1TMF1

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
276
structure length
276
Chain Sequence
GVDNAEKGKVSNDDASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNMETTFNYQENDYRLNCLLLTPLPSFCPDSSSGPQKTKAPVQWRWVRSGGVNGANFPLMTKQDYAFLCFSPFTFYKCDLEVTVSALGTDTVASVLRWAPTGAPADVTDQLIGYTPSLGETRNPHMWLVGAGNSQVSFVVPYNSPLSVLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTSASVRIRYKKMKVFCPRPTLFFPWPTPTTTKINADNPVPILELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
source organism Theiler's encephalomyelitis virus
total genus 17
structure length 276
sequence length 276
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf100
1ND2A 1PVC2 4CEWB 1K5MA 3TN92 3J8F3 1PO23 1TME3 1RUJ3 3ZFEA 1RUG2 3NAPA 2R072 1COV3 5L7OC 2MEV2 5C9AA 2WS93 4SBVA 5A33B 3ZFGB 4CEYB 5CFDA 1RUC2 2RS32 2HWD2 2RS51 3LOBA 2RR11 1VBB2 3VDDB 5A32A 1EAH2 2XBO3 1IHMA 1NOVA 2QQPA 1SMVA 3JD73 4IV1A 2FZ1A 2RMU1 3DPRB 1VBE2 4JGYC 1MEC1 1HRV1 1AYN2 1RVF2 2WLPA 3VBUB 1NG0A 4EJRA 2WFF2 4GMP0 1RB8G 5AC92 3CJIA 3VBFC 1AYM1 1AR82 4FTEA 5CFCA 1RMU1 5ABJB 1EV12 1B35C 5DDJ3 1AR72 4N43A 1CJDA 1PO13 1BBT3 1R1A3 4QPGC 1F2NA 4PDWC 4GMP1 4WM7A 3JBG3 3VBHA 1RUI1 1MQTA 1AL0G 1W39A 1E57A 3J8F2 1TME2 1RUJ2 4CEWC 1OHFA 2RS11 1C8NA 1TMF1 4IV3A 5BNOA 1COV2 4GH4A 2X5IA 1VBA1 2HWF3 2WS92 4BCUA 5BNPB 4RS5A 3JB4C 3VBOA 1QQP1 1QJY3 2ZAHA 3ZFGC 1HRI1 4CEYC 1NA1B 3ZFFA 5ACA1 5C4WB 2R041 1OOPA 1VBC3 2PLV1 3VDDC 1BEV1 3JD72 1VAKA 1VRH3 4QPIA 1NY72 2GH8A 4N53B 3DPRC 5K0UA 4CDXB 1ZBA1 2BBVA 1FOD3 4GB33 1H8TA 3VBUC 4YVWA 1RUD1 4JGZA 1ZBE3 1PIV3 1VBD3 1HXS3 4YVSB 1Z7S3 1DDLA 1NCQA 5C8CA 4WM8A 1BEV3 1C8M3 1AR91 5DDJ2 1RUF1 4RHV3 5ABJC 5JZGB 1PO12 1BBT2 1R1A2 2DF7A 2HWE1 5D8AB 3S6PA 1D4M1 3JBG2 1ASJ1 1AR61 5LK7B 4Q4Y3 1OPOA 1PGL1 4FSJA 4CDQB 1RUE3 4RQPB 3VBSA 2HWF2 4AEDB 1QJU3 4RR3A 4CDUB 4Q4W1 1RUH1 1ND3A 2HWC1 2WZR1 1QJY2 5BNPC 1V9U3 1QJX1 1NA1C 5C4WC 1VBC2 4Q4V1 4Y5Z0 4CDWB 2BPA2 1VRH2 2R061 1NCRB 4N53C 1FOD2 4GB32 5L7OA 4CDXC 1ZBE2 1PIV2 1FPN1 1VBD2 1HXS2 1R091 4Q4X1 1QJX3 1Z7S2 5J96B 2HWB1 3M8LA 1FMD1 1AL21 4YVSC 4FTBA 2RS53 2RR13 2RM21 3VBRB 3IDEA 5BNNB 1C8M2 1RHI1 4RHV2 1R081 1HQNA 4Y4YA 2RMU3 5JZGC 4JGYA 5D8AC 1ND2B 4Q4Y2 1MEC3 1HRV3 1PVC1 1BMV2 1K5MB 3TN91 4NWVA 3ZFEB 3NAPB 1PO22 1CD3G 1RUG1 2ZTNA 2R071 1RUE2 3VBFA 4CDQC 5C9AB 1PGW2 2MEV1 1AYM3 4RQPC 1QJU2 1F8VA 4AEDC 1RMU3 1RHI3 4CDUC 2GSYA 5CFDB 1V9U2 1B35A 1RUC1 2RS31 2HWD1 4QPGA 5A32B 4PDWA 1VBB1 2WWSA 1EAH1 4GMP3 2XBO2 2Y26A 1RUI3 4IV1B 4Z92B 4CDWC 4CEWA 1VBE1 1GFF2 2RS13 1TMF3 1NCRC 1AYN1 1RVF1 