4ET7A

Crystal structure of eph receptor 5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
174
structure length
174
Chain Sequence
NEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ephrin type-A receptor 5
publication title Crystal structure of Eph receptor 5
rcsb
source organism Homo sapiens
total genus 25
structure length 174
sequence length 174
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4et7A00
3WF3A 1UY3A 5DMYA 4HG6B 4KI5M 1K3IA 2WAAA 3CKHA 4CU6A 3CDZB 1BHGA 2B9VA 1JYVA 4XVHA 5JXHA 2V5DA 5B4NA 1GQPA 1K12A 3PUIA 3VDBA 3A21A 3I2JA 1J84A 3K4ZA 4UOJA 2VCCA 2YC4A 4D0QA 3I2HA 3GM8A 2J1TA 1PX4A 4AAXA 2W92A 3THCA 3THDA 1CIYA 4GWJA 1O8SA 3A7QA 4ZY9A 1JYWA 4LPLA 3T08A 2HYXA 2VZSA 2VZ3A 2Y6LA 4OMDA 4A44A 2PQSA 1UY4A 4QDQA 1UXXX 2BGPA 4MOAA 3SEEA 2W47A 2WO3A 2VZ1A 5LA2A 5JXIA 2L9LA 4CU9A 3WNNA 2QQOA 1JZ5A 5A1AA 3WSOA 2VMFA 3K4AA 5IFTA 1O59A 3UNPA 1CZTA 1DLCA 3WF1A 1L7RA 1XC6A 2QQKA 1JHJA 1WKYA 2WDBA 2W1UA 3OGRA 1IQDC 3SEPA 3NNGA 3WNMA 2EICA 2BBAA 4A42A 2VZVA 4XURA 2QQJA 3GXUA 3PUHA 3I3DA 2E31A 3VD4A 3OEBA 3GGLA 3LEIA 1GNYA 5EJ1B 3UETA 3SKVA 3ECQA 3OG2A 5IHRA 2Y6KA 1NKGA 1ULPA 3VD5A 3HPNA 3K46A 4D8MA 2EIDA 3OGVA 5G05L 2V4VA 4MGQA 1J83A 1PMJX 2E32A 2J1RA 3ACIA 5EIYB 1W8NA 2JE8A 4JKKA 3NRUA 2VO5A 1UY1A 1WCQA 3SKJE 2RVAA 3EB7A 3WNOA 2VZQA 4OZOA 1W0NA 3LPFA 2DCKA 3WF2A 1F4AA 1W9SA 2BERA 3OB8A 3FHAA 2VTFA 2J1AA 2XONA 3T0DA 4GWIA 4RYDA 5C7GA 1W9WA 1EUTA 3ACFA 3HJRA 4QDSA 4QB6A 3GDBA 4A45A 1JYNA 3NJXA 1W9TA 1H6YA 1KEXA 3I97A 3T2QA 3ABZA 1EUUA 3WNLA 2BGOA 5IJRA 2VR4A 2WZ8A 3HNMA 2E26A 4DUVA 4W50A 4XZUG 2W9XA 3C8XA 2Y6HA 3HNYM 4OUEA 2ZEXA 4OYUA 3T2OA 4LHSA 4W8JA 3UESA 2WAOA 2VZOA 4ET7A 5IFPA 4QX1A 4W4ZA 4MO3M 1US2A 4BK5A 2C4XA 3OGSA 2OKXA 2VMCA 1UWWA 4ZZ8A 2C26A 2VM9A 1O8PA 1SHWB 1TG7A 2XHNA 3MBWA 4PQQA 2J1EA 1UYYA 1XNAA 5G04L 2XQXA 4A3ZA 3J7HA 3MUY1 2YG0A 3WF0A 5JUVA 1H6XA 2J7MA 1ULOA 1HN1A 2ORXA 1SDDB 4L0PA 5LA1A 2J22A 3A22A 2B4KA 4UAPA 1D7PM 2XOMA 2YFZA 2DDUA 2WN3A 3C7FA 1JZ6A 4LQRA 4JX0A 2WYSA 3W5NA 3K4DA 3ZM8A 2J1UA 2YB7A 2EIBA 1NX9A 3A23A 4OMCA 2WZEA 1DYOA 5DN2A 2ZEZA 4CUCA 1OF3A 1GUIA 4XUPA 3VD7A 3T2PA 3MUZ1 3P1IA 3HEIA 3LE0A 3BGAA 1OD3A 4BJ0A 3WNKA 2Y8KA 4JKMA 2J1SA 5JR2A 1JU3A 1GOFA 4RN5A 1JZ4A 5J1XA 1XPWA 2CDPA 2WN2A 2W5FA 3T0AA 1T2XA 3OBAA 2BZDA 4QPWA 2VMDA 5CZKA 4BXSV 3IIIA 4AG4A 2WQ8A 4CU8A 1UYZA 1F4HA 1XNTA 5C71A 3FL7A 2VL4A 4QX2A 4A41A 3VDCA 4A4AA 5F7UA 2QQIA 2Y64A 3IB3A 3CZUA 4TTGA 2ZXQA 4M4RA 1UY2A 2J1VA 1GOHA 3I2GA 1JZ3A 4BDVB 5JMOA 2V72A 3VDAA 4KWUA 1JZ8A 3VD3A 3I3EA 1SG3A 3FHQA 4FI9A 5I0DA 4ARXA 1MPXA 2W1QA 3W5MA 1I5PA 2VZUA 3WF4A 4CVUA 2WABA 2W95A 2W3JA 5CYYA 3EYPA 3I3BA 4XUOA 3OEAA 3ACHA 4IUGA 1GU3A 2VCAA 2VZPA 4QDRA 3LQCA 1P8JA 2W87A 4XUNA 4CUAA 1UZ0A 2QQLA 2WO2A 3C7GA 3HNBM 3T0BA 1JZ2A 5LCWL 1YQ2A 3CZJA 1UXZA 3T09A 4CU7A 4JHZA 2Y6JA 3LEGA 3IAPA 3BN6A 3LPGA 3I2KA 2VCBA 2X05A 1PX3A 3WQBA 3ETPA 3I2IA 5EJZB 1KGYA 3E1F1 2W91A 3JXSA 5IYYA 3HOBA 3MV01 3WNPA 1L7QA 3C7OA 4DUXA 1TVGA 2VMEA 2WBKA 2Z4FA 2VC9A 2VZTA 3AC0A 2ORZA 2CDOA 1CX1A 3ACGA 3DYPA 4DEVA 4Z2AA 1UX7A 3FN9A 4QX0A 4PT6A 4QX3A 4ARYA 2EIEA 1JI6A 4MGSA 1LNSA 4UI9L 1R64A 4KMQA 2QBXA 1K45A 3CMGA 3I2FA 2YFUA 3K77A 1GOGA 3MV11 3DECA 5DQ0A 3VD9A 2HLEA 4XUTA 2Y6GA 4P08A 5FUIA 1GMMA 2YC2A 3K75B 4TXWA 3LEKA 5HPOA 1US3A 2X10A 1JYXA 2DCJA 5DPNA 2C9KA 4P00B 3D3AA 1W8OA 4P02B 4M4PA 4QB2A 3P6BA 3CQOA 4P5YA 4YPJA 1OT5A 2VQUA 2JKXA 4ZZ5A 2W1WA 3U37A 3IDAA 4DXTA 5C70A 4PF1A 3F2ZA 4CUBA 2JD9A 5HXMA 1RYYA 5B4XA 2E33A 3C7EA 2ZEYA 2WO1A 2QQMA 4DEQA 2X09A 1W99A 3IAQA 2WUHA 1NUKA 1UY0A 4LKSA 4XUQA 5JXGA 2VJXA 3C7HA 1UYXA 2LW8A 1K42A 4QAWA 2W46A 2VZRA 1UMIA 2W94A 5JXJA 4DXSA 4GZ9A 1JU4A 1JZ7A 2KD7A 3NJVA 2LS6A 4E8DA 1CZSA 1OH4A 2QQNA 4MADA 3WEZA 2RJ2A 2R7EB 3NQHA 3CIHA 1PMHX 1DP0A 1CZVA 4QB1A 3DYOA 2ZEWA 3DYMA 1OF4A 4A6OA 2RV9A 5LA0A 4DUWA 2W1SA 4BK4A 2VOTA 4E8CA 2JDAA 3MO4A 1NAEA 1UMHA 4DXRA 4JKLA 4ZXEA 3HN3A 2ID4A 2VQTA
chains in the Genus database with same CATH superfamily
3KT4A 1MS0A 5GKAC 1SFYA 2A6XA 2ETEA 4O65A 1NT0A 1Q56A 5FPVA 5JVVA 1CIWA 3S5QA 4CDUB 3CKHA 3UT0A 1UZVA 2OUJA 1AXZA 4RQPC 4JDOA 4Y1VA 5E6HA 3RRDA 1FNYA 2JDUA 3KVBA 2B9VA 2DUOA 4HFSA 4JQRA 3O7OA 3D5OA 2WFPA 1GQPA 1K12A 2HBUA 2HBTA 5DAQA 4YW6A 3U1XA 3PUIA 4CDUA 1ACCA 2VAUA 2VW2A 4FPLA 3SXWA 4CPBA 1J84A 1QOSA 3OTFA 2VCCA 4UOJA 2CV6A 3A0NA 4NUBA 5EJ3A 4YM0A 4S2HA 4C90A 4DS0A 4E27A 3GZAA 3PHMA 3WG3A 3WP3A 4AAXA 1MACA 2EAKA 1N1YA 4H7MA 3POYA 3JBG3 3MFCA 3OBRA 1I5ZA 5LW9A 2NP0A 2XVGA 3M3OA 5JZGB 1R091 4LPLA 2UU8A 3H8OA 1F15A 1EYBA 4ASKA 4QGNA 2QKDA 2HYXA 2R16A 2VZSA 2Y6LA 4A44A 3KV4A 1BEV3 3R0RA 3PU3A 1UPIA 4HKOA 4BH9A 1D4VB 3GZTB 3D4KA 1UXXX 5JZGA 3WP4A 3SEEA 3JUUA 2W08A 2BVVA 1KDKA 1QXPA 3JB8A 5JXIA 1AHSA 4P9WA 2P2KA 2BWCA 2K0GA 3QACA 4CU9A 1EV13 1PIV3 5A1AA 5E16A 5IFTA 2K9ZA 3LDBA 5FYHA 3URFA 3WXPA 1LHOA 5FR3A 4DQAA 3UNPA 4NRMA 3AL6A 1R1A3 4LKDA 1OMIA 4AXOA 2LALA 4LO8A 4OZXA 5FMOS 4H14A 3WF1A 1XC6A 1W8ZA 3TYJA 1JHJA 3MF6A 1AL22 2I74A 2R073 3OGRA 3LWCA 4N9HA 1IQDC 1RUJ1 4AI0A 4E9KA 4UW3A 3RSJA 1UKRA 1ZYBA 3ZXDA 2VW0A 5A3OA 2A73B 1QJU3 2VU9A 4HSJA 1O91A 1TME1 1QQP3 2D6KA 4J25A 2FMDA 5IK8A 2A3WA 2HWB1 1BVP1 3SH4A 2VUAA 1D0GA 5ANQA 5F2WA 3GGLA 5I0UA 1W6MB 2JDZA 1IHMA 4AQ2A 3LKJA 4EZ4A 2VBDA 1LJ7A 1FXZA 4CXWA 3WUCA 2GP5A 3AKQA 2PAEA 3JD71 3KLSA 3OG2A 5IHRA 4BQ3A 3GBGA 4FOQA 4AEMA 3RWNA 1WUVA 1PZ7A 1A78A 1XYPA 4AEDB 1W6MA 4D8MA 1JUHA 1WLTA 2EIDA 2HYKA 5D8AB 2V4VA 4EN8B 5FZDA 3JQWA 2EAAA 3ACIA 5EIYB 1W2UA 4AVSA 5F5CA 1F31A 1XNBA 4BLJA 5A3LA 5ACA2 2EIGA 4KH9A 1XSRA 4NN0A 4D3WA 4AEDA 3PVNA 2WQ4A 3EB7A 4W6XA 5D8AA 4BZ4A 2VZQA 1W0NA 1KQRA 1OA4A 1F4AA 3HBZA 1AYM2 4TSVA 4AFMA 4YG6A 3WQ1A 5FY8A 5T5OA 3ZN6B 5JOWA 1AX1A 1JYIA 5FO7B 1UMZA 1X36A 4Q4Y1 3CEWA 4R9CA 3U75A 5FYBA 5F5QA 1REDA 2Y0OA 1W2OA 4GWIA 4K1YA 5FWEA 1OVPA 2ZGKA 4EN0A 3MZHA 1QHDA 3PVBB 4AF9A 3TNQA 2B8MA 3HR9A 4IGOA 1UNBA 3OJBA 1W3VA 4R9AA 1EUTA 3ZN6A 5K8SA 4WM8B 3N7JA 1ND2C 1JYNA 1UF2C 1H6YA 1W9TA 1G7YA 3ETQA 1ENSA 2JE9A 2ZOEB 4RFRB 3L9JT 3WNLA 3ZVXA 1ODMA 3HNMA 3IT8A 1NE4A 3N9QA 5T5LA 4W50A 5A1FA 1UQXA 3SISA 4IEPA 4PLOA 4HOOA 1U5XA 3HNYM 2Y6HA 3BODA 4WM8A 1DYPA 1W6NB 2RMU2 4LBKA 2VNGA 4NAMA 4Y1ZA 2A7AA 4ATFA 4ET7A 4B4PA 3VBHB 1TME3 5DAVA 3ZXJA 5FO9B 2FDFA 4YGDA 4P9GA 2HWB3 2ZJCA 2DU0A 1W90A 3VKOA 5KHIA 4DMIA 1C4RA 4E4HA 2C4XA 5LZ6A 3OGSA 1VR3A 3OOXA 1W6NA 5CBLA 1DZTA 4RR3C 4NIGA 2ZGNA 2C26A 2CAUA 4O9GA 1VMHA 2E53A 1YFWA 4PQQA 3VBHA 4FAHA 3E5QA 2UWAA 3JD73 5F1RA 5LRRA 2GU9A 1GZTA 4XF4A 5EZWA 5BNNC 4A3ZA 3RZMA 3WF0A 5CU1A 4TWTA 1YCIA 3IDCB 4N9IA 4I3GA 4OHZA 4CDWC 5KR7A 5JSOA 4KG8A 5DUXA 4ZU4A 2Y0IA 4ES8A 5A6QA 3LOIA 2B4KA 5FZ4A 1SEFA 4UAPA 4ZPIA 2DBIA 4OI1A 3MLLA 1STMA 2XOMA 2ET7A 1IPSA 3AMQA 3BU0A 2GH8A 5FO8B 4HL0A 1JMUB 1GV9A 2XG3A 1KXGA 2VQAA 5IATA 5DZEA 3W5NA 3J9SA 1YQ8A 1T6BX 2VTXJ 1QXJA 1GYKA 2J1UA 4QKFA 2R1DA 4Q4W1 2Q8CA 2E9QA 1AYN2 2IXIA 4OMCA 3WUDA 4Q4Y3 1DYOA 3ZYGA 1VBA2 4OHVA 4C91A 3BTXA 4IEYA 1GUIA 5FBZA 1KJRA 2VOWA 5A7QA 2ZBJA 5C5TA 3MUZ1 1JYTA 3MIEA 4FQZA 4MGIE 5H9PA 5E88A 1PHMA 1GKBA 1OD3A 3CJIC 4Q1RA 4LA2A 4BJ0A 4AQ6A 2WS92 2Y8KA 3OGGA 2B42B 3ZFEB 2J1SA 4XBQA 3LD8A 4E2QA 3GBFA 1JU3A 1ULDA 5CG8A 1VAKA 3RFRA 1XJAA 2HH9A 2WN2A 2IC1A 2W5FA 3O0WA 4L99A 5F3CA 4CCCA 1CJPA 2VMDA 2VTXA 3H9AA 3O5SA 2HJIA 4AFBA 5EXOA 3RWKX 4AVAA 1AR91 3SH3A 1DZRA 3S57A 3ZFEA 1IS5A 2BOIA 2I45A 4QMAA 3DV8A 4HPKB 3WLUA 1F8VA 3R6SA 4A41A 4YW2A 3IB3A 1GICA 3HBKA 2RM22 4MGYE 5FBJA 3S7IA 5KXBA 2VMHA 2ZXQA 1ZREA 2J1VA 1GOHA 2YBSA 4FOWA 4QWNA 4HPKA 4N90A 4OI0A 4OFGA 2BTVC 2V72A 3FLTA 4HVRA 5A32B 3RDIA 3TBDA 4K9SA 4W6YA 4DNYA 3PUAA 5C3OA 4AEKA 4CEYB 5FJHA 2IXHA 4GXLA 1AL0G 4IL7A 2RJLA 3I3EA 3AYCA 4UBGA 1W8FA 3GCWA 3IN9A 3J7MA 1MPXA 2D97A 3W5MA 3LIHA 3HQUA 3WF4A 2D40A 4U2AA 5FZFA 2W95A 2D6MA 5CYYA 4YVWC 4DIQA 5A32A 1W28A 4KWJA 4CCEA 1Z0HA 1NXMA 4YWAA 5EWSA 2OQ7A 3TEXA 4CEYA 2Z5WA 2X29A 5FZ7A 5I93A 1Z7S1 2WRAA 1ZZ9A 1VRH1 2VD7A 2ZABA 1UZ0A 3T0BA 3UKVA 3HT1A 1JZ2A 1DQ4A 4FO9A 2G9GA 5LCWL 3GYDA 4A6SA 3FLPA 1LECA 4NWVA 4V2WA 1V9U2 3H0OA 1LAJA 5GALA 3KVAA 3RMYA 3AMPA 4QQHA 1DDLA 4Q4W3 4QX8A 1JYCA 2XWJB 1FOD3 3IAPA 4H7LA 3LPGA 2VXJA 5FZ6A 1PO12 1UCXA 3DKQA 2P6HA 4OULA 5FYMA 3VDDC 2AZ5A 1QH7A 1WBFA 3HMYA 1AX2A 2WLQA 3BU7A 2YMZA 2YROA 3POJA 5GLWA 4QGMA 1CAWB 3ENRA 5LY2A 2EXHA 5KXEA 2D6OX 5LWBA 3PJYA 5EJZB 4XIKA 2BNNA 1GZ9A 1RHI2 2W91A 4I3PA 4RR3B 5CKNA 1O3SA 2QQPA 1NZIA 2O8QA 2SBAA 2ZGOA 3D6EA 3MV01 1V6LA 1VBB2 1KD7A 4KWKA 1XYOA 2UURA 4K3UA 4I02A 3WP6A 3SCHA 4ONUA 2VMEA 5FZ1A 4X6RB 3WDVA 1CAWA 2IWGB 2P1BA 4Q0PA 2PHRA 4COYA 2ZEYA 1OFNA 3ZKYA 2Z4FA 5FYZA 5BNNB 1OSGA 1AXYA 1HLCA 3ILRA 3AC0A 3WQ7A 1NG0A 1AR93 5CNAA 5J48A 1CX1A 2VXRA 1T6GC 1V00A 2OPWA 5FY9A 1EAH2 2JX9A 1H30A 1PO21 1UX7A 2EXIA 3FN9A 4I30A 1WW5A 3SLIA 4QX3A 1H2NA 4HETA 4MHUA 3NV3A 3VV1A 4NAOA 5AFBA 1NLQA 3AYAA 3WNXA 5BNNA 5J36A 5GLVA 4W8JA 3VBFC 3SCFA 1MZ5A 2RDRA 1RVF2 5DABA 4KU8A 1FI2A 1O6UA 2YFUA 3AZVA 3K77A 2WA4A 1NCRC 4D6SA 3AKSA 4K7JA 2OA2A 2ZKLA 4DFSA 4CDQB 3VD9A 1FPN2 3H8XA 1QJFA 3ITQA 4EV0A 1BK0A 2EXJA 2WR9A 1ND3B 2VW1A 3U11A 4Q2FA 3V65A 1PGL2 2WSUA 2X53S 2IFWA 2P34A 3KCCA 5FQ0B 1NYWA 3RZZA 4DB5A 2YC2A 3QBQA 4COZA 3OPZA 4XILA 1US3A 5C9AC 2JE7A 2XR4A 2RS12 5FZOB 1RITA 4CDQA 1OVSA 5K4LA 3UV9A 2D43A 2AREA 3BTAA 2DCJA 2IUWA 5FDBA 3O1VA 1ND3A 3USUB 1Z7S3 4XQDA 1RUC1 1VRH3 3PDQA 2Q5TA 2WKKA 3U4XA 5FQ0A 4LHKA 5CB7A 1YYNA 3D3AA 5FYYA 3UL2A 4P02B 1LRHA 1YRZA 5FZOA 3JQXA 3IM0A 3NL1A 5IW0A 4NE9A 4P5YA 4YPJA 2P6CA 1OT5A 2GMMA 2VQUA 2BJSA 3USUA 3JZVA 2W1WA 1QDCA 1W9YA 3MFAA 2JKBA 4BQ1A 3ZXAC 2VNOA 4YW4A 1S0FA 1XU2A 3OBTA 3NNLA 3F2ZA 3TAYA 1BMV2 5HXMA 1PMIA 1AR82 4A2UA 3K51A 2E33A 1UW8A 1U5IA 3C7EA 2VG9A 4Y22B 3ASIA 5JOYA 2CNAA 3WINE 4DEQA 4DXZA 1JOBA 1RJ7A 1W99A 1WMDA 3DUIA 3IAQA 3UKTA 3VZJA 1ZZ8A 3MHZA 2HWD2 4AYUA 1LEDA 4IGPA 4R4ZA 5FZGA 3H1YA 4GKXA 4NHKA 4A7YA 3WP5A 2BRTA 3R4UA 2VBPA 4Y22A 4YYOA 3O1RA 4EN9B 1PGW2 2V4AA 3NJVA 5A3NA 2AR6A 1BVVA 2LS6A 4E8DA 1OH4A 3O1TA 4MADA 2R7EB 5ACA1 3KHCA 1QJY2 3AP7A 1OA3A 4IEQA 3CIHA 4EYUA 1PMHX 3KHBA 4R4XA 4GJYA 1WGPA 3WT3A 3CO2A 4QB1A 1NLSA 2DVFA 3BOPA 3DYOA 2AENA 5FZEA 3DYMA 1OF4A 1SCRA 2W0XA 2RV9A 1AYM1 3LCPA 4JQTA 2OZJA 4CCMA 3KM5A 2FBEA 5IAVA 3ZDSA 2BBVA 2VOXA 1WCKA 5FZKA 3PTYA 4AVVA 5FP4A 1ZA4A 3MO4A 5JDBA 2Q1MA 5FMDA 2HWC1 1WD3A 4DXRA 2WWSA 4CP9B 5LB6A 1KFUL 1MEC2 1ZBE1 1AR71 1COV2 4KGQA 4LORA 5L9VA 1GLHA 5FYUA 1F9KA 4HG6B 3POGA 1K3IA 4KI5M 4HK8A 3ZSEA 1V6JA 4DOUA 4DY5A 4CU6A 3CDZB 2V09A 4CCOA 