4ET7A

Crystal structure of eph receptor 5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
174
structure length
174
Chain Sequence
NEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 5
publication title Crystal structure of Eph receptor 5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 25
structure length 174
sequence length 174
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4et7A00
1ULPA 3CZUA 2X10A 2QBXA 4A4AA 1US3A 1XNTA 4A6OA 1JZ2A 1YQ2A 1JHJA 3MUY1 4QDQA 3HPNA 1PX4A 3I2JA 2V5DA 4W8JA 1R64A 3MO4A 4DUXA 4JX0A 4LHSA 4E8CA 5IFPA 3WNKA 1EUTA 2VZ1A 1CZSA 2Y6JA 5G04L 2WN2A 2WZEA 4P08A 5LCWL 1LNSA 2YC4A 2W47A 2CDOA 4OYUA 3NJXA 4BK5A 1IQDC 3ACIA 3GGLA 4CU6A 1GU3A 1F4AA 2VZ3A 2X05A 3THDA 3GXUA 2J1UA 1L7RA 2J22A 4XUPA 3PUHA 3T08A 3ECQA 4XUNA 1W9WA 5IJRA 3IDAA 4LQRA 3DYOA 2VO5A 5JXHA 1OH4A 4RYDA 2W92A 4KWUA 3WEZA 2C26A 3VD4A 1OF3A 2Y6KA 5HPOA 3C7EA 4XUQA 1KEXA 2XOMA 4BJ0A 4MGQA 2W1QA 3I2KA 1JYWA 5FUIA 2VZSA 3E1F1 3HOBA 2W1UA 3NRUA 4XURA 2EIDA 4UI9L 2Y6LA 1UY1A 4GWJA 2W3JA 2QQIA 3I3BA 3WNMA 3MV01 4ZZ5A 4KI5M 1JYVA 2W1SA 2X09A 4A42A 3LE0A 3WF0A 2VZTA 2VZQA 3DECA 2RJ2A 3W5MA 3A23A 5CYYA 2VCCA 1UXXX 3C7HA 3I2FA 1UMIA 3U37A 3OGVA 1UY0A 3FL7A 2DDUA 3A22A 5JXIA 2V4VA 4A44A 2ZEZA 3I2GA 4RN5A 1PMHX 3CKHA 4MO3M 2VMCA 4QX3A 4D8MA 4ARXA 1UY3A 4GZ9A 1UYZA 3K4ZA 3K4AA 3MV11 5I0DA 3BN6A 4UOJA 1W9TA 1CIYA 2WZ8A 2VZPA 1NAEA 4QAWA 2E32A 3IAQA 4LPLA 1I5PA 2BZDA 1UY4A 2VMEA 2ZEYA 1NUKA 3BGAA 4L0PA 2J1SA 1O8SA 4PF1A 2W46A 3D3AA 3CDZB 4QX2A 4XVHA 4ZZ8A 1NX9A 2YFUA 4OMDA 4P00B 1JZ6A 4A41A 4HG6B 1T2XA 2DCKA 1JZ3A 2YFZA 1TG7A 1UYYA 3VD9A 3LEIA 1JU3A 2W5FA 4W4ZA 1GUIA 3DYMA 1DLCA 2ORXA 2RVAA 2EIEA 2BGOA 3WF1A 1KGYA 4M4PA 2VQUA 2Y8KA 4P02B 3EB7A 2QQJA 5LA1A 3LEGA 3OEBA 3WNOA 2ID4A 2W1WA 2WQ8A 1K45A 2C9KA 1CZTA 3SKVA 4TXWA 3HJRA 1TVGA 3WF2A 5C71A 5IHRA 2WABA 4W50A 1SHWB 1JYXA 3VD7A 3ZM8A 2J1VA 3OB8A 3J7HA 4CU7A 4JKMA 2JD9A 2LW8A 1NKGA 2R7EB 4QDRA 3T0BA 4JKKA 3UESA 3F2ZA 3W5NA 3ACFA 3I2IA 3ETPA 3UETA 2ORZA 3HEIA 1UZ0A 2VZUA 1BHGA 2JKXA 1OF4A 2WO1A 4JKLA 5JXGA 2J7MA 3GDBA 4PT6A 2QQOA 2B4KA 5DQ0A 3HNYM 2WN3A 1GOFA 2XONA 3OGRA 2VJXA 5G05L 2VCAA 3CIHA 2WBKA 5LA0A 2VQTA 4IUGA 3P6BA 3VDAA 1F4HA 2VMFA 1W0NA 1GNYA 5DMYA 3CMGA 1XC6A 3A21A 1W99A 3WNLA 2W9XA 2EIBA 4YPJA 2ZXQA 1UXZA 3T2PA 1H6YA 1OT5A 1DP0A 4OZOA 2L9LA 2W87A 2Y6HA 4UAPA 5C7GA 5B4NA 3SKJE 4D0QA 1SG3A 4KMQA 3THCA 2RV9A 1CX1A 3K75B 5JXJA 3HN3A 3I2HA 5EJZB 3WNPA 1JZ5A 1UWWA 4TTGA 3K4DA 2WAAA 3C8XA 3T2QA 1HN1A 4A45A 4PQQA 2VC9A 5LA2A 3P1IA 3JXSA 1P8JA 4DEQA 4OUEA 5HXMA 3WF4A 2YC2A 2XHNA 4ET7A 3AC0A 2HLEA 3SEEA 4DXTA 4MADA 3HNBM 3ACHA 1GOGA 3CZJA 5A1AA 4DUVA 3ACGA 1H6XA 2VL4A 4DXSA 1JYNA 3LPGA 4JHZA 4XUTA 1PMJX 4QX1A 1W8OA 4CUBA 1WKYA 4QPWA 1JZ4A 1K42A 2Y6GA 2VZVA 2WDBA 3LEKA 4XUOA 3NQHA 2W91A 5EIYB 3EYPA 3WF3A 1CZVA 1UYXA 2OKXA 2VZRA 4QX0A 3OEAA 3DYPA 3VDCA 2QQKA 4CVUA 2VMDA 4BK4A 2J1TA 5IYYA 3C7FA 2BBAA 3HNMA 1UMHA 2VTFA 1MPXA 3IB3A 2ZEXA 2YB7A 3ABZA 5C70A 5JR2A 5J1XA 1W8NA 2WO3A 1ULOA 2BERA 1OD3A 3GM8A 2J1AA 2QQNA 2Z4FA 2W95A 2E33A 1K12A 1J84A 3LPFA 1D7PM 4DUWA 2WUHA 2EICA 3T0DA 4GWIA 3SEPA 4QDSA 1UY2A 2VZOA 4XZUG 3MBWA 2E26A 4DEVA 4BXSV 1US2A 2BGPA 3WSOA 1J83A 3FHQA 4BDVB 3OGSA 3NJVA 2KD7A 2XQXA 3UNPA 1JU4A 3VD5A 3FHAA 2VOTA 2CDPA 4CUAA 2ZEWA 2HYXA 2W94A 5JMOA 3C7OA 4ZY9A 4CU8A 5CZKA 3C7GA 4OMCA 3OG2A 3T0AA 4P5YA 3CQOA 2WAOA 4A3ZA 2LS6A 1JI6A 1O59A 3I97A 3I3DA 2B9VA 1O8PA 4FI9A 4QB6A 4ZXEA 1RYYA 2VCBA 2DCJA 1K3IA 1EUUA 1GOHA 4MGSA 2VM9A 3LQCA 4DXRA 2J1EA 2J1RA 2JE8A 3WNNA 5JUVA 5DN2A 3FN9A 4AG4A 1W9SA 1L7QA 5EJ1B 2WO2A 3IAPA 1GMMA 3T09A 3NNGA 1SDDB 2VR4A 1XPWA 5IFTA 2QQMA 3I3EA 1GQPA 1PX3A 2V72A 1DYOA 2C4XA 4AAXA 1WCQA 2WYSA 4QB1A 5B4XA 4QB2A 2JDAA 3VD3A 4CU9A 3MUZ1 3IIIA 2Y64A 4E8DA 2YG0A 5DPNA 3WQBA 3K77A 2QQLA 1JZ7A 4ARYA 3OBAA 4CUCA 3VDBA 3K46A 1XNAA 2E31A 4LKSA 4MOAA 4M4RA 5F7UA 3T2OA 3PUIA 1JZ8A 1UX7A 3A7QA 4Z2AA 2PQSA
chains in the Genus database with same CATH superfamily
4N7UA 4FO9A 1ULPA 4CXYA 2D5FA 1VLNA 3AZZA 1US3A 3WG4A 1UPIA 4HKWA 5EHDA 2D6OX 4XFIA 2ZGTA 1UZVA 3NV3A 4YRDA 1YQ2A 3DF0A 3KS7A 4UW6A 1JHJA 5FXWA 1N1YA 4LBLA 1WGPA 3M1HA 1PK6B 4XACA 4AI3A 3AYDA 4AEJA 4QT6A 2ZX0A 2XBO3 2NQYA 2LALA 3I2JA 4PI0A 2V5DA 3ASIA 4QM8A 1SBDA 4YVWA 3O1OA 4QWNA 4LHSA 1EUTA 4YVSB 4OI0A 5IVCA 3LEMA 4P9WA 2FDFA 1SLAA 3AKSA 4U2AA 1GQGA 4LR4A 5FZ3A 2WN2A 2WZEA 1W2TA 4K1YA 1QJY2 4HK8A 2GH8A 4UFHA 1KS5A 4OUMA 5FZOB 3RJRA 3ZIWA 1W2UA 3ZKUA 3PIGA 2XUEA 4LEJA 3E5QA 2DVAA 1W6QB 4X6RB 3UJOA 5FV3A 4BU2A 3VBHB 3N4MA 3GGLA 4CE8A 5KHHA 1WLDA 1GU3A 1ENQA 3THDA 2I07B 2JG8A 3R4DB 1DGLA 1PGSA 1RUG3 4C91A 3O1SA 2BU9A 4LKFA 5F9TA 1GKBA 2JG9B 3THTA 5A3LA 4OHZA 3JCIA 1E57A 3LDBA 4LQRA 4NROA 3W20A 2C24A 2VO5A 5IK4A 5EXOA 5LRRA 3IPVA 4LO5B 2GNDA 3POJA 4KU8A 4MGIE 3AK0A 3WEZA 1IQAA 1SQ4A 4FPOB 2GC0A 4NHLA 1OLMA 1YFYA 4XF9A 1KQRA 3H3LA 3SXWA 1M4WA 3CL1A 1OOPB 3ES4A 4HKLA 4BJ0A 1BBT3 5FUNA 1GANA 1VBB3 3BVCA 3NWKA 3RFRA 3ZYFA 3ZFFA 2W1QA 3JB8A 4FFFA 1HB3A 4CYDA 3C3VA 5CADA 5FYTA 1IPKA 3HOBA 3H42B 4U36A 1W8TA 1VBA1 1CIWA 2EIDA 3BIWE 3I4IA 5A33A 5CAZA 2Y6LA 1UY1A 4GWJA 1WW4A 5FZAA 3N7MA 4FFGA 2ZGKA 3DPRC 3MIEA 4ASKA 3U0ZA 2RR11 4KI5M 4ZZ5A 1DYKA 5LY1A 1JYTA 4A42A 1PO22 3LE0A 1Z7S1 2C1FA 4M3CA 4V1PA 4HVQA 1QJU2 5EWSA 4QGNA 4TYSA 1AXYA 2BV4A 3T4VA 1AR72 3KHCA 3A23A 4JRLA 1ZA7A 5CYYA 3PU3A 4QKFA 3V65A 4BYYA 2HJIA 3AZXA 4Q4Y3 4JV4A 2HWB1 4WVZA 2VE1A 5DUXA 5F6KA 2VOWA 3C7HA 2G19A 3AX4A 3U37A 1H8TC 2VVFA 4LMFA 5FYHA 4LTAA 2GALA 1CJPA 1SDWA 2DDUA 2VMIA 4UW4A 1XYPA 1RVF1 5GZFA 3VHOA 1CAVA 2H6BA 4NRMA 5DAQA 1D0GA 5ABJA 5IAXA 5DUUA 3MIFA 1J3QA 3TN92 3ILFA 1FMD3 1K5MC 3I2GA 2VBPA 4RN5A 1VBA3 2BRTA 1UAIA 5ERLA 5E16A 1JN2P 1FAYA 1N3PA 4A7KA 1ULEA 3H1YA 2VMCA 4MO3M 4QX3A 3ZFEA 3ZYJB 4CP0A 1AR93 4CEYC 1OFNA 1BQPA 1ZBA3 4J6GA 5T5LA 3OD4A 2DVGA 3HQXA 2EALA 2RR13 2VOXA 3O1VA 5F5QA 3TAYA 2PLV2 5E89A 4GIQA 1T6GC 2WQZC 3I59A 2EIGA 2PELA 4Y4YA 3RWNA 5FZ6A 4ITCA 5FYMA 3WOGA 3RNSA 3B02A 3JQWA 4ZS2A 1RJ7A 1N1VA 1XNKA 3IDEA 2CSGA 4Q2FA 4BHPA 1I9RA 1FV3A 2J42A 3AXDA 3DXTA 2D3SA 4KU7A 1GQHA 3NL1A 1UY4A 3FFZA 1QY4A 5IK5A 2RG4A 1RUE3 1AJKA 3OUJA 1O8SA 3JU9A 3CEWA 1LULA 3ACLA 4PQ9A 1URXA 5FMBA 1SLTA 5IVYA 3RQ0A 1V6IA 4UWDA 4YW3A 4ZZ8A 1KDMA 1W8HA 4UF0A 1QJX2 2YFUA 3LZZA 1GR3A 4NIAA 3ZDSA 4E2QA 4P00B 4I3PA 5CBLA 1E5HA 3VBSC 4A41A 2TUNA 4Y1YA 3H8RA 3AP4A 4AQ6A 5FBJA 3NKGA 4RGAA 5C5TA 3GJAA 3FUOA 3VD9A 3WHUA 5BUVA 2YC0A 5BY5A 4IEUA 1ND3C 2W5FA 2Z5WA 4W4ZA 3SMHA 2RVAA 4WM7C 4JHTA 4FSJA 2DU1A 2B9UA 1WW7A 2AR6A 4GA9A 3H1WA 3WF1A 4H7MA 1KGYA 2WRAA 3KF5A 4M4PA 3WHTA 1ZZBA 1X50A 5D2AA 4IGQA 3AKTA 2VNOA 4P02B 5CIRA 2R49A 3B00A 2OS2A 3M3EA 3KSCA 2JWPA 4CDWB 4XILA 2QQJA 5LA1A 1V6JA 2XH6A 3H1MA 4XCAA 1PO11 2MEV1 5T5OA 4DOUA 1U5IA 1VMJA 4AHZA 2W1WA 3OUHA 3KVAA 4URTA 4XF3A 5CEHA 1UZYA 1POV1 5KC6A 3WF2A 2PN5A 4Y5SA 4Y1UA 2Q8EA 5C71A 5IHRA 1KD7A 2AZ5A 5L36A 2WABA 1YWKA 4CCNA 1SHWB 3VHRA 3QACA 2JE7A 3DPRA 5C9AC 3ZM8A 4FAGA 3TOJA 1EAH2 3JD72 3M70A 4KWLA 5EJ3A 5A70A 2NYYA 2OT7A 2VOKA 3ST7A 4NPLA 3OB8A 3FX3A 1DQ4A 1AYN3 4XIOA 1UF2C 3KHBA 1AL22 1W3VA 4W65A 5GZCA 2QZ2A 5DAVA 2XJTA 2R7EB 3T0BA 3ZXDA 4ZXKA 3QLQA 4BMBA 2UY9A 5CISA 3AMPA 4AVBA 3OF1A 3ACFA 2P2KA 1MEC2 3AP5A 3L2YA 1JS9A 4WVMB 1PK6C 3AP9A 1TNFA 4K6BA 3DKWA 3F95A 4YLZA 1WW6A 2CY6A 3D82A 3GBWA 4E2GA 2R043 2WSVA 1ND2A 1S0BA 5JPNB 4QQPA 5HV4A 4P9XA 1UCXA 1RUH3 1SACA 4YVSC 4HK9A 5LBBA 4RFT0 1UYPA 4FOYA 4EV0A 1K5MA 2J7MA 1W0OA 2QJVA 3GDBA 2QQOA 5FRAA 1LHWA 3HNYM 4JDOA 5DZFA 4LORA 3VDDB 4DFSA 4RR3B 1ASJ1 1GOFA 2OA2A 2DF7A 4CCMA 3OGRA 2W39A 1YUDA 4XQWA 5FYCA 5G05L 4B1LA 4CEYA 4CSWA 1SFNA 3NAPB 5F8PA 1F5FA 2HWC3 1PMIA 1RUJ2 1WMFA 2O0OA 4YM2A 4F83A 4META 1W6NB 2WQ4A 4JDNA 3VBHC 3VBFB 3MDPA 3S5QA 3U1XA 3MGUA 2A71A 2VMFA 4Q5OA 2HWE2 2RJLA 3JQXA 2KM2A 5FAXA 1VBC2 3ZPOA 4AVTA 1SLIA 2V73A 2JG9C 3Q8AA 2E7TA 1GNYA 3IN9A 4I0BA 3CMGA 3BTYA 1XC6A 3MFCA 4LOTA 3RRDA 1W99A 3V0AB 1NXD1 2EIBA 2ZXQA 4P9IA 2P6CA 1POV0 1YIPA 3EJKA 2OXBA 2I2SA 2W87A 4R4XA 1DG6A 5C4WB 5C5UA 4EZHA 2Y6HA 4PDWA 2ZJCA 4XAEA 5C7GA 5GLTA 5B4NA 3ZN6A 1G9FA 4D0QA 1FV2A 1OOPC 1SG3A 1W8UA 3K75B 1APNA 3OJBA 3RZGA 5CG8A 4NIGA 2A6YA 4MZUA 3WNPA 1JZ5A 5GZEA 2Q5TA 1S0GA 5FO7B 3J8F2 4MYEA 5L73A 3WW2A 3O0WA 2AEYA 3Q8FA 2Y34A 1HN1A 1C1LA 1NQJA 5FLHA 4A45A 3KV5A 5LZ6A 1LJ7A 1ND3A 2JJ6A 2VY0A 3B9CA 2E9QA 4A3XA 1RB8G 4GMP0 4LA2A 3M4FA 2BYVE 4AVAA 1XE7A 4LK7A 1H4HA 3JXSA 3LGRA 2PHRA 4XETA 3MIDA 2YC2A 2XHNA 2NZ9A 2VCMA 3WF4A 5IW0A 2IXHA 3POEA 4ONUA 3K3OA 3KQ4B 3SEEA 2BJSA 1X7NA 4B8EA 3GZUC 4MADA 3HNBM 1LGBA 4H7LA 3A4UA 2D6MA 2HWD3 5FKBA 1YYNA 5JDBA 2P17A 3ACGA 3OY8B 2CGOA 3H8XA 1GZ9A 2BOIA 4XUTA 4FCAA 1PIV2 5ANNA 4WBBA 1CVNA 3RGBA 1WKYA 1Y9MA 3MLJA 5F32A 2QZ3A 1K42A 2R061 4I2OA 2VNGA 2Y6GA 2QKDA 1WD4A 1SFPA 5FPZA 2UU8A 4QPYA 1LOGA 1TMF1 3LEKA 3KT1A 4FPFA 1FNYA 2E7QA 5L9BA 1XU2A 3EYPA 3WF3A 1XXNA 2P3YA 3IM0A 5FZMA 2YUEA 4AQTA 5KHKA 1S2KA 4YM3A 1R091 5FPXA 1H9WA 3FLRA 4QX0A 3DYPA 2JDHA 4NIHA 2VMDA 2EXKA 1HRI1 2XUMA 3KQRA 1ZM1A 5A1LA 5IYYA 4I09A 4CDXB 1QJFA 5CA6A 1WCUA 1UMHA 3R4SA 3TEYA 2OZJA 2VTFA 5EYYA 1QGLA 4BZ4A 1YO8A 2KA3A 3KV6A 1LCLA 5JPMB 3GBFA 4IE5A 5C3RA 3AP7A 1PGW2 2CAUA 5F2WA 3VL8A 4BWOA 5T50A 4CP2A 1NE6A 3VLBB 3ZXJA 4FT8A 4M00A 4EN9B 5F3GA 5J1XA 1DZQA 2J1AA 2JIGA 2Z4FA 5DAXA 5I8TA 1J84A 1D7PM 2RS31 1AR62 5FZOA 4DUWA 2WUHA 5IK7A 2EICA 4IQPA 4XMAA 5FYSA 1FX5A 4GWIA 5A3MA 3RZZA 2JEMA 5K8SA 1LOFA 2Q0AA 1UOGA 2VZOA 4Z1VA 2LRPA 4LO6B 5J09A 3SC7X 5K0UB 2E26A 4AI9A 2VNVA 4BXSV 1CAWA 2BGPA 2TNFA 3ZN5A 1W9FA 3NJVA 4HPKB 1RUC1 2ZHKA 3AZWA 2Z69A 4LA3A 3PDQA 5E88A 2XVGA 4YNIA 2QQUA 2RM23 2AUYA 1QJU3 4J1XA 4QQHA 5KXEA 2CDPA 3B94A 1ZZ7A 1RJ8A 1SMVA 5FYZA 1WBFA 4BMEA 4UFMA 4Q4W1 3MW4A 3SH3A 5JMOA 2C6SA 2RS11 3V0BB 2AREA 2D98A 4JCKA 1UPSA 4OHVA 4DS0A 3C7GA 1O91A 4CDWC 1K5JA 3GHNA 1OOPA 1RGSA 1J1LA 4IEOA 1YJLA 4CDUB 4LO7A 2B39A 3NO8A 1JI6A 4C0BA 1O59A 3I3DA 2YDEA 1OBNA 4FI9A 2B46X 3TN93 4GJZA 2RS33 4HL0A 3O1UA 4F3JA 1S4CA 3ZYGA 1EUUA 1LECA 1UNBA 2ARAA 2ZGQA 5FK8A 3ZIXA 3ZPYA 5CFDA 4AFAA 2DUPA 2GSYA 5LB6A 5FO9B 4DXRA 2J1EA 4AFMA 2FDGA 3KGLA 3UKVA 1Y43B 2JE8A 1N1TA 3IDCB 3WP5A 3K3NA 2WWUA 5LW9A 2GC3A 1B35A 3M7AA 5EJ1B 3CBNA 1R083 4FQ4A 2AYHA 4WM8B 5FBZA 1VE0A 3N9MA 2E53A 1SDDB 3NV4A 4QGMA 5C3QA 1GFF2 1XPWA 5FZ4A 1YHFA 3H8OA 3AB0A 3OYWB 1AX2A 3I3EA 1TME3 4Q4X2 4JGYA 2C4XA 2XB6C 3POSA 1SBFA 5FDBA 1C8M2 3M3QA 4Y20B 5FZ0A 4QB1A 4RFRB 5L7OC 1SLLA 5F2SA 3LA2A 3WUDA 5I0RA 2ZHNA 3K48A 4WZFA 5BV6A 4J1WA 3RI9A 1OXCA 