2WFF1 1VBA3 5A33A 5AC91 1QQP3 3CJIB 3ZFGA 4CEYA 1HRI3 1AR81 5CFCB 2RS52 2RR12 5ACA3 1POV1 3VDDA 2R043 2PLV3 4N43B 1EV11 3VBRC 5BNNC 1AR71 4WM7B 2RMU2 3VBHB 3HAGA 3DPRA 2XPJA 1MEC2 1HRV2 4NWWA 1MQTB 1ND2C 1ZBA3 3VBUA 3J8F1 1PO21 1RUD3 1RUJ1 1QJZA 1K5MC 1TME1 2IZWA 4IV3B 5BNOB 4GH4B 2X5IB 3ZFEC 1COV1 3NAPC 5GKAC 1AYM2 2WS91 5C9AC 4RS5B 3VBOB 1M06G 1RMU2 3ZFFB 1AR93 1RUF3 5ABJA 5CFDC 2HWE3 1A6CA 1OOPB 2XBO1 1X36A 1D4M3 1AR63 1ASJ3 1RUI2 3JD71 1VB2A 4QPIB 1WCDJ 4IV1C 1NY71 5K0UB 1AUYA 2RS12 1TMF2 1H8TB 4YVWB 1VBA2 4JGZB 4Q4W3 1RUH3 1QQP2 5BNPA 2HWC3 2WZR3 1HRI2 1NCQB 5C8CB 3CJIC 4WM8B 5ACA2 1NA1A 5CFCC 5C4WA 2R042 4Q4V3 2PLV2 1BEV2 5DDJ1 2VQ0A 1PO11 1BBT1 1R1A1 4N43C 2R063 3JBG1 4WM7C 3VBHC 4N53A 1ZBA2 4CDXA 1MQTC 1RUD2 5FMOL 1FPN3 4IV3C 5BNOC 3VBSB 4LLFA 1R093 3JB8A 4GH4C 2X5IC 1HX6A 4Q4X3 2HWF1 2HWB3 4YVSA 4RR3B 1FMD3 1AL23 1ND3B 4RS5C 3VBOC 2RM23 1QJY1 1AR92 1RUF2 4FTSA 5FMOS 3ZFFC 2HWE2 5JZGA 1R083 5D8AA 1D4M2 1VBC1 1ASJ2 1AR62 1OOPC 2TBVA 1PVC3 3FBMA 1PGL2 1VRH1 4QPIC 3TN93 1POV0 5K0UC 1RUG3 5L7OB 2R073 4CDQA 1FOD1 2BUKA 4GB31 2ZZQA 4RQPA 2MEV3 1ZBE1 1H8TC 1PIV1 4AEDA 4YVWC 4JGZC 1VBD1 4Q4W2 1RUH2 1HXS1 4CDUA 2HWC2 2WZR2 1Z7S1 1QJX2 1RUC3 2RS33 2HWD3 1NCQC 5C8CC 1VBB3 4WM8C 1EAH3 4Q4V2 1C8M1 2BFUL 4RHV1 4CDWA 2R062 4JGYB 5FOJB 1VBE3 1NCRA 4Q4Y1 1AYN3 1RVF3 1BMV1 2WFF3 2BFUS 1FPN2 5J98B 3VBFB 1X33A 1R092 1RUE1 4Q4X2 5AC93 2HWB2 1PGW1 3VBSC 4RFT0 1FMD2 1AL22 1AR83 1QJU1 4RR3C 1POV3 2RM22 2FZ2A 1B35B 1ND3C 1RHI2 1V9U1 3VBRA 5BNNA 4QPGB 1EV13 4PDWB 1AR73 3ZXAC 1R082 1VB4A
chains in the Genus database with same CATH superfamily
4GWJA 1SDDB 4KI5M 5FBJA 4IE7A 1UW8A 2TNFA 3DECA 5CKQA 4B7EA 1K5MA 4XTPA 2EXIA 2NLRA 2VULA 3POGA 1UIJA 1UKRA 4A7ZA 4BLIA 1UOFA 4DUWA 3ZVXA 3AL5A 4HZFA 1KEXA 3PU3A 4H14A 4HG6B 5HXVA 4AF9A 4CCCA 2AEZA 5FMDA 2VAUA 5C7GA 5C9AA 3WP5A 4TZDA 2OXBA 2C6SA 3SXWA 3AX4A 1APNA 3VUOA 2H0VA 2YFUA 3AP5A 3EBRA 4IE6A 3ZFGB 4CCJA 5C3RA 5LEKA 1IS5A 2GNBA 3I3EA 3E6BA 3BODA 2RS51 1KDKA 3SITA 3DGTA 2RR11 4BPZA 2BVVA 5A1FA 5A32A 2XBO3 1PZ7A 2H6CA 1KQRA 3ACHA 4FCAA 4QMAA 5GM0A 1NOVA 3UV9A 2VMEA 2YZ4A 1S0GA 5CBLA 1WA4A 4QT6A 3WY6A 3FUQA 4P08A 1E5RA 5DUWA 4JGYC 2ZHNA 1MEC1 1HRV1 3QH7A 4B3NA 3TEZA 4NPLA 4OCTA 4YW4A 4OI1A 2XLGA 1N1VA 3ZYBA 2D43A 4CP2A 1NG0A 3OBZA 4MXWB 4YZ5A 4FOWA 1VE0A 2YYOA 2JKBA 3C3VA 3K77A 4D3WA 1ODNA 3OJBA 4K6BA 4UFKA 1LTEA 2VOKA 4J25A 1A78A 2JD4A 1W0NA 1AR82 2BVBA 2OT7A 3GZEA 2OIIA 3LFMA 4DXZA 5CFCA 4M00A 4XZPA 2E7TA 2VNGA 2R30A 2VR4A 1O59A 1O6UA 2OZ6A 4J6GA 5J3UA 