1TMF1

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
276
structure length
276
Chain Sequence
GVDNAEKGKVSNDDASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNMETTFNYQENDYRLNCLLLTPLPSFCPDSSSGPQKTKAPVQWRWVRSGGVNGANFPLMTKQDYAFLCFSPFTFYKCDLEVTVSALGTDTVASVLRWAPTGAPADVTDQLIGYTPSLGETRNPHMWLVGAGNSQVSFVVPYNSPLSVLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTSASVRIRYKKMKVFCPRPTLFFPWPTPTTTKINADNPVPILELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
source organism Theiler's encephalomyelitis virus
molecule tags Virus
total genus 17
structure length 276
sequence length 276
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf100
4CDQC 2HWD1 1BMV2 1X36A 1OOPA 2R043 5CFCB 4IV1C 1M06G 3VBSC 1VBD1 2ZTNA 4CEWB 5ABJC 3VDDA 3ZFEC 1W39A 4BCUA 1QJU2 1ND2B 5ACA1 5CFDC 2HWB2 1QJX1 1TMF2 4CEWA 4JGYB 1RUD2 3DPRC 4YVWC 4RR3C 1AUYA 1RMU1 1COV1 1NCRA 1RUC3 1ND3B 2VQ0A 1ZBA1 2HWF2 4Q4Y1 4PDWB 1BEV1 4N43C 4JGYA 3ZFGB 1AL21 1FOD3 2RS31 2BBVA 4CDWB 1C8M3 2HWE3 1VBE2 3ZFFB 4YVSB 1AR73 4PDWA 3ZFGA 3CJIA 5JZGC 1PVC3 3NAPB 4QPIB 4Z92B 1RUJ2 3VBFC 2WS92 3JBG3 1D4M1 4CDUA 5C9AC 1VBD2 1MQTB 1HXS3 1RUF2 1ASJ2 1BBT2 1POV3 1RHI2 1VBA3 5C8CA 2WLPA 2BPA2 1RUI3 5FMOL 4CDQB 2X5IC 3TN92 4GB33 1MQTA 1QJX2 5FMOS 4WM8C 1R082 1TME1 4LLFA 3ZXAC 1OOPC 1ZBE3 3VBSB 1RUC1 2HWD3 5J98B 2RMU2 5A33A 1VBC1 1NCQC 4Q4W1 2RM22 1PGL1 1AL0G 2XBO3 5K0UA 5BNOB 1MEC2 3VBUB 4RFT0 2R071 3VDDC 1GFF2 1V9U3 1AR71 1RUH1 3DPRB 1PVC1 3VBHC 5BNOA 1OPOA 2TBVA 4N53C 4IV3C 4FTSA 4NWVA 4QPGC 2R042 3VBRA 1HRI1 1NCRC 3VBOC 4FTBA 3JBG1 5D8AB 4CEYB 1HXS1 1RMU3 1COV3 1POV1 1K5MC 1VBA1 2RS52 4JGZB 1ZBA3 1RUI1 1HX6A 1BEV3 1AL23 2RS33 5D8AA 3CJIC 1R091 1NA1B 4FSJA 1RUE1 4JGZA 5C4WA 1ZBE1 1B35A 2MEV3 2GSYA 5LK7B 1FOD2 4RS5C 2PLV1 1C8M2 2HWE2 2XBO1 1D4M3 2DF7A 1AR72 2R063 2ZZQA 1V9U1 1PO13 4WM8B 4WM7B 1VRH1 5DDJ1 1PVC2 3JB8A 1RUG1 2WZR3 5GKAC 4CDXB 3J8F1 5CFCA 4FTEA 1X33A 4GH4C 1HXS2 1TME3 4RQPC 1VBA2 5K0UC 1RUI2 1ND2A 2GH8A 1VBC3 4GB32 1Z7S1 4Q4W3 4RHV1 2R073 3VBOB 1ND3A 4AEDB 2WFF3 5BNPB 1RUH3 2HWD2 1EV13 1QQP3 2XPJA 1H8TB 2MEV1 5FOJB 4CDWA 3ZFFA 2HWC1 2BUKA 4YVSA 1HRI3 3LOBA 1NG0A 2R061 1VBB1 1FMD3 5BNNB 1AR61 1PO11 3NAPA 4QPIA 1RVF3 1CD3G 1IHMA 2WZR1 1PIV3 1AR81 3HAGA 5L7OB 1C8NA 3JB4C 5ACA2 1DDLA 1B35C 1R093 1HRV1 1QJY3 1RUE3 1RMU2 1COV2 5L7OA 4Q4V1 4IV1B 4CDQA 1ZBA2 2HWB3 4Q4Y2 1BEV2 1FPN1 1SMVA 1AL22 2RS32 5ABJB 4Y5Z0 1EAH1 2PLV3 3ZFEB 3JD71 1AYN3 2HWF3 3VBSA 5CFDB 1PO23 2WFF1 5DDJ3 1VRH3 5ABJA 2MEV2 1RUG3 4YVWB 1EV11 1QQP1 4RR3B 4RQPB 4CEWC 3VBUA 3J8F3 1R1A1 5A32B 4Q4X3 1D4M2 2R062 4N43B 1ND2C 3DPRA 1PO12 1FMD1 1RUJ3 4JGYC 2WZR2 1F2NA 1RVF1 1PIV1 4EJRA 4GMP0 5JZGB 1Z7S3 4RHV3 4PDWC 1ASJ3 3ZFGC 4CEYA 3IDEA 1TME2 3VBFB 1AYM3 1QJY1 4YVSC 1RUC2 5C9AB 2RS13 2HWB1 1TMF1 1VBC2 5AC93 1RUD1 1NOVA 4Q4W2 4CDUC 1NA1A 1PGL2 3NAPC 2HWC3 1A6CA 2R072 1AYN1 5C8CC 5J96B 2X5IB 1PGW1 1VBB3 2HWF1 2ZAHA 1RUH2 1AR63 1PO21 1EV12 1QQP2 1MQTC 1AR83 1OOPB 1VBE1 2X5IA 2QQPA 1HRI2 3M8LA 4Q4X1 4WM8A 3JBG2 4WM7A 1NCQB 1FMD2 1HRV3 2RR13 1RVF2 4GMP1 1RUJ1 2FZ1A 3VDDB 4CDXA 4Q4V3 1PIV2 1F8VA 2WS91 1FPN3 1NCQA 3VBHB 1EAH3 1R092 1RUF1 1ASJ1 1BBT1 1RHI1 3JD73 4N53B 4IV3B 2RS53 1AR93 1QJY2 4QPGB 1RUE2 1NCRB 5BNOC 3VBUC 1AYM1 2BFUL 1ZBE2 3TN91 3VBRC 3VBHA 2BFUS 2RS11 1VB2A 4N53A 1R081 4IV3A 1K5MB 5AC91 2PLV2 4QPGA 1R1A3 1AYN2 3VBOA 2XBO2 4NWWA 1PGW2 4AEDA 2WWSA 5BNPA 1V9U2 1PO22 3CJIB 1H8TA 1VRH2 2RMU1 5DDJ2 1K5MA 1RUG2 2RM21 5D8AC 4CEYC 1RB8G 1MEC1 3J8F2 4JGZC 4Q4X2 4CDUB 5BNNA 5C4WC 4RS5B 1CJDA 1HQNA 5C8CB 2RR11 1NA1C 1QJU3 2R041 4RS5A 1TMF3 1Z7S2 1RUD3 4RHV2 1NY71 4IV1A 2RS51 1QJZA 1AYM2 1AR91 1POV0 4GH4B 5CFCC 2RS12 1VB4A 5A33B 1OHFA 4WM7C 5AC92 3ZFEA 1VBE3 2HWC2 1WCDJ 5K0UB 5CFDA 4CDXC 3FBMA 4GH4A 1VBB2 1AR62 4YVWA 4RQPA 4RR3A 1BMV1 1FOD1 2IZWA 4GMP3 1E57A 1AR82 1C8M1 2HWE1 5A32A 3VBRB 2WS93 4N43A 1ND3C 2FZ2A 1VBD3 2Y26A 1RUF3 1BBT3 1RHI3 1HRV2 2RR12 4CDWC 4Q4V2 4Y4YA 5ACA3 3ZFFC 3TN93 5JZGA 1QJU1 4AEDC 1QJX3 5BNPC 1FPN2 1NY72 1VAKA 1R083 1EAH2 1H8TC 3JD72 3VBFA 4QPIC 3S6PA 1AR92 4Q4Y3 5C9AA 5C4WB 2WFF2 1B35B 2RMU3 4GB31 4SBVA 2RM23 5BNNC 1MEC3 1R1A2 5L7OC
chains in the Genus database with same CATH superfamily
3OG2A 4YRDA 5LBEA 3WR0A 4CDQC 1W8OA 2OQ6A 1ULCA 3P3NA 3NRUA 5I0UA 4AE2A 3KMHA 4BYYA 2LS6A 4KWJA 1ZYBA 3HQXA 3ATGA 3TRSB 5A1FA 1CAVA 4UFMA 3MPPG 5CFCB 5I91A 1XU1A 2J1VA 1CIWA 4MGQA 3BIEA 5GZGA 1M06G 1V0AA 4MOAA 3LIHA 5KXBA 1VBD1 4HBNA 3WW4A 1UPSA 3GBFA 4NHLA 4COUA 3CLPA 4YZ3A 4DB5A 2D6PA 1ENSA 4WVWA 1MVQA 3ZFEC 2YXSA 1W39A 4AHWA 3HQRA 3LKJA 1Y43B 4QKNA 4UFJA 3T30A 5ACA1 2XVLA 2XJQA 4IESA 4PCRA 1XXNA 3N9QA 2HWB2 1J1LA 1QJX1 4A7YA 2Y6KA 2XWJB 3PMSA 4JGYB 5FIXA 3UJOA 4CEWA 3VD4A 4RR3C 3K3OA 3J7NA 4AG4A 4CP9A 4P00B 5JXGA 2D44A 1COV1 3BPZA 3LEIA 3DYOA 1SBFA 2VQ0A 2BZDA 3AP9A 4ZHNA 4XF9A 3I59B 3ZFGB 1FOD3 1SCSA 3TB0A 1LHUA 1K12A 4COZA 4TLFA 1LGNA 2HEVF 3J7MA 5L9BA 5LY1A 2J42A 4MGYE 4TTGA 5FXXA 1AR73 1DP0A 3I97A 2B4KA 3K51A 1OMIA 1A34A 1JHJA 1F4AA 2JB8A 1Q56A 5H9SA 5JVVA 3H9AA 3ME2A 2Y0OA 2Q5TA 3NAPB 4QPIB 5FUIA 2UWAA 1RUJ2 2QQNA 3C3VA 1ZZ8A 