1FPN1 5T55A 4QPGB 4OYUA 5EFUA 3VD3A 2D40A 3EHKA 1QJX3 3IIIA 3VDDC 4RR3C 1Q3EA 4E8DA 3ZSKA 1VB2A 1RUNA 5DPNA 5KBFA 3WQBA 1UL9A 1UMZA 1LODA 2QQLA 3K77A 4ARYA 1GP5A 3NAPC 4I30A 1IG3A 1HXS3 1RUD3 4MOAA 3ITQA 4M4RA 5F7UA 2WT2A 1UW8A 4YM0A 3VBFC 1NY72 1IGOA 3HWJA 1Q8SA 1D4M2 2Y0IA 3ME2A 1X33A 3U11A 1WCDJ 3WZ1A 3CZUA 4QGLA 5BNPA 3V64A 4XJWA 5CNAA 4GXLA 1MACA 1YQ8A 4XDPA 3UK9A 4A4AA 3ILRA 3JZVA 5T54A 5F3CA 1AHSA 1XSRA 2Q8CA 3ZSEA 3ZX7A 1O4TA 1FYUA 1Z7S2 4QQOA 2F4PA 3LCPA 3ZO0B 1XOYA 2ENRA 1PX4A 1UKGA 1XNCA 5EQUA 4XFBA 5C4WC 1DGWX 5C3OA 4DUXA 2HWB2 3KCCA 1VR3A 5FY9A 3GCWA 4NN0A 3CJIA 1ZRIA 5H9SA 2BQPA 2VZ1A 4BH9A 4QXKA 1R1A3 1O5LA 4DRRA 1OPMA 4MX3A 1VMFA 2YHJA 4S2HA 5G04L 5AC93 5I91A 1RVF2 4X6QB 1G6NA 1ZBE2 2GN7A 1OUXA 5F6LB 4ZPIA 1LHNA 3EMRA 4YSFA 2EF6A 2VGDA 4BK5A 1IQDC 1DQ6A 2VH9A 3CHXA 4D6RA 5HCHA 2JENA 1AL23 2ZGNA 3ACIA 2JB4A 4IEWA 4AI0A 5CFCB 5BNOB 1F4AA 2X05A 4G3YC 1WW5A 2RHPA 5E8AA 3H7YA 3M2MA 3UL2A 4LOSA 3WV6A 2Y38A 1MZ6A 4XUNA 3VBRB 2D93A 5KHIA 4CCJA 2ADEA 5IJRA 4OQ8A 2ZGOA 3N7KA 4Q0UA 3PVOA 2FCTA 4RYDA 1VAVA 1V6MA 1VBE1 2OW4A 1VRH1 2W92A 1KS4A 4KWUA 4Y22B 5E1RA 1SPPA 1PHMA 1OF3A 2VUAA 3AYEA 4CP1A 5FZGA 5GLVA 2GN3A 2JDPA 3E6CC 3C7EA 1JOPA 5FPLA 5F5AA 4OI1A 4H2AA 1RHI2 1H1IA 1HQNA 3HBZA 4N43A 3L9JT 1AYM1 3I2KA 2Q1FA 3SCFA 2KR2A 3I8TA 3WX5A 4EWDA 1OSGA 4OQ9A 1REFA 2W1UA 3JB4C 1MZFA 2EXIA 2UYBA 2YU2A 3I54A 2Y26A 4XBNA 1Q8OA 2WO7A 3I7DA 3O5SA 4AQSA 4FTEA 2DTWA 2W3JA 3B69A 3GNEA 3WNMA 2I45A 2P3IA 4RQPA 4YW7A 2D3RA 4XBLA 4ORFA 1XNDA 3KCYA 3POYA 2X09A 4P9LA 1I3HA 2YROA 3A0NA 3FHIB 3PVEA 5B2GB 1Q5OA 1OURA 2VZQA 3DECA 3KZ4C 1ALYA 3N3HA 3PMSA 5D21A 3DUIA 2WZR1 4X8NA 2AACA 4ZU4A 4KNCA 4CDXC 5L7OA 2CNAA 1MZEA 3J7MA 1UN1A 3VZOA 2YZ4A 1DQ2A 1UXXX 4JTNA 3AFKA 3HIFA 1O5UA 3I2FA 1UMIA 4Q0PA 4CP9B 5FY7A 1COV1 1RUF1 1UY0A 4K21A 2WFF2 4IEYA 1HB4A 4LE4A 2ZMNA 4FVVA 4MV2A 1HB2A 5FZBA 5DG1A 3S6PA 2FD8A 1RMU2 2QNKA 2PAKA 3A22A 1LTEA 2DURA 2MNGA 3BTXA 2V4VA 1W28A 4LKEA 3IZOA 4FOWA 3BU7A 1YEWA 3NKTA 1VPHA 1BK0A 3N9LA 3OBTA 2CGNA 1N3QA 1NE4A 2JIJA 1ENSA 4BB3A 1RUI3 1W6NA 1X36A 5K0UC 1G9AA 3EXUA 4Q0VA 2R16A 2BDRA 4WZCA 3AMHA 4MXWA 2W68A 1JW6A 3HN1A 1UIJA 2CWMA 1ODNA 2CU5A 1UYZA 4XJ8A 3K4AA 2LROA 3RYRA 3U4SA 4P14A 5A7PA 4K9SA 3WP4A 5JSPA 4LE3A 2D44A 4AI8A 2UURA 3KT4A 2E63A 4QMAA 3VZKA 1LHUA 5D8AA 4IV3A 4FPJA 2G9ZA 4KH9A 5L19A 4LT5A 4JTOA 2DV9A 1H2LA 3MPBA 1PZ8A 2FDIA 3OPWA 4QQ2A 1WCSA 3ZFGB 4LPLA 2GC2A 5HBAA 2R32A 1I1EA 2SLIA 1SZBA 4CDUC 1GZCA 1XU1A 2OQ7A 1RUG1 2PTMA 2IXIA 5CKQA 3PMEA 3ZMOA 1LOAA 3J9SA 4M01A 2W46A 4NVPA 3ZYHA 4D69A 3QOPA 4QX2A 4IESA 2OIIA 2P3JA 1FOD2 5KC5A 5I0SA 2Y0OA 4HN1A 5GM0A 1JZ6A 4QKNA 2Q8DA 1MQTB 1ZRDA 3IKWA 2DCZA 5FJKA 3SLIA 1M06G 1ASJ2 3ZVXA 4HG6B 2DTYA 1W0PA 3I3MA 4DXZA 3U4XA 3NJYA 4EROA 1BBT1 1TG7A 2ERFA 1VBB1 3LEIA 4OI2A 1EV12 1JU3A 4MGTA 4WM8C 3RYKA 4NIDA 2CGPA 1LKNA 2EIEA 1ZA4A 1A6CA 4RS5B 5DDJ3 4JGZB 3KV4A 2W52A 1PGL2 2Y8KA 1WA6X 4Y5TA 1U5XA 5BNNB 3EB7A 1CGPA 4Q4V3 3U78A 3IIAA 4XQDA 4EZ4A 1AZDA 3LEGA 3OEBA 4OCTA 4CDQA 1J59A 4IV1B 2PHUA 2ES3A 2ETEA 1QF3A 4EN6B 2ARBA 1AR63 2WS93 1CZTA 4QPGC 4CXWA 1W90A 1HLCA 3HJRA 4CTEA 3VHPA 5GZDA 1G9CA 1JBCA 2WNVA 3Q9OA 1FI2A 5LEKA 2BWCA 2ZX4A 4LUMA 4Q4Y1 4B7EA 4TWTA 5HXVA 1JYXA 3FFQA 1HIXA 2WZPP 1NCRB 3TWIA 4URAA 1UIKA 2RJKA 3VD7A 2XPJA 2J1VA 3WLUA 1ULCA 2NP0A 2GU9A 1POQA 4Q0QA 5BPXA 5T3NA 2E6VA 3AXEA 4YZ4A 3R4UA 4AQ2A 4BQ3A 4XF1A 1GZTA 2RS53 2ZX1A 1LAJA 1RXGA 2G4IA 4CDXA 2WNUA 4Q8LA 1DZRA 1QJEA 1QOTA 1MS9A 1OKOA 1SLCA 3NNFA 4JKKA 1OD5A 4QDRA 1FMD1 3BCWA 1UD1A 4WVWA 4Z07A 3UESA 3D0SA 3PUSA 3W5NA 4Z82A 4BPZA 1F2NA 3R0RA 3UETA 5A32B 1PM7A 2BVBA 4GH4B 3MF9A 3BPZA 1SCSA 1AR91 3B3QE 5I8SA 4EWAA 1ZBA1 2OQ6A 5FK7A 3X29B 1QOSA 1SCRA 5FOBB 3LDKA 2P6HA 1OF4A 2PHDA 5JMCA 1S0CA 2WLQA 4RSUA 2VUCA 5FYYA 1JODA 1A78A 1L7LA 3D0JA 1V6KA 3MIGA 4MSVA 4N53A 3WUCA 5DQ0A 4NHKA 1GNHA 3P3PA 2JDNA 1RIRA 5FZ1A 3I2OA 1JTZX 4PLOA 1F8VA 2XONA 2OYZA 1QEXA 1NCQB 2VJXA 1WA4A 1UOJA 2R062 2WBKA 1ULDA 5LA0A 4AHWA 4LBQA 4LBNA 5FXXA 2BVVA 2OPKA 1R1ZA 4HPKA 1TMF2 1RUE1 4RGGA 5CFCC 5BNOC 2B45X 3LFIA 5C3SA 1E5IA 2ZPXA 4QX8A 3GZAA 1NLQA 2GMPA 1EPWA 4KBBA 4QPIA 3VBRC 5DMYA 4G9SB 4NHXA 4Q4X3 1R092 4R4ZA 5F5IA 3VL9A 2XXZA 3A21A 3FC0A 2WJSA 2FDHA 5A3WA 2VUDA 5FZKA 5JLVA 1ZYBA 1AF9A 1C8M3 2TEPA 4MHUA 2FZ2A 1DP0A 2XLAA 2XVLA 3MI8A 4FPHA 5LBCA 4CEWA 2JICA 5JZGB 3VN4A 4NE9A 2PHTA 1LOCA 3FBYA 1ENXA 3PVBB 4KG0A 2UWAA 4IE4A 4AEDB 5FLIA 2W0XA 2DUOA 2AEZA 5K7PA 3THCA 1J58A 2RV9A 1CX1A 3VBUB 2YV8A 2XL7A 1PNFA 5H9RA 4D6SA 4HONA 4OHWA 1H2KA 4R9AA 4PIZA 5EJZB 1C57A 1OH3A 1IHMA 2FDJA 3GCXA 1O3SA 3ETQA 4YGBA 4LBJA 3GBGA 1UWWA 3D8CA 2P4EA 2FCUA 5BXXA 4LBOA 4UBHA 4MGKE 3VBOB 1U0AA 2OX0A 2VG9A 1QQP3 1D4M3 1W05A 5LA2A 1EYBA 3USUB 1ZZ6A 2DVBA 4MG2A 2A6ZA 1G86A 2ZKNA 5HXMA 5FMDA 5A7WA 4XJZA 1V6NA 4ET7A 3H9AA 1BEV3 2HLEA 2DCYA 2X5IB 2IXKA 2C0ZA 3RMYA 5I0UA 2VMGA 4JRAA 3ZYRA 3ACHA 5KXDA 5ACA3 2R072 5FTTC 2XLGA 4K1ZA 4Q4W2 1H6XA 1AYN1 1D2SA 3AJZA 3LPGA 3ZLIA 1PMJX 2Q8OA 2PAMA 5FCCA 4S2DA 5FP4A 4FAHA 3IDBB 1ZBE3 3BOPA 4IEPA 4YZ5A 4A7ZA 1V0AA 2VZVA 2PAEA 4CCOA 4UFIA 4NPRA 3AP6A 1BK1A 2R041 2TBVA 2W91A 5A3UA 5J36A 1H30A 3QH7A 1RUH1 3LOIA 2X53S 5SV5A 2OKXA 3POBA 5A7NA 4HBNA 5EPAA 3NJZA 1AR83 3OEAA 1HX6A 5JIUA 2R0FA 4BK4A 2QDNA 2J1TA 3KGZA 1UQXA 4PF5A 1HRV2 2YPJA 2BBAA 3HNMA 1CAUB 1MPXA 4K7JA 3U10A 1DFQA 1ODMA 4LKDA 4AK3A 2DWRA 2W08A 2ZEXA 4CCDA 2HWC1 2QVSB 3B9IA 3AKRA 4D6QA 1CWPA 3OPTA 4LO8A 4NHYA 3ZFGC 2JDUA 1NXMA 1GWKA 1ZZ8A 4HVOA 5JR2A 4E4SA 3IMMA 5BNQA 2WO3A 1RHI3 4R52A 4XQ4A 4DIQA 2W95A 2E33A 3AYCA 1K12A 1MS3A 2O1QA 5IK8A 2BNMA 3LPFA 4NMIA 5C8CB 2OVUA 1ZRRA 4MLOA 4RHV2 1BZWA 3RVHA 3VZMA 3T0DA 1GBGA 3KWVA 2FMYA 3ATGA 1OC1A 3H50A 4DY5A 4ES8A 1H8TA 4QDSA 5FZDA 4D7TA 3UGFA 4GD4A 2HWF3 1MQTC 1TZOA 5CFCA 3MICA 4DEVA 1ACCA 4BISA 5L9VA 3OGSA 4ASLA 1GWLA 3ZYPA 2VTXA 1W6OB 2KD7A 3FBMA 3VBRA 3UNPA 4AI2A 3H3UA 5HI0A 2DVDA 4BM8A 1FNZA 3PVNA 4GALA 4LUKA 4RS5C 5DUWA 4B7KA 4AWDA 1V6OA 2W94A 1W04A 4JGZC 4ZY9A 3BKZA 5FQ0A 5BNNC 1CD3G 4OMCA 2WFF3 4P5YA 2BGCA 3CQOA 1RMU3 2RMU3 5DZEA 5A7OA 4A3ZA 4IV1C 2K46A 2JXAA 5FXZA 4N8MA 2BP6A 4GWNA 3AYAA 1A8MA 4QXBA 2QTWB 4UT5A 2VCBA 2DCJA 4ZHNA 1DU3D 2YGLA 3ILNA 5FPVA 1GOHA 5FZFA 4QM9A 4RL7A 1NLSA 2HWD1 2IVJA 4TLFA 5DUVA 5IT6A 3LQCA 1WCKA 2N7GA 1NCRC 1ULGA 1V9U3 3AL5A 1YJKA 1S0DA 4N7IA 3WCRA 5JUVA 5DN2A 3FLPA 4AG4A 2XQRA 4PBOA 4EE2A 1CAXB 2WNEA 4NWVA 4KQ7A 3HT1A 2WSUA 5JOZA 2AGSA 3RI8A 2P1BA 4HSLA 3T09A 3NNGA 2A1XA 1QJY1 2NMNA 4IL7A 4R8HA 2WC2A 2F4LA 1OLRA 2XMLA 4BQYA 5HV0A 3E5XA 4HLTA 1CPMA 3VBSA 5IFTA 3T4HB 4FOQA 2QQMA 4XYXA 1PX3A 1JUIA 4UBGA 3M3OA 1IS4A 4E4HA 2QCSB 4GH4C 4CCCA 4YW1A 4GMP3 1SLBA 2A73B 4AAXA 3J4UH 1OKQA 1LGNA 4LJHA 4WM7A 3RZKA 3R6SA 3GYDA 3NV2A 2ZAAA 5LRSA 2V09A 2JDAA 1UZZA 4DZGA 4GB32 3BALA 3KVBA 3SH5A 4CU9A 5FIXA 2NPIA 3MUZ1 1FOD3 2D3PA 2IXJA 2WNOA 2ATFA 4XTMA 5ISLA 1AYM2 2HBUA 2YG0A 1NCQC 1AJOA 1QU0A 2VBDA 5F1RA 2A5ZA 4XF0A 1HJFA 3EBRA 3G7DA 4CUCA 3VDBA 1DZTA 1W2NA 5JI9A 3E5UA 1EV13 3N36A 3S0MA 1JOJA 1VBD2 2XHKA 3O12A 3KD4A 3POFA 4K3UA 4Z2AA 2PQSA 4YVWB 4HT1T 3MFAA 4W6XA 5BYNA 2X10A 1QJY3 3TNPB 1PVC2 3FZ3A 3DEMA 3NV1A 4YGDA 1QXJA 3VKOA 4GKXA 3ZSMA 2JDYA 1XNTA 5CVRA 3PUAA 5C9AA 4A6OA 2PHXA 4P9JA 2F6BA 4XCBA 3SH4A 4Q29A 1U5YA 1TNRA 3MUY1 3HPNA 4QDQA 2WZR2 3BTZA 1HQWA 5JZGC 3TEWA 3BPSA 3LD8A 4LNVA 4W8JA 1R64A 1BYHA 2JECA 4JX0A 4AEDC 4E8CA 4O9GA 4AVCA 2RM21 1OPOA 1QJU1 4J25A 5FWJA 3O7OA 4EWEA 5J98B 2XJUA 2XKOA 5DAWA 2Y6JA 4UFKA 3VBUC 2GH2A 4P08A 1PK6A 1OI6A 1S0FA 4NUBA 4LO4B 4CXXA 2H0VA 1LNSA 3BI3A 2V4AA 4AOCA 4DO0A 5F37A 2W47A 3NJXA 4YVSA 2D43A 1DGRA 4FP2A 5DXDA 5J96B 3T2TA 2QFEA 3LIGA 4Q26A 2VZ3A 2XBO2 2NM1A 3TN91 1ONAA 2J1UA 2J22A 4XUPA 3D4KA 4IEVA 2GNMA 3PUHA 3ECQA 3WCSA 1RC6A 4NWWA 4AYUA 1F35A 2X5IC 3IDAA 3ZFFB 1W6QA 3JBG2 2P5BA 1OUSA 3AFGA 4MH0E 3VBHA 3OUIA 4IE0A 2VULA 3VV1A 4O7XA 4OVEA 1Z78A 1R081 4ASMB 4YFZA 5HPOA 1PO23 3CJXA 2JG9A 4L2NA 4XUQA 1H2MA 1KEXA 2XOMA 5FY4A 2ZS6B 1F15A 3POGA 1YXWA 2PHLA 5K4LA 5FOJB 1W9YA 5I93A 1AR73 2ZA9A 2CL2A 3E1F1 1BVP1 1TME1 3LA7A 1UX6A 4M3CB 4XURA 2EAAA 3LF7A 1PVXA 2X8KA 4HXCA 3ZSLA 2QQIA 2Y6FA 2YY1A 3I3BA 5FZ8A 1KFUL 2RDNA 3GALA 4AR2A 1JYVA 3UKNA 4IGPA 2W1SA 4XBQA 3WF0A 1QJX1 4KWJA 2NLRA 1CAVB 4DY3A 5ABJB 1GP4A 2RJ2A 5FR3A 3W5MA 5F3IA 1WLTA 2EVXA 2R6QA 4XC9A 3S5AA 2D6LX 2ZKLA 1QXPA 2B42B 1QWRA 3RDIA 4ATEA 1RUD1 1HXS1 3GHMA 3OGVA 1O7FA 4CCLA 2JDKA 2ZGLA 2PLV3 3MF6A 5FMOS 3ZFEB 1JHNA 1PM4A 1XYNA 5JI7A 4XE9A 5IUQA 1EP0A 2VVDA 1IOAA 3ALQA 1N1SA 3PIJA 4A44A 5T5JA 3VGIA 5C8CC 3ON7A 2ZEZA 5DZGA 2GAUA 1XB9A 2E7AA 5FWEA 2IXLA 1AVBA 2ZBJA 3I59B 5GZGA 4FPGA 2DFBA 3HQUA 3OGGA 4XIKA 4EYUA 1BVVA 3EQEA 3MPPG 2ZGPA 4D8MA 2HKXA 3QD6A 1UY3A 5AFEA 4Q4Y2 4HETA 1XE8A 5LK5A 2BWAA 3UJQA 1R1A1 4AHXA 3ZXEA 3PTYA 2IWGB 5AC91 1KXGA 3BUCA 4TN7A 5I0DA 3BN6A 4I02A 4D7YA 4UOJA 3I49A 1EAH1 2R073 2VZPA 4DQAA 1YFWA 4QD2A 4SBVA 2CHHA 3EO6A 1J3PA 4UF0B 1DGRN 1VBA2 1H2NA 4LK6A 1AL21 4QAWA 1O3QA 1QH7A 3FJSA 2AC1A 3DL3A 4AEMA 4DRVA 5DG2A 2BZDA 4UFLA 2VMEA 4RD7A 3U14A 3BGAA 2J1SA 1ZBA2 3WG2A 2ZMKA 1CR7A 4PF1A 3WVJA 2D6KA 2RR12 4COZA 3H3ZA 4FOVA 5A7QA 2EA7A 5FP3A 1H1MA 2C5DA 2HBTA 2Y33A 4I0AA 4NOTA 2XJVA 5GKAC 4LHNA 3GZEA 3M3CA 5IWFA 4BOWA 3WDYA 2A6WA 5CKMA 1T2XA 2DCKA 5LWBA 1JZ3A 4H14A 1NG0A 2YFZA 3CF6E 4BQ2A 1OFSA 1UYYA 4L9BA 4H55A 1ULFA 1ZRFA 5LASA 4B4QA 3SQOA 1DLCA 1HRV3 2YXSA 1RUE2 2ZAHA 3WNXA 2BGOA 2EXJA 2VW1A 1KJLA 2VQUA 3QH6A 1EAH3 3JD73 5EP9A 1FT9A 4UFJA 1CX4A 5JOXA 1C1FA 3PJQA 4CZSA 4L97A 2VAUA 4Q1PA 3WNOA 5LEJA 2JKBA 3T1LA 1E5SA 4QX5A 3WY6A 3PLQA 2ID4A 4QX7A 2DFCA 3ZMNA 3WP6A 2WQ8A 3LAGA 3C2UA 1LRHA 4IETA 2A7AA 2C9KA 2UWCA 2GNTA 3SKVA 4LBMA 3NNMA 2SBAA 4RHV3 4FFHA 4TXWA 1YCIA 2MPFA 4H3WA 5FYVA 3TEXA 2LTNA 4QQLA 1LGCA 1MEC3 3TEZA 3U75A 4NO4A 1N3OA 4W50A 4CDWA 3N9PA 3FMGA 4COVA 3J26N 4A6SA 5FO8B 4HANA 4K40A 1WMEA 4LHLA 5H9QA 3OD0A 3LWCA 3Q8CA 2R1DA 1DF0A 1L3JA 2VNRA 1DCSA 1KJRA 3PTRB 3V56A 3J7HA 1UO9A 4CU7A 4JKMA 2QUOA 1GV9A 1BJQA 1IS6A 4QU1A 4XHBA 5J7MA 1SEFA 2FZ1A 5A3NA 4YVWC 2Z42A 1W03A 1ND2B 1MVEA 2FDKA 5FKCA 5ANQA 3T3YA 1BKZA 1J3RA 3BODA 5JOYA 1UZWA 5FZHA 1YQCA 1ST8A 2GNBA 1NA1B 1STMA 1RUI1 1UOBA 1RUJ3 2JD4A 3VKMA 2YBSA 3HEIA 4IEXA 4LXLA 4JQRA 4CEYB 1ZREA 1BHGA 2HWE3 1AL0G 4QXCA 1VBC3 2JKXA 3DCQA 4XJ9A 1D0HA 2WO1A 4JKLA 5FMOL 1AYN2 3VZJA 4ZU5A 3KMHA 4PIXA 4Y1ZA 2B4KA 2UY8A 1HW5A 1RTVA 5E6HA 4FPEA 3HD8B 4IE6A 4WVMA 5A6YA 4XFAA 2UWBA 4D94A 3W59A 3RYPA 1H1AA 2XVKA 1YI7A 3PHMA 3P6BA 4IUGA 1XJAA 4LULA 3VDAA 1W6OA 