MEV 2;  3UKN A;  2FDK A;  1LOD A;  1W2N A;  2GND A;  1OT5 A;  5H9R A;  5HI0 A;  1WUV A;  2ZX3 A;  4FSJ A;  2ZHN A;  3AC0 A;  1ZRR A;  1W06 A;  4IEU A;  3A22 A;  1AR8 2;  4Q2F A;  1F5J A;  1FV3 A;  1R08 1;  4X8N A;  1V9U 3;  1Y43 B;  4YG6 A;  5JXG A;  1LJ7 A;  4NE9 A;  5F2W A;  4Y1X A;  3SIT A;  5FCC A;  3WG1 A;  1HQN A;  4YGB A;  1WMF A;  4YGD A;  4TTG A;  1BJQ A;  3BU0 A;  1DU3 D;  1GR3 A;  2JG8 A;  4IEY A;  4UBG A;  5EJ1 B;  4COU A;  3OBT A;  1FNY A;  1AF9 A;  3SCH A;  4V2V A;  4ORF A;  4LBO A;  4N90 A;  1IS4 A;  1E57 A;  2JKB A;  1R1A 3;  1ZA4 A;  1VRH 3;  2JDM A;  3QD6 A;  5FZL A;  5GZF A;  5DN2 A;  4CEW B;  2CGN A;  4CCE A;  1KEX A;  3N4M A;  1O3Q A;  2B5H A;  4XCB A;  1POQ A;  2J1T A;  1K5J A;  1K5M A;  3EBR A;  3MV0 1;  3MF9 A;  4CU7 A;  2D43 A;  4Q4X 3;  1COV 1;  3LZZ A;  4LKS A;  1NCR C;  1S2E A;  3ACH A;  1VJ2 A;  2WS9 3;  1KD7 A;  1U5X A;  1XYN A;  2YC0 A;  3HNB M;  2OII A;  3LA3 A;  4FT8 A;  4XPV A;  5FYS A;  1AL2 3;  5HXM A;  4OHY A;  1BYH A;  2WQZ C;  1CX4 A;  1PVC 2;  5CFD B;  3I97 A;  1CR7 A;  5F3I A;  3POY A;  1I5Z A;  4PIX A;  2XDV A;  2XVG A;  2RR1 1;  3LCP A;  1UWW A;  2YB7 A;  4ZS2 A;  4Y5S A;  3H9A A;  2OQ7 A;  3PUQ A;  1DZR A;  4CCO A;  2BFU S;  4NID A;  5T5J A;  4AEJ A;  3WZ1 A;  2GN7 A;  4DY3 A;  1STM A;  2DTW A;  3ZMN A;  1PVC 3;  3GBG A;  4ZPI A;  1COV 2;  1G6N A;  3VZK A;  5CAD A;  1LOF C;  2IC1 A;  2V5D A;  1RHI 2;  3FBM A;  5CKM A;  2YGL A;  2DCT A;  4RFR B;  3ZXL A;  1JOB A;  3KD4 A;  3OGR A;  1DP0 A;  1LEC A;  3DXU A;  4Q4Y 1;  1UF2 C;  2KD7 A;  1NY7 2;  1RUG 2;  1YFU A;  3GZT B;  1DQ0 A;  3KWV A;  4I09 A;  4GKX A;  4QGN A;  1N1V A;  4Y20 B;  1FPN 3;  1G9A A;  4Q1P A;  5DDJ 3;  3RFR A;  4DIN B;  5I8T A;  1RUE 1;  5TSW A;  2NMO A;  4LBK A;  4LO8 A;  5FYT A;  1ZBA 3;  5I8S A;  2P3I A;  5ANN A;  4YW5 A;  5JMO A;  2ADE A;  2RDN A;  3FC0 A;  2J42 A;  2OYZ A;  4F83 A;  2VJX A;  4NIA A;  4PCR A;  5FBJ A;  3VKL A;  1NQJ A;  3KHB A;  1UKG A;  1CWP A;  5IVB A;  2WLQ A;  2QQI A;  1MZ5 A;  4KMQ A;  5FTT C;  3GM8 A;  5KXE A;  2OW4 A;  1UZZ A;  2WNE A;  5FY5 A;  1M06 G;  1VBC 2;  5K7P A;  2H6C A;  2VMH A;  3KCY A;  1RHI 3;  1DYP A;  1MEC 3;  4TSV A;  5JR2 A;  3A4U A;  1O7F A;  1WA4 A;  2EXK A;  1VBB 2;  4I3P A;  4AVT A;  4DUV A;  5LA0 A;  3KVA A;  1QMJ A;  3JQX A;  3OUJ A;  3G7D A;  3HN1 A;  5CZK A;  2W39 A;  2WC2 A;  2WQ4 A;  5C5U A;  1AYN 2;  4LE3 A;  4LKE A;  1TMF 2;  3B3Q E;  4OVE A;  2HWF 2;  1W8Z A;  4GMP 3;  1H8T A;  1LOE A;  1UY0 A;  3NO8 A;  3DL3 A;  3MLJ A;  1VP6 A;  2V4A A;  4LBM A;  3FZ3 A;  2LUW A;  4L99 A;  3ACG A;  2YC4 A;  4LK6 A;  2KR2 A;  2XH6 A;  4FPY A;  1OVS A;  3B9C A;  3ZLI A;  4HXC A;  5GZE A;  1WKY A;  3SH4 A;  4Q0Q A;  4HKL A;  1PX3 A;  3DUI A;  1F5F A;  4BQ3 A;  2E33 A;  3LFM A;  3JXS A;  1F31 A;  2CSG A;  3OY8 B;  1B09 A;  5DAB A;  3SMH A;  2XL7 A;  4XIO A;  2Q5T A;  3GZU C;  3GJB A;  4FP2 A;  4N43 C;  4BZ4 A;  5FPX A;  1SPP A;  1VRH 2;  1ZZ9 A;  1UMH A;  4Z2A A;  1GQH A;  4BCU A;  1NQD A;  3OUH A;  4URA A;  3D82 A;  4O61 A;  4AVB A;  1REF A;  2VTF A;  3VBH B;  1EV1 2;  2IXC A;  2ZGQ A;  4QHB A;  3WDU A;  2P37 A;  5C3Q A;  4LBQ B;  4CDQ A;  1ULC A;  1ZA7 A;  4PIY A;  4JAA A;  1I5P A;  3FLT A;  3OCP A;  4LT5 A;  2VUJ A;  2W1U A;  5FLH A;  3KV4 A;  4YGC A;  2PXJ A;  3WUD A;  1A6C A;  1AL2 1;  3ZSK A;  4L0P A;  3I2O A;  1OVP A;  2ZJC A;  2MHF A;  4QXC A;  1NKG A;  1E5H A;  1IZ3 A;  1YIP A;  1RMU 2;  1ZBE 1;  2RM2 1;  2RMU 2;  1QJY 3;  2ZPX A;  1AR7 1;  1SLC A;  4Z82 A;  4AK3 A;  1CJD A;  4UFJ A;  1CZV A;  3JUU A;  2FDH A;  3RWK X;  2Q4S A;  2JKX A;  4I0B A;  1RTV A;  1IOA A;  1HN1 A;  2JIG A;  3QBQ A;  1YRZ A;  2CL2 A;  2K9Z A;  1S55 A;  2R04 2;  1V6M A;  1WLT A;  3AZW A;  5D2A A;  4CCD A;  2MNG A;  1W8F A;  4QDQ A;  1GIC A;  1W03 A;  3B7M A;  5HV4 A;  5JOY A;  1AR9 2;  3ZIX A;  4XF3 A;  1K45 A;  1C5I A;  1Z7S 3;  1IHM A;  4TLG A;  4E4Z A;  4E8D A;  3HWJ A;  4D7T A;  4X8P A;  2W87 A;  1G7Y A;  1WMX A;  1HV0 A;  2JG9 C;  1JUI A;  4PJY A;  1LHO A;  1XNA A;  4NJ4 A;  1S1A A;  4AAX A;  2VNG A;  4OHZ A;  2SBA A;  4YW6 A;  1CAU B;  4WVV A;  2JDP A;  4UFH A;  1AYM 3;  2ZTN A;  1TZO A;  5A6X A;  1ND2 A;  3HPN A;  3JU9 A;  1ZRC A;  1GP4 A;  3LD8 