1TMF1

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
276
structure length
276
Chain Sequence
b'GVDNAEKGKVSNDDASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNMETTFNYQENDYRLNCLLLTPLPSFCPDSSSGPQKTKAPVQWRWVRSGGVNGANFPLMTKQDYAFLCFSPFTFYKCDLEVTVSALGTDTVASVLRWAPTGAPADVTDQLIGYTPSLGETRNPHMWLVGAGNSQVSFVVPYNSPLSVLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTSASVRIRYKKMKVFCPRPTLFFPWPTPTTTKINADNPVPILELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
source organism Theiler's encephalomyelitis virus
molecule tags Virus
total genus 17
structure length 276
sequence length 276
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf100
1NCQC 1R092 1QJX3 4RHV3 1R1A3 2MEV1 3ZFEA 1TME2 2RM21 1HRV1 4WM7B 1MEC2 1PO12 1WCDJ 4JGYC 1ZBA3 1RUD3 3VBFB 1OPOA 4JGYA 2GSYA 1RVF2 4GH4B 4RFT0 1BBT1 1VBB1 5A33B 2HWF1 1QJU1 1RUE1 4CDQC 1NY71 3VBRB 5C9AA 1COV1 1ND2C 4IV3B 4CDQA 4QPGB 1EV12 1FPN1 3TN91 1NCQB 1RUF2 1X33A 1H8TC 1PO22 2RS11 4GB33 1H8TA 1AR82 1PVC3 1TME1 4GMP0 2RMU2 1EV13 1VB4A 1VBE3 2R062 4CDQB 1RUF3 1K5MB 1ND2B 1VBD2 1RUG2 1RMU3 2RS32 1TMF2 1FOD2 1AR72 3DPRB 4Q4Y3 3NAPC 4Q4W2 4N53A 5ACA2 2RR13 1ZBE2 5BNOA 1NG0A 3NAPA 5D8AA 3IDEA 2HWD1 2BBVA 3VBHC 4CDXB 1HX6A 1PO21 2HWB3 1CJDA 1GFF2 2R041 5AC92 3VBHA 1RUG3 1HQNA 1NCRC 1Z7S1 4CDWC 1BMV2 4YVSC 1OOPC 4Q4W3 4CDWA 4YVSA 2X5IB 1OOPA 3M8LA 1QJY2 2R061 2PLV1 3S6PA 2MEV2 1MQTC 1VBD1 1M06G 1VBA3 2RM22 5AC93 1HRV2 1TMF1 1MQTA 1POV3 1FOD1 4WM8C 1AR71 5K0UC 1HXS1 1HRI1 1ZBE1 4WM8A 4WM7C 5FOJB 2Y26A 4CDUC 1BBT2 1NCRB 1VBB2 2HWF2 4WM7A 1QJU2 3VBFC 5J98B 1RUE2 5C4WB 1NY72 1COV2 1ND3B 4CEYC 1SMVA 2MEV3 3VBFA 1VBC2 1FPN2 3TN92 3JB8A 4GH4A 1BEV3 1RUH1 4BCUA 2WS93 1V9U2 5A33A 4IV3C 4RR3B 4QPGC 3VBRA 1RUI2 1VB2A 4IV3A 1QJY1 4WM8B 1BBT3 5K0UB 1VBB3 1C8M1 1FMD1 4Q4V2 4QPGA 2HWF3 2WWSA 1QJU3 2RS51 1RUE3 5FMOL 1NCQA 1RUJ1 1X36A 2XBO3 3ZFGC 4FSJA 1RHI2 5CFDC 4CDUB 4Q4X1 4AEDB 1FPN3 4CEYB 4IV1B 4FTSA 2RS13 2R072 4NWVA 4RS5B 1R093 1B35C 1K5MC 2HWC2 1TME3 1K5MA 1VBC1 1VAKA 1IHMA 1ND2A 4YVWC 2HWD2 3DPRC 1MEC3 1PO13 1V9U1 1QJZA 1R081 3VBUC 1PGL1 2ZAHA 4JGZC 3DPRA 2R042 3ZFGB 1RVF3 1RUI1 4N43C 1Z7S2 1QJX1 5CFDB 4LLFA 4Q4V1 1AR91 2TBVA 4CDXC 1RHI1 4CDXA 1PIV1 4FTBA 2HWD3 1RUD1 2PLV2 1B35B 1EAH1 3ZFFC 1PO23 2X5IC 2R071 3JD71 4YVWB 2X5IA 1AR83 3VBOB 3VBUB 1AUYA 1HXS2 1HRI2 2FZ1A 4JGZB 1POV0 2HWC1 3VBSB 2RMU3 4N43B 3ZXAC 1OHFA 2R063 4GB31 1VBD3 1VRH2 1AYN2 3LOBA 2RS33 1NA1B 1TMF3 1PVC1 5CFCB 5BNPB 1FOD3 1RUH2 3CJIC 1AR73 5C4WC 2WFF1 5ACA3 1NCRA 1ND3C 3ZFFB 1HRI3 1ZBE3 5C4WA 1ND3A 1AL0G 4Y4YA 1C8M2 1FMD2 1W39A 2RS52 4RR3C 5FMOS 4CEWC 1RUJ2 3FBMA 4RR3A 4Q4X2 1RUH3 5JZGC 5K0UA 4RQPC 1NOVA 2BUKA 4AEDC 5BNNB 4RQPA 1QJY3 2HWB1 3CJIB 1D4M2 1C8M3 1FMD3 4CDUA 4AEDA 4Z92B 4IV1C 1AYM1 1VRH1 1AYN1 1RUJ3 2RM23 1HRV3 3JB4C 4GMP1 5DDJ2 4RS5C 4CEYA 4IV1A 4PDWB 1RUC1 4Q4X3 1R082 1PGL2 1AR61 4RS5A 4CEWB 3J8F2 4QPIC 2HWE1 3HAGA 1QJX2 5ABJC 1AR92 1R1A2 5A32B 5JZGB 1COV3 4RQPB 1DDLA 1VBC3 1PIV2 5GKAC 3VDDB 3ZFGA 3TN93 1ZBA2 1RUD2 1V9U3 5CFDA 1R083 1EAH2 1QQP1 1C8NA 3JD72 3JBG1 1RUI3 3ZFEC 1ASJ1 1D4M1 4Q4V3 1AR93 5L7OB 2WZR1 1B35A 4QPIB 2VQ0A 1RHI3 1AL21 5DDJ1 1BEV1 2DF7A 5ABJB 2WS91 1PIV3 2BFUL 3VBOC 4YVWA 3VBSC 1EAH3 4GB32 3J8F1 3VBUA 3VBOA 5J96B 2XPJA 4JGZA 2R073 3JD73 5C9AC 3VBSA 1PVC2 4RHV1 1R1A1 5C8CB 2WFF2 4N43A 2XBO1 4Y5Z0 2ZZQA 2HWC3 1NA1C 5CFCC 5BNPC 3ZFEB 1ZBA1 1VBE2 1E57A 1NA1A 5CFCA 5BNPA 1RMU2 2R043 1PGW1 3ZFFA 1R091 1Z7S3 4Q4Y2 1F8VA 2IZWA 4JGYB 1RB8G 2RR12 2WFF3 1MEC1 5C9AB 1PO11 2HWB2 2PLV3 4NWWA 1AYM2 1RVF1 4N53C 5BNNC 5BNOC 5LK7B 1RUC2 5D8AC 1H8TB 5BNNA 1HXS3 1AR62 1CD3G 3CJIA 4FTEA 1EV11 4PDWC 2HWE2 1VBE1 1RUF1 4PDWA 2WLPA 2FZ2A 1RMU1 1VBA2 1AYM3 1VRH3 1AYN3 4SBVA 4CEWA 1A6CA 2QQPA 1AR81 4Q4Y1 4GMP3 2RR11 1RUC3 2BPA2 1AR63 5A32A 2RMU1 1QQP2 5JZGA 4N53B 3VDDC 3JBG2 2HWE3 5BNOB 1ASJ2 3NAPB 5D8AB 3VDDA 2RS53 1RUG1 2WZR2 2RS31 1AL22 1BEV2 2WS92 2BFUS 4Q4W1 5ACA1 5L7OC 3VBHB 5L7OA 1QQP3 1F2NA 3JBG3 4RHV2 2ZTNA 4QPIA 4CDWB 4YVSB 1ASJ3 1OOPB 1D4M3 2XBO2 5ABJA 1VBA1 2GH8A 5AC91 4GH4C 1POV1 2WZR3 5DDJ3 1AL23 5C8CC 1BMV1 3VBRC 1MQTB 5C8CA 4EJRA 2RS12 3J8F3 1PGW2
chains in the Genus database with same CATH superfamily
4ISRA 2DVBA 3ZSKA 1NCQC 1CAUA 1OQDA 1R092 3MPPG 1XU1A 1HIXA 1TE1B 1O8SA 2MEV1 5JOYA 3ZFEA 5KHKA 4XQ4A 2YBPA 4DXRA 3K46A 3KV5A 2RM21 3HOBA 4TTGA 1HRV1 4AVSA 1GZWA 2NLRA 2ZPXA 1US3A 3H8XA 5LRSA 2PHTA 1GQPA 1SCSA 3VBFB 4NRPA 1OPOA 3LE0A 1OVSA 3OBTA 2GSYA 3OEAA 1WW6A 1DP0A 5A33B 3VD9A 5A3UA 5LZ6A 3TB0A 4C1XA 1XYNA 2PQSA 2KR2A 5JDBA 1YFXA 2WNUA 2VZ1A 3NRUA 3KLSA 1WLWA 2VQAA 4IV3B 5IFTA 1AZDA 4QGNA 2DURA 2AH2A 4CDQA 4PF1A 3O14A 4KBBA 3PMEA 4BH9A 1O8PA 4CSWA 4QDSA 5F32A 4FXGB 4BPZA 1A34A 3U11A 4LHSA 4N7IA 3KQRA 1S2BA 4YPJA 5JI7A 2XLAA 1VJ2A 4GB33 4Z2AA 1HKDA 1H8TA 3ZN6A 3BODA 4MGQA 5B4NA 4NE9A 5F7UA 3W21A 1VLNA 1S0JA 4OHXA 4BZ4A 5KHJA 1SLLA 4XAEA 3DN7A 1GICA 4Q0VA 5C3SA 2O0OA 2F4PA 1RJ8A 3JZVA 3E6CC 4WVMB 2D40A 2RMU2 4HANA 3N9PA 3L2HA 4D0QA 4ZU5A 4OUEA 4P5HA 3HQUA 2GC3A 3VHRA 1CX1A 3JUUA 3I7DA 4LEJA 1Q43A 3UJQA 2VOWA 3ZXLA 4FPEA 3AZXA 