3ZOIA 5KHGA 2WYFA 2ZGMA 2BBVA 1F4HA 1WZXA 2DCTA 2Q4SA 2R042 2ZHMA 4PDWB 3J7LA 2R30A 3VDDA 4KWKA 1YIFA 1PO12 2MEV2 4RR3A 4BA6A 1W0NA 5JVVA 1LR5A 2ET1A 3RZMA 2BEOA 3J8F3 1H0BA 3NSTA 3OBZA 3NAPA 3ZFFC 3T2PA 4YPJA 1UXZA 1C8NA 1H6YA 2PMWB 2L9LA 3VBFA 4UXAA 1W6PB 3U07A 2KXLA 4OUSA 1UKRA 1G7YA 1QH6A 2HWC2 1UU5A 2A75A 2VQ0A 4R9DA 4ZS3A 4KMQA 3MYXA 4UW3A 4YM1A 5A3PA 4TZDA 5DDJ1 4LBKA 5IVEA 3V0AA 5K9YA 1ENRA 3HN3A 3I2HA 1MS1A 4AVSA 4XOGA 3SCGA 5C4WA 4WVVA 4ISRA 4Q4V1 2VW2A 3K4DA 2WAAA 4ZKTB 1PIV3 1OVPA 2VC9A 1VBD3 1Q56A 4HN0A 4XXAA 1GICA 3HMYA 3DV8A 2C9AA 1AR61 2Q1MA 2WS91 3DGTA 3P1IA 4YG6A 4HMZA 1PVC3 2G1MA 3ZKYA 3AMNA 4OUEA 5J37A 3O1PA 5GLZA 5JWPA 2CAVA 5FUPA 1VP6A 2BW8A 3ZXFA 3ORJA 4ZONA 3G6JB 5ABJC 1XSQA 1GZWB 4AXOA 4B3NA 1O4YA 1G8WA 1NLRA 3CZJA 3GZTB 3KCXA 4HSJA 4QKBA 4XDQA 2VL4A 3H7JA 4IDZA 4DXSA 1JYNA 1Y7BA 4JHZA 1C5HA 4KBZA 2RS51 4YFWA 4YYOA 3ZFEC 1RUOA 3RZLA 3WD5A 3N7JA 2WA4A 5FYIA 4CUBA 4GAZA 1JZ4A 1OQEA 4KG8A 3UYJA 5LA9A 2VU9A 4EJRA 5A7SA 3OY8A 2WIIB 4UYBA 3RMXA 4FTBA 1VJ2A 1FXZA 3N35A 5JOWA 1IKQA 3NQHA 1DQ0A 2HWD2 2IVIB 5EIYB 4R9CA 2DBIA 3B93A 4A2UA 2A6VA 3J7NA 2VZRA 3VDCA 4TLGA 2QQKA 3FUQA 2DU0A 5FLJA 4CVUA 1OA3A 4B29A 3H0OA 1N47A 2PXJA 5FZLA 3JBG3 2Z79A 3OBRA 4MUVA 3BIEA 3WT3A 1Y9QA 2CWSA 1DIWA 4K8RB 4XTPA 3WQ7A 1NQDA 2YB7A 4IEQA 4S2FA 3BTAA 3M8LA 4XW3A 5FMCA 3S7EA 3IMNA 2H6CA 4CPBA 4JQTA 2P37A 3TBDA 2BERA 5FFOC 3GM8A 1PZ7A 4YW4A 1CAWB 3WP3A 1CPNA 5LBEA 5JAXA 4Q4X1 2PYTA 4XXPA 5M0TA 1MS8A 4MGZE 5F39A 1NZCA 2DVFA 1YQ6A 1C8M1 5JSOA 3SEPA 4HKOA 1UY2A 1C5IA 3ZXLA 4XZUG 3GF6A 3WW4A 3H8UA 4L11A 5T52A 2D6PA 1US2A 4OHYA 4BXFA 1J83A 4BDVB 1S55A 2ZTNA 1C4RA 2XQXA 5C8WA 4HZFA 3MZHA 1W39A 2XJQA 4NRPA 5FP8A 1O3TA 3VD5A 3FHAA 4XFGA 5CB7A 1S0IA 4IERA 4CUAA 2ZEWA 4R9BA 5K0UA 3C7OA 3N9QA 3WQ1A 1I6XA 4NHMA 4P9GA 2VMHA 1O4ZA 3LSDA 4N9IA 5CZKA 4O65A 2VVEA 3OG2A 1NY71 2WWJA 1QQP1 1D4M1 3ZN4A 2Q30A 5CFDB 3OTFA 1VAKA 2ZGRA 4TSVA 3I97A 2B9VA 3ZYIB 1B35B 1O8PA 2GMMA 4OLLA 3ROUA 4BLJA 5IATA 3OCPA 1RYYA 1BEV1 4Y1VA 2YU1A 4AGRA 3V0BA 1V70A 4C90A 1WMDA 2RM22 4YGEA 3QBQA 3B5LB 4MGSA 5ACA1 1W8WA 1HRI2 4KGGA 1FATA 3LDRA 2QDRA 2IZWA 4CDUA 5KR7A 1RL3A 3O14A 2YBPA 1QOOA 3PNAA 3FN9A 1REDA 3MEPA 4GJYA 4JGYB 5FP9A 1QNWA 4F7ZA 4EQVA 2VXRA 4L92A 1W3XA 2HEYF 4JC1A 4XDOA 3THPA 4AGGA 3IAPA 1GMMA 4CPBD 4DPNA 3MW2A 1ND2C 1H4GA 2YBKA 2JDZA 4FQZA 1ZBE1 2VR4A 4IEZA 4PBPA 1H8VA 5TSWA 2PA7A 5GALA 1GP6A 1GQPA 4AL9A 2RS32 1NA1C 4AW7A 4JZRA 4QKDA 2FCVA 4XJUA 5FZEA 3APBA 4B1MA 1WCQA 2ZMLA 4YZ2A 1Z0HA 4Y1XA 4WM8A 2OZ6A 3B7MA 5T5PA 1SBEA 1AR81 3VKLA 1GWMA 3WDVA 4FPCA 3ZXKA 1OVSA 1R082 3OYWA 3AMMA 4AHYA 1T6BX 3BU0A 1RUC2 1Z7S3 2ZCWA 3AVSA 3K2OA 4I01A 4L99A 1I5ZA 5BNPB 2Y64A 2OUJA 3POWA 4XAAA 2GP5A 4Y20A 3MIBA 3MW3A 5EYXA 4PCRA 1WLCA 1TME2 1BMV1 2HWB3 3E97A 1CONA 1JOBA 2RS12 3OBAA 1LENA 3K46A 1RHI1 1XNAA 3O1TA 3UGHA 4QPGA 4LBQD 1JZ8A 1UX7A 5HCFA 3A7QA 3JUUA 2ARCA 5CG9A 1A34A 4PDWC 4Q0SA 2AENA 1AXZA 1C3HA 1RVF3 4KL1A 3CJIB 2QBXA 5A6ZA 2JX9A 4EN7B 4KGQA 3URFA 1VALA 4QHBA 1JZ2A 3DKQA 2HWF1 5FPUA 3AM2A 1S1AA 1XBFA 4K20A 1LU2A 3N9NA 1AXKA 3KB5A 4OZXA 4COUA 2XR4A 1F31A 2G9FA 3MO4A 3LKJA 2V5YA 4NAOA 5I0TA 3WNKA 5IFPA 1KRIA 1OA2A 1RUD2 1HXS2 4FPYA 3P3NA 3B01A 3S7IA 3T30A 3ZXAC 1CZSA 4QU2A 1NZIA 3OPZA 4IW3A 1QHDA 4AFCA 5AVPA 5L9RA 2JE9A 3LFMA 3W58A 4OHXA 5LCWL 2YC4A 2XWBB 5KXCA 1QJZA 2WFF1 1VIWB 2PFWA 2CDOA 3TB0A 1CJDA 1OQ1A 1Q8PA 2GP3A 2WR9A 3E6BA 1RMU1 1XNBA 2RMU1 3ES1A 4XJAA 2ZZQA 3KF3A 1WWYA 2IC1A 4Y24A 4PLMA 4YARA 4LHKA 4CU6A 1SPPB 3WINE 1W8ZA 3GXUA 1DLLA 1L7RA 4XABA 5GLUA 3T08A 4FPLA 1W9WA 5AVAA 1YRZA 4NRQA 1FPN2 1R1A2 4N43B 3UKTA 3DYOA 5JXHA 2UYAA 4LIUA 1OH4A 5AC92 4DNYA 1V9U1 3WW3A 3SCHA 4XFHA 1IS5A 5BNOA 2C26A 3VD4A 3WG3A 2Y60A 3IWZA 5FYUA 2Y6KA 2JB8A 2XG3A 4OI4A 1YFXA 5IVFA 5FY0A 2PQQA 2ZGUA 4RQPB 4MGQA 1JYWA 5FUIA 2O8QA 2QE3A 4INDA 2O8OA 2VZSA 3O0XA 4GULA 3PJYA 2XGXA 3NRUA 2WA3A 4MGYE 4Y22A 4E4ZA 4UI9L 4E2SA 2A6XA 4GMP1 4XMIA 4YG0A 2WKKA 1LOBA 1DYPA 5L7OB 5HCBA 1H9PA 1QDCA 5EZWA 2D97A 3MV01 4ES9A 3TYJA 5JR7B 2W2IA 1PO13 2MEV3 4IGOA 2BNNA 4LLOA 2VECA 4FP3A 1LB2A 4AF9A 3KM5A 3VKFC 2HEWF 2I74A 1FOD1 4QHOA 2VZTA 4HOOA 4XZPA 1NA1A 3QCWA 1POV3 2A3YA 4A7YA 3CLPA 1MR5A 3WW1A 3ZXGA 3LIHA 2VCCA 2XL9A 2ZX2A 2ADDA 1HKDA 1LOFC 1EV11 4BQ1A 5A6XA 3DXUA 1DQ5A 2FMDA 1XYOA 4FPKA 3ZR6A 2XJPA 2VW0A 2Z2SB 3FL7A 5IVBA 4CA9A 4Y5Z0 4MXWB 5JXIA 1J1TA 2YPDA 3O1MA 2RE9A 1PGL1 4BLIA 2DYCA 1HV0A 2IUWA 3HQRA 2NMOA 1DGWA 1OLME 2ZHLA 4IXLA 4CUGA 5J48A 4CP9A 5FXVA 1PMHX 3CKHA 5D8AB 1D4VB 1Y4WA 4P9YA 4IV3B 1LU1A 3KLSA 3AMQA 2FHRA 1U5ZA 2VD7A 1OQDA 4ARXA 1IG0A 2GDFA 4BQXA 1V6LA 1ZX5A 1VBE2 2VQAA 1VRH2 4GZ9A 5FZCA 2RDQA 1W6MB 3K4ZA 3MHZA 1AUYA 3NMBA 3MV11 2WLPA 3PUQA 2WL1A 3UT0A 4XFCA 1W9TA 1CIYA 2WZ8A 1NAEA 1ASJ3 1W6PA 1X9PA 5IVJA 3ZDVA 4ATFA 1O3RA 1QIQA 4PIYA 4O9EA 2E32A 3IAQA 5CFDC 1RUI2 4M3CE 1I5PA 2ARXA 4B4PA 4AFBA 2ZEYA 1NUKA 2K2SA 2WFPA 4L0PA 2FQPA 4PLNA 3AJYA 1B35C 3D3AA 2ZX3A 3CDZB 5EV7A 1VAMA 3E6DA 4XVHA 1JH5A 4E27A 3I2DA 4D7SA 2VOVA 1NX9A 3O0VA 4OMDA 3HAGA 1MS0A 3ZFGA 1JMUB 1A3KA 3PU8A 2BOJA 1W06A 1ZZCA 4JGYC 1CQ9A 1PO21 4EN0A 2HEVF 5APAA 2A3WA 4FBFA 3CO2A 4DB5A 1COV2 1RUF2 4CDQB 3W9AA 5FP7A 1AR71 1GUIA 2E51A 2ORXA 3DYMA 4JDMA 4YGCA 2JG8B 3BOWA 1GZWA 1W2AX 3VUOA 1DHKB 5C33A 1MQTA 2LUWA 4B4RA 2WNVB 5KXBA 1TE1B 3VBOC 3IPVB 5FZIA 1S0EA 1AX0A 2JDMA 4AEKA 4MHRA 2BUKA 2HH9A 4RS5A 4BCUA 1K45A 3W21A 4JGZA 4BQ5A 1TVGA 4XHXA 5LBFA 5BNPC 5LATA 5BNNA 5HCAA 2WNUB 5D1IA 3GJBA 4PHZA 1SFYA 1Y3TA 5DDJ2 3VHNA 4IV1A 2ZOEB 1W2OA 3A0KA 5A33B 1GSLA 2PLV1 3T1MA 3BYWA 4Q4V2 1IPJA 2ZABA 4FXKB 4K8FA 2D6NA 2JD9A 3ENRA 2BNOA 4X8PA 2LW8A 2BFUS 5I8YA 1Q43A 1NKGA 3Q8EA 3TRSB 1HJGA 4WV8A 1IKPA 1RUG2 3CJIC 3AVRA 4NIIA 1QMJA 1X8MA 2WS92 3F2ZA 1A8DA 1NCRA 4CCEA 1MS5A 2R063 2WT1A 3I2IA 2K9ZA 3ETPA 4N53B 5IAVA 3SISA 5A1FA 4M3CF 2XDVA 2ORZA 3HVDA 4YWAA 3SNMA 5C3PA 1UZ0A 1TMF3 3NW4A 3K51A 4Y33A 2VZUA 4EN8B 1REEA 5FY5A 4LBQB 3VZLA 1XQNA 3OGJA 1R093 5JXGA 1BBT2 4PT6A 4COWA 4AVVA 2RS52 1VBB2 1WLWA 5A32A 4GH4A 1HRI3 2R071 1HV1A 2WN3A 3M3IA 4QPIB 2VCAA 1YFUA 3CIHA 4LITA 2AH2A 2VQTA 2EAKA 4CCKA 3N7LA 1RXFA 4CEWB 2H0BA 1BXHA 1G9DA 4ZU7A 3AL6A 5A80A 4LLFA 4Z92B 3RWKX 1D2QA 1NCQA 2YMZA 1OLQA 4N43C 5FYBA 3I3QA 4BQ4A 3WNLA 1ZVFA 2W9XA 3MLLA 4O61A 5LY2A 1UU6A 3HBKA 1OT5A 2ET7A 3TNQA 3WDWA 4BIFA 4OZOA 4FXGB 3KV9A 4C1XA 3AKQA 5F3EA 4UAPA 1DBNA 3INAA 4NR1A 3MIHA 3SKJE 4N9HA 2XJRA 1F5JA 1HRV1 1RUC3 4QHZA 4UW5A 4XPVA 2DUQA 4C8DA 4RQPC 2A3XA 4S2GA 5JXJA 1CN1A 2HYKA 4Q1RA 4DINB 1X82A 3WG1A 4Y3OA 2R0HA 3PURA 3JD71 5JZGA 5FPAA 5A7WB 1JXNA 4Q4W3 3WDXA 1FMD2 1O6UA 4TTGA 4YG3A 4LIVA 2RS13 4AEDA 3USSA 5FREA 3C8XA 4PI2A 3T2QA 1GLHA 3UV9A 2YYOA 3LSEA 4Q27A 4PQQA 5A3OA 2D5HA 4IE7A 2QQPA 3S30A 3VBUA 1AR92 1AX1A 2YGMA 4NAMA 5JCTA 2XWJB 1P8JA 4RHV1 3SITA 4DEQA 1KFXL 2IFRA 4G4FA 4GKYA 4COYA 1MEC1 2PHFA 3AC0A 3O1RA 1C28A 1S2EA 2O14A 4Y26A 2DBNA 4DXTA 1RINA 3VBOA 1BCXA 1NT0A 1MVQA 5DABA 1BLZA 1IS3A 4D3WA 1GOGA 5GJ6A 5GLWA 2K0GA 4L8QA 3VZNA 4DUVA 3USUA 5A1AA 4JVAA 1DDLA 1DQ1A 1E5RA 1HB1A 1QNYA 2CV6A 3WDUA 2NN8A 4QX1A 1QDOA 1W8OA 1LOEA 3NNJA 1JYIA 1QQP2 5JIAA 1EPZA 1XE0A 2X5IA 4M0NA 4QPWA 2EXHA 1IZ3A 3WDTA 3RZJA 1JYCA 4RGKA 1RUJ1 2WDBA 1BEV2 2GZWA 4E9KA 4C1WA 4XUOA 1S0JA 5CKNA 4XF4A 5D8AC 1CESA 3RS6A 4AGVA 1YI9A 4CRQA 2P3KA 3OOXA 4IV3C 1VMHA 2HWE1 4PJYA 3DPRB 3RJ2X 1VBC1 1NYWA 2VXJA 5ACA2 3HR9A 1UU4A 1CZVA 1UYXA 1YQ5A 2D7FA 3KT7A 4HVRA 4AE2A 4I0WB 2G9GA 2BFUL 1FPN3 4FTSA 1X8EA 3S57A 3C7FA 5FY1A 5LK7B 1YC61 1PNGA 2OUHA 1PZ9A 3IB3A 4XFFA 2XKPA 3IT8A 5FZ7A 4GWMA 3WR0A 4AAPA 3CNAA 4MXVA 5KWRA 1YNAA 4BQWA 3Q8BA 1H8TB 2WWSA 4V2VA 3ABZA 2RDSA 5C70A 3IBMA 1W8NA 3FLTA 1ULOA 4DMIA 1OD3A 2QQNA 3P5BA 3N9OA 5A6QA 1G9BA 4I3GA 1WBLA 1CAUA 2VUJA 3NNLA 1Y9GA 2VTXJ 3RSJA 4AI1A 1W8FA 4AZZA 3J8F1 4W6WA 1AR82 3HT2A 4Z8BA 2CTVA 1K5MB 2F17A 3DN7A 3RG0A 4BE3A 3FE5A 2P34A 2PHWA 1LHVA 4JAAA 4Y4RA 2QQWA 1X9TA 2X29A 3MBWA 4E4DX 1F9KA 3BB6A 1S2BA 5FQ0B 5IVVA 3WSOA 3FHQA 4GB31 5C8CA 2Q1ZB 1BMV2 1EY2A 3NVCA 3FWEA 1JU4A 4V2WA 4CDQC 3L2HA 3LOBA 2VOTA 2JG8C 4YZ3A 2WINB 1OMIA 5CU1A 2HYXA 3WXPA 2GMEA 4N90A 3LB9A 4CU8A 1ZZ9A 3LA3A 3SHRA 2A70A 2WNVC 1PIV1 3T0AA 1VBD1 1RITA 3AZVA 1KITA 4FFIA 5F5CA 4OFGA 2HWF2 2QQVA 2WAOA 2LS6A 3RZHA 1OA4A 1Q8QA 1IPSA 4YZ1A 1Q8VA 1PVC1 3D6EA 3PL0A 1WD3A 2FBEA 4QB6A 3ZN6B 1UOFA 1RUH2 1HDKA 1VB4A 3R05A 2OPWA 1LHOA 2VPVA 1GNZA 4F8AA 2ZACA 2ILMA 1K3IA 3ZYBA 5JSRA 1WMXA 1OHFA 1ZRCA 2WNUC 1WUVA 1YLLA 3AKPA 2VM9A 2GC1A 1HN0A 3VBSB 5H9PA 2J1RA 2B7YA 4XEZA 3WNNA 2RDRA 4AFDA 5SV8A 1VBE3 3CU7A 1VRH3 2R1BA 1MS4A 1JUHA 1W9SA 5A3TA 1L7QA 2WO2A 2IXCA 1TQ5A 3ELNA 2B5HA 4GB33 4MVTA 1GYKA 2RMU2 1ND3B 1QXRA 1LEMA 3VKNA 4WM7B 5C6CA 4YW2A 3POIA 4YW6A 1LEDA 1AYM3 2LM3A 2XLFA 4GQ7A 1PGW1 3AZYA 5KHJA 4Q8KA 2V72A 1B09A 4N53C 1DYOA 4RA0A 1CAXA 2XBO1 2IFWA 2WYSA 4M0HA 5B4XA 3RPQA 5DAPA 3D5OA 1KDKA 5FZ9A 5FY8A 1V9U2 3OSDA 3VB9A 4QB2A 4BIOA 4QXHA 1NOVA 4W6YA 1XRUA 2ZZJA 4YW5A 5J3UA 2ZGSA 2MHFA 4HFSA 2BTVC 2CYFA 5FPBA 3JBG1 5FJHA 4ISQA 1VRBA 2XJSA 5AFBA 1U12A 3WQ0A 2WZR3 1MZ5A 1V00A 4QPIC 3ZSJA 2B8MA 5C9AB 3ZR5A 4P5HA 1ZNPA 2BPA2 1HQLA 2WT0A 3UGGA 4Z2WA 1JZ7A 4NJ4A 1TEIA 1W6MA 2E31A 4LKSA 4SLIA 4C0HA 1COV3 1RUF3 2VBBA 1QKQA 3T2OA 4CEWC 3MLKA 3PUIA 4OULA 4NPMA 4ZXEA 1LESA
chains in the Genus database with same CATH topology