5FZ7A 4ES9A 5K9YA 5T5PA 5DAVA 3RVHA 3KD4A 1LR5A 1KS4A 1SLTA 2GNBA 1HXS3 2WABA 3G6JB 1ASJ2 1YRZA 1RHI2 3AVSA 5FZ3A 3ILNA 1JODA 2WLPA 1N47A 1YQCA 2BPA2 2ZXQA 4ZZ5A 1I3HA 3KGZA 3TN92 4GB33 1MZ5A 1OH4A 2X05A 4AGGA 4AFAA 1J1TA 2FDHA 1R082 3KV5A 3VHNA 2GNMA 1STMA 2ZHLA 5L73A 4LLFA 4FOVA 2LW8A 2D6OX 2Y38A 2W1SA 3ASIA 4MXVA 3ZYPA 3VBSB 1RUC1 2ARXA 4OZXA 1QWRA 2AR6A 4M4RA 5IFPA 3RI8A 4FPKA 3C7HA 2AYHA 1S0BA 1QOTA 3HR9A 5F1RA 2FCVA 5BNOB 1SCRA 4IE0A 5G05L 1HW5A 2DV9A 2UY9A 4QQOA 4OHWA 3BI3A 3DPRB 4CA9A 2W52A 1GSLA 3CMGA 5LEJA 1FV2A 3PDQA 1OPOA 3N3HA 3VB9A 2W1UA 3CF6E 4FTSA 1UY1A 3J7LA 1DG6A 5JIAA 4R9DA 3VBRA 1HV0A 1JS9A 1Q8VA 2UYBA 2XMLA 2OKXA 5LW9A 1N1YA 2JG9B 4N9IA 4XJWA 4B7EA 4BQ3A 4CCDA 4XQ4A 2YC4A 2D6MA 5F32A 5D8AB 5FKBA 2A6YA 2ID4A 1IS4A 1XU2A 1COV3 2XHNA 3KT7A 4CEYB 1POV1 1K5MC 2WO2A 4LOTA 2BNOA 4XUPA 4NIHA 4M3CE 1FI2A 4P9YA 4CE8A 4ASMB 4LHSA 3NO8A 3RG0A 2EICA 3S5QA 3K2OA 2XJUA 4P14A 5KXCA 2VQAA 4JKLA 3N9LA 1ODMA 2FMDA 1BZWA 3H1WA 2XJVA 3NMBA 4JGZA 4Y5TA 2PHLA 2ZEZA 4NAOA 5FYVA 4BIFA 4E8DA 5FYZA 2BQPA 1AX0A 3P5BA 4NE9A 1SDWA 3OPTA 2MEV3 3PUHA 3U37A 2ZHMA 2WNVB 5FO7B 1FOD2 3NKTA 3OF1A 1K42A 4IEXA 3WCRA 1N3OA 4NHXA 4UW5A 3UK9A 2XQXA 2YDEA 1ZA7A 3DYMA 3MICA 3BN6A 1YQ2A 2GN3A 2XBO1 2J1UA 3WT3A 3ORJA 1WUVA 3ZKYA 4AHXA 1AR72 2CTVA 4WZCA 2XONA 4WM8B 3TEXA 1H4GA 2JICA 4NOTA 4LA2A 1ZM1A 2WZR3 4NHMA 3WD5A 5CYYA 4F7ZA 4J25A 1NLQA 4B8EA 1VR3A 1H4HA 4YM2A 1HDKA 3AMMA 1J58A 3AZWA 5CFCA 3POGA 1ONAA 3CIHA 1O8PA 1YQ8A 4IEOA 4L11A 1V6IA 3VHRA 3V56A 1HXS2 4R4ZA 4OI0A 4P08A 1G9AA 4YM1A 3WINE 4NUBA 1UYPA 2R0FA 1MR5A 4L99A 2W47A 3ZIXA 5B2GB 4QQLA 4GWMA 3B9CA 2EALA 1OFNA 4GB32 4K3UA 4AI0A 2H0VA 3FE5A 3ALQA 3TEYA 4O9GA 3DKQA 3NNMA 3GZAA 5C3SA 4QM8A 1CESA 2VZRA 3VBOB 2ET7A 2Z69A 2YB7A 3EYPA 2JJ6A 5BNPB 4JC1A 2Q0AA 3JU9A 2VNVA 3E6BA 3IDCB 2XPJA 2VC9A 5FOJB 3AB0A 3K3NA 5FYMA 2GNTA 3W21A 3C7GA 3KSCA 3D0SA 3LSDA 4L0PA 4LE4A 4HVRA 1GQHA 2HWC1 2WJSA 2ETEA 4IE7A 4J1XA 4XABA 4NIAA 4XC9A 1NE4A 1MS9A 2R061 4M0NA 4LHLA 5CZKA 1AR61 1PO11 2FBEA 3NAPA 4QPIA 3SQOA 4NRQA 3GCWA 1RVF3 5JMOA 2JKBA 1CD3G 1JYWA 5KXDA 4OMDA 1C8NA 1NLRA 3ZYGA 4GWJA 3OGSA 1AX1A 5ACA2 4QKDA 4QX3A 4GXLA 4WVVA 3SKJE 2EXIA 1V6JA 1HRV1 3GHMA 1COV2 4QU1A 1T2XA 5FLHA 3SCHA 3ZXGA 4A6SA 3T1LA 2NMNA 4CP0A 1ZX5A 3FFZA 3I2FA 4I3GA 4XF1A 1NYWA 5E6HA 3POIA 1F4HA 1OUSA 1SBDA 2ADEA 4XDQA 4AFBA 4Q1PA 5CIRA 5JOYA 5ANQA 4YZ1A 3VZNA 3VBSA 1OURA 2ZZJA 4LTAA 4UBHA 1PO23 5HV4A 5JUVA 2WFF1 4NPLA 2XWBB 4OUEA 5ABJA 4WVMB 2MEV2 4HVQA 1WGPA 3I3MA 4UW3A 3ITQA 3WDVA 2WWJA 3TWIA 2W5FA 4HXCA 1W6MA 4IW3A 1VAMA 3KM5A 3KCXA 5DMYA 5A32B 5JPMB 4AI8A 3K4DA 2W87A 5CKMA 4N43B 2VH9A 1YUDA 1Y7BA 3CL1A 2PXJA 3DPRA 4HMZA 5CVRA 3O12A 3KQ4B 5FXWA 3O0XA 4JGYC 5JI9A 2WZR2 2QQOA 4I09A 5FK8A 3HN1A 5FJKA 1HB4A 5D2AA 5FUNA 2BW8A 5GLTA 1DCSA 1ZRFA 2JG9A 2UWCA 1JYTA 4FOWA 1DQ1A 5M0TA 4MO3M 1WCUA 1FV3A 3T08A 4RN5A 3PIJA 2JE8A 3GF6A 3IDEA 1SLLA 3ACIA 5FZHA 4CEYA 4D3WA 1GQPA 2ARAA 5FP7A 3B3QE 4LKFA 1AYM3 1QJY1 4FP2A 3ELNA 3ZYBA 4FI9A 2ZHKA 1SFYA 3OUIA 4KBBA 1RUC2 1W9YA 5C9AB 3KV9A 3O1TA 1GNHA 3KS7A 2XXZA 3D6EA 4CDUC 2VW1A 2XLAA 4LO7A 2Q30A 3NAPC 4MXWB 1G8WA 2HWC3 2BEOA 4BH9A 4AQSA 1MS4A 2HLEA 1A6CA 3SCGA 4YZ4A 3UGGA 4D6RA 5C8CC 1PX4A 3PJQA 5FZ6A 3WLUA 4FO9A 4QHBA 2ZAHA 5FXZA 3PUSA 5FZ8A 1AR63 2WNVA 4OHZA 3V0BB 3B02A 3SH5A 1UCXA 3WF0A 2C0ZA 1DU3D 3AJYA 2XGXA 1ULOA 1VBE1 5IK8A 2ZBJA 3E97A 4XIKA 3SLIA 1U12A 3WG1A 3TBDA 2GP3A 3ACFA 3USSA 4WM8A 2ZGNA 3UETA 4BJ0A 2VXJA 1HRV3 5FZBA 2RR13 1LULA 2D43A 1OLMA 1RVF2 2EF6A 2IFWA 4GMP1 4LNVA 4PLMA 3VDDB 4BDVB 3WX5A 2VNGA 5HI0A 1F8VA 2EXJA 4XDOA 1YNAA 4L92A 1W6PA 1W8WA 1EPZA 4EWDA 4O61A 5JOZA 3DUIA 1VLNA 4LKEA 3VBHB 5JSRA 2VZUA 2R30A 4QPYA 4O7XA 1RUF1 1BBT1 2ZEXA 4UFLA 2BGPA 2YMZA 2RS53 2NM1A 5ISLA 1AXKA 2A5ZA 2VULA 3IDBB 1NCRB 2DU0A 4E4HA 4DUVA 5BNOC 1MS3A 3CEWA 5IAXA 2DWRA 4S2DA 3ZSLA 1DQ4A 1ZZBA 3WNLA 4CZSA 1ZRDA 1C1LA 2WO1A 2RS11 4AL9A 4JDMA 1OA3A 1H2LA 4I0WB 4IV3A 4N53A 4QPGA 2XL9A 1QXJA 4AOCA 5FZOB 3VBOA 3ZO0B 4ZZ8A 2XBO2 1X50A 1PGW2 3NQHA 5BNPA 1RTVA 1W8UA 1AZDA 4AAXA 1PO22 2SLIA 3CJIB 3ZN4A 2P3IA 4FPOB 4XFGA 4YSFA 2IVJA 4OI2A 3H3ZA 5LATA 5KHGA 4R9CA 2P1BA 4SLIA 5D8AC 1PMIA 3WHTA 4V2VA 1MEC1 3ZDSA 4CEYC 4UFKA 4YGEA 1NXMA 4FPHA 2ES3A 2DVDA 3AL6A 4IEPA 3AMQA 1W6OB 5FZ4A 4YW4A 2VMCA 3ZX7A 2XB6C 2NP0A 4OULA 3B00A 3HNMA 4M00A 4OVEA 3VKNA 2X8KA 4BQ5A 2JDUA 5F6LB 2KXLA 1BK1A 4O65A 2R041 4XAEA 3AM2A 5FPZA 4FXKB 4CP1A 2CHHA 2WAAA 5DXDA 5D21A 1DGWA 2ARBA 2VBBA 3DN7A 4RS5A 3T2OA 3H42B 1J59A 4NIDA 2FDFA 3LSEA 1GMMA 4NO4A 1W6QB 1V6KA 4JTOA 1AYM2 3TNQA 1VPHA 5FMBA 4XURA 1L7QA 3VL8A 3D0JA 1US3A 1ULDA 3C2UA 2AEZA 5EFUA 2E63A 4GWNA 4Z8BA 1OQEA 2UU8A 1VBE3 4ZXEA 3PMEA 3W9AA 5JOXA 2NLRA 1H2MA 1TEIA 2HWC2 5K0UB 3K48A 3S7IA 2Y0IA 4A3XA 4Y4RA 1QOOA 2D98A 3IB3A 3IBMA 2Y64A 3LQCA 3CU7A 3JQXA 1SHWB 4LO8A 1AR62 4DEQA 4IUGA 3CBNA 3ILFA 4LUMA 2VVDA 4GMP3 1S0GA 2JDMA 1ULFA 4UFHA 1H1AA 3ZXFA 2CYFA 5A32A 5JLVA 1UQXA 4LBLA 4N43A 4M01A 1ENQA 4QX2A 2VOXA 3N9NA 4XCBA 4XBQA 1W9TA 1RUF3 1BBT3 1S0CA 3O1MA 3MIHA 5EJZB 1HRV2 3O1SA 2C4XA 2RR12 3OSDA 4LEJA 2XG3A 2ERFA 4D7YA 