1J3RA 3GHMA 4N90A 4N43A 1HB2A 1BBT3 1PO13 1Q3EA 1R1A3 1F2NA 2RDSA 4OULA 4PDWC 1I5ZA 5FYIA 1SLLA 1MZ6A 4XFFA 3AM2A 1ZZBA 1JYIA 1RJ7A 1RUI1 1UY4A 4OUMA 5EYYA 1HQLA 3FLTA 1HKDA 3NNMA 3FZ3A 3S30A 5DABA 3J8F2 4EWEA 4CEWC 1DQ2A 2RS11 4KH9A 1C8NA 4IV3A 5BNOA 5B4XA 3WW1A 1W28A 1UOGA 4XHBA 3D5OA 2CWSA 2B5HA 2RHPA 4Q5OA 4FPLA 4LEJA 1JYCA 4IEXA 3THCA 4DEQA 2QNKA 2Y6GA 5A1AA 1UWWA 2W1QA 3E97A 4RA0A 4PT6A 4CEYC 3VDBA 4GZ9A 1S1AA 3AP7A 1WW5A 4CCMA 2YC2A 1UY3A 4A6OA 1OA2A 1SBFA 4LITA 2R041 3O1RA 1OOPA 4NUBA 2VCBA 3P3PA 3VDDC 2OUJA 4BH9A 1MZFA 2ZCWA 1CIWA 4H2AA 4ZZ5A 1VAKA 4LKEA 2JDNA 1U5IA 3CLPA 4MO3M 5IJRA 4ATFA 4E2SA 2RDQA 4OFGA 2Z42A 2FCVA 1GANA 3NKTA 1XQNA 2VC9A 4EE2A 3RRDA 1UZ0A 3OUIA 1ONAA 3NVCA 4FFFA 3PVNA 5C70A 3MZHA 1QGLA 4ZPIA 3EO6A 1UU4A 1VBD3 1JH5A 4I0WB 1NE4A 3RJRA 3D8CA 4QX2A 4YVSB 2Q1MA 1DDLA 2PA7A 2VL4A 2R6QA 3MW3A 5C8CA 5FZ7A 4JKLA 5G04L 5LW9A 4IEOA 4M0HA 2W91A 3BOPA 3NRUA 3DL3A 2E9QA 1AR91 3PHMA 5DDJ2 4AEJA 1LEDA 5CISA 4RHV3 2X53S 1OLRA 4IEYA 3WF3A 3ZOIA 5ABJC 4MG2A 2HWE1 3RMXA 1W6QB 2NN8A 4Q0SA 2W9XA 3R4UA 5FTTC 4CSWA 1LHVA 1AR61 4GD4A 3MF9A 3B9IA 1CZTA 4P9JA 1IS4A 3HOBA 4P02B 3APBA 4WVWA 1C3HA 5A3NA 4YGCA 2A71A 1W6PA 3A7QA 3O5SA 2P5BA 5EV7A 3WXPA 3OUJA 3UNPA 3C7EA 2Q0AA 3L2HA 2DVDA 1OUXA 3GCXA 4NR1A 5DAWA 1GSLA 2HWF2 3ZYFA 2V72A 2XVLA 4RR3A 4WVMB 4CDUB 3KT4A 4MADA 1F35A 1D4VB 2HWC1 3CIHA 4QX7A 4Y33A 1PX4A 2E7QA 4FP2A 4OZOA 2QZ2A 2R0HA 2VECA 1ZRIA 4UYBA 5IVFA 1F4HA 5IVJA 4LO4B 3PURA 3OOXA 1VBC2 2QUOA 3WNMA 3MW4A 5C4WC 1G8WA 1V6JA 1YWKA 5F1RA 4NRMA 5FAXA 1V6LA 3U0ZA 1VRH2 1ZNPA 1YQ5A 3RGBA 1MS9A 5FO9B 3QD6A 4BMBA 1QXPA 2VUDA 5FFOC 1UQXA 1XXNA 5KHHA 1FOD2 4GB32 4I01A 5K9YA 3ZYIB 1PIV2 1X7NA 2WRAA 3GBFA 3ASIA 4R4ZA 3V0BB 1FPN1 3KV4A 3JXSA 1U5YA 3VD3A 2ZAAA 2V5DA 2C1FA 1RUOA 3ZXJA 5FZBA 2GDFA 1OA4A 1Q8QA 4CPBD 2RS53 2CV6A 2RR13 4ZHNA 4CCDA 3GXUA 3ZYRA 2VZRA 1NX9A 2RM21 4X8PA 3WNPA 5BNNB 5CG8A 1RHI1 4XOGA 3OBTA 4AVBA 3SCFA 2ZGTA 3BGAA 1W2TA 2A3WA 4CPBA 1DQ1A 1R081 5JZGC 1JBCA 1SBEA 2G19A 5D8AC 1YEWA 1DF0A 4YW1A 1MEC3 1HRV3 2AEYA 2Y6KA 3J7HA 4K1YA 4XBQA 5IVYA 5C33A 3KV6A 4LBJA 2D5HA 1RJ8A 2EIGA 1BMV2 4M3CF 1AX2A 3Q8CA 5A3LA 3NAPB 2N7GA 2XKPA 1PO22 4D8MA 3T2QA 2ZTNA 2J1TA 3ABZA 2R071 1RUE2 3IMMA 3NNGA 3NV1A 1A8DA 4NHYA 4QB2A 5EP9A 1UPIA 4AHXA 5BUVA 4UW6A 3ACLA 2QCSB 2HYKA 1QJU2 2WT1A 4N7IA 3ITQA 4XF0A 3S7EA 2SLIA 4CYDA 5FV3A 1F8VA 4YGEA 5SV5A 1SCRA 3ZPOA 4P9XA 4OI2A 3FWEA 1B35A 3LA7A 2G1MA 1IS6A 5A6QA 3BYWA 4NIGA 3BB6A 1UIKA 5A7QA 1NAEA 3RI9A 3GGLA 1JS9A 2GMPA 3PTYA 3OBRA 1V6OA 1VAVA 2LROA 