1ULPA 3CZUA 2X10A 2QBXA 4A4AA 1US3A 1XNTA 4A6OA 1JZ2A 1YQ2A 1JHJA 3MUY1 4QDQA 3HPNA 1PX4A 3I2JA 2V5DA 4W8JA 1R64A 3MO4A 4DUXA 4JX0A 4LHSA 4E8CA 5IFPA 3WNKA 1EUTA 2VZ1A 1CZSA 2Y6JA 5G04L 2WN2A 2WZEA 4P08A 5LCWL 1LNSA 2YC4A 2W47A 2CDOA 4OYUA 3NJXA 4BK5A 1IQDC 3ACIA 3GGLA 4CU6A 1GU3A 1F4AA 2VZ3A 2X05A 3THDA 3GXUA 2J1UA 1L7RA 2J22A 4XUPA 3PUHA 3T08A 3ECQA 4XUNA 1W9WA 5IJRA 3IDAA 4LQRA 3DYOA 2VO5A 5JXHA 1OH4A 4RYDA 2W92A 4KWUA 3WEZA 2C26A 3VD4A 1OF3A 2Y6KA 5HPOA 3C7EA 4XUQA 1KEXA 2XOMA 4BJ0A 4MGQA 2W1QA 3I2KA 1JYWA 5FUIA 2VZSA 3E1F1 3HOBA 2W1UA 3NRUA 4XURA 2EIDA 4UI9L 2Y6LA 1UY1A 4GWJA 2W3JA 2QQIA 3I3BA 3WNMA 3MV01 4ZZ5A 4KI5M 1JYVA 2W1SA 2X09A 4A42A 3LE0A 3WF0A 2VZTA 2VZQA 3DECA 2RJ2A 3W5MA 3A23A 5CYYA 2VCCA 1UXXX 3C7HA 3I2FA 1UMIA 3U37A 3OGVA 1UY0A 3FL7A 2DDUA 3A22A 5JXIA 2V4VA 4A44A 2ZEZA 3I2GA 4RN5A 1PMHX 3CKHA 4MO3M 2VMCA 4QX3A 4D8MA 4ARXA 1UY3A 4GZ9A 1UYZA 3K4ZA 3K4AA 3MV11 5I0DA 3BN6A 4UOJA 1W9TA 1CIYA 2WZ8A 2VZPA 1NAEA 4QAWA 2E32A 3IAQA 4LPLA 1I5PA 2BZDA 1UY4A 2VMEA 2ZEYA 1NUKA 3BGAA 4L0PA 2J1SA 1O8SA 4PF1A 2W46A 3D3AA 3CDZB 4QX2A 4XVHA 4ZZ8A 1NX9A 2YFUA 4OMDA 4P00B 1JZ6A 4A41A 4HG6B 1T2XA 2DCKA 1JZ3A 2YFZA 1TG7A 1UYYA 3VD9A 3LEIA 1JU3A 2W5FA 4W4ZA 1GUIA 3DYMA 1DLCA 2ORXA 2RVAA 2EIEA 2BGOA 3WF1A 1KGYA 4M4PA 2VQUA 2Y8KA 4P02B 3EB7A 2QQJA 5LA1A 3LEGA 3OEBA 3WNOA 2ID4A 2W1WA 2WQ8A 1K45A 2C9KA 1CZTA 3SKVA 4TXWA 3HJRA 1TVGA 3WF2A 5C71A 5IHRA 2WABA 4W50A 1SHWB 1JYXA 3VD7A 3ZM8A 2J1VA 3OB8A 3J7HA 4CU7A 4JKMA 2JD9A 2LW8A 1NKGA 2R7EB 4QDRA 3T0BA 4JKKA 3UESA 3F2ZA 3W5NA 3ACFA 3I2IA 3ETPA 3UETA 2ORZA 3HEIA 1UZ0A 2VZUA 1BHGA 2JKXA 1OF4A 2WO1A 4JKLA 5JXGA 2J7MA 3GDBA 4PT6A 2QQOA 2B4KA 5DQ0A 3HNYM 2WN3A 1GOFA 2XONA 3OGRA 2VJXA 5G05L 2VCAA 3CIHA 2WBKA 5LA0A 2VQTA 4IUGA 3P6BA 3VDAA 1F4HA 2VMFA 1W0NA 1GNYA 5DMYA 3CMGA 1XC6A 3A21A 1W99A 3WNLA 2W9XA 2EIBA 4YPJA 2ZXQA 1UXZA 3T2PA 1H6YA 1OT5A 1DP0A 4OZOA 2L9LA 2W87A 2Y6HA 4UAPA 5C7GA 5B4NA 3SKJE 4D0QA 1SG3A 4KMQA 3THCA 2RV9A 1CX1A 3K75B 5JXJA 3HN3A 3I2HA 5EJZB 3WNPA 1JZ5A 1UWWA 4TTGA 3K4DA 2WAAA 3C8XA 3T2QA 1HN1A 4A45A 4PQQA 2VC9A 5LA2A 3P1IA 3JXSA 1P8JA 4DEQA 4OUEA 5HXMA 3WF4A 2YC2A 2XHNA 4ET7A 3AC0A 2HLEA 3SEEA 4DXTA 4MADA 3HNBM 3ACHA 1GOGA 3CZJA 5A1AA 4DUVA 3ACGA 1H6XA 2VL4A 4DXSA 1JYNA 3LPGA 4JHZA 4XUTA 1PMJX 4QX1A 1W8OA 4CUBA 1WKYA 4QPWA 1JZ4A 1K42A 2Y6GA 2VZVA 2WDBA 3LEKA 4XUOA 3NQHA 2W91A 5EIYB 3EYPA 3WF3A 1CZVA 1UYXA 2OKXA 2VZRA 4QX0A 3OEAA 3DYPA 3VDCA 2QQKA 4CVUA 2VMDA 4BK4A 2J1TA 5IYYA 3C7FA 2BBAA 3HNMA 1UMHA 2VTFA 1MPXA 3IB3A 2ZEXA 2YB7A 3ABZA 5C70A 5JR2A 5J1XA 1W8NA 2WO3A 1ULOA 2BERA 1OD3A 3GM8A 2J1AA 2QQNA 2Z4FA 2W95A 2E33A 1K12A 1J84A 3LPFA 1D7PM 4DUWA 2WUHA 2EICA 3T0DA 4GWIA 3SEPA 4QDSA 1UY2A 2VZOA 4XZUG 3MBWA 2E26A 4DEVA 4BXSV 1US2A 2BGPA 3WSOA 1J83A 3FHQA 4BDVB 3OGSA 3NJVA 2KD7A 2XQXA 3UNPA 1JU4A 3VD5A 3FHAA 2VOTA 2CDPA 4CUAA 2ZEWA 2HYXA 2W94A 5JMOA 3C7OA 4ZY9A 4CU8A 5CZKA 3C7GA 4OMCA 3OG2A 3T0AA 4P5YA 3CQOA 2WAOA 4A3ZA 2LS6A 1JI6A 1O59A 3I97A 3I3DA 2B9VA 1O8PA 4FI9A 4QB6A 4ZXEA 1RYYA 2VCBA 2DCJA 1K3IA 1EUUA 1GOHA 4MGSA 2VM9A 3LQCA 4DXRA 2J1EA 2J1RA 2JE8A 3WNNA 5JUVA 5DN2A 3FN9A 4AG4A 1W9SA 1L7QA 5EJ1B 2WO2A 3IAPA 1GMMA 3T09A 3NNGA 1SDDB 2VR4A 1XPWA 5IFTA 2QQMA 3I3EA 1GQPA 1PX3A 2V72A 1DYOA 2C4XA 4AAXA 1WCQA 2WYSA 4QB1A 5B4XA 4QB2A 2JDAA 3VD3A 4CU9A 3MUZ1 3IIIA 2Y64A 4E8DA 2YG0A 5DPNA 3WQBA 3K77A 2QQLA 1JZ7A 4ARYA 3OBAA 4CUCA 3VDBA 3K46A 1XNAA 2E31A 4LKSA 4MOAA 4M4RA 5F7UA 3T2OA 3PUIA 1JZ8A 1UX7A 3A7QA 4Z2AA 2PQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULP A;  3CZU A;  2X10 A;  2QBX A;  4A4A A;  1US3 A;  1XNT A;  4A6O A;  1JZ2 A;  1YQ2 A;  1JHJ A;  3MUY 1;  4QDQ A;  3HPN A;  1PX4 A;  3I2J A;  2V5D A;  4W8J A;  1R64 A;  3MO4 A;  4DUX A;  4JX0 A;  4LHS A;  4E8C A;  5IFP A;  3WNK A;  1EUT A;  2VZ1 A;  1CZS A;  2Y6J A;  5G04 L;  2WN2 A;  2WZE A;  4P08 A;  5LCW L;  1LNS A;  2YC4 A;  2W47 A;  2CDO A;  4OYU A;  3NJX A;  4BK5 A;  1IQD C;  3ACI A;  3GGL A;  4CU6 A;  1GU3 A;  1F4A A;  2VZ3 A;  2X05 A;  3THD A;  3GXU A;  2J1U A;  1L7R A;  2J22 A;  4XUP A;  3PUH A;  3T08 A;  3ECQ A;  4XUN A;  1W9W A;  5IJR A;  3IDA A;  4LQR A;  3DYO A;  2VO5 A;  5JXH A;  1OH4 A;  4RYD A;  2W92 A;  4KWU A;  3WEZ A;  2C26 A;  3VD4 A;  1OF3 A;  2Y6K A;  5HPO A;  3C7E A;  4XUQ A;  1KEX A;  2XOM A;  4BJ0 A;  4MGQ A;  2W1Q A;  3I2K A;  1JYW A;  5FUI A;  2VZS A;  3E1F 1;  3HOB A;  2W1U A;  3NRU A;  4XUR A;  2EID A;  4UI9 L;  2Y6L A;  1UY1 A;  4GWJ A;  2W3J A;  2QQI A;  3I3B A;  3WNM A;  3MV0 1;  4ZZ5 A;  4KI5 M;  1JYV A;  2W1S A;  2X09 A;  4A42 A;  3LE0 A;  3WF0 A;  2VZT A;  2VZQ A;  3DEC A;  2RJ2 A;  3W5M A;  3A23 A;  5CYY A;  2VCC A;  1UXX X;  3C7H A;  3I2F A;  1UMI A;  3U37 A;  3OGV A;  1UY0 A;  3FL7 A;  2DDU A;  3A22 A;  5JXI A;  2V4V A;  4A44 A;  2ZEZ A;  3I2G A;  4RN5 A;  1PMH X;  3CKH A;  4MO3 M;  2VMC A;  4QX3 A;  4D8M A;  4ARX A;  1UY3 A;  4GZ9 A;  1UYZ A;  3K4Z A;  3K4A A;  3MV1 1;  5I0D A;  3BN6 A;  4UOJ A;  1W9T A;  1CIY A;  2WZ8 A;  2VZP A;  1NAE A;  4QAW A;  2E32 A;  3IAQ A;  4LPL A;  1I5P A;  2BZD A;  1UY4 A;  2VME A;  2ZEY A;  1NUK A;  3BGA A;  4L0P A;  2J1S A;  1O8S A;  4PF1 A;  2W46 A;  3D3A A;  3CDZ B;  4QX2 A;  4XVH A;  4ZZ8 A;  1NX9 A;  2YFU A;  4OMD A;  4P00 B;  1JZ6 A;  4A41 A;  4HG6 B;  1T2X A;  2DCK A;  1JZ3 A;  2YFZ A;  1TG7 A;  1UYY A;  3VD9 A;  3LEI A;  1JU3 A;  2W5F A;  4W4Z A;  1GUI A;  3DYM A;  1DLC A;  2ORX A;  2RVA A;  2EIE A;  2BGO A;  3WF1 A;  1KGY A;  4M4P A;  2VQU A;  2Y8K A;  4P02 B;  3EB7 A;  2QQJ A;  5LA1 A;  3LEG A;  3OEB A;  3WNO A;  2ID4 A;  2W1W A;  2WQ8 A;  1K45 A;  2C9K A;  1CZT A;  3SKV A;  4TXW A;  3HJR A;  1TVG A;  3WF2 A;  5C71 A;  5IHR A;  2WAB A;  4W50 A;  1SHW B;  1JYX A;  3VD7 A;  3ZM8 A;  2J1V A;  3OB8 A;  3J7H A;  4CU7 A;  4JKM A;  2JD9 A;  2LW8 A;  1NKG A;  2R7E B;  4QDR A;  3T0B A;  4JKK A;  3UES A;  3F2Z A;  3W5N A;  3ACF A;  3I2I A;  3ETP A;  3UET A;  2ORZ A;  3HEI A;  1UZ0 A;  2VZU A;  1BHG A;  2JKX A;  1OF4 A;  2WO1 A;  4JKL A;  5JXG A;  2J7M A;  3GDB A;  4PT6 A;  2QQO A;  2B4K A;  5DQ0 A;  3HNY M;  2WN3 A;  1GOF A;  2XON A;  3OGR A;  2VJX A;  5G05 L;  2VCA A;  3CIH A;  2WBK A;  5LA0 A;  2VQT A;  4IUG A;  3P6B A;  3VDA A;  1F4H A;  2VMF A;  1W0N A;  1GNY A;  5DMY A;  3CMG A;  1XC6 A;  3A21 A;  1W99 A;  3WNL A;  2W9X A;  2EIB A;  4YPJ A;  2ZXQ A;  1UXZ A;  3T2P A;  1H6Y A;  1OT5 A;  1DP0 A;  4OZO A;  2L9L A;  2W87 A;  2Y6H A;  4UAP A;  5C7G A;  5B4N A;  3SKJ E;  4D0Q A;  1SG3 A;  4KMQ A;  3THC A;  2RV9 A;  1CX1 A;  3K75 B;  5JXJ A;  3HN3 A;  3I2H A;  5EJZ B;  3WNP A;  1JZ5 A;  1UWW A;  4TTG A;  3K4D A;  2WAA A;  3C8X A;  3T2Q A;  1HN1 A;  4A45 A;  4PQQ A;  2VC9 A;  5LA2 A;  3P1I A;  3JXS A;  1P8J A;  4DEQ A;  4OUE A;  5HXM A;  3WF4 A;  2YC2 A;  2XHN A;  4ET7 A;  3AC0 A;  2HLE A;  3SEE A;  4DXT A;  4MAD A;  3HNB M;  3ACH A;  1GOG A;  3CZJ A;  5A1A A;  4DUV A;  3ACG A;  1H6X A;  2VL4 A;  4DXS A;  1JYN A;  3LPG A;  4JHZ A;  4XUT A;  1PMJ X;  4QX1 A;  1W8O A;  4CUB A;  1WKY A;  4QPW A;  1JZ4 A;  1K42 A;  2Y6G A;  2VZV A;  2WDB A;  3LEK A;  4XUO A;  3NQH A;  2W91 A;  5EIY B;  3EYP A;  3WF3 A;  1CZV A;  1UYX A;  2OKX A;  2VZR A;  4QX0 A;  3OEA A;  3DYP A;  3VDC A;  2QQK A;  4CVU A;  2VMD A;  4BK4 A;  2J1T A;  5IYY A;  3C7F A;  2BBA A;  3HNM A;  1UMH A;  2VTF A;  1MPX A;  3IB3 A;  2ZEX A;  2YB7 A;  3ABZ A;  5C70 A;  5JR2 A;  5J1X A;  1W8N A;  2WO3 A;  1ULO A;  2BER A;  1OD3 A;  3GM8 A;  2J1A A;  2QQN A;  2Z4F A;  2W95 A;  2E33 A;  1K12 A;  1J84 A;  3LPF A;  1D7P M;  4DUW A;  2WUH A;  2EIC A;  3T0D A;  4GWI A;  3SEP A;  4QDS A;  1UY2 A;  2VZO A;  4XZU G;  3MBW A;  2E26 A;  4DEV A;  4BXS V;  1US2 A;  2BGP A;  3WSO A;  1J83 A;  3FHQ A;  4BDV B;  3OGS A;  3NJV A;  2KD7 A;  2XQX A;  3UNP A;  1JU4 A;  3VD5 A;  3FHA A;  2VOT A;  2CDP A;  4CUA A;  2ZEW A;  2HYX A;  2W94 A;  5JMO A;  3C7O A;  4ZY9 A;  4CU8 A;  5CZK A;  3C7G A;  4OMC A;  3OG2 A;  3T0A A;  4P5Y A;  3CQO A;  2WAO A;  4A3Z A;  2LS6 A;  1JI6 A;  1O59 A;  3I97 A;  3I3D A;  2B9V A;  1O8P A;  4FI9 A;  4QB6 A;  4ZXE A;  1RYY A;  2VCB A;  2DCJ A;  1K3I A;  1EUU A;  1GOH A;  4MGS A;  2VM9 A;  3LQC A;  4DXR A;  2J1E A;  2J1R A;  2JE8 A;  3WNN A;  5JUV A;  5DN2 A;  3FN9 A;  4AG4 A;  1W9S A;  1L7Q A;  5EJ1 B;  2WO2 A;  3IAP A;  1GMM A;  3T09 A;  3NNG A;  1SDD B;  2VR4 A;  1XPW A;  5IFT A;  2QQM A;  3I3E A;  1GQP A;  1PX3 A;  2V72 A;  1DYO A;  2C4X A;  4AAX A;  1WCQ A;  2WYS A;  4QB1 A;  5B4X A;  4QB2 A;  2JDA A;  3VD3 A;  4CU9 A;  3MUZ 1;  3III A;  2Y64 A;  4E8D A;  2YG0 A;  5DPN A;  3WQB A;  3K77 A;  2QQL A;  1JZ7 A;  4ARY A;  3OBA A;  4CUC A;  3VDB A;  3K46 A;  1XNA A;  2E31 A;  4LKS A;  4MOA A;  4M4R A;  5F7U A;  3T2O A;  3PUI A;  1JZ8 A;  1UX7 A;  3A7Q A;  4Z2A A;  2PQS A; 
#chains in the Genus database with same CATH topology
 4N7U A;  4FO9 A;  1ULP A;  4CXY A;  2D5F A;  1VLN A;  3AZZ A;  1US3 A;  3WG4 A;  1UPI A;  4HKW A;  5EHD A;  2D6O X;  4XFI A;  2ZGT A;  1UZV A;  3NV3 A;  4YRD A;  1YQ2 A;  3DF0 A;  3KS7 A;  4UW6 A;  1JHJ A;  5FXW A;  1N1Y A;  4LBL A;  1WGP A;  3M1H A;  1PK6 B;  4XAC A;  4AI3 A;  3AYD A;  4AEJ A;  4QT6 A;  2ZX0 A;  2XBO 3;  2NQY A;  2LAL A;  3I2J A;  4PI0 A;  2V5D A;  3ASI A;  4QM8 A;  1SBD A;  4YVW A;  3O1O A;  4QWN A;  4LHS A;  1EUT A;  4YVS B;  4OI0 A;  5IVC A;  3LEM A;  4P9W A;  2FDF A;  1SLA A;  3AKS A;  4U2A A;  1GQG A;  4LR4 A;  5FZ3 A;  2WN2 A;  2WZE A;  1W2T A;  4K1Y A;  1QJY 2;  4HK8 A;  2GH8 A;  4UFH A;  1KS5 A;  4OUM A;  5FZO B;  3RJR A;  3ZIW A;  1W2U A;  3ZKU A;  3PIG A;  2XUE A;  4LEJ A;  3E5Q A;  2DVA A;  1W6Q B;  4X6R B;  3UJO A;  5FV3 A;  4BU2 A;  3VBH B;  3N4M A;  3GGL A;  4CE8 A;  5KHH A;  1WLD A;  1GU3 A;  1ENQ A;  3THD A;  2I07 B;  2JG8 A;  3R4D B;  1DGL A;  1PGS A;  1RUG 3;  4C91 A;  3O1S A;  2BU9 A;  4LKF A;  5F9T A;  1GKB A;  2JG9 B;  3THT A;  5A3L A;  4OHZ A;  3JCI A;  1E57 A;  3LDB A;  4LQR A;  4NRO A;  3W20 A;  2C24 A;  2VO5 A;  5IK4 A;  5EXO A;  5LRR A;  3IPV A;  4LO5 B;  2GND A;  3POJ A;  4KU8 A;  4MGI E;  3AK0 A;  3WEZ A;  1IQA A;  1SQ4 A;  4FPO B;  2GC0 A;  4NHL A;  1OLM A;  1YFY A;  4XF9 A;  1KQR A;  3H3L A;  3SXW A;  1M4W A;  3CL1 A;  1OOP B;  3ES4 A;  4HKL A;  4BJ0 A;  1BBT 3;  5FUN A;  1GAN A;  1VBB 3;  3BVC A;  3NWK A;  3RFR A;  3ZYF A;  3ZFF A;  2W1Q A;  3JB8 A;  4FFF A;  1HB3 A;  4CYD A;  3C3V A;  5CAD A;  5FYT A;  1IPK A;  3HOB A;  3H42 B;  4U36 A;  1W8T A;  1VBA 1;  1CIW A;  2EID A;  3BIW E;  3I4I A;  5A33 A;  5CAZ A;  2Y6L A;  1UY1 A;  4GWJ A;  1WW4 A;  5FZA A;  3N7M A;  4FFG A;  2ZGK A;  3DPR C;  3MIE A;  4ASK A;  3U0Z A;  2RR1 1;  4KI5 M;  4ZZ5 A;  1DYK A;  5LY1 A;  1JYT A;  4A42 A;  1PO2 2;  3LE0 A;  1Z7S 1;  2C1F A;  4M3C A;  4V1P A;  4HVQ A;  1QJU 2;  5EWS A;  4QGN A;  4TYS A;  1AXY A;  2BV4 A;  3T4V A;  1AR7 2;  3KHC A;  3A23 A;  4JRL A;  1ZA7 A;  5CYY A;  3PU3 A;  4QKF A;  3V65 A;  4BYY A;  2HJI A;  3AZX A;  4Q4Y 3;  4JV4 A;  2HWB 1;  4WVZ A;  2VE1 A;  5DUX A;  5F6K A;  2VOW A;  3C7H A;  2G19 A;  3AX4 A;  3U37 A;  1H8T C;  2VVF A;  4LMF A;  5FYH A;  4LTA A;  2GAL A;  1CJP A;  1SDW A;  2DDU A;  2VMI A;  4UW4 A;  1XYP A;  1RVF 1;  5GZF A;  3VHO A;  1CAV A;  2H6B A;  4NRM A;  5DAQ A;  1D0G A;  5ABJ A;  5IAX A;  5DUU A;  3MIF A;  1J3Q A;  3TN9 2;  3ILF A;  1FMD 3;  1K5M C;  3I2G A;  2VBP A;  4RN5 A;  1VBA 3;  2BRT A;  1UAI A;  5ERL A;  5E16 A;  1JN2 P;  1FAY A;  1N3P A;  4A7K A;  1ULE A;  3H1Y A;  2VMC A;  4MO3 M;  4QX3 A;  3ZFE A;  3ZYJ B;  4CP0 A;  1AR9 3;  4CEY C;  1OFN A;  1BQP A;  1ZBA 3;  4J6G A;  5T5L A;  3OD4 A;  2DVG A;  