5JCTA 3H8RA 2FDIA 4CXWA 3BODA 3GHNA 2VZ3A 4Y4YA 4AQ6A 4IEVA 5BNPC 2ZGMA 3MHZA 1NX9A 2ZGPA 1YI9A 4Y5SA 1W6NA 1LHVA 2VU9A 2WRAA 1E5IA 1P8JA 4BQ4A 2OXBA 5A6QA 2WYFA 2YG0A 2VQUA 3ZXDA 3I49A 4K40A 1ZRCA 4Q4Y3 3ZPOA 5C9AA 3D82A 2WFF2 1B35B 2CGNA 4GD4A 1JU3A 4MXWA 1XYOA 1MEC3 1J3PA 2WNUB 3MEPA 2Z42A 1CAVB 2RE9A 2BRTA 4FP3A 4HKWA 2EA7A 5FWJA 4K1YA 2ZMLA 1JYVA 2JXAA 3V0BA 2E33A 1BMV2 4NHKA 1X36A 2QKDA 3X29B 3THDA 4U2AA 4CXXA 3Q8FA 4QAWA 1QH7A 3WV6A 1ZZCA 2R043 1WW6A 2XL7A 2HBTA 4EZHA 5FTTC 5B4XA 5JXIA 3EQEA 3FX3A 4LHKA 4KGQA 3RQ0A 1LJ7A 1MZ6A 1WA4A 4RGAA 2D93A 5DAPA 3ROUA 1V6NA 1LOEA 3ZXLA 3NKGA 4CEWB 4R8HA 1O91A 3FBYA 5F7UA 3VDDA 5BNQA 2J1AA 4BB3A 4A45A 4XFHA 4PIXA 3VN4A 5JAXA 1M4WA 1J83A 4JX0A 4KG0A 4E27A 1POQA 2V5YA 2ZCWA 2NPIA 1OA2A 3R0RA 4MLOA 2PA7A 1AUYA 1RMU1 5A7WA 5KHJA 1S0IA 1UY2A 1S0EA 1NCRA 1QHDA 4DIQA 1YJKA 1PGSA 3AC0A 5FCCA 1AXYA 1ZBA1 4UF0B 5HXVA 1WMEA 2O14A 2PTMA 4HN1A 4N43C 5IVBA 1AL21 2EAKA 2YY1A 4DO0A 5IWFA 2WC2A 4Y1ZA 5DABA 1W9SA 4CDWB 3VZMA 1F5FA 3FWEA 1TNRA 1VBE2 5FZOA 2VJXA 3AK0A 1QNYA 3EJKA 5FREA 4KG8A 3I2HA 4YVSB 4F83A 4EN8B 2UY8A 4F8AA 3DKWA 5GZCA 2XLFA 2LTNA 3CJIA 4ZY9A 3ZLIA 1PVC3 1LKNA 1W0OA 5F5AA 2GP5A 3FN9A 3IMNA 5FZEA 5A3NA 3K75B 1W05A 4H7LA 3KVBA 5EYYA 1IPKA 3M3OA 1UYXA 4FCAA 4O9EA 5CAZA 5C5TA 1WW5A 3FC0A 1GP5A 1DGRN 4NAMA 1DYKA 3VD7A 1KJRA 2JWPA 4AVBA 2RJLA 5E88A 5C9AC 3IAPA 4N9HA 2YROA 2LM3A 1RUF2 4X6RB 3U07A 1BBT2 1Y9MA 2D5HA 1VBA3 1XYPA 3WVJA 5C3OA 4BHPA 5FMDA 2G9GA 4OHVA 3B94A 1QY4A 3ZMNA 1RUI3 1WLCA 2DBIA 5LBFA 4UI9L 1UOFA 5CG9A 1MQTA 2G1MA 3OBTA 5FMOS 4COWA 2ZGLA 3QBQA 1W6QA 1XB9A 4HK9A 2YBKA 1OH3A 3ZXAC 4CCLA 1ENXA 1Q8PA 3EHKA 5DAQA 1ZBE3 2O0OA 2XUEA 4KL1A 3CZUA 5J09A 5FBJA 3VL9A 3N9PA 2B46X 4HL0A 2GN7A 4Q4W1 3ZYIB 2VUJA 4PLNA 2IXJA 4QB1A 1W9WA 3B93A 5K0UA 1MEC2 3NV2A 4Q5OA 4RFT0 4XFAA 1CPMA 3VDDC 1IG3A 2W46A 2OZ6A 1V9U3 1N3QA 4J1WA 1AR71 1C5IA 1JOBA 2Y6FA 3LA2A 4P5YA 1RUH1 5FZFA 4HSLA 4XETA 1YFUA 1XNCA 1UZZA 3R4SA 2C1FA 3VBHC 5FYIA 3M70A 4GALA 5A70A 1GWMA 2TBVA 3THCA 1I6XA 1UXXX 2HH9A 4NWVA 2R042 4XJ9A 1HRI1 1NCRC 2DYCA 1CAUB 4HKLA 5T5OA 2VUDA 2VM9A 4FTBA 4QQHA 4XOGA 5FKCA 1OQDA 2QQMA 2ZMKA 4AVVA 1HXS1 1RMU3 1WW4A 2OQ7A 4HOOA 5FFOC 1PZ7A 1Z0HA 3NJXA 4CUAA 1C4RA 2W1QA 1W8TA 3E6DA 3RGBA 4DY5A 5KC6A 1RUOA 4JGZB 1ZBA3 2E26A 4XDPA 3ZN5A 1UXZA 3O0WA 3IT8A 2IXIA 4V2WA 1GV9A 1UZYA 1AL23 1GNYA 2DVGA 2QQJA 2VZPA 3SCFA 4A7KA 4BE3A 2FDKA 3CJIC 4ZXKA 3F95A 2XOMA 1NA1B 1IPSA 2LUWA 2DCTA 3PLQA 4FSJA 2JG8A 2A71A 1RUE1 1TG7A 2CSGA 5G04L 4GJZA 3VD3A 1QEXA 1B35A 2HJIA 1UMIA 5C7GA 1QF3A 2VXRA 4NROA 4K6BA 3MIBA 1FYUA 4XJUA 2V73A 1WLDA 3GALA 2PLV1 3QACA 1U5ZA 2BWAA 2WNUA 3BIWE 1OVSA 3NV1A 1CWPA 3ETPA 1LTEA 2DF7A 1DQ2A 4OCTA 4OQ8A 1KS5A 4S2GA 1A8DA 2Y34A 1WKYA 2D5FA 1PVC2 3H8OA 1CVNA 2PELA 1RUG1 3ZKUA 3ZSKA 3AP7A 2Q1MA 3MFAA 2GAUA 2AACA 2J1SA 4FAGA 1WA6X 4M3CB 5CKQA 4CDXB 2ZGOA 3T2QA 5EIYB 4KU7A 4FTEA 1VIWB 3KT4A 3P1IA 4MSVA 5A3UA 1E5RA 3T4VA 5C71A 3WF1A 4AXOA 1VAVA 4OHYA 1CAWB 3MZHA 4RQPC 4D7TA 1VBA2 1XQNA 5EXOA 1EYBA 1GR3A 4N8MA 5K0UC 5CKNA 1RUI2 3ON7A 4W6WA 3MV11 5I0DA 1QNWA 4LKSA 4AVSA 1Z7S1 4Q4W3 2RG4A 3SNMA 4QKFA 5FZAA 5IVFA 4LUKA 1UN1A 3WG2A 2KA3A 4ISQA 2C26A 2JDAA 2P34A 3F2ZA 5T55A 4NIIA 1BVVA 4GZ9A 5BV6A 1OFSA 1SLAA 2Y33A 4LE3A 4UF0A 5SV5A 5GALA 4IETA 1RUH3 5FV3A 2Q1FA 4CP2A 1JMUB 5JWPA 1FXZA 1KFXL 4MG2A 4IE4A 1ULGA 4NRPA 2MEV1 4FQZA 4CDWA 2OUHA 1VRBA 3FFQA 2VVEA 4W50A 1WCQA 2DUPA 4IE6A 1YFXA 1LU1A 4YVSA 3SEPA 1CGPA 1HRI3 2Q8CA 5FY9A 1LAJA 1UWWA 3LOBA 3S30A 1ZZ6A 2NZ9A 3AKTA 4OHXA 1VBB1 1FMD3 2CY6A 3ES1A 3C7EA 4I0AA 4YM3A 4Z2AA 3G7DA 4IGQA 3UJQA 2IXLA 1CONA 1GP4A 1IHMA 1PIV3 2WZR1 3GM8A 1HB3A 3HAGA 4C1WA 1I9RA 5BPXA 3KQRA 3OGGA 2R32A 1LEMA 1X9PA 3K4AA 4JHTA 4EQVA 1IQAA 2C6SA 2R16A 4AQ2A 5CBLA 2HEWF 2D7FA 3JQWA 5KC5A 1B35C 3WEZA 3Q9OA 1EY2A 1UU6A 3CQOA 1RUE3 1RMU2 1LNSA 3PUQA 5DN2A 5L7OA 1HQLA 5FYTA 1YLLA 4Q4V1 4XBLA 1G9DA 3UNPA 2C24A 2WNUC 5CNAA 1ZBA2 3RZZA 2XVKA 4K8RB 2E32A 2ZJCA 2PHTA 2WNOA 1AL22 4UWDA 3RDIA 5ABJB 1US2A 4DNYA 2PLV3 3K46A 4S2HA 5F2SA 5FZCA 3FHAA 3JD71 2GZWA 2PHWA 2ZGQA 1W6MB 3I3DA 4ARYA 4LA3A 2HWF3 5CFDB 1K5JA 3KCYA 4CU8A 3Q8AA 1RUG3 3NL1A 5B4NA 3BTZA 1AVBA 2VE1A 4CEWC 4JZRA 4GKYA 4Q26A 2A6WA 5I0TA 4RSUA 1H1IA 1G9BA 1JUIA 1R1A1 1Q5OA 4ASLA 1XE7A 3C7OA 1IPJA 4YZ2A 4GA9A 1H2NA 1O4TA 1BCXA 1JYCA 1BQPA 4R4XA 2JIGA 3MLKA 1YO8A 2VZTA 3FUOA 3IWZA 3LIGA 1F2NA 1W99A 4PBPA 1RVF1 5DUXA 1VMJA 3MV01 1JXNA 1DZTA 1UMHA 2ZMNA 5GLVA 3M2MA 2YPDA 4QGMA 1CAUA 4AYUA 3LDBA 4GMP0 5CU1A 1YWKA 3ZR6A 1HJFA 1KXGA 1Z7S3 3ZSMA 1WLWA 3WG4A 4M3CF 4A4AA 3TEWA 1YI7A 2ET1A 4A44A 2GDFA 4XJAA 4C0BA 3VBFB 5FYHA 4KWKA 1DYPA 5LBCA 3FZ3A 5EWSA 4YVSC 1ST8A 2XVGA 1D2SA 3S5AA 1C1FA 5AC93 1O8SA 1RUD1 3AP5A 4Q4W2 1NA1A 3VKFC 3HT2A 4XMAA 5J7MA 1SPPB 3CKHA 1PZ8A 1URXA 4LXLA 1UOBA 3TYJA 1KJLA 5J96B 3PVEA 1PGW1 2DBNA 4QXBA 4FFHA 1O4YA 2HBUA 3OUHA 4JAAA 1VBB3 4XXAA 1QOSA 1RUH2 2VW2A 3OPZA 1PO21 4XUNA 5JMCA 1WD3A 1MS0A 3ZXEA 2PHFA 2X53S 2H6CA 1OOPB 1CQ9A 5BY5A 3OY8B 2X5IA 4D94A 3POWA 3RPQA 2BNNA 2K46A 4N7UA 1HRI2 1QKQA 3RWKX 1WD4A 3M8LA 2JDYA 5J1XA 2JDNA 1W6PB 