4CDQB 4FI9A 3TOJA 4RGKA 4V2WA 2WO2A 4I3GA 1VBD2 2XVGA 4AF9A 4JTOA 5TSWA 4B1MA 2DV9A 1FOD2 1QH6A 3B7MA 5FOBB 4S2HA 2XMLA 3LAGA 1CAWA 1CZVA 3NAPC 1W2NA 4Q4Y3 4Q4W2 1S0FA 4QX1A 4E8CA 1OURA 5FZEA 1NG0A 1UZZA 1V6LA 1VMFA 2YY1A 5J1XA 1WMXA 5D8AA 2A71A 3GJBA 1GBGA 3AX4A 3I3EA 5FAXA 3VD4A 5L36A 3R05A 3VBHC 3ENRA 1HX6A 4LO6B 1WBLA 4N9HA 1V00A 1YRZA 2WWUA 2VU9A 4D3WA 5AC92 1GWLA 1Z7S1 4O9GA 4A7ZA 2CWMA 1OOPC 4X6QB 3BU0A 3HQRA 4Q4W3 3AJYA 4YGDA 5FXZA 3SMHA 1AHSA 1K42A 3U75A 4YVSA 1DQ2A 2X5IB 4NIAA 5HPOA 1OI6A 5LATA 1LNSA 4DQAA 3M8LA 1AJOA 1QJY2 2WSVA 4P5YA 2QZ3A 4UWDA 3SKVA 2ES3A 3MYXA 4FPLA 4K1YA 4QHOA 5IVYA 4O61A 2QQWA 1VBD1 4RSUA 5CU1A 3RNSA 4BQYA 5FIXA 5AC93 4HOOA 2WQZC 5GZEA 3UETA 1MQTA 2WC2A 1FOD1 2DFBA 5C5UA 3ZN5A 5FO8B 5K0UC 2TUNA 3WY6A 4AQ2A 2F17A 4MYEA 3H42B 1ULGA 4WM8A 4K3UA 1NE6A 2GC1A 4PIXA 1CIYA 4CDUC 1BBT2 4WVVA 3OD4A 1UYPA 1MS1A 4GWNA 3EJKA 1QDCA 1QJU2 1SCRA 2W68A 4FOWA 5J98B 5C4WB 4LE3A 1JUHA 4XBNA 2VNGA 2I45A 2E53A 3PUHA 5T54A 1L3JA 1C5HA 4QU1A 2ETEA 2KD7A 1FPN2 4GH4A 2ZEWA 4KGGA 1RUH1 1VAMA 2K2SA 2WS93 1V9U2 2GP3A 2JDZA 3WG2A 3BIEA 2QQNA 4CYDA 2W46A 5EV7A 3FBYA 4TXWA 3EXUA 3VBRA 2ZGTA 1LECA 2BNNA 3UT0A 1RUI2 5LK5A 3AK0A 3IMNA 1QJY1 4AVAA 1XE8A 4WM8B 1CESA 1BBT3 2OQ7A 1IQAA 3CZJA 4Q4V2 1DLCA 1YQCA 3HIFA 4XFHA 2PYTA 2WWSA 3ZXDA 1QJU3 2XKOA 2RS51 1STMA 2X10A 5FMOL 1NCQA 5I93A 1N3PA 1DQ5A 3IIAA 2QQVA 3KSCA 3HN1A 2A1XA 2LS6A 4ITCA 2CAUA 2CHHA 2J22A 4Q4X1 3BB6A 1FPN3 3NV2A 1Z78A 1LOBA 3C7OA 4CEYB 2HEWF 1H2NA 4LR4A 2RS13 4NWVA 4Y1XA 1C1FA 5A1AA 1OMIA 3I2HA 4RS5B 4NRQA 4UFIA 1GMMA 4LHKA 2EVXA 1B35C 1OPMA 3T2OA 1S55A 1I5ZA 4Y4RA 1OUXA 1V6NA 3WSOA 2Y8KA 4UOJA 5HCBA 1YEWA 2BP6A 4PQ9A 2YC0A 1K5MA 4A4AA 4FOQA 1W8OA 1K45A 1D7PM 4AGVA 1V9U1 3HT1A 1XPWA 5FZ4A 3D82A 5J7MA 5DG2A 5FJHA 2GMEA 1PGL1 4BE3A 2UU8A 3DPRA 3WV6A 1I6XA 2Y6FA 1RVF3 1RUI1 3KV9A 3UKVA 4W6YA 1QJX1 3MEPA 2XONA 3Q8FA 4Q4V1 4QX3A 1AR91 4FT8A 5FP9A 4CDXC 1JYCA 2E31A 4YWAA 2YU1A 4MUVA 4RGGA 4EWEA 2YGMA 3AKTA 4JC1A 4Y5SA 4CP9B 4AAPA 1PIV1 4MV2A 4DRVA 3L2YA 3ACGA 1N3QA 1XBFA 2E26A 1GOHA 4AAXA 1EAH1 1HB2A 3ZFFC 2W39A 2XJUA 5FPBA 1PO23 3NO8A 4S2DA 2WNVB 2E9QA 2DYCA 4KG8A 2CV6A 2X09A 4XF0A 4NPLA 3VBUB 4YZ2A 1IZ3A 1HRI2 4KBZA 4Q2FA 2AEYA 3IBMA 4JGZB 4XFIA 4YLZA 3LIHA 5H9RA 1UX7A 2ZBJA 2QBXA 5C6CA 5DUVA 5C8WA 4N43B 2ZACA 2BNMA 2YV8A 5E6HA 1W8TA 2VUCA 2ZXQA 4GD4A 3HD8B 2R063 1RC6A 3NVCA 3UESA 1IGOA 1OD3A 2JE9A 3HBKA 3S30A 1VRH2 3N9OA 4P08A 4CCCA 1QOOA 1TMF3 4JDOA 1NQDA 2PHWA 4FCAA 4KH9A 5JOWA 1ODMA 4Q1PA 1JI6A 3B01A 5HXMA 1HW5A 3U37A 1HRI3 2IXLA 2VR4A 5FPXA 1ND3A 2RVAA 4BLJA 2GAUA 1UPSA 1GZCA 1W9TA 2Q0AA 2NM1A 3AB0A 3ILRA 1YC61 4MXWA 4AG4A 3PNAA 4UT5A 3WLUA 5CYYA 5CVRA 1H9WA 4KI5M 3I4IA 3NQHA 1X82A 1O5UA 1C4RA 4RR3A 4OI1A 2RJLA 5D1IA 1PK6C 4B4RA 2ADDA 5FZMA 3ZYPA 3H3LA 2ZGLA 2ZGOA 4K7JA 2JKBA 5K0UA 4RQPC 3ZYFA 2YXSA 5DAQA 4Y1UA 1CZTA 3RRDA 2VAUA 4YSFA 4AEDC 2G9ZA 2RJKA 2OUHA 4DXSA 2HWB1 1YNAA 2DTWA 1D4M2 1V6JA 4CDUA 4NPRA 1YQ8A 1VRH1 4QX5A 3IIIA 4FFHA 1OT5A 3JQXA 4IV1A 2R0HA 4O9EA 1ODNA 5FP7A 1CPNA 3J4UH 4Y22B 3O1OA 3MIHA 2FDFA 4ZKTB 1QWRA 4XFFA 4CEWB 4IGOA 5KHIA 1MR5A 2QZ2A 2JJ6A 1PM4A 1YI7A 3DYMA 4OI0A 3DL3A 2CGOA 5FP4A 3ZSMA 1TG7A 5ABJC 2KXLA 3FMGA 1R1A2 2ENRA 5IT6A 4XABA 3AKQA 3GM8A 5JZGB 3O1TA 1SEFA 3QOPA 2FMYA 1CAVA 2W0XA 1JH5A 2QJVA 3GHNA 2KM2A 3POGA 4XDPA 5IVJA 2EXHA 1VBC3 1WD4A 4GAZA 4XFBA 2GNMA 4BK5A 1E5SA 5IATA 4CU9A 4QU2A 5F3EA 2OKXA 3VKFC 4XJ9A 3GZTB 1Y7BA 4QX2A 5JWPA 2BGOA 1C8NA 3V0AB 1CONA 3JD72 1CWPA 2WT2A 4Q1RA 1LR5A 2C1FA 2RDQA 1JOPA 3ZYBA 1D4M1 3MO4A 2XL9A 1Y43B 4E8DA 1NX9A 3BGAA 1KRIA 1OSGA 2ZJCA 3D5OA 1SLCA 2BWCA 1AX1A 5FZOA 1B35A 2NQYA 3VL8A 2VQ0A 1RHI3 4NHMA 3VGIA 4AYUA 5LWBA 3CMGA 3WG3A 4BQ2A 2WAAA 4NIIA 2BFUL 4XC9A 3AL6A 2JECA 1XSRA 2EXIA 1JMUB 4DXZA 3WP3A 4CU6A 1RUNA 4PHZA 4ZPIA 4BXSV 3K2OA 4GKXA 4LBQA 1U5IA 4GIQA 5L9RA 1AVBA 1UNBA 2ARXA 1W6MA 3JD73 3IAQA 1UY0A 2ID4A 3VBSA 3RZKA 3OBAA 2EA7A 2P2KA 1R1A1 3T2TA 5I91A 2VCAA 3U10A 1YFYA 2VQTA 2XBO1 3AZZA 4J1XA 1W8WA 2HWC3 5LEKA 4A7YA 2D5HA 4QQOA 5FCCA 5HCFA 4BQ5A 4NVPA 3FHQA 2HKXA 1VBE2 3T4VA 2LTNA 1WW4A 2VZUA 5DZEA 2VCMA 3KB5A 4QGLA 3E5XA 4O7XA 5CFCA 5BNPA 1LHNA 1RMU2 3BN6A 4QX7A 4P14A 3CU7A 4HKWA 4TWTA 2VC9A 2JXAA 3WP6A 3AP5A 4COWA 3VZKA 3ZFFA 4ZZ5A 4UFHA 1JZ2A 4OI4A 1F8VA 4FTEA 2IZWA 2RR12 3O5SA 5C71A 1CX4A 2YHJA 4A6SA 3ZOIA 4N90A 3RZZA 3V0BA 4TLFA 1ENRA 2ZHNA 4YFZA 2W3JA 2VJXA 1MEC1 1PO11 2PXJA 4M0HA 4JZRA 1UYYA 5FYYA 2GDFA 1W99A 4AQ6A 2GZWA 4PF5A 5FY9A 5AFEA 1N1TA 1OVPA 2CTVA 1DZQA 2ERFA 4CTEA 2HEVF 4LORA 2A5ZA 4QQ2A 3RZMA 1D2SA 3UL2A 3HQXA 3P6BA 4W6WA 4YZ5A 1H1AA 3I2IA 5CKMA 5BNNA 1AR62 3J7MA 3BPZA 1OA4A 5JXGA 2ZGMA 4XZUG 1EV11 2DCYA 2GU9A 4FFIA 4LXLA 4NN0A 1D0GA 1DHKB 2HWE2 4PDWC 1VBE1 2FD8A 3AP9A 4BA6A 5IK7A 4XCAA 1UZ0A 1LGBA 5FZ7A 1RMU1 1DGRA 3U1XA 3WNXA 5CA6A 5IK8A 3MIGA 3UGFA 2LRPA 1AYN3 4SBVA 2BDRA 1A6CA 2JG9C 3PU3A 4IE6A 5CIRA 1AR81 2FCTA 5EPAA 1SLBA 3H7JA 2RR11 4FPGA 4IETA 3VUOA 2Z5WA 1PK6A 3WDVA 1AR63 2N7GA 1IG0A 3MIFA 1MACA 4UF0A 3ETPA 4MADA 3N9MA 4P9GA 1BK1A 3AZWA 1I9RA 3H0OA 4N53B 5KXEA 1MZEA 3JBG2 1YFWA 2E7TA 1F4HA 