3HQX A;  2EAL A;  2RR1 3;  2VOX A;  3O1V A;  5F5Q A;  3TAY A;  2PLV 2;  5E89 A;  4GIQ A;  1T6G C;  2WQZ C;  3I59 A;  2EIG A;  2PEL A;  4Y4Y A;  3RWN A;  5FZ6 A;  4ITC A;  5FYM A;  3WOG A;  3RNS A;  3B02 A;  3JQW A;  4ZS2 A;  1RJ7 A;  1N1V A;  1XNK A;  3IDE A;  2CSG A;  4Q2F A;  4BHP A;  1I9R A;  1FV3 A;  2J42 A;  3AXD A;  3DXT A;  2D3S A;  4KU7 A;  1GQH A;  3NL1 A;  1UY4 A;  3FFZ A;  1QY4 A;  5IK5 A;  2RG4 A;  1RUE 3;  1AJK A;  3OUJ A;  1O8S A;  3JU9 A;  3CEW A;  1LUL A;  3ACL A;  4PQ9 A;  1URX A;  5FMB A;  1SLT A;  5IVY A;  3RQ0 A;  1V6I A;  4UWD A;  4YW3 A;  4ZZ8 A;  1KDM A;  1W8H A;  4UF0 A;  1QJX 2;  2YFU A;  3LZZ A;  1GR3 A;  4NIA A;  3ZDS A;  4E2Q A;  4P00 B;  4I3P A;  5CBL A;  1E5H A;  3VBS C;  4A41 A;  2TUN A;  4Y1Y A;  3H8R A;  3AP4 A;  4AQ6 A;  5FBJ A;  3NKG A;  4RGA A;  5C5T A;  3GJA A;  3FUO A;  3VD9 A;  3WHU A;  5BUV A;  2YC0 A;  5BY5 A;  4IEU A;  1ND3 C;  2W5F A;  2Z5W A;  4W4Z A;  3SMH A;  2RVA A;  4WM7 C;  4JHT A;  4FSJ A;  2DU1 A;  2B9U A;  1WW7 A;  2AR6 A;  4GA9 A;  3H1W A;  3WF1 A;  4H7M A;  1KGY A;  2WRA A;  3KF5 A;  4M4P A;  3WHT A;  1ZZB A;  1X50 A;  5D2A A;  4IGQ A;  3AKT A;  2VNO A;  4P02 B;  5CIR A;  2R49 A;  3B00 A;  2OS2 A;  3M3E A;  3KSC A;  2JWP A;  4CDW B;  4XIL A;  2QQJ A;  5LA1 A;  1V6J A;  2XH6 A;  3H1M A;  4XCA A;  1PO1 1;  2MEV 1;  5T5O A;  4DOU A;  1U5I A;  1VMJ A;  4AHZ A;  2W1W A;  3OUH A;  3KVA A;  4URT A;  4XF3 A;  5CEH A;  1UZY A;  1POV 1;  5KC6 A;  3WF2 A;  2PN5 A;  4Y5S A;  4Y1U A;  2Q8E A;  5C71 A;  5IHR A;  1KD7 A;  2AZ5 A;  5L36 A;  2WAB A;  1YWK A;  4CCN A;  1SHW B;  3VHR A;  3QAC A;  2JE7 A;  3DPR A;  5C9A C;  3ZM8 A;  4FAG A;  3TOJ A;  1EAH 2;  3JD7 2;  3M70 A;  4KWL A;  5EJ3 A;  5A70 A;  2NYY A;  2OT7 A;  2VOK A;  3ST7 A;  4NPL A;  3OB8 A;  3FX3 A;  1DQ4 A;  1AYN 3;  4XIO A;  1UF2 C;  3KHB A;  1AL2 2;  1W3V A;  4W65 A;  5GZC A;  2QZ2 A;  5DAV A;  2XJT A;  2R7E B;  3T0B A;  3ZXD A;  4ZXK A;  3QLQ A;  4BMB A;  2UY9 A;  5CIS A;  3AMP A;  4AVB A;  3OF1 A;  3ACF A;  2P2K A;  1MEC 2;  3AP5 A;  3L2Y A;  1JS9 A;  4WVM B;  1PK6 C;  3AP9 A;  1TNF A;  4K6B A;  3DKW A;  3F95 A;  4YLZ A;  1WW6 A;  2CY6 A;  3D82 A;  3GBW A;  4E2G A;  2R04 3;  2WSV A;  1ND2 A;  1S0B A;  5JPN B;  4QQP A;  5HV4 A;  4P9X A;  1UCX A;  1RUH 3;  1SAC A;  4YVS C;  4HK9 A;  5LBB A;  4RFT 0;  1UYP A;  4FOY A;  4EV0 A;  1K5M A;  2J7M A;  1W0O A;  2QJV A;  3GDB A;  2QQO A;  5FRA A;  1LHW A;  3HNY M;  4JDO A;  5DZF A;  4LOR A;  3VDD B;  4DFS A;  4RR3 B;  1ASJ 1;  1GOF A;  2OA2 A;  2DF7 A;  4CCM A;  3OGR A;  2W39 A;  1YUD A;  4XQW A;  5FYC A;  5G05 L;  4B1L A;  4CEY A;  4CSW A;  1SFN A;  3NAP B;  5F8P A;  1F5F A;  2HWC 3;  1PMI A;  1RUJ 2;  1WMF A;  2O0O A;  4YM2 A;  4F83 A;  4MET A;  1W6N B;  2WQ4 A;  4JDN A;  3VBH C;  3VBF B;  3MDP A;  3S5Q A;  3U1X A;  3MGU A;  2A71 A;  2VMF A;  4Q5O A;  2HWE 2;  2RJL A;  3JQX A;  2KM2 A;  5FAX A;  1VBC 2;  3ZPO A;  4AVT A;  1SLI A;  2V73 A;  2JG9 C;  3Q8A A;  2E7T A;  1GNY A;  3IN9 A;  4I0B A;  3CMG A;  3BTY A;  1XC6 A;  3MFC A;  4LOT A;  3RRD A;  1W99 A;  3V0A B;  1NXD 1;  2EIB A;  2ZXQ A;  4P9I A;  2P6C A;  1POV 0;  1YIP A;  3EJK A;  2OXB A;  2I2S A;  2W87 A;  4R4X A;  1DG6 A;  5C4W B;  5C5U A;  4EZH A;  2Y6H A;  4PDW A;  2ZJC A;  4XAE A;  5C7G A;  5GLT A;  5B4N A;  3ZN6 A;  1G9F A;  4D0Q A;  1FV2 A;  1OOP C;  1SG3 A;  1W8U A;  3K75 B;  1APN A;  3OJB A;  3RZG A;  5CG8 A;  4NIG A;  2A6Y A;  4MZU A;  3WNP A;  1JZ5 A;  5GZE A;  2Q5T A;  1S0G A;  5FO7 B;  3J8F 2;  4MYE A;  5L73 A;  3WW2 A;  3O0W A;  2AEY A;  3Q8F A;  2Y34 A;  1HN1 A;  1C1L A;  1NQJ A;  5FLH A;  4A45 A;  3KV5 A;  5LZ6 A;  1LJ7 A;  1ND3 A;  2JJ6 A;  2VY0 A;  3B9C A;  2E9Q A;  4A3X A;  1RB8 G;  4GMP 0;  4LA2 A;  3M4F A;  2BYV E;  4AVA A;  1XE7 A;  4LK7 A;  1H4H A;  3JXS A;  3LGR A;  2PHR A;  4XET A;  3MID A;  2YC2 A;  2XHN A;  2NZ9 A;  2VCM A;  3WF4 A;  5IW0 A;  2IXH A;  3POE A;  4ONU A;  3K3O A;  3KQ4 B;  3SEE A;  2BJS A;  1X7N A;  4B8E A;  3GZU C;  4MAD A;  3HNB M;  1LGB A;  4H7L A;  3A4U A;  2D6M A;  2HWD 3;  5FKB A;  1YYN A;  5JDB A;  2P17 A;  3ACG A;  3OY8 B;  2CGO A;  3H8X A;  1GZ9 A;  2BOI A;  4XUT A;  4FCA A;  1PIV 2;  5ANN A;  4WBB A;  1CVN A;  3RGB A;  1WKY A;  1Y9M A;  3MLJ A;  5F32 A;  2QZ3 A;  1K42 A;  2R06 1;  4I2O A;  2VNG A;  2Y6G A;  2QKD A;  1WD4 A;  1SFP A;  5FPZ A;  2UU8 A;  4QPY A;  1LOG A;  1TMF 1;  3LEK A;  3KT1 A;  4FPF A;  1FNY A;  2E7Q A;  5L9B A;  1XU2 A;  3EYP A;  3WF3 A;  1XXN A;  2P3Y A;  3IM0 A;  5FZM A;  2YUE A;  4AQT A;  5KHK A;  1S2K A;  4YM3 A;  1R09 1;  5FPX A;  1H9W A;  3FLR A;  4QX0 A;  3DYP A;  2JDH A;  4NIH A;  2VMD A;  2EXK A;  1HRI 1;  2XUM A;  3KQR A;  1ZM1 A;  5A1L A;  5IYY A;  4I09 A;  4CDX B;  1QJF A;  5CA6 A;  1WCU A;  1UMH A;  3R4S A;  3TEY A;  2OZJ A;  2VTF A;  5EYY A;  1QGL A;  4BZ4 A;  1YO8 A;  2KA3 A;  3KV6 A;  1LCL A;  5JPM B;  3GBF A;  4IE5 A;  5C3R A;  3AP7 A;  1PGW 2;  2CAU A;  5F2W A;  3VL8 A;  4BWO A;  5T50 A;  4CP2 A;  1NE6 A;  3VLB B;  3ZXJ A;  4FT8 A;  4M00 A;  4EN9 B;  5F3G A;  5J1X A;  1DZQ A;  2J1A A;  2JIG A;  2Z4F A;  5DAX A;  5I8T A;  1J84 A;  1D7P M;  2RS3 1;  1AR6 2;  5FZO A;  4DUW A;  2WUH A;  5IK7 A;  2EIC A;  4IQP A;  4XMA A;  5FYS A;  1FX5 A;  4GWI A;  5A3M A;  3RZZ A;  2JEM A;  5K8S A;  1LOF A;  2Q0A A;  1UOG A;  2VZO A;  4Z1V A;  2LRP A;  4LO6 B;  5J09 A;  3SC7 X;  5K0U B;  2E26 A;  4AI9 A;  2VNV A;  4BXS V;  1CAW A;  2BGP A;  2TNF A;  3ZN5 A;  1W9F A;  3NJV A;  4HPK B;  1RUC 1;  2ZHK A;  3AZW A;  2Z69 A;  4LA3 A;  3PDQ A;  5E88 A;  2XVG A;  4YNI A;  2QQU A;  2RM2 3;  2AUY A;  1QJU 3;  4J1X A;  4QQH A;  5KXE A;  2CDP A;  3B94 A;  1ZZ7 A;  1RJ8 A;  1SMV A;  5FYZ A;  1WBF A;  4BME A;  4UFM A;  4Q4W 1;  3MW4 A;  3SH3 A;  5JMO A;  2C6S A;  2RS1 1;  3V0B B;  2ARE A;  2D98 A;  4JCK A;  1UPS A;  4OHV A;  4DS0 A;  3C7G A;  1O91 A;  4CDW C;  1K5J A;  3GHN A;  1OOP A;  1RGS A;  1J1L A;  4IEO A;  1YJL A;  4CDU B;  4LO7 A;  2B39 A;  3NO8 A;  1JI6 A;  4C0B A;  1O59 A;  3I3D A;  2YDE A;  1OBN A;  4FI9 A;  2B46 X;  3TN9 3;  4GJZ A;  2RS3 3;  4HL0 A;  3O1U A;  4F3J A;  1S4C A;  3ZYG A;  1EUU A;  1LEC A;  1UNB A;  2ARA A;  2ZGQ A;  5FK8 A;  3ZIX A;  3ZPY A;  5CFD A;  4AFA A;  2DUP A;  2GSY A;  5LB6 A;  5FO9 B;  4DXR A;  2J1E A;  4AFM A;  2FDG A;  3KGL A;  3UKV A;  1Y43 B;  2JE8 A;  1N1T A;  3IDC B;  3WP5 A;  3K3N A;  2WWU A;  5LW9 A;  2GC3 A;  1B35 A;  3M7A A;  5EJ1 B;  3CBN A;  1R08 3;  4FQ4 A;  2AYH A;  4WM8 B;  5FBZ A;  1VE0 A;  3N9M A;  2E53 A;  1SDD B;  3NV4 A;  4QGM A;  5C3Q A;  1GFF 2;  1XPW A;  5FZ4 A;  1YHF A;  3H8O A;  3AB0 A;  3OYW B;  1AX2 A;  3I3E A;  1TME 3;  4Q4X 2;  4JGY A;  2C4X A;  2XB6 C;  3POS A;  1SBF A;  5FDB A;  1C8M 2;  3M3Q A;  4Y20 B;  5FZ0 A;  4QB1 A;  4RFR B;  5L7O C;  1SLL A;  5F2S A;  3LA2 A;  3WUD A;  5I0R A;  2ZHN A;  3K48 A;  4WZF A;  5BV6 A;  4J1W A;  3RI9 A;  1OXC A;  1FPN 1;  5T55 A;  4QPG B;  4OYU A;  5EFU A;  3VD3 A;  2D40 A;  3EHK A;  1QJX 3;  3III A;  3VDD C;  4RR3 C;  1Q3E A;  4E8D A;  3ZSK A;  1VB2 A;  1RUN A;  5DPN A;  5KBF A;  3WQB A;  1UL9 A;  1UMZ A;  1LOD A;  2QQL A;  3K77 A;  4ARY A;  1GP5 A;  3NAP C;  4I30 A;  1IG3 A;  1HXS 3;  1RUD 3;  4MOA A;  3ITQ A;  4M4R A;  5F7U A;  2WT2 A;  1UW8 A;  4YM0 A;  3VBF C;  1NY7 2;  1IGO A;  3HWJ A;  1Q8S A;  1D4M 2;  2Y0I A;  3ME2 A;  1X33 A;  3U11 A;  1WCD J;  3WZ1 A;  3CZU A;  4QGL A;  5BNP A;  3V64 A;  4XJW A;  5CNA A;  4GXL A;  1MAC A;  1YQ8 A;  4XDP A;  3UK9 A;  4A4A A;  3ILR A;  3JZV A;  5T54 A;  5F3C A;  1AHS A;  1XSR A;  2Q8C A;  3ZSE A;  3ZX7 A;  1O4T A;  1FYU A;  1Z7S 2;  4QQO A;  2F4P A;  3LCP A;  3ZO0 B;  1XOY A;  2ENR A;  1PX4 A;  1UKG A;  1XNC A;  5EQU A;  4XFB A;  5C4W C;  1DGW X;  5C3O A;  4DUX A;  2HWB 2;  3KCC A;  1VR3 A;  5FY9 A;  3GCW A;  4NN0 A;  3CJI A;  1ZRI A;  5H9S A;  2BQP A;  2VZ1 A;  4BH9 A;  4QXK A;  1R1A 3;  1O5L A;  4DRR A;  1OPM A;  4MX3 A;  1VMF A;  2YHJ A;  4S2H A;  5G04 L;  5AC9 3;  5I91 A;  1RVF 2;  4X6Q B;  1G6N A;  1ZBE 2;  2GN7 A;  1OUX A;  5F6L B;  4ZPI A;  1LHN A;  3EMR A;  4YSF A;  2EF6 A;  2VGD A;  4BK5 A;  1IQD C;  1DQ6 A;  2VH9 A;  3CHX A;  4D6R A;  5HCH A;  2JEN A;  1AL2 3;  2ZGN A;  3ACI A;  2JB4 A;  4IEW A;  4AI0 A;  5CFC B;  5BNO B;  1F4A A;  2X05 A;  4G3Y C;  1WW5 A;  2RHP A;  5E8A A;  3H7Y A;  3M2M A;  3UL2 A;  4LOS A;  3WV6 A;  2Y38 A;  1MZ6 A;  4XUN A;  3VBR B;  2D93 A;  5KHI A;  4CCJ A;  2ADE A;  5IJR A;  4OQ8 A;  2ZGO A;  3N7K A;  4Q0U A;  3PVO A;  2FCT A;  4RYD A;  1VAV A;  1V6M A;  1VBE 1;  2OW4 A;  1VRH 1;  2W92 A;  1KS4 A;  4KWU A;  4Y22 B;  5E1R A;  1SPP A;  1PHM A;  1OF3 A;  2VUA A;  3AYE A;  4CP1 A;  5FZG A;  5GLV A;  2GN3 A;  2JDP A;  3E6C C;  3C7E A;  1JOP A;  5FPL A;  5F5A A;  4OI1 A;  4H2A A;  1RHI 2;  1H1I A;  1HQN A;  3HBZ A;  4N43 A;  3L9J T;  1AYM 1;  3I2K A;  2Q1F A;  3SCF A;  2KR2 A;  3I8T A;  3WX5 A;  4EWD A;  1OSG A;  4OQ9 A;  1REF A;  2W1U A;  3JB4 C;  1MZF A;  2EXI A;  2UYB A;  2YU2 A;  3I54 A;  2Y26 A;  4XBN A;  1Q8O A;  2WO7 A;  3I7D A;  3O5S A;  4AQS A;  4FTE A;  2DTW A;  2W3J A;  3B69 A;  3GNE A;  3WNM A;  2I45 A;  2P3I A;  4RQP A;  4YW7 A;  2D3R A;  4XBL A;  4ORF A;  1XND A;  3KCY A;  3POY A;  2X09 A;  4P9L A;  1I3H A;  2YRO A;  3A0N A;  3FHI B;  3PVE A;  5B2G B;  1Q5O A;  1OUR A;  2VZQ A;  3DEC A;  3KZ4 C;  1ALY A;  3N3H A;  3PMS A;  5D21 A;  3DUI A;  2WZR 1;  4X8N A;  2AAC A;  4ZU4 A;  4KNC A;  4CDX C;  5L7O A;  2CNA A;  1MZE A;  3J7M A;  1UN1 A;  3VZO A;  2YZ4 A;  1DQ2 A;  1UXX X;  4JTN A;  3AFK A;  3HIF A;  1O5U A;  3I2F A;  1UMI A;  4Q0P A;  4CP9 B;  5FY7 A;  1COV 1;  1RUF 1;  1UY0 A;  4K21 A;  2WFF 2;  4IEY A;  1HB4 A;  4LE4 A;  2ZMN A;  4FVV A;  4MV2 A;  1HB2 A;  5FZB A;  5DG1 A;  3S6P A;  2FD8 A;  1RMU 2;  2QNK A;  2PAK A;  3A22 A;  1LTE A;  2DUR A;  2MNG A;  3BTX A;  2V4V A;  1W28 A;  4LKE A;  3IZO A;  4FOW A;  3BU7 A;  1YEW A;  3NKT A;  1VPH A;  1BK0 A;  3N9L A;  3OBT A;  2CGN A;  1N3Q A;  1NE4 A;  2JIJ A;  1ENS A;  4BB3 A;  1RUI 3;  1W6N A;  1X36 A;  5K0U C;  1G9A A;  3EXU A;  4Q0V A;  2R16 A;  2BDR A;  4WZC A;  3AMH A;  4MXW A;  2W68 A;  1JW6 A;  3HN1 A;  1UIJ A;  2CWM A;  1ODN A;  2CU5 A;  1UYZ A;  4XJ8 A;  3K4A A;  2LRO A;  3RYR A;  3U4S A;  4P14 A;  5A7P A;  4K9S A;  3WP4 A;  5JSP A;  4LE3 A;  2D44 A;  4AI8 A;  2UUR A;  3KT4 A;  2E63 A;  4QMA A;  3VZK A;  1LHU A;  5D8A A;  4IV3 A;  4FPJ A;  2G9Z