4NVPA 3H8XA 2C9AA 5A3OA 1FMD2 3WNKA 2J1TA 4G9SB 5E89A 4YYOA 3WDYA 4QHOA 4E4ZA 2WT1A 4YARA 3I4IA 2FZ1A 4M3CA 4CDXA 4Q4V3 1OBNA 1PIV2 2VL4A 3THPA 5LA1A 4YW5A 3BTYA 2WS91 4ZU5A 4WVZA 2Q8OA 2P6HA 1NCQA 1MS5A 2BYVE 1W06A 1F15A 1SLBA 1U5XA 3H7YA 4I0BA 3JD73 1CAWA 4N53B 4IV3B 1EUUA 4QHZA 1RUE2 4QPGB 1W8HA 3W20A 2WIIB 4UW6A 1CZVA 4IEWA 4HPKB 4F3JA 1AYM1 2RV9A 4FPCA 1W2TA 2DVAA 3RRDA 4XVHA 1JZ3A 1RUNA 3VBRC 2QUOA 4MGSA 1LOBA 3ZYHA 5JOWA 2BFUS 1PNGA 3ACGA 1VB2A 1RGSA 3AMNA 2B42B 3PU8A 2PLV2 2A1XA 1R1A3 4UXAA 4ES8A 5AFEA 5FXVA 5JIUA 4UBGA 1IKQA 3FL7A 4XXPA 2QNKA 4Y1YA 5A7QA 1W04A 4BQYA 1CIYA 3C8XA 2FMYA 1LENA 1UYZA 1IKPA 2RMU1 3LPGA 4TWTA 5DUWA 1RUG2 2RM21 1RYYA 4XTPA 2VCAA 2PYTA 2RDQA 1JI6A 1RB8G 2P3KA 3D8CA 4Y22A 1I5ZA 3RJRA 5FMCA 1SFPA 2CWSA 3AZXA 1JZ5A 4JGZC 1UX7A 2ZX2A 4LMFA 2QJVA 2GC1A 1GZWB 2BBAA 2WZEA 3E1F1 4QXHA 4NRMA 4RS5B 2NMOA 5F3IA 4RGGA 3RJ2X 1CJDA 2PAEA 5C33A 4AGRA 5ANNA 2RR11 1NA1C 3J9SA 1QJU3 1XRUA 1JW6A 1CX4A 2CDPA 2Y6HA 3U4XA 3RFRA 3GZTB 4OI1A 4PI0A 2VOTA 2JE7A 2PFWA 3GCXA 1FNZA 4Q0UA 2BU9A 5F39A 3H1MA 1Z7S2 1RUD3 2AREA 1F9KA 4FFGA 3RMYA 2PHRA 4DMIA 1JH5A 4BQ1A 2VCBA 2VCMA 1OLRA 3ZPYA 1MPXA 4MV2A 1QJZA 2RS51 4YFWA 4TYSA 4JQTA 1O3TA 4RGKA 4IERA 2VPVA 4CRQA 5CFCC 4UAPA 4Q0QA 5DAWA 3USUB 3HD8B 4LIUA 4C91A 1VB4A 2B7YA 2PHXA 4DRVA 4FAHA 4DUWA 5LASA 2ZX1A 1U5IA 4MHRA 3ST7A 5AC92 2ZKNA 1HIXA 4W6YA 1WBFA 4OZOA 2VMFA 5GLZA 4C1XA 1OQ1A 3FUQA 4GQ7A 3I2DA 5CFDA 3FBMA 4MH0E 4GH4A 5T52A 4AHZA 4CDXC 1KEXA 4K20A 4INDA 3ZSEA 5CISA 3W58A 1VBB2 1PHMA 2QQIA 2UYAA 2GMEA 2WAOA 4DUXA 1BMV1 1I5PA 2IZWA 3OBAA 1LGCA 2FQPA 3WQBA 1E57A 1ZA4A 4JKKA 1C8M1 3OYWB 5TSWA 3V65A 1H2KA 2ZAAA 2WS93 3NJVA 4XMIA 2D3PA 4R9BA 3BVCA 1L7LA 2Z4FA 4KI5M 2GU9A 3BUCA 5F6KA 3LA3A 2G4IA 1HJGA 1W6NB 2B9VA 3P6BA 2WT0A 4LPLA 2W92A 4M0HA 4AHYA 2DTYA 4QXKA 4XQWA 2DUOA 3M3EA 4Q4V2 1JOPA 1RJ8A 3Q8EA 4IEQA 1E5SA 4D6SA 5FOBB 1YCIA 5IFTA 4QD2A 3N4MA 2AC1A 2ZABA 2BOIA 4Y3OA 3WNXA 1KRIA 5LA2A 2ZS6B 1NY72 1REEA 5JPNB 2QQVA 4CUGA 3JD72 4QMAA 1OKOA 4QPIC 4R9AA 5A80A 3VBFA 1S0DA 3D4KA 2TEPA 4HKOA 5AVAA 3U10A 1BK0A 5APAA 5C4WB 2RMU3 5F3CA 3O1VA 4DS0A 5J3UA 2RM23 5FQ0B 5FY0A 1BYHA 4BISA 1SPPA 5F37A 1ZZ7A 1OKQA 4AWDA 2QDNA 5T50A 1R1A2 1DHKB 1S2KA 1UOJA 2W2IA 4TSVA 1BVP1 1UIJA 2TUNA 1L3JA 4QM9A 4TN7A 5L19A 4XFIA 1XSRA 2WKKA 1X8MA 4J6GA 2P17A 3SISA 4E9KA 3RZMA 1OD5A 2B9UA 3PUIA 5HCFA 1OOPA 4A2UA 3A23A 5K4LA 5BUVA 3OY8A 2WSUA 4K9SA 3OJBA 1GZTA 3WP3A 5C3RA 2K0GA 3VBSC 1UKRA 3NJZA 4EN0A 5DZEA 1AJKA 3B01A 5IVJA 2VBPA 1JTZX 1B09A 2OT7A 3I2IA 4JQRA 5ABJC 4A41A 4QKBA 1KGYA 4PLOA 5IHRA 2P3YA 5A7WB 4FOQA 3VV1A 5LBBA 1QJU2 3RZKA 2YC0A 3DECA 4OUMA 5CFDC 3S0MA 2F6BA 4WBBA 3V0AB 2XKOA 1RUD2 2WSVA 3DPRC 1D7PM 3GBWA 3KF3A 4ASKA 3AKSA 5FK7A 1JZ6A 2LROA 3R6SA 5C6CA 4HPKA 4LJHA 1ND3B 3OB8A 4LOSA 2JDZA 1NUKA 1LHNA 5LRRA 3GJAA 1UIKA 4Q4Y1 4Q0PA 1BEV1 4XBNA 4Z1VA 2RS31 2JG9C 2CAUA 1C8M3 1GLHA 3AYEA 3R05A 3ZFFB 1LU2A 3S7EA 5FYBA 1Q3EA 3SH3A 4QQPA 4PDWA 1DZRA 4QU2A 5C3PA 3U4SA 1KITA 4D0QA 2WYSA 2J1EA 2WINB 1FAYA 4BXFA 4W8JA 3HNBM 4QGNA 2EXKA 4JV4A 4LBNA 2P4EA 1UYYA 3CHXA 2K2SA 4Z92B 1DF0A 2EXHA 5FAXA 2BV4A 5T3NA 1AXZA 2A6XA 2GC3A 3VBFC 1G86A 4FBFA 2JD4A 1PZ9A 1VALA 2WS92 3JBG3 1D4M1 3J4UH 4OYUA 3MIFA 3WF3A 5A1AA 1GZWA 1FT9A 5EV7A 1MQTB 4YGCA 2VTXJ 1FATA 1UF2C 2VMEA 2WNVC 5FYUA 3DF0A 4L8QA 2AH2A 2VMDA 1JZ4A 4FPFA 2ZX0A 4XAAA 4CDQB 2VY0A 3LWCA 3FJSA 1NT0A 2YU2A 4OQ9A 4RYDA 3TNPB 5I8YA 2WA3A 4MX3A 4WM8C 2BTVC 1JU4A 3WNPA 4AVTA 5IK4A 1IS6A 3LFIA 2W1WA 3N9OA 2V5DA 3HBKA 1WMXA 4UT5A 1OOPC 2CGPA 4ATEA 1PK6A 5FBZA 4YW3A 1G9FA 2V4VA 1F35A 3MDPA 3GDBA 3USUA 3IM0A 3HEIA 2ZGRA 2OVUA 2RMU2 1VBC1 3HNYM 4AVAA 4XTMA 3AKRA 2W91A 2RM22 2WBKA 3N7KA 3B69A 3MLJA 4CCCA 2GH2A 1YHFA 4N90A 3H7JA 4ZS2A 1SACA 1VP6A 3VBUB 1Y9GA 4XQDA 3WQ0A 4ZKTB 4URTA 3K77A 4X8NA 1DLCA 3HVDA 2DFBA 5FP8A 3M3QA 4Q0SA 3OPWA 1ZNPA 1W3XA 1PVC1 4E4SA 5AFBA 1LHWA 4MGIE 4HG6B 4PF1A 4Z07A 5ERLA 4EWEA 1WW7A 3OYWA 4N53C 4IV3C 3J7HA 4QPGC 5GLWA 4FOYA 4COVA 1SQ4A 3WHUA 5GLUA 4LBJA 3VBOC 4XJ8A 1EPWA 3B5LB 3ACHA 4KU8A 1PVXA 3FLTA 4XZPA 2E53A 1H8VA 3CNAA 4LBQB 1VBA1 3UKVA 2JG8B 2RS52 3LEKA 1ZREA 1O3SA 1GU3A 1GOFA 4IDZA 3HMYA 3RSJA 1RUI1 1HX6A 3RYPA 1BEV3 1VMHA 4AI3A 2RS33 1ODNA 4XFBA 4OUSA 2BVBA 4EZ4A 3VDBA 4AGVA 4PIYA 1W90A 3AYDA 2UURA 4FPJA 4RD7A 3RYRA 4ZS3A 5EP9A 5C4WA 1ZBE1 2XUMA 2EIBA 3DEMA 2Z79A 2GSYA 3AX4A 2QQWA 5LB6A 5LK7B 3PNAA 5FQ0A 2QFEA 4RS5C 1WMFA 3PHMA 4JDOA 1QIQA 1GOGA 1C8M2 1VJ2A 3VZJA 3ZYFA 5EZWA 1G9CA 1D4M3 4LK6A 1SG3A 1IGOA 1GQGA 2AEYA 2QDRA 2ZZQA 1SEFA 4XHXA 1V9U1 4AFCA 3IKWA 1E5HA 4HT1T 1J3QA 1YEWA 5DDJ1 1VRH1 5FZ1A 5FPVA 4A6OA 4YW7A 4IEUA 2B5HA 1W9FA 4AR2A 4QB2A 3BPSA 1HN1A 2CDOA 3UT0A 4YLZA 5JSPA 1LHOA 1HLCA 1X33A 4CTEA 3QLQA 3MUZ1 3IAQA 1D2QA 3POJA 4LULA 4Y1VA 2D40A 3AL5A 5F3GA 1UZWA 3WSOA 4E2QA 4XF3A 2Q1ZB 5FZKA 3AXEA 4Q8LA 5FY7A 1NXD1 5DG2A 1BJQA 4BMEA 4I01A 5HCHA 3UGHA 5KHKA 3V0AA 1VBC3 2CGOA 4WV8A 1WCSA 3AZZA 4DOUA 3MGUA 5IK5A 4N7IA 3HN3A 4EYUA 3IPVA 1ND3A 1OUXA 3ZVXA 3U11A 3MF9A 1SFNA 3H1YA 2VZ1A 1W2NA 4RA0A 1DLLA 1EV13 1QQP3 3EB7A 5FY1A 1PMHX 1H8TB 3I3BA 1O59A 5A7SA 