5C33A 2HWE3 5BNOB 4CCKA 5G04L 3ZMNA 5FYUA 3AM2A 3OD0A 3VDDA 1DGWX 1PHMA 4QM8A 4YZ3A 4JRLA 1G9DA 3C7FA 1RUG1 1XJAA 2VOKA 3I59A 2RS31 3IKWA 3MBWA 1O59A 4HBNA 5DZFA 1AL22 1ZZCA 1QKQA 4IL7A 4FQ4A 4M3CF 5ACA1 3U14A 1J83A 5L7OC 1O3SA 3MGUA 1UQXA 2BV4A 4YG3A 3C7EA 1VIWB 3NJVA 1J3RA 3PIGA 2GMMA 4ZXEA 2VVEA 3ZYGA 1UOJA 2VM9A 1HLCA 1P8JA 3PJYA 3JBG3 4A45A 3R0RA 3NW4A 5LA1A 3J7HA 3BI3A 3MICA 4LIUA 5ABJA 2GH8A 2BVVA 4QHZA 4DO0A 3SC7X 3BALA 1POV1 4UFJA 2WABA 2XH6A 1AL23 1R64A 1QDOA 2E6VA 5C8CC 3RSJA 2EIDA 5GLWA 2VTFA 1SLAA 1XNBA 2B45X 4IQPA 2E7QA 4GXLA 4UW6A 5F2SA 4CXXA 5FLHA 2EIGA 3OUHA 5JVVA 5L19A 1PGW2 4FPOB 5DQ0A 4B4PA 2ATFA 1GP6A 1UIKA 2VCBA 1GSLA 1OD5A 3ASIA 1LULA 4R9AA 5FK7A 4AK3A 1TME2 2QCSB 2ET7A 4B4QA 1LHOA 2O1QA 3CJXA 1MS5A 4WM7B 1JHNA 4KL1A 4IEPA 2BQPA 4Z8BA 2DUOA 3LQCA 1RYYA 1RUD3 4CUAA 1RINA 2F4LA 2JB8A 4E2GA 1X7NA 2YMZA 4JGYA 4LJHA 3TRSB 2A75A 2WO7A 5FZCA 2WNUC 2RV9A 4E4ZA 4JDNA 1HDKA 1VBB1 2XOMA 4MH0E 2HWF1 3RPQA 3QCWA 4ZHNA 2QDNA 1RUE1 1US2A 4CDQC 3MIEA 4Q27A 1COV1 1W0PA 1XNCA 3E6DA 3K48A 2R30A 2XGXA 3QBQA 3ES4A 4QPGB 4JKLA 3U78A 3U4SA 3KT4A 3GNEA 3TN91 4BHPA 4XTMA 5FUIA 3LD8A 4QB6A 1HN0A 4ORFA 5KHHA 1H8TC 1RUOA 3H3ZA 3BCWA 3NKTA 4YG6A 2C0ZA 2PTMA 2HEYF 1ULDA 3VZMA 1OFSA 4P00B 1WWYA 5FZBA 2R1BA 1GWMA 3GDBA 3LEKA 3AP6A 3NNMA 3DEMA 4DFSA 2P4EA 1PVC3 2QQMA 3K75B 4QB2A 1YLLA 4LK7A 1TME1 5LASA 3POEA 4PI0A 4MGSA 3GCXA 2R0FA 1UCXA 2VZOA 4IE7A 4P9WA 2W9XA 4CE8A 4EZHA 2XQXA 3U07A 5I8TA 5F8PA 3PUSA 3VD3A 1WMDA 1W9YA 3AYCA 2HJIA 2QDRA 2JB4A 5T5PA 1O4TA 4I2OA 2MHFA 1UOGA 2LUWA 1ZRFA 4R9BA 3ZYHA 4E9KA 1AR72 1YXWA 1UW8A 4LBLA 2W08A 4G3YC 4AEKA 3FHIB 2Q5TA 3ATGA 3H1YA 4FP2A 5FYCA 2PQQA 1WMFA 4B1LA 1W6NB 2FBEA 2Y6KA 5FZ9A 2HWD1 2BBVA 5CB7A 1N3OA 4LO5B 1SPPA 2E7AA 3S57A 1GFF2 4UW4A 1BLZA 1URXA 1SFNA 1S0DA 2R041 2Q1FA 2YROA 3MW4A 3MUZ1 4GJYA 4HT1T 3ACHA 4L9BA 5I0DA 2OUJA 3R4SA 2IXJA 2PMWB 1JYWA 3S0MA 1W06A 2ZEZA 1LGNA 1G9AA 1SHWB 3OPTA 4YVSC 1UOBA 1DZRA 2ZX3A 5ANNA 1S1AA 2JG9A 4YW5A 4HLTA 2JDHA 4CDWA 5M0TA 4ONUA 4XAAA 4K21A 3PU8A 3FZ3A 3NMBA 4XQWA 3VD5A 4KG0A 2QKDA 3RYPA 2PLV1 4L92A 1POQA 2MEV2 1MQTC 5LEJA 1ST8A 2X29A 5EQUA 3W5MA 2D5FA 2RJ2A 3POSA 1M06G 4AFMA 2RM22 3EO6A 2VH9A 3ABZA 1HRV2 4XUNA 4BQ3A 5B2GB 5F5QA 3POFA 4WM8C 1GOGA 1AR71 2BOJA 5CISA 5FKBA 3ZPOA 3IPVB 1HXS1 2W91A 2W95A 2V73A 2OIIA 4YG0A 3GBWA 2Y26A 1G8WA 1CR7A 5A80A 1YQ5A 1NCRB 3KCYA 1ZZ8A 2WBKA 3GZAA 1UF2C 2QQLA 4E4DX 2W52A 1FV3A 2WWJA 5A3NA 4OYUA 1SMVA 2MEV3 3OBRA 4CEYC 5DMYA 4XBQA 3AKPA 3VBFA 4H2AA 1OLME 4FPHA 3JB8A 1BEV3 2ZMNA 4BCUA 5A33A 4QAWA 2DVGA 2O8OA 2D44A 4KWJA 3D3AA 5IAXA 3H1MA 2ZHMA 4L97A 1OQEA 4UFLA 4XJ8A 1VB2A 4IV3A 1QXPA 4ARYA 1JYNA 1SQ4A 1TNRA 1C8M1 1FMD1 2NPIA 4QWNA 2JDYA 4ZS3A 5JSPA 1HV0A 3LWCA 5K8SA 1RUJ1 2DUPA 4FSJA 2VOTA 3MF9A 1X8MA 3GALA 1QJFA 4EQVA 1KD7A 1EP0A 1SBDA 2ARBA 3IZOA 2YB7A 5JMCA 4I01A 2R49A 4AXOA 5E8AA 1AJKA 4J6GA 3ZSJA 4CP0A 2SLIA 2R072 3AMNA 2VMFA 4XUTA 4I30A 4WVMA 1O4ZA 2VVFA 2ZMKA 3PVBB 1R093 1K5MC 3WW3A 3DKQA 3OF1A 4R8HA 3SKJE 2WNVC 1GU3A 2V5YA 3BYWA 1IHMA 4HPKA 3DPRC 4BIOA 5C3QA 4XYXA 3VBUC 4CU8A 3ZXFA 1J1LA 3B02A 2VBDA 4JGZC 4X6RB 3WOGA 3WR0A 2XJRA 4YGCA 4N43C 4CXWA 1KXGA 4NO4A 3C7GA 1JXNA 1Z7S2 2DU1A 1OLQA 2AYHA 3A4UA 2ZX1A 3HJRA 1GLHA 2Y60A 5A6ZA 5JXJA 1JYTA 1Z0HA 4HK9A 4QGMA 2J1TA 4CCOA 1DGWA 3B9CA 3PURA 3F2ZA 3CKHA 3FLPA 4TZDA 5KXDA 3LOIA 4TYSA 2VE1A 4IEOA 1C5IA 2B9VA 3IN9A 4Y24A 5GALA 1V0AA 3DYPA 1OC1A 4Q0PA 4UBGA 5FV3A 1H1IA 4HPKB 1WCUA 3M4FA 2R071 3T30A 1FXZA 1WW5A 4OUSA 1CZSA 2NZ9A 2X5IA 5DAWA 1IG3A 3KM5A 4L0PA 1AUYA 4JDMA 4MX3A 3VBOB 3LKJA 3A0KA 1POV0 2VZRA 4AHWA 1UYZA 3I2DA 3PVNA 3T1LA 2VOVA 3WUCA 3ZSEA 2NP0A 2RMU3 4COVA 2JKXA 3OGGA 4LBJA 4DEQA 1QF3A 5FMCA 2PHXA 2VMGA 2UWCA 5A7WB 2PFWA 1OHFA 3IWZA 4LBOA 4AVVA 2EAKA 2A6WA 4GB31 2GALA 4AI8A 5GZGA 2UY9A 1VBD3 1O3QA 3LOBA 1O4YA 3IDAA 5J09A 1NA1B 4PI2A 1FOD3 1RUH2 4FAHA 4R9CA 2WFF1 2PELA 1ND3C 3T1MA 1F4AA 1YJKA 5GLVA 4B29A 5A6YA 1IQDC 1OLRA 3ETQA 3LA2A 4J25A 2D6KA 5C4WA 3VZJA 3UGGA 5FZHA 4XCBA 4B7KA 3V65A 5FDBA 5FQ0B 5J36A 3N9QA 5EZWA 5A6QA 5F6KA 2RS52 4RR3C 4CEWC 4OULA 4Y33A 1F15A 5FZ3A 3FBMA 4ASKA 1JZ7A 1NT0A 1S2KA 2QVSB 2I07B 1W6PB 1DFQA 3FE5A 4LLOA 4Q4X2 5FLJA 5FZ0A 3USUB 1RUH3 1OA3A 5FPVA 5JZGC 4XPVA 4NIHA 3WD5A 4NROA 2FMDA 2XLFA 1EY2A 1NOVA 4MSVA 1AX0A 4LIVA 4FQZA 1LRHA 3USSA 1QOSA 1H0BA 1LTEA 1E5RA 2HYXA 1LOFC 1QJY3 1KJLA 1ULPA 2PHDA 1GOFA 4YZ4A 3K4AA 1W9SA 4Z92B 4H3WA 3I2GA 4IV1C 4EN0A 4N9IA 4XJWA 1UY1A 4GALA 2JEMA 3O1PA 3JB4C 1ZVFA 3AYDA 3N7KA 3LDRA 4XETA 5CZKA 5DDJ2 3SCHA 3SLIA 4CEYA 4XOGA 1RUC1 5FO9B 4Q4X3 1CN1A 4D7YA 4UAPA 1KS4A 2WYFA 3N7LA 1PGL2 1C3HA 2D3SA 3B94A 4RS5A 4V2VA 1LB2A 3VHNA 3H3UA 1SLIA 3J8F2 1IS3A 1Q5OA 4ZU4A 1XNAA 5K7PA 1WD3A 1W2TA 2JDPA 3OOXA 3AXEA 4HN0A 1Y4WA 1QJX2 1BYHA 4YW7A 3J7NA 1AR92 5A32B 3VN4A 2BGPA 2BNOA 4MHUA 2Q8OA 3FUQA 1JW6A 2QTWB 4JVAA 1BKZA 4FAGA 3TEZA 2B4KA 1RIRA 3TWIA 2P37A 3KF5A 4CCNA 4C90A 4DB5A 4A6OA 2YPDA 4D6RA 1V6IA 3PHMA 1PIV2 4IEZA 5GKAC 1J59A 3PVEA 1ZBA2 4MGIE 4XJZA 4URTA 2DVAA 4HKLA 1V9U3 4LPLA 3SCFA 4PBPA 1EAH2 2CGNA 5JOXA 3RFRA 3O1MA 1PVXA 2PN5A 4HMZA 