1JYVA 4C1XA 4CP9A 1U5ZA 4BA6A 4A7KA 1S0EA 1RUG2 4HVOA 2E6VA 4ITCA 4GJZA 4YM2A 1N3PA 5EFUA 3S30A 5IVVA 1ULEA 1WW4A 5D2AA 2WO7A 4QHBA 1SZBA 3ZFGC 3I2JA 5CA6A 2TNFA 5I0RA 3K4ZA 1PM7A 3I4IA 1GQHA 4D0QA 4P9LA 1X8EA 3ZIWA 2GNDA 2RMU1 1PX4A 5FYIA 1PK6B 1K5MC 2W92A 2QQWA 4R8HA 5EV7A 4KU7A 3THDA 1CIYA 3N7KA 4GWJA 1O8SA 2JDMA 2ZX4A 3A7QA 3DGTA 4QGLA 2F6BA 5DXDA 5F6KA 1S55A 2JG9B 1J1LA 4WM7C 4IEOA 1H2LA 3T08A 4ATEA 5T3NA 4IETA 5FXVA 4NJ4A 4IV1B 1KRIA 1PK6A 1F35A 2PQSA 5J98B 4EWDA 5FOJB 1VAMA 2YGLA 2D6LX 4JZRA 4QDQA 5FKCA 3OPTA 4G9SB 4P9YA 2BGPA 3WHTA 4Q8LA 4BIOA 4MOAA 5F2SA 1LOFC 2FZ1A 2JG9A 2PFWA 1SBFA 3UJOA 2WIIB 2WO3A 1D4M1 3PMEA 4Y1UA 2QQOA 1VBC2 4IV1A 1NY71 1MZ6A 4Y26A 5K7PA 4LHNA 3K4AA 1W8TA 3M4FA 2BWAA 4QM9A 1OUSA 2GH2A 3O1PA 1GZCA 1BZWA 1CZTA 1S1AA 1XOYA 4KBBA 4UFIA 5ACA3 3BI3A 2EALA 5JR7B 2P3JA 4SLIA 1HB3A 4NPMA 4OQ8A 2XLAA 3KQRA 1SDWA 3VHRA 4BOWA 2PTMA 3AB0A 3WOGA 3WW2A 5KBFA 2D44A 2XHKA 1AYM3 2MEV1 1DGWX 3P3PA 4E4ZA 3WNMA 2YZ4A 4XJ8A 3N35A 4CEWC 5JSRA 1ASJ2 2XKOA 4ZS3A 3GJAA 4CUGA 1AYN1 2HWC3 3KT7A 3I3DA 5DUWA 3H8RA 4JGZC 2RS32 5T54A 3O1MA 2GZWA 3ZYHA 1G6NA 1KDMA 1ZBE3 3V56A 4FCAA 4L11A 4Q1PA 3RYKA 1GNYA 3BIWE 4Q27A 5IK5A 1N3QA 3B93A 3UETA 4XTPA 3FUQA 2RR12 2WS91 2WYFA 4O9EA 2ZKNA 4CDXC 5JIUA 4QX5A 4AOCA 1YLLA 1OOPB 4RSUA 4LBLA 4XFBA 2Z42A 2FDKA 2CAVA 4FPEA 4MLOA 3N9MA 4MGQA 1J83A 4ZKTB 2RDSA 3Q9OA 4QHZA 4NIHA 2CTVA 3VBSB 2JE8A 4CA9A 4JKKA 2VO5A 3MLKA 1I6XA 1VIWB 3JB4C 2RMU3 3T1MA 3B5LB 2WFF2 1OOPA 5GZCA 3QH6A 4PCRA 5F3GA 1IS6A 2ARAA 2XXZA 3DXTA 2G9FA 2H0VA 3OCPA 3PLQA 1MS8A 4BM8A 2QFEA 2RM21 2DCKA 1MS3A 3AYDA 3VBSA 3EQEA 5GZGA 2VVFA 2GAUA 5FRAA 3CLPA 4EN7B 2Z69A 1NCQC 2VTFA 4WVVA 3V0BB 1BBT2 1S2BA 3M7AA 4NVPA 5FP9A 2B7YA 4NOTA 3L2YA 3EHKA 5FYSA 2WNUC 2XONA 4I0AA 3ZMNA 3BTZA 1RXFA 2XUMA 4RYDA 3TNPB 4XJUA 5ANNA 5HV0A 1D0HA 1NA1C 2ARCA 2GMEA 2DCYA 5C7GA 2YGMA 3KQ4B 3RJ2X 5LA9A 4FVVA 4IV3C 4QDSA 4QB6A 4Y5Z0 3GDBA 4Q0SA 4A45A 1KEXA 1SBDA 2P3IA 3T2QA 3V0BA 1SLIA 1LU1A 1ZZBA 1LEMA 1CX4A 3ABZA 5FMBA 1VALA 2WZ8A 4A3XA 4NPRA 1Q8VA 4DUVA 1VP6A 4XZUG 1OHFA 5L7OB 3FWEA 4AHWA 4Z07A 3K3NA 1MS1A 3C8XA 1V9U1 2MEV3 4QPIB 5IUQA 4DPNA 1PZ9A 1OH3A 4HN0A 2PHLA 3N4MA 3MIGA 1W03A 2PN5A 4YVSC 1W06A 3VKLA 1X9TA 1AYN3 4AWDA 1PNGA 5IFPA 3ES4A 3LFIA 1WLDA 1B35C 2RJKA 2UY9A 2KR2A 2VUCA 3POWA 2E7TA 5L7OA 1ZNPA 2IXJA 3PUQA 5GZDA 5CFDC 2R0FA 4ZZ8A 3LA3A 1Q3EA 2F4PA 3ZO0B 1TG7A 5BV6A 5ISLA 3GCXA 3MBWA 2LUWA 4J1WA 3E5XA 1UYYA 1JODA 1XNAA 2VULA 2WS93 3I8TA 1QWRA 2G19A 5G04L 1H8TC 2XQXA 1QJZA 4U36A 3HIFA 2DFBA 4XMIA 1VBB1 3J7HA 3MUY1 3VZLA 4IEVA 1QY4A 3OGJA 2NMNA 1ULOA 2X5IB 4FP2A 3I2DA 4S2GA 2Y34A 2J22A 5FP8A 3E97A 3SMHA 2ZGPA 1REFA 3UKNA 4Q0QA 1H1MA 1D7PM 2MHFA 1E5IA 1H1IA 2TEPA 1Q5OA 1EAH1 1WD4A 2VGDA 5K0UC 3WHUA 4JDNA 4JTNA 2WZPP 2X5IA 2RM23 3WDWA 2R042 3ILNA 1Y3TA 3ZM8A 1Y9QA 4FOVA 1D2SA 4CP1A 3AKTA 3R05A 4P9JA 4XCBA 5F5IA 4LBQD 2AYHA 1H2MA 2YB7A 4HXCA 3A23A 2H6CA 1ENXA 1FYUA 5DN2A 1XYNA 1FPN1 4L92A 5FY5A 3VBRC 1RTVA 1UOGA 5J7MA 1CWPA 3NVCA 1WCSA 3NAPC 2A71A 3NO8A 1PGL1 3VD7A 4NHLA 1V70A 4RS5B 3I3MA 1S0BA 5HBAA 2ET1A 3HEIA 3LE0A 2DUQA 4NROA 5ABJB 3IDEA 1DQ5A 1FNZA 1X7NA 1FATA 4KG0A 2JB4A 1JN2P 4M3CE 2VMIA 5A7OA 1C57A 2QTWB 4RN5A 1JS9A 4NMIA 2OQ6A 4RS5A 1W6PB 3OBAA 1Z78A 3LGRA 4RA0A 5CZKA 4AGGA 1HRI1 2IXKA 3IDBB 3IIIA 3DPRB 4AG4A 4BXSV 5ABJA 4IE4A 2WQ8A 1V9U3 1L3JA 1ZM1A 4KL1A 4O7XA 4F7ZA 2B9UA 4K8RB 1F4HA 1XNTA 1O3TA 1QXRA 2D3PA 2DVDA 1TNFA 2JXAA 1G9DA 2Z2SB 4YGBA 1E5SA 2QQUA 3IWZA 5F7UA 1PO13 2R0HA 1W6PA 2WWJA 5SV8A 4KNCA 2NMOA 3FUOA 1RUI2 3DPRA 4QPIC 4CCNA 5KXDA 3VN4A 4CCKA 1J59A 5H9QA 1JH5A 3CBNA 4N53B 1AR81 2JJ6A 2DU1A 1JZ3A 1RHI3 1ZA7A 2JIGA 3NW4A 4LE4A 1BQPA 5JMOA 2K46A 4YSFA 5FPXA 3LA7A 5H9RA 2AUYA 5IVCA 1VBB3 1AF9A 2QVSB 4XEZA 3H7JA 2NYYA 2ZZJA 4TYSA 3VD3A 4GA9A 4UF0B 3W58A 5BNOB 3TN92 1JZ8A 5F3EA 1C8M2 4FI9A 5I0DA 4MHRA 2W1QA 1JOJA 4N53A 2GN3A 2VZUA 2WWUA 4YG0A 2WABA 4XFGA 4YW5A 2WNEA 3AP4A 4ZS2A 2ARXA 4WVZA 1XNDA 4PIYA 2H0BA 3I3BA 4XW3A 4XUOA 3OEAA 4BCUA 1EAH3 5LK7B 4IUGA 1PVC1 2B45X 4HLTA 5A7SA 4KQ7A 1U12A 4G4FA 2UWCA 2A6ZA 2W87A 4EQVA 1PGW1 4CE8A 4MGZE 4I01A 4N43C 3AFKA 2HWF2 2JDPA 2QQLA 2WO2A 5GLTA 4X8PA 1XE0A 5DDJ2 1W2TA 2W39A 4RQPB 3SCGA 1UXZA 2YU1A 1HN0A 4NRPA 4IEXA 2JWPA 3DEMA 5AVPA 2P5BA 1IPJA 2DYCA 1Y7BA 1YQCA 3ZLIA 3LEGA 1RUH2 3BN6A 3WG2A 1UZWA 4S2FA 1FPN3 3I49A 4YARA 1M06G 4QD2A 5A3PA 4RQPA 2EA7A 2XJTA 1IQAA 2BGCA 4V1PA 3ETPA 3H3UA 3I2IA 3MPBA 1RUNA 3AKPA 5C3QA 1WCUA 1JUIA 4D7YA 1MEC1 1YJKA 3NV2A 1COV1 5JI7A 3H8UA 4IE0A 5AC92 3WX5A 5JWPA 4QKDA 4AI9A 1L7QA 3WW4A 5LK5A 2XH6A 4LMFA 2A3XA 3FJSA 5GZFA 2WSVA 1TVGA 2WLPA 4PDWC 1H8TB 4NO4A 4TLGA 2UYAA 4LO5B 5FK8A 1DZQA 3VGIA 1HRI3 5LRSA 2WZR1 2XJVA 4OI2A 1PVXA 2VC9A 4IE6A 2CDOA 3VKNA 5F32A 3RVHA 1RUG1 4CCJA 3TRSB 5A70A 1IG0A 4DEVA 4Z2AA 4JHTA 2XL7A 3FMGA 1OUXA 5L9BA 3AJYA 2YDEA 3PIGA 4QX0A 4ARYA 5IVFA 5CEHA 1H8TA 2PHXA 4FPJA 4LK6A 4BQYA 1V6IA 1AVBA 4Q0VA 1FMD2 2VBBA 5F8PA 1R64A 2V5YA 4FXGB 2FMYA 3S5AA 1QGLA 2JEMA 2QBXA 1CPNA 3CMGA 1GNHA 3I2FA 4Q4V2 1VBD1 4GKYA 1AR83 4Q4X2 1X33A 4CZSA 3IIAA 5FKBA 3DECA 5DQ0A 4HVQA 4QM8A 5TSWA 2CGPA 3B7MA 2FD8A 3HVDA 5FYVA 5E8AA 2W52A 3BVCA 2FHRA 5JLVA 4EROA 2I2SA 3IPVB 1FOD1 4Q5OA 4P08A 3R4SA 4E4SA 2PQQA 3AYEA 2OYZA 3N3HA 1YWKA 3AZXA 1RUF2 3NJYA 3P3NA 1WW7A 2D98A 3B02A 1LODA 2HEVF 1TE1B 4FBFA 2QZ3A 5LBCA 2Y26A 3ST7A 3VHNA 5CADA 3PMSA 3PU8A 1N1SA 1QIQA 2X10A 3QCWA 5EYYA 3IPVA 3PVEA 1PVC3 2VOVA 3T3YA 3WD5A 1HW5A 5DPNA 1NQJA 3J4UH 5HV4A 2C9KA 5IWFA 4OHXA 1CAVB 4KBZA 5FIXA 1N47A 5FZHA 2K2SA 1QJY3 2RS52 3PJQA 4M4PA 1URXA 4UFHA 5A3TA 3P6BA 3FBMA 5BNQA 1MVEA 2A1XA 2R061 2BU9A 4LJHA 4ZZ5A 5E89A 2CSGA 5HI0A 1DCSA 1V6KA 4LBOA 3IDAA 4MUVA 1R082 5FREA 3U10A 2Q4SA 2GDFA 1CAVA 1SLAA 4WVWA 3IBMA 5BYNA 1FV2A 2C1FA 4CUBA 3B3QE 1GANA 1YI7A 2VQ0A 2CHHA 3TEYA 5GZEA 3LF7A 4SBVA 1DGLA 1NE6A 3V64A 4AQTA 1SACA 1YFUA 2RS31 2VNRA 2V73A 2VPVA 2QQMA 2EF6A 2VVDA 2WO1A 1MEC3 4NR1A 4W6WA 1COV3 4XAAA 5FYTA 4YNIA 4NIAA 4DO0A 1ENQA 2X09A 5F9TA 5LEJA 5HCHA 4IE7A 5C8WA 1NUKA 1NXD1 4XUQA 4YRDA 1OQ1A 5FCCA 2WQZC 5DZGA 1NOVA 1N1VA 1QF3A 1SFPA 2LW8A 1GQGA 2RR11 4FPFA 4GB32 4JGYC 4M0HA 2WZR3 4QX7A 4C8DA 1K42A 1A8DA 4QAWA 4BU2A 4XBLA 1RUG3 4QKBA 4XDQA 1UYPA 3WV6A 4XFFA 4BHPA 3O1OA 1QNYA 4MGTA 4GZ9A 1JTZX 4JC1A 2R6QA 2UYBA 4I09A 2W68A 4RHV2 1HRV2 4UW6A 1X50A 4WV8A 5BNPC 1HV1A 1LOBA 4RFT0 4ZU5A 1AUYA 2RJ2A 4HKLA 3NQHA 1ND2B 1O5UA 5JPMB 4M01A 5DG2A 1VBD3 3SHRA 4DINB 1DP0A 1C5HA 4PLNA 1QJU2 3A4UA 1EPZA 4LE3A 1J58A 4A6OA 4XQWA 3E6CC 4L2NA 3B01A 3HT2A 1QQP2 2EXKA 4BYYA 3V0AB 1VMJA 1W0OA 2W1SA 3RI9A 1VB4A 4E8CA 4MG2A 1APNA 1CPMA 1ND2A 3C2UA 3KV6A 2BUKA 5EYXA 1NAEA 1VB2A 2UWBA 1BBT1 2B39A 5C8CC 4LUKA 3VZOA 1MZFA 4ZXEA 4FFHA 4MVTA 2OS2A 4CTEA 4XC9A 2CWSA 5LEKA 3VBOC 4GULA 3ZX7A 4BIFA 5DMYA 3V0AA 1S0IA 5IVJA 1VBC3 3QD6A 4Y3OA 3E5UA 4BQ5A 1RMU2 5F37A 1YO8A 3KGLA 5F39A 2XGXA 2O1QA 3ATGA 1G86A 1N3OA 5JXHA 4FTBA 3B94A 4YM1A 2V5DA 1UO9A 1YFXA 1ZBA2 1DQ1A 2YXSA 3SQOA 2TUNA 3F95A 3VDBA 1WA4A 2R063 4ZONA 3CJXA 2ZHMA 4FFFA 4RR3A 4FPGA 4CDWB 1XNKA 2O8OA 5EP9A 1FV3A 2YC4A 3B9CA 4XAEA 2RDQA 3EBRA 3HN1A 3I2HA 1GBGA 3GM8A 4LA3A 1ASJ3 1R092 4LO6B 3RYPA 4BMBA 3O0XA 5J37A 4GALA 4KGGA 1FT9A 1AR62 3LFMA 3D8CA 4LXLA 4PQ9A 1MQTC 2IFRA 3GJBA 4FPOB 5A80A 2RS33 3WZ1A 4AFCA 5IVEA 1WWYA 1WMEA 4ZY9A 4ES9A 4XETA 4O61A 3U4SA 4CDWA 2FZ2A 1OKOA 4AR2A 1IOAA 2IXCA 2VZ3A 4OMDA 4D7TA 1LR5A 1BCXA 2C6SA 2YHJA 1HV0A 2RR13 3GNEA 2Q1FA 4NHMA 3AJZA 5FP3A 2PLV2 1OLME 1QJX2 4JCKA 4XDOA 3EXUA 1VE0A 3ZR6A 4PBOA 5FV3A 4CXYA 5JCTA 2X8KA 5LA2A 2XLFA 4AI2A 4C0BA 1OURA 3WNNA 1GP6A 4A7ZA 3I59B 3TEZA 1O59A 5L9RA 4AZZA 3CJIB 1RINA 4YZ4A 1DLCA 4L8QA 2WFF3 3KB5A 4E2SA 1RUJ2 1L7RA 5C5UA 1MS4A 2LM3A 1MR5A 2QQKA 2ZCWA 3Q8BA 3ES1A 2WDBA 1DQ0A 5IVBA 2BFUL 2BNOA 1WLWA 2R041 1OD5A 3I59A 5CVRA 3SEPA 4ASMB 3NNGA 1G9AA 4BQ2A 4HONA 3KD4A 1N1TA 3J26N 2EICA 2BBAA 1AL21 3CJIA 4A42A 2VZVA 4XURA 2QQJA 5KHGA 5M0TA 3AP6A 2ATFA 1TMF2 1BBT3 2PMWB 2E31A 4CPBD 3KMHA 2ES3A 4H55A 4E2GA 2VMGA 4TN7A 3JD72 2RDNA 2YU2A 2I07B 4HBNA 2FDIA 4QPGC 1IKQA 2FCTA 4YGEA 1VRBA 2XKPA 4AFDA 5A6YA 3ECQA 4RGKA 4OQ9A 4B4QA 5A6XA 2Y6KA 2ADEA 3KWVA 3HPNA 2P3YA 4PHZA 1QEXA 1DG6A 1V6OA 4JGYB 5G05L 1YUDA 2WINB 4YZ2A 1SLLA 4Q26A 1LGBA 5A7WB 1REEA 2ZPXA 3DCQA 3OY8B 2A6YA 1GSLA 4GH4C 5FYCA 1V6MA 4YVWB 1WCQA 3MIHA 5C4WC 3BTYA 3ZDVA 2AEZA 2C9AA 2RVAA 3SKJE 4AI1A 4JGYA 4XXPA 5CFCC 4XABA 4PBPA 3WNOA 4OZOA 3TWIA 3AM2A 2YYOA 1RUI1 3WF2A 1W9SA 1ULCA 1ZRIA 5A7WA 4BQWA 3OY8A 3PVOA 1LKNA 3WCRA 3OB8A 4GWNA 5A7NA 5JPNB 1OQEA 2BYVE 3FHAA 2ZMNA 4H3WA 4YVWA 2PHUA 4GQ7A 3B00A 1GP4A 1Q8SA 3FFZA 2J1AA 1AXKA 2WA3A 1GZWB 2ERFA 3VDDB 4QQLA 1DGRN 3TN91 1C8M1 3U78A 3ZPOA 2PHDA 1A6CA 2ZS6B 2JICA 3ACFA 3HJRA 3OUHA 3I97A 3NSTA 1LHVA 1UOBA 2E51A 4CP0A 1B09A 1NQDA 2JECA 2BGOA 5FK7A 5IJRA 2VR4A 1W05A 1GZWA 4OVEA 4HMZA 3PIJA 4AGRA 3VDDA 3GZUC 3QH7A 2JG8C 4CRQA 2ZX1A 2R043 3M3IA 2YV8A 3TOJA 4V2VA 2ZEXA 1TZOA 2XUEA 3TB0A 4LHSA 1WMFA 1ZX5A 1AL23 2B46X 3UESA 4HT1T 2WAOA 2PAKA 1ZRFA 3RZHA 1W6OB 5T5JA 3HN3A 2XMLA 3AL5A 3AVRA 4QXCA 4QX1A 1JOPA 2P37A 3VB9A 2DTWA 4XFAA 2CL2A 3RYRA 4MO3M 2Y6FA 1US2A 4XYXA 4CDUC 4BK5A 5DG1A 4Y5TA 3ILFA 1X82A 5CIRA 3CHXA 4Z82A 2VMCA 2CU5A 4QXBA 3MICA 3I3QA 1BK1A 1JXNA 2NN8A 3RI8A 3VBFB 1SHWB 5LBEA 1W6OA 1OPOA 2BOJA 3VHPA 3WG1A 3KCYA 4LKEA 3WCSA 5D21A 1NCRB 1HJGA 5AC91 1YNAA 2GNTA 2Y60A 3U0ZA 1H9PA 1HXS2 3UJQA 5JUVA 2ZGRA 1H6XA 5FFOC 1HQLA 3VZNA 1HKDA 4K21A 4AK3A 2XVLA 2YBPA 3CF6E 3MIDA 4IEUA 4ISRA 2ORXA 2WL1A 1SDDB 3LZZA 4L0PA 3VBFA 5HCAA 2ZACA 3WDTA 3FFQA 4EWAA 4Y4YA 4GMP0 5DAWA 1O3RA 4K40A 1TEIA 3HWJA 1IS3A 1NCRA 1XNCA 2IZWA 4J1XA 3ZYPA 5DUUA 5C9AB 3BYWA 3O1UA 2WN3A 1O4YA 3AK0A 4LQRA 2OIIA 2AEYA 2WC2A 5JZGC 5FPAA 4N8MA 2VH9A 3K4DA 4Q4W2 4PJYA 4OHWA 5LBFA 2XJSA 1RUI3 1UZYA 3B69A 5FZ8A 4LITA 3WQ0A 2DWRA 1ZVFA 2XLGA 4Q4V1 2WT1A 5C9AA 4XFHA 2A75A 2EIBA 1W04A 4Q4X1 3BUCA 1NX9A 4BMEA 4LKFA 4TZDA 1C1FA 4XTMA 1S4CA 4B8EA 4UT5A 3O0VA 2Y33A 1POQA 1KITA 4XUPA 5FUPA 1WLCA 3TN93 1RUF1 1C8M3 1KS4A 1ONAA 1VBA1 2R30A 3KT1A 2Q8EA 2GMPA 4IEZA 3RNSA 2VECA 1YJLA 1DF0A 4UYBA 5ERLA 1ZZ7A 5FTTC 3WNKA 4B3NA 1QKQA 3J8F2 2YPJA 3FE5A 3M8LA 3QOPA 4Y33A 1GOFA 2WT0A 5GLZA 3ZYFA 3IMNA 5FY4A 3VBUC 2GC3A 3T0AA 1XU1A 3Q8EA 5FWJA 2HWF3 3H7YA 4QPWA 2BZDA 4BWOA 2JDNA 3H3LA 2IXLA 5DDJ3 4AI8A 3AP5A 4Z1VA 4IXLA 1S0GA 4CU8A 2BPA2 2QZ2A 4M00A 4QQ2A 4XJZA 2D3RA 4FPCA 2OXBA 2VL4A 4F83A 1RUH3 4QX2A 1YHFA 4LOTA 3W59A 1J3PA 3NNJA 4A4AA 2QQIA 2Y64A 4NWWA 4GMP1 1R081 1DGWA 2DTYA 