2YYOA 1YQ5A 5L9RA 4KGGA 3U14A 2BNMA 4CPBA 5JSOA 3ZFFA 3LEGA 3BB6A 3FHQA 3T4HB 5C70A 5KHIA 1LOFA 2E7QA 4XEZA 3ZYRA 3ES4A 1JZ7A 1RJ7A 2EIDA 4AI1A 5BNNB 1PX3A 2JECA 3QH6A 1HV1A 2DCZA 3ETQA 3HWJA 3J26N 5JDBA 1J84A 2RDNA 4MGTA 2QZ2A 4BA6A 5L7OB 3PVBB 3LAGA 1CAXB 1G6NA 2QVSB 1U0AA 4PI2A 3RNSA 4EE2A 3TEZA 1DDLA 3I54A 5F5CA 4YPJA 4ITCA 4D7SA 1ACCA 2WLQA 4E4DX 1R1ZA 2EIGA 3Q8BA 3RI9A 4LBOA 3WP5A 4A7ZA 4KNCA 2W08A 4IV1B 2D3SA 2FCUA 3A4UA 4CDQA 4DZGA 5A3PA 1N3PA 3WQ1A 2HWB3 4Q4Y2 4XILA 3OBRA 1BEV2 1FPN1 5KBFA 3LCPA 2RS32 3GZUC 2PQSA 5FR3A 4Y5Z0 2XLGA 4PHZA 1W8NA 1EAH1 3N7JA 5E16A 3WW1A 5LZ6A 2VVFA 1AYN3 3ZMOA 2VUAA 1NKGA 1W0NA 5FP3A 4IGPA 5I8TA 2ZEWA 5DDJ3 1VRH3 1RITA 1W8ZA 4UFIA 1LGBA 2A3YA 2YU1A 4YVWB 3RZLA 4IGOA 2EIEA 2BOJA 2DCJA 3S57A 2QBXA 3VBUA 5E8AA 5FY5A 3W5MA 1UPIA 3WOGA 4Q4X3 4IXLA 3VHOA 1GKBA 1D4M2 5HCBA 1ALYA 3WDXA 1XYNA 1XNAA 1FMD1 3AP4A 4TXWA 4IEYA 1RUJ3 1OPMA 4LKDA 2J22A 5FYSA 1PIV1 2AGSA 4EJRA 3VZOA 2GC2A 2V4AA 5JZGB 2VTXA 5LWBA 4L9BA 1LECA 2JDPA 4YG6A 1BHGA 1ASJ3 1YYNA 2OPWA 1LODA 5H9QA 4MGKE 3N7LA 2L9LA 1RINA 4LBQA 1GICA 1YIPA 3D3AA 4KQ7A 4PF5A 3I2OA 1R64A 5A7OA 1TNFA 1UZ0A 2W39A 1LOFC 1DQ0A 4L2NA 1TMF1 1VBC2 5DUVA 5SV8A 5HBAA 2A75A 4AI9A 4AEMA 5A7NA 3DYPA 4AZZA 1GP6A 1KQRA 4CCNA 1JYXA 4NPRA 2X5IB 1WBLA 1QU0A 1JOJA 3A22A 3MI8A 2HWF1 1MS1A 3O7OA 2Q4SA 1IOAA 2R49A 2DTWA 1EV12 1QQP2 4Y20A 5FZIA 1MQTC 1A3KA 3KV4A 4H7MA 4P9LA 1TVGA 4MYEA 3OGRA 2ADDA 1W2AX 2Z5WA 4ARXA 2I74A 2ATFA 4FVVA 1XSQA 1NCQB 2G19A 4XFCA 1JZ8A 1UD1A 1Q43A 3POFA 1D0GA 4LBMA 2IFRA 1MZFA 3HIFA 1A78A 3I2KA 3N9MA 4Y26A 1L7RA 4HK8A 1BLZA 3VKMA 3AKQA 2R0HA 2VOKA 2OYZA 1H0BA 4CVUA 4PIZA 3SH4A 1FPN3 3FMGA 4FT8A 4G3YC 1HB2A 2OIIA 3WW3A 1EAH3 2VO5A 4CPBD 2VQTA 1UAIA 2R1DA 2I45A 1NQDA 2J7MA 4BQWA 2V09A 1O3QA 2P6CA 4A42A 1AR93 2ARCA 4D69A 2A73B 2TNFA 3T2TA 2O8QA 1DQ5A 2E7AA 3VBUC 4BM8A 3GZEA 4U36A 3VKOA 5CB7A 1ZBE2 2VR4A 3MW3A 5D1IA 1YFYA 4YZ5A 2X29A 2DCKA 2XJPA 2E7TA 3KZ4C 5DQ0A 4Y1XA 2BERA 5JR7B 3URFA 1DGRA 4GAZA 5K7PA 5AC91 4FPGA 1LESA 1AYN2 2WL1A 3HOBA 4NWWA 4Y22B 3INAA 5FLIA 4YGDA 3NW4A 3R4UA 1V9U2 3KV6A 3LEMA 4NPMA 2IXKA 3BYWA 1H8TA 1VRH2 4LORA 1UY0A 5DDJ2 4CCEA 1K5MA 3NNLA 3QCWA 5FDBA 3OBZA 4QXCA 2JDHA 2O1QA 1RL3A 3KF5A 3MYXA 1NE6A 1UX6A 3H0OA 4DXRA 2GC0A 5I8SA 2DURA 2JENA 5GZFA 4E8CA 2JG8C 3SITA 4Q4X2 2V72A 4NN0A 1DZQA 2F4LA 5A7PA 4CDUB 5BNNA 2AUYA 2YUEA 3OD0A 3MF6A 2KR2A 3UYJA 3WZ1A 3A0KA 3WF4A 1H30A 2W3JA 4LIVA 5FZLA 2YFUA 2Y6JA 4AEJA 5C8CB 5FPBA 3ENRA 5LA0A 1EP0A 2LRPA 1CAXA 4KWLA 1AF9A 1XNBA 4P02B 4HZFA 2QE3A 1F5JA 2BVVA 1TMF3 2VCCA 3DGTA 3GBGA 4H14A 4XF0A 5FZ0A 5C5UA 2PN5A 1NY71 4K8FA 2IXHA 4C8DA 2MNGA 3HJRA 1K45A 3O1PA 2K9ZA 2FDJA 4IV1A 3UKNA 4C0HA 5T5LA 3ECQA 3ZOIA 4Q2FA 3T1MA 4K1ZA 4GH4B 2W95A 2OS2A 5DPNA 1V6OA 3GGLA 2D6LX 5A33B 4AW7A 4BU2A 1NZIA 5A3LA 3M3CA 3AJZA 1APNA 3BOWA 4COYA 2YBPA 1YQ6A 3LB9A 3N36A 2Y6GA 4MGZE 3RYKA 1JYIA 4DPNA 1KDKA 4YVWA 4LBQD 2C5DA 1JYNA 1DIWA 2BJSA 3LE0A 3NV3A 4MADA 2FD8A 3UESA 1K3IA 2HWE1 2YZ4A 1V6MA 5IVYA 4X6QB 2FZ2A 3LFMA 1VBD3 5FPAA 4MVTA 5K8SA 2Y26A 1X8EA 3R4DB 5GZEA 3E5XA 4Q1RA 4QX7A 4AEKA 3BCWA 1OD3A 1Z78A 1GWLA 5H9RA 5KHHA 3B9IA 4W65A 2W94A 4CUBA 4CDWC 4P5HA 4BWOA 2ZHNA 5ACA3 5JZGA 1QJU1 5L9VA 3RZGA 2LALA 1QJX3 3TOJA 1FPN2 1XE8A 1QJFA 4P9IA 5A3WA 1VAKA 4QQ2A 2CAVA 1EAH2 2R6QA 1H8TC 2VOWA 4MHUA 3T2PA 4CYDA 3S6PA 1RIRA 1GANA 4WZFA 2VZVA 4D8MA 1AR92 3H3UA 2VNRA 1I1EA 3BKZA 1HB1A 4UW4A 4Z2WA 1X7NA 1TQ5A 3PJYA 3M1HA 2ORXA 3FLPA 4UOJA 4NHYA 1YC61 3MLLA 1HN0A 5BNNC 1DYOA 3ABZA 5F5QA 2VMGA 5LRSA 5FP4A 2WQ4A 4DEVA 3AXDA 4B4RA 1F31A 5HV0A 1W0PA 5L7OC 3AZVA 2HWD1 2W0XA 1H6XA 1XNTA 3ACLA 2QCSB 3CZJA 1W03A 2EVXA 4PQQA 3T3YA 3WDTA 3MO4A 2P37A 1CZTA 2CWMA 3PUAA 1ULEA 4PBOA 2DVBA 3I3EA 4NMIA 3ZDVA 3JXSA 4PT6A 1LOAA 5FY4A 2MHFA 4IV1C 3MIGA 4V1PA 1UZVA 2VGDA 2VUCA 4ZONA 3VDAA 2ZTNA 4JRLA 5FZMA 4HFSA 5EQUA 4Y33A 4W6XA 4BOWA 3MW4A 4QGLA 1N1VA 2F4PA 3BGAA 3JCIA 5KXEA 5FO8B 1WLTA 5H9PA 4BCUA 1ND2B 2E6VA 1T6BX 2XQRA 3D5OA 5JXJA 3OTFA 5CADA 1TMF2 4ISRA 4BQXA 5A3TA 2Y8KA 3WY6A 1DBNA 5FPXA 4YVWC 5FPUA 3KLSA 4GULA 5DZFA 1RUC3 1SLIA 5IUQA 1N1SA 3U78A 3T0AA 2HWF2 4PDWB 5A6XA 2UWBA 1LB2A 2ZGTA 4JGYA 1W2UA 4IL7A 2BBVA 3NNJA 4E2SA 2Z2SB 1IG0A 2KD7A 4KWUA 1LEDA 4NIGA 3T0BA 2HWE3 4GKXA 2IUWA 3MIEA 2VOVA 3WP4A 3L9JT 3KWVA 3QH7A 1W28A 2QTWB 1JBCA 4BK5A 3OCPA 1S55A 3I59A 3ZFGA 5JZGC 4E2GA 3M4FA 2JEMA 2QQUA 2PQQA 2IWGB 2ZGUA 3I8TA 1UW8A 5CEHA 1MS8A 4S2FA 2G9ZA 4CDUA 3DV8A 4OMCA 5A3MA 1VBD2 2ZACA 2XDVA 4K21A 4LO4B 3VHPA 1POV3 4PJYA 5C8CA 1PM7A 1VE0A 3VD5A 4LITA 5LY2A 5FMOL 1ZRRA 1QDOA 3SEEA 1PK6B 1MZEA 2X5IC 3GXUA 3Q8CA 5DG1A 5EJ1B 1KFUL 3PTRB 1J3RA 1QJX2 4EV0A 3U75A 3P3PA 2GMMA 3WNOA 4CCKA 2JE9A 1TME1 4B1LA 4JTNA 3BOPA 4ZU7A 1XPWA 4HETA 3VD9A 4JCKA 2WN2A 3A21A 2D97A 1UO9A 2HWD3 4CCOA 3WP6A 3VZLA 5J98B 4CCJA 1QJEA 4ZU4A 3LDRA 5F3EA 5A33A 2OUJA 5IVCA 3E6CC 1NCQC 4I02A 1AX2A 2RDRA 1PGL1 4HLTA 1AL0G 5C3QA 4KBZA 5JXHA 2XBO3 5IJRA 4FPYA 5I0RA 2BGCA 2R071 2Y6LA 3AKPA 3ZM8A 4YM0A 1GFF2 3H3LA 3VUOA 3H50A 3MBWA 1UMZA 1AHSA 4QB6A 1ZRIA 4B7KA 4BMBA 3NJYA 2WNEA 3OD4A 2WR9A 3KGLA 3L2HA 1IS5A 