2YFZA 4JX0A 5F6KA 1RUI3 4IV1B 5A3MA 5FY5A 3IB3A 1FXZA 4LUKA 1S2BA 1HIXA 2QTWB 3WNNA 5KWRA 2K0GA 1VBE1 1G9BA 2UYAA 1YQ6A 2DTWA 1W2NA 1QDCA 2RS13 3ZMNA 5SV8A 1RVF1 3H1WA 4Y22B 3HNYM 4J1XA 4W6YA 2OQ7A 4GWNA 1F4AA 4DRRA 2DV9A 3AXEA 2PYTA 3PTRB 5DUVA 3RG0A 2WNVC 4A41A 1SBDA 3B02A 5AC91 3HMYA 3IAQA 3KWVA 3PIJA 3LE0A 4Q0QA 3ZFGA 1W9WA 2ZGMA 4D6RA 2VQUA 4MGSA 3VHOA 4XCAA 3POBA 2WYSA 3WR0A 2R043 1QOOA 2Z79A 2DUOA 4AOCA 4Z1VA 4BQ4A 3IM0A 2KA3A 4YG3A 3VBRC 1AR71 5ANQA 3MLKA 3WOGA 4HN0A 5CB7A 1JOPA 1WCUA 3J26N 5FY8A 2P3KA 2DVGA 2C26A 3HAGA 1HB3A 2OYZA 3POJA 1SLAA 1ND2C 4L99A 2VBDA 4FOQA 5JLVA 1GOFA 4QQ2A 2HEWF 3MLJA 4YRDA 3NSTA 3NNJA 4MXWA 4D69A 5IFTA 5KR7A 4LT5A 1TME1 1RUJ1 4LO8A 1DYPA 1OQEA 3IWZA 4GH4B 1OSGA 3ZFEC 1UPSA 1Y43B 4XF1A 5DZGA 5KXBA 2Y6FA 2G9GA 1FATA 4O61A 2YV8A 3WNXA 2QKDA 1UZVA 1JW6A 2D6OX 3W5NA 1S55A 5IAVA 4O9EA 3ZFFB 3ZO0B 3H1YA 1AR93 1QH6A 1YXWA 2E53A 4LQRA 4C1XA 5CFDC 4MGKE 3I2JA 4U36A 2HWE3 4JCKA 3JCIA 1W2OA 3KB5A 3WG2A 4QKNA 1Q8VA 5LRSA 1AR63 4LBMA 3GYDA 3JD71 4W8JA 3B00A 2VQTA 1GKBA 1WW4A 4MXVA 5FMBA 1DGWA 1MVQA 1N47A 1WMXA 1W6OB 1FYUA 2HLEA 4QPIB 1GWLA 5LA0A 4HKLA 4EQVA 1YUDA 1NY71 3OPWA 4YW5A 3RS6A 4I2OA 1AUYA 4UFIA 3OYWB 3M70A 3WP3A 1H8TB 1CIYA 2ZKNA 2WT0A 2I45A 1LU2A 1Q43A 1PM7A 1VJ2A 2ARBA 4U2AA 3WF2A 1OA3A 4QQOA 2W52A 3OSDA 4V2VA 3HIFA 4BQYA 2WQ4A 1P8JA 2D3PA 5AVPA 1QQP2 3CJXA 2HWC3 3POSA 1VMJA 2EVXA 1W9SA 1ENXA 1RYYA 3CJIC 4WM8B 1JTZX 3POWA 4HKWA 4OHXA 3E6CC 1GV9A 5JOXA 1UY1A 1J83A 1AJOA 2ZBJA 1LOFA 4FO9A 2YPJA 1M4WA 3BN6A 4AI1A 3U07A 3VHNA 2QQKA 3IAPA 2XONA 3EJKA 4I0BA 3CO2A 3PLQA 3R6SA 1GUIA 1GWKA 4KU8A 3LF7A 3N9MA 3MO4A 3JBG1 5L9RA 2BGPA 1V00A 4FPFA 2W87A 1XU1A 3WNKA 3PUIA 2Z2SB 3ZXGA 2YU1A 1QXRA 4HSLA 1CPMA 5C8WA 1W8OA 1D2QA 5FMCA 4OUSA 1QY4A 5F39A 5J09A 4PIXA 5EJ3A 5A3PA 1FPN3 3KQ4B 4BQXA 3J7MA 1ZZ9A 4LLFA 4AI9A 4I0AA 4UXAA 3WQ7A 2X5IC 4DOUA 3WX5A 4YVSA 4BK4A 4CCEA 4QGLA 1J3PA 1LULA 1MACA 1GICA 1MS4A 2YC4A 5LA9A 4BXSV 5K7PA 3VBOC 2RM23 4XF4A 1QJY1 1R1ZA 2FHRA 5FZ6A 5KHKA 3AKRA 3H3UA 1RUF2 3S5AA 1VALA 1XNCA 4O65A 1J1LA 5HI0A 2DCJA 2VZUA 2QJVA 5A6XA 3H8RA 1R083 1W6QA 5J7MA 5DXDA 1ASJ2 1IS3A 3WF1A 4CCOA 4A6SA 2BRTA 3POYA 1O7FA 3I2HA 4OHYA 2DCKA 2X8KA 1JODA 2XOMA 5H9SA 4YARA 2ET7A 5K0UC 2WNUC 2Y0OA 2YGMA 3N9PA 2R073 5DAPA 1PK6B 1JZ8A 5JXJA 4XMAA 1KXGA 3K3OA 3QACA 3WT3A 4JGZC 4KWUA 2BNNA 4E8CA 4JKMA 3RZLA 4WVMA 3M3QA 3M3CA 2H0BA 4P5HA 2XWBB 3VLBB 4CDUA 2VMCA 2WZR2 5GZCA 5JOWA 1Z7S1 3J7NA 3T4HB 1UKGA 4TYSA 1BVVA 2A75A 1LHOA 3I3QA 2RV9A 4UF0B 4OQ9A 3UT0A 4BJ0A 4IDZA 