A;  5FXX A;  2WA4 A;  4FFF A;  4IDZ A;  4GMP 1;  2RS1 3;  4WM7 A;  3ZFE C;  3OPW A;  3OUI A;  4P14 A;  1QGL A;  4QQ2 A;  4AFM A;  5C6C A;  1COV 3;  3T0B A;  4CUC A;  2VMG A;  1UZW A;  4CDU C;  1RMU 1;  4M4P A;  2J1U A;  3P3P A;  1MS8 A;  4BK4 A;  1VRB A;  1QHD A;  1H9P A;  2YGM A;  4BH9 A;  3WOG A;  3ZO0 B;  4CYD A;  2VG9 A;  1NCQ C;  1WWY A;  4RR3 C;  3MPP G;  1RXF A;  4C0H A;  3BGA A;  1V6N A;  3ZXA C;  5C8W A;  2ZAA A;  1A78 A;  5JWP A;  1UZ0 A;  1NUK A;  1RUC 2;  2X5I B;  3JB8 A;  4KWU A;  2GNT A;  5A3P A;  5IVV A;  2RDR A;  1ND3 B;  4NPL A;  1GZW A;  4AHX A;  4Q4Y 2;  1NY7 1;  1RUG 1;  2JE7 A;  3N9L A;  4XE9 A;  5CFC A;  1ZZC A;  3ST7 A;  2AEY A;  2C6S A;  2ZAB A;  2GME A;  3IBM A;  4QPG B;  2YYO A;  2G9F A;  1NX9 A;  1YC6 1;  2PHD A;  1IS3 A;  3M3E A;  3NAP A;  5FRE A;  3LSE A;  1IQA A;  4MG2 A;  1H6Y A;  3GDB A;  4AEK A;  1EPW A;  1VBE 2;  2EA7 A;  1AR9 3;  4Y33 A;  1JYX A;  1PO2 1;  3VL9 A;  5L9V A;  5LK5 A;  1FYU A;  4YM1 A;  3VBO C;  1NE4 A;  2A71 A;  1GNH A;  2VBP A;  2ERF A;  3R05 A;  4QAW A;  5F39 A;  5A32 B;  1GLH A;  4EN9 B;  4Y3O A;  2CDO A;  4W6X A;  5D8A B;  5ABJ A;  3WW3 A;  3BIE A;  3MIF A;  1B35 B;  2V73 A;  3ZSE A;  1FV2 A;  4AW7 A;  4IEP A;  4JHT A;  3GAL A;  3ES1 A;  3PHM A;  1IKP A;  5FDB A;  2GH8 A;  4QPI B;  2PN5 A;  1PIV 3;  3D0J A;  4F3J A;  2HBT A;  1BZW A;  1PZ9 A;  2YUE A;  3SKJ E;  4FAH A;  1RVF 2;  2YBS A;  3VBU A;  3ZPY A;  5FQ0 B;  1R64 A;  4YW7 A;  1CON A;  5FFO C;  2A5Z A;  1SG3 A;  5CFD A;  2WNU C;  3WNP A;  2WL1 A;  3GHM A;  2WIN B;  2J1V A;  3CJX A;  3GCX A;  3KT7 A;  1Z7S 1;  3NVC A;  3WEZ A;  4I0W B;  1JZ3 A;  2V4V A;  1W8H A;  1VAV A;  3DYM A;  4EN6 B;  5K0U B;  2F4P A;  4EN8 B;  3ALQ A;  2VM9 A;  5J09 A;  3O1T A;  2FD8 A;  3K51 A;  1IKQ A;  3MIC A;  4MGS A;  1VLN A;  1X33 A;  4ZS3 A;  4DRR A;  5A7S A;  5FXV A;  4PHZ A;  1OA2 A;  1OOP B;  2WR9 A;  4AVV A;  3NKG A;  4Q0P A;  3PUR A;  2ORZ A;  4LPL A;  4P9L A;  2CGO A;  5ERL A;  1DIW A;  5FP9 A;  3ZN6 B;  2QQV A;  2OZ6 A;  4RQP A;  3LF7 A;  4HN1 A;  4BK5 A;  1NLR A;  3T2O A;  2G1M A;  4J25 A;  1OXC A;  2OZJ A;  4NPR A;  1YQ8 A;  2B39 A;  4NAM A;  1O3T A;  1C3H A;  4LTA A;  2FQP A;  4YNI A;  1G9B A;  3PVB B;  1MZ6 A;  3RYR A;  3ECQ A;  2ZZQ A;  4QX2 A;  2YRO A;  5C3S A;  1VBC 1;  3K2O A;  1N1S A;  1OLQ A;  1R09 1;  1WMD A;  4YM2 A;  2ZKN A;  2PHF A;  1AUY A;  5KHJ A;  5FP7 A;  2WT2 A;  3EHK A;  1UXX X;  5A3N A;  1S0I A;  5ACA 1;  1QJF A;  4I01 A;  3BB6 A;  3O14 A;  3H1M A;  4S2G A;  3PTY A;  2PHW A;  4JQR A;  3MZH A;  2FDF A;  3VL8 A;  4G3Y C;  4FOY A;  1DGW A;  2E7A A;  1RVF 1;  4O9E A;  3MYX A;  3O1U A;  1FXZ A;  3VZM A;  2Y8K A;  3HNY M;  5FPZ A;  3PUS A;  4RS5 B;  2TEP A;  4Y1V A;  3K46 A;  5ABJ C;  5T3N A;  1R1A 2;  1QXR A;  1RUC 3;  3WF0 A;  4ZZ5 A;  2DUO A;  1UYP A;  4CP1 A;  5GKA C;  2RV9 A;  1DF0 A;  3BN6 A;  1U5Y A;  2WWU A;  1RUJ 2;  4IUG A;  1HQW A;  3O1M A;  2BNO A;  1UD1 A;  4TN7 A;  3U78 A;  3VBU C;  2D6P A;  3ZFF A;  1QF3 A;  1KRI A;  1UU5 A;  4A41 A;  5EXO A;  5FJH A;  2DFC A;  2ET1 A;  5GZG A;  3A23 A;  4MSV A;  5LA9 A;  3ZSJ A;  4OI4 A;  4CDX B;  4Z1V A;  2Z42 A;  3A7Q A;  3AMM A;  4QHZ A;  2BUK A;  1UKR A;  3BUC A;  1EPZ A;  1RUF 3;  4ZZ8 A;  3POG A;  2XHK A;  1ULE A;  1P8J A;  1NAE A;  2XON A;  4K8R B;  5T50 A;  2VU9 A;  3VHN A;  2B8M A;  1C5H A;  1VPH A;  1Y9M A;  3NRU A;  2LM3 A;  1YNA A;  3HT1 A;  3K3N A;  4FPC A;  4N7I A;  1C8M 3;  1FNZ A;  2VW0 A;  3AKQ A;  3ZFG B;  2HJI A;  4AGV A;  3KMH A;  4LHL A;  1RUH 3;  5JZG A;  3VD5 A;  4AGR A;  4IEO A;  3TYJ A;  3O0X A;  2DVA A;  1JS9 A;  3KT4 A;  5FQ0 A;  4D0Q A;  2AC1 A;  4Z2W A;  2A1X A;  5F5I A;  1CAW A;  2QTW B;  2X10 A;  5C33 A;  4FXK B;  4LIU A;  4HVO A;  4QQO A;  3FWE A;  3RMY A;  3RMX A;  1QDC A;  2TNF A;  4DXT A;  1UAI A;  2VME A;  1WCD J;  4GD4 A;  4XBQ A;  5AC9 3;  5IAV A;  2I2S A;  1EAH 3;  2Q0A A;  2WUH A;  1D2Q A;  2EID A;  2PAM A;  3N9N A;  3NNL A;  3WW1 A;  3AB0 A;  2D97 A;  3ME2 A;  5L9R A;  5C3P A;  5EP9 A;  3KF5 A;  3KV9 A;  3O1R A;  5FMB A;  2ID4 A;  1L7L A;  2IXH A;  1QJX 1;  2HEW F;  4ZU7 A;  1PM4 A;  3R6S A;  3HT2 A;  1ENR A;  4B29 A;  5IAX A;  3VD4 A;  4C1X A;  4E2G A;  5JAX A;  1GKB A;  2F17 