1X9TA 2SBAA 5BNOA 3WF2A 1W2OA 4FPLA 2A70A 1MACA 2OW4A 4R52A 2MPFA 4XW3A 3UGFA 4XF4A 1NLSA 3JBG1 3I2GA 3LOIA 4XACA 1YJLA 4BZ4A 5FPLA 2PAKA 4OFGA 3RMXA 2A6VA 4XYXA 5JI7A 1C5HA 4BLJA 5CG8A 5LEKA 4URAA 1OLME 1RXFA 1V00A 2RVAA 1DGLA 1XNDA 2E31A 2OX0A 4DY3A 4XHBA 4W4ZA 3T09A 4CU6A 2VD7A 2QQKA 4IQPA 5AVPA 4BPZA 3BU0A 1XNKA 2HYKA 4LO5B 2W68A 1C3HA 5D8AA 1HKDA 2XKPA 1QH6A 1R091 3NNFA 2A3XA 5IK7A 1SDDB 3NSTA 2NYYA 1WZXA 1CZSA 3GJBA 2YPJA 5FLJA 2BGOA 4JVAA 3AFKA 4YGBA 1JUHA 1NAEA 2VMIA 2YFZA 4LQRA 2JDKA 3HPNA 2OA2A 4B4PA 3RS6A 4H2AA 3PU3A 1UKGA 5EHDA 4AK3A 5IVEA 3VGIA 4AI2A 5EPAA 2HWE2 4YWAA 1D4VB 2RJKA 3MFCA 4QDQA 3POSA 3AFGA 5FYCA 2R063 3OGJA 5FO9B 2DFCA 1UY3A 4NR1A 5I93A 1PO13 1FNYA 3AMPA 2B45X 4WM7B 1U5YA 4B29A 4LBKA 4ZPIA 3JB8A 1JN2P 1UU5A 3U1XA 5GKAC 4D6QA 4A3ZA 4I2OA 3J8F1 1HQWA 1RXGA 3O5SA 3OEBA 1XBFA 4Q0VA 2XR4A 5GZDA 4GH4C 2AENA 3BTAA 3QD6A 4YG0A 1O7FA 2HEYF 2ORZA 5F9TA 3O1RA 4AQTA 3THTA 1TME3 4KMQA 3DL3A 4B3NA 1ULPA 2BWCA 4HN0A 3SHRA 4CUCA 3IPVB 1ND2A 3MIDA 1SBEA 3SXWA 4AFDA 2GH8A 1C28A 3I2JA 4RHV1 3LA7A 5EYXA 3AZYA 1JZ2A 1O3RA 3JZVA 1O6UA 2R073 4K7JA 2WQ8A 4AEDB 1QMJA 2HYXA 4QX8A 4XE9A 2WFF3 4P9GA 1AJOA 5IAVA 3CDZB 5FYYA 3WUCA 2HWD2 2CL2A 3A7QA 2ZX3A 3VKLA 2JIJA 3ZR5A 2VAUA 1TZOA 4RFRB 1UU4A 3GYDA 3AP6A 3V64A 5GM0A 1GZ9A 2BUKA 3PVNA 3ZYJB 2JKXA 2YC2A 2YV8A 2BDRA 4LO6B 5FJHA 1NQJA 3PIGA 1GYKA 1NG0A 2VG9A 4DQAA 3KHCA 4H55A 2R7EB 3K4ZA 4X8PA 2ENRA 1GOHA 2GMPA 2PHDA 1XJAA 4Q29A 4HVOA 5FP9A 2DDUA 1AR81 2R1BA 1O4ZA 2WUHA 2ZGSA 2I07B 2ZGKA 1UOGA 2XJRA 4ET7A 2ZX4A 1Y3TA 1S1AA 3JB4C 2PMWB 5KWRA 1SLCA 1OF3A 3PTYA 3E5UA 4M4PA 5FZGA 3MUY1 1H9WA 5IVVA 1R093 1UY4A 3LF7A 4DRRA 3O1UA 2YHJA 3I3QA 3ZXJA 3VDCA 1QJY3 1IS3A 4JKMA 4QDSA 2DU1A 3FLRA 4EN9B 5FZ9A 2RDSA 2E51A 4TLGA 4YW6A 3FHIB 4MZUA 3MW2A 1W3VA 2G9FA 1CR7A 1TE1B 1V6LA 2N7GA 1XE0A 1SMVA 5F5IA 3IIIA 3RZHA 3NNGA 4EN6B 3SC7X 1QGLA 3ZFEB 2WZ8A 3HT1A 4HSJA 3LZZA 1RC6A 4QX0A 3POBA 3I7DA 4JDNA 5DUUA 3HBZA 3DXTA 1PNFA 3VLBB 4FFIA 1BKZA 1EV11 1QQP1 1S2EA 4QPWA 4RR3B 3GNEA 1KDMA 2VTFA 4I30A 4RQPB 4AFMA 4KH9A 2YGMA 3WDWA 3J8F3 3NWKA 2FHRA 4G4FA 3CJXA 1LRHA 1UNBA 2R062 3N35A 1ND2C 4WVMA 3WUDA 2DCYA 4EWAA 1PO12 3POYA 1H6YA 1WCKA 4LR4A 3WCSA 3H8UA 3IIAA 3PVOA 4QWNA 5FWEA 3WNMA 5EJ3A 1QDCA 3ZN6B 3W59A 1O5LA 2PHUA 2ZPXA 5IATA 1S0FA 4YFZA 3ZSJA 4QDRA 1Q8OA 4AF9A 2Q8DA 4RHV3 2VECA 4PDWC 4XUOA 2WFPA 5FZDA 3WXPA 1T6GC 4P9JA 2WZPP 5J36A 5FRAA 2VMHA 1SZBA 2A6ZA 1TME2 1JHNA 2AZ5A 2C9KA 3M7AA 2HKXA 5GJ6A 5J37A 4Q8KA 5HPOA 1DFQA 4HONA 2WO7A 1CPNA 4OI4A 2RS13 1X82A 5C8WA 1IZ3A 2ZOEB 4HANA 2HWB1 3AYAA 4XZUG 3ZXKA 5L36A 3WQ7A 4FPEA 1NOVA 4Y20B 2BP6A 1PGL2 5T54A 5F2WA 1OF4A 1XC6A 2DVFA 2OZJA 1VMFA 2R072 1AYN1 1QXPA 5FUPA 1CX1A 1ENRA 3AVRA 3EBRA 4B1MA 3BALA 5BXXA 4TZDA 2PAMA 2P2KA 2ZEYA 3N7MA 2NN8A 3MPBA 3IMMA 3WDUA 2J1RA 4LT5A 1AR83 2CV6A 4GIQA 2QQPA 3O0VA 3BU7A 3KVAA 2P3JA 5KR7A 4EN7B 5LA9A 1CJPA 3DXUA 4Q4X1 1PK6C 3JBG2 4JHZA 2IVIB 3KB5A 3ILRA 4WM7A 3ZFGC 2CU5A 3KCCA 4META 1NZCA 5DZGA 4EROA 1Y4WA 1PMJX 1Y9QA 1WMDA 1YFWA 3LD8A 1RUJ1 4GJYA 3M3IA 4AVCA 5A6ZA 4P9XA 3LDKA 5FY8A 1KD7A 2XJSA 3IDAA 2B8MA 4DXZA 4NJ4A 1UL9A 4Q27A 2QQLA 2WO3A 3QOPA 1OC1A 4XUQA 3ZIWA 1FX5A 2FDGA 1R092 1ASJ1 1RHI1 4BQ2A 1S4CA 5IYYA 4CP9B 2Y60A 1QJY2 3KHBA 2XJTA 1OLQA 1OSGA 1V70A 2BFUL 3TN91 1PM4A 3TAYA 3VBHA 2WN3A 5IT6A 4LK7A 3LPFA 4IEZA 3APBA 2XHKA 1R081 4PQ9A 1K5MB 1XOYA 1OA4A 4I3PA 3AYCA 4ORFA 5LCWL 5CA6A 3UKTA 4AEDA 2I2SA 2WWSA 5E1RA 4CXYA 2DUQA 1IQDC 4XPVA 2W9XA 3EMRA 1WWYA 2E9QA 3O1OA 1GBGA 1D0HA 2H0BA 3J8F2 4FXGB 4Y24A 2A7AA 2F17A 3U0ZA 4QX5A 1DGWX 1Q8QA 2A3WA 1REDA 5C4WC 1CN1A 3EO6A 2WWUA 3O14A 2ZKLA 4JRAA 4ONUA 3NV4A 1HQNA 3RZJA 5J48A 3OUJA 1LOCA 1GUIA 2YGLA 1OVPA 2D3RA 4DINB 4UYBA 4Y1UA 1H1MA 1W6OA 4BLIA 3JUUA 2ILMA 3SKVA 4RHV2 4XUTA 1ZVFA 1OT5A 4MUVA 3HQUA 3SMHA 4DXSA 2RJ2A 4LHNA 1ZZ9A 4XIOA 1AR91 1G7YA 2JB4A 4QT6A 1POV0 3WNNA 1LOGA 1MVEA 2VNOA 2VZQA 5IW0A 3E5QA 4Z82A 1C57A 3PL0A 4GWIA 2RS12 4DFSA 4CU7A 1EUTA 4XFFA 5A6YA 1OHFA 2FCTA 2GALA 3OOXA 4WM7C 3ZFEA 1YIFA 2GNDA 2YBSA 4OLLA 3T0DA 2WA4A 1GNZA 1WCDJ 4FQ4A 3OGVA 1S0JA 2WDBA 2WQZC 3AMHA 3CO2A 4XCAA 3IZOA 4CU9A 1DQ6A 2D6NA 2P5BA 4RQPA 4RR3A 1FOD1 1S2BA 3A0NA 3UV9A 3VZKA 1LCLA 3L2YA 4RL7A 1AR82 2B39A 3EXUA 2Q8EA 5JR2A 3VBRB 3BTXA 5HCAA 4YW2A 2X10A 1ND3C 3IN9A 5HXMA 4YNIA 1GWKA 1H9PA 1BXHA 2IXCA 2WT2A 4B4QA 1GZCA 3KT1A 1RHI3 2H6BA 3B7MA 3POEA 3ZN6A 4C90A 3WW2A 1O5UA 4FFFA 4XJZA 2XH6A 3ZFFC 3TN93 2VZOA 3OEAA 2JD9A 4AEDC 1REFA 2OPKA 2CNAA 3WG3A 4P9WA 4YW1A 4BXSV 1OI6A 1YXWA 5F8PA 1R083 2VW0A 3PURA 2RHPA 4H3WA 5DAXA 4LLOA 4CCMA 5I0SA 2X09A 1QXRA 2O8OA 2QZ3A 1N1TA 2EAAA 4QX1A 3LGRA 4IE5A 2KM2A 3NVCA 4L97A 2IC1A 5T5JA 4GB31 4SBVA 2JX9A 4DXTA 4BIOA 1W8FA 2VZSA 4BK4A 5LK5A 4AAPA 1Q8SA 5A1LA 2D6KA 2NQYA 3C7FA 3UL2A 4YG3A 2ZA9A 1OXCA 4ATFA 3RWNA 4CSWA 5BYNA 3W5NA 3DCQA 2VBDA 1A8MA
chains in the Genus database with same CATH topology