3S0MA 1CAWB 3VB9A 4UFLA 1VLNA 4FPOB 3VL9A 3B69A 3O1SA 1Y3TA 3AJZA 1JXNA 4C91A 5FOJB 1LOGA 1GWMA 1VBE3 2GN3A 1O4ZA 2LRPA 3HBKA 5FY1A 4Q4Y1 1W06A 1L3JA 4PJYA 1RVF3 4XW3A 4XUOA 2CU5A 3TBDA 1J84A 2P3IA 4AWDA 1WLDA 2FDJA 2OA2A 4E9KA 4JDNA 3ACGA 3V0BA 4EZHA 4FPCA 5J98B 1VPHA 4ASKA 4Z2AA 3SEPA 5AC93 2J7MA 3I2IA 4CCKA 1REFA 4I02A 1FMD2 2QQWA 3G7DA 2R16A 3A22A 2CYFA 1UYZA 2PAKA 5A6YA 4DZGA 1ND3C 5FP9A 5BNNA 2R32A 4XHXA 1AR73 1GZ9A 2NM1A 3WSOA 1D0GA 4DS0A 3ZXAC 1STMA 4A42A 4M4RA 1JZ4A 4HOOA 5DUXA 4LO5B 2DTYA 5JWPA 3UGFA 2F4PA 3NO8A 4NAOA 4NHLA 3OY8B 2WO3A 1W3VA 4GKYA 3VZMA 4M01A 3TN92 1LEMA 2WAOA 3K75B 1TME3 1RUJ3 4IL7A 4UFMA 4XDQA 4JC1A 4JKKA 1DYKA 5HXMA 1RUG2 3CBNA 3NAPA 1CGPA 3J7LA 3RDIA 3EXUA 2WINB 4R9CA 3WG4A 3ZSLA 3FE5A 4B8EA 4Z2WA 5L7OC 2DFCA 1OLQA 2GC1A 4SBVA 4AGRA 3I59B 3MUY1 3OD0A 1HB4A 5AFEA 2CHHA 2AREA 2QQOA 3LPGA 4HVOA 3U10A 5C3PA 3TEWA 1RUC2 4K20A 2DCYA 2RS32 2HWD2 2W1SA 3ZYPA 4E27A 3LOBA 3O0XA 1I1EA 1EAH2 4ISQA 3ME2A 4ONUA 3U1XA 2A6WA 3VHPA 3NL1A 1SMVA 3BIWE 2WA4A 3JD73 1NQDA 3KV9A 1A3KA 4WBBA 3ALQA 3SC7X 2VZ1A 2VZTA 3F2ZA 1GNHA 3IZOA 3F95A 4IV1A 4NAMA 3UGHA 5I91A 1UZYA 1LENA 2P1BA 1OQ1A 4QM9A 4ASMB 3SH3A 1JYVA 1DGWX 4RL7A 3T1MA 2ZACA 3W9AA 3DKWA 1URXA 4Y22A 4V2WA 4INDA 4EJRA 2WFF2 4P9IA 3CU7A 2VE1A 4EN9B 4QPWA 1X8EA 2GU9A 3LCPA 1NQJA 4IE0A 3W59A 4F83A 1QHDA 3VBFC 1AYM1 4NMIA 2YHJA 4FTEA 2W47A 4LBNA 1DQ0A 3VDCA 1PNGA 3RWNA 2VOVA 4AE2A 4XFAA 3HEIA 2IXHA 4QPGC 5D21A 3OGJA 2VZSA 1CESA 1SFNA 5FYVA 2QQPA 3AKQA 1O4TA 3JBG3 4Y1UA 1RTVA 3I7DA 3K4ZA 1H1IA 4B4PA 5JIUA 2VZQA 5GZEA 1Y9MA 5LATA 4PBOA 2V4AA 2W39A 2WA3A 1W39A 5T5OA 3RZGA 3AJYA 1JZ7A 1OHFA 3GJBA 4Y5SA 4S2DA 5FR3A 4F8AA 4GH4A 1CAVB 2BBAA 4PLNA 2NMNA 1H4GA 1GZCA 1MS8A 1VBA1 1OLME 1RL3A 2B7YA 3HWJA 4XAAA 1AX0A 3VZKA 5DG2A 3SISA 4BCUA 5BNPB 3URFA 4IESA 5TSWA 1QJY3 2ZAHA 5FY7A 1HRI1 1SPPB 5F2SA 1NA1B 1RXGA 3ZFFA 4FP3A 4Q26A 3D82A 5ACA1 5FYCA 2D7FA 3H3LA 4PLOA 2YXSA 5JMOA 5KBFA 3U14A 1ULPA 2DVFA 3KGLA 3I97A 2DUPA 4CP0A 1WLWA 3VZNA 1C5IA 1UXZA 2JIGA 2OX0A 5FJHA 1AVBA 4MVTA 5J36A 4QPIA 1W6OA 3WUCA 3DPRC 1OD3A 1UMIA 3V0AA 2D6PA 1LU1A 4NO4A 5ERLA 3SH5A 2JJ6A 3OYWA 4Q27A 3VD5A 1H8TA 3VBUC 3HVDA 1W2AX 3UKTA 3CL1A 4IEVA 4PF5A 3K48A 3NJVA 2NQYA 1Z7S3 2O1QA 2W3JA 1W8TA 4IEQA 4WM8A 1CZSA 2PHLA 3LEMA 2B45X 3ETPA 1DYOA 4FPHA 1BEV3 1YFUA 1OURA 3FHAA 2ZKLA 5IUQA 2XJTA 5FXXA 2Q30A 1S0EA 1PO12 1BBT2 1R1A2 3B93A 1ULCA 1W9TA 2EF6A 4AI0A 5GZDA 5GLTA 1H1MA 1QNWA 5FQ0B 3VZJA 4Q4Y3 2Y6JA 5FPLA 4E2QA 1OPOA 4BIFA 4URAA 5GLVA 2QE3A 4AQSA 2BGCA 2JDPA 5C3SA 