A;  2CWM A;  1R08 3;  1AR6 2;  1N1Y A;  3C7F A;  4RL7 A;  3LEM A;  5LK7 B;  1ZRD A;  2BNM A;  1HKD A;  1N1T A;  3J7L A;  3ACL A;  3T2T A;  5FPA A;  4BIF A;  5DUW A;  4E8C A;  3SLI A;  1LTE A;  1T2X A;  4HL0 A;  5CFC B;  3O0V A;  3H3U A;  3VBU B;  4LR4 A;  5GAL A;  5BUV A;  2KXL A;  5LRS A;  5ACA 3;  4FOQ A;  1ASJ 2;  5IK4 A;  1KDK A;  5CU1 A;  3ZFF B;  1PGS A;  4C90 A;  2K0G A;  1JZ4 A;  5I93 A;  4YAR A;  4PI2 A;  1T6B X;  2F6B A;  3ZSM A;  4XHB A;  1MS9 A;  3TEY A;  4XJ8 A;  1QNY A;  2VZ1 A;  2Z5W A;  3WLU A;  2F4L A;  3M3C A;  5HV0 A;  3H0O A;  3F95 A;  1AR6 1;  4UF0 A;  2J7M A;  4K20 A;  2QDN A;  4QX8 A;  4RS5 C;  5ABJ B;  5L7O A;  5K8S A;  1G9F A;  3OD4 A;  1SPP B;  4IE7 A;  4JGY C;  1X9P A;  5I8Y A;  5IFT A;  5L7O C;  2VMC A;  4YVW C;  5EFU A;  3LA7 A;  1RUO A;  3ZN6 A;  3C8X A;  3H3L A;  3H1W A;  3TEZ A;  4M3C A;  2BU9 A;  3AL6 A;  2XQX A;  3NAP C;  4DUW A;  4LUL A;  4DOU A;  4TZD A;  5FZ9 A;  4XJ9 A;  4XFH A;  1TNF A;  4IEX A;  1YXW A;  3AKT A;  5C4W C;  3M3O A;  1GZW B;  1H2M A;  4MZU A;  4ZY9 A;  3III A;  4KH9 A;  5G04 L;  1N47 A;  1V6L A;  3FN9 A;  2WWS A;  1CIW A;  4LBJ A;  4QDS A;  2QQJ A;  3AMQ A;  1SBE A;  3K77 A;  1IGO A;  4XJU A;  3ZYP A;  2BP6 A;  2NQY A;  3K48 A;  3WSO A;  4M3C B;  2GP5 A;  1EY2 A;  2WZ8 A;  3ILN A;  3VBF B;  4AWD A;  3BTY A;  3FL7 A;  5ISL A;  4OQ8 A;  1DGR A;  1DZQ A;  4OHW A;  1E5I A;  3QOP A;  4FPL A;  3ZVX A;  1J59 A;  5T55 A;  2VCA A;  5CBL A;  4PT6 A;  4UFK A;  3IDA A;  1X8M A;  2DFB A;  4GA9 A;  4CVU A;  1CAW B;  1VBA 3;  4W50 A;  5I0U A;  3VBF A;  1BQP A;  3IIA A;  2D3P A;  4XDQ A;  1R09 2;  1SFN A;  2ZGU A;  5KHG A;  2LW8 A;  2R06 1;  2PHT A;  3OYW B;  4RHV 1;  4ASM B;  3NV2 A;  4LO6 B;  1GBG A;  4EE2 A;  4NRO A;  1W8O A;  3AYD A;  4G4F A;  3ZFG A;  1I9R A;  4EV0 A;  1SBF A;  4RD7 A;  4AVS A;  5A32 A;  3USU B;  2VVD A;  2WAA A;  2D6N A;  1JH5 A;  4EZ4 A;  5K0U C;  3B93 A;  4DMI A;  4S2H A;  4EJR A;  2ZX0 A;  3T09 A;  2Z4F A;  1MS5 A;  1Z7S 2;  3FX3 A;  2PAE A;  4CPB A;  3MEP A;  4E27 A;  5F5C A;  1PVX A;  4EZH A;  5FPL A;  2DYC A;  4JTN A;  1OPO A;  1LOG A;  3U10 A;  1I1E A;  3VDC A;  4GJY A;  3UES A;  2TBV A;  4GH4 A;  4UW6 A;  3SCF A;  2O8Q A;  2R1D A;  3ZM8 A;  2DVF A;  3EQE A;  3MI8 A;  3THP A;  2AZ5 A;  3POS A;  4HFS A;  5FWJ A;  4P08 A;  5D8A C;  1YHF A;  2D3R A;  5FLJ A;  3LFI A;  2Z69 A;  1CX1 A;  2IXI A;  4NWV A;  5AVP A;  1GFF 2;  1OD3 A;  3RRD A;  1MQT B;  3B9I A;  5J7M A;  1RMU 3;  5BXX A;  5IK7 A;  3HJR A;  3Q9O A;  3VHR A;  3U11 A;  4LXL A;  3W9A A;  3VKF C;  2ZEY A;  2D98 A;  4I3G A;  4YZ1 A;  4JZR A;  4KBB A;  3P6B A;  4Q4W 1;  4Z07 A;  4CRQ A;  4M00 A;  5KHI A;  4I30 A;  1W8W A;  1AR7 3;  5FMC A;  2ET7 A;  2CTV A;  3AZX A;  4HVR A;  1LRH A;  1GOH A;  2XUE A;  1RIT A;  2ZMN A;  3FHQ A;  4OCT A;  1H9W A;  2WZR 3;  3N9O A;  1UX7 A;  1VBA 2;  1NCQ B;  4CDX A;  1O3S A;  3A21 A;  4JQT A;  5KBF A;  5J1X A;  5FIX A;  3N3H A;  1VBD 1;  1MS0 A;  5SV8 A;  4CCK A;  4S2D A;  2ZKL A;  3LDB A;  1O59 A;  3HIF A;  4XBL A;  5I0S A;  4J1X A;  1IQD C;  5HCH A;  3ZKY A;  2X8K A;  4QDR A;  4WM8 C;  2VBD A;  1FOD 3;  1HRI 2;  1ULD A;  5DAQ A;  5JLV A;  5FY9 A;  1W6O B;  1KS5 A;  2OVU A;  3PUI A;  4A7Z A;  1CD3 G;  2VQT A;  4YZ4 A;  5FK8 A;  3ZFE B;  3DN7 A;  1K5M C;  4FTB A;  5EPA A;  4AED C;  2HWD 1;  4NHY A;  4FPK A;  1EUT A;  5C7G A;  1OH3 A;  1RUI 2;  1XYO A;  1YQC A;  2HWB 2;  2QCS B;  3MIB A;  1S0D A;  3HN3 A;  3JD7 3;  2FCT A;  2NN8 A;  1RL3 A;  3CDZ B;  3NJX A;  4LO5 B;  2DCJ A;  4XF4 A;  5HPO A;  3WP5 A;  4WBB A;  1H8T B;  1SLB A;  2XVL A;  3AXD A;  5BNQ A;  4AFC A;  1VR3 A;  4NN0 A;  2Z2S B;  1TME 1;  5G05 L;  4K9S A;  4C91 A;  3KSC A;  1MEC 2;  3WF4 A;  4MVT A;  2XJU A;  4BQX A;  3I8T A;  3MBW A;  4M01 A;  3WW4 A;  1MQT C;  2XJR A;  2Y60 A;  1RUC 1;  4BU2 A;  4N43 A;  3EJK A;  5LRR A;  5CG9 A;  5FYZ A;  5A7P A;  2VD7 A;  2XJV A;  1RIR A;  4ZU5 A;  5APA A;  3I2K A;  2VOW A;  4XZP A;  4COZ A;  4MGY E;  4RN5 A;  4RR3 A;  3THD A;  3TB0 A;  4DEQ A;  4NIH A;  4BPZ A;  1XNB A;  3I2D A;  4Y24 A;  2VUD A;  1IS5 A;  2NM1 A;  1GWL A;  4DIQ A;  4MHU A;  5I91 A;  3H1Y A;  4P5H A;  5JMC A;  2BQP A;  1VB4 A;  3PUH A;  1AR7 2;  2Y6H A;  3M7A A;  