4YRDA 3WR0A 4CDQC 1ULCA 3P3NA 5I0UA 4AE2A 3KMHA 4BYYA 4KWJA 1ZYBA 3HQXA 3ATGA 3TRSB 1CAVA 3MPPG 5CFCB 5I91A 1XU1A 1CIWA 5GZGA 1M06G 5KXBA 1VBD1 4HBNA 3WW4A 1UPSA 3GBFA 4NHLA 4COUA 3CLPA 4YZ3A 4DB5A 2D6PA 1ENSA 4WVWA 1MVQA 3ZFEC 2YXSA 1W39A 4AHWA 3LKJA 1Y43B 5ACA1 2XVLA 2XJQA 4IESA 4PCRA 1XXNA 2HWB2 1J1LA 1QJX1 4A7YA 4CEWA 2XWJB 3PMSA 4JGYB 3UJOA 4RR3C 4AG4A 2D44A 1COV1 3BPZA 1SBFA 2VQ0A 3AP9A 4XF9A 3I59B 3ZFGB 1FOD3 1SCSA 3TB0A 1LHUA 4COZA 4TLFA 1LGNA 2HEVF 4MGYE 1AR73 3K51A 1OMIA 1Q56A 5H9SA 5JVVA 3H9AA 3ME2A 2Y0OA 2Q5TA 3NAPB 4QPIB 2UWAA 1RUJ2 3C3VA 1ZZ8A 4ES9A 5K9YA 5T5PA 3KD4A 1LR5A 1KS4A 1SLTA 2GNBA 1HXS3 3G6JB 1ASJ2 1YRZA 1RHI2 3ILNA 2WLPA 1N47A 2BPA2 1I3HA 3KGZA 3TN92 4GB33 1MZ5A 4AGGA 4AFAA 1J1TA 1R082 3VHNA 2GNMA 2ZHLA 5L73A 4LLFA 4FOVA 2D6OX 2Y38A 3ZYPA 3ASIA 4MXVA 3VBSB 1RUC1 2ARXA 4OZXA 1QWRA 2AR6A 3RI8A 4FPKA 2AYHA 1S0BA 1QOTA 3HR9A 5F1RA 5BNOB 1SCRA 1HW5A 2DV9A 2UY9A 4QQOA 4OHWA 3DPRB 2W52A 1GSLA 5LEJA 1FV2A 1OPOA 3N3HA 3CF6E 4FTSA 1DG6A 5JIAA 4R9DA 3VBRA 1HV0A 1Q8VA 2UYBA 1N1YA 2JG9B 4N9IA 4XJWA 4B7EA 4XQ4A 2D6MA 5D8AB 2A6YA 4CEYB 1IS4A 1XU2A 1COV3 3KT7A 1POV1 1K5MC 2BNOA 4M3CE 1FI2A 4P9YA 4ASMB 3NO8A 3RG0A 2XJUA 4P14A 5KXCA 2VQAA 2FMDA 1BZWA 3H1WA 2XJVA 4JGZA 2PHLA 4BIFA 2BQPA 1AX0A 1SDWA 2MEV3 2ZHMA 2WNVB 5FO7B 1FOD2 3NKTA 3OF1A 4IEXA 3WCRA 1N3OA 4UW5A 3UK9A 2YDEA 3MICA 2GN3A 2XBO1 3WT3A 4AHXA 1WUVA 1AR72 2CTVA 4WZCA 4WM8B 1H4GA 2JICA 4NOTA 4LA2A 1ZM1A 2WZR3 4NHMA 3WD5A 4F7ZA 4B8EA 1VR3A 1H4HA 4YM2A 1HDKA 3AMMA 1J58A 3AZWA 5CFCA 1ONAA 4IEOA 4L11A 1V6IA 3VHRA 3V56A 1HXS2 4R4ZA 4OI0A 1G9AA 4YM1A 3WINE 2R0FA 1MR5A 4L99A 3ZIXA 5B2GB 4QQLA 4GWMA 3B9CA 2EALA 1OFNA 4GB32 4K3UA 4AI0A 2H0VA 3FE5A 3ALQA 4O9GA 3GZAA 4QM8A 1CESA 3VBOB 2ET7A 2Z69A 2JJ6A 5BNPB 4JC1A 2Q0AA 3JU9A 3E6BA 3IDCB 2XPJA 5FOJB 3AB0A 2GNTA 3KSCA 3LSDA 3D0SA 4LE4A 4HVRA 1GQHA 2HWC1 2WJSA 2ETEA 4J1XA 1NE4A 1MS9A 2R061 4M0NA 4LHLA 1AR61 1PO11 2FBEA 3NAPA 4QPIA 1RVF3 2JKBA 1CD3G 5KXDA 1C8NA 1NLRA 3ZYGA 1AX1A 5ACA2 4GXLA 4WVVA 2EXIA 1V6JA 1HRV1 3GHMA 1COV2 5FLHA 3SCHA 3ZXGA 3T1LA 2NMNA 4CP0A 1ZX5A 3FFZA 4I3GA 4XF1A 1NYWA 1SBDA 4XDQA 4AFBA 4Q1PA 5CIRA 5JOYA 4YZ1A 3VZNA 3VBSA 2ZZJA 4LTAA 4UBHA 1PO23 2WFF1 2XWBB 5ABJA 4WVMB 2MEV2 4HVQA 1WGPA 4UW3A 3WDVA 3TWIA 1W6MA 1VAMA 3KM5A 3KCXA 5A32B 5JPMB 4AI8A 4N43B 2VH9A 1YUDA 1Y7BA 3CL1A 3DPRA 4HMZA 5CVRA 3O12A 3O0XA 4JGYC 5JI9A 2WZR2 4I09A 3HN1A 2BW8A 5GLTA 1ZRFA 2JG9A 2UWCA 4FOWA 1DQ1A 1FV3A 3ZFGC 4EROA 4D3WA 3GF6A 3IDEA 1SLLA 4CEYA 3B3QE 1AYM3 1QJY1 4FP2A 3ELNA 2ZHKA 1SFYA 4KBBA 1RUC2 5C9AB 1GNHA 3KS7A 3D6EA 4CDUC 2VW1A 2XLAA 4LO7A 2Q30A 3NAPC 4MXWB 1G8WA 2HWC3 2BEOA 4BH9A 4AQSA 1MS4A 1A6CA 3SCGA 4YZ4A 5C8CC 3PJQA 3WLUA 4FO9A 4QHBA 2ZAHA 4OHZA 2WNVA 1AR63 3V0BB 3B02A 3SH5A 1UCXA 2C0ZA 1DU3D 3AJYA 2XGXA 1VBE1 5IK8A 2ZBJA 3E97A 4XIKA 3SLIA 1U12A 3WG1A 3TBDA 3USSA 4WM8A 2ZGNA 1HRV3 2RR13 1LULA 2D43A 1RVF2 2EF6A 2IFWA 4GMP1 4LNVA 4PLMA 3VDDB 5HI0A 3WX5A 2VNGA 1F8VA 2EXJA 1YNAA 4L92A 1W6PA 4EWDA 1EPZA 5JOZA 3DUIA 1VLNA 5JSRA 3VBHB 2R30A 4QPYA 1RUF1 1BBT1 2YMZA 2RS53 2NM1A 1AXKA 2VULA 2A5ZA 3IDBB 1NCRB 2DU0A 5BNOC 1MS3A 3CEWA 2DWRA 4S2DA 3ZSLA 1DQ4A 1ZZBA 4CZSA 1ZRDA 1C1LA 2RS11 4JDMA 1OA3A 1H2LA 4I0WB 4IV3A 4N53A 4QPGA 2XL9A 1QXJA 3VBOA 3ZO0B 2XBO2 1X50A 1PGW2 5BNPA 1RTVA 1AZDA 1PO22 2SLIA 3CJIB 3ZN4A 2P3IA 4FPOB 4XFGA 4YSFA 4OI2A 3H3ZA 5KHGA 4R9CA 4SLIA 5D8AC 3WHTA 1PMIA 3ZDSA 4CEYC 1MEC1 4YGEA 1NXMA 4FPHA 2ES3A 2DVDA 4IEPA 3AMQA 1W6OB 4YW4A 3ZX7A 2XB6C 2NP0A 4OULA 3B00A 4M00A 4OVEA 3VKNA 2X8KA 5F6LB 2KXLA 1BK1A 2R041 3AM2A 5FPZA 4FXKB 4CP1A 5DXDA 1DGWA 2ARBA 4RS5A 3DN7A 1J59A 3LSEA 4NO4A 1W6QB 1V6KA 4JTOA 1AYM2 3TNQA 3VL8A 3D0JA 3C2UA 1ULDA 5EFUA 2E63A 4GWNA 4Z8BA 1OQEA 2UU8A 1VBE3 3PMEA 3W9AA 5JOXA 2NLRA 1H2MA 1TEIA 2HWC2 5K0UB 3K48A 3S7IA 2Y0IA 4A3XA 1QOOA 2D98A 3IBMA 4LO8A 3CU7A 3JQXA 1AR62 3ILFA 4LUMA 2VVDA 4GMP3 1S0GA 1ULFA 1H1AA 3ZXFA 2CYFA 5A32A 5JLVA 4LBLA 4N43A 4M01A 1ENQA 2VOXA 4XBQA 1RUF3 1BBT3 1S0CA 3MIHA 1HRV2 2RR12 4LEJA 2XG3A 2ERFA 4D7YA 5JCTA 3BODA 3GHNA 4Y4YA 4AQ6A 4IEVA 5BNPC 2ZGMA 2ZGPA 1YI9A 1W6NA 1LHVA 2VU9A 3ZXDA 1ZRCA 4K40A 4Q4Y3 5C9AA 3D82A 2WFF2 1B35B 2CGNA 4MXWA 1XYOA 1MEC3 1J3PA 2WNUB 3MEPA 2Z42A 1CAVB 2RE9A 4FP3A 4HKWA 2EA7A 4K1YA 2ZMLA 2JXAA 3V0BA 1BMV2 4NHKA 1X36A 2QKDA 3X29B 4U2AA 1QH7A 3WV6A 1ZZCA 2R043 1WW6A 2XL7A 5FTTC 3EQEA 3FX3A 4LHKA 4KGQA 3RQ0A 1LJ7A 1MZ6A 1WA4A 4RGAA 2D93A 3ROUA 1V6NA 1LOEA 3ZXLA 3NKGA 4CEWB 4R8HA 1O91A 3FBYA 3VDDA 5BNQA 4XFHA 4PIXA 3VN4A 5JAXA 1M4WA 4KG0A 4E27A 2V5YA 2ZCWA 2NPIA 1OA2A 3R0RA 4MLOA 2PA7A 1AUYA 1RMU1 5KHJA 1S0IA 1S0EA 1NCRA 1QHDA 1YJKA 1PGSA 5FCCA 1AXYA 1ZBA1 5HXVA 1WMEA 2PTMA 4HN1A 4N43C 1AL21 2EAKA 2YY1A 2WC2A 4Y1ZA 4CDWB 3VZMA 1F5FA 3FWEA 1TNRA 1VBE2 5FO8B 3AK0A 3EJKA 1QNYA 5FREA 4KG8A 4YVSB 4F83A 4EN8B 2UY8A 4F8AA 3DKWA 5GZCA 2XLFA 2LTNA 3CJIA 1PVC3 1LKNA 1W0OA 3IMNA 4H7LA 5EYYA 1IPKA 3M3OA 4FCAA 5CAZA 4O9EA 1WW5A 3FC0A 1DGRN 1DYKA 1KJRA 4AVBA 2RJLA 5E88A 5C9AC 4N9HA 2YROA 2LM3A 1RUF2 4X6RB 3U07A 1BBT2 2D5HA 1VBA3 1XYPA 3WVJA 4BHPA 2G9GA 4OHVA 3B94A 1QY4A 3ZMNA 1RUI3 1WLCA 5CG9A 1MQTA 3OBTA 5FMOS 4COWA 2ZGLA 3QBQA 1W6QA 4HK9A 3ZXAC 1ENXA 1Q8PA 3EHKA 1ZBE3 2O0OA 4KL1A 5J09A 3VL9A 2B46X 4HL0A 2GN7A 4Q4W1 3ZYIB 2VUJA 4PLNA 2IXJA 3B93A 5K0UA 1MEC2 3NV2A 