2UY8A 4BB3A 3LSDA 2OW4A 4P9XA 4AAPA 1MVQA 2D5HA 2JB8A 4M4RA 3ZXGA 1VLNA 3H3ZA 3IZOA 5I0TA 1AZDA 3ZSKA 5IVYA 1H8VA 5FXXA 4JV4A 3MW4A 4XZPA 3VDAA 5AC93 4UW5A 4AEDC 3T1LA 3K3OA 1YIPA 2DFCA 2GSYA 5D8AC 3GHNA 5DZFA 3ZFFC 3N9NA 4K6BA 4BQ4A 3RJRA 3OBZA 2P4EA 4UXAA 5JMCA 3S7EA 4GB31 4YFWA 4BXFA 3VUOA 4W65A 4CVUA 2AC1A 1KJLA 2W3JA 4LBMA 3NMBA 3VKFC 3AXEA 2HEWF 4MH0E 4LO7A 5AVAA 4LK7A 2VZPA 4QDRA 3AP9A 2VUJA 1P8JA 4XUNA 3OUJA 3AVSA 1RGSA 1UN1A 4RHV1 4OI4A 1HRV1 1O4ZA 3T4HB 4CCDA 1GWKA 3C7GA 3HNBM 2NQYA 2ZAHA 1LESA 1LOAA 4HKWA 1LCLA 1YQ2A 5FZAA 3T09A 4DZGA 4CU7A 5BUVA 4Q4V3 2ZGUA 5FP7A 2JG8B 2Y6JA 4Q4X3 1OBNA 4OUMA 3VZMA 4LUMA 4TLFA 5FZBA 5AFEA 1O3QA 4RD7A 3OD0A 3I2KA 2C5DA 2VCBA 1EP0A 2VE1A 4CSWA 3ZFGB 4KWLA 1PM4A 1ULGA 1PX3A 4YGCA 3AZWA 4WM8C 3WQBA 1RUF3 1PO11 1VBA3 4YG3A 4Z2WA 1KGYA 2JG8A 3E1F1 4GWMA 3USSA 1K5MB 4Y20B 4META 4PIXA 1CD3G 1J3RA 1LGCA 5I0SA 3UK9A 2VOKA 5IYYA 3CU7A 2OZ6A 3MPPG 4HANA 3WNPA 2RHPA 4WM7B 1HQWA 1RHI1 3C7OA 4ORFA 2PXJA 4XJ9A 4ZXKA 4LLFA 3ZFGA 1RMU1 2A6WA 3Q8FA 5DUVA 4Y1XA 2WBKA 1PO22 3ZYJB 1K5MA 2VZTA 4Y20A 2RS53 2QQVA 1LGNA 5FJKA 3DYPA 1YI9A 1ZBA1 3VBHC 4EWEA 1DIWA 2BP6A 5GM0A 5A33B 3MI8A 4WM7A 2WJSA 1IZ3A 4JDMA 4PT6A 5APAA 1L7LA 2BW8A 4WBBA 1S2KA 5FZCA 2GP3A 2ZGLA 5C6CA 3BB6A 1J3QA 1R083 3AZYA 4GMP3 1OA2A 4MGSA 5A7PA 4Z8BA 3NV1A 4DRRA 1RUE2 1Q8PA 4UI9L 1RUD2 1GWLA 4KMQA 1OKQA 3MEPA 3ZXEA 3NNFA 1GOGA 1AR61 2ZGTA 3Q8CA 4RL7A 4XOGA 4B1MA 2DVAA 1LOFA 1QOOA 5A33A 2R1BA 2O0OA 1CAUB 4WVMB 3INAA 2GNMA 1RVF1 4MX3A 2HLEA 5FUNA 3SC7X 3HD8B 4C0HA 1JW6A 2DURA 1U0AA 3ZYBA 5KHKA 2JDKA 4NRQA 3D0SA 4GB33 2DF7A 3K75B 1YC61 4TXWA 4CEWB 3LEKA 1QJEA 1XBFA 4AEJA 5HPOA 4COVA 2PLV1 1RUC2 1QJX1 2PHTA 1CAUA 3M1HA 4WVMA 4R9BA 1O5LA 4I0BA 1HDKA 2A70A 3G7DA 3N9LA 3CL1A 4JGZB 5FZIA 1JYXA 3RZLA 5CG9A 1W8UA 2Y38A 5IK7A 1HQNA 5FPUA 4XF0A 1XQNA 2RS11 4RHV3 2R49A 1HRV3 2IVIB 4P5HA 3OF1A 3E6BA 4P00B 5I91A 2XL9A 4CEWA 1WMXA 1W8OA 2BFUS 1AJOA 3ZPYA 3VBUB 4CDXB 4QU1A 1HIXA 2BV4A 1DLLA 1SLCA 4JGZA 4GIQA 2GC2A 4INDA 1J1TA 1YQ5A 5A3MA 3THTA 4AVBA 4ISQA 1RB8G 4OUSA 1V6NA 5C70A 5C3RA 4JRLA 2EVXA 3CNAA 3LSEA 1POV0 3VBUA 4CDXA 5KHHA 3W20A 1TMF1 1RYYA 3ZFEC 2XJPA 4XIOA 2XBO2 2QE3A 3ELNA 3AMNA 4PIZA 4XQ4A 1BMV1 4YW1A 3MYXA 1W6QB 5FOBB 4R52A 2WUHA 4S2DA 1C5IA 4LKSA 4AGVA 1RMU3 4AI3A 5JXGA 2VJXA 2ADDA 1UYXA 3KSCA 2VNVA 2AGSA 1BLZA 2C24A 4AW7A 1NCQB 2W46A 2HWD1 5FAXA 2QUOA 5HXVA 3ZFFB 3PUSA 1ZBA3 1YQ6A 4MGKE 2D7FA 3EMRA 5JXJA 2ILMA 2WNUB 1W6QA 4F8AA 2TBVA 1JU4A 1OPMA 2GNBA 1PGSA 3MDPA 5FZLA 3WDXA 4AHXA 2P17A 1NA1B 2NZ9A 4B29A 4XBNA 5KWRA 4YW3A 1I9RA 4CXXA 1OLMA 2CWMA 4AHYA 2ZX0A 2Q30A 3JU9A 4ZU7A 4XDPA 2JENA 4IV3B 2KXLA 5HCBA 3T30A 3WEZA 1PZ8A 1NCQA 4PI0A 1R093 2XWBB 3FC0A 2HWE2 3MIFA 3MW2A 4UF0A 3ZFFA 4UFKA 4OHYA 3O1SA 1AR63 3RS6A 3WY6A 1K5JA 5LATA 3RMXA 2WNUA 2ZTNA 4LNVA 5FZ0A 3VL8A 5L36A 2DCTA 2ZEWA 1UZZA 3ME2A 4BPZA 1QJY1 4CEYC 1NA1A 2NPIA 1RVF3 1YEWA 3GBWA 2HWC2 4YZ3A 2PHWA 1RXGA 4DUWA 4MXVA 1Y9GA 4BK4A 2VOTA 1Y43B 4IV3A 4AL9A 1AR72 1ZBE2 3LDRA 3BKZA 1D2QA 4GAZA 4D6RA 4COWA 4N7UA 3ALQA 3I2OA 2PLV3 3M3EA 4YVSB 1QJX3 3H1MA 2DVBA 3WG4A 1PNFA 2ID4A 2NLRA 1B35B 2VQTA 3GHMA 3WF3A 4CUAA 3BPZA 5DAXA 4Y5SA 1UY3A 1POV1 2H6BA 4K1ZA 5FPZA 1RUOA 4B7EA 4JTOA 2WAAA 1W2AX 4QQOA 4EZHA 5CFDB 4AFAA 2RS13 5JOZA 1OLRA 1VBE2 3LIGA 4HN1A 1BHGA 4IDZA 2KA3A 3ZSMA 3AXDA 3KF3A 4QKNA 4XVHA 4YVSA 3BIEA 4LTAA 1G8WA 5B4NA 2NM1A 1RUJ3 1SLTA 1B35A 3LAGA 3LB9A 2QDNA 2OT7A 3DF0A 4K20A 3M3CA 5GLUA 5CFDA 5KHJA 3A21A 4B1LA 3ON7A 3ZIXA 4QT6A 4LBNA 1GNZA 3WW1A 2J1TA 4URTA 3THCA 1TMF3 4BE3A 4FAGA 5FLHA 3VZKA 5K0UB 1CVNA 1VMFA 5JIAA 1NZCA 4HK9A 1O7FA 4XF9A 5BPXA 3BALA 1JYWA 4AE2A 4BLIA 3HQXA 1MS9A 2MPFA 5L73A 4IE5A 5A3UA 1QNWA 1CESA 4F3JA 1O4TA 1UY4A 4FTEA 1CONA 2KM2A 1D4M2 5KXCA 5K0UA 1BJQA 5FZMA 1NY72 3UYJA 2HWD3 3BCWA 3WR0A 4I2OA 1HXS1 2W47A 3VBRB 1C8NA 2VZ1A 2L9LA 3KV5A 4NHYA 3NAPB 1JZ5A 3DXUA 3WSOA 1WA6X 2VMFA 4Y1YA 4YFZA 3JCIA 2R32A 4JVAA 5FPLA 1CR7A 4LR4A 4R9DA 1UU6A 1VBC1 4UW4A 2WT2A 4Y4RA 5EPAA 3IKWA 4BISA 4XMAA 2MEV2 3VBRA 4CDQC 1UPSA 1UL9A 1WKYA 2JDHA 3NAPA 3ZKUA 1ND3C 3OUIA 2W1UA 2PAMA 2VVEA 3ROUA 1YXWA 4UFMA 1IKPA 3ZYRA 1SFNA 1LOEA 3K48A 5J3UA 1YIFA 5FPBA 3GXUA 1H0BA 1W3XA 1OI6A 3PUHA 1SPPB 3Q8AA 4XXAA 3JBG2 2SLIA 4FTSA 3VD4A 3OD4A 1V0AA 1ASJ1 3T2TA 3OEBA 3D0JA 4ASLA 1VPHA 2XVKA 1POV3 4PI2A 2Q0AA 2YBKA 3LEIA 2FCUA 1XE8A 4D69A 1BEV2 3S6PA 3AFGA 3KGZA 4NIIA 5EJ1B 4XE9A 5JAXA 3SKVA 3BOWA 2XQRA 1SPPA 3J8F1 4LULA 2GC1A 1WZXA 4FPYA 5F3IA 1NKGA 4D94A 1ULPA 3VD5A 2G9ZA 3OSDA 1FAYA 1CGPA 3K46A 3NJZA 3OGVA 1H1AA 1PMJX 1EV12 2E32A 1CJDA 1PIV2 2J1RA 4QPIA 1W8NA 1LTEA 1QMJA 1A3KA 1DQ2A 3GF6A 3NRUA 1UY1A 1R1A2 1H9WA 3GZEA 2WNOA 2XJQA 1XRUA 1CQ9A 5FY1A 5CISA 2ARBA 4XF3A 2R072 3LPFA 3RZJA 2WFF1 5FXZA 3EJKA 5IAXA 2A6VA 2BERA 1UOJA 3LA2A 4N43B 3J7NA 3E6DA 1GFF2 3MF9A 4IQPA 2CY6A 2PELA 1W8HA 4I0WB 3L2HA 4XHXA 3W9AA 2ZX3A 5C3PA 1ZRDA 4ZHNA 2D5FA 4LBQB 3T0DA 1HXS3 2BEOA 4N43A 1SQ4A 3MLJA 3PL0A 3AZZA 3VLBB 1W9WA 5H9SA 2WNVC 4YW7A 2QJVA 2DCZA 3NJXA 1A8MA 5DAPA 3MGUA 1EUUA 4LBQA 1Y9MA 1CAXB 5CKQA 3ZOIA 3S0MA 3H42B 4FP3A 2E26A 5FXWA 4XACA 1DFQA 5LASA 4QPYA 2W9XA 4OUEA 1EPWA 4LOSA 4PDWB 1HB1A 1W9FA 1VAVA 3BPSA 3D82A 4OYUA 5FZ3A 3T2OA 4E4DX 3WDYA 2FDGA 1UIKA 2ENRA 1LHNA 2O14A 1QH6A 2YC0A 3GALA 1X8MA 3POBA 2VZOA 4IW3A 3LOBA 2FDHA 1CAXA 2ZHNA 5KC5A 3U07A 3G6JB 4W4ZA 4CYDA 3RQ0A 1ALYA 2OKXA 4PDWA 4L9BA 1HB4A 2BNMA 1UWWA 2Q8OA 5GJ6A 2VM9A 1IGOA 1BYHA 1O8PA 2DVGA 2XHNA 3MW3A 2J1EA 3J8F3 1OQDA 2VY0A 2AH2A 1S0JA 1E57A 4PF5A 2YG0A 3POFA 2J7MA 2ZA9A 1HN1A 5J09A 5LA1A 4AQSA 3DKWA 3A22A 3I7DA 4OCTA 4Q0UA 4UFLA 4J6GA 1PK6C 1IG3A 3ZXKA 4XHBA 2G1MA 2YFZA 3WW3A 1RL3A 4P14A 2C0ZA 2DDUA 3C7FA 1JZ6A 1ST8A 2FDJA 4JAAA 2JG9C 2Z79A 4IESA 2WYSA 4JX0A 2XB6C 1DHKB 1TQ5A 2D6PA 4DRVA 4N7IA 3FBYA 1JBCA 2ZGMA 1RUE1 4IV1C 3VHOA 3T4VA 1RUD1 4HSLA 5FMOL 1BKZA 3C3VA 1W2NA 4FSJA 5FLJA 3ZXLA 1FX5A 3AMHA 1TME2 4LT5A 4Y24A 2WZEA 2HWB2 4YZ1A 2ZEZA 4CUCA 4YZ5A 2JDYA 1AJKA 1XXNA 2OPKA 3P5BA 1BXHA 3ZSLA 1OF3A 5KC6A 2A5ZA 3ZYIB 3M70A 3T2PA 4COUA 3P1IA 3H1WA 4XFCA 3FHIB 1XB9A 3BGAA 1DQ6A 3VL9A 4HZFA 4LHLA 4D7SA 4JKMA 1LB2A 2E7QA 2HEYF 3WDUA 3THPA 5JR2A 1HRI2 2E63A 3OYWB 1S2EA 2Q1ZB 1ZRCA 5EHDA 1JZ4A 5J1XA 3ZR5A 1XPWA 2CDPA 4X8NA 3OPWA 5IK4A 2OUHA 1T2XA 3H50A 5FLIA 4AVCA 1EY2A 1OXCA 1I3HA 3R4DB 1H4HA 4EJRA 3KZ4C 1UYZA 2LRPA 1DU3D 5C71A 1W0PA 1GP5A 3FL7A 3LEMA 3OYWA 5FY0A 3FZ3A 1NLRA 3VDCA 2IVJA 2ZMKA 1OFSA 1H2KA 1JHNA 4P9IA 1ULFA 2YY1A 2E7AA 3CZUA 4TTGA 1LHUA 1RJ8A 1ODNA 5BNPB 5L19A 2ZAAA 1UY2A 3I2GA 4BDVB 4M3CF 3W21A 3AKRA 4L97A 2XBO1 1OOPC 4Q4Y2 3ORJA 2QDRA 1C3HA 4KWUA 5HCFA 2YPDA 2D6NA 4LLOA 5BXXA 2ZMLA 2VUDA 5F5AA 5FMCA 3VBSC 5BNPA 1HB2A 4B4RA 1SG3A 3FHQA 5B2GB 5CAZA 4ARXA 4JRAA 4WZFA 1PVC2 1PO23 1I5PA 1QDOA 2FQPA 4OLLA 4CP2A 4WZCA 4LEJA 2D93A 1ENRA 3EYPA 3LDKA 3ZN5A 5C8CB 2BDRA 3ACHA 2MNGA 1GU3A 2WNVB 2VCAA 2LROA 1Y4WA 4MYEA 3LQCA 2VCMA 4M3CB 3VBOB 4XCAA 2CGOA 4NPLA 3RZGA 2GN7A 1RUE3 1HX6A 2XJUA 1IPKA 1RUD3 3CZJA 5T52A 3ZXFA 2HWE1 4JHZA 2PYTA 2J42A 3SITA 2RG4A 5C8CA 2HWF1 3APBA 1I1EA 3NV4A 5DDJ1 2WNVA 1C1LA 3DN7A 5T50A 4M3CA 3VBOA 1SCSA 1KS5A 4QXHA 2X05A 4XJWA 3A0KA 1RUH1 4MZUA 4BQXA 1HJFA 3K2OA 4RGGA 4XJAA 1IS4A 4FXKB 1Q43A 5I8YA 5C3SA 4MXWB 3NKTA 5FZ9A 3JXSA 4UFJA 1RUC3 3ZSJA 2AACA 1MQTB 4FQ4A 3RG0A 2GALA 3HOBA 3KCXA 3UGGA 2JIJA 2WZR2 5L7OC 3ZMOA 1UU4A 1F5FA 5EQUA 4DUXA 4G3YC 4PLMA 1VBE1 2G4IA 3UGFA 3NWKA 2D3SA 1LHWA 1SBEA 2ZZQA 5I8SA 4MXWA 4UWDA 2DBNA 1C28A 2ORZA 3M2MA 2XPJA 5JI9A 3ACGA 1MQTA 3RGBA 1SMVA 5E1RA 1XE7A 4AHZA 1LOCA 3HQRA 4QHOA 1AX0A 2XDVA 1QU0A 1VJ2A 1WBLA 4QQPA 2BQPA 1JI6A 1VBD2 2EIEA 2QCSB 5JSPA 1LNSA 2N7GA 1ZRRA 1RC6A 3PURA 1MS5A 3POIA 3FLRA 4QXKA 1K45A 4NHXA 4Q29A 1M4WA 4LBJA 3MV11 1UKGA 1FOD2 4FFIA 1SLBA 2A3YA 1KFXL 2YUEA 2B5HA 1FMD1 2XBO3 4XF1A 5T55A 1F2NA 2PA7A 4QU2A 3DL3A 4XUTA 4Q8KA 2Y6GA 5K9YA 4H2AA 2X5IC 1F5JA 5FUIA 2W2IA 1W8WA 4NIDA 1UIJA 3POEA 1G9BA 1GMMA 4AVTA 2OVUA 1E5HA 3IMMA 5JOXA 4MV2A 2QNKA 1ZZCA 2F4LA 3KS7A 3J7LA 4FPKA 5F6LB 2JD4A 2BVBA 3NNMA 3B9IA 1LULA 1UX6A 3RPQA 1Q8QA 3U14A 1UOFA 3NKGA 3N36A 5CKMA 3UGHA 1S0DA 1ZZ6A 2DV9A 4QPGB 4K8FA 2F17A 1UD1A 1UAIA 2CGNA 4RGAA 1MZEA 2R062 3O12A 1AR92 1E5RA 2HWE3 4GD4A 4QB2A 1S0CA 3CQOA 1OC1A 2PHFA 3X29B 1H4GA 1WW6A 4LIVA 2JKXA 3ACLA 2RS51 5IT6A 3U37A 4DY3A 4QPGA 2OX0A 3PNAA 4RS5C 4DXTA 3VKMA 5A6ZA 5A1LA 5ABJC 4PF1A 4X6QB 1AR73 3N9OA 2JD9A 4GH4B 5SV5A 4UBHA 2DUPA 5B4XA 3N7LA 1CN1A 1LENA 3JBG1 1X9PA 3O14A 5C4WB 5I8TA 1OLQA 1G9FA 3AMMA 5CFCB 4YLZA 4M0NA 3HAGA 5C33A 1GR3A 2LTNA 4YM3A 4CCLA 1YFYA 4Z92B 3WVJA 1UU5A 1UY0A 2HKXA 1BEV1 1U5YA 4B7KA 3DPRC 5T5PA 5A3WA 3C7HA 1VBE3 4GH4A 1WCDJ 4FT8A 4FFGA 3POSA 1R1ZA 1W39A 5C4WA 2XJRA 3I54A 2VZRA 3EO6A 5BY5A 5CFCA 4FOYA 4FPHA 1DYKA 1GWMA 1UMIA 2W94A 3SH5A 2ZHKA 3SNMA 4DXSA 5FY7A 1Z7S2 1EV11 2ZHLA 4EE2A 1PIV1 3N7MA 1JZ7A 2KD7A 1VRH2 4D6QA 4IGQA 2FCVA 2ZX2A 1CZSA 2QQNA 5LY1A 3FX3A 1Q8OA 1R1A1 1DGRA 3AX4A 4IERA 4N53C 5J96B 2ZGSA 4XFIA 4URAA 3QLQA 2P3KA 3KF5A 1CZVA 4LO4B 1G9CA 1FMD3 1QOTA 2R071 3PTRB 3N9PA 1LU2A 3M3QA 3MIBA 4MSVA 5BNOA 5BNOC 1A34A 5LA0A 1DBNA 4EN6B 1QJU1 3ZN4A 2ZGQA 2Q8DA 2JDAA 2GC0A 2RE9A 3KV9A 4C1WA 1UMHA 4LIUA 3RZKA 1QQP1 1D4M3 4JKLA 2CYFA 1RIRA 5LBBA 4IEWA 3TEWA 5D1IA 4XPVA 1TNRA 1LOGA 1XSQA
chains in the Genus database with same CATH topology