3OY8B 4LKSA 1JZ8A 2XXZA 3OEBA 2IXIA 2Y64A 4KWUA 1RUI3 3TEWA 4CP9A 3KT1A 3MIDA 2UY8A 4S2GA 1ASJ1 4Q4V3 4NAOA 4WBBA 1AR93 1KJRA 3AVSA 2CGPA 4AEMA 1XYOA 1WBFA 1YFUA 2P34A 2WZR1 4QDRA 4F7ZA 2DBNA 3NKGA 3BTZA 3VDBA 4K6BA 4QHBA 5DDJ1 1FV2A 3BOWA 2JDNA 3ZX7A 5CG9A 2DFCA 2WNVA 1PIV3 2WS91 3PTRB 4FPFA 1D2QA 4PLMA 3DXUA 2G1MA 2UYBA 1YWKA 1EAH3 3VBSC 3J8F1 4QB1A 3VBUA 4MGTA 2J1VA 3BTAA 2XPJA 2W47A 1O3RA 4JGZA 1G6NA 2EXJA 3P5BA 4KWKA 2DUQA 3DF0A 4RHV1 3KS7A 4Q0QA 1J3QA 3RJ2X 5KBFA 3VZOA 4N43A 1YO8A 1SG3A 1XNTA 2AENA 1BZWA 2FHRA 2X53S 3LA7A 3ELNA 1H6YA 2CL2A 4QX0A 3KMHA 4COUA 1VR3A 5CFCC 3QH7A 5BNPC 2WAOA 1H4HA 1ZBA1 2VNOA 3POIA 1GNHA 4W6XA 5F5IA 4BOWA 2BGCA 3A7QA 2O14A 1DGRN 4OZXA 1H2MA 1GANA 5LA9A 3ZDVA 3SH5A 3NL1A 2A73B 1OLMA 3M1HA 1S0BA 2D97A 4YM0A 5C3OA 4QT6A 4XUPA 1GKBA 5FLIA 2VMHA 3BIWE 3MW3A 4MGZE 1GV9A 3AC0A 3W58A 5FTTC 2ZOEB 4AQTA 5ISLA 3VZLA 1LHWA 1VP6A 5C9AB 4LUKA 1WCKA 2EIEA 4LKFA 3WCRA 4MZUA 1BQPA 1WZXA 4Y1YA 1ZM1A 1KDMA 2FCUA 2HWB2 4PLNA 1GNZA 1RVF1 3OPZA 4YW6A 3THTA 4L99A 4N53C 5DAXA 4JRAA 4UFMA 5BNNC 5BNOC 4ZS2A 1OBNA 2QE3A 4XBLA 2IXCA 4K8RB 3RMYA 2WA4A 2OA2A 1PZ7A 2Y0IA 1EYBA 4DPNA 3M70A 2VMIA 5FXVA 1Y9GA 1VAVA 2DCJA 3KVAA 5F9TA 3RZLA 5E89A 3DGTA 5FBZA 5FY0A 2JD9A 3WF4A 5B4XA 3BTXA 1LESA 4EYUA 4XJAA 3WHTA 4AFBA 1TEIA 5FK8A 1RUF1 3VKOA 3HMYA 5C3PA 3RJRA 4IERA 4CRQA 2WLPA 3PIJA 4META 2YBKA 4DS0A 1VBA2 5FZGA 4HXCA 4YNIA 4Y22A 1UZWA 4HFSA 4IGQA 1VRH3 3WNNA 4ZZ8A 5C3RA 4CEWA 3T0BA 2YC2A 4E27A 5CG8A 1X8EA 4YFWA 1UU6A 5BPXA 5ANQA 3BPSA 3J7LA 3N9NA 1UMHA 4V1PA 1ENQA 2JENA 5JZGA 1XU2A 1VRBA 2K46A 5F39A 4HVQA 4CUBA 3KT7A 5FKCA 1CAXB 3VDDC 4IESA 3O1UA 1PX3A 4Y20B 3ILNA 1FT9A 4IUGA 3NAPB 1U5YA 3ZN4A 3THPA 5DG1A 1LOFA 4AOCA 5FY4A 5T5JA 1IS4A 1X9PA 3ZR6A 4OMDA 4NHYA 4Y26A 5T5OA 4D6QA 2AACA 1GNYA 1W6QB 5IVEA 3V0AA 3TNPB 3VBHB 2VW2A 4P9JA 3JQWA 3WUDA 5FZDA 1QU0A 2XHNA 1NYWA 5H9SA 3RMXA 1PNGA 1GR3A 4IEVA 3AYAA 1F2NA 2IVIB 1UO9A 2ZTNA 2D6NA 1OOPB 1D4M3 1W04A 2XBO2 1VBA1 1W3VA 1IPJA 5LA0A 4D94A 1LJ7A 3I2OA 2VNVA 1UYXA 3ILFA 2OQ6A 3ITQA 3Q9OA 3I97A 1BMV1 3I3MA 2VUAA 3LB9A 3AFGA 2R6QA 4LITA 1NLSA 5A1LA 3AL5A 4AW7A 4L2NA 4FP3A 2Y6GA 1ZZ9A 4A42A 1IOAA 3APBA 3EMRA 4M3CB 3S5QA 1LHVA 1R1A3 4M4PA 4AHYA 3F95A 2ORZA 2IFRA 2YG0A 2JDAA 3Q8AA 1FNZA 4P9LA 3GZUC 1N47A 1N1VA 2C5DA 4S2FA 4EN9B 5DUXA 1MEC2 1EPWA 2P6HA 1PO12 3C7HA 3WP5A 1UXXX 4JGYC 2K9ZA 1RITA 2GP5A 2P5BA 4WZFA 5IFPA 3BKZA 3VB9A 1OFNA 2G9FA 2H0BA 2CU5A 2R16A 4EN8B 4CVUA 2BEOA 4RFT0 3SQOA 4LBMA 3SH4A 3MI8A 2FDGA 5BV6A 4OLLA 4FVVA 1NY71 2NN8A 1ACCA 1WKYA 3CEWA 1IS6A 4NAMA 1KDKA 4OFGA 3WG1A 1EV12 1QJEA 5LY1A 4W65A 5ERLA 3AYEA 5FY5A 4DUVA 5JAXA 3FL7A 1XYPA 2P3IA 4CCDA 1H1MA 4OQ8A 3WQ7A 3FUOA 1LHUA 2WT1A 3CDZB 3FX3A 3M3IA 1I1EA 1AR82 5FXXA 3KHCA 1BHGA 3WW4A 4P02B 4LUMA 1J3PA 5FRAA 2ZGNA 1LOEA 5FMBA 5JIAA 3WX5A 2WSUA 4B8EA 3X29B 4CPBD 4DEVA 2CYFA 1GQHA 1JS9A 1RL3A 3ES1A 4D6SA 2Q1ZB 4N8MA 2AZ5A 5SV5A 1H8VA 2MNGA 1EV13 4Z1VA 3FJSA 1FATA 3ZIXA 3G6JB 4BMBA 3I3QA 1VBE3 2RG4A 1S0EA 1HN1A 2JE7A 4P9IA 1ND2B 4KMQA 1RUG2 1RMU3 2VMCA 2RS32 4BISA 5LA2A 4AGGA 1VE0A 1O91A 5ACA2 2ILMA 4FXKB 4N53A 4AFAA 2A3WA 2RR13 1NUKA 1ZBE2 5BNOA 1U0AA 3B3QE 1LODA 2AREA 2PHRA 4PIZA 4UW5A 3CNAA 4YW4A 3SCGA 1QXJA 1ZRDA 1DQ4A 3JCIA 3AXDA 3WNKA 4YW2A 3J26N 3FLTA 4CDXB 1MS3A 1CJDA 2C9KA 4PBOA 4C0HA 2V09A 4DRRA 3BTYA 1RUG3 4N7UA 2HBTA 3H8UA 4GKYA 1NCRC 4Q5OA 1AXYA 5L73A 3RS6A 2FDHA 3WCSA 2B8MA 3ZM8A 4CDWC 3WQ0A 5FY8A 4HN1A 4LK6A 3RVHA 4LQRA 5A1FA 3D6EA 3NJXA 1AF9A 3ORJA 3I54A 3VKNA 3N3HA 1ZREA 5KWRA 1V6MA 3I3DA 1UAIA 3U0ZA 1JODA 3S6PA 2ZHKA 4BDVB 2W1UA 4AVCA 2BERA 1W6OB 2C9AA 1FAYA 3O0XA 3OYWB 4YGEA 1POV3 4DUWA 2ZZJA 4WVZA 1CGPA 1W8UA 2YPJA 1ZBE1 2OYZA 1X9TA 5HCAA 1MS9A 4HSJA 2DWRA 5LRRA 3TEYA 3ZXKA 4XXPA 2ARCA 1VBB2 4XURA 3W5NA 2HWF2 3VLBB 4WM7A 2D7FA 3VBFC 1RUE2 4B3NA 1MVQA 1COV2 1PNFA 5JIUA 4QPWA 3ZKYA 2ZGPA 3ZYRA 3TN92 1YIFA 3N7JA 5GZFA 3RQ0A 2JX9A 3RI8A 1PMHX 4IV3C 4HL0A 4P9XA 1ZNPA 3OGSA 2IXHA 4XQDA 5IK5A 1W05A 4DY3A 3FN9A 1ZX5A 1FNYA 2GH2A 4DINB 1ULOA 1VBB3 2HBUA 1W90A 2VXJA 1D0HA 3HEIA 4M0NA 4OMCA 2HWF3 4QPGA 2XG3A 4WVWA 1RUE3 4GJZA 4JAAA 4EV0A 1QEXA 1X36A 5EIYB 1YHFA 1W9FA 1LU1A 2ZX0A 2VUDA 4XMIA 2ZGRA 5FY1A 5T55A 3T0AA 5JPNB 2G9GA 2JE8A 2Q8EA 4HONA 4F3JA 5CFDC 2JIGA 2JICA 4AEDB 4ZU7A 3K77A 3B69A 1BVVA 3KF3A 1TQ5A 1JTZX 2CWSA 4AI0A 1YIPA 2VL4A 3A22A 4XJUA 4CU7A 4OHYA 3N7MA 3LPGA 2VD7A 4AI1A 3THDA 5DUWA 5DUUA 4A41A 2Y6JA 3HT2A 4Q8KA 3OBZA 4NIGA 2DDUA 3HWJA 3WNMA 2R32A 5IVFA 4PIYA 3LIGA 3E6BA 4M4RA 3I2KA 5GZDA 1TME3 5K9YA 1Q56A 4XF3A 1VAKA 4RFRB 3PVOA 2C26A 2HWD2 1DYPA 1HB3A 1QJZA 1R081 5FYMA 2ZKLA 5LB6A 1UKGA 3P3PA 2WQ8A 4BQWA 2PHLA 3RZJA 2R042 2BW8A 3CQOA 1WA6X 3ZFGB 2ZGQA 3HN3A 3MPBA 4KGQA 4EN6B 5FPUA 4LT5A 3W9AA 4QKFA 4LLFA 3WVJA 1TNFA 1W6NA 2GN7A 1MVEA 1JOBA 2B39A 1XRUA 2TBVA 3AFKA 3B9IA 2BRTA 1W8ZA 2GC0A 4FOVA 1YCIA 3KQ4B 4TLGA 3R6SA 3WF0A 3KGLA 4NHKA 2EALA 4CCEA 1LOGA 3E97A 2A6VA 2C6SA 3OPWA 2HWD3 1RUD1 1N1SA 5A7OA 4CZSA 2E32A 1UY3A 2PLV2 4QKNA 2JG8B 4D7TA 4D7SA 1FX5A 3VKLA 3A21A 2X5IC 5JPMB 4SLIA 4B7EA 4XHBA 2ORXA 4KU8A 1LCLA 4YVWB 1C1LA 2XWBB 