4RFT0 4XFAA 1CPMA 3VDDC 2OZ6A 1V9U3 1N3QA 4J1WA 1AR71 1C5IA 3LA2A 1RUH1 4HSLA 4XETA 1YFUA 1XNCA 1UZZA 3R4SA 2C1FA 3VBHC 3M70A 4GALA 2TBVA 1I6XA 4NWVA 2R042 4XJ9A 1HRI1 1NCRC 2DYCA 1CAUB 4HKLA 5T5OA 4FTBA 4QQHA 4XOGA 1OQDA 2ZMKA 4AVVA 1HXS1 1RMU3 1WW4A 5FFOC 1PZ7A 1Z0HA 4DY5A 5KC6A 1C4RA 3E6DA 1RUOA 4JGZB 1ZBA3 3ZN5A 3O0WA 3IT8A 2IXIA 1GV9A 1UZYA 1AL23 3SCFA 2DVGA 4A7KA 4BE3A 3CJIC 4ZXKA 1NA1B 2LUWA 2DCTA 3PLQA 4FSJA 2JG8A 2A71A 1RUE1 1B35A 2HJIA 1QF3A 2VXRA 4K6BA 3MIBA 1FYUA 4XJUA 2V73A 1WLDA 3GALA 2PLV1 3QACA 1U5ZA 2BWAA 2WNUA 3BIWE 3NV1A 1LTEA 2DF7A 1DQ2A 1KS5A 4S2GA 1A8DA 2D5FA 1PVC2 1CVNA 2PELA 1RUG1 3ZSKA 3AP7A 2Q1MA 3MFAA 2GAUA 4FAGA 4M3CB 4CDXB 2ZGOA 4KU7A 4FTEA 1VIWB 3KT4A 4MSVA 4AXOA 1VAVA 4OHYA 1CAWB 3MZHA 4RQPC 4D7TA 1VBA2 1XQNA 5EXOA 1EYBA 1GR3A 5K0UC 1RUI2 4W6WA 1QNWA 4AVSA 1Z7S1 4Q4W3 3SNMA 4LUKA 1UN1A 3WG2A 2KA3A 4ISQA 2P34A 5T55A 1BVVA 5BV6A 1OFSA 1SLAA 5SV5A 4LE3A 5GALA 4IETA 1RUH3 4CP2A 5JWPA 1FXZA 1KFXL 1ULGA 2MEV1 4FQZA 4CDWA 2OUHA 3FFQA 2VVEA 2DUPA 1YFXA 1LU1A 4YVSA 1CGPA 1HRI3 3LOBA 3S30A 1ZZ6A 2NZ9A 3AKTA 4OHXA 1VBB1 1FMD3 2CY6A 3ES1A 4I0AA 4YM3A 3G7DA 3UJQA 2IXLA 1CONA 1IHMA 1PIV3 2WZR1 4C1WA 3HAGA 1I9RA 5BPXA 3KQRA 3OGGA 2R32A 1LEMA 5CBLA 1IQAA 2R16A 4AQ2A 2HEWF 2D7FA 3JQWA 5KC5A 1B35C 3Q9OA 1EY2A 1UU6A 1RUE3 1RMU2 5L7OA 1HQLA 1YLLA 4Q4V1 4XBLA 1G9DA 2WNUC 5CNAA 1ZBA2 3RZZA 2XVKA 2ZJCA 2PHTA 1AL22 3RDIA 5ABJB 4DNYA 2PLV3 4S2HA 3JD71 2GZWA 2PHWA 2ZGQA 1W6MB 4LA3A 2HWF3 5CFDB 3KCYA 1RUG3 3NL1A 1AVBA 4CEWC 4GKYA 4Q26A 2A6WA 5I0TA 4RSUA 1H1IA 1G9BA 1JUIA 1R1A1 1Q5OA 4ASLA 1XE7A 1IPJA 4YZ2A 4GA9A 1H2NA 1O4TA 1BCXA 1JYCA 1BQPA 4R4XA 3MLKA 1YO8A 3FUOA 3IWZA 1F2NA 4PBPA 1RVF1 5DUXA 1JXNA 1DZTA 2ZMNA 5GLVA 3M2MA 4QGMA 1CAUA 4AYUA 4GMP0 5CU1A 1YWKA 3ZSMA 1KXGA 1Z7S3 1WLWA 3WG4A 4M3CF 1YI7A 2ET1A 2GDFA 4XJAA 4C0BA 3VBFB 4KWKA 1DYPA 3FZ3A 5EWSA 4YVSC 2XVGA 1D2SA 1C1FA 5AC93 1RUD1 3AP5A 4Q4W2 5J7MA 1NA1A 3VKFC 3HT2A 4XMAA 1PZ8A 1URXA 3TYJA 1KJLA 5J96B 3PVEA 1PGW1 1O4YA 4JAAA 1VBB3 4XXAA 1QOSA 1RUH2 2VW2A 3OPZA 1PO21 5JMCA 1WD3A 1MS0A 3ZXEA 2PHFA 2X53S 2H6CA 1OOPB 1CQ9A 5BY5A 3OY8B 2X5IA 4D94A 3POWA 3RPQA 2BNNA 4N7UA 1HRI2 1QKQA 1WD4A 3M8LA 1W6PB 4NVPA 2C9AA 1FMD2 4G9SB 4YYOA 5E89A 3WDYA 4E4ZA 4YARA 2WT1A 3I4IA 2FZ1A 4M3CA 4CDXA 4Q4V3 1PIV2 3THPA 4YW5A 2WS91 4ZU5A 4WVZA 2Q8OA 1NCQA 1MS5A 2BYVE 1SLBA 1U5XA 3H7YA 4I0BA 3JD73 1CAWA 4N53B 4IV3B 4QPGB 1RUE2 4F3JA 2WIIB 4UW6A 4IEWA 4HPKB 1AYM1 4FPCA 2DVAA 3RRDA 1RUNA 3VBRC 2QUOA 1LOBA 5JOWA 2BFUS 1PNGA 1VB2A 1RGSA 3AMNA 2B42B 2PLV2 1R1A3 4UXAA 4ES8A 5AFEA 5JIUA 4UBGA 1IKQA 4XXPA 2QNKA 4Y1YA 2FMYA 1LENA 4TWTA 1IKPA 2RMU1 5DUWA 1RUG2 2RM21 4XTPA 2PYTA 1RB8G 2P3KA 3D8CA 4Y22A 1I5ZA 3RJRA 2CWSA 3AZXA 4JGZC 2ZX2A 2QJVA 2GC1A 1GZWB 4RS5B 3RJ2X 2NMOA 4RGGA 1CJDA 2PAEA 5C33A 4AGRA 2RR11 1NA1C 3J9SA 1QJU3 1XRUA 1JW6A 1CX4A 3U4XA 3GZTB 4OI1A 2JE7A 2PFWA 1FNZA 4Q0UA 3H1MA 1Z7S2 1RUD3 2AREA 1F9KA 3RMYA 2PHRA 4DMIA 1JH5A 4BQ1A 3ZPYA 1OLRA 4MV2A 1QJZA 2RS51 4YFWA 4TYSA 1O3TA 4IERA 2VPVA 4CRQA 5CFCC 3USUB 4Q0QA 3HD8B 4DRVA 4C91A 1VB4A 2B7YA 2PHXA 4FAHA 2ZX1A 1U5IA 3ST7A 5AC92 2ZKNA 1HIXA 4W6YA 1WBFA 5GLZA 4C1XA 1OQ1A 3FUQA 4GQ7A 3I2DA 5CFDA 3FBMA 4MH0E 4GH4A 5T52A 4AHZA 4CDXC 4K20A 4INDA 3ZSEA 3W58A 1VBB2 1PHMA 2UYAA 2GMEA 1BMV1 2IZWA 1LGCA 2FQPA 1E57A 1ZA4A 5TSWA 1C8M1 3OYWB 3V65A 1H2KA 2ZAAA 2WS93 4XMIA 2D3PA 4R9BA 2GU9A 5F6KA 3LA3A 2G4IA 1W6NB 2WT0A 4M0HA 4AHYA 2DTYA 4QXKA 4XQWA 2DUOA 3M3EA 4Q4V2 1RJ8A 4IEQA 5FOBB 1YCIA 3N4MA 4QD2A 2ZABA 3WNXA 1KRIA 2ZS6B 1NY72 1REEA 5JPNB 3JD72 4QMAA 4QPIC 3VBFA 4R9AA 1S0DA 3D4KA 2TEPA 4HKOA 5AVAA 3U10A 5C4WB 2RMU3 4DS0A 5J3UA 2RM23 5FQ0B 1BYHA 1ZZ7A 1OKQA 4AWDA 2QDNA 5T50A 1R1A2 1DHKB 1S2KA 4TSVA 1BVP1 1UIJA 2TUNA 1L3JA 4QM9A 5L19A 4XFIA 2WKKA 1X8MA 4J6GA 2P17A 3SISA 4E9KA 1OD5A 2B9UA 5HCFA 1OOPA 4A2UA 5BUVA 3OY8A 2WSUA 4K9SA 3OJBA 3WP3A 2K0GA 3VBSC 1UKRA 3NJZA 4EN0A 5DZEA 1AJKA 3B01A 4JQRA 1JTZX 1B09A 5ABJC 4PLOA 4FOQA 3VV1A 1QJU2 2YC0A 4OUMA 5CFDC 3S0MA 2F6BA 4WBBA 3V0AB 2XKOA 1RUD2 2WSVA 3DPRC 3GBWA 3AKSA 5C6CA 3R6SA 4HPKA 1ND3B 2JDZA 1LHNA 5LRRA 1UIKA 4Q4Y1 4Q0PA 1BEV1 4XBNA 4Z1VA 2RS31 2JG9C 2CAUA 1C8M3 1GLHA 3AYEA 3R05A 3ZFFB 1LU2A 3S7EA 1Q3EA 3SH3A 4QQPA 4PDWA 1DZRA 4QU2A 1KITA 2WINB 1FAYA 4QGNA 2EXKA 4JV4A 4LBNA 4Z92B 2K2SA 1DF0A 2EXHA 5FAXA 5T3NA 1AXZA 2A6XA 2GC3A 3VBFC 1G86A 4FBFA 2JD4A 1PZ9A 1VALA 2WS92 3JBG3 1D4M1 3J4UH 3MIFA 1GZWA 1FT9A 5EV7A 1MQTB 4YGCA 1FATA 1UF2C 2WNVC 3DF0A 4L8QA 2AH2A 4FPFA 2ZX0A 4CDQB 2VY0A 3LWCA 3FJSA 3TNPB 5I8YA 2WA3A 4MX3A 4WM8C 2BTVC 4AVTA 5IK4A 1IS6A 1OOPC 2CGPA 4ATEA 1PK6A 5FBZA 4YW3A 1G9FA 3MDPA 3USUA 3IM0A 2ZGRA 2OVUA 2RMU2 1VBC1 4AVAA 4XTMA 3AKRA 2RM22 3N7KA 3B69A 3MLJA 5LEKA 2GH2A 1YHFA 4N90A 3H7JA 4ZKTB 1SACA 1VP6A 3VBUB 3WQ0A 4XQDA 4URTA 4X8NA 2DFBA 3M3QA 4Q0SA 1ZNPA 1PVC1 4E4SA 5AFBA 1LHWA 4MGIE 4Z07A 4EWEA 1WW7A 3OYWA 4N53C 4IV3C 4QPGC 5GLWA 4FOYA 4COVA 1SQ4A 3WHUA 5GLUA 4LBJA 3VBOC 4XJ8A 1EPWA 3B5LB 4KU8A 1PVXA 3FLTA 4XZPA 2E53A 1H8VA 3CNAA 4LBQB 1VBA1 3UKVA 2JG8B 2RS52 1ZREA 1O3SA 3HMYA 3RSJA 1RUI1 1HX6A 3RYPA 1BEV3 4AI3A