1W0P A;  4A3Z A;  2W1S A;  5DPN A;  3T1L A;  4O9G A;  2PHU A;  1WCS A;  3PDQ A;  4GUL A;  5FYH A;  3FE5 A;  2G19 A;  5C3R A;  2VZS A;  4MXW A;  4GB3 3;  3T0A A;  2Y34 A;  4YW4 A;  5FLI A;  1LAJ A;  3WY6 A;  3IWZ A;  2VUL A;  3MDP A;  3LAG A;  5A6Q A;  2CV6 A;  4C0B A;  4AQ6 A;  1QJY 1;  2WT0 A;  1C8M 1;  2ZCW A;  3PUA A;  4N8M A;  4DRV A;  1W6P B;  5BYN A;  3T1M A;  3HEI A;  3EXU A;  2VZU A;  4M3C E;  3BIW E;  3L2Y A;  1BLZ A;  1PMJ X;  1OSG A;  5DUV A;  1NXM A;  3B69 A;  4LMF A;  3LGR A;  2EIC A;  3W59 A;  3WIN E;  3J9S A;  4AF9 A;  4DB5 A;  5FBZ A;  1HB3 A;  4LA2 A;  2UYA A;  4OFG A;  2E6V A;  3DV8 A;  3N7J A;  2EXH A;  5FAX A;  4DO0 A;  1ULG A;  2Y6G A;  3M8L A;  5A1L A;  4RFT 0;  5AFB A;  4QB6 A;  1IS6 A;  3LEI A;  3AVS A;  1FPN 2;  3NWK A;  4Y5T A;  1H8T C;  3RZL A;  1C8M 2;  1JN2 P;  4Q4W 3;  5EYX A;  1H2K A;  3KT1 A;  4AFA A;  3O1P A;  5F7U A;  3VZO A;  1SLT A;  3OF1 A;  2P4E A;  3HVD A;  4XDP A;  5FPB A;  3WX5 A;  4MUV A;  2WRA A;  1XND A;  3C7G A;  3I7D A;  1JU3 A;  1GP5 A;  4YW1 A;  1K5M B;  4JVA A;  3CMG A;  3AFK A;  3U0Z A;  4QT6 A;  2WT1 A;  4MGQ A;  1ONA A;  4YFZ A;  2ENR A;  2B9U A;  4JCK A;  4JHZ A;  2GP3 A;  2ZGP A;  4LKF A;  4Q1R A;  3NAP B;  3U75 A;  2GSY A;  4HPK B;  3WF3 A;  3URF A;  2R07 1;  4AG4 A;  4WM8 B;  5HCA A;  3W5N A;  1WCQ A;  3RGB A;  2W1W A;  3QH6 A;  3RZJ A;  5IT6 A;  4UFI A;  3SH3 A;  5KC6 A;  3SQO A;  1LHU A;  1U5Z A;  1W2T A;  2A3W A;  3BU7 A;  1NA1 A;  4D6R A;  5DMY A;  2X5I A;  2R04 3;  2VL4 A;  3VKO A;  1PGL 1;  2E9Q A;  2X29 A;  2ZHK A;  3I54 A;  4Q4X 1;  3K4D A;  3H8O A;  4A4A A;  1SLI A;  3VDA A;  2FDI A;  3R0R A;  4GB3 2;  1ST8 A;  4PLM A;  3KV5 A;  3S7I A;  2YC2 A;  2AGS A;  4QGM A;  3KB5 A;  1D7P M;  3VLB B;  4GQ7 A;  2FZ1 A;  3S5A A;  3V0B A;  5E1R A;  3T0D A;  3N35 A;  5CFC C;  1ZX5 A;  2VNO A;  1UPI A;  2CU5 A;  1NE6 A;  5FMO S;  5FZ1 A;  1TME 3;  2EAA A;  5A33 B;  2HWC 1;  2GDF A;  2P2K A;  1QJY 2;  1ZBA 2;  2RS3 1;  1HV1 A;  2WNO A;  5DDJ 2;  4CUA A;  5FKB A;  3WDY A;  4OYU A;  4URT A;  3WDV A;  3X29 B;  3BOW A;  2VQ0 A;  3LSD A;  4FO9 A;  3NW4 A;  4R9C A;  4XUT A;  3ZXE A;  3EMR A;  5BY5 A;  3WQ1 A;  1FOD 2;  1HRI 3;  2A6V A;  1KFU L;  5IYY A;  4NPM A;  1C1L A;  2W52 A;  3AK0 A;  1RGS A;  5EJ3 A;  2QBX A;  4A44 A;  3GZA A;  4AVA A;  2ZS6 B;  4JGY A;  4L8Q A;  4A3X A;  1IPS A;  3ZXF A;  4LOR A;  1FPN 1;  2ZX4 A;  2DVB A;  3E5X A;  2XBO 2;  2GZW A;  1L7R A;  1OUS A;  4GMP 0;  1PVC 1;  1PIV 1;  1DFQ A;  2R06 3;  3FUO A;  1OMI A;  2R49 A;  2VO5 A;  4LE4 A;  3SC7 X;  3ZX7 A;  5C9A A;  1WD3 A;  5CFD C;  4AED A;  2IWG B;  2FDG A;  5FZI A;  3ZFG C;  2R7E B;  4QM8 A;  3DGT A;  4HON A;  3J26 N;  1G9D A;  5FO8 B;  1OF3 A;  1UPS A;  4L9B A;  4LOS A;  3VUO A;  2J1E A;  1ENX A;  2AUY A;  3N36 A;  3AP9 A;  3ZSL A;  1OUX A;  1ZRF A;  2PAK A;  3BCW A;  1T6G C;  2R16 A;  2RDS A;  5FYI A;  1TME 2;  3WG4 A;  1PO1 1;  4S2F A;  1VMH A;  4BA6 A;  4LHK A;  3W20 A;  4MAD A;  4HET A;  2CAU A;  3UJO A;  4CDX C;  3WT3 A;  4XXA A;  1CIY A;  2D40 A;  5FKC A;  3S30 A;  1QJX 2;  5AFE A;  5L19 A;  4XUR A;  4WM8 A;  1SBD A;  1OQ1 A;  3MUY 1;  4ZXK A;  1EUU A;  4KWK A;  2NP0 A;  1OPM A;  1ACC A;  2WJS A;  2GAU A;  4EYU A;  2ZGR A;  2QQP A;  2P3K A;  3J4U H;  3P5B A;  5FXZ A;  1HRV 3;  3UGF A;  4ATF A;  1LED A;  1Q8Q A;  1OF4 A;  1REE A;  1S2K A;  1X7N A;  2P6C A;  3D6E A;  1W9T A;  4R8H A;  3DXT A;  2VXR A;  2YBK A;  1LGN A;  4CSW A;  1OLM A;  3AXE A;  4D6S A;  2X09 A;  5FUI A;  2C9K A;  3WNO A;  3AKP A;  4FTS A;  4YFW A;  1H2N A;  2D6L X;  2A70 A;  4UFL A;  2P1B A;  5I0R A;  2O14 A;  3APB A;  4CCN A;  2QQW A;  3AYA A;  2WDB A;  1NG0 A;  1ASJ 3;  3OGV A;  1DGW X;  5L7O B;  2GH2 A;  4Z8B A;  5A80 A;  4JGY B;  3WV6 A;  1E5R A;  1D2S A;  4Q26 A;  2X53 S;  3V65 A;  3L9J T;  4B7K A;  2AH2 A;  5JXJ A;  4XVH A;  1HRV 1;  1PM7 A;  2OKX A;  3JBG 3;  4YW2 A;  4NRP A;  1W6M A;  3VKN A;  3S0M A;  3TBD A;  3UYJ A;  4A7Y A;  2RS5 3;  4O65 A;  2GC3 A;  3RDI A;  2UU8 A;  3DKW A;  3ZFF C;  1OA3 A;  2ZHL A;  4PQQ A;  5IVC A;  5IW0 A;  2C9A A;  2ZGO A;  1HIX A;  3AX4 A;  2WNV B;  1QQP 1;  4H14 A;  4KL1 A;  4N53 A;  4DUX A;  1ZBE 3;  2RM2 3;  3LDR A;  1EAH 2;  4I2O A;  3I59 A;  3DEC