5EHDA 5EYYA 3UKTA 4AHXA 3OGVA 2BTVC 1HXS2 3ZPYA 2FZ1A 4XW3A 3SISA 5KHGA 1UWWA 2RDNA 4RYDA 4XF9A 4BJ0A 2PA7A 3WDWA 2CNAA 4JCKA 3ZXAC 1I5PA 1A8MA 4UW3A 2VZVA 1J84A 3CZUA 5FYBA 4TN7A 1SDWA 2WZ8A 3THCA 3IPVA 4K1ZA 4OCTA 5FZKA 4HETA 1LU2A 5I0SA 1F35A 1PVC1 2W87A 4XILA 4BMEA 1DIWA 3EYPA 1H2LA 5C4WC 3KD4A 1AR73 4LHNA 2TNFA 3IDCB 1NCRA 2VO5A 4GWMA 1HQLA 4QX8A 4Z82A 3RZGA 1UD1A 3UKNA 4R4XA 4J1WA 5F2WA 5DPNA 2VECA 1AL0G 1W3XA 4ARXA 4Y4YA 1C8M2 1FMD2 3WDUA 1UPIA 2VZPA 1W39A 2Z69A 3IT8A 4W50A 5FYSA 5DABA 1G9BA 5FMOS 1RUJ2 4QDQA 5BY5A 5J3UA 5T52A 4DZGA 3RYKA 4AI3A 4XACA 1UIJA 5LW9A 3KVBA 3KZ4C 1JYVA 3UV9A 1EPZA 4AVBA 1MS4A 5KXBA 1A3KA 5KC5A 2DVDA 2Y34A 4LOTA 1GP4A 2HH9A 5FPZA 3AP7A 4JKMA 4EROA 3H8OA 2Y6LA 3IDBB 4IE0A 1CJPA 1ONAA 3UYJA 2W5FA 4GWJA 4K20A 2B46X 2JD4A 1DF0A 1XSQA 3CJIB 4U2AA 1C8M3 1FMD3 4AHZA 2K0GA 3NV3A 3VV1A 4ATEA 1AYM1 3AJZA 2EAAA 1RUJ3 2RM23 1VALA 1HRV3 4GMP1 4RS5C 4C1WA 4PDWB 3VD7A 4BWOA 4FPCA 5IVBA 1Q8VA 2Q8CA 3PDQA 3C8XA 5EJ3A 5IJRA 1MPXA 2WLQA 1T6BX 2XB6C 3ACIA 1XB9A 3NWKA 1UKRA 4ZY9A 4XTPA 2ZX4A 2YUEA 3MFCA 1F5FA 1PZ9A 5A3PA 1PX4A 2XQRA 3PUIA 3ACLA 2WQ4A 3D0SA 2MPFA 5A7NA 2JIJA 4W8JA 1ENSA 4LTAA 4MOAA 3VZNA 4MVTA 1Q3EA 5JXIA 4PCRA 4D69A 1KGYA 1U5XA 5CFDA 2VUJA 3J9SA 4BXFA 4NIDA 4Y1ZA 1ULFA 1C57A 1QQP1 4MHRA 2PHUA 3POJA 5GJ6A 2VZQA 5HBAA 3AMMA 3WNPA 4R4ZA 3T2PA 4COYA 5FYVA 5L7OB 4FO9A 1XNKA 2BVBA 2VW1A 4WV8A 1RXFA 3JU9A 3OUJA 4IEXA 4QPIB 3IB3A 1OKOA 2DCTA 1BEV1 2DF7A 1NZCA 2VBBA 2R7EB 1XE0A 4BIFA 2LW8A 1O6UA 4RA0A 2J1UA 1ZRRA 3EBRA 4JQTA 4GB32 4AE2A 4CP1A 4LE4A 2IVJA 4NOTA 4XVHA 1G7YA 3VBOA 4FPJA 5FR3A 2R073 2WL1A 5C9AC 3FLRA 4Q0UA 5C8CB 3NSTA 4RD7A 4YZ1A 2WFF2 1Q8OA 2XJVA 4Y5Z0 4MXVA 2XJPA 2ZZQA 5A7WA 4U36A 5LBCA 1CAUB 4LA3A 1U12A 2W92A 2XVKA 5FYTA 3LEMA 3ZFEB 1E57A 1EUTA 2YDEA 3POBA 1NA1A 2UWBA 4Q8LA 3H9AA 1GZWB 5F3CA 2QUOA 4XMAA 4YW3A 2D93A 1IS5A 3H1WA 5CAZA 4M3CE 5GLZA 2J1AA 2J7MA 2XUEA 4I02A 2DBIA 2WN2A 4QKBA 5CKNA 1R091 1Z7S3 3LDKA 4Q4Y2 3WEZA 2BWAA 1RB8G 1PM7A 2WFF3 5FQ0A 1V6OA 3CBNA 1APNA 2WNEA 3RWKX 2GMPA 1JYXA 3QACA 2YU2A 1HQWA 2ZGKA 3DUIA 4L8QA 1YQ2A 1KITA 3SITA 2WNUB 1YQ6A 2IXKA 2YGLA 2VMEA 2ZEYA 4W4ZA 3WW1A 4MO3M 3RWNA 3N9LA 4Q0SA 3R4DB 1W6PA 1YYNA 5FREA 5FZIA 3USUA 5CADA 5FBJA 1T6GC 1ZA7A 3B93A 2BYVE 5LK7B 1RUC2 5DAPA 3S7EA 1FI2A 5A70A 1B09A 1H8TB 3OTFA 2VG9A 3ZN6B 3ZLIA 3S5AA 3N4MA 3PUQA 4DNYA 5CBLA 3FHAA 2PHFA 4FPKA 4OHZA 2D3RA 3BUCA 2WNOA 3IAPA 4IW3A 2XKPA 2Q8DA 3AMHA 5I0RA 1WMEA 2Y38A 5F3IA 4NUBA 2D98A 2H6BA 1CPMA 1ZZ6A 3LDBA 4HKOA 4BK4A 2JWPA 4BU2A 4F83A 2FZ2A 1QGLA 1N1YA 3DECA 3ROUA 2WJSA 5BNQA 1S2EA 3OJBA 4Q4Y1 5APAA 1C28A 3ZXEA 4OUMA 1QH7A 3VHOA 5HCHA 4C0BA 3ECQA 1M4WA 4EN7B 1RUC3 1ALYA 3R4UA 4A3XA 2BPA2 4Z2WA 5F1RA 5A32A 1W8HA 5CKQA 2RMU1 3GBGA 3HPNA 1CAWB 2P17A 1PZ8A 4NPMA 3O12A 3WINE 1D4VB 4CP2A 1ASJ2 1ZRIA 2YFZA 5D2AA 1RGSA 3DKWA 4L11A 5IWFA 1JU4A 5D8AB 2WT0A 1BXHA 5D21A 2RS53 3BOPA 2IFWA 2WZR2 2Z2SB 2A6XA 3GXUA 5IAVA 4CCMA 1NKGA 5I0TA 5J48A 2PAMA 5K4LA 2AUYA 3OY8A 5BXXA 2WS92 3SH3A 2BFUS 4Q4W1 1WA4A 3C2UA 3KV6A 3LPFA 1DG6A 5H9QA 3SNMA 1WW7A 2WYSA 3MLKA 1W03A 4LO4B 5LBEA 5IVCA 3VKMA 4YW1A 5FUNA 2DCKA 4FOYA 4NR1A 3HR9A 4RHV2 4UXAA 1A78A 4I09A 1LENA 1S4CA 2P6CA 2WO1A 4RN5A 1ASJ3 4YVSB 5HV0A 3D0JA 4WZCA 1W2OA 5AC91 1Q8SA 1UX6A 4K8FA 2WZR3 5FWEA 3ALQA 4D8MA 3UJOA 1WUVA 1G86A 2VGDA 1W2AX 4XIOA 2A7AA 5DDJ3 2P1BA 5A3WA 1WLDA 3P1IA 4YRDA 2PAEA 4JTNA 5C7GA 1DQ6A 4G9SB 1MQTB 1A8DA 2A3XA 2P3JA 2RS12 1QMJA 3AVRA 3P3NA 3J8F3 2ZGUA 2VTXJ 1L7LA 3NV4A 3MV01 4H7MA 1VMHA 1QJX3 3G7DA 4QXCA 4RHV3 3AP4A 1UN1A 1ENXA 2FDKA 1J1TA 2WUHA 2CY6A 1L7RA 1UL9A 4MGKE 3POYA 4E2SA 2D43A 3MUY1 1QY4A 1MZ6A 1WCSA 2V5DA 5I0UA 1WCDJ 3LF7A 4GZ9A 2XLGA 4IEQA 1ZBA3 3WDYA 5FWJA 5HV4A 5DN2A 2YC4A 4H7LA 1RVF2 4GH4B 2ZABA 3ZYJB 1DQ0A 1BBT1 1LOCA 2VPVA 3L9JT 3OGJA 4OVEA 1QJU1 2ZEXA 1OF3A 3M3CA 3RG0A 2E33A 3VBRB 5C9AA 1ND2C 5IUQA 3OG2A 3KCXA 3D8CA 1FPN1 3T4HB 4A3ZA 1NCQB 2VY0A 1RUF2 1PGSA 1X33A 2ZA9A 3MDPA 3PJQA 4CCLA 5LBBA 2VZTA 1PO22 2QQJA 2RS11 1E5HA 2OVUA 1SZBA 5A6XA 2ZX2A 3MZHA 2FQPA 3GJAA 1LGCA 3C3VA 4E2QA 1T2XA 3M3EA 2D6OX 3A0NA 2ARAA 1DCSA 2YFUA 4GMP0 2OS2A 1ZRCA 3I2FA 4LA2A 5JXHA 3FFZA 3INAA 4KQ7A 5FPLA 3LSDA 3CF6E 1VB4A 5F37A 2R062 4HVRA 1DYOA 3S7IA 2PAKA 1RUF3 1K5MB 2WR9A 4LKDA 4XF4A 4FBFA 4Y5TA 3NNGA 5FJKA 1GYKA 4LBQD 1NLRA 5A3MA 1TMF2 4YARA 5FZLA 3DPRB 3V64A 3K51A 3B5LB 3LZZA 3ZDSA 4LO8A 3MHZA 1CAXA 2OW4A 4EZ4A 4Y20A 4DMIA 3TAYA 4QD2A 1UZVA 2XJTA 2W94A 3NAPA 4INDA 3VDAA 4G4FA 3IDEA 2OZ6A 1XNDA 1SFYA 1UY4A 2Y33A 3H50A 3LEGA 4BQ1A 4CUCA 2EICA 2Y6HA 2NMOA 2ZMLA 1W0OA 3AZVA 2HWB3 1PO21 5EJ1B 1W6QA 3IM0A 1REFA 2W2IA 4EE2A 1SDDB 3VBHA 3NNJA 5FXWA 1GWKA 3LGRA 1HQNA 1AX2A 4UYBA 2X8KA 1BMV2 4AVTA 2WO3A 1BVP1 4YM3A 3AMQA 3MIBA 1JZ3A 2V72A 3I49A 1OOPA 3GCWA 3WQ1A 2BJSA 2XDVA 3M3OA 2GNBA 2VVDA 4RGAA 4I0WB 2VMDA 2R061 4CUGA 4XDQA 3GF6A 4LHLA 4XFCA 2B9UA 1UMIA 1VBA3 1V6KA 5E88A 1PMIA 1TMF1 4AI9A 2D6LX 1JZ5A 2Q1MA 3ACFA 4JKKA 3WHUA 4E4HA 1HRI1 2EIBA 4R9DA 2DCZA 3CL1A 4M3CA 3RI9A 4LULA 4WM7C 5FOJB 2VBPA 3ZKUA 2LALA 4Z07A 3ON7A 5HXVA 4DOUA 1S0CA 1K5JA 2BU9A 3H7YA 3W20A 