A;  4KH9 A;  5L19 A;  4LT5 A;  4JTO A;  2DV9 A;  1H2L A;  3MPB A;  1PZ8 A;  2FDI A;  3OPW A;  4QQ2 A;  1WCS A;  3ZFG B;  4LPL A;  2GC2 A;  5HBA A;  2R32 A;  1I1E A;  2SLI A;  1SZB A;  4CDU C;  1GZC A;  1XU1 A;  2OQ7 A;  1RUG 1;  2PTM A;  2IXI A;  5CKQ A;  3PME A;  3ZMO A;  1LOA A;  3J9S A;  4M01 A;  2W46 A;  4NVP A;  3ZYH A;  4D69 A;  3QOP A;  4QX2 A;  4IES A;  2OII A;  2P3J A;  1FOD 2;  5KC5 A;  5I0S A;  2Y0O A;  4HN1 A;  5GM0 A;  1JZ6 A;  4QKN A;  2Q8D A;  1MQT B;  1ZRD A;  3IKW A;  2DCZ A;  5FJK A;  3SLI A;  1M06 G;  1ASJ 2;  3ZVX A;  4HG6 B;  2DTY A;  1W0P A;  3I3M A;  4DXZ A;  3U4X A;  3NJY A;  4ERO A;  1BBT 1;  1TG7 A;  2ERF A;  1VBB 1;  3LEI A;  4OI2 A;  1EV1 2;  1JU3 A;  4MGT A;  4WM8 C;  3RYK A;  4NID A;  2CGP A;  1LKN A;  2EIE A;  1ZA4 A;  1A6C A;  4RS5 B;  5DDJ 3;  4JGZ B;  3KV4 A;  2W52 A;  1PGL 2;  2Y8K A;  1WA6 X;  4Y5T A;  1U5X A;  5BNN B;  3EB7 A;  1CGP A;  4Q4V 3;  3U78 A;  3IIA A;  4XQD A;  4EZ4 A;  1AZD A;  3LEG A;  3OEB A;  4OCT A;  4CDQ A;  1J59 A;  4IV1 B;  2PHU A;  2ES3 A;  2ETE A;  1QF3 A;  4EN6 B;  2ARB A;  1AR6 3;  2WS9 3;  1CZT A;  4QPG C;  4CXW A;  1W90 A;  1HLC A;  3HJR A;  4CTE A;  3VHP A;  5GZD A;  1G9C A;  1JBC A;  2WNV A;  3Q9O A;  1FI2 A;  5LEK A;  2BWC A;  2ZX4 A;  4LUM A;  4Q4Y 1;  4B7E A;  4TWT A;  5HXV A;  1JYX A;  3FFQ A;  1HIX A;  2WZP P;  1NCR B;  3TWI A;  4URA A;  1UIK A;  2RJK A;  3VD7 A;  2XPJ A;  2J1V A;  3WLU A;  1ULC A;  2NP0 A;  2GU9 A;  1POQ A;  4Q0Q A;  5BPX A;  5T3N A;  2E6V A;  3AXE A;  4YZ4 A;  3R4U A;  4AQ2 A;  4BQ3 A;  4XF1 A;  1GZT A;  2RS5 3;  2ZX1 A;  1LAJ A;  1RXG A;  2G4I A;  4CDX A;  2WNU A;  4Q8L A;  1DZR A;  1QJE A;  1QOT A;  1MS9 A;  1OKO A;  1SLC A;  3NNF A;  4JKK A;  1OD5 A;  4QDR A;  1FMD 1;  3BCW A;  1UD1 A;  4WVW A;  4Z07 A;  3UES A;  3D0S A;  3PUS A;  3W5N A;  4Z82 A;  4BPZ A;  1F2N A;  3R0R A;  3UET A;  5A32 B;  1PM7 A;  2BVB A;  4GH4 B;  3MF9 A;  3BPZ A;  1SCS A;  1AR9 1;  3B3Q E;  5I8S A;  4EWA A;  1ZBA 1;  2OQ6 A;  5FK7 A;  3X29 B;  1QOS A;  1SCR A;  5FOB B;  3LDK A;  2P6H A;  1OF4 A;  2PHD A;  5JMC A;  1S0C A;  2WLQ A;  4RSU A;  2VUC A;  5FYY A;  1JOD A;  1A78 A;  1L7L A;  3D0J A;  1V6K A;  3MIG A;  4MSV A;  4N53 A;  3WUC A;  5DQ0 A;  4NHK A;  1GNH A;  3P3P A;  2JDN A;  1RIR A;  5FZ1 A;  3I2O A;  1JTZ X;  4PLO A;  1F8V A;  2XON A;  2OYZ A;  1QEX A;  1NCQ B;  2VJX A;  1WA4 A;  1UOJ A;  2R06 2;  2WBK A;  1ULD A;  5LA0 A;  4AHW A;  4LBQ A;  4LBN A;  5FXX A;  2BVV A;  2OPK A;  1R1Z A;  4HPK A;  1TMF 2;  1RUE 1;  4RGG A;  5CFC C;  5BNO C;  2B45 X;  3LFI A;  5C3S A;  1E5I A;  2ZPX A;  4QX8 A;  3GZA A;  1NLQ A;  2GMP A;  1EPW A;  4KBB A;  4QPI A;  3VBR C;  5DMY A;  4G9S B;  4NHX A;  4Q4X 3;  1R09 2;  4R4Z A;  5F5I A;  3VL9 A;  2XXZ A;  3A21 A;  3FC0 A;  2WJS A;  2FDH A;  5A3W A;  2VUD A;  5FZK A;  5JLV A;  1ZYB A;  1AF9 A;  1C8M 3;  2TEP A;  4MHU A;  2FZ2 A;  1DP0 A;  2XLA A;  2XVL A;  3MI8 A;  4FPH A;  5LBC A;  4CEW A;  2JIC A;  5JZG B;  3VN4 A;  4NE9 A;  2PHT A;  1LOC A;  3FBY A;  1ENX A;  3PVB B;  4KG0 A;  2UWA A;  4IE4 A;  4AED B;  5FLI A;  2W0X A;  2DUO A;  2AEZ A;  5K7P A;  3THC A;  1J58 A;  2RV9 A;  1CX1 A;  3VBU B;  2YV8 A;  2XL7 A;  1PNF A;  5H9R A;  4D6S A;  4HON A;  4OHW A;  1H2K A;  4R9A A;  4PIZ A;  5EJZ B;  1C57 A;  1OH3 A;  1IHM A;  2FDJ A;  3GCX A;  1O3S A;  3ETQ A;  4YGB A;  4LBJ A;  3GBG A;  1UWW A;  3D8C A;  2P4E A;  2FCU A;  5BXX A;  4LBO A;  4UBH A;  4MGK E;  3VBO B;  1U0A A;  2OX0 A;  2VG9 A;  1QQP 3;  1D4M 3;  1W05 A;  5LA2 A;  1EYB A;  3USU B;  1ZZ6 A;  2DVB A;  4MG2 A;  2A6Z A;  1G86 A;  2ZKN A;  5HXM A;  5FMD A;  5A7W A;  4XJZ A;  1V6N A;  4ET7 A;  3H9A A;  1BEV 3;  2HLE A;  2DCY A;  2X5I B;  2IXK A;  2C0Z A;  3RMY A;  5I0U A;  2VMG A;  4JRA A;  3ZYR A;  3ACH A;  5KXD A;  5ACA 3;  2R07 2;  5FTT C;  2XLG A;  4K1Z A;  4Q4W 2;  1H6X A;  1AYN 1;  1D2S A;  3AJZ A;  3LPG A;  3ZLI A;  1PMJ X;  2Q8O A;  2PAM A;  5FCC A;  4S2D A;  5FP4 A;  4FAH A;  3IDB B;  1ZBE 3;  3BOP A;  4IEP A;  4YZ5 A;  4A7Z A;  1V0A A;  2VZV A;  2PAE A;  4CCO A;  4UFI A;  4NPR A;  3AP6 A;  1BK1 A;  2R04 1;  2TBV A;  2W91 A;  5A3U A;  5J36 A;  1H30 A;  3QH7 A;  1RUH 1;  3LOI A;  2X53 S;  5SV5 A;  2OKX A;  3POB A;  5A7N A;  4HBN A;  5EPA A;  3NJZ A;  1AR8 3;  3OEA A;  1HX6 A;  5JIU A;  2R0F A;  4BK4 A;  2QDN A;  2J1T A;  3KGZ A;  1UQX A;  4PF5 A;  1HRV 2;  2YPJ A;  2BBA A;  3HNM A;  1CAU B;  1MPX A;  4K7J A;  3U10 A;  1DFQ A;  1ODM A;  4LKD A;  4AK3 A;  2DWR A;  2W08 A;  2ZEX A;  4CCD A;  2HWC 1;  2QVS B;  3B9I A;  3AKR A;  4D6Q A;  1CWP A;  3OPT A;  4LO8 A;  4NHY A;  3ZFG C;  2JDU A;  1NXM A;  1GWK A;  1ZZ8 A;  4HVO A;  5JR2 A;  4E4S A;  3IMM A;  5BNQ A;  2WO3 A;  1RHI 3;  4R52 A;  4XQ4 A;  4DIQ A;  2W95 A;  2E33 A;  3AYC A;  1K12 A;  1MS3 A;  2O1Q A;  5IK8 A;  2BNM A;  3LPF A;  4NMI A;  5C8C B;  2OVU A;  1ZRR A;  4MLO A;  4RHV 2;  1BZW A;  3RVH A;  3VZM A;  3T0D A;  1GBG A;  3KWV A;  2FMY A;  3ATG A;  1OC1 A;  3H50 A;  4DY5 A;  4ES8 A;  1H8T A;  4QDS A;  5FZD A;  4D7T A;  3UGF A;  4GD4 A;  2HWF 3;  1MQT C;  1TZO A;  5CFC A;  3MIC A;  4DEV A;  1ACC A;  4BIS A;  5L9V A;  3OGS A;  4ASL A;  1GWL A;  3ZYP A;  2VTX A;  1W6O B;  2KD7 A;  3FBM A;  3VBR A;  3UNP A;  4AI2 A;  3H3U A;  5HI0 A;  2DVD A;  4BM8 A;  1FNZ A;  3PVN A;  4GAL A;  4LUK A;  4RS5 C;  5DUW A;  4B7K A;  4AWD A;  1V6O A;  2W94 A;  1W04 A;  4JGZ C;  4ZY9 A;  3BKZ A;  5FQ0 A;  5BNN C;  1CD3 G;  4OMC A;  2WFF 3;  4P5Y A;  2BGC A;  3CQO A;  1RMU 3;  2RMU 3;  5DZE A;  5A7O A;  4A3Z A;  4IV1 C;  2K46 A;  2JXA A;  5FXZ A;  4N8M A;  2BP6 A;  4GWN A;  3AYA A;  1A8M A;  4QXB A;  2QTW B;  4UT5 A;  2VCB A;  2DCJ A;  4ZHN A;  1DU3 D;  2YGL A;  3ILN A;  5FPV A;  1GOH A;  5FZF A;  4QM9 A;  4RL7 A;  1NLS A;  2HWD 1;  2IVJ A;  4TLF A;  5DUV A;  5IT6 A;  3LQC A;  1WCK A;  2N7G A;  1NCR C;  1ULG A;  1V9U 3;  3AL5 A;  1YJK A;  1S0D A;  4N7I A;  3WCR A;  5JUV A;  5DN2 A;  3FLP A;  4AG4 A;  2XQR A;  4PBO A;  4EE2 A;  1CAX B;  2WNE A;  4NWV A;  4KQ7 A;  3HT1 A;  2WSU A;  5JOZ A;  2AGS A;  3RI8 A;  2P1B A;  4HSL A;  3T09 A;  3NNG A;  2A1X A;  1QJY 1;  2NMN A;  4IL7 A;  4R8H A;  2WC2 A;  2F4L A;  1OLR A;  2XML A;  4BQY A;  5HV0 A;  3E5X A;  4HLT A;  1CPM A;  3VBS A;  5IFT A;  3T4H B;  4FOQ A;  2QQM A;  4XYX A;  1PX3 A;  1JUI A;  4UBG A;  3M3O A;  1IS4 A;  4E4H A;  2QCS B;  4GH4 C;  4CCC A;  4YW1 A;  4GMP 3;  1SLB A;  2A73 B;  4AAX A;  3J4U H;  1OKQ A;  1LGN A;  4LJH A;  4WM7 A;  3RZK A;  3R6S A;  3GYD A;  3NV2 A;  2ZAA A;  5LRS A;  2V09 A;  2JDA A;  1UZZ A;  4DZG A;  4GB3 2;  3BAL A;  3KVB A;  3SH5 A;  4CU9 A;  5FIX A;  2NPI A;  3MUZ 1;  1FOD 3;  2D3P A;  2IXJ A;  2WNO A;  2ATF A;  4XTM A;  5ISL A;  1AYM 2;  2HBU A;  2YG0 A;  1NCQ C;  1AJO A;  1QU0 A;  2VBD A;  5F1R A;  2A5Z A;  4XF0 A;  1HJF A;  3EBR A;  3G7D A;  4CUC A;  3VDB A;  1DZT A;  1W2N A;  5JI9 A;  3E5U A;  1EV1 3;  3N36 A;  3S0M A;  1JOJ A;  1VBD 2;  2XHK A;  3O12 A;  3KD4 A;  3POF A;  4K3U A;  4Z2A A;  2PQS A;  4YVW B;  4HT1 T;  3MFA A;  4W6X A;  5BYN A;  2X10 A;  1QJY 3;  3TNP B;  1PVC 2;  3FZ3 A;  3DEM A;  3NV1 A;  4YGD A;  1QXJ A;  3VKO A;  4GKX A;  3ZSM A;  2JDY A;  1XNT A;  5CVR A;  3PUA A;  5C9A A;  4A6O A;  2PHX A;  4P9J A;  2F6B A;  4XCB A;  3SH4 A;  4Q29 A;  1U5Y A;  1TNR A;  3MUY 1;  3HPN A;  4QDQ A;  2WZR 2;  3BTZ A;  1HQW A;  5JZG C;  3TEW A;  3BPS A;  3LD8 A;  4LNV A;  4W8J A;  1R64 A;  1BYH A;  2JEC A;  4JX0 A;  4AED C;  4E8C A;  4O9G A;  4AVC A;  2RM2 1;  1OPO A;  1QJU 1;  4J25 A;  5FWJ A;  3O7O A;  4EWE A;  5J98 B;  2XJU A;  2XKO A;  5DAW A;  2Y6J A;  4UFK A;  3VBU C;  2GH2 A;  4P08 A;  1PK6 A;  1OI6 A;  1S0F A;  4NUB A;  4LO4 B;  4CXX A;  2H0V A;  1LNS A;  3BI3 A;  2V4A A;  4AOC A;  4DO0 A;  5F37 A;  2W47 A;  3NJX A;  4YVS A;  2D43 A;  1DGR A;  4FP2 A;  5DXD A;  5J96 B;  3T2T A;  2QFE A;  3LIG A;  4Q26 A;  2VZ3 A;  2XBO 2;  2NM1 A;  3TN9 1;  1ONA A;  2J1U A;  2J22 A;  4XUP A;  3D4K A;  4IEV A;  2GNM A;  3PUH A;  3ECQ A;  3WCS A;  1RC6 A;  4NWW A;  4AYU A;  1F35 A;  2X5I C;  3IDA A;  3ZFF B;  1W6Q A;  3JBG 2;  2P5B A;  1OUS A;  3AFG A;  4MH0 E;  3VBH A;  3OUI A;  4IE0 A;  2VUL A;  3VV1 A;  4O7X A;  4OVE A;  1Z78 A;  1R08 1;  4ASM B;  4YFZ A;  5HPO A;  1PO2 3;  3CJX A;  2JG9 A;  4L2N A;  4XUQ A;  1H2M A;  1KEX A;  2XOM A;  5FY4 A;  2ZS6 B;  1F15 A;  3POG A;  1YXW A;  2PHL A;  5K4L A;  5FOJ B;  1W9Y A;  5I93 A;  1AR7 3;  2ZA9 A;  2CL2 A;  3E1F 1;  1BVP 1;  1TME 1;  3LA7 A;  1UX6 A;  4M3C B;  4XUR A;  2EAA A;  3LF7 A;  1PVX A;  2X8K A;  4HXC A;  3ZSL A;  2QQI A;  2Y6F A;  2YY1 A;  3I3B A;  5FZ8 A;  1KFU L;  2RDN A;  3GAL A;  4AR2 A;  1JYV A;  3UKN A;  4IGP A;  2W1S A;  4XBQ A;  3WF0 A;  1QJX 1;  4KWJ A;  2NLR A;  1CAV B;  4DY3 A;  5ABJ B;  1GP4 A;  2RJ2 A;  5FR3 A;  3W5M A;  5F3I A;  1WLT A;  2EVX A;  2R6Q A;  4XC9 A;  3S5A A;  2D6L X;  2ZKL A;  1QXP A;  2B42 B;  1QWR A;  3RDI A;  4ATE A;  1RUD 1;  1HXS 1;  3GHM A;  3OGV A;  1O7F A;  4CCL A;  2JDK A;  2ZGL A;  2PLV 3;  3MF6 A;  5FMO S;  3ZFE B;  1JHN A;  1PM4 A;  1XYN A;  5JI7 A;  4XE9 A;  5IUQ A;  1EP0 A;  2VVD A;  1IOA A;  3ALQ A;  1N1S A;  3PIJ A;  4A44 A;  5T5J A;  3VGI A;  5C8C C;  3ON7 A;  2ZEZ A;  5DZG A;  2GAU A;  1XB9 A;  2E7A A;  5FWE A;  2IXL A;  1AVB A;  2ZBJ A;  3I59 B;  5GZG A;  4FPG A;  2DFB A;  3HQU A;  3OGG A;  4XIK A;  4EYU A;  1BVV A;  3EQE A;  3MPP G;  2ZGP A;  4D8M A;  2HKX A;  3QD6 A;  1UY3 A;  5AFE A;  4Q4Y 2;  4HET A;  1XE8 A;  5LK5 A;  2BWA A;  3UJQ A;  1R1A 1;  4AHX A;  3ZXE A;  3PTY A;  2IWG B;  5AC9 1;  1KXG A;  3BUC A;  4TN7 A;  5I0D A;  3BN6 A;  4I02 A;  4D7Y A;  4UOJ A;  3I49 A;  1EAH 1;  2R07 3;  2VZP A;  4DQA A;  1YFW A;  4QD2 A;  4SBV A;  2CHH A;  3EO6 A;  1J3P A;  4UF0 B;  1DGR N;  1VBA 2;  1H2N A;  4LK6 A;  1AL2 1;  4QAW A;  1O3Q A;  1QH7 A;  3FJS A;  2AC1 A;  3DL3 A;  4AEM A;  4DRV A;  5DG2 A;  2BZD A;  4UFL A;  2VME A;  4RD7 A;  3U14 A;  3BGA A;  2J1S A;  1ZBA 2;  3WG2 A;  2ZMK A;  1CR7 A;  4PF1 A;  3WVJ A;  2D6K A;  2RR1 2;  4COZ A;  3H3Z A;  4FOV A;  5A7Q A;  2EA7 A;  5FP3 A;  1H1M A;  2C5D A;  2HBT A;  2Y33 A;  4I0A A;  4NOT A;  2XJV A;  5GKA C;  4LHN A;  3GZE A;  3M3C A;  5IWF A;  4BOW A;  3WDY A;  2A6W A;  5CKM A;  1T2X A;  2DCK A;  5LWB A;  1JZ3 A;  4H14 A;  1NG0 A;  2YFZ A;  3CF6 E;  4BQ2 A;  1OFS A;  1UYY A;  4L9B A;  4H55 A;  1ULF A;  1ZRF A;  5LAS A;  4B4Q A;  3SQO A;  