A;  2HYK A;  2ZHM A;  1Q8S A;  4QX5 A;  4AI8 A;  2XJS A;  2E63 A;  4W6W A;  1LOA A;  3Q8E A;  1AJK A;  3GNE A;  1OOP C;  2W3J A;  3IAQ A;  1GNZ A;  1ENQ A;  1VE0 A;  3HQX A;  3MW4 A;  4IE0 A;  4L11 A;  5F6K A;  2QQM A;  4K1Z A;  5A7O A;  4XET A;  3ZDS A;  4AE2 A;  2WO3 A;  5FPV A;  3KM5 A;  2OQ6 A;  4DZG A;  2IXJ A;  3VBR A;  2P6H A;  1XC6 A;  3NKT A;  4OI2 A;  1GP6 A;  2XLA A;  2EIE A;  4EWA A;  1D4V B;  3BVC A;  3PNA A;  5FMD A;  4IE5 A;  5FZ8 A;  5LY1 A;  2WO7 A;  3SNM A;  1W39 A;  1WME A;  1ZZ8 A;  2A6X A;  3ZYR A;  4KWJ A;  2BV4 A;  2D7F A;  2D5H A;  2UY9 A;  3HBK A;  3I3Q A;  4MYE A;  5DAV A;  2BNN A;  4CDU A;  5JIU A;  4IQP A;  4JV4 A;  1MS3 A;  5FZO B;  3C7O A;  4IXL A;  4BOW A;  4Q0U A;  4KU7 A;  1S0G A;  2JDZ A;  3Q8F A;  4QPI C;  4HPK A;  1F15 A;  4XFB A;  3KLS A;  1ZBE 2;  2RM2 2;  3AYC A;  1Q8P A;  1FX5 A;  3D5O A;  4PLO A;  1JW6 A;  1TQ5 A;  2RMU 1;  4X6R B;  3LEK A;  2YPJ A;  3AFG A;  5FP3 A;  4CDW C;  1CPN A;  3ACI A;  3CEW A;  4IGQ A;  3VHO A;  1PO2 2;  1FAY A;  1OUR A;  1V6K A;  1XJA A;  1C1F A;  2QE3 A;  2YY1 A;  1A8M A;  1GUI A;  3D3A A;  4LO7 A;  4Y22 B;  4D69 A;  3RZH A;  1DBN A;  3B00 A;  2GC2 A;  5T5L A;  3DKQ A;  4B3N A;  1JMU B;  1OLM E;  3T2Q A;  3I2F A;  4XTP A;  3HOB A;  5LEJ A;  5JR7 B;  4YLZ A;  1AYM 2;  4HAN A;  5FZ6 A;  2HWC 2;  1JBC A;  5C9A B;  2VMI A;  1W6N A;  4QX3 A;  1K42 A;  1GSL A;  1HX6 A;  1V6O A;  2JD9 A;  3CZJ A;  1GZ9 A;  4JKK A;  4QPG C;  4RYD A;  4D7S A;  1EP0 A;  5JXI A;  4XJA A;  1PX4 A;  1YFY A;  2AR6 A;  2RR1 2;  4QPG A;  5CEH A;  5FZ4 A;  4E4S A;  3VD7 A;  5IHR A;  3CU7 A;  1XBF A;  4V1P A;  2DDU A;  4Y4Y A;  2CHH A;  3N9Q A;  3BTA A;  2RDQ A;  4WVZ A;  4RGA A;  3DYO A;  3AYE A;  3M70 A;  3D4K A;  1R1A 1;  5DZF A;  2D44 A;  3KGL A;  2ZX2 A;  2FCU A;  2JE8 A;  3ATG A;  1AX1 A;  2XBO 1;  3H8R A;  5FYU A;  3AL5 A;  4CDU B;  4BWO A;  1F4H A;  2G9Z A;  2OX0 A;  3FFZ A;  2W9X A;  2CNA A;  5A7Q A;  4MGZ E;  2W1Q A;  1AVB A;  4JRA A;  2VQU A;  3R4U A;  2QQK A;  4UW3 A;  1H1I A;  1S0E A;  3OGS A;  3V56 A;  3B01 A;  1I6X A;  1AXZ A;  5IVE A;  3PJY A;  4HKW A;  4UBH A;  5LCW L;  2YU2 A;  4OUL A;  1TMF 3;  3LPF A;  4W8J A;  5HBA A;  2JEM A;  3NJZ A;  5KC5 A;  3T08 A;  4EWD A;  3PMS A;  1GYK A;  4TYS A;  4QD2 A;  4Y22 A;  4QXB A;  3T3Y A;  5FOJ B;  5ANQ A;  3E5Q A;  3OD0 A;  5JI7 A;  1DGR N;  2IXK A;  3JCI A;  4LOT A;  1XPW A;  5KXC A;  4QMA A;  5LBF A;  4ZXE A;  3O1S A;  2XJQ A;  2G9G A;  2ZGN A;  1OFS A;  2QQO A;  1JXN A;  4KGQ A;  5DAX A;  1RUD 2;  3WG3 A;  2PLV 1;  1QQP 3;  1YFW A;  4IEQ A;  3RS6 A;  3VGI A;  3Q8B A;  1RUI 1;  2HWB 1;  3O12 A;  4AVC A;  4CUB A;  1QJE A;  4PF5 A;  4HT1 T;  1VBB 1;  4FQZ A;  2VZV A;  1ULF A;  3Q8A A;  2R6Q A;  1PO1 3;  4OZX A;  1S0C A;  1YCI A;  2SLI A;  3MO4 A;  4A7K A;  3ZKU A;  4QKF A;  4BQ1 A;  1QOS A;  2MEV 1;  3N7M A;  4P9Y A;  1LUL A;  3RG0 A;  1BEV 3;  5FZK A;  1BBT 2;  1OA4 A;  4QQL A;  5DAP A;  2A6W A;  4CE8 A;  3RZG A;  2W0X A;  4RHV 3;  1CGP A;  5J48 A;  2GNM A;  2WAB A;  4FPE A;  4LLF A;  5E6H A;  3ETQ A;  2ZMK A;  4JRL A;  2RS1 1;  5T5P A;  4FQ4 A;  4BLI A;  3FHI B;  1QIQ A;  3J7H A;  4TLF A;  3UGG A;  2CY6 A;  3ZFE A;  2LRO A;  3T4H B;  1D4M 2;  4D8M A;  1W6O A;  2BBV A;  2IZW A;  1AR8 3;  1VAK A;  4O7X A;  2J1R A;  3FJS A;  2P3J A;  3L2H A;  1YJL A;  2QZ3 A;  4BHP A;  4H55 A;  4XJW A;  3CIH A;  3WQB A;  1QH6 A;  1B35 A;  1HRV 2;  3TOJ A;  5JIA A;  3UGH A;  1HXS 2;  2WS9 1;  1ZRE A;  1B35 C;  5FZH A;  5FWE A;  1UOJ A;  1QY4 A;  1R09 3;  2L9L A;  2Q1F A;  4FFI A;  4QX0 A;  5D1I A;  3TN9 3;  4AI9 A;  5GZC A;  2LAL A;  5FY4 A;  3VDD A;  1VIW B;  4RS5 A;  3J8F 1;  1EV1 1;  1U5I A;  4UWD A;  3VBH C;  3AZZ A;  3VBO B;  1RUJ 3;  2VUC A;  3GHN A;  4OLL A;  1QQP 2;  5JOX A;  5AC9 1;  2VQA A;  3VD3 A;  4LUM A;  3GJA A;  4FPG A;  2JDY A;  2D93 A;  1PMI A;  1AL2 2;  3U4X A;  1SFP A;  5LAS A;  4JKM A;  4KI5 M;  3TAY A;  3RI9 A;  1UL9 A;  1BK0 A;  4Q4X 2;  5A3L A;  2EVX A;  2Q1M A;  2D6M A;  4QQH A;  1XQN A;  3USU A;  1HXS 1;  2CWS A;  2WS9 2;  3ZN5 A;  1S2B A;  1US2 A;  3T30 A;  2UUR A;  1GZC A;  2BTV C;  3ABZ A;  2UWC A;  2LRP A;  4A6O A;  3INA A;  4B1L A;  4YSF A;  3ITQ A;  3LOI A;  1CAX B;  2E32 