3WF3A 1UY3A 5DMYA 4HG6B 4KI5M 1K3IA 2WAAA 3CKHA 4CU6A 3CDZB 1BHGA 2B9VA 1JYVA 4XVHA 5JXHA 2V5DA 5B4NA 1GQPA 1K12A 3PUIA 3VDBA 3A21A 3I2JA 1J84A 3K4ZA 4UOJA 2VCCA 2YC4A 4D0QA 3I2HA 3GM8A 2J1TA 1PX4A 4AAXA 2W92A 3THCA 3THDA 1CIYA 4GWJA 1O8SA 3A7QA 4ZY9A 1JYWA 4LPLA 3T08A 2HYXA 2VZSA 2VZ3A 2Y6LA 4OMDA 4A44A 2PQSA 1UY4A 4QDQA 1UXXX 2BGPA 4MOAA 3SEEA 2W47A 2WO3A 2VZ1A 5LA2A 5JXIA 2L9LA 4CU9A 3WNNA 2QQOA 1JZ5A 5A1AA 3WSOA 2VMFA 3K4AA 5IFTA 1O59A 3UNPA 1CZTA 1DLCA 3WF1A 1L7RA 1XC6A 2QQKA 1JHJA 1WKYA 2WDBA 2W1UA 3OGRA 1IQDC 3SEPA 3NNGA 3WNMA 2EICA 2BBAA 4A42A 2VZVA 4XURA 2QQJA 3GXUA 3PUHA 3I3DA 2E31A 3VD4A 3OEBA 3GGLA 3LEIA 1GNYA 5EJ1B 3UETA 3SKVA 3ECQA 3OG2A 5IHRA 2Y6KA 1NKGA 1ULPA 3VD5A 3HPNA 3K46A 4D8MA 2EIDA 3OGVA 5G05L 2V4VA 4MGQA 1J83A 1PMJX 2E32A 2J1RA 3ACIA 5EIYB 1W8NA 2JE8A 4JKKA 3NRUA 2VO5A 1UY1A 1WCQA 3SKJE 2RVAA 3EB7A 3WNOA 2VZQA 4OZOA 1W0NA 3LPFA 2DCKA 3WF2A 1F4AA 1W9SA 2BERA 3OB8A 3FHAA 2VTFA 2J1AA 2XONA 3T0DA 4GWIA 4RYDA 5C7GA 1W9WA 1EUTA 3ACFA 3HJRA 4QDSA 4QB6A 3GDBA 4A45A 1JYNA 3NJXA 1W9TA 1H6YA 1KEXA 3I97A 3T2QA 3ABZA 1EUUA 3WNLA 2BGOA 5IJRA 2VR4A 2WZ8A 3HNMA 2E26A 4DUVA 4W50A 4XZUG 2W9XA 3C8XA 2Y6HA 3HNYM 4OUEA 2ZEXA 4OYUA 3T2OA 4LHSA 4W8JA 3UESA 2WAOA 2VZOA 4ET7A 5IFPA 4QX1A 4W4ZA 4MO3M 1US2A 4BK5A 2C4XA 3OGSA 2OKXA 2VMCA 1UWWA 4ZZ8A 2C26A 2VM9A 1O8PA 1SHWB 1TG7A 2XHNA 3MBWA 4PQQA 2J1EA 1UYYA 1XNAA 5G04L 2XQXA 4A3ZA 3J7HA 3MUY1 2YG0A 3WF0A 5JUVA 1H6XA 2J7MA 1ULOA 1HN1A 2ORXA 1SDDB 4L0PA 5LA1A 2J22A 3A22A 2B4KA 4UAPA 1D7PM 2XOMA 2YFZA 2DDUA 2WN3A 3C7FA 1JZ6A 4LQRA 4JX0A 2WYSA 3W5NA 3K4DA 3ZM8A 2J1UA 2YB7A 2EIBA 1NX9A 3A23A 4OMCA 2WZEA 1DYOA 5DN2A 2ZEZA 4CUCA 1OF3A 1GUIA 4XUPA 3VD7A 3T2PA 3MUZ1 3P1IA 3HEIA 3LE0A 3BGAA 1OD3A 4BJ0A 3WNKA 2Y8KA 4JKMA 2J1SA 5JR2A 1JU3A 1GOFA 4RN5A 1JZ4A 5J1XA 1XPWA 2CDPA 2WN2A 2W5FA 3T0AA 1T2XA 3OBAA 2BZDA 4QPWA 2VMDA 5CZKA 4BXSV 3IIIA 4AG4A 2WQ8A 4CU8A 1UYZA 1F4HA 1XNTA 5C71A 3FL7A 2VL4A 4QX2A 4A41A 3VDCA 4A4AA 5F7UA 2QQIA 2Y64A 3IB3A 3CZUA 4TTGA 2ZXQA 4M4RA 1UY2A 2J1VA 1GOHA 3I2GA 1JZ3A 4BDVB 5JMOA 2V72A 3VDAA 4KWUA 1JZ8A 3VD3A 3I3EA 1SG3A 3FHQA 4FI9A 5I0DA 4ARXA 1MPXA 2W1QA 3W5MA 1I5PA 2VZUA 3WF4A 4CVUA 2WABA 2W95A 2W3JA 5CYYA 3EYPA 3I3BA 4XUOA 3OEAA 3ACHA 4IUGA 1GU3A 2VCAA 2VZPA 4QDRA 3LQCA 1P8JA 2W87A 4XUNA 4CUAA 1UZ0A 2QQLA 2WO2A 3C7GA 3HNBM 3T0BA 1JZ2A 5LCWL 1YQ2A 3CZJA 1UXZA 3T09A 4CU7A 4JHZA 2Y6JA 3LEGA 3IAPA 3BN6A 3LPGA 3I2KA 2VCBA 2X05A 1PX3A 3WQBA 3ETPA 3I2IA 5EJZB 1KGYA 3E1F1 2W91A 3JXSA 5IYYA 3HOBA 3MV01 3WNPA 1L7QA 3C7OA 4DUXA 1TVGA 2VMEA 2WBKA 2Z4FA 2VC9A 2VZTA 3AC0A 2ORZA 2CDOA 1CX1A 3ACGA 3DYPA 4DEVA 4Z2AA 1UX7A 3FN9A 4QX0A 4PT6A 4QX3A 4ARYA 2EIEA 1JI6A 4MGSA 1LNSA 4UI9L 1R64A 4KMQA 2QBXA 1K45A 3CMGA 3I2FA 2YFUA 3K77A 1GOGA 3MV11 3DECA 5DQ0A 3VD9A 2HLEA 4XUTA 2Y6GA 4P08A 5FUIA 1GMMA 2YC2A 3K75B 4TXWA 3LEKA 5HPOA 1US3A 2X10A 1JYXA 2DCJA 5DPNA 2C9KA 4P00B 3D3AA 1W8OA 4P02B 4M4PA 4QB2A 3P6BA 3CQOA 4P5YA 4YPJA 1OT5A 2VQUA 2JKXA 4ZZ5A 2W1WA 3U37A 3IDAA 4DXTA 5C70A 4PF1A 3F2ZA 4CUBA 2JD9A 5HXMA 1RYYA 5B4XA 2E33A 3C7EA 2ZEYA 2WO1A 2QQMA 4DEQA 2X09A 1W99A 3IAQA 2WUHA 1NUKA 1UY0A 4LKSA 4XUQA 5JXGA 2VJXA 3C7HA 1UYXA 2LW8A 1K42A 4QAWA 2W46A 2VZRA 1UMIA 2W94A 5JXJA 4DXSA 4GZ9A 1JU4A 1JZ7A 2KD7A 3NJVA 2LS6A 4E8DA 1CZSA 1OH4A 2QQNA 4MADA 3WEZA 2RJ2A 2R7EB 3NQHA 3CIHA 1PMHX 1DP0A 1CZVA 4QB1A 3DYOA 2ZEWA 3DYMA 1OF4A 4A6OA 2RV9A 5LA0A 4DUWA 2W1SA 4BK4A 2VOTA 4E8CA 2JDAA 3MO4A 1NAEA 1UMHA 4DXRA 4JKLA 4ZXEA 3HN3A 2ID4A 2VQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WF3 A;  1UY3 A;  5DMY A;  4HG6 B;  4KI5 M;  1K3I A;  2WAA A;  3CKH A;  4CU6 A;  3CDZ B;  1BHG A;  2B9V A;  1JYV A;  4XVH A;  5JXH A;  2V5D A;  5B4N A;  1GQP A;  1K12 A;  3PUI A;  3VDB A;  3A21 A;  3I2J A;  1J84 A;  3K4Z A;  4UOJ A;  2VCC A;  2YC4 A;  4D0Q A;  3I2H A;  3GM8 A;  2J1T A;  1PX4 A;  4AAX A;  2W92 A;  3THC A;  3THD A;  1CIY A;  4GWJ A;  1O8S A;  3A7Q A;  4ZY9 A;  1JYW A;  4LPL A;  3T08 A;  2HYX A;  2VZS A;  2VZ3 A;  2Y6L A;  4OMD A;  4A44 A;  2PQS A;  1UY4 A;  4QDQ A;  1UXX X;  2BGP A;  4MOA A;  3SEE A;  2W47 A;  2WO3 A;  2VZ1 A;  5LA2 A;  5JXI A;  2L9L A;  4CU9 A;  3WNN A;  2QQO A;  1JZ5 A;  5A1A A;  3WSO A;  2VMF A;  3K4A A;  5IFT A;  1O59 A;  3UNP A;  1CZT A;  1DLC A;  3WF1 A;  1L7R A;  1XC6 A;  2QQK A;  1JHJ A;  1WKY A;  2WDB A;  2W1U A;  3OGR A;  1IQD C;  3SEP A;  3NNG A;  3WNM A;  2EIC A;  2BBA A;  4A42 A;  2VZV A;  4XUR A;  2QQJ A;  3GXU A;  3PUH A;  3I3D A;  2E31 A;  3VD4 A;  3OEB A;  3GGL A;  3LEI A;  1GNY A;  5EJ1 B;  3UET A;  3SKV A;  3ECQ A;  3OG2 A;  5IHR A;  2Y6K A;  1NKG A;  1ULP A;  3VD5 A;  3HPN A;  3K46 A;  4D8M A;  2EID A;  3OGV A;  5G05 L;  2V4V A;  4MGQ A;  1J83 A;  1PMJ X;  2E32 A;  2J1R A;  3ACI A;  5EIY B;  1W8N A;  2JE8 A;  4JKK A;  3NRU A;  2VO5 A;  1UY1 A;  1WCQ A;  3SKJ E;  2RVA A;  3EB7 A;  3WNO A;  2VZQ A;  4OZO A;  1W0N A;  3LPF A;  2DCK A;  3WF2 A;  1F4A A;  1W9S A;  2BER A;  3OB8 A;  3FHA A;  2VTF A;  2J1A A;  2XON A;  3T0D A;  4GWI A;  4RYD A;  5C7G A;  1W9W A;  1EUT A;  3ACF A;  3HJR A;  4QDS A;  4QB6 A;  3GDB A;  4A45 A;  1JYN A;  3NJX A;  1W9T A;  1H6Y A;  1KEX A;  3I97 A;  3T2Q A;  3ABZ A;  1EUU A;  3WNL A;  2BGO A;  5IJR A;  2VR4 A;  2WZ8 A;  3HNM A;  2E26 A;  4DUV A;  4W50 A;  4XZU G;  2W9X A;  3C8X A;  2Y6H A;  3HNY M;  4OUE A;  2ZEX A;  4OYU A;  3T2O A;  4LHS A;  4W8J A;  3UES A;  2WAO A;  2VZO A;  4ET7 A;  5IFP A;  4QX1 A;  4W4Z A;  4MO3 M;  1US2 A;  4BK5 A;  2C4X A;  3OGS A;  2OKX A;  2VMC A;  1UWW A;  4ZZ8 A;  2C26 A;  2VM9 A;  1O8P A;  1SHW B;  1TG7 A;  2XHN A;  3MBW A;  4PQQ A;  2J1E A;  1UYY A;  1XNA A;  5G04 L;  2XQX A;  4A3Z A;  3J7H A;  3MUY 1;  2YG0 A;  3WF0 A;  5JUV A;  1H6X A;  2J7M A;  1ULO A;  1HN1 A;  2ORX A;  1SDD B;  4L0P A;  5LA1 A;  2J22 A;  3A22 A;  2B4K A;  4UAP A;  1D7P M;  2XOM A;  2YFZ A;  2DDU A;  2WN3 A;  3C7F A;  1JZ6 A;  4LQR A;  4JX0 A;  2WYS A;  3W5N A;  3K4D A;  3ZM8 A;  2J1U A;  2YB7 A;  2EIB A;  1NX9 A;  3A23 A;  4OMC A;  2WZE A;  1DYO A;  5DN2 A;  2ZEZ A;  4CUC A;  1OF3 A;  1GUI A;  4XUP A;  3VD7 A;  3T2P A;  3MUZ 1;  3P1I A;  3HEI A;  3LE0 A;  3BGA A;  1OD3 A;  4BJ0 A;  3WNK A;  2Y8K A;  4JKM A;  2J1S A;  5JR2 A;  1JU3 A;  1GOF A;  4RN5 A;  1JZ4 A;  5J1X A;  1XPW A;  2CDP A;  2WN2 A;  2W5F A;  3T0A A;  1T2X A;  3OBA A;  2BZD A;  4QPW A;  2VMD A;  5CZK A;  4BXS V;  3III A;  4AG4 A;  2WQ8 A;  4CU8 A;  1UYZ A;  1F4H A;  1XNT A;  5C71 A;  3FL7 A;  2VL4 A;  4QX2 A;  4A41 A;  3VDC A;  4A4A A;  5F7U A;  2QQI A;  2Y64 A;  3IB3 A;  3CZU A;  4TTG A;  2ZXQ A;  4M4R A;  1UY2 A;  2J1V A;  1GOH A;  3I2G A;  1JZ3 A;  4BDV B;  5JMO A;  2V72 A;  3VDA A;  4KWU A;  1JZ8 A;  3VD3 A;  3I3E A;  1SG3 A;  3FHQ A;  4FI9 A;  5I0D A;  4ARX A;  1MPX A;  2W1Q A;  3W5M A;  1I5P A;  2VZU A;  3WF4 A;  4CVU A;  2WAB A;  2W95 A;  2W3J A;  5CYY A;  3EYP A;  3I3B A;  4XUO A;  3OEA A;  3ACH A;  4IUG A;  1GU3 A;  2VCA A;  2VZP A;  4QDR A;  3LQC A;  1P8J A;  2W87 A;  4XUN A;  4CUA A;  1UZ0 A;  2QQL A;  2WO2 A;  3C7G A;  3HNB M;  3T0B A;  1JZ2 A;  5LCW L;  1YQ2 A;  3CZJ A;  1UXZ A;  3T09 A;  4CU7 A;  4JHZ A;  2Y6J A;  3LEG A;  3IAP A;  3BN6 A;  3LPG A;  3I2K A;  2VCB A;  2X05 A;  1PX3 A;  3WQB A;  3ETP A;  3I2I A;  5EJZ B;  1KGY A;  3E1F 1;  2W91 A;  3JXS A;  5IYY A;  3HOB A;  3MV0 1;  3WNP A;  1L7Q A;  3C7O A;  4DUX A;  1TVG A;  2VME A;  2WBK A;  2Z4F A;  2VC9 A;  2VZT A;  3AC0 A;  2ORZ A;  2CDO A;  1CX1 A;  3ACG A;  3DYP A;  4DEV A;  4Z2A A;  1UX7 A;  3FN9 A;  4QX0 A;  4PT6 A;  4QX3 A;  4ARY A;  2EIE A;  1JI6 A;  4MGS A;  1LNS A;  4UI9 L;  1R64 A;  4KMQ A;  2QBX A;  1K45 A;  3CMG A;  3I2F A;  2YFU A;  3K77 A;  1GOG A;  3MV1 1;  3DEC A;  5DQ0 A;  3VD9 A;  2HLE A;  4XUT A;  2Y6G A;  4P08 A;  5FUI A;  1GMM A;  2YC2 A;  3K75 B;  4TXW A;  3LEK A;  5HPO A;  1US3 A;  2X10 A;  1JYX A;  2DCJ A;  5DPN A;  2C9K A;  4P00 B;  3D3A A;  1W8O A;  4P02 B;  4M4P A;  4QB2 A;  3P6B A;  3CQO A;  4P5Y A;  4YPJ A;  1OT5 A;  2VQU A;  2JKX A;  4ZZ5 A;  2W1W A;  3U37 A;  3IDA A;  4DXT A;  5C70 A;  4PF1 A;  3F2Z A;  4CUB A;  2JD9 A;  5HXM A;  1RYY A;  5B4X A;  2E33 A;  3C7E A;  2ZEY A;  2WO1 A;  2QQM A;  4DEQ A;  2X09 A;  1W99 A;  3IAQ A;  2WUH A;  1NUK A;  1UY0 A;  4LKS A;  4XUQ A;  5JXG A;  2VJX A;  3C7H A;  1UYX A;  2LW8 A;  1K42 A;  4QAW A;  2W46 A;  2VZR A;  1UMI A;  2W94 A;  5JXJ A;  4DXS A;  4GZ9 A;  1JU4 A;  1JZ7 A;  2KD7 A;  3NJV A;  2LS6 A;  4E8D A;  1CZS A;  1OH4 A;  2QQN A;  4MAD A;  3WEZ A;  2RJ2 A;  2R7E B;  3NQH A;  3CIH A;  1PMH X;  1DP0 A;  1CZV A;  4QB1 A;  3DYO A;  2ZEW A;  3DYM A;  1OF4 A;  4A6O A;  2RV9 A;  5LA0 A;  4DUW A;  2W1S A;  4BK4 A;  2VOT A;  4E8C A;  2JDA A;  3MO4 A;  1NAE A;  1UMH A;  4DXR A;  4JKL A;  4ZXE A;  3HN3 A;  2ID4 A;  2VQT A; 
#chains in the Genus database with same CATH topology
 3KT4 A;  1MS0 A;  5GKA C;  1SFY A;  2A6X A;  2ETE A;  4O65 A;  1NT0 A;  1Q56 A;  5FPV A;  5JVV A;  1CIW A;  3S5Q A;  4CDU B;  3CKH A;  3UT0 A;  1UZV A;  2OUJ A;  1AXZ A;  4RQP C;  4JDO A;  4Y1V A;  5E6H A;  3RRD A;  1FNY A;  2JDU A;  3KVB A;  2B9V A;  2DUO A;  4HFS A;  4JQR A;  3O7O A;  3D5O A;  2WFP A;  1GQP A;  1K12 A;  2HBU A;  2HBT A;  5DAQ A;  4YW6 A;  3U1X A;  3PUI A;  4CDU A;  1ACC A;  2VAU A;  2VW2 A;  4FPL A;  3SXW A;  4CPB A;  1J84 A;  1QOS A;  3OTF A;  2VCC A;  4UOJ A;  2CV6 A;  3A0N A;  4NUB A;  5EJ3 A;  4YM0 A;  4S2H A;  4C90 A;  4DS0 A;  4E27 A;  3GZA A;  3PHM A;  3WG3 A;  3WP3 A;  4AAX A;  1MAC A;  2EAK A;  1N1Y A;  4H7M A;  3POY A;  3JBG 3;  3MFC A;  3OBR A;  1I5Z A;  5LW9 A;  2NP0 A;  2XVG A;  3M3O A;  5JZG B;  1R09 1;  4LPL A;  2UU8 A;  3H8O A;  1F15 A;  1EYB A;  4ASK A;  4QGN A;  2QKD A;  2HYX A;  2R16 A;  2VZS A;  2Y6L A;  4A44 A;  3KV4 A;  1BEV 3;  3R0R A;  3PU3 A;  1UPI A;  4HKO A;  4BH9 A;  1D4V B;  3GZT B;  3D4K A;  1UXX X;  5JZG A;  3WP4 A;  3SEE A;  3JUU A;  2W08 A;  2BVV A;  1KDK A;  1QXP A;  3JB8 A;  5JXI A;  1AHS A;  4P9W A;  2P2K A;  2BWC A;  2K0G A;  3QAC A;  4CU9 A;  1EV1 3;  1PIV 3;  5A1A A;  5E16 A;  5IFT A;  2K9Z A;  3LDB A;  5FYH A;  3URF A;  3WXP A;  1LHO A;  5FR3 A;  4DQA A;  3UNP A;  4NRM A;  3AL6 A;  1R1A 3;  4LKD A;  1OMI A;  4AXO A;  2LAL A;  4LO8 A;  4OZX A;  5FMO S;  4H14 A;  3WF1 A;  1XC6 A;  1W8Z A;  3TYJ A;  1JHJ A;  3MF6 A;  1AL2 2;  2I74 A;  2R07 3;  3OGR A;  3LWC A;  4N9H A;  1IQD C;  1RUJ 1;  4AI0 A;  4E9K A;  4UW3 A;  3RSJ A;  1UKR A;  1ZYB A;  3ZXD A;  2VW0 A;  5A3O A;  2A73 B;  1QJU 3;  2VU9 A;  4HSJ A;  1O91 A;  1TME 1;  1QQP 3;  2D6K A;  4J25 A;  2FMD A;  5IK8 A;  2A3W A;  2HWB 1;  1BVP 1;  3SH4 A;  2VUA A;  1D0G A;  5ANQ A;  5F2W A;  3GGL A;  5I0U A;  1W6M B;  2JDZ A;  1IHM A;  4AQ2 A;  3LKJ A;  4EZ4 A;  2VBD A;  1LJ7 A;  1FXZ A;  4CXW A;  3WUC A;  2GP5 A;  3AKQ A;  2PAE A;  3JD7 1;  3KLS A;  3OG2 A;  5IHR A;  4BQ3 A;  3GBG A;  4FOQ A;  4AEM A;  3RWN A;  1WUV A;  1PZ7 A;  1A78 A;  1XYP A;  4AED B;  1W6M A;  4D8M A;  1JUH A;  1WLT A;  2EID A;  2HYK A;  5D8A B;  2V4V A;  4EN8 B;  5FZD A;  3JQW A;  2EAA A;  3ACI A;  5EIY B;  1W2U A;  4AVS A;  5F5C A;  1F31 A;  1XNB A;  4BLJ A;  5A3L A;  5ACA 2;  2EIG A;  4KH9 A;  1XSR A;  4NN0 A;  4D3W A;  4AED A;  3PVN A;  2WQ4 A;  3EB7 A;  4W6X A;  5D8A A;  4BZ4 A;  2VZQ A;  1W0N A;  1KQR A;  1OA4 A;  1F4A A;  3HBZ A;  1AYM 2;  4TSV A;  4AFM A;  4YG6 A;  3WQ1 A;  5FY8 A;  5T5O A;  3ZN6 B;  5JOW A;  1AX1 A;  1JYI A;  5FO7 B;  1UMZ A;  1X36 A;  4Q4Y 1;  3CEW A;  4R9C A;  3U75 A;  5FYB A;  5F5Q A;  1RED A;  2Y0O A;  1W2O A;  4GWI A;  4K1Y A;  5FWE A;  1OVP A;  2ZGK A;  4EN0 A;  3MZH