1DLC A;  1HRV 3;  2YXS A;  1RUE 2;  2ZAH A;  3WNX A;  2BGO A;  2EXJ A;  2VW1 A;  1KJL A;  2VQU A;  3QH6 A;  1EAH 3;  3JD7 3;  5EP9 A;  1FT9 A;  4UFJ A;  1CX4 A;  5JOX A;  1C1F A;  3PJQ A;  4CZS A;  4L97 A;  2VAU A;  4Q1P A;  3WNO A;  5LEJ A;  2JKB A;  3T1L A;  1E5S A;  4QX5 A;  3WY6 A;  3PLQ A;  2ID4 A;  4QX7 A;  2DFC A;  3ZMN A;  3WP6 A;  2WQ8 A;  3LAG A;  3C2U A;  1LRH A;  4IET A;  2A7A A;  2C9K A;  2UWC A;  2GNT A;  3SKV A;  4LBM A;  3NNM A;  2SBA A;  4RHV 3;  4FFH A;  4TXW A;  1YCI A;  2MPF A;  4H3W A;  5FYV A;  3TEX A;  2LTN A;  4QQL A;  1LGC A;  1MEC 3;  3TEZ A;  3U75 A;  4NO4 A;  1N3O A;  4W50 A;  4CDW A;  3N9P A;  3FMG A;  4COV A;  3J26 N;  4A6S A;  5FO8 B;  4HAN A;  4K40 A;  1WME A;  4LHL A;  5H9Q A;  3OD0 A;  3LWC A;  3Q8C A;  2R1D A;  1DF0 A;  1L3J A;  2VNR A;  1DCS A;  1KJR A;  3PTR B;  3V56 A;  3J7H A;  1UO9 A;  4CU7 A;  4JKM A;  2QUO A;  1GV9 A;  1BJQ A;  1IS6 A;  4QU1 A;  4XHB A;  5J7M A;  1SEF A;  2FZ1 A;  5A3N A;  4YVW C;  2Z42 A;  1W03 A;  1ND2 B;  1MVE A;  2FDK A;  5FKC A;  5ANQ A;  3T3Y A;  1BKZ A;  1J3R A;  3BOD A;  5JOY A;  1UZW A;  5FZH A;  1YQC A;  1ST8 A;  2GNB A;  1NA1 B;  1STM A;  1RUI 1;  1UOB A;  1RUJ 3;  2JD4 A;  3VKM A;  2YBS A;  3HEI A;  4IEX A;  4LXL A;  4JQR A;  4CEY B;  1ZRE A;  1BHG A;  2HWE 3;  1AL0 G;  4QXC A;  1VBC 3;  2JKX A;  3DCQ A;  4XJ9 A;  1D0H A;  2WO1 A;  4JKL A;  5FMO L;  1AYN 2;  3VZJ A;  4ZU5 A;  3KMH A;  4PIX A;  4Y1Z A;  2B4K A;  2UY8 A;  1HW5 A;  1RTV A;  5E6H A;  4FPE A;  3HD8 B;  4IE6 A;  4WVM A;  5A6Y A;  4XFA A;  2UWB A;  4D94 A;  3W59 A;  3RYP A;  1H1A A;  2XVK A;  1YI7 A;  3PHM A;  3P6B A;  4IUG A;  1XJA A;  4LUL A;  3VDA A;  1W6O A;  3ZOI A;  5KHG A;  2WYF A;  2ZGM A;  2BBV A;  1F4H A;  1WZX A;  2DCT A;  2Q4S A;  2R04 2;  2ZHM A;  4PDW B;  3J7L A;  2R30 A;  3VDD A;  4KWK A;  1YIF A;  1PO1 2;  2MEV 2;  4RR3 A;  4BA6 A;  1W0N A;  5JVV A;  1LR5 A;  2ET1 A;  3RZM A;  2BEO A;  3J8F 3;  1H0B A;  3NST A;  3OBZ A;  3NAP A;  3ZFF C;  3T2P A;  4YPJ A;  1UXZ A;  1C8N A;  1H6Y A;  2PMW B;  2L9L A;  3VBF A;  4UXA A;  1W6P B;  3U07 A;  2KXL A;  4OUS A;  1UKR A;  1G7Y A;  1QH6 A;  2HWC 2;  1UU5 A;  2A75 A;  2VQ0 A;  4R9D A;  4ZS3 A;  4KMQ A;  3MYX A;  4UW3 A;  4YM1 A;  5A3P A;  4TZD A;  5DDJ 1;  4LBK A;  5IVE A;  3V0A A;  5K9Y A;  1ENR A;  3HN3 A;  3I2H A;  1MS1 A;  4AVS A;  4XOG A;  3SCG A;  5C4W A;  4WVV A;  4ISR A;  4Q4V 1;  2VW2 A;  3K4D A;  2WAA A;  4ZKT B;  1PIV 3;  1OVP A;  2VC9 A;  1VBD 3;  1Q56 A;  4HN0 A;  4XXA A;  1GIC A;  3HMY A;  3DV8 A;  2C9A A;  1AR6 1;  2Q1M A;  2WS9 1;  3DGT A;  3P1I A;  4YG6 A;  4HMZ A;  1PVC 3;  2G1M A;  3ZKY A;  3AMN A;  4OUE A;  5J37 A;  3O1P A;  5GLZ A;  5JWP A;  2CAV A;  5FUP A;  1VP6 A;  2BW8 A;  3ZXF A;  3ORJ A;  4ZON A;  3G6J B;  5ABJ C;  1XSQ A;  1GZW B;  4AXO A;  4B3N A;  1O4Y A;  1G8W A;  1NLR A;  3CZJ A;  3GZT B;  3KCX A;  4HSJ A;  4QKB A;  4XDQ A;  2VL4 A;  3H7J A;  4IDZ A;  4DXS A;  1JYN A;  1Y7B A;  4JHZ A;  1C5H A;  4KBZ A;  2RS5 1;  4YFW A;  4YYO A;  3ZFE C;  1RUO A;  3RZL A;  3WD5 A;  3N7J A;  2WA4 A;  5FYI A;  4CUB A;  4GAZ A;  1JZ4 A;  1OQE A;  4KG8 A;  3UYJ A;  5LA9 A;  2VU9 A;  4EJR A;  5A7S A;  3OY8 A;  2WII B;  4UYB A;  3RMX A;  4FTB A;  1VJ2 A;  1FXZ A;  3N35 A;  5JOW A;  1IKQ A;  3NQH A;  1DQ0 A;  2HWD 2;  2IVI B;  5EIY B;  4R9C A;  2DBI A;  3B93 A;  4A2U A;  2A6V A;  3J7N A;  2VZR A;  3VDC A;  4TLG A;  2QQK A;  3FUQ A;  2DU0 A;  5FLJ A;  4CVU A;  1OA3 A;  4B29 A;  3H0O A;  1N47 A;  2PXJ A;  5FZL A;  3JBG 3;  2Z79 A;  3OBR A;  4MUV A;  3BIE A;  3WT3 A;  1Y9Q A;  2CWS A;  1DIW A;  4K8R B;  4XTP A;  3WQ7 A;  1NQD A;  2YB7 A;  4IEQ A;  4S2F A;  3BTA A;  3M8L A;  4XW3 A;  5FMC A;  3S7E A;  3IMN A;  2H6C A;  4CPB A;  4JQT A;  2P37 A;  3TBD A;  2BER A;  5FFO C;  3GM8 A;  1PZ7 A;  4YW4 A;  1CAW B;  3WP3 A;  1CPN A;  5LBE A;  5JAX A;  4Q4X 1;  2PYT A;  4XXP A;  5M0T A;  1MS8 A;  4MGZ E;  5F39 A;  1NZC A;  2DVF A;  1YQ6 A;  1C8M 1;  5JSO A;  3SEP A;  4HKO A;  1UY2 A;  1C5I A;  3ZXL A;  4XZU G;  3GF6 A;  3WW4 A;  3H8U A;  4L11 A;  5T52 A;  2D6P A;  1US2 A;  4OHY A;  4BXF A;  1J83 A;  4BDV B;  1S55 A;  2ZTN A;  1C4R A;  2XQX A;  5C8W A;  4HZF A;  3MZH A;  1W39 A;  2XJQ A;  4NRP A;  5FP8 A;  1O3T A;  3VD5 A;  3FHA A;  4XFG A;  5CB7 A;  1S0I A;  4IER A;  4CUA A;  2ZEW A;  4R9B A;  5K0U A;  3C7O A;  3N9Q A;  3WQ1 A;  1I6X A;  4NHM A;  4P9G A;  2VMH A;  1O4Z A;  3LSD A;  4N9I A;  5CZK A;  4O65 A;  2VVE A;  3OG2 A;  1NY7 1;  2WWJ A;  1QQP 1;  1D4M 1;  3ZN4 A;  2Q30 A;  5CFD B;  3OTF A;  1VAK A;  2ZGR A;  4TSV A;  3I97 A;  2B9V A;  3ZYI B;  1B35 B;  1O8P A;  2GMM A;  4OLL A;  3ROU A;  4BLJ A;  5IAT A;  3OCP A;  1RYY A;  1BEV 1;  4Y1V A;  2YU1 A;  4AGR A;  3V0B A;  1V70 A;  4C90 A;  1WMD A;  2RM2 2;  4YGE A;  3QBQ A;  3B5L B;  4MGS A;  5ACA 1;  1W8W A;  1HRI 2;  4KGG A;  1FAT A;  3LDR A;  2QDR A;  2IZW A;  4CDU A;  5KR7 A;  1RL3 A;  3O14 A;  2YBP A;  1QOO A;  3PNA A;  3FN9 A;  1RED A;  3MEP A;  4GJY A;  4JGY B;  5FP9 A;  1QNW A;  4F7Z A;  4EQV A;  2VXR A;  4L92 A;  1W3X A;  2HEY F;  4JC1 A;  4XDO A;  3THP A;  4AGG A;  3IAP A;  1GMM A;  4CPB D;  4DPN A;  3MW2 A;  1ND2 C;  1H4G A;  2YBK A;  2JDZ A;  4FQZ A;  1ZBE 1;  2VR4 A;  4IEZ A;  4PBP A;  1H8V A;  5TSW A;  2PA7 A;  5GAL A;  1GP6 A;  1GQP A;  4AL9 A;  2RS3 2;  1NA1 C;  4AW7 A;  4JZR A;  4QKD A;  2FCV A;  4XJU A;  5FZE A;  3APB A;  4B1M A;  1WCQ A;  2ZML A;  4YZ2 A;  1Z0H A;  4Y1X A;  4WM8 A;  2OZ6 A;  3B7M A;  5T5P A;  1SBE A;  1AR8 1;  3VKL A;  1GWM A;  3WDV A;  4FPC A;  3ZXK A;  1OVS A;  1R08 2;  3OYW A;  3AMM A;  4AHY A;  1T6B X;  3BU0 A;  1RUC 2;  1Z7S 3;  2ZCW A;  3AVS A;  3K2O A;  4I01 A;  4L99 A;  1I5Z A;  5BNP B;  2Y64 A;  2OUJ A;  3POW A;  4XAA A;  2GP5 A;  4Y20 A;  3MIB A;  3MW3 A;  5EYX A;  4PCR A;  1WLC A;  1TME 2;  1BMV 1;  2HWB 3;  3E97 A;  1CON A;  1JOB A;  2RS1 2;  3OBA A;  1LEN A;  3K46 A;  1RHI 1;  1XNA A;  3O1T A;  3UGH A;  4QPG A;  4LBQ D;  1JZ8 A;  1UX7 A;  5HCF A;  3A7Q A;  3JUU A;  2ARC A;  5CG9 A;  1A34 A;  4PDW C;  4Q0S A;  2AEN A;  1AXZ A;  1C3H A;  1RVF 3;  4KL1 A;  3CJI B;  2QBX A;  5A6Z A;  2JX9 A;  4EN7 B;  4KGQ A;  3URF A;  1VAL A;  4QHB A;  1JZ2 A;  3DKQ A;  2HWF 1;  5FPU A;  3AM2 A;  1S1A A;  1XBF A;  4K20 A;  1LU2 A;  3N9N A;  1AXK A;  3KB5 A;  4OZX A;  4COU A;  2XR4 A;  1F31 A;  2G9F A;  3MO4 A;  3LKJ A;  2V5Y A;  4NAO A;  5I0T A;  3WNK A;  5IFP A;  1KRI A;  1OA2 A;  1RUD 2;  1HXS 2;  4FPY A;  3P3N A;  3B01 A;  3S7I A;  3T30 A;  3ZXA C;  1CZS A;  4QU2 A;  1NZI A;  3OPZ A;  4IW3 A;  1QHD A;  4AFC A;  5AVP A;  5L9R A;  2JE9 A;  3LFM A;  3W58 A;  4OHX A;  5LCW L;  2YC4 A;  2XWB B;  5KXC A;  1QJZ A;  2WFF 1;  1VIW B;  2PFW A;  2CDO A;  3TB0 A;  1CJD A;  1OQ1 A;  1Q8P A;  2GP3 A;  2WR9 A;  3E6B A;  1RMU 1;  1XNB A;  2RMU 1;  3ES1 A;  4XJA A;  2ZZQ A;  3KF3 A;  1WWY A;  2IC1 A;  4Y24 A;  4PLM A;  4YAR A;  4LHK A;  4CU6 A;  1SPP B;  3WIN E;  1W8Z A;  3GXU A;  1DLL A;  1L7R A;  4XAB A;  5GLU A;  3T08 A;  4FPL A;  1W9W A;  5AVA A;  1YRZ A;  4NRQ A;  1FPN 2;  1R1A 2;  4N43 B;  3UKT A;  3DYO A;  5JXH A;  2UYA A;  4LIU A;  1OH4 A;  5AC9 2;  4DNY A;  1V9U 1;  3WW3 A;  3SCH A;  4XFH A;  1IS5 A;  5BNO A;  2C26 A;  3VD4 A;  3WG3 A;  2Y60 A;  3IWZ A;  5FYU A;  2Y6K A;  2JB8 A;  2XG3 A;  4OI4 A;  1YFX A;  5IVF A;  5FY0 A;  2PQQ A;  2ZGU A;  4RQP B;  4MGQ A;  1JYW A;  5FUI A;  2O8Q A;  2QE3 A;  4IND A;  2O8O A;  2VZS A;  3O0X A;  4GUL A;  3PJY A;  2XGX A;  3NRU A;  2WA3 A;  4MGY E;  4Y22 A;  4E4Z A;  4UI9 L;  4E2S A;  2A6X A;  4GMP 1;  4XMI A;  4YG0 A;  2WKK A;  1LOB A;  1DYP A;  5L7O B;  5HCB A;  1H9P A;  1QDC A;  5EZW A;  2D97 A;  3MV0 1;  4ES9 A;  3TYJ A;  5JR7 B;  2W2I A;  1PO1 3;  2MEV 3;  4IGO A;  2BNN A;  4LLO A;  2VEC A;  4FP3 A;  1LB2 A;  4AF9 A;  3KM5 A;  3VKF C;  2HEW F;  2I74 A;  1FOD 1;  4QHO A;  2VZT A;  4HOO A;  4XZP A;  1NA1 A;  3QCW A;  1POV 3;  2A3Y A;  4A7Y A;  3CLP A;  1MR5 A;  3WW1 A;  3ZXG A;  3LIH A;  2VCC A;  2XL9 A;  2ZX2 A;  2ADD A;  1HKD A;  1LOF C;  1EV1 1;  4BQ1 A;  5A6X A;  3DXU A;  1DQ5 A;  2FMD A;  1XYO A;  4FPK A;  3ZR6 A;  2XJP A;  2VW0 A;  2Z2S B;  3FL7 A;  5IVB A;  4CA9 A;  4Y5Z 0;  4MXW B;  5JXI A;  1J1T A;  2YPD A;  3O1M A;  2RE9 A;  1PGL 1;  4BLI A;  2DYC A;  1HV0 A;  2IUW A;  3HQR A;  2NMO A;  1DGW A;  1OLM E;  2ZHL A;  4IXL A;  4CUG A;  5J48 A;  4CP9 A;  5FXV A;  1PMH X;  3CKH A;  5D8A B;  1D4V B;  1Y4W A;  4P9Y A;  4IV3 B;  1LU1 A;  3KLS A;  3AMQ A;  2FHR A;  1U5Z A;  2VD7 A;  1OQD A;  4ARX A;  1IG0 A;  2GDF A;  4BQX A;  1V6L A;  1ZX5 A;  1VBE 2;  2VQA A;  1VRH 2;  4GZ9 A;  5FZC A;  2RDQ A;  1W6M B;  3K4Z A;  3MHZ A;  1AUY A;  3NMB A;  3MV1 1;  2WLP A;  3PUQ A;  2WL1 A;  3UT0 A;  4XFC A;  1W9T A;  1CIY A;  2WZ8 A;  1NAE A;  1ASJ 3;  1W6P A;  1X9P A;  5IVJ A;  3ZDV A;  4ATF A;  1O3R A;  1QIQ A;  4PIY A;  4O9E A;  2E32 A;  3IAQ A;  5CFD C;  1RUI 2;  4M3C E;  1I5P A;  2ARX A;  4B4P A;  4AFB A;  2ZEY A;  1NUK A;  2K2S A;  2WFP A;  4L0P A;  2FQP A;  4PLN A;  3AJY A;  1B35 C;  3D3A A;  2ZX3 A;  3CDZ B;  5EV7 A;  1VAM A;  3E6D A;  4XVH A;  1JH5 A;  4E27 A;  3I2D A;  4D7S A;  2VOV A;  1NX9 A;  3O0V A;  4OMD A;  3HAG A;  1MS0 A;  3ZFG A;  1JMU B;  1A3K A;  3PU8 A;  2BOJ A;  1W06 A;  1ZZC A;  4JGY C;  1CQ9 A;  1PO2 1;  4EN0 A;  2HEV F;  5APA A;  2A3W A;  4FBF A;  3CO2 A;  4DB5 A;  1COV 2;  1RUF 2;  4CDQ B;  3W9A A;  5FP7 A;  1AR7 1;  1GUI A;  2E51 A;  2ORX A;  3DYM A;  4JDM A;  4YGC A;  2JG8 B;  3BOW A;  1GZW A;  1W2A X;  3VUO A;  1DHK B;  5C33 A;  1MQT A;  2LUW A;  4B4R A;  2WNV B;  5KXB A;  1TE1 B;  3VBO C;  3IPV B;  5FZI A;  1S0E A;  1AX0 A;  2JDM A;  4AEK A;  4MHR A;  2BUK A;  2HH9 A;  4RS5 A;  4BCU A;  1K45 A;  3W21 A;  4JGZ A;  4BQ5 A;  1TVG A;  4XHX A;  5LBF A;  5BNP C;  5LAT A;  5BNN A;  5HCA A;  2WNU B;  5D1I A;  3GJB A;  4PHZ A;  1SFY A;  1Y3T A;  5DDJ 2;  3VHN A;  4IV1 A;  2ZOE B;  1W2O A;  3A0K A;  5A33 B;  1GSL A;  2PLV 1;  3T1M A;  3BYW A;  4Q4V 2;  1IPJ A;  2ZAB A;  4FXK B;  4K8F A;  2D6N A;  2JD9 A;  3ENR A;  2BNO A;  4X8P A;  2LW8 A;  2BFU S;  5I8Y A;  1Q43 A;  1NKG A;  3Q8E A;  3TRS B;  1HJG A;  4WV8 A;  1IKP A;  1RUG 2;  3CJI C;  3AVR A;  4NII A;  1QMJ A;  1X8M A;  2WS9 2;  3F2Z A;  1A8D A;  1NCR A;  4CCE A;  1MS5 A;  2R06 3;  2WT1 A;  3I2I A;  2K9Z A;  3ETP A;  4N53 B;  5IAV A;  3SIS A;  5A1F A;  4M3C F;  2XDV A;  2ORZ A;  3HVD