4QXCA 4BQ2A 3ZYGA 3SKVA 1FV3A 3D0JA 3WHUA 4CDQB 4RQPB 2WO1A 1OQDA 1S4CA 3HNMA 3THPA 3MFCA 3QLQA 2ZX3A 1LNSA 2UU8A 4P9WA 1RUH1 3H0OA 2XJRA 4CXXA 5CAZA 4OUEA 1DCSA 5F5AA 3O1UA 2ORZA 5I0UA 3RPQA 5LEJA 4MGQA 4Y5TA 1E5IA 5JSRA 4BE3A 5EFUA 2TEPA 4COYA 5FZKA 4AAXA 4EWAA 3SCHA 5FK7A 3V65A 2YY1A 2XGXA 2VZPA 4QM8A 1DQ4A 1F5JA 3SMHA 3OBAA 2R061 1UAIA 4QHOA 1NCRB 4FPGA 1C28A 2Y34A 2VTXJ 4OYUA 2IFRA 3MIBA 1PMIA 3V64A 4CA9A 2FDIA 3NQHA 4N53C 5JXGA 4AGVA 1J59A 1GQPA 2V73A 2BNMA 2I2SA 4CDXC 2X10A 4LOSA 5EIYB 1PK6A 3HBZA 4D0QA 4EN7B 2JDHA 3R0RA 2CGPA 1TEIA 1VBD2 1WBFA 1XSRA 3FLPA 3LEIA 2VNOA 3DUIA 4IEUA 4OHZA 1FI2A 1LGNA 2ZJCA 3THTA 4Q4X1 1QJX3 1XPWA 1FNZA 2HWB1 3A21A 3M8LA 5FLHA 5J96B 1LKNA 3A0KA 1AL21 1CX4A 3ECQA 4KBBA 3J9SA 1NLQA 2JG8B 3HPNA 4Q1PA 3UKNA 1Z78A 4AFBA 2HH9A 5T54A 4UF0A 3N7MA 4GJYA 5CYYA 5FZ8A 1RITA 1CAWA 2WJSA 4AVAA 5JI9A 3C8XA 2Z4FA 2BERA 2ZGSA 4RHV2 3UKVA 4AI3A 1W9YA 4ZU4A 1K45A 3JU9A 4YZ1A 2ZX0A 3D4KA 3HQRA 4QGMA 3TB0A 2BYVE 1JZ5A 1ULEA 3E5QA 4FPKA 5IHRA 2XDVA 1PVC1 1W99A 2ZGPA 1WBLA 5IK8A 1GYKA 1XE0A 2JG9B 2MHFA 1NKGA 1VR3A 1UX7A 3GHNA 1B09A 4FT8A 2ZHLA 1XYOA 2VCCA 3B5LB 4QKBA 1W6NB 4QU2A 3USUB 3DYPA 3S5QA 5C5TA 4DUXA 1VMFA 5FZFA 1PGW2 3SH4A 2MEV1 1SFPA 1AYM3 3ZXEA 3DCQA 4S2GA 4PI0A 2D5FA 4AEDC 3M4FA 1BK1A 5FIXA 4UW5A 2A6YA 4H7LA 4ZU5A 2GSYA 3E6DA 1GZWB 1ZM1A 1CAUB 3D3AA 1VBB1 1RINA 2WWSA 4CTEA 2PHTA 5I0RA 4UBGA 1G9CA 3TOJA 4FPEA 2CGNA 1FT9A 2UYBA 3SKJE 1W0PA 2BNOA 4BMEA 3OY8A 1K42A 1XSQA 4CDWC 3H8XA 1GFF2 3AZVA 2JDKA 1JI6A 1LGCA 2RJKA 4NRQA 4S2HA 4UW4A 4XBNA 3VD7A 3WF4A 2QQLA 1AYN1 1QF3A 2UWCA 2X29A 1XBFA 1VBA3 2VUAA 3ZN6B 2EALA 5DN2A 2OS2A 4E4ZA 1KFXL 4BK5A 3FJSA 4L8QA 4AEKA 4CP1A 5FZ0A 3ZKUA 3I59A 5FKBA 1VRBA 1H1AA 2CWMA 2VNRA 1JYWA 2XWJB 4HT1T 1HRI3 2G9FA 3ACIA 5I0SA 2GNTA 2RS52 4GXLA 2PHWA 1W90A 2RR12 5ACA3 1HDKA 1I3HA 4NRPA 4META 4WVZA 4FBFA 1SQ4A 2WQ8A 4YFWA 1OUSA 1EV11 5F6LB 3M7AA 4WM7B 5HBAA 5KXEA 3OEAA 3I3MA 3ATGA 4EN0A 1W6MB 3VBHB 3RZHA 2IXJA 1L7RA 1MEC2 1HRV2 4NWWA 1MQTB 1EPZA 3QH6A 3NWKA 4BU2A 3NJYA 4IGPA 1PO21 4Y3OA 3VKLA 2IZWA 1K5MC 2IXCA 1Y9GA 3UL2A 2WSVA 3RYRA 3BTZA 1COV1 2CAUA 3JQXA 5GKAC 1QWRA 3ZYHA 3R05A 3MPPG 4Y24A 2WS91 4IE5A 4ZZ8A 4LUMA 5C9AC 4RS5B 4QQPA 4AHWA 3WUDA 2ZX2A 1M06G 4OI0A 1SZBA 1IKPA 1IOAA 3OGSA 5F5QA 2EIBA 4KG8A 3RFRA 3C7OA 1OKQA 4LMFA 5DQ0A 1WUVA 2VMIA 2VMHA 1DIWA 5FZIA 5GLZA 1MS5A 3B9CA 5IWFA 1UCXA 4AK3A 4BOWA 5EJ1B 1DLCA 3LZZA 4BIOA 4HONA 1RUI2 4P9GA 5I8TA 4QDSA 2B9VA 1HJGA 2R1BA 3O1MA 3LSEA 5DUUA 5FZDA 1IPSA 4OHVA 5DAVA 3WINE 5FCCA 4Y1VA 