A;  1QHD A;  3PVB B;  4AF9 A;  3TNQ A;  2B8M A;  3HR9 A;  4IGO A;  1UNB A;  3OJB A;  1W3V A;  4R9A A;  1EUT A;  3ZN6 A;  5K8S A;  4WM8 B;  3N7J A;  1ND2 C;  1JYN A;  1UF2 C;  1H6Y A;  1W9T A;  1G7Y A;  3ETQ A;  1ENS A;  2JE9 A;  2ZOE B;  4RFR B;  3L9J T;  3WNL A;  3ZVX A;  1ODM A;  3HNM A;  3IT8 A;  1NE4 A;  3N9Q A;  5T5L A;  4W50 A;  5A1F A;  1UQX A;  3SIS A;  4IEP A;  4PLO A;  4HOO A;  1U5X A;  3HNY M;  2Y6H A;  3BOD A;  4WM8 A;  1DYP A;  1W6N B;  2RMU 2;  4LBK A;  2VNG A;  4NAM A;  4Y1Z A;  2A7A A;  4ATF A;  4ET7 A;  4B4P A;  3VBH B;  1TME 3;  5DAV A;  3ZXJ A;  5FO9 B;  2FDF A;  4YGD A;  4P9G A;  2HWB 3;  2ZJC A;  2DU0 A;  1W90 A;  3VKO A;  5KHI A;  4DMI A;  1C4R A;  4E4H A;  2C4X A;  5LZ6 A;  3OGS A;  1VR3 A;  3OOX A;  1W6N A;  5CBL A;  1DZT A;  4RR3 C;  4NIG A;  2ZGN A;  2C26 A;  2CAU A;  4O9G A;  1VMH A;  2E53 A;  1YFW A;  4PQQ A;  3VBH A;  4FAH A;  3E5Q A;  2UWA A;  3JD7 3;  5F1R A;  5LRR A;  2GU9 A;  1GZT A;  4XF4 A;  5EZW A;  5BNN C;  4A3Z A;  3RZM A;  3WF0 A;  5CU1 A;  4TWT A;  1YCI A;  3IDC B;  4N9I A;  4I3G A;  4OHZ A;  4CDW C;  5KR7 A;  5JSO A;  4KG8 A;  5DUX A;  4ZU4 A;  2Y0I A;  4ES8 A;  5A6Q A;  3LOI A;  2B4K A;  5FZ4 A;  1SEF A;  4UAP A;  4ZPI A;  2DBI A;  4OI1 A;  3MLL A;  1STM A;  2XOM A;  2ET7 A;  1IPS A;  3AMQ A;  3BU0 A;  2GH8 A;  5FO8 B;  4HL0 A;  1JMU B;  1GV9 A;  2XG3 A;  1KXG A;  2VQA A;  5IAT A;  5DZE A;  3W5N A;  3J9S A;  1YQ8 A;  1T6B X;  2VTX J;  1QXJ A;  1GYK A;  2J1U A;  4QKF A;  2R1D A;  4Q4W 1;  2Q8C A;  2E9Q A;  1AYN 2;  2IXI A;  4OMC A;  3WUD A;  4Q4Y 3;  1DYO A;  3ZYG A;  1VBA 2;  4OHV A;  4C91 A;  3BTX A;  4IEY A;  1GUI A;  5FBZ A;  1KJR A;  2VOW A;  5A7Q A;  2ZBJ A;  5C5T A;  3MUZ 1;  1JYT A;  3MIE A;  4FQZ A;  4MGI E;  5H9P A;  5E88 A;  1PHM A;  1GKB A;  1OD3 A;  3CJI C;  4Q1R A;  4LA2 A;  4BJ0 A;  4AQ6 A;  2WS9 2;  2Y8K A;  3OGG A;  2B42 B;  3ZFE B;  2J1S A;  4XBQ A;  3LD8 A;  4E2Q A;  3GBF A;  1JU3 A;  1ULD A;  5CG8 A;  1VAK A;  3RFR A;  1XJA A;  2HH9 A;  2WN2 A;  2IC1 A;  2W5F A;  3O0W A;  4L99 A;  5F3C A;  4CCC A;  1CJP A;  2VMD A;  2VTX A;  3H9A A;  3O5S A;  2HJI A;  4AFB A;  5EXO A;  3RWK X;  4AVA A;  1AR9 1;  3SH3 A;  1DZR A;  3S57 A;  3ZFE A;  1IS5 A;  2BOI A;  2I45 A;  4QMA A;  3DV8 A;  4HPK B;  3WLU A;  1F8V A;  3R6S A;  4A41 A;  4YW2 A;  3IB3 A;  1GIC A;  3HBK A;  2RM2 2;  4MGY E;  5FBJ A;  3S7I A;  5KXB A;  2VMH A;  2ZXQ A;  1ZRE A;  2J1V A;  1GOH A;  2YBS A;  4FOW A;  4QWN A;  4HPK A;  4N90 A;  4OI0 A;  4OFG A;  2BTV C;  2V72 A;  3FLT A;  4HVR A;  5A32 B;  3RDI A;  3TBD A;  4K9S A;  4W6Y A;  4DNY A;  3PUA A;  5C3O A;  4AEK A;  4CEY B;  5FJH A;  2IXH A;  4GXL A;  1AL0 G;  4IL7 A;  2RJL A;  3I3E A;  3AYC A;  4UBG A;  1W8F A;  3GCW A;  3IN9 A;  3J7M A;  1MPX A;  2D97 A;  3W5M A;  3LIH A;  3HQU A;  3WF4 A;  2D40 A;  4U2A A;  5FZF A;  2W95 A;  2D6M A;  5CYY A;  4YVW C;  4DIQ A;  5A32 A;  1W28 A;  4KWJ A;  4CCE A;  1Z0H A;  1NXM A;  4YWA A;  5EWS A;  2OQ7 A;  3TEX A;  4CEY A;  2Z5W A;  2X29 A;  5FZ7 A;  5I93 A;  1Z7S 1;  2WRA A;  1ZZ9 A;  1VRH 1;  2VD7 A;  2ZAB A;  1UZ0 A;  3T0B A;  3UKV A;  3HT1 A;  1JZ2 A;  1DQ4 A;  4FO9 A;  2G9G A;  5LCW L;  3GYD A;  4A6S A;  3FLP A;  1LEC A;  4NWV A;  4V2W A;  1V9U 2;  3H0O A;  1LAJ A;  5GAL A;  3KVA A;  3RMY A;  3AMP A;  4QQH A;  1DDL A;  4Q4W 3;  4QX8 A;  1JYC A;  2XWJ B;  1FOD 3;  3IAP A;  4H7L A;  3LPG A;  2VXJ A;  5FZ6 A;  1PO1 2;  1UCX A;  3DKQ A;  2P6H A;  4OUL A;  5FYM A;  3VDD C;  2AZ5 A;  1QH7 A;  1WBF A;  3HMY A;  1AX2 A;  2WLQ A;  3BU7 A;  2YMZ A;  2YRO A;  3POJ A;  5GLW A;  4QGM A;  1CAW B;  3ENR A;  5LY2 A;  2EXH A;  5KXE A;  2D6O X;  5LWB A;  3PJY A;  5EJZ B;  4XIK A;  2BNN A;  1GZ9 A;  1RHI 2;  2W91 A;  4I3P A;  4RR3 B;  5CKN A;  1O3S A;  2QQP A;  1NZI A;  2O8Q A;  2SBA A;  2ZGO A;  3D6E A;  3MV0 1;  1V6L A;  1VBB 2;  1KD7 A;  4KWK A;  1XYO A;  2UUR A;  4K3U A;  4I02 A;  3WP6 A;  3SCH A;  4ONU A;  2VME A;  5FZ1 A;  4X6R B;  3WDV A;  1CAW A;  2IWG B;  2P1B A;  4Q0P A;  2PHR A;  4COY A;  2ZEY A;  1OFN A;  3ZKY A;  2Z4F A;  5FYZ A;  5BNN B;  1OSG A;  1AXY A;  1HLC A;  3ILR A;  3AC0 A;  3WQ7 A;  1NG0 A;  1AR9 3;  5CNA A;  5J48 A;  1CX1 A;  2VXR A;  1T6G C;  1V00 A;  2OPW A;  5FY9 A;  1EAH 2;  2JX9 A;  1H30 A;  1PO2 1;  1UX7 A;  2EXI A;  3FN9 A;  4I30 A;  1WW5 A;  3SLI A;  4QX3 A;  1H2N A;  4HET A;  4MHU A;  3NV3 A;  3VV1 A;  4NAO A;  5AFB A;  1NLQ A;  3AYA A;  3WNX A;  5BNN A;  5J36 A;  5GLV A;  4W8J A;  3VBF C;  3SCF A;  1MZ5 A;  2RDR A;  1RVF 2;  5DAB A;  4KU8 A;  1FI2 A;  1O6U A;  2YFU A;  3AZV A;  3K77 A;  2WA4 A;  1NCR C;  4D6S A;  3AKS A;  4K7J A;  2OA2 A;  2ZKL A;  4DFS A;  4CDQ B;  3VD9 A;  1FPN 2;  3H8X A;  1QJF A;  3ITQ A;  4EV0 A;  1BK0 A;  2EXJ A;  2WR9 A;  1ND3 B;  2VW1 A;  3U11 A;  4Q2F A;  3V65 A;  1PGL 2;  2WSU A;  2X53 S;  2IFW A;  2P34 A;  3KCC A;  5FQ0 B;  1NYW A;  3RZZ A;  4DB5 A;  2YC2 A;  3QBQ A;  4COZ A;  3OPZ A;  4XIL A;  1US3 A;  5C9A C;  2JE7 A;  2XR4 A;  2RS1 2;  5FZO B;  1RIT A;  4CDQ A;  1OVS A;  5K4L A;  3UV9 A;  2D43 A;  2ARE A;  3BTA A;  2DCJ A;  2IUW A;  5FDB A;  3O1V A;  1ND3 A;  3USU B;  1Z7S 3;  4XQD A;  1RUC 1;  1VRH 3;  3PDQ A;  2Q5T A;  2WKK A;  3U4X A;  5FQ0 A;  4LHK A;  5CB7 A;  1YYN A;  3D3A A;  5FYY A;  3UL2 A;  4P02 B;  1LRH A;  1YRZ A;  5FZO A;  3JQX A;  3IM0 A;  3NL1 A;  5IW0 A;  4NE9 A;  4P5Y A;  4YPJ A;  2P6C A;  1OT5 A;  2GMM A;  2VQU A;  2BJS A;  3USU A;  3JZV A;  2W1W A;  1QDC A;  1W9Y A;  3MFA A;  2JKB A;  4BQ1 A;  3ZXA C;  2VNO A;  4YW4 A;  1S0F A;  1XU2 A;  3OBT A;  3NNL A;  3F2Z A;  3TAY A;  1BMV 2;  5HXM A;  1PMI A;  1AR8 2;  4A2U A;  3K51 A;  2E33 A;  1UW8 A;  1U5I A;  3C7E A;  2VG9 A;  4Y22 B;  3ASI A;  5JOY A;  2CNA A;  3WIN E;  4DEQ A;  4DXZ A;  1JOB A;  1RJ7 A;  1W99 A;  1WMD A;  3DUI A;  3IAQ A;  3UKT A;  3VZJ A;  1ZZ8 A;  3MHZ A;  2HWD 2;  4AYU A;  1LED A;  4IGP A;  4R4Z A;  5FZG A;  3H1Y A;  4GKX A;  4NHK A;  4A7Y A;  3WP5 A;  2BRT A;  3R4U A;  2VBP A;  4Y22 A;  4YYO A;  3O1R A;  4EN9 B;  1PGW 2;  2V4A A;  3NJV A;  5A3N A;  2AR6 A;  1BVV A;  2LS6 A;  4E8D A;  1OH4 A;  3O1T A;  4MAD A;  2R7E B;  5ACA 1;  3KHC A;  1QJY 2;  3AP7 A;  1OA3 A;  4IEQ A;  3CIH A;  4EYU A;  1PMH X;  3KHB A;  4R4X A;  4GJY A;  1WGP A;  3WT3 A;  3CO2 A;  4QB1 A;  1NLS A;  2DVF A;  3BOP A;  3DYO A;  2AEN A;  5FZE A;  3DYM A;  1OF4 A;  1SCR A;  2W0X A;  2RV9 A;  1AYM 1;  3LCP A;  4JQT A;  2OZJ A;  4CCM A;  3KM5 A;  2FBE A;  5IAV A;  3ZDS A;  2BBV A;  2VOX A;  1WCK A;  5FZK A;  3PTY A;  4AVV A;  5FP4 A;  1ZA4 A;  3MO4 A;  5JDB A;  2Q1M A;  5FMD A;  2HWC 1;  1WD3 A;  4DXR A;  2WWS A;  4CP9 B;  5LB6 A;  1KFU L;  1MEC 2;  1ZBE 1;  1AR7 1;  1COV 2;  4KGQ A;  4LOR A;  5L9V A;  1GLH A;  5FYU A;  1F9K A;  4HG6 B;  3POG A;  1K3I A;  4KI5 M;  4HK8 A;  3ZSE A;  1V6J A;  4DOU A;  4DY5 A;  4CU6 A;  3CDZ B;  2V09 A;  4CCO A;  1JYV A;  4C1X A;  4CP9 A;  1U5Z A;  4BA6 A;  4A7K A;  1S0E A;  1RUG 2;  4HVO A;  2E6V A;  4ITC A;  4GJZ A;  4YM2 A;  1N3P A;  5EFU A;  3S30 A;  5IVV A;  1ULE A;  1WW4 A;  5D2A A;  2WO7 A;  4QHB A;  1SZB A;  3ZFG C;  3I2J A;  5CA6 A;  2TNF A;  5I0R A;  3K4Z A;  1PM7 A;  3I4I A;  1GQH A;  4D0Q A;  4P9L A;  1X8E A;  3ZIW A;  2GND A;  2RMU 1;  1PX4 A;  5FYI A;  1PK6 B;  1K5M C;  2W92 A;  2QQW A;  4R8H A;  5EV7 A;  4KU7 A;  3THD A;  1CIY A;  3N7K A;  4GWJ A;  1O8S A;  2JDM A;  2ZX4 A;  3A7Q A;  3DGT A;  4QGL A;  2F6B A;  5DXD A;  5F6K A;  1S55 A;  2JG9 B;  1J1L A;  4WM7 C;  4IEO A;  1H2L A;  3T08 A;  4ATE A;  5T3N A;  4IET A;  5FXV A;  4NJ4 A;  4IV1 B;  1KRI A;  1PK6 A;  1F35 A;  2PQS A;  5J98 B;  4EWD A;  5FOJ B;  1VAM A;  2YGL A;  2D6L X;  4JZR A;  4QDQ A;  5FKC A;  3OPT A;  4G9S B;  4P9Y A;  2BGP A;  3WHT A;  4Q8L A;  4BIO A;  4MOA A;  5F2S A;  1LOF C;  2FZ1 A;  2JG9 A;  2PFW A;  1SBF A;  3UJO A;  2WII B;  2WO3 A;  1D4M 1;  3PME A;  4Y1U A;  2QQO A;  1VBC 2;  4IV1 A;  1NY7 1;  1MZ6 A;  4Y26 A;  5K7P A;  4LHN A;  3K4A A;  1W8T A;  3M4F A;  2BWA A;  4QM9 A;  1OUS A;  2GH2 A;  3O1P A;  1GZC A;  1BZW A;  1CZT A;  1S1A A;  1XOY A;  4KBB A;  4UFI A;  5ACA 3;  3BI3 A;  2EAL A;  5JR7 B;  2P3J A;  4SLI A;  1HB3 A;  4NPM A;  4OQ8 A;  2XLA A;  3KQR A;  1SDW A;  3VHR A;  4BOW A;  2PTM A;  3AB0 A;  3WOG A;  3WW2 A;  5KBF A;  2D44 A;  2XHK A;  1AYM 3;  2MEV 1;  1DGW X;  3P3P A;  4E4Z A;  3WNM A;  2YZ4 A;  4XJ8 A;  3N35 A;  4CEW C;  5JSR A;  1ASJ 2;  2XKO A;  4ZS3 A;  3GJA A;  4CUG A;  1AYN 1;  2HWC 3;  3KT7 A;  3I3D A;  5DUW A;  3H8R A;  4JGZ C;  2RS3 2;  5T54 A;  3O1M A;  2GZW A;  3ZYH A;  1G6N A;  1KDM A;  1ZBE 3;  3V56 A;  4FCA A;  4L11 A;  4Q1P A;  3RYK A;  1GNY A;  3BIW E;  4Q27 A;  5IK5 A;  1N3Q A;  3B93 A;  3UET A;  4XTP A;  3FUQ A;  2RR1 2;  2WS9 1;  2WYF A;  4O9E A;  2ZKN A;  4CDX C;  5JIU A;  4QX5 A;  4AOC A;  1YLL A;  1OOP B;  4RSU A;  4LBL A;  4XFB A;  2Z42 A;  2FDK A;  2CAV A;  4FPE A;  4MLO A;  3N9M A;  4MGQ A;  1J83 A;  4ZKT B;  2RDS A;  3Q9O A;  4QHZ A;  4NIH A;  2CTV A;  3VBS B;  2JE8 A;  4CA9 A;  4JKK A;  2VO5 A;  3MLK A;  1I6X A;  1VIW B;  3JB4 C;  2RMU 3;  3T1M A;  3B5L B;  2WFF 2;  1OOP A;  5GZC A;  3QH6 A;  4PCR A;  5F3G A;  1IS6 A;  2ARA A;  2XXZ A;  3DXT A;  2G9F A;  2H0V A;  3OCP A;  3PLQ A;  1MS8 A;  4BM8 A;  2QFE A;  2RM2 1;  2DCK A;  1MS3 A;  3AYD A;  3VBS A;  3EQE A;  5GZG A;  2VVF A;  2GAU A;  5FRA A;  3CLP A;  4EN7 B;  2Z69 A;  1NCQ C;  2VTF A;  4WVV A;  3V0B B;  1BBT 2;  1S2B A;  3M7A A;  4NVP A;  5FP9 A;  2B7Y A;  4NOT A;  3L2Y A;  3EHK A;  5FYS A;  2WNU C;  2XON A;  4I0A A;  3ZMN A;  3BTZ A;  1RXF A;  2XUM A;  4RYD A;  3TNP B;  4XJU A;  5ANN A;  5HV0 A;  1D0H A;  1NA1 C;  2ARC A;  2GME A;  2DCY A;  5C7G A;  2YGM A;  3KQ4 B;  3RJ2 X;  5LA9 A;  4FVV A;  4IV3 C;  4QDS A;  4QB6 A;  4Y5Z 0;  3GDB A;  4Q0S A;  4A45 A;  1KEX A;  1SBD A;  2P3I A;  3T2Q A;  3V0B A;  1SLI A;  1LU1 A;  1ZZB A;  1LEM A;  1CX4 A;  3ABZ A;  5FMB A;  1VAL A;  2WZ8 A;  4A3X A;  4NPR A;  1Q8V A;  4DUV A;  1VP6 A;  4XZU G;  1OHF A;  5L7O B;  3FWE A;  4AHW A;  4Z07 A;  3K3N A;  1MS1 A;  3C8X A;  1V9U 1;  2MEV 3;  4QPI B;  5IUQ A;  4DPN A;  1PZ9 A;  1OH3 A;  4HN0 A;  2PHL A;  3N4M A;  3MIG A;  1W03 A;  2PN5 A;  4YVS C;  1W06 A;  3VKL A;  1X9T A;  1AYN 3;  4AWD A;  1PNG A;  5IFP A;  3ES4 A;  3LFI A;  1WLD A;  1B35 C;  2RJK A;  2UY9 A;  2KR2 A;  2VUC A;  3POW A;  2E7T A;  5L7O A;  1ZNP A;  2IXJ A;  3PUQ A;  5GZD A;  