A;  4YWA A;  3SNM A;  5C3P A;  1UZ0 A;  1TMF 3;  3NW4 A;  3K51 A;  4Y33 A;  2VZU A;  4EN8 B;  1REE A;  5FY5 A;  4LBQ B;  3VZL A;  1XQN A;  3OGJ A;  1R09 3;  5JXG A;  1BBT 2;  4PT6 A;  4COW A;  4AVV A;  2RS5 2;  1VBB 2;  1WLW A;  5A32 A;  4GH4 A;  1HRI 3;  2R07 1;  1HV1 A;  2WN3 A;  3M3I A;  4QPI B;  2VCA A;  1YFU A;  3CIH A;  4LIT A;  2AH2 A;  2VQT A;  2EAK A;  4CCK A;  3N7L A;  1RXF A;  4CEW B;  2H0B A;  1BXH A;  1G9D A;  4ZU7 A;  3AL6 A;  5A80 A;  4LLF A;  4Z92 B;  3RWK X;  1D2Q A;  1NCQ A;  2YMZ A;  1OLQ A;  4N43 C;  5FYB A;  3I3Q A;  4BQ4 A;  3WNL A;  1ZVF A;  2W9X A;  3MLL A;  4O61 A;  5LY2 A;  1UU6 A;  3HBK A;  1OT5 A;  2ET7 A;  3TNQ A;  3WDW A;  4BIF A;  4OZO A;  4FXG B;  3KV9 A;  4C1X A;  3AKQ A;  5F3E A;  4UAP A;  1DBN A;  3INA A;  4NR1 A;  3MIH A;  3SKJ E;  4N9H A;  2XJR A;  1F5J A;  1HRV 1;  1RUC 3;  4QHZ A;  4UW5 A;  4XPV A;  2DUQ A;  4C8D A;  4RQP C;  2A3X A;  4S2G A;  5JXJ A;  1CN1 A;  2HYK A;  4Q1R A;  4DIN B;  1X82 A;  3WG1 A;  4Y3O A;  2R0H A;  3PUR A;  3JD7 1;  5JZG A;  5FPA A;  5A7W B;  1JXN A;  4Q4W 3;  3WDX A;  1FMD 2;  1O6U A;  4TTG A;  4YG3 A;  4LIV A;  2RS1 3;  4AED A;  3USS A;  5FRE A;  3C8X A;  4PI2 A;  3T2Q A;  1GLH A;  3UV9 A;  2YYO A;  3LSE A;  4Q27 A;  4PQQ A;  5A3O A;  2D5H A;  4IE7 A;  2QQP A;  3S30 A;  3VBU A;  1AR9 2;  1AX1 A;  2YGM A;  4NAM A;  5JCT A;  2XWJ B;  1P8J A;  4RHV 1;  3SIT A;  4DEQ A;  1KFX L;  2IFR A;  4G4F A;  4GKY A;  4COY A;  1MEC 1;  2PHF A;  3AC0 A;  3O1R A;  1C28 A;  1S2E A;  2O14 A;  4Y26 A;  2DBN A;  4DXT A;  1RIN A;  3VBO A;  1BCX A;  1NT0 A;  1MVQ A;  5DAB A;  1BLZ A;  1IS3 A;  4D3W A;  1GOG A;  5GJ6 A;  5GLW A;  2K0G A;  4L8Q A;  3VZN A;  4DUV A;  3USU A;  5A1A A;  4JVA A;  1DDL A;  1DQ1 A;  1E5R A;  1HB1 A;  1QNY A;  2CV6 A;  3WDU A;  2NN8 A;  4QX1 A;  1QDO A;  1W8O A;  1LOE A;  3NNJ A;  1JYI A;  1QQP 2;  5JIA A;  1EPZ A;  1XE0 A;  2X5I A;  4M0N A;  4QPW A;  2EXH A;  1IZ3 A;  3WDT A;  3RZJ A;  1JYC A;  4RGK A;  1RUJ 1;  2WDB A;  1BEV 2;  2GZW A;  4E9K A;  4C1W A;  4XUO A;  1S0J A;  5CKN A;  4XF4 A;  5D8A C;  1CES A;  3RS6 A;  4AGV A;  1YI9 A;  4CRQ A;  2P3K A;  3OOX A;  4IV3 C;  1VMH A;  2HWE 1;  4PJY A;  3DPR B;  3RJ2 X;  1VBC 1;  1NYW A;  2VXJ A;  5ACA 2;  3HR9 A;  1UU4 A;  1CZV A;  1UYX A;  1YQ5 A;  2D7F A;  3KT7 A;  4HVR A;  4AE2 A;  4I0W B;  2G9G A;  2BFU L;  1FPN 3;  4FTS A;  1X8E A;  3S57 A;  3C7F A;  5FY1 A;  5LK7 B;  1YC6 1;  1PNG A;  2OUH A;  1PZ9 A;  3IB3 A;  4XFF A;  2XKP A;  3IT8 A;  5FZ7 A;  4GWM A;  3WR0 A;  4AAP A;  3CNA A;  4MXV A;  5KWR A;  1YNA A;  4BQW A;  3Q8B A;  1H8T B;  2WWS A;  4V2V A;  3ABZ A;  2RDS A;  5C70 A;  3IBM A;  1W8N A;  3FLT A;  1ULO A;  4DMI A;  1OD3 A;  2QQN A;  3P5B A;  3N9O A;  5A6Q A;  1G9B A;  4I3G A;  1WBL A;  1CAU A;  2VUJ A;  3NNL A;  1Y9G A;  2VTX J;  3RSJ A;  4AI1 A;  1W8F A;  4AZZ A;  3J8F 1;  4W6W A;  1AR8 2;  3HT2 A;  4Z8B A;  2CTV A;  1K5M B;  2F17 A;  3DN7 A;  3RG0 A;  4BE3 A;  3FE5 A;  2P34 A;  2PHW A;  1LHV A;  4JAA A;  4Y4R A;  2QQW A;  1X9T A;  2X29 A;  3MBW A;  4E4D X;  1F9K A;  3BB6 A;  1S2B A;  5FQ0 B;  5IVV A;  3WSO A;  3FHQ A;  4GB3 1;  5C8C A;  2Q1Z B;  1BMV 2;  1EY2 A;  3NVC A;  3FWE A;  1JU4 A;  4V2W A;  4CDQ C;  3L2H A;  3LOB A;  2VOT A;  2JG8 C;  4YZ3 A;  2WIN B;  1OMI A;  5CU1 A;  2HYX A;  3WXP A;  2GME A;  4N90 A;  3LB9 A;  4CU8 A;  1ZZ9 A;  3LA3 A;  3SHR A;  2A70 A;  2WNV C;  1PIV 1;  3T0A A;  1VBD 1;  1RIT A;  3AZV A;  1KIT A;  4FFI A;  5F5C A;  4OFG A;  2HWF 2;  2QQV A;  2WAO A;  2LS6 A;  3RZH A;  1OA4 A;  1Q8Q A;  1IPS A;  4YZ1 A;  1Q8V A;  1PVC 1;  3D6E A;  3PL0 A;  1WD3 A;  2FBE A;  4QB6 A;  3ZN6 B;  1UOF A;  1RUH 2;  1HDK A;  1VB4 A;  3R05 A;  2OPW A;  1LHO A;  2VPV A;  1GNZ A;  4F8A A;  2ZAC A;  2ILM A;  1K3I A;  3ZYB A;  5JSR A;  1WMX A;  1OHF A;  1ZRC A;  2WNU C;  1WUV A;  1YLL A;  3AKP A;  2VM9 A;  2GC1 A;  1HN0 A;  3VBS B;  5H9P A;  2J1R A;  2B7Y A;  4XEZ A;  3WNN A;  2RDR A;  4AFD A;  5SV8 A;  1VBE 3;  3CU7 A;  1VRH 3;  2R1B A;  1MS4 A;  1JUH A;  1W9S A;  5A3T A;  1L7Q A;  2WO2 A;  2IXC A;  1TQ5 A;  3ELN A;  2B5H A;  4GB3 3;  4MVT A;  1GYK A;  2RMU 2;  1ND3 B;  1QXR A;  1LEM A;  3VKN A;  4WM7 B;  5C6C A;  4YW2 A;  3POI A;  4YW6 A;  1LED A;  1AYM 3;  2LM3 A;  2XLF A;  4GQ7 A;  1PGW 1;  3AZY A;  5KHJ A;  4Q8K A;  2V72 A;  1B09 A;  4N53 C;  1DYO A;  4RA0 A;  1CAX A;  2XBO 1;  2IFW A;  2WYS A;  4M0H A;  5B4X A;  3RPQ A;  5DAP A;  3D5O A;  1KDK A;  5FZ9 A;  5FY8 A;  1V9U 2;  3OSD A;  3VB9 A;  4QB2 A;  4BIO A;  4QXH A;  1NOV A;  4W6Y A;  1XRU A;  2ZZJ A;  4YW5 A;  5J3U A;  2ZGS A;  2MHF A;  4HFS A;  2BTV C;  2CYF A;  5FPB A;  3JBG 1;  5FJH A;  4ISQ A;  1VRB A;  2XJS A;  5AFB A;  1U12 A;  3WQ0 A;  2WZR 3;  1MZ5 A;  1V00 A;  4QPI C;  3ZSJ A;  2B8M A;  5C9A B;  3ZR5 A;  4P5H A;  1ZNP A;  2BPA 2;  1HQL A;  2WT0 A;  3UGG A;  4Z2W A;  1JZ7 A;  4NJ4 A;  1TEI A;  1W6M A;  2E31 A;  4LKS A;  4SLI A;  4C0H A;  1COV 3;  1RUF 3;  2VBB A;  1QKQ A;  3T2O A;  4CEW C;  3MLK A;  3PUI A;  4OUL A;  4NPM A;  4ZXE A;  1LES A; 
#chains in the Genus database with same CATH homology
 1ULP A;  3CZU A;  2X10 A;  2QBX A;  4A4A A;  1US3 A;  1XNT A;  4A6O A;  1JZ2 A;  1YQ2 A;  1JHJ A;  3MUY 1;  4QDQ A;  3HPN A;  1PX4 A;  3I2J A;  2V5D A;  4W8J A;  1R64 A;  3MO4 A;  4DUX A;  4JX0 A;  4LHS A;  4E8C A;  5IFP A;  3WNK A;  1EUT A;  2VZ1 A;  1CZS A;  2Y6J A;  5G04 L;  2WN2 A;  2WZE A;  4P08 A;  5LCW L;  1LNS A;  2YC4 A;  2W47 A;  2CDO A;  4OYU A;  3NJX A;  4BK5 A;  1IQD C;  3ACI A;  3GGL A;  4CU6 A;  1GU3 A;  1F4A A;  2VZ3 A;  2X05 A;  3THD A;  3GXU A;  2J1U A;  1L7R A;  2J22 A;  4XUP A;  3PUH A;  3T08 A;  3ECQ A;  4XUN A;  1W9W A;  5IJR A;  3IDA A;  4LQR A;  3DYO A;  2VO5 A;  5JXH A;  1OH4 A;  4RYD A;  2W92 A;  4KWU A;  3WEZ A;  2C26 A;  3VD4 A;  1OF3 A;  2Y6K A;  5HPO A;  3C7E A;  4XUQ A;  1KEX A;  2XOM A;  4BJ0 A;  4MGQ A;  2W1Q A;  3I2K A;  1JYW A;  5FUI A;  2VZS A;  3E1F 1;  3HOB A;  2W1U A;  3NRU A;  4XUR A;  2EID A;  4UI9 L;  2Y6L A;  1UY1 A;  4GWJ A;  2W3J A;  2QQI A;  3I3B A;  3WNM A;  3MV0 1;  4ZZ5 A;  4KI5 M;  1JYV A;  2W1S A;  2X09 A;  4A42 A;  3LE0 A;  3WF0 A;  2VZT A;  2VZQ A;  3DEC A;  2RJ2 A;  3W5M A;  3A23 A;  5CYY A;  2VCC A;  1UXX X;  3C7H A;  3I2F A;  1UMI A;  3U37 A;  3OGV A;  1UY0 A;  3FL7 A;  2DDU A;  3A22 A;  5JXI A;  2V4V A;  4A44 A;  2ZEZ A;  3I2G A;  4RN5 A;  1PMH X;  3CKH A;  4MO3 M;  2VMC A;  4QX3 A;  4D8M A;  4ARX A;  1UY3 A;  4GZ9 A;  1UYZ A;  3K4Z A;  3K4A A;  3MV1 1;  5I0D A;  3BN6 A;  4UOJ A;  1W9T A;  1CIY A;  2WZ8 A;  2VZP A;  1NAE A;  4QAW A;  2E32 A;  3IAQ A;  4LPL A;  1I5P A;  2BZD A;  1UY4 A;  2VME A;  2ZEY A;  1NUK A;  3BGA A;  4L0P A;  2J1S A;  1O8S A;  4PF1 A;  2W46 A;  3D3A A;  3CDZ B;  4QX2 A;  4XVH A;  4ZZ8 A;  1NX9 A;  2YFU A;  4OMD A;  4P00 B;  1JZ6 A;  4A41 A;  4HG6 B;  1T2X A;  2DCK A;  1JZ3 A;  2YFZ A;  1TG7 A;  1UYY A;  3VD9 A;  3LEI A;  1JU3 A;  2W5F A;  4W4Z A;  1GUI A;  3DYM A;  1DLC A;  2ORX A;  2RVA A;  2EIE A;  2BGO A;  3WF1 A;  1KGY A;  4M4P A;  2VQU A;  2Y8K A;  4P02 B;  3EB7 A;  2QQJ A;  5LA1 A;  3LEG A;  3OEB A;  3WNO A;  2ID4 A;  2W1W A;  2WQ8 A;  1K45 A;  2C9K A;  1CZT A;  3SKV A;  4TXW A;  3HJR A;  1TVG A;  3WF2 A;  5C71 A;  5IHR A;  2WAB A;  4W50 A;  1SHW B;  1JYX A;  3VD7 A;  3ZM8 A;  2J1V A;  3OB8 A;  3J7H A;  4CU7 A;  4JKM A;  2JD9 A;  2LW8 A;  1NKG A;  2R7E B;  4QDR A;  3T0B A;  4JKK A;  3UES A;  3F2Z A;  3W5N A;  3ACF A;  3I2I A;  3ETP A;  3UET A;  2ORZ A;  3HEI A;  1UZ0 A;  2VZU A;  1BHG A;  2JKX A;  1OF4 A;  2WO1 A;  4JKL A;  5JXG A;  2J7M A;  3GDB A;  4PT6 A;  2QQO A;  2B4K A;  5DQ0 A;  3HNY M;  2WN3 A;  1GOF A;  2XON A;  3OGR A;  2VJX A;  5G05 L;  2VCA A;  3CIH A;  2WBK A;  5LA0 A;  2VQT A;  4IUG A;  3P6B A;  3VDA A;  1F4H A;  2VMF A;  1W0N A;  1GNY A;  5DMY A;  3CMG A;  1XC6 A;  3A21 A;  1W99 A;  3WNL A;  2W9X A;  2EIB A;  4YPJ A;  2ZXQ A;  1UXZ A;  3T2P A;  1H6Y A;  1OT5 A;  1DP0 A;  4OZO A;  2L9L A;  2W87 A;  2Y6H A;  4UAP A;  5C7G A;  5B4N A;  3SKJ E;  4D0Q A;  1SG3 A;  4KMQ A;  3THC A;  2RV9 A;  1CX1 A;  3K75 B;  5JXJ A;  3HN3 A;  3I2H A;  5EJZ B;  3WNP A;  1JZ5 A;  1UWW A;  4TTG A;  3K4D A;  2WAA A;  3C8X A;  3T2Q A;  1HN1 A;  4A45 A;  4PQQ A;  2VC9 A;  5LA2 A;  3P1I A;  3JXS A;  1P8J A;  4DEQ A;  4OUE A;  5HXM A;  3WF4 A;  2YC2 A;  2XHN A;  4ET7 A;  3AC0 A;  2HLE A;  3SEE A;  4DXT A;  4MAD A;  3HNB M;  3ACH A;  1GOG A;  3CZJ A;  5A1A A;  4DUV A;  3ACG A;  1H6X A;  2VL4 A;  4DXS A;  1JYN A;  3LPG A;  4JHZ A;  4XUT A;  1PMJ X;  4QX1 A;  1W8O A;  4CUB A;  1WKY A;  4QPW A;  1JZ4 A;  1K42 A;  2Y6G A;  2VZV A;  2WDB A;  3LEK A;  4XUO A;  3NQH A;  2W91 A;  5EIY B;  3EYP A;  3WF3 A;  1CZV A;  1UYX A;  2OKX A;  2VZR A;  4QX0 A;  3OEA A;  3DYP A;  3VDC A;  2QQK A;  4CVU A;  2VMD A;  4BK4 A;  2J1T A;  5IYY A;  3C7F A;  2BBA A;  3HNM A;  1UMH A;  2VTF A;  1MPX A;  3IB3 A;  2ZEX A;  2YB7 A;  3ABZ A;  5C70 A;  5JR2 A;  5J1X A;  1W8N A;  2WO3 A;  1ULO A;  2BER A;  1OD3 A;  3GM8 A;  2J1A A;  2QQN A;  2Z4F A;  2W95 A;  2E33 A;  1K12 A;  1J84 A;  3LPF A;  1D7P M;  4DUW A;  2WUH A;  2EIC A;  3T0D A;  4GWI A;  3SEP A;  4QDS A;  1UY2 A;  2VZO A;  4XZU G;  3MBW A;  2E26 A;  4DEV A;  4BXS V;  1US2 A;  2BGP A;  3WSO A;  1J83 A;  3FHQ A;  4BDV B;  3OGS A;  3NJV A;  2KD7 A;  2XQX A;  3UNP A;  1JU4 A;  3VD5 A;  3FHA A;  2VOT A;  2CDP A;  4CUA A;  2ZEW A;  2HYX A;  2W94 A;  5JMO A;  3C7O A;  4ZY9 A;  4CU8 A;  5CZK A;  3C7G A;  4OMC A;  3OG2 A;  3T0A A;  4P5Y A;  3CQO A;  2WAO A;  4A3Z A;  2LS6 A;  1JI6 A;  1O59 A;  3I97 A;  3I3D A;  2B9V A;  1O8P A;  4FI9 A;  4QB6 A;  4ZXE A;  1RYY A;  2VCB A;  2DCJ A;  1K3I A;  1EUU A;  1GOH A;  4MGS A;  2VM9 A;  3LQC A;  4DXR A;  2J1E A;  2J1R A;  2JE8 A;  3WNN A;  5JUV A;  5DN2 A;  3FN9 A;  4AG4 A;  1W9S A;  1L7Q A;  5EJ1 B;  2WO2 A;  3IAP A;  1GMM A;  3T09 A;  3NNG A;  1SDD B;  2VR4 A;  1XPW A;  5IFT A;  2QQM A;  3I3E A;  1GQP A;  1PX3 A;  2V72 A;  1DYO A;  2C4X A;  4AAX A;  1WCQ A;  2WYS A;  4QB1 A;  5B4X A;  4QB2 A;  2JDA A;  3VD3 A;  4CU9 A;  3MUZ 1;  3III A;  2Y64 A;  4E8D A;  2YG0 A;  5DPN A;  3WQB A;  3K77 A;  2QQL A;  1JZ7 A;  4ARY A;  3OBA A;  4CUC A;  3VDB A;  3K46 A;  1XNA A;  2E31 A;  4LKS A;  4MOA A;  4M4R A;  5F7U A;  3T2O A;  3PUI A;  1JZ8 A;  1UX7 A;  3A7Q A;  4Z2A A;  2PQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...