2RDNA 1U0AA 4LXLA 2RS12 4P5YA 5GJ6A 5FPUA 4ZKTB 1VMHA 1WMFA 3CF6E 2BU9A 2D98A 2HEVF 2RDRA 3H8OA 1YNAA 1CAVA 4YVWB 2WZEA 1MZEA 2XLFA 4CE8A 2BV4A 2XB6C 1RUH3 2PAEA 3OB8A 5BNPA 4LKFA 4UWDA 3CZJA 1JZ2A 1VAMA 1NCQB 4UFJA 5LY2A 1XNTA 1KS4A 5FZGA 3N9QA 1SPPA 1UY0A 1HV0A 1NA1A 3HN3A 4AVVA 2WKKA 2PELA 4XVHA 4B1MA 5CFCC 2YDEA 5T55A 4ASLA 2R042 1X50A 3VZOA 1QKQA 2UY8A 1IKQA 3PDQA 4JVAA 4AZZA 4K1ZA 1CVNA 4N43C 3NJZA 2R063 3IDBB 5H9RA 5FO8B 1D2SA 2OKXA 2W94A 2ZOEB 2FDFA 2B9UA 4DQAA 1L7QA 4FQZA 2IXIA 4YWAA 2XHNA 1GOHA 1HW5A 2E6VA 1QOTA 1JMUB 2VO5A 4DNYA 4IV3C 4XUTA 5BNOC 3K46A 2J1VA 3VBSB 3JQWA 1JYXA 4IGOA 2HBUA 4Q4X3 4XF3A 5FLJA 2HWB3 1GMMA 2BQPA 3RQ0A 1BVP1 2GNDA 3FC0A 4N9IA 2D3SA 1AL23 4HN1A 4XDOA 3S57A 1WCKA 5LY1A 2F4LA 1KGYA 1ULGA 3AZXA 4HKOA 3TEYA 2J1SA 5LB6A 1AR92 3ES1A 2I74A 2Q5TA 5F8PA 1OH3A 4NJ4A 5FMOS 4FTSA 1TE1B 2BDRA 2HWE2 3GZUC 4AQ6A 4BQ3A 4CUAA 3U78A 4XF9A 1SG3A 4QDQA 1AR62 2WT2A 1OOPC 3NNLA 3NW4A 3ON7A 5FPZA 1PVC3 4Z8BA 5FQ0A 1EP0A 5FP8A 4YGBA 2DVBA 2QQVA 4LPLA 5LA1A 2ZMLA 1S0CA 1HV1A 4BDVB 1DQ5A 2P4EA 1A8MA 1PHMA 5CU1A 2ERFA 5FBZA 4RGGA 3WLUA 4CDQA 5H9PA 2A6XA 2AYHA 2O0OA 4RQPA 2MEV3 1QMJA 1ZBE1 2BOJA 1JU4A 2EXJA 4LIUA 4W65A 1GR3A 1HXS1 1PM4A 1Y7BA 2MNGA 2HWC2 4KL1A 2FDHA 3VGIA 3PMSA 4EZ4A 2C9KA 1YQCA 5C8CC 2MPFA 1JYTA 1VBB3 3GM8A 1UL9A 4YM3A 3AC0A 1ENRA 4CCLA 3P3NA 1C8M1 2XL7A 4F7ZA 1HLCA 5F9TA 1XE7A 1MPXA 4JGYB 4L97A 1V0AA 3FFQA 4AI2A 4XIOA 4YW3A 2PHFA 1DBNA 4MSVA 2DVAA 3S7IA 1NCRA 2WBKA 4P9LA 3MV01 4IE4A 1AYN3 3BKZA 4M3CE 2AC1A 2C5DA 3OGVA 4LULA 3AYEA 3OTFA 1XNDA 3M3EA 4Y4RA 1UMZA 2BFUS 3VL8A 5C5UA 1CWPA 4FVVA 1FPN2 1US3A 4R4XA 2ZGNA 5FY9A 2VTXA 3AKSA 4QHZA 5FUIA 1X33A 3BTAA 1XJAA 5ISLA 4C0HA 4QD2A 3FLRA 4MYEA 5FZ9A 1OXCA 3FFZA 3KVBA 3V0AB 4RR3C 3DXUA 3MIGA 2JG8A 4Q0VA 2RM22 3I2KA 5FXZA 5LRRA 4XJWA 1O3RA 1RHI2 1V9U1 4D7YA 2IWGB 1MS0A 4ARXA 4EROA 1EV13 4DFSA 4PDWB 3MW2A 1GNYA 4LHNA 1R082 1VB4A 1YIFA 3MUZ1 4XJ8A 4ZS3A 3AP9A 2OQ6A 2OW4A 3IDAA 4O9GA 2Q8EA 3PIGA 2GMMA 3BPZA 4B4RA 5FP4A 4CEWB 4L0PA 2JG9A 3P1IA 2LM3A 4L2NA 3OPZA 4DXRA 1PO23 3BCWA 3LD8A 2QZ3A 3I2OA 4UBHA 1W6NA 2B8MA 3DF0A 2R072 1COV3 3ENRA 3USUA 4COUA 3AMMA 5IK5A 3IBMA 3RVHA 3EQEA 1YQ2A 1KD7A 2WS93 4QAWA 5A33B 3IT8A 1SDWA 4AL9A 2XXZA 4MH0E 4MHRA 4CEYB 2Y64A 2WN3A 1CQ9A 3KQRA 2VH9A 5JCTA 1J3QA 4LORA 2CSGA 1GZWA 2ZGKA 2B46X 5C3QA 1CAUA 3U37A 2JEMA 3LDBA 1N1SA 1YYNA 3LOIA 3T2TA 1GOGA 3JUUA 2Q8CA 3SCGA 4Q29A 3VDDB 5CADA 3MICA 1IHMA 2VVDA 4RSUA 1YFYA 3AYDA 4S2FA 2LS6A 3UJOA 2JB4A 1TG7A 4XAEA 3KGZA 2FZ1A 1C1LA 3R4SA 5A80A 