5CFD C;  2R0F A;  4ZZ8 A;  3LA3 A;  1Q3E A;  2F4P A;  3ZO0 B;  1TG7 A;  5BV6 A;  5ISL A;  3GCX A;  3MBW A;  2LUW A;  4J1W A;  3E5X A;  1UYY A;  1JOD A;  1XNA A;  2VUL A;  2WS9 3;  3I8T A;  1QWR A;  2G19 A;  5G04 L;  1H8T C;  2XQX A;  1QJZ A;  4U36 A;  3HIF A;  2DFB A;  4XMI A;  1VBB 1;  3J7H A;  3MUY 1;  3VZL A;  4IEV A;  1QY4 A;  3OGJ A;  2NMN A;  1ULO A;  2X5I B;  4FP2 A;  3I2D A;  4S2G A;  2Y34 A;  2J22 A;  5FP8 A;  3E97 A;  3SMH A;  2ZGP A;  1REF A;  3UKN A;  4Q0Q A;  1H1M A;  1D7P M;  2MHF A;  1E5I A;  1H1I A;  2TEP A;  1Q5O A;  1EAH 1;  1WD4 A;  2VGD A;  5K0U C;  3WHU A;  4JDN A;  4JTN A;  2WZP P;  2X5I A;  2RM2 3;  3WDW A;  2R04 2;  3ILN A;  1Y3T A;  3ZM8 A;  1Y9Q A;  4FOV A;  1D2S A;  4CP1 A;  3AKT A;  3R05 A;  4P9J A;  4XCB A;  5F5I A;  4LBQ D;  2AYH A;  1H2M A;  2YB7 A;  4HXC A;  3A23 A;  2H6C A;  1ENX A;  1FYU A;  5DN2 A;  1XYN A;  1FPN 1;  4L92 A;  5FY5 A;  3VBR C;  1RTV A;  1UOG A;  5J7M A;  1CWP A;  3NVC A;  1WCS A;  3NAP C;  2A71 A;  3NO8 A;  1PGL 1;  3VD7 A;  4NHL A;  1V70 A;  4RS5 B;  3I3M A;  1S0B A;  5HBA A;  2ET1 A;  3HEI A;  3LE0 A;  2DUQ A;  4NRO A;  5ABJ B;  3IDE A;  1DQ5 A;  1FNZ A;  1X7N A;  1FAT A;  4KG0 A;  2JB4 A;  1JN2 P;  4M3C E;  2VMI A;  5A7O A;  1C57 A;  2QTW B;  4RN5 A;  1JS9 A;  4NMI A;  2OQ6 A;  4RS5 A;  1W6P B;  3OBA A;  1Z78 A;  3LGR A;  4RA0 A;  5CZK A;  4AGG A;  1HRI 1;  2IXK A;  3IDB B;  3III A;  3DPR B;  4AG4 A;  4BXS V;  5ABJ A;  4IE4 A;  2WQ8 A;  1V9U 3;  1L3J A;  1ZM1 A;  4KL1 A;  4O7X A;  4F7Z A;  2B9U A;  4K8R B;  1F4H A;  1XNT A;  1O3T A;  1QXR A;  2D3P A;  2DVD A;  1TNF A;  2JXA A;  1G9D A;  2Z2S B;  4YGB A;  1E5S A;  2QQU A;  3IWZ A;  5F7U A;  1PO1 3;  2R0H A;  1W6P A;  2WWJ A;  5SV8 A;  4KNC A;  2NMO A;  3FUO A;  1RUI 2;  3DPR A;  4QPI C;  4CCN A;  5KXD A;  3VN4 A;  4CCK A;  1J59 A;  5H9Q A;  1JH5 A;  3CBN A;  4N53 B;  1AR8 1;  2JJ6 A;  2DU1 A;  1JZ3 A;  1RHI 3;  1ZA7 A;  2JIG A;  3NW4 A;  4LE4 A;  1BQP A;  5JMO A;  2K46 A;  4YSF A;  5FPX A;  3LA7 A;  5H9R A;  2AUY A;  5IVC A;  1VBB 3;  1AF9 A;  2QVS B;  4XEZ A;  3H7J A;  2NYY A;  2ZZJ A;  4TYS A;  3VD3 A;  4GA9 A;  4UF0 B;  3W58 A;  5BNO B;  3TN9 2;  1JZ8 A;  5F3E A;  1C8M 2;  4FI9 A;  5I0D A;  4MHR A;  2W1Q A;  1JOJ A;  4N53 A;  2GN3 A;  2VZU A;  2WWU A;  4YG0 A;  2WAB A;  4XFG A;  4YW5 A;  2WNE A;  3AP4 A;  4ZS2 A;  2ARX A;  4WVZ A;  1XND A;  4PIY A;  2H0B A;  3I3B A;  4XW3 A;  4XUO A;  3OEA A;  4BCU A;  1EAH 3;  5LK7 B;  4IUG A;  1PVC 1;  2B45 X;  4HLT A;  5A7S A;  4KQ7 A;  1U12 A;  4G4F A;  2UWC A;  2A6Z A;  2W87 A;  4EQV A;  1PGW 1;  4CE8 A;  4MGZ E;  4I01 A;  4N43 C;  3AFK A;  2HWF 2;  2JDP A;  2QQL A;  2WO2 A;  5GLT A;  4X8P A;  1XE0 A;  5DDJ 2;  1W2T A;  2W39 A;  4RQP B;  3SCG A;  1UXZ A;  2YU1 A;  1HN0 A;  4NRP A;  4IEX A;  2JWP A;  3DEM A;  5AVP A;  2P5B A;  1IPJ A;  2DYC A;  1Y7B A;  1YQC A;  3ZLI A;  3LEG A;  1RUH 2;  3BN6 A;  3WG2 A;  1UZW A;  4S2F A;  1FPN 3;  3I49 A;  4YAR A;  1M06 G;  4QD2 A;  5A3P A;  4RQP A;  2EA7 A;  2XJT A;  1IQA A;  2BGC A;  4V1P A;  3ETP A;  3H3U A;  3I2I A;  3MPB A;  1RUN A;  3AKP A;  5C3Q A;  1WCU A;  1JUI A;  4D7Y A;  1MEC 1;  1YJK A;  3NV2 A;  1COV 1;  5JI7 A;  3H8U A;  4IE0 A;  5AC9 2;  3WX5 A;  5JWP A;  4QKD A;  4AI9 A;  1L7Q A;  3WW4 A;  5LK5 A;  2XH6 A;  4LMF A;  2A3X A;  3FJS A;  5GZF A;  2WSV A;  1TVG A;  2WLP A;  4PDW C;  1H8T B;  4NO4 A;  4TLG A;  2UYA A;  4LO5 B;  5FK8 A;  1DZQ A;  3VGI A;  1HRI 3;  5LRS A;  2WZR 1;  2XJV A;  4OI2 A;  1PVX A;  2VC9 A;  4IE6 A;  2CDO A;  3VKN A;  5F32 A;  3RVH A;  1RUG 1;  4CCJ A;  3TRS B;  5A70 A;  1IG0 A;  4DEV A;  4Z2A A;  4JHT A;  2XL7 A;  3FMG A;  1OUX A;  5L9B A;  3AJY A;  2YDE A;  3PIG A;  4QX0 A;  4ARY A;  5IVF A;  5CEH A;  1H8T A;  2PHX A;  4FPJ A;  4LK6 A;  4BQY A;  1V6I A;  1AVB A;  4Q0V A;  1FMD 2;  2VBB A;  5F8P A;  1R64 A;  2V5Y A;  4FXG B;  2FMY A;  3S5A A;  1QGL A;  2JEM A;  2QBX A;  1CPN A;  3CMG A;  1GNH A;  3I2F A;  4Q4V 2;  1VBD 1;  4GKY A;  1AR8 3;  4Q4X 2;  1X33 A;  4CZS A;  3IIA A;  5FKB A;  3DEC A;  5DQ0 A;  4HVQ A;  4QM8 A;  5TSW A;  2CGP A;  3B7M A;  2FD8 A;  3HVD A;  5FYV A;  5E8A A;  2W52 A;  3BVC A;  2FHR A;  5JLV A;  4ERO A;  2I2S A;  3IPV B;  1FOD 1;  4Q5O A;  4P08 A;  3R4S A;  4E4S A;  2PQQ A;  3AYE A;  2OYZ A;  3N3H A;  1YWK A;  3AZX A;  1RUF 2;  3NJY A;  3P3N A;  1WW7 A;  2D98 A;  3B02 A;  1LOD A;  2HEV F;  1TE1 B;  4FBF A;  2QZ3 A;  5LBC A;  2Y26 A;  3ST7 A;  3VHN A;  5CAD A;  3PMS A;  3PU8 A;  1N1S A;  1QIQ A;  2X10 A;  3QCW A;  5EYY A;  3IPV A;  3PVE A;  1PVC 3;  2VOV A;  3T3Y A;  3WD5 A;  1HW5 A;  5DPN A;  1NQJ A;  3J4U H;  5HV4 A;  2C9K A;  5IWF A;  4OHX A;  1CAV B;  4KBZ A;  5FIX A;  1N47 A;  5FZH A;  2K2S A;  1QJY 3;  2RS5 2;  3PJQ A;  4M4P A;  1URX A;  4UFH A;  5A3T A;  3P6B A;  3FBM A;  5BNQ A;  1MVE A;  2A1X A;  2R06 1;  2BU9 A;  4LJH A;  4ZZ5 A;  5E89 A;  2CSG A;  5HI0 A;  1DCS A;  1V6K A;  4LBO A;  3IDA A;  4MUV A;  1R08 2;  5FRE A;  3U10 A;  2Q4S A;  2GDF A;  1CAV A;  1SLA A;  4WVW A;  3IBM A;  5BYN A;  1FV2 A;  2C1F A;  4CUB A;  3B3Q E;  1GAN A;  1YI7 A;  2VQ0 A;  2CHH A;  3TEY A;  5GZE A;  3LF7 A;  4SBV A;  1DGL A;  1NE6 A;  3V64 A;  4AQT A;  1SAC A;  1YFU A;  2RS3 1;  2VNR A;  2V73 A;  2VPV A;  2QQM A;  2EF6 A;  2VVD A;  2WO1 A;  1MEC 3;  4NR1 A;  4W6W A;  1COV 3;  4XAA A;  5FYT A;  4YNI A;  4NIA A;  4DO0 A;  1ENQ A;  2X09 A;  5F9T A;  5LEJ A;  5HCH A;  4IE7 A;  5C8W A;  1NUK A;  1NXD 1;  4XUQ A;  4YRD A;  1OQ1 A;  5FCC A;  2WQZ C;  5DZG A;  1NOV A;  1N1V A;  1QF3 A;  1SFP A;  2LW8 A;  1GQG A;  2RR1 1;  4FPF A;  4GB3 2;  4JGY C;  4M0H A;  2WZR 3;  4QX7 A;  4C8D A;  1K42 A;  1A8D A;  4QAW A;  4BU2 A;  4XBL A;  1RUG 3;  4QKB A;  4XDQ A;  1UYP A;  3WV6 A;  4XFF A;  4BHP A;  3O1O A;  1QNY A;  4MGT A;  4GZ9 A;  1JTZ X;  4JC1 A;  2R6Q A;  2UYB A;  4I09 A;  2W68 A;  4RHV 2;  1HRV 2;  4UW6 A;  1X50 A;  4WV8 A;  5BNP C;  1HV1 A;  1LOB A;  4RFT 0;  4ZU5 A;  1AUY A;  2RJ2 A;  4HKL A;  3NQH A;  1ND2 B;  1O5U A;  5JPM B;  4M01 A;  5DG2 A;  1VBD 3;  3SHR A;  4DIN B;  1DP0 A;  1C5H A;  4PLN A;  1QJU 2;  3A4U A;  1EPZ A;  4LE3 A;  1J58 A;  4A6O A;  4XQW A;  3E6C C;  4L2N A;  3B01 A;  3HT2 A;  1QQP 2;  2EXK A;  4BYY A;  3V0A B;  1VMJ A;  1W0O A;  2W1S A;  3RI9 A;  1VB4 A;  4E8C A;  4MG2 A;  1APN A;  1CPM A;  1ND2 A;  3C2U A;  3KV6 A;  2BUK A;  5EYX A;  1NAE A;  1VB2 A;  2UWB A;  1BBT 1;  2B39 A;  5C8C C;  4LUK A;  3VZO A;  1MZF A;  4ZXE A;  4FFH A;  4MVT A;  2OS2 A;  4CTE A;  4XC9 A;  2CWS A;  5LEK A;  3VBO C;  4GUL A;  3ZX7 A;  4BIF A;  5DMY A;  3V0A A;  1S0I A;  5IVJ A;  1VBC 3;  3QD6 A;  4Y3O A;  3E5U A;  4BQ5 A;  1RMU 2;  5F37 A;  1YO8 A;  3KGL A;  5F39 A;  2XGX A;  2O1Q A;  3ATG A;  1G86 A;  1N3O A;  5JXH A;  4FTB A;  3B94 A;  4YM1 A;  2V5D A;  1UO9 A;  1YFX A;  1ZBA 2;  1DQ1 A;  2YXS A;  3SQO A;  2TUN A;  3F95 A;  3VDB A;  1WA4 A;  2R06 3;  4ZON A;  3CJX A;  2ZHM A;  4FFF A;  4RR3 A;  4FPG A;  4CDW B;  1XNK A;  2O8O A;  5EP9 A;  1FV3 A;  2YC4 A;  3B9C A;  4XAE A;  2RDQ A;  3EBR A;  3HN1 A;  3I2H A;  1GBG A;  3GM8 A;  4LA3 A;  1ASJ 3;  1R09 2;  4LO6 B;  3RYP A;  4BMB A;  3O0X A;  5J37 A;  4GAL A;  4KGG A;  1FT9 A;  1AR6 2;  3LFM A;  3D8C A;  4LXL A;  4PQ9 A;  1MQT C;  2IFR A;  3GJB A;  4FPO B;  5A80 A;  2RS3 3;  3WZ1 A;  4AFC A;  5IVE A;  1WWY A;  1WME A;  4ZY9 A;  4ES9 A;  4XET A;  4O61 A;  3U4S A;  4CDW A;  2FZ2 A;  1OKO A;  4AR2 A;  1IOA A;  2IXC A;  2VZ3 A;  4OMD A;  4D7T A;  1LR5 A;  1BCX A;  2C6S A;  2YHJ A;  1HV0 A;  2RR1 3;  3GNE A;  2Q1F A;  4NHM A;  3AJZ A;  5FP3 A;  2PLV 2;  1OLM E;  1QJX 2;  4JCK A;  4XDO A;  3EXU A;  1VE0 A;  3ZR6 A;  4PBO A;  5FV3 A;  4CXY A;  5JCT A;  2X8K A;  5LA2 A;  2XLF A;  4AI2 A;  4C0B A;  1OUR A;  3WNN A;  1GP6 A;  4A7Z A;  3I59 B;  3TEZ A;  1O59 A;  5L9R A;  4AZZ A;  3CJI B;  1RIN A;  4YZ4 A;  1DLC A;  4L8Q A;  2WFF 3;  3KB5 A;  4E2S A;  1RUJ 2;  1L7R A;  5C5U A;  1MS4 A;  2LM3 A;  1MR5 A;  2QQK A;  2ZCW A;  3Q8B A;  3ES1 A;  2WDB A;  1DQ0 A;  5IVB A;  2BFU L;  2BNO A;  1WLW A;  2R04 1;  1OD5 A;  3I59 A;  5CVR A;  3SEP A;  4ASM B;  3NNG A;  1G9A A;  4BQ2 A;  4HON A;  3KD4 A;  1N1T A;  3J26 N;  2EIC A;  2BBA A;  1AL2 1;  3CJI A;  4A42 A;  2VZV A;  4XUR A;  2QQJ A;  5KHG A;  5M0T A;  3AP6 A;  2ATF A;  1TMF 2;  1BBT 3;  2PMW B;  2E31 A;  4CPB D;  3KMH A;  2ES3 A;  4H55 A;  4E2G A;  2VMG A;  4TN7 A;  3JD7 2;  2RDN A;  2YU2 A;  2I07 B;  4HBN A;  2FDI A;  4QPG C;  1IKQ A;  2FCT A;  4YGE A;  1VRB A;  2XKP A;  4AFD A;  5A6Y A;  3ECQ A;  4RGK A;  4OQ9 A;  4B4Q A;  5A6X A;  2Y6K A;  2ADE A;  3KWV A;  3HPN A;  2P3Y A;  4PHZ A;  1QEX A;  1DG6 A;  1V6O A;  4JGY B;  5G05 L;  1YUD A;  2WIN B;  4YZ2 A;  1SLL A;  4Q26 A;  1LGB A;  5A7W B;  1REE A;  2ZPX A;  3DCQ A;  3OY8 B;  2A6Y A;  1GSL A;  4GH4 C;  5FYC A;  1V6M A;  4YVW B;  1WCQ A;  3MIH A;  5C4W C;  3BTY A;  3ZDV A;  2AEZ A;  2C9A A;  2RVA A;  3SKJ E;  4AI1 A;  4JGY A;  4XXP A;  5CFC C;  4XAB A;  4PBP A;  3WNO A;  4OZO A;  3TWI A;  3AM2 A;  2YYO A;  1RUI 1;  3WF2 A;  1W9S A;  1ULC A;  1ZRI A;  5A7W A;  4BQW A;  3OY8 A;  3PVO A;  1LKN A;  3WCR A;  3OB8 A;  4GWN A;  5A7N A;  5JPN B;  1OQE A;  2BYV E;  3FHA A;  2ZMN A;  4H3W A;  4YVW A;  2PHU A;  4GQ7 A;  3B00 A;  1GP4 A;  1Q8S A;  3FFZ A;  2J1A A;  1AXK A;  2WA3 A;  1GZW B;  2ERF A;  3VDD B;  4QQL A;  1DGR N;  3TN9 1;  1C8M 1;  3U78 A;  3ZPO A;  2PHD A;  1A6C A;  2ZS6 B;  2JIC A;  3ACF A;  3HJR A;  3OUH A;  3I97 A;  3NST A;  1LHV A;  1UOB A;  2E51 A;  4CP0 A;  1B09 A;  1NQD A;  2JEC A;  2BGO A;  5FK7 A;  5IJR A;  2VR4 A;  1W05 A;  1GZW A;  4OVE A;  4HMZ A;  3PIJ A;  4AGR A;  3VDD A;  3GZU C;  3QH7 A;  2JG8 C;  4CRQ A;  2ZX1 A;  2R04 3;  3M3I A;  2YV8 A;  3TOJ A;  4V2V A;  2ZEX A;  1TZO A;  2XUE A;  3TB0 A;  4LHS A;  1WMF A;  1ZX5 A;  1AL2 3;  2B46 X;  3UES A;  4HT1 T;  2WAO A;  2PAK A;  1ZRF A;  3RZH A;  1W6O B;  5T5J A;  3HN3 A;  2XML A;  3AL5 A;  3AVR A;  4QXC A;  4QX1 A;  1JOP A;  2P37 A;  3VB9 A;  2DTW A;  4XFA A;  2CL2 A;  3RYR A;  4MO3 M;  2Y6F A;  1US2 A;  4XYX A;  4CDU C;  4BK5 A;  5DG1 A;  4Y5T A;  3ILF A;  1X82 A;  5CIR A;  3CHX A;  4Z82 A;  2VMC A;  2CU5 A;  4QXB A;  3MIC A;  3I3Q A;  1BK1 A;  1JXN A;  2NN8 A;  3RI8 A;  3VBF B;  1SHW B;  5LBE A;  1W6O A;  1OPO A;  2BOJ A;  3VHP A;  3WG1 A;  3KCY A;  4LKE A;  3WCS A;  5D21 A;  1NCR B;  1HJG A;  5AC9 1;  1YNA A;  2GNT A;  2Y60 