1WLTA 2QQUA 3URFA 5C5TA 3UNPA 3N35A 1NY72 3HNBM 3RYRA 1ND3B 3BU7A 1WGPA 2BOIA 1W0NA 5FO7B 4ET7A 1XOYA 1VBC2 3KWVA 5GZCA 4MXWB 4ES9A 2YZ4A 3ZYIB 2G4IA 3AKRA 5T3NA 5FZ6A 1SBFA 1GP5A 4Q26A 4A44A 4ASMB 2I74A 2HLEA 4IEWA 4RR3B 1HJGA 2L9LA 1EUUA 5FPAA 3SEPA 4QPGC 1XQNA 1G9FA 4M01A 1ZYBA 5EJZB 3CO2A 4NJ4A 1X50A 2O8QA 4XE9A 4JX0A 1HB4A 4QXKA 5K0UB 2DTYA 2WINB 4XFGA 3HVDA 1XE7A 3SXWA 3K3NA 4KWLA 2XBO3 2VNRA 5FYIA 2ZCWA 3ZFGC 4BQXA 5KXCA 2KA3A 1K3IA 2UWAA 2SBAA 1RHI2 2VCCA 3O1SA 2XWJB 2QQOA 2P3KA 5JUVA 4IDZA 2B7YA 1DGLA 4CDUB 1OF4A 3LFMA 2WFPA 3PUAA 4Y3OA 1HJFA 5A7SA 1OH3A 3WDXA 4IV1B 4FTSA 4IGPA 3VL9A 2OZJA 2EXKA 1LAJA 3KV4A 2GN3A 2NYYA 3M2MA 4QPYA 3WDTA 1MS8A 1O3TA 1VPHA 2ZAAA 5CFDB 2JG8C 3M3QA 1JYIA 3HNYM 3EQEA 4XZPA 5AVPA 4ZXKA 1QHDA 3TBDA 2HWC2 3T08A 1PMJX 5LY2A 1VBC1 3A23A 1ZZ7A 2YBSA 3JXSA 2FDIA 2ZS6B 1ND2A 5AVAA 3UK9A 4UBHA 4YVWC 4KNCA 1MEC3 3BVCA 4XEZA 1PO13 2ET1A 1DLLA 4CA9A 1CAVB 3PMSA 3AMPA 5JR2A 3ZO0B 5JLVA 1AXZA 1F5JA 2VXRA 2ZAHA 3AZYA 4R52A 4ASLA 5JCTA 2YYOA 1VMJA 3FWEA 4XIKA 5DZGA 1Y9MA 2OPWA 5DXDA 4C91A 3GGLA 4GULA 3NNLA 4I3PA 2XHKA 5CEHA 3POWA 4MLOA 5GLTA 5JSOA 5L9VA 5SV8A 2ZHLA 3PTYA 3VHPA 4BQ4A 1RJ7A 4OHVA 1TZOA 3B00A 3FFQA 3IMMA 5FZAA 3Q8CA 1ULEA 1RHI1 2AGSA 3DCQA 4CDXA 1O5LA 5F6LB 3H8RA 4BM8A 2X05A 3HBZA 5FZFA 3U4XA 3O7OA 2QFEA 2FCVA 4FTBA 1MZFA 5FZOB 1OUSA 1B35B 5T5LA 2C4XA 4LMFA 1H6XA 1IKPA 3TNQA 4PQQA 2VOXA 3JD71 3FC0A 4A2UA 1YUDA 1RXGA 2WA3A 4URAA 1JZ6A 1OKQA 4HK8A 4BB3A 4ISQA 5EP9A 3KHBA 1AR83 4LBQB 5GLUA 1W2UA 2CDPA 3GYDA 3T3YA 3ZXGA 5FP3A 5IYYA 1SACA 3E1F1 1UU4A 1W6MB 2HWC1 5EXOA 3VBSB 1QXRA 1UOFA 2V4AA 3MF6A 4RL7A 3OSDA 4LNVA 5JOZA 1W6OA 3OYWA 2Q30A 1NE4A 1QIQA 1DZTA 1Q8QA 1XXNA 4PT6A 3OGRA 1SFPA 1TVGA 4YGBA 5A3TA 4QMAA 1AYN2 4QQPA 2RS33 4PLOA 1K12A 3K4ZA 4AI2A 5CFCB 2VTXA 5BNPB 2LM3A 2VULA 2D3PA 3CJIC 3NNFA 5EWSA 3WW2A 3ZR5A 4UFKA 5ACA3 2QQIA 1DQ1A 3DV8A 5F5AA 3ZFFB 3O0WA 1ZBE3 1JHJA 3NJYA 4TSVA 2LROA 5A7QA 2JDUA 3WF1A 1S0IA 3MLJA 3W59A 3WT3A 2BZDA 3SEEA 3ZMOA 4Q29A 4JQRA 3OUIA 1OXCA 2ADEA 5FZ1A 4K9SA 5KR7A 2AC1A 3V0BB 2H0VA 4F8AA 2E63A 4FFGA 1LOAA 3WF2A 2VQUA 4YYOA 1DBNA 1WCQA 2GC2A 4NMIA 1QNYA 4AWDA 4GA9A 3V56A 2J1EA 4IXLA 2H6CA 2BBAA 1KQRA 2J42A 4BYYA 1Q8PA 1H9PA 2G19A 1JN2P 4XUQA 3O1RA 2BUKA 2XL7A 4JV4A 5F5CA 5A7PA 1JBCA 3QLQA 5BNNB 4RQPA 4JHZA 3KGZA 1W8FA 3LA3A 1NAEA 2CSGA 5T50A 4AEDA 5FUPA 1AXKA 2XUMA 3OCPA 1NQJA 2RDSA 5FYHA 2IWGB 1AYN1 2XJSA 3TYJA 1R1ZA 2A70A 4I0BA 1GZTA 2XR4A 3ZVXA 4COZA 3NV1A 1NLQA 3RDIA 1R082 1AR61 3K4DA 5BUVA 4XFAA 3AKSA 1I3HA 4K40A 2AR6A 1GUIA 4QPIC 1J58A 1BJQA 3WQBA 4MGYE 2HWE1 3HAGA 1PK6B 3GBFA 1XC6A 1UMZA 3I8TA 4LO7A 4UF0B 1ZA4A 5F3GA 3T2QA 1FYUA 4XUOA 4HVOA 1YI9A 2Q4SA 4AFCA 4X8PA 1COV3 4RQPB 1UY2A 3Q8BA 4PJYA 1O7FA 4ATFA 2IUWA 4P9YA 1DDLA 2OX0A 1IKQA 3VDDB 3ZFGA 1RTVA 5CNAA 3TN93 1RUD2 4EWDA 1UU5A 3I59B 2B5HA 4X8NA 5EYXA 1CVNA 1R083 4HG6B 4OQ9A 2OPKA 4AR2A 2A3YA 2TEPA 5FP8A 3VDCA 4DXTA 1UXZA 5GM0A 5JMOA 2GNTA 1QNWA 3JBG1 3LCPA 2F6BA 3ZFEC 5L9BA 1ULCA 3ZIWA 2A6YA 2OXBA 2J1RA 4H55A 2VZ3A 2QNKA 4CPBA 2FDJA 3CIHA 1V70A 2JG8A 4QKDA 4GQ7A 5LCWL 4YM2A 1QOTA 1AL21 3Q8EA 5AFBA 3CHXA 5ABJB 4ZONA 3VBOC 3MLLA 2WN3A 3TEXA 3LFIA 4QQLA 2W1SA 4YVWA 4LBNA 3MV11 2I2SA 2ZGSA 4NHXA 5FYZA 5J96B 5BYNA 5A3LA 3DYOA 1E5IA 2NMNA 4JHTA 3ZXJA 2C24A 2JDMA 4FFFA 1PVC2 4OHWA 4CXYA 1F9KA 3T0DA 4M00A 1JOJA 3WF3A 2XVLA 4AEJA 2W1WA 5JI9A 3EHKA 2P3YA 3K3OA 5J37A 1CIWA 4OZOA 1NA1C 3WG4A 2WRAA 3GZEA 2DVFA 3RZHA 3PLQA 2Y0OA 4AFDA 2A6ZA 4BLIA 2JDKA 2WIIB 2RE9A 1W28A 2R043 1PGW1 2ZKNA 5G05L 2Z42A 4O65A 4AGRA 5I8YA 3ME2A 4JGYB 4LBKA 3MFAA 3M7AA 1MZ5A 1KFUL 1OH4A 1YJLA 1IPSA 3RGBA 4C8DA 1IPKA 1S0GA 2VZSA 3MW2A 4Y1VA 3WXPA 5E16A 4CCJA 1BCXA 2D6PA 1UZYA 4DY5A 3T09A 3WNOA 2E51A 3N36A 2PLV3 4FPYA 1DYKA 5IW0A 4NWWA 1AYM2 1SBEA 3KCCA 5IK4A 2R1DA 3EB7A 1ZZBA 2XJQA 5JR7B 5HI0A 1NXMA 5E1RA 4ES8A 1LKNA 3CLPA 4LKEA 1NZIA 1NXD1 1OA2A 5D8AC 1CQ9A 1Y3TA 1HXS3 3O0VA 1CD3G 1F31A 4OI2A 2W1QA 2WZEA 3CJIA 4XF1A 1U5ZA 3SHRA 4A7KA 4DUXA 4YM1A 1WLCA 4IE5A 2IC1A 3I3BA 1GZ9A 1G9CA 4QXBA 4MG2A 4PDWA 5LBFA 1AYM3 5JSRA 3ST7A 1JZ4A 2QQPA 4DIQA 1HV1A 4GMP3 4IEUA 3WZ1A 3O1VA 2UYAA 5EFUA 5A3OA 2J1SA 3D4KA 1JU3A 4EWAA 3PL0A 4XHXA 1QQP2 2OT7A 2WKKA 1REDA 4IEYA 5FFOC 4NRMA 2WDBA 1H4GA 5IVVA 1REEA 2AEZA 1DU3D 3QD6A 3LEIA 1LEDA 4HSLA 4QQHA 3GHMA 2RDRA 4LOSA 1H2KA 4AL9A 1HB1A 4AZZA 2WZPP 1SPPB 2EF6A 2GNDA 2Z79A 3LSEA 4IE4A 2RHPA 5FZ8A 5I8SA 1BEV2 3E5QA 1GQGA 5C70A 4KU7A 2V4VA 1W8NA 3OB8A 1BK0A 3NJZA 1JUIA 2CAVA 4HZFA 4I0AA 1QQP3 3HNMA 5KC6A 2VW0A 5L7OA 2JG9B 1SLTA 4QXHA 4E4SA 4QPIA 4CDWB 5IHRA 2Z4FA 4GWIA 5FY7A 1LEMA 4XDOA 3ZSLA 3I2JA 1Y9QA 4GH4C 3E5UA 1H30A 2B42B 1KFXL 2D6MA 2HYKA 3DXTA 4H14A 1L7QA 1KS5A 4NHLA 2CDOA 3WP4A 5FMDA 1W9WA 4QM9A 5H9PA 2QQKA 4AQSA 4XXAA 3VBRC 3WNLA 2UURA 3UGHA 1OQ1A 5C8CA 2DU0A 3QH6A 5DAVA 4EJRA 4UI9L 1KEXA 1MS0A
chains in the Genus database with same CATH topology