A;  4AED B;  2QKD A;  5JPN B;  4IV3 C;  3WHU A;  2JJ6 A;  1JZ2 A;  3M1H A;  1W3V A;  4IV3 A;  4LA3 A;  4YGE A;  1UY2 A;  2ZGL A;  2VPV A;  1QNW A;  2QDR A;  4MHR A;  1D4M 1;  2VW1 A;  3WR0 A;  4BM8 A;  1W8T A;  3MGU A;  1YYN A;  4CCL A;  4QGL A;  5BNP C;  2GMM A;  2R0F A;  4IW3 A;  4XFF A;  3V0A B;  3ETP A;  2Q8D A;  1J3P A;  3AZV A;  5IVJ A;  1W6M B;  3I3M A;  1BBT 1;  1FOD 1;  4H3W A;  1KDM A;  4WZC A;  2Q8O A;  1ULP A;  2PA7 A;  2J22 A;  2ZAC A;  3JB4 C;  1VMF A;  2VZP A;  4HOO A;  5A3U A;  4AI1 A;  1JTZ X;  1C57 A;  1YQ6 A;  1RHI 1;  2HWD 3;  1MEC 1;  4TXW A;  4XFG A;  4NRM A;  2EXJ A;  3MW3 A;  2LS6 A;  2UY8 A;  4XQW A;  1GWK A;  5EZW A;  2JEC A;  5DAW A;  4AXO A;  2ATF A;  1AXK A;  4HKO A;  4Y4R A;  4FTE A;  4NHM A;  1XU1 A;  3V64 A;  1W6Q A;  4W65 A;  1X8E A;  4HK9 A;  1Y9G A;  4NII A;  4BQY A;  1W0O A;  2E53 A;  4UF0 B;  3PL0 A;  4E4D X;  4G9S B;  1PO2 3;  3LDK A;  2RJL A;  3N7K A;  1W9W A;  1XOY A;  2VZQ A;  1XU2 A;  3AP5 A;  5CB7 A;  3MV1 1;  2NMN A;  4B7E A;  4LHS A;  4AYU A;  2FHR A;  4GWJ A;  4QU2 A;  2Z79 A;  3ZXG A;  2R04 1;  3AMH A;  4XQ4 A;  2B7Y A;  5AC9 2;  1XNK A;  1UY1 A;  2UWB A;  3FHA A;  3WXP A;  4AQS A;  3CKH A;  3VDB A;  1CZT A;  1Z78 A;  3OG2 A;  2JX9 A;  4KGG A;  1Q43 A;  4BQ2 A;  5K9Y A;  4HSJ A;  3WNX A;  4GAZ A;  4OZO A;  4NIG A;  1W04 A;  2BRT A;  4IEW A;  2VC9 A;  3OGG A;  2Y6J A;  3BAL A;  4DFS A;  4XUN A;  2GU9 A;  3IMN A;  5JSP A;  1URX A;  2YU1 A;  4FFG A;  3USS A;  1EYB A;  1TEI A;  2HLE A;  5EYY A;  1SDW A;  1XE7 A;  3P3N A;  4GIQ A;  5JCT A;  1GQP A;  3H7Y A;  3OYW A;  2C0Z A;  2RJK A;  4Q8L A;  2VOK A;  1ALY A;  1WLW A;  3HAG A;  4IER A;  4CP2 A;  1LHW A;  2VNR A;  5HCF A;  1AYN 3;  5CG8 A;  3IT8 A;  5GLU A;  3AKR A;  5HXV A;  4CEW C;  1O8S A;  3ZYI B;  1X9T A;  2Q8C A;  1SAC A;  3LWC A;  4K21 A;  2JDH A;  2WKK A;  1ZRI A;  4DEV A;  4ES9 A;  1RUH 2;  2QVS B;  2OXB A;  3SCG A;  1AZD A;  1MPX A;  1UU6 A;  3NNF A;  3IN9 A;  2QFE A;  5FO9 B;  4MXV A;  1UIK A;  4OUE A;  3CJI B;  3VBF C;  1W28 A;  1VRH 1;  1UMZ A;  1Z0H A;  2YV8 A;  4OI1 A;  2IXL A;  4HZF A;  3LB9 A;  4Q8K A;  4ATE A;  1KGY A;  3B94 A;  4ARY A;  4M3C F;  3VKM A;  1V6J A;  3E5U A;  1SLA A;  1VB2 A;  1ZZ7 A;  2ZZJ A;  3MIH A;  4KWL A;  1PK6 A;  2PLV 3;  5GLV A;  4YZ3 A;  1GQG A;  2HEY F;  3WNN A;  4EWE A;  1VBC 3;  5C4W B;  1JYT A;  3VBS A;  1LU2 A;  5JPM B;  1J83 A;  3NV3 A;  5CIR A;  1QDO A;  5FZM A;  5LA2 A;  1JOJ A;  2NPI A;  1TNR A;  1LOB A;  4BQ5 A;  1OH4 A;  2E7T A;  4NUB A;  1U12 A;  1MQT A;  2PTM A;  2Y64 A;  4CP9 B;  4RGK A;  1KQR A;  1JOP A;  1WLD A;  3V0B B;  5T54 A;  4YVW B;  1SHW B;  4OQ9 A;  4LK7 A;  4XFC A;  4M4R A;  1CES A;  4BIO A;  3RZZ A;  3WNL A;  2C5D A;  1RJ8 A;  2HH9 A;  3ZDV A;  2FDJ A;  4AL9 A;  1YI7 A;  4KG0 A;  3IDB B;  2WQ8 A;  3FFQ A;  4E9K A;  4XF1 A;  2RS5 2;  4Q4W 2;  1F2N A;  2J1S A;  1W6P A;  3IDC B;  3RI8 A;  3FLP A;  4V2W A;  4B4P A;  1C8N A;  1HQL A;  1FAT A;  1H6X A;  4CTE A;  2W2I A;  5C3O A;  5C5T A;  5GLT A;  2B42 B;  2XB6 C;  4YYO A;  1TG7 A;  4MGT A;  3I2I A;  3RQ0 A;  3O0W A;  5DDJ 1;  1DYO A;  3TN9 1;  2XPJ A;  5DZE A;  2A6Z A;  3ZPO A;  3U14 A;  1WBF A;  4HSL A;  5H9Q A;  1XSQ A;  3DEM A;  4XFA A;  4YVS A;  5EJZ B;  1KJR A;  2O0O A;  2DU0 A;  4N7U A;  1DQ4 A;  3T4V A;  1H4G A;  1OKO A;  3OBZ A;  4QQP A;  4W4Z A;  3UNP A;  3IPV A;  2WYF A;  3OTF A;  3C3V A;  3AZY A;  1S4C A;  2XWB B;  2QQL A;  3KZ4 C;  1H8V A;  4UI9 L;  3RNS A;  4YM3 A;  1RUN A;  5FXW A;  1DCS A;  1PMH X;  1JU4 A;  1DG6 A;  1CN1 A;  1WW7 A;  3MW2 A;  3W21 A;  4BME A;  1W6Q B;  2GNB A;  2DCY A;  3FLR A;  1RUH 1;  1LHV A;  4DXR A;  1ZVF A;  3AP6 A;  1JZ8 A;  2W68 A;  5FZG A;  3MIG A;  3WNM A;  4RA0 A;  4B4R A;  3KV6 A;  2Y0I A;  5FZE A;  4ITC A;  3SKV A;  4Y5Z 0;  3THC A;  3CQO A;  2E31 A;  4KU8 A;  1O3R A;  2IUW A;  2HYX A;  2ZAH A;  3NNJ A;  3PVO A;  3MPB A;  4QKB A;  2R0H A;  2YMZ A;  4OHX A;  4PQ9 A;  5L73 A;  1DZT A;  4FXG B;  1J58 A;  1WCU A;  2XJP A;  3O5S A;  4XUO A;  1D4M 3;  2A75 A;  2NZ9 A;  3IZO A;  4LIV A;  3UET A;  1GWM A;  3LIH A;  4BIS A;  1JYC A;  3POF A;  5E88 A;  1BVP 1;  1POV 1;  3KCX A;  3CJI A;  4FCA A;  4ES8 A;  2OS2 A;  2D3S A;  3I49 A;  5F32 A;  