A;  3U0Z A;  1H9P A;  1HXS 2;  3UJQ A;  5JUV A;  2ZGR A;  1H6X A;  5FFO C;  1HQL A;  3VZN A;  1HKD A;  4K21 A;  4AK3 A;  2XVL A;  2YBP A;  3CF6 E;  3MID A;  4IEU A;  4ISR A;  2ORX A;  2WL1 A;  1SDD B;  3LZZ A;  4L0P A;  3VBF A;  5HCA A;  2ZAC A;  3WDT A;  3FFQ A;  4EWA A;  4Y4Y A;  4GMP 0;  5DAW A;  1O3R A;  4K40 A;  1TEI A;  3HWJ A;  1IS3 A;  1NCR A;  1XNC A;  2IZW A;  4J1X A;  3ZYP A;  5DUU A;  5C9A B;  3BYW A;  3O1U A;  2WN3 A;  1O4Y A;  3AK0 A;  4LQR A;  2OII A;  2AEY A;  2WC2 A;  5JZG C;  5FPA A;  4N8M A;  2VH9 A;  3K4D A;  4Q4W 2;  4PJY A;  4OHW A;  5LBF A;  2XJS A;  1RUI 3;  1UZY A;  3B69 A;  5FZ8 A;  4LIT A;  3WQ0 A;  2DWR A;  1ZVF A;  2XLG A;  4Q4V 1;  2WT1 A;  5C9A A;  4XFH A;  2A75 A;  2EIB A;  1W04 A;  4Q4X 1;  3BUC A;  1NX9 A;  4BME A;  4LKF A;  4TZD A;  1C1F A;  4XTM A;  1S4C A;  4B8E A;  4UT5 A;  3O0V A;  2Y33 A;  1POQ A;  1KIT A;  4XUP A;  5FUP A;  1WLC A;  3TN9 3;  1RUF 1;  1C8M 3;  1KS4 A;  1ONA A;  1VBA 1;  2R30 A;  3KT1 A;  2Q8E A;  2GMP A;  4IEZ A;  3RNS A;  2VEC A;  1YJL A;  1DF0 A;  4UYB A;  5ERL A;  1ZZ7 A;  5FTT C;  3WNK A;  4B3N A;  1QKQ A;  3J8F 2;  2YPJ A;  3FE5 A;  3M8L A;  3QOP A;  4Y33 A;  1GOF A;  2WT0 A;  5GLZ A;  3ZYF A;  3IMN A;  5FY4 A;  3VBU C;  2GC3 A;  3T0A A;  1XU1 A;  3Q8E A;  5FWJ A;  2HWF 3;  3H7Y A;  4QPW A;  2BZD A;  4BWO A;  2JDN A;  3H3L A;  2IXL A;  5DDJ 3;  4AI8 A;  3AP5 A;  4Z1V A;  4IXL A;  1S0G A;  4CU8 A;  2BPA 2;  2QZ2 A;  4M00 A;  4QQ2 A;  4XJZ A;  2D3R A;  4FPC A;  2OXB A;  2VL4 A;  4F83 A;  1RUH 3;  4QX2 A;  1YHF A;  4LOT A;  3W59 A;  1J3P A;  3NNJ A;  4A4A A;  2QQI A;  2Y64 A;  4NWW A;  4GMP 1;  1R08 1;  1DGW A;  2DTY A;  2UY8 A;  4BB3 A;  3LSD A;  2OW4 A;  4P9X A;  4AAP A;  1MVQ A;  2D5H A;  2JB8 A;  4M4R A;  3ZXG A;  1VLN A;  3H3Z A;  3IZO A;  5I0T A;  1AZD A;  3ZSK A;  5IVY A;  1H8V A;  5FXX A;  4JV4 A;  3MW4 A;  4XZP A;  3VDA A;  5AC9 3;  4UW5 A;  4AED C;  3T1L A;  3K3O A;  1YIP A;  2DFC A;  2GSY A;  5D8A C;  3GHN A;  5DZF A;  3ZFF C;  3N9N A;  4K6B A;  4BQ4 A;  3RJR A;  3OBZ A;  2P4E A;  4UXA A;  5JMC A;  3S7E A;  4GB3 1;  4YFW A;  4BXF A;  3VUO A;  4W65 A;  4CVU A;  2AC1 A;  1KJL A;  2W3J A;  4LBM A;  3NMB A;  3VKF C;  3AXE A;  2HEW F;  4MH0 E;  4LO7 A;  5AVA A;  4LK7 A;  2VZP A;  4QDR A;  3AP9 A;  2VUJ A;  1P8J A;  4XUN A;  3OUJ A;  3AVS A;  1RGS A;  1UN1 A;  4RHV 1;  4OI4 A;  1HRV 1;  1O4Z A;  3T4H B;  4CCD A;  1GWK A;  3C7G A;  3HNB M;  2NQY A;  2ZAH A;  1LES A;  1LOA A;  4HKW A;  1LCL A;  1YQ2 A;  5FZA A;  3T09 A;  4DZG A;  4CU7 A;  5BUV A;  4Q4V 3;  2ZGU A;  5FP7 A;  2JG8 B;  2Y6J A;  4Q4X 3;  1OBN A;  4OUM A;  3VZM A;  4LUM A;  4TLF A;  5FZB A;  5AFE A;  1O3Q A;  4RD7 A;  3OD0 A;  3I2K A;  2C5D A;  2VCB A;  1EP0 A;  2VE1 A;  4CSW A;  3ZFG B;  4KWL A;  1PM4 A;  1ULG A;  1PX3 A;  4YGC A;  3AZW A;  4WM8 C;  3WQB A;  1RUF 3;  1PO1 1;  1VBA 3;  4YG3 A;  4Z2W A;  1KGY A;  2JG8 A;  3E1F 1;  4GWM A;  3USS A;  1K5M B;  4Y20 B;  4MET A;  4PIX A;  1CD3 G;  1J3R A;  1LGC A;  5I0S A;  3UK9 A;  2VOK A;  5IYY A;  3CU7 A;  2OZ6 A;  3MPP G;  4HAN A;  3WNP A;  2RHP A;  4WM7 B;  1HQW A;  1RHI 1;  3C7O A;  4ORF A;  2PXJ A;  4XJ9 A;  4ZXK A;  4LLF A;  3ZFG A;  1RMU 1;  2A6W A;  3Q8F A;  5DUV A;  4Y1X A;  2WBK A;  1PO2 2;  3ZYJ B;  1K5M A;  2VZT A;  4Y20 A;  2RS5 3;  2QQV A;  1LGN A;  5FJK A;  3DYP A;  1YI9 A;  1ZBA 1;  3VBH C;  4EWE A;  1DIW A;  2BP6 A;  5GM0 A;  5A33 B;  3MI8 A;  4WM7 A;  2WJS A;  1IZ3 A;  4JDM A;  4PT6 A;  5APA A;  1L7L A;  2BW8 A;  4WBB A;  1S2K A;  5FZC A;  2GP3 A;  2ZGL A;  5C6C A;  3BB6 A;  1J3Q A;  1R08 3;  3AZY A;  4GMP 3;  1OA2 A;  4MGS A;  5A7P A;  4Z8B A;  3NV1 A;  4DRR A;  1RUE 2;  1Q8P A;  4UI9 L;  1RUD 2;  1GWL A;  4KMQ A;  1OKQ A;  3MEP A;  3ZXE A;  3NNF A;  1GOG A;  1AR6 1;  2ZGT A;  3Q8C A;  4RL7 A;  4XOG A;  4B1M A;  2DVA A;  1LOF A;  1QOO A;  5A33 A;  2R1B A;  2O0O A;  1CAU B;  4WVM B;  3INA A;  2GNM A;  1RVF 1;  4MX3 A;  2HLE A;  5FUN A;  3SC7 X;  3HD8 B;  4C0H A;  1JW6 A;  2DUR A;  1U0A A;  3ZYB A;  5KHK A;  2JDK A;  4NRQ A;  3D0S A;  4GB3 3;  2DF7 A;  3K75 B;  1YC6 1;  4TXW A;  4CEW B;  3LEK A;  1QJE A;  1XBF A;  4AEJ A;  5HPO A;  4COV A;  2PLV 1;  1RUC 2;  1QJX 1;  2PHT A;  1CAU A;  3M1H A;  4WVM A;  4R9B A;  1O5L A;  4I0B A;  1HDK A;  2A70 A;  3G7D A;  3N9L A;  3CL1 A;  4JGZ B;  5FZI A;  1JYX A;  3RZL A;  5CG9 A;  1W8U A;  2Y38 A;  5IK7 A;  1HQN A;  5FPU A;  4XF0 A;  1XQN A;  2RS1 1;  4RHV 3;  2R49 A;  1HRV 3;  2IVI B;  4P5H A;  3OF1 A;  3E6B A;  4P00 B;  5I91 A;  2XL9 A;  4CEW A;  1WMX A;  1W8O A;  2BFU S;  1AJO A;  3ZPY A;  3VBU B;  4CDX B;  4QU1 A;  1HIX A;  2BV4 A;  1DLL A;  1SLC A;  4JGZ A;  4GIQ A;  2GC2 A;  4IND A;  1J1T A;  1YQ5 A;  5A3M A;  3THT A;  4AVB A;  4ISQ A;  1RB8 G;  4OUS A;  1V6N A;  5C70 A;  5C3R A;  4JRL A;  2EVX A;  3CNA A;  3LSE A;  1POV 0;  3VBU A;  4CDX A;  5KHH A;  3W20 A;  1TMF 1;  1RYY A;  3ZFE C;  2XJP A;  4XIO A;  2XBO 2;  2QE3 A;  3ELN A;  3AMN A;  4PIZ A;  4XQ4 A;  1BMV 1;  4YW1 A;  3MYX A;  1W6Q B;  5FOB B;  4R52 A;  2WUH A;  4S2D A;  1C5I A;  4LKS A;  4AGV A;  1RMU 3;  4AI3 A;  5JXG A;  2VJX A;  2ADD A;  1UYX A;  3KSC A;  2VNV A;  2AGS A;  1BLZ A;  2C24 A;  4AW7 A;  1NCQ B;  2W46 A;  2HWD 1;  5FAX A;  2QUO A;  5HXV A;  3ZFF B;  3PUS A;  1ZBA 3;  1YQ6 A;  4MGK E;  2D7F A;  3EMR A;  5JXJ A;  2ILM A;  2WNU B;  1W6Q A;  4F8A A;  2TBV A;  1JU4 A;  1OPM A;  2GNB A;  1PGS A;  3MDP A;  5FZL A;  3WDX A;  4AHX A;  2P17 A;  1NA1 B;  2NZ9 A;  4B29 A;  4XBN A;  5KWR A;  4YW3 A;  1I9R A;  4CXX A;  1OLM A;  2CWM A;  4AHY A;  2ZX0 A;  2Q30 A;  3JU9 A;  4ZU7 A;  4XDP A;  2JEN A;  4IV3 B;  2KXL A;  5HCB A;  3T30 A;  3WEZ A;  1PZ8 A;  1NCQ A;  4PI0 A;  1R09 3;  2XWB B;  3FC0 A;  2HWE 2;  3MIF A;  3MW2 A;  4UF0 A;  3ZFF A;  4UFK A;  4OHY A;  3O1S A;  1AR6 3;  3RS6 A;  3WY6 A;  1K5J A;  5LAT A;  3RMX A;  2WNU A;  2ZTN A;  4LNV A;  5FZ0 A;  3VL8 A;  5L36 A;  2DCT A;  2ZEW A;  1UZZ A;  3ME2 A;  4BPZ A;  1QJY 1;  4CEY C;  1NA1 A;  2NPI A;  1RVF 3;  1YEW A;  3GBW A;  2HWC 2;  4YZ3 A;  2PHW A;  1RXG A;  4DUW A;  4MXV A;  1Y9G A;  4BK4 A;  2VOT A;  1Y43 B;  4IV3 A;  4AL9 A;  1AR7 2;  1ZBE 2;  3LDR A;  3BKZ A;  1D2Q A;  4GAZ A;  4D6R A;  4COW A;  4N7U A;  3ALQ A;  3I2O A;  2PLV 3;  3M3E A;  4YVS B;  1QJX 3;  3H1M A;  2DVB A;  3WG4 A;  1PNF A;  2ID4 A;  2NLR A;  1B35 B;  2VQT A;  3GHM A;  3WF3 A;  4CUA A;  3BPZ A;  5DAX A;  4Y5S A;  1UY3 A;  1POV 1;  2H6B A;  4K1Z A;  5FPZ A;  1RUO A;  4B7E A;  4JTO A;  2WAA A;  1W2A X;  4QQO A;  4EZH A;  5CFD B;  4AFA A;  2RS1 3;  5JOZ A;  1OLR A;  1VBE 2;  3LIG A;  4HN1 A;  1BHG A;  4IDZ A;  2KA3 A;  3ZSM A;  3AXD A;  3KF3 A;  4QKN A;  4XVH A;  4YVS A;  3BIE A;  4LTA A;  1G8W A;  5B4N A;  2NM1 A;  1RUJ 3;  1SLT A;  1B35 A;  3LAG A;  3LB9 A;  2QDN A;  2OT7 A;  3DF0 A;  4K20 A;  3M3C A;  5GLU A;  5CFD A;  5KHJ A;  3A21 A;  4B1L A;  3ON7 A;  3ZIX A;  4QT6 A;  4LBN A;  1GNZ A;  3WW1 A;  2J1T A;  4URT A;  3THC A;  1TMF 3;  4BE3 A;  4FAG A;  5FLH A;  3VZK A;  5K0U B;  1CVN A;  1VMF A;  5JIA A;  1NZC A;  4HK9 A;  1O7F A;  4XF9 A;  5BPX A;  3BAL A;  1JYW A;  4AE2 A;  4BLI A;  3HQX A;  1MS9 A;  2MPF A;  5L73 A;  4IE5 A;  5A3U A;  1QNW A;  1CES A;  4F3J A;  1O4T A;  1UY4 A;  4FTE A;  1CON A;  2KM2 A;  1D4M 2;  5KXC A;  5K0U A;  1BJQ A;  5FZM A;  1NY7 2;  3UYJ A;  2HWD 3;  3BCW A;  3WR0 A;  4I2O A;  1HXS 1;  2W47 A;  3VBR B;  1C8N A;  2VZ1 A;  2L9L A;  3KV5 A;  4NHY A;  3NAP B;  1JZ5 A;  3DXU A;  3WSO A;  1WA6 X;  2VMF A;  4Y1Y A;  4YFZ A;  3JCI A;  2R32 A;  4JVA A;  5FPL A;  1CR7 A;  4LR4 A;  4R9D A;  1UU6 A;  1VBC 1;  4UW4 A;  2WT2 A;  4Y4R A;  5EPA A;  3IKW A;  4BIS A;  4XMA A;  2MEV 2;  3VBR A;  4CDQ C;  1UPS A;  1UL9 A;  1WKY A;  2JDH A;  3NAP A;  3ZKU A;  1ND3 C;  3OUI A;  2W1U A;  2PAM A;  2VVE A;  3ROU A;  1YXW A;  4UFM A;  1IKP A;  3ZYR A;  1SFN A;  1LOE A;  3K48 A;  5J3U A;  1YIF A;  5FPB A;  3GXU A;  1H0B A;  1W3X A;  1OI6 A;  3PUH A;  1SPP B;  3Q8A A;  4XXA A;  3JBG 2;  2SLI A;  4FTS A;  3VD4 A;  3OD4 A;  1V0A A;  1ASJ 1;  3T2T A;  3OEB A;  3D0J A;  4ASL A;  1VPH A;  2XVK A;  1POV 3;  4PI2 A;  2Q0A A;  2YBK A;  3LEI A;  2FCU A;  1XE8 A;  4D69 A;  1BEV 2;  3S6P A;  3AFG A;  3KGZ A;  4NII A;  5EJ1 B;  4XE9 A;  5JAX A;  3SKV A;  3BOW A;  2XQR A;  1SPP A;  3J8F 1;  4LUL A;  2GC1 A;  1WZX A;  4FPY A;  5F3I A;  1NKG A;  4D94 A;  1ULP A;  3VD5 A;  2G9Z A;  3OSD A;  1FAY A;  1CGP A;  3K46 A;  3NJZ A;  3OGV A;  1H1A A;  1PMJ X;  1EV1 2;  2E32 A;  1CJD A;  1PIV 2;  2J1R A;  4QPI A;  1W8N A;  1LTE A;  1QMJ A;  1A3K A;  1DQ2 A;  3GF6 A;  3NRU A;  1UY1 A;  1R1A 2;  1H9W A;  3GZE A;  2WNO A;  2XJQ A;  1XRU A;  1CQ9 A;  5FY1 A;  5CIS A;  2ARB A;  4XF3 A;  2R07 2;  3LPF A;  3RZJ A;  2WFF 1;  5FXZ A;  3EJK A;  5IAX A;  2A6V A;  2BER A;  1UOJ A;  3LA2 A;  4N43 B;  3J7N A;  3E6D A;  1GFF 2;  3MF9 A;  4IQP A;  2CY6 A;  2PEL A;  1W8H A;  4I0W B;  3L2H A;  4XHX A;  3W9A A;  2ZX3 A;  5C3P A;  1ZRD A;  4ZHN A;  2D5F A;  4LBQ B;  3T0D A;  1HXS 3;  2BEO A;  4N43 A;  1SQ4 A;  3MLJ A;  3PL0 A;  3AZZ A;  3VLB B;  1W9W A;  5H9S A;  2WNV C;  4YW7 A;  2QJV A;  2DCZ A;  3NJX A;  1A8M A;  5DAP A;  3MGU A;  1EUU A;  4LBQ A;  1Y9M A;  1CAX B;  5CKQ A;  3ZOI A;  3S0M A;  3H42 B;  4FP3 A;  2E26 A;  5FXW A;  4XAC A;  1DFQ A;  5LAS A;  4QPY A;  2W9X A;  4OUE A;  1EPW A;  4LOS A;  4PDW B;  1HB1 A;  1W9F A;  1VAV A;  3BPS A;  3D82 A;  4OYU A;  5FZ3 A;  3T2O A;  4E4D X;  3WDY A;  2FDG A;  1UIK A;  2ENR A;  1LHN A;  2O14 A;  1QH6 A;  2YC0 A;  3GAL A;  1X8M A;  3POB A;  2VZO A;  4IW3 A;  3LOB A;  2FDH A;  1CAX A;  2ZHN A;  5KC5 A;  3U07 A;  3G6J B;  4W4Z A;  4CYD A;  3RQ0 A;  1ALY A;  2OKX A;  4PDW A;  4L9B A;  1HB4 A;  2BNM A;  1UWW A;  2Q8O A;  5GJ6 A;  2VM9 A;  1IGO A;  1BYH A;  1O8P A;  2DVG A;  2XHN A;  3MW3 A;  2J1E A;  3J8F 3;  1OQD A;  2VY0 A;  2AH2 A;  1S0J A;  1E57 A;  4PF5 A;  2YG0 A;  3POF A;  2J7M A;  2ZA9 A;  1HN1 A;  5J09 A;  5LA1 A;  4AQS A;  3DKW A;  3A22 A;  3I7D A;  4OCT A;  4Q0U A;  4UFL A;  4J6G A;  1PK6 C;  1IG3 A;  3ZXK A;  4XHB A;  2G1M A;  2YFZ A;  3WW3 A;  1RL3 A;  4P14 A;  2C0Z A;  2DDU A;  3C7F A;  1JZ6 A;  1ST8 A;  2FDJ A;  4JAA A;  2JG9 C;  2Z79 A;  4IES A;  2WYS A;  4JX0 A;  2XB6 C;  1DHK B;  1TQ5 A;  2D6P A;  4DRV A;  4N7I A;  3FBY A;  1JBC A;  2ZGM A;  1RUE 1;  4IV1 C;  3VHO A;  3T4V A;  1RUD 1;  4HSL A;  5FMO L;  