4ISRA 2DVBA 3ZSKA 1NCQC 1CAUA 1OQDA 1R092 3MPPG 1XU1A 1HIXA 1TE1B 2MEV1 5JOYA 3ZFEA 5KHKA 4XQ4A 2RM21 1HRV1 4AVSA 1GZWA 2NLRA 2ZPXA 5LRSA 2PHTA 1SCSA 3VBFB 1OPOA 3OBTA 2GSYA 1WW6A 5A33B 3TB0A 4C1XA 1XYNA 5JDBA 1YFXA 2WNUA 3KLSA 1WLWA 2VQAA 4IV3B 1AZDA 4QGNA 2DURA 2AH2A 4CDQA 3O14A 4KBBA 3PMEA 4BH9A 4FXGB 4BPZA 3U11A 4N7IA 3KQRA 1S2BA 5JI7A 2XLAA 1VJ2A 4GB33 1HKDA 1H8TA 3ZN6A 3BODA 1VLNA 1S0JA 4OHXA 4BZ4A 5KHJA 1SLLA 3DN7A 1GICA 4Q0VA 3E6CC 2O0OA 2F4PA 1RJ8A 3JZVA 4WVMB 2D40A 2RMU2 4HANA 3L2HA 4ZU5A 4P5HA 3VHRA 2GC3A 3JUUA 3I7DA 4LEJA 1Q43A 3UJQA 2VOWA 3ZXLA 4FPEA 3AZXA 4CDQB 3TOJA 4AF9A 4I3GA 1VBD2 2XVGA 4JTOA 5TSWA 2DV9A 1FOD2 1QH6A 3B7MA 5FOBB 4S2HA 3LAGA 1CAWA 3NAPC 4Q4Y3 4Q4W2 1S0FA 1NG0A 1UZZA 1V6LA 2YY1A 5D8AA 2A71A 1GBGA 3AX4A 5FAXA 5L36A 3R05A 3VBHC 3ENRA 1HX6A 4LO6B 1WBLA 4N9HA 1V00A 1YRZA 4D3WA 2VU9A 5AC92 1Z7S1 4O9GA 4A7ZA 2CWMA 1OOPC 4X6QB 4Q4W3 4YGDA 3AJYA 3SMHA 1AHSA 4YVSA 1DQ2A 2X5IB 1OI6A 4DQAA 3M8LA 1AJOA 1QJY2 2WSVA 2QZ3A 2ES3A 3MYXA 4FPLA 4K1YA 3RNSA 1VBD1 4RSUA 5CU1A 5AC93 2WQZC 5GZEA 1MQTA 2WC2A 1FOD1 2DFBA 5FO8B 3ZN5A 5K0UC 2TUNA 3WY6A 4AQ2A 4MYEA 1ULGA 4WM8A 4K3UA 1NE6A 2GC1A 4PIXA 4CDUC 1BBT2 4WVVA 3OD4A 4GWNA 1MS1A 3EJKA 1QDCA 1QJU2 1SCRA 2W68A 4FOWA 5J98B 5C4WB 4LE3A 1JUHA 4XBNA 2VNGA 2I45A 2E53A 5T54A 1L3JA 1C5HA 2ETEA 1FPN2 4GH4A 4KGGA 1RUH1 1VAMA 2K2SA 2WS93 1V9U2 2JDZA 3WG2A 4CYDA 5EV7A 3FBYA 3EXUA 3VBRA 2ZGTA 1LECA 2BNNA 1RUI2 5LK5A 3AK0A 3IMNA 1QJY1 4AVAA 1XE8A 4WM8B 1CESA 1BBT3 4XFHA 1IQAA 4Q4V2 3HIFA 3ZXDA 2PYTA 2WWSA 1QJU3 2XKOA 2RS51 5FMOL 1NCQA 5I93A 1N3PA 1DQ5A 3IIAA 3KSCA 3HN1A 4ITCA 2CAUA 4Q4X1 3BB6A 1FPN3 3NV2A 1Z78A 1LOBA 4CEYB 2HEWF 1H2NA 4LR4A 2RS13 4NWVA 4Y1XA 1C1FA 1OMIA 4RS5B 4LHKA 2EVXA 1B35C 1OPMA 1S55A 1I5ZA 1V6NA 5HCBA 4PQ9A 2YC0A 1K5MA 4FOQA 4AGVA 1V9U1 3HT1A 5J7MA 3D82A 5DG2A 1PGL1 2GMEA 4BE3A 2UU8A 3DPRA 3WV6A 1I6XA 1RVF3 1RUI1 3UKVA 4W6YA 1QJX1 3MEPA 4Q4V1 1AR91 4FT8A 4CDXC 1JYCA 4MUVA 4EWEA 4RGGA 2YGMA 3AKTA 4JC1A 1PIV1 4MV2A 4DRVA 3L2YA 1N3QA 1EAH1 3ZFFC 2W39A 2XJUA 1PO23 3NO8A 4S2DA 2WNVB 2E9QA 2DYCA 4KG8A 2CV6A 4XF0A 3VBUB 4YZ2A 1IZ3A 1HRI2 4Q2FA 4JGZB 3IBMA 4XFIA 4YLZA 5H9RA 2ZBJA 5C6CA 5DUVA 5C8WA 4N43B 2ZACA 2BNMA 2YV8A 3HD8B 2R063 1RC6A 3NVCA 1IGOA 2JE9A 3S30A 1VRH2 1QOOA 1TMF3 4JDOA 1NQDA 2PHWA 4FCAA 4KH9A 5JOWA 4Q1PA 3B01A 1HW5A 5FPXA 1HRI3 2IXLA 1ND3A 4BLJA 2GAUA 1UPSA 1GZCA 3AB0A 2Q0AA 2NM1A 4AG4A 3ILRA 4MXWA 3PNAA 3WLUA 5CVRA 1H9WA 3I4IA 1X82A 1O5UA 1C4RA 4RR3A 4OI1A 2RJLA 5D1IA 1PK6C 4B4RA 3ZYPA 4K7JA 2ZGLA 2ZGOA 2JKBA 5K0UA 4RQPC 2YXSA 4Y1UA 3RRDA 4YSFA 4AEDC 2RJKA 2OUHA 2HWB1 1YNAA 2DTWA 1D4M2 1V6JA 4CDUA 4NPRA 1VRH1 4QX5A 3JQXA 4IV1A 2R0HA 4O9EA 1CPNA 3J4UH 4Y22B 3MIHA 4ZKTB 1QWRA 4XFFA 4CEWB 5KHIA 1MR5A 2QZ2A 2JJ6A 1YI7A 4OI0A 3DL3A 2CGOA 3ZSMA 5ABJC 2KXLA 3FMGA 1R1A2 2ENRA 5IT6A 3AKQA 5JZGB 1SEFA 3QOPA 2FMYA 1CAVA 2W0XA 1JH5A 2QJVA 3GHNA 2KM2A 2EXHA 1VBC3 1WD4A 4XFBA 2GNMA 4QU2A 3VKFC 4XJ9A 3GZTB 1Y7BA 5JWPA 1C8NA 3V0AB 1CONA 3JD72 2WT2A 4Q1RA 1LR5A 2C1FA 1D4M1 2XL9A 1Y43B 1KRIA 1OSGA 2ZJCA 3D5OA 1SLCA 2BWCA 1AX1A 1B35A 2NQYA 3VL8A 2VQ0A 1RHI3 4NHMA 3VGIA 4AYUA 3WG3A 2BFUL 2JECA 2EXIA 4DXZA 3WP3A 1RUNA 4LBQA 4GKXA 1U5IA 4GIQA 1AVBA 2ARXA 1W6MA 3JD73 3VBSA 2EA7A 2P2KA 1R1A1 3T2TA 5I91A 3U10A 1YFYA 2XBO1 4J1XA 3AZZA 2HWC3 5LEKA 4A7YA 2D5HA 4QQOA 5FCCA 5HCFA 4NVPA 2HKXA 1VBE2 2LTNA 1WW4A 5DZEA 3KB5A 4QGLA 3E5XA 5CFCA 5BNPA 1LHNA 1RMU2 4TWTA 5GZDA 4P14A 3CU7A 4HKWA 2JXAA 3WP6A 3AP5A 4COWA 3VZKA 3ZFFA 4OI4A 1F8VA 2IZWA 2RR12 3O5SA 1CX4A 2YHJA 4N90A 3RZZA 3V0BA 4TLFA 1ENRA 2ZHNA 4YFZA 1MEC1 1PO11 4M0HA 2GDFA 4AQ6A 2GZWA 4PF5A 5AFEA 1N1TA 2CTVA 1DZQA 2ERFA 4CTEA 2HEVF 2A5ZA 4QQ2A 1D2SA 3UL2A 3HQXA 4W6WA 4YZ5A 1H1AA 5BNNA 1AR62 3BPZA 1OA4A 2ZGMA 1EV11 2DCYA 2GU9A 4PDWC 4NN0A 1D0GA 1DHKB 2HWE2 1VBE1 3AP9A 4BA6A 5IK7A 1LGBA 3WNXA 1RMU1 1DGRA 5CA6A 5IK8A 3MIGA 1AYN3 4SBVA 1A6CA 2JG9C 5CIRA 1AR81 1SLBA 3H7JA 2RR11 4FPGA 4IETA 3VUOA 2Z5WA 1PK6A 3WDVA 1AR63 2N7GA 3MIFA 3WX5A 1MACA 4P9GA 1BK1A 3AZWA 1I9RA 3H0OA 4N53B 5KXEA 1MZEA 3JBG2 1YFWA 2E7TA 5C33A 2HWE3 5BNOB 3ZMNA 3AM2A 3OD0A 3VDDA 1DGWX 1PHMA 4QM8A 4YZ3A 4JRLA 1G9DA 1RUG1 2VOKA 3I59A 2RS31 3IKWA 4HBNA 5DZFA 1AL22 1ZZCA 1QKQA 4IL7A 4FQ4A 4M3CF 5ACA1 5L7OC 1O3SA 3MGUA 4YG3A 1VIWB 1J3RA 2GMMA 3ZYGA 2VVEA 1HLCA 3PJYA 3JBG3 3R0RA 3NW4A 3MICA 5ABJA 2GH8A 2BVVA 3BALA 1POV1 2XH6A 1AL23 5C8CC 1QDOA 2E6VA 5GLWA 4UW6A 1SLAA 1XNBA 2B45X 4IQPA 2E7QA 4GXLA 5FLHA 2EIGA 5JVVA 5L19A 1PGW2 4FPOB 4B4PA 2ATFA 3ASIA 1UIKA 4R9AA 1GSLA 1OD5A 1LULA 4AK3A 1TME2 2QCSB 2ET7A 4B4QA 1LHOA 2O1QA 3CJXA 1MS5A 4WM7B 1JHNA 4KL1A 4IEPA 2BQPA 4Z8BA 2DUOA 1RUD3 1RINA 4E2GA 1X7NA 2YMZA 4JGYA 3TRSB 2A75A 2WNUC 4E4ZA 4JDNA 1HDKA 1VBB1 4MH0E 2HWF1 3RPQA 3QCWA 2QDNA 1RUE1 4CDQC 3MIEA 4Q27A 1COV1 1W0PA 1XNCA 3E6DA 3K48A 2R30A 2XGXA 3QBQA 3ES4A 4QPGB 4BHPA 3KT4A 3GNEA 3TN91 4XTMA 4ORFA 5KHHA 1H8TC 1RUOA 3H3ZA 3BCWA 3NKTA 4YG6A 2C0ZA 2PTMA 2HEYF 1ULDA 3VZMA 1OFSA 5BPXA 2R1BA 4DFSA 3AP6A 1PVC3 1YLLA 1TME1 2R0FA 1UCXA 4P9WA 3U07A 5I8TA 1WMDA 3AYCA 2HJIA 2QDRA 5T5PA 1O4TA 4I2OA 2MHFA 2LUWA 1ZRFA 4R9BA 4E9KA 1AR72 1YXWA 1UW8A 4LBLA 2W08A 4G3YC 4AEKA 3FHIB 2Q5TA 3ATGA 3H1YA 4FP2A 2PQQA 1WMFA 1W6NB 2FBEA 2HWD1 2BBVA 5CB7A 1N3OA 4LO5B 2E7AA 1GFF2 4UW4A 1URXA 1S0DA 1SFNA 