4CXY A;  2RE9 A;  2JG8 B;  3WDT A;  1N3P A;  1QJU 3;  1RUE 2;  4R4Z A;  4KBZ A;  3ZN4 A;  4GJZ A;  3WP4 A;  5JVV A;  3ZR6 A;  2HWF 3;  2WBK A;  2RR1 3;  5M0T A;  3POB A;  3O1V A;  3TN9 2;  2BYV E;  5DG2 A;  3Q8C A;  4LEJ A;  1PO1 2;  5KHH A;  2Y6L A;  4CU6 A;  1ENS A;  1HB2 A;  3PIG A;  5A1F A;  3QLQ A;  4PDW C;  3NV4 A;  3UJQ A;  2ES3 A;  1QJU 2;  1AX2 A;  1FMD 3;  1RUE 3;  2C24 A;  1WA6 X;  2JWP A;  3RVH A;  2PQS A;  4ZHN A;  5F6L B;  4A42 A;  3DYP A;  4JGZ A;  3LPG A;  4FOW A;  1LHN A;  1WGP A;  2P17 A;  4WZF A;  1YEW A;  2D6K A;  4P9X A;  4PF1 A;  4YWA A;  1HJF A;  1O91 A;  3LOB A;  2VY0 A;  4YVS B;  5FMO L;  2R1B A;  1RUI 3;  2HWB 3;  4MET A;  2GC1 A;  5J36 A;  5D21 A;  2W5F A;  3PIJ A;  2HWF 1;  1WZX A;  2IVJ A;  2YBP A;  1JYW A;  2BVV A;  4Q0V A;  1W99 A;  2BWA A;  2VCC A;  2HWE 1;  4K40 A;  5FY0 A;  1JHJ A;  1UOG A;  2CDP A;  3GBF A;  4OHV A;  1WW6 A;  2DUP A;  3E97 A;  4XXP A;  2DTY A;  4FPO B;  2WLP A;  3POJ A;  1ULO A;  5F5Q A;  5E89 A;  5EWS A;  3RJR A;  1ASJ 1;  2QQU A;  1W2A X;  1CPM A;  3O1O A;  3VD9 A;  4CCM A;  1L7Q A;  4K1Y A;  3D0S A;  1UY3 A;  4XHX A;  1UQX A;  3RPQ A;  3JQW A;  4R9A A;  2IFW A;  1J1T A;  1Y3T A;  4XUQ A;  3WP6 A;  3ZR5 A;  3BOP A;  1ZYB A;  4F8A A;  3VDD C;  5D8A A;  1QEX A;  3KHC A;  5A7N A;  3VZJ A;  5EV7 A;  3WG2 A;  2D6O X;  4K3U A;  4QU1 A;  2EF6 A;  2JDN A;  3I3D A;  5GJ6 A;  2YZ4 A;  2WWJ A;  2XUM A;  1W0N A;  2RVA A;  3BTX A;  3AP7 A;  2B4K A;  5DUX A;  3VZN A;  2VMF A;  5FZ0 A;  5FP4 A;  1CJP A;  2W46 A;  2WII B;  4HLT A;  4MO3 M;  4AGG A;  1OBN A;  3J8F 2;  4IND A;  1BEV 2;  1GNY A;  1PK6 C;  4CCJ A;  2WO2 A;  3THT A;  5BNN C;  1W2U A;  3LQC A;  3VBS C;  5JSR A;  2QJV A;  1BMV 1;  4EQV A;  3TEW A;  2FBE A;  1C28 A;  3WF1 A;  4WM7 C;  4D6Q A;  3V0A A;  2ARE A;  3IMM A;  3JBG 2;  5IVF A;  1UOF A;  3PU8 A;  5CA6 A;  1ZM1 A;  3PU3 A;  1V9U 2;  2Y6F A;  3PLQ A;  4K7J A;  4DXS A;  4GB3 1;  4LKD A;  4UW4 A;  4WVM B;  2ZX1 A;  4OI0 A;  4IES A;  2WNU B;  1QU0 A;  3GCW A;  1FT9 A;  3AMN A;  4NHL A;  5CIS A;  4ZKT B;  3BPZ A;  3H8X A;  1HLC A;  2OUJ A;  1WLC A;  3B02 A;  2BBA A;  4QX1 A;  3KCC A;  4XOG A;  4F7Z A;  3ZYF A;  1QJU 1;  2VMD A;  3CZU A;  5LA1 A;  5J96 B;  3GGL A;  5EIY B;  2AAC A;  3HQR A;  1HRI 1;  2KA3 A;  4Y1Z A;  2ADD A;  2VUA A;  3S57 A;  3IPV B;  1GAN A;  5J98 B;  1BK1 A;  5FPU A;  4QB1 A;  2PEL A;  4RHV 2;  2FCV A;  4DNY A;  2VTX J;  2MEV 3;  2RMU 3;  3GZE A;  1PK6 B;  5ACA 2;  2ARB A;  4UOJ A;  1NCR A;  1KIT A;  1W9S A;  1ND2 B;  2YPD A;  2ZML A;  3OBA A;  4OMD A;  5IVY A;  5LAT A;  3VN4 A;  3NL1 A;  2I45 A;  2P5B A;  3D8C A;  5EHD A;  4L2N A;  4XTM A;  2JXA A;  1RXG A;  1OHF A;  1UX6 A;  1W9Y A;  2VBB A;  2WNV A;  4IGP A;  4N53 B;  5A3T A;  3ES4 A;  2HWE 2;  2AEZ A;  4LLO A;  2XL9 A;  3PTR B;  1F4A A;  3HR9 A;  5H9P A;  1RED A;  3SH5 A;  2NYY A;  2VE1 A;  4ISR A;  3DF0 A;  1QOT A;  4EN7 B;  2W92 A;  4DPN A;  1UXZ A;  1ND3 C;  3E6B A;  2GC0 A;  4E2S A;  4D3W A;  3IKW A;  4GXL A;  1BEV 1;  2X5I C;  4MV2 A;  1MVE A;  4P9G A;  1UOB A;  1LES A;  1AL0 G;  2ARX A;  4KNC A;  4U2A A;  5LBB A;  4K8F A;  4XAA A; 
#chains in the Genus database with same CATH homology
 3DYO A;  2JE8 A;  5IFT A;  2VMC A;  3LE0 A;  1F4H A;  3C8X A;  1GOG A;  2QQN A;  2W9X A;  2BZD A;  2XQX A;  4DUW A;  2EIB A;  4P00 B;  2W1Q A;  2VQU A;  2QQK A;  3OGS A;  5B4X A;  1K3I A;  1O8P A;  2XHN A;  5LCW L;  2W95 A;  3LPF A;  3MUZ 1;  1UYY A;  1XNT A;  4W8J A;  4ZY9 A;  4A45 A;  3III A;  3T08 A;  5G04 L;  3OEA A;  1OT5 A;  3FN9 A;  4QDS A;  2QQJ A;  3F2Z A;  3AC0 A;  3K77 A;  2ORX A;  3A22 A;  3WSO A;  1XPW A;  2B9V A;  2WZ8 A;  3EB7 A;  4ZXE A;  3FL7 A;  5JXG A;  4CU8 A;  2QQO A;  2YFZ A;  4BDV B;  1J84 A;  4TTG A;  5EJ1 B;  2VCA A;  4PT6 A;  3IDA A;  4CUB A;  4CVU A;  2VZV A;  4W50 A;  5DMY A;  3MO4 A;  5DN2 A;  1KEX A;  2LW8 A;  2E26 A;  2VOT A;  2J1T A;  3MV0 1;  1W8O A;  4CU7 A;  4LKS A;  3ACH A;  3HNB M;  2WAA A;  1JZ8 A;  2C26 A;  2WAB A;  5HXM A;  3P1I A;  3J7H A;  3I97 A;  3T09 A;  2Z4F A;  4D8M A;  1UWW A;  2J1R A;  2YB7 A;  1UY4 A;  3E1F 1;  3CIH A;  3WQB A;  3I2J A;  3VDC A;  3UES A;  2X05 A;  3ZM8 A;  5CYY A;  1US3 A;  4QX0 A;  2L9L A;  1W8N A;  