1BKZ A;  3C3V A;  1W2N A;  4FSJ A;  5FLJ A;  3ZXL A;  1FX5 A;  3AMH A;  1TME 2;  4LT5 A;  4Y24 A;  2WZE A;  2HWB 2;  4YZ1 A;  2ZEZ A;  4CUC A;  4YZ5 A;  2JDY A;  1AJK A;  1XXN A;  2OPK A;  3P5B A;  1BXH A;  3ZSL A;  1OF3 A;  5KC6 A;  2A5Z A;  3ZYI B;  3M70 A;  3T2P A;  4COU A;  3P1I A;  3H1W A;  4XFC A;  3FHI B;  1XB9 A;  3BGA A;  1DQ6 A;  3VL9 A;  4HZF A;  4LHL A;  4D7S A;  4JKM A;  1LB2 A;  2E7Q A;  2HEY F;  3WDU A;  3THP A;  5JR2 A;  1HRI 2;  2E63 A;  3OYW B;  1S2E A;  2Q1Z B;  1ZRC A;  5EHD A;  1JZ4 A;  5J1X A;  3ZR5 A;  1XPW A;  2CDP A;  4X8N A;  3OPW A;  5IK4 A;  2OUH A;  1T2X A;  3H50 A;  5FLI A;  4AVC A;  1EY2 A;  1OXC A;  1I3H A;  3R4D B;  1H4H A;  4EJR A;  3KZ4 C;  1UYZ A;  2LRP A;  1DU3 D;  5C71 A;  1W0P A;  1GP5 A;  3FL7 A;  3LEM A;  3OYW A;  5FY0 A;  3FZ3 A;  1NLR A;  3VDC A;  2IVJ A;  2ZMK A;  1OFS A;  1H2K A;  1JHN A;  4P9I A;  1ULF A;  2YY1 A;  2E7A A;  3CZU A;  4TTG A;  1LHU A;  1RJ8 A;  1ODN A;  5BNP B;  5L19 A;  2ZAA A;  1UY2 A;  3I2G A;  4BDV B;  4M3C F;  3W21 A;  3AKR A;  4L97 A;  2XBO 1;  1OOP C;  4Q4Y 2;  3ORJ A;  2QDR A;  1C3H A;  4KWU A;  5HCF A;  2YPD A;  2D6N A;  4LLO A;  5BXX A;  2ZML A;  2VUD A;  5F5A A;  5FMC A;  3VBS C;  5BNP A;  1HB2 A;  4B4R A;  1SG3 A;  3FHQ A;  5B2G B;  5CAZ A;  4ARX A;  4JRA A;  4WZF A;  1PVC 2;  1PO2 3;  1I5P A;  1QDO A;  2FQP A;  4OLL A;  4CP2 A;  4WZC A;  4LEJ A;  2D93 A;  1ENR A;  3EYP A;  3LDK A;  3ZN5 A;  5C8C B;  2BDR A;  3ACH A;  2MNG A;  1GU3 A;  2WNV B;  2VCA A;  2LRO A;  1Y4W A;  4MYE A;  3LQC A;  2VCM A;  4M3C B;  3VBO B;  4XCA A;  2CGO A;  4NPL A;  3RZG A;  2GN7 A;  1RUE 3;  1HX6 A;  2XJU A;  1IPK A;  1RUD 3;  3CZJ A;  5T52 A;  3ZXF A;  2HWE 1;  4JHZ A;  2PYT A;  2J42 A;  3SIT A;  2RG4 A;  5C8C A;  2HWF 1;  3APB A;  1I1E A;  3NV4 A;  5DDJ 1;  2WNV A;  1C1L A;  3DN7 A;  5T50 A;  4M3C A;  3VBO A;  1SCS A;  1KS5 A;  4QXH A;  2X05 A;  4XJW A;  3A0K A;  1RUH 1;  4MZU A;  4BQX A;  1HJF A;  3K2O A;  4RGG A;  4XJA A;  1IS4 A;  4FXK B;  1Q43 A;  5I8Y A;  5C3S A;  4MXW B;  3NKT A;  5FZ9 A;  3JXS A;  4UFJ A;  1RUC 3;  3ZSJ A;  2AAC A;  1MQT B;  4FQ4 A;  3RG0 A;  2GAL A;  3HOB A;  3KCX A;  3UGG A;  2JIJ A;  2WZR 2;  5L7O C;  3ZMO A;  1UU4 A;  1F5F A;  5EQU A;  4DUX A;  4G3Y C;  4PLM A;  1VBE 1;  2G4I A;  3UGF A;  3NWK A;  2D3S A;  1LHW A;  1SBE A;  2ZZQ A;  5I8S A;  4MXW A;  4UWD A;  2DBN A;  1C28 A;  2ORZ A;  3M2M A;  2XPJ A;  5JI9 A;  3ACG A;  1MQT A;  3RGB A;  1SMV A;  5E1R A;  1XE7 A;  4AHZ A;  1LOC A;  3HQR A;  4QHO A;  1AX0 A;  2XDV A;  1QU0 A;  1VJ2 A;  1WBL A;  4QQP A;  2BQP A;  1JI6 A;  1VBD 2;  2EIE A;  2QCS B;  5JSP A;  1LNS A;  2N7G A;  1ZRR A;  1RC6 A;  3PUR A;  1MS5 A;  3POI A;  3FLR A;  4QXK A;  1K45 A;  4NHX A;  4Q29 A;  1M4W A;  4LBJ A;  3MV1 1;  1UKG A;  1FOD 2;  4FFI A;  1SLB A;  2A3Y A;  1KFX L;  2YUE A;  2B5H A;  1FMD 1;  2XBO 3;  4XF1 A;  5T55 A;  1F2N A;  2PA7 A;  4QU2 A;  3DL3 A;  4XUT A;  4Q8K A;  2Y6G A;  5K9Y A;  4H2A A;  2X5I C;  1F5J A;  5FUI A;  2W2I A;  1W8W A;  4NID A;  1UIJ A;  3POE A;  1G9B A;  1GMM A;  4AVT A;  2OVU A;  1E5H A;  3IMM A;  5JOX A;  4MV2 A;  2QNK A;  1ZZC A;  2F4L A;  3KS7 A;  3J7L A;  4FPK A;  5F6L B;  2JD4 A;  2BVB A;  3NNM A;  3B9I A;  1LUL A;  1UX6 A;  3RPQ A;  1Q8Q A;  3U14 A;  1UOF A;  3NKG A;  3N36 A;  5CKM A;  3UGH A;  1S0D A;  1ZZ6 A;  2DV9 A;  4QPG B;  4K8F A;  2F17 A;  1UD1 A;  1UAI A;  2CGN A;  4RGA A;  1MZE A;  2R06 2;  3O12 A;  1AR9 2;  1E5R A;  2HWE 3;  4GD4 A;  4QB2 A;  1S0C A;  3CQO A;  1OC1 A;  2PHF A;  3X29 B;  1H4G A;  1WW6 A;  4LIV A;  2JKX A;  3ACL A;  2RS5 1;  5IT6 A;  3U37 A;  4DY3 A;  4QPG A;  2OX0 A;  3PNA A;  4RS5 C;  4DXT A;  3VKM A;  5A6Z A;  5A1L A;  5ABJ C;  4PF1 A;  4X6Q B;  1AR7 3;  3N9O A;  2JD9 A;  4GH4 B;  5SV5 A;  4UBH A;  2DUP A;  5B4X A;  3N7L A;  1CN1 A;  1LEN A;  3JBG 1;  1X9P A;  3O14 A;  5C4W B;  5I8T A;  1OLQ A;  1G9F A;  3AMM A;  5CFC B;  4YLZ A;  4M0N A;  3HAG A;  5C33 A;  1GR3 A;  2LTN A;  4YM3 A;  4CCL A;  1YFY A;  4Z92 B;  3WVJ A;  1UU5 A;  1UY0 A;  2HKX A;  1BEV 1;  1U5Y A;  4B7K A;  3DPR C;  5T5P A;  5A3W A;  3C7H A;  1VBE 3;  4GH4 A;  1WCD J;  4FT8 A;  4FFG A;  3POS A;  1R1Z A;  1W39 A;  5C4W A;  2XJR A;  3I54 A;  2VZR A;  3EO6 A;  5BY5 A;  5CFC A;  4FOY A;  4FPH A;  1DYK A;  1GWM A;  1UMI A;  2W94 A;  3SH5 A;  2ZHK A;  3SNM A;  4DXS A;  5FY7 A;  1Z7S 2;  1EV1 1;  2ZHL A;  4EE2 A;  1PIV 1;  3N7M A;  1JZ7 A;  2KD7 A;  1VRH 2;  4D6Q A;  4IGQ A;  2FCV A;  2ZX2 A;  1CZS A;  2QQN A;  5LY1 A;  3FX3 A;  1Q8O A;  1R1A 1;  1DGR A;  3AX4 A;  4IER A;  4N53 C;  5J96 B;  2ZGS A;  4XFI A;  4URA A;  3QLQ A;  2P3K A;  3KF5 A;  1CZV A;  4LO4 B;  1G9C A;  1FMD 3;  1QOT A;  2R07 1;  3PTR B;  3N9P A;  1LU2 A;  3M3Q A;  3MIB A;  4MSV A;  5BNO A;  5BNO C;  1A34 A;  5LA0 A;  1DBN A;  4EN6 B;  1QJU 1;  3ZN4 A;  2ZGQ A;  2Q8D A;  2JDA A;  2GC0 A;  2RE9 A;  3KV9 A;  4C1W A;  1UMH A;  4LIU A;  3RZK A;  1QQP 1;  1D4M 3;  4JKL A;  2CYF A;  1RIR A;  5LBB A;  4IEW A;  3TEW A;  5D1I A;  4XPV A;  1TNR A;  1LOG A;  1XSQ A; 
#chains in the Genus database with same CATH homology
 3WF3 A;  1UY3 A;  5DMY A;  4HG6 B;  4KI5 M;  1K3I A;  2WAA A;  3CKH A;  4CU6 A;  3CDZ B;  1BHG A;  2B9V A;  1JYV A;  4XVH A;  5JXH A;  2V5D A;  5B4N A;  1GQP A;  1K12 A;  3PUI A;  3VDB A;  3A21 A;  3I2J A;  1J84 A;  3K4Z A;  4UOJ A;  2VCC A;  2YC4 A;  4D0Q A;  3I2H A;  3GM8 A;  2J1T A;  1PX4 A;  4AAX A;  2W92 A;  3THC A;  3THD A;  1CIY A;  4GWJ A;  1O8S A;  3A7Q A;  4ZY9 A;  1JYW A;  4LPL A;  3T08 A;  2HYX A;  2VZS A;  2VZ3 A;  2Y6L A;  4OMD A;  4A44 A;  2PQS A;  1UY4 A;  4QDQ A;  1UXX X;  2BGP A;  4MOA A;  3SEE A;  2W47 A;  2WO3 A;  2VZ1 A;  5LA2 A;  5JXI A;  2L9L A;  4CU9 A;  3WNN A;  2QQO A;  1JZ5 A;  5A1A A;  3WSO A;  2VMF A;  3K4A A;  5IFT A;  1O59 A;  3UNP A;  1CZT A;  1DLC A;  3WF1 A;  1L7R A;  1XC6 A;  2QQK A;  1JHJ A;  1WKY A;  2WDB A;  2W1U A;  3OGR A;  1IQD C;  3SEP A;  3NNG A;  3WNM A;  2EIC A;  2BBA A;  4A42 A;  2VZV A;  4XUR A;  2QQJ A;  3GXU A;  3PUH A;  3I3D A;  2E31 A;  3VD4 A;  3OEB A;  3GGL A;  3LEI A;  1GNY A;  5EJ1 B;  3UET A;  3SKV A;  3ECQ A;  3OG2 A;  5IHR A;  2Y6K A;  1NKG A;  1ULP A;  3VD5 A;  3HPN A;  3K46 A;  4D8M A;  2EID A;  3OGV A;  5G05 L;  2V4V A;  4MGQ A;  1J83 A;  1PMJ X;  2E32 A;  2J1R A;  3ACI A;  5EIY B;  1W8N A;  2JE8 A;  4JKK A;  3NRU A;  2VO5 A;  1UY1 A;  1WCQ A;  3SKJ E;  2RVA A;  3EB7 A;  3WNO A;  2VZQ A;  4OZO A;  1W0N A;  3LPF A;  2DCK A;  3WF2 A;  1F4A A;  1W9S A;  2BER A;  3OB8 A;  3FHA A;  2VTF A;  2J1A A;  2XON A;  3T0D A;  4GWI A;  4RYD A;  5C7G A;  1W9W A;  1EUT A;  3ACF A;  3HJR A;  4QDS A;  4QB6 A;  3GDB A;  4A45 A;  1JYN A;  3NJX A;  1W9T A;  1H6Y A;  1KEX A;  3I97 A;  3T2Q A;  3ABZ A;  1EUU A;  3WNL A;  2BGO A;  5IJR A;  2VR4 A;  2WZ8 A;  3HNM A;  2E26 A;  4DUV A;  4W50 A;  4XZU G;  2W9X A;  3C8X A;  2Y6H A;  3HNY M;  4OUE A;  2ZEX A;  4OYU A;  3T2O A;  4LHS A;  4W8J A;  3UES A;  2WAO A;  2VZO A;  4ET7 A;  5IFP A;  4QX1 A;  4W4Z A;  4MO3 M;  1US2 A;  4BK5 A;  2C4X A;  3OGS A;  2OKX A;  2VMC A;  1UWW A;  4ZZ8 A;  2C26 A;  2VM9 A;  1O8P A;  1SHW B;  1TG7 A;  2XHN A;  3MBW A;  4PQQ A;  2J1E A;  1UYY A;  1XNA A;  5G04 L;  2XQX A;  4A3Z A;  3J7H A;  3MUY 1;  2YG0 A;  3WF0 A;  5JUV A;  1H6X A;  2J7M A;  1ULO A;  1HN1 A;  2ORX A;  1SDD B;  4L0P A;  5LA1 A;  2J22 A;  3A22 A;  2B4K A;  4UAP A;  1D7P M;  2XOM A;  2YFZ A;  2DDU A;  2WN3 A;  3C7F A;  1JZ6 A;  4LQR A;  4JX0 A;  2WYS A;  3W5N A;  3K4D A;  3ZM8 A;  2J1U A;  2YB7 A;  2EIB A;  1NX9 A;  3A23 A;  4OMC A;  2WZE A;  1DYO A;  5DN2 A;  2ZEZ A;  4CUC A;  1OF3 A;  1GUI A;  4XUP A;  3VD7 A;  3T2P A;  3MUZ 1;  3P1I A;  3HEI A;  3LE0 A;  3BGA A;  1OD3 A;  4BJ0 A;  3WNK A;  2Y8K A;  4JKM A;  2J1S A;  5JR2 A;  1JU3 A;  1GOF A;  4RN5 A;  1JZ4 A;  5J1X A;  1XPW A;  2CDP A;  2WN2 A;  2W5F A;  3T0A A;  1T2X A;  3OBA A;  2BZD A;  4QPW A;  2VMD A;  5CZK A;  4BXS V;  3III A;  4AG4 A;  2WQ8 A;  4CU8 A;  1UYZ A;  1F4H A;  1XNT A;  5C71 A;  3FL7 A;  2VL4 A;  4QX2 A;  4A41 A;  3VDC A;  4A4A A;  5F7U A;  2QQI A;  2Y64 A;  3IB3 A;  3CZU A;  4TTG A;  2ZXQ A;  4M4R A;  1UY2 A;  2J1V A;  1GOH A;  3I2G A;  1JZ3 A;  4BDV B;  5JMO A;  2V72 A;  3VDA A;  4KWU A;  1JZ8 A;  3VD3 A;  3I3E A;  1SG3 A;  3FHQ A;  4FI9 A;  5I0D A;  4ARX A;  1MPX A;  2W1Q A;  3W5M A;  1I5P A;  2VZU A;  3WF4 A;  4CVU A;  2WAB A;  2W95 A;  2W3J A;  5CYY A;  3EYP A;  3I3B A;  4XUO A;  3OEA A;  3ACH A;  4IUG A;  1GU3 A;  2VCA A;  2VZP A;  4QDR A;  3LQC A;  1P8J A;  2W87 A;  4XUN A;  4CUA A;  1UZ0 A;  2QQL A;  2WO2 A;  3C7G A;  3HNB M;  3T0B A;  1JZ2 A;  5LCW L;  1YQ2 A;  3CZJ A;  1UXZ A;  3T09 A;  4CU7 A;  4JHZ A;  2Y6J A;  3LEG A;  3IAP A;  3BN6 A;  3LPG A;  3I2K A;  2VCB A;  2X05 A;  1PX3 A;  3WQB A;  3ETP A;  3I2I A;  5EJZ B;  1KGY A;  3E1F 1;  2W91 A;  3JXS A;  5IYY A;  3HOB A;  3MV0 1;  3WNP A;  1L7Q A;  3C7O A;  4DUX A;  1TVG A;  2VME A;  2WBK A;  2Z4F A;  2VC9 A;  2VZT A;  3AC0 A;  2ORZ A;  2CDO A;  1CX1 A;  3ACG A;  3DYP A;  4DEV A;  4Z2A A;  1UX7 A;  3FN9 A;  4QX0 A;  4PT6 A;  4QX3 A;  4ARY A;  2EIE A;  1JI6 A;  4MGS A;  1LNS A;  4UI9 L;  1R64 A;  4KMQ A;  2QBX A;  1K45 A;  3CMG A;  3I2F A;  2YFU A;  3K77 A;  1GOG A;  3MV1 1;  3DEC A;  5DQ0 A;  3VD9 A;  2HLE A;  4XUT A;  2Y6G A;  4P08 A;  5FUI A;  1GMM A;  2YC2 A;  3K75 B;  4TXW A;  3LEK A;  5HPO A;  1US3 A;  2X10 A;  1JYX A;  2DCJ A;  5DPN A;  2C9K A;  4P00 B;  3D3A A;  1W8O A;  4P02 B;  4M4P A;  4QB2 A;  3P6B A;  3CQO A;  4P5Y A;  4YPJ A;  1OT5 A;  2VQU A;  2JKX A;  4ZZ5 A;  2W1W A;  3U37 A;  3IDA A;  4DXT A;  5C70 A;  4PF1 A;  3F2Z A;  4CUB A;  2JD9 A;  5HXM A;  1RYY A;  5B4X A;  2E33 A;  3C7E A;  2ZEY A;  2WO1 A;  2QQM A;  4DEQ A;  2X09 A;  1W99 A;  3IAQ A;  2WUH A;  1NUK A;  1UY0 A;  4LKS A;  4XUQ A;  5JXG A;  2VJX A;  3C7H A;  1UYX A;  2LW8 A;  1K42 A;  4QAW A;  2W46 A;  2VZR A;  1UMI A;  2W94 A;  5JXJ A;  4DXS A;  4GZ9 A;  1JU4 A;  1JZ7 A;  2KD7 A;  3NJV A;  2LS6 A;  4E8D A;  1CZS A;  1OH4 A;  2QQN A;  4MAD A;  3WEZ A;  2RJ2 A;  2R7E B;  3NQH A;  3CIH A;  1PMH X;  1DP0 A;  1CZV A;  4QB1 A;  3DYO A;  2ZEW A;  3DYM A;  1OF4 A;  4A6O A;  2RV9 A;  5LA0 A;  4DUW A;  2W1S A;  4BK4 A;  2VOT A;  4E8C A;  2JDA A;  3MO4 A;  1NAE A;  1UMH A;  4DXR A;  4JKL A;  4ZXE A;  3HN3 A;  2ID4 A;  2VQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...