2R041 3MW4A 2YROA 4L9BA 4HT1T 2OUJA 3R4SA 2IXJA 3S0MA 1G9AA 1LGNA 4YVSC 1DZRA 2ZX3A 1S1AA 2JG9A 4YW5A 4HLTA 4CDWA 4ONUA 4K21A 3FZ3A 4XQWA 4KG0A 2QKDA 3RYPA 2PLV1 4L92A 2MEV2 1MQTC 5LEJA 2X29A 2D5FA 3POSA 1M06G 4AFMA 2RM22 3EO6A 2VH9A 5B2GB 1HRV2 5F5QA 4WM8C 1AR71 3IPVB 1HXS1 2V73A 2OIIA 4YG0A 3GBWA 2Y26A 1G8WA 1CR7A 1NCRB 3KCYA 1ZZ8A 3GZAA 1UF2C 4E4DX 2W52A 1FV3A 4CEYC 1SMVA 2MEV3 3OBRA 4XBQA 3AKPA 3VBFA 4FPHA 3JB8A 1BEV3 2ZMNA 4BCUA 5A33A 2DVGA 2O8OA 2D44A 4KWJA 3H1MA 2ZHMA 4L97A 1OQEA 4XJ8A 1VB2A 4IV3A 1QXPA 1SQ4A 1TNRA 1C8M1 1FMD1 2NPIA 5JSPA 1HV0A 3LWCA 5K8SA 1RUJ1 2DUPA 4FSJA 3MF9A 1X8MA 3GALA 1KD7A 1EP0A 1SBDA 2ARBA 5JMCA 4I01A 2R49A 4AXOA 5E8AA 1AJKA 4J6GA 3ZSJA 4CP0A 2SLIA 2R072 3AMNA 4I30A 4WVMA 1O4ZA 2VVFA 2ZMKA 3PVBB 1R093 1K5MC 3WW3A 3OF1A 4R8HA 2WNVC 2V5YA 1IHMA 4HPKA 3DPRC 4BIOA 4XYXA 3VBUC 3ZXFA 1J1LA 3B02A 4X6RB 4JGZC 3WOGA 3WR0A 2XJRA 4YGCA 4N43C 1KXGA 4NO4A 1JXNA 1Z7S2 2DU1A 1OLQA 2AYHA 3A4UA 2ZX1A 5CFDB 1GLHA 1Z0HA 4HK9A 4QGMA 1DGWA 3B9CA 3FLPA 4TZDA 5KXDA 3LOIA 4TYSA 4IEOA 1C5IA 3IN9A 5GALA 4Y24A 4Q0PA 4UBGA 1H1IA 4HPKB 3M4FA 2R071 1FXZA 1WW5A 4OUSA 2NZ9A 2X5IA 3KM5A 3VBOB 1AUYA 4JDMA 4MX3A 3LKJA 3A0KA 1POV0 4AHWA 3I2DA 3PVNA 3T1LA 2VOVA 3WUCA 3ZSEA 2NP0A 2RMU3 4COVA 3OGGA 4LBJA 1QF3A 2PHXA 2VMGA 2UWCA 2PFWA 1OHFA 3IWZA 4LBOA 4AVVA 2EAKA 2A6WA 4GB31 2GALA 4AI8A 5GZGA 2UY9A 1VBD3 1O3QA 3LOBA 1O4YA 5J09A 1NA1B 1FOD3 1RUH2 4FAHA 4R9CA 2WFF1 2PELA 1ND3C 3T1MA 1YJKA 5GLVA 4B29A 3ETQA 1OLRA 3LA2A 5C4WA 2D6KA 3VZJA 4B7KA 3V65A 5FDBA 5FQ0B 5J36A 5EZWA 5F6KA 2RS52 4RR3C 4CEWC 4OULA 3FBMA 1S2KA 2QVSB 2I07B 1W6PB 1DFQA 3FE5A 4LLOA 4Q4X2 5FLJA 3USUB 1RUH3 1OA3A 5JZGC 4XPVA 3WD5A 2FMDA 2XLFA 1EY2A 1NOVA 4MSVA 1AX0A 4FQZA 1LRHA 3USSA 1QOSA 1H0BA 1LTEA 1LOFC 1QJY3 1KJLA 2PHDA 4YZ4A 4Z92B 4H3WA 4EN0A 4IV1C 4N9IA 4XJWA 4GALA 2JEMA 3JB4C 1ZVFA 3AYDA 3N7KA 4XETA 5DDJ2 3SCHA 3SLIA 4CEYA 4XOGA 1RUC1 5FO9B 4Q4X3 1CN1A 4D7YA 1KS4A 3N7LA 1PGL2 1C3HA 2D3SA 3B94A 4RS5A 1LB2A 3VHNA 3H3UA 1SLIA 3J8F2 1IS3A 1Q5OA 4ZU4A 5K7PA 1WD3A 3AXEA 4HN0A 1QJX2 1BYHA 1AR92 5A32B 3VN4A 2BNOA 2Q8OA 3FUQA 1JW6A 4JVAA 4FAGA 1BKZA 1RIRA 3TWIA 2P37A 4C90A 4DB5A 1V6IA 3PHMA 1PIV2 4IEZA 5GKAC 1J59A 3PVEA 1ZBA2 4MGIE 4XJZA 4URTA 2DVAA 4HKLA 1V9U3 3SCFA 5JOXA 4PBPA 1EAH2 2CGNA 1PVXA 2PN5A 4HMZA 3OY8B 2IXIA 1RUI3 3KT1A 3MIDA 2UY8A 4S2GA 1ASJ1 4Q4V3 4WBBA 1AR93 1KJRA 2CGPA 4AEMA 1XYOA 1WBFA 1YFUA 2P34A 2WZR1 4F7ZA 3NKGA 4K6BA 4QHBA 5DDJ1 1FV2A 3BOWA 3ZX7A 5CG9A 2DFCA 2WNVA 1PIV3 2WS91 4FPFA 1D2QA 4PLMA 3VBSC 2UYBA 1YWKA 1EAH3 3J8F1 3VBUA 3BTAA 2XPJA 1O3RA 4JGZA 1G6NA 2EXJA 4KWKA 2DUQA 3DF0A 4RHV1 3KS7A 4Q0QA 1J3QA 3RJ2X 5KBFA 3VZOA 4N43A 1YO8A 2AENA 1BZWA 2FHRA 2X53S 3LA7A 3ELNA 2CL2A 3KMHA 4COUA 1VR3A 5CFCC 3QH7A 5BNPC 4BOWA 1H4HA 1ZBA1 2VNOA 1GNHA 4W6XA 2BGCA 1DGRN 4OZXA 1H2MA 1GANA 3SH5A 3NL1A 2A73B 3M1HA 1S0BA 2D97A 4YM0A 4QT6A 1GKBA 5FLIA 2VMHA 3BIWE 3MW3A 4MGZE 1GV9A 3W58A 5FTTC 2ZOEB 4AQTA 3VZLA 1LHWA 1VP6A 5C9AB 4LUKA 1WCKA 3WCRA 4MZUA 1BQPA 4Y1YA 1ZM1A 1KDMA 2HWB2 4PLNA 1GNZA 1RVF1 3OPZA 3THTA 4L99A 4N53C 4JRAA 5BNNC 5BNOC 2QE3A 4XBLA 2IXCA 3RMYA 2WA4A 2OA2A 2Y0IA 1PZ7A 1EYBA 4DPNA 3M70A 2VMIA 5F9TA 1VAVA 2DCJA 4FTEA 5E89A 3DGTA 5FBZA 1LESA 4XJAA 3WHTA 4AFBA 1TEIA 1RUF1 3VKOA 3HMYA 3RJRA 4IERA 4CRQA 2WLPA 4META 4DS0A 1VBA2 4YNIA 4Y22A 4HFSA 1VRH3 4CEWA 4E27A 5CG8A 1X8EA 4YFWA 1UU6A 4V1PA 1ENQA 2JENA 5JZGA 1XU2A 4HVQA 3KT7A 3VDDC 1CAXB 4IESA 4Y20B 3ILNA 1FT9A 3NAPB 1U5YA 3ZN4A 3THPA 5DG1A 1LOFA 5T5JA 1IS4A 5T5OA 4Y26A 1W6QB 3V0AA 3TNPB 3VBHB 2VW2A 4P9JA 3JQWA 3WUDA 1QU0A 1NYWA 5H9SA 3RMXA 1PNGA 1GR3A 4IEVA 3AYAA 1F2NA 2ZTNA 2D6NA 1OOPB 1D4M3 2XBO2 1VBA1 1IPJA 4D94A 1LJ7A 3ILFA 3Q9OA 1BMV1 2VUAA 3LB9A 3AFGA 2R6QA 1NLSA 4AW7A 4L2NA 4FP3A 1ZZ9A 1IOAA 3APBA 4M3CB 1LHVA 1R1A3 4AHYA 2IFRA 1FNZA 4P9LA 3GZUC 1N47A 1N1VA 2C5DA 4S2FA 4EN9B 5DUXA 1MEC2 1EPWA 3WP5A 1PO12 4JGYC 2K9ZA 1RITA 4WZFA 1OFNA 2G9FA 2H0BA 2R16A 4EN8B 2BEOA 4RFT0 4LBMA 3SH4A 3MI8A 5BV6A 4OLLA 4FVVA 1NY71 2NN8A 3CEWA 1IS6A 1KDKA 4OFGA 3WG1A 1EV12 4W65A 3AYEA 5JAXA 1XYPA 2P3IA 1H1MA 3WQ7A 3FUOA 1LHUA 2WT1A 3FX3A 3M3IA 1I1EA 1AR82 3WW4A 4LUMA 1J3PA 5FRAA 2ZGNA 1LOEA 5JIAA 2WSUA 4B8EA 3X29B 2CYFA 1GQHA 1RL3A 3ES1A 2Q1ZB 5SV5A 2AZ5A 4Z1VA 1H8VA 2MNGA 1EV13 3FJSA 1FATA 3ZIXA 3G6JB 4BMBA 1VBE3 1S0EA 2JE7A 4P9IA 1ND2B 1RUG2 1RMU3 2RS32 4AGGA 1O91A 5ACA2 2ILMA 4FXKB 4N53A 4AFAA 2A3WA 2RR13 1ZBE2 5BNOA 1U0AA 3B3QE 1LODA 2AREA 2PHRA 4PIZA 4UW5A 3CNAA 4YW4A 3SCGA 1QXJA 1ZRDA 1DQ4A 3JCIA 3AXDA 4YW2A 3J26N 3FLTA 4CDXB 1MS3A 1CJDA 4C0HA 4PBOA 2V09A 4DRRA 1RUG3 4N7UA 4GKYA 3H8UA 1NCRC 1AXYA 5L73A 3RS6A 3WCSA 2B8MA 4CDWC 3WQ0A 4HN1A 3D6EA 1AF9A 3I54A 3VKNA 3N3HA 1ZREA 5KWRA 1V6MA 1UAIA 3U0ZA 3S6PA 2ZHKA 4AVCA 2C9AA 1W6OB 3O0XA 1FAYA 3OYWB 4YGEA 1POV3 2ZZJA 4WVZA 1CGPA 2YPJA 1ZBE1 2OYZA 5HCAA 1MS9A 4HSJA 2DWRA 5LRRA 3ZXKA 4XXPA 1VBB2 2HWF2 3VLBB 4WM7A 2D7FA 3VBFC 1RUE2 4B3NA 1MVQA 1COV2 1PNFA 5JIUA 2ZGPA 3ZYRA 3TN92 1YIFA 3N7JA 5GZFA 3RQ0A 2JX9A 3RI8A 4IV3C 4HL0A 4P9XA 1ZNPA 2IXHA 4XQDA 5IK5A 4DY3A 1ZX5A 1FNYA 2GH2A 4DINB 1VBB3 4QPGA