2V5D A;  4P08 A;  3GXU A;  4GZ9 A;  5I0D A;  4OMC A;  1CX1 A;  1GMM A;  3OGR A;  1DP0 A;  4ET7 A;  3VD3 A;  1OD3 A;  2KD7 A;  4BXS V;  3HJR A;  2ZEY A;  4JKM A;  4KI5 M;  3P6B A;  2WN3 A;  5JMO A;  1US2 A;  1UMI A;  3ABZ A;  3T2P A;  1GOH A;  2VJX A;  3FHQ A;  4A6O A;  2QQI A;  3W5M A;  4KMQ A;  1UX7 A;  2E32 A;  3GM8 A;  2YG0 A;  3A21 A;  1JZ2 A;  5J1X A;  1UY2 A;  5JR2 A;  1O59 A;  1IQD C;  4DUV A;  4QDR A;  5LA0 A;  3SEE A;  5IJR A;  5CZK A;  3PUI A;  2VQT A;  3ETP A;  5A1A A;  1UY0 A;  1JZ7 A;  1ULP A;  1EUT A;  5C7G A;  2J22 A;  2WAO A;  2Y6K A;  2VZP A;  3ACG A;  1LNS A;  2YC4 A;  3HN3 A;  4TXW A;  3NJX A;  5HPO A;  3CDZ B;  1WKY A;  2DCJ A;  1PX3 A;  2LS6 A;  2E33 A;  3JXS A;  4FI9 A;  5G05 L;  3EYP A;  3WF4 A;  3MBW A;  3NJV A;  5DQ0 A;  4Z2A A;  1UMH A;  2VTF A;  1W9W A;  3I2K A;  2VZQ A;  3MV1 1;  4RN5 A;  3THD A;  4LHS A;  4DEQ A;  4GWJ A;  1I5P A;  1UY1 A;  3FHA A;  3CKH A;  2W1U A;  3VDB A;  1CZT A;  3OG2 A;  3C7H A;  2BER A;  3K75 B;  3PUH A;  2Y6H A;  2W47 A;  4L0P A;  4A3Z A;  2W1S A;  5DPN A;  1NKG A;  4OZO A;  2VC9 A;  3OB8 A;  2Y6J A;  2VZS A;  4XUN A;  3T0A A;  2WN2 A;  3I2G A;  1CZV A;  3U37 A;  2HLE A;  4HG6 B;  2JKX A;  2V72 A;  1HN1 A;  1GQP A;  3ACF A;  2C4X A;  4ARX A;  5C70 A;  2WYS A;  1GOF A;  4QDQ A;  3HEI A;  2VZU A;  3C7E A;  1K45 A;  1O8S A;  1PMJ X;  4E8D A;  5JUV A;  2EIC A;  4GWI A;  4DEV A;  2W87 A;  1MPX A;  2Y6G A;  1XNA A;  4QB6 A;  4AAX A;  3LEI A;  4OUE A;  1KGY A;  4QPW A;  4ARY A;  5F7U A;  2ZXQ A;  3HPN A;  3I2H A;  3WNN A;  1SDD B;  3C7G A;  1JU3 A;  1J83 A;  2VZO A;  1YQ2 A;  3CMG A;  5LA2 A;  4MGQ A;  4LQR A;  1DLC A;  4JHZ A;  3WF3 A;  1CZS A;  4AG4 A;  1OH4 A;  2W94 A;  3W5N A;  1WCQ A;  3T0B A;  4CUC A;  2Y64 A;  2W1W A;  3HNM A;  4M4P A;  2J1U A;  1SHW B;  4BK4 A;  4M4R A;  3WNL A;  3BGA A;  2VL4 A;  2WQ8 A;  1UZ0 A;  3K4D A;  1NUK A;  3K4A A;  4A4A A;  2J1S A;  4KWU A;  3VDA A;  2YC2 A;  3SEP A;  1D7P M;  1H6X A;  3T0D A;  1TG7 A;  1UYX A;  1GU3 A;  3I2I A;  1NX9 A;  2ZEX A;  1DYO A;  1H6Y A;  3GDB A;  5EJZ B;  1JYX A;  2ZEW A;  4W4Z A;  4XUP A;  3UNP A;  4QAW A;  4CUA A;  2CDO A;  4OYU A;  1RYY A;  2QQL A;  4XUT A;  4UI9 L;  1PMH X;  5IYY A;  1JU4 A;  1BHG A;  4DXR A;  2QBX A;  4A44 A;  4P02 B;  2VZR A;  3SKJ E;  3WNM A;  1R64 A;  3WNP A;  1SG3 A;  1L7R A;  3SKV A;  3THC A;  3CQO A;  2J1V A;  2E31 A;  1JZ3 A;  3WEZ A;  2HYX A;  2VO5 A;  2V4V A;  2BGO A;  3DYM A;  2VM9 A;  2BGP A;  2R7E B;  2VR4 A;  2XOM A;  4MGS A;  4XUO A;  1OF3 A;  3UET A;  2J1E A;  5B4N A;  3LEG A;  4LPL A;  2ORZ A;  1K12 A;  4MAD A;  3IAP A;  4MOA A;  2VCB A;  1CIY A;  4BK5 A;  3T2O A;  2WBK A;  2VZT A;  4XUR A;  3WNK A;  4CU6 A;  2Y6L A;  3MUY 1;  1EUU A;  4JX0 A;  3ECQ A;  4QX2 A;  2PQS A;  1OF4 A;  4A42 A;  3DYP A;  1W9T A;  3LPG A;  4PF1 A;  4UAP A;  3NNG A;  1JYN A;  2X09 A;  1UXX X;  5FUI A;  2C9K A;  3NQH A;  3WNO A;  4XZU G;  5JXH A;  2W5F A;  2YFU A;  1JYW A;  2JDA A;  2WDB A;  1W99 A;  2VCC A;  3OGV A;  2Y8K A;  1JHJ A;  2CDP A;  1JZ6 A;  3HNY M;  3K46 A;  1ULO A;  1TVG A;  3WF0 A;  4ZZ5 A;  3I3B A;  5JXJ A;  3VD9 A;  4XVH A;  1UYZ A;  2OKX A;  1L7Q A;  2RV9 A;  1UY3 A;  3BN6 A;  4XUQ A;  4IUG A;  5IFP A;  2WZE A;  1JZ5 A;  5C71 A;  4PQQ A;  2ZEZ A;  4A41 A;  4DUX A;  3I3D A;  3A23 A;  3WF2 A;  1W0N A;  2RVA A;  3DEC A;  4YPJ A;  2B4K A;  3A7Q A;  2VMF A;  2VZ3 A;  2W46 A;  3I3E A;  4MO3 M;  4BJ0 A;  2W3J A;  3IAQ A;  4ZZ8 A;  1GNY A;  1P8J A;  1NAE A;  2WO2 A;  2QQM A;  2XON A;  4JKL A;  2WO3 A;  3LQC A;  3NRU A;  1JI6 A;  2WO1 A;  3WF1 A;  1XC6 A;  2EIE A;  3IB3 A;  3VD5 A;  4DXS A;  4D0Q A;  2J1A A;  2X10 A;  3C7O A;  4QX1 A;  2BBA A;  4DXT A;  2VME A;  2VMD A;  3CZU A;  5LA1 A;  2WUH A;  3GGL A;  5EIY B;  2EID A;  3LEK A;  2ID4 A;  3ACI A;  1JYV A;  1GUI A;  3D3A A;  4QB1 A;  3VD4 A;  4UOJ A;  1W9S A;  3T2Q A;  4CU9 A;  3OBA A;  4OMD A;  3I2F A;  3C7F A;  3HOB A;  4QB2 A;  4P5Y A;  2W91 A;  4E8C A;  4QX3 A;  1K42 A;  1T2X A;  2JD9 A;  3CZJ A;  4JKK A;  1F4A A;  2DCK A;  4RYD A;  5JXI A;  1PX4 A;  3K4Z A;  3VD7 A;  5IHR A;  1JZ4 A;  2W92 A;  1UXZ A;  2DDU A;  2VZ1 A;  2RJ2 A;  3OEB A;  2J7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...