2RMU1 3ZSJA 1VBE2 5GZFA 4H55A 4Y26A 5HV4A 1RVF2 2WLPA 5F3GA 1NE6A 3VV1A 3T0DA 3T2OA 4Q8LA 4GMP0 3ZN6A 2JB8A 3INAA 4LHKA 3ZPYA 3O1OA 3LIGA 2AENA 1XNKA 5AC92 4YG0A 5IW0A 2XJUA 3W58A 3H9AA 4AEMA 1N1YA 2XJSA 4NN0A 4XFGA 2JE9A 2JDAA 2XKOA 3HT1A 2W1WA 4JQTA 1LHNA 1RMU1 1W8UA 4GWIA 1WLTA 4W4ZA 5ABJB 1D7PM 2Z5WA 2W0XA 4R9DA 1B35C 1AR72 2VM9A 3WNLA 2YGLA 1CJDA 2VW1A 2OPWA 2Y6LA 3GZTB 3WNOA 4XFHA 4LBLA 4TSVA 1UYYA 4GMP1 4WM7A 4HXCA 1N3QA 4YFZA 1W6MA 3VBHA 2BW8A 3C7FA 2DURA 4M0NA 3RZZA 1MQTA 3O14A 1AHSA 1WMDA 4LK7A 1PX3A 3BVCA 5C3OA 3ZR6A 1QIQA 1E57A 2ZHMA 4MGTA 5FYUA 1TME2 1RUJ2 4I3GA 4NPMA 2Y60A 1TMF1 4FOVA 1SLTA 2PHUA 1ZZCA 3WDUA 3MYXA 5APAA 5DZFA 4CP9B 2JDZA 4QX1A 4RS5A 3WVJA 5JXHA 4CRQA 2IVIB 4KNCA 2VTFA 5KC5A 2E33A 4ATEA 3BUCA 2IUWA 3ZFGC 5FY0A 1GU3A 3AFGA 1PNFA 1NT0A 5F37A 5DAQA 4JQRA 3MHZA 5FYHA 5C4WB 1YIPA 2GP5A 3ZXLA 4CXWA 2PLV1 1BEV1 5FP3A 3JD72 4JHZA 3ST7A 4DMIA 3LEGA 5A3WA 4KWKA 3AK0A 1Y4WA 4H3WA 1NY72 4G3YC 2PAMA 2VY0A 2FMYA 3WF0A 5T52A 4LA2A 1ZBA1 4LE4A 1K12A 2BEOA 2VW0A 2BBVA 3WDTA 1IQDC 3NV2A 1W2UA 2XQXA 2ZGQA 3IIAA 1RUD1 2PHDA 3PJYA 1ZBE3 4YVWA 5AVAA 5FOBB 4TN7A 1QU0A 3OGGA 4XQWA 1HXS3 3KZ4C 2EICA 5A3TA 1E5SA 2VBBA 4GAZA 3N9OA 1Y9QA 2WZ8A 3LEKA 5FRAA 4ZU7A 2JKXA 2VZ3A 1NCQA 4HVRA 4QHBA 5LBEA 3KT7A 4SLIA 3RSJA 2CGOA 4WZFA 1ZA7A 2GC0A 4XEZA 2VD7A 4Z82A 1IZ3A 1C8M3 4DRVA 3C7HA 3USSA 1Q56A 5L19A 5JIAA 5JZGB 2QDRA 5FPBA 1POQA 3O0WA 5D8AB 3ZXKA 2QQNA 2EIEA 2X09A 3KCCA 5F2WA 3VKNA 1D4M1 5KXDA 1JHNA 3JBG2 1YO8A 2AH2A 2ZEYA 3KD4A 3ZSMA 3H7YA 4E4DX 5LK7B 2PMWB 1ZX5A 4BQWA 1PGL1 3ZN5A 3GBWA 4E8DA 4LIVA 1KDMA 2E32A 4FSJA 2W95A 2YBKA 2WNOA 2JENA 3KM5A 4K9SA 2VCAA 1BXHA 4JRAA 1DZQA 2XH6A 3VBSA 1OT5A 1DP0A 1DZTA 3A0NA 1R64A 2HEYF 5G05L 2K46A 1ENQA 4Q4W1 2UURA 1RUNA 2VMDA 4G4FA 5A7WB 1CONA 1QJY2 2VUJA 2WYFA 1KJLA 2BJSA 2ZX4A 1V9U3 3B7MA 3IKWA 1QJX1 4IERA 3QBQA 4JRLA 4KWLA 2OZJA 4YZ4A 3ZN4A 3WQ1A 1WGPA 1EYBA 2Y38A 1G6NA 4GIQA 4K8FA 4CXYA 3RNSA 3PVEA 4C1WA 4DINB 1S0IA 1LOFC 1VIWB 3J4UH 1WA6X 1I9RA 4Q4V1 5FPAA 4Y5Z0 4I3PA 1QEXA 1H6YA 4HK8A 5JR2A 4A7YA 1LAJA 3PUAA 4B7KA 4LHLA 2PTMA 1S0JA 4FAHA 3GZAA 1H2LA 2CY6A 3NMBA 3W20A 3AMQA 3DKQA 1BLZA 1WD3A 3EYPA 4R52A 5EYXA 3AMHA 2WNVB 1IPKA 2ATFA 4K21A 1IG0A 4YZ3A 1ZRDA 1AJKA 1X9PA 4YLZA 3BTXA 4AHZA 4KQ7A 3ILRA 4RN5A 3AYCA 1R091 4NIIA 3KSCA 1Z7S2 1CPNA 1X82A 5F5IA 4PCRA 1W8HA 4YVSC 2QVSB 2VZOA 3LDRA 4D94A 1V6NA 2UWAA 2WWUA 3LGRA 1W9FA 2R7EB 1CAXB 2CTVA 2FBEA 2JDMA 3IDEA 1W8NA 3VBRB 4AI8A 1LB2A 3PVOA 4LOTA 1QOSA 3ZDSA 3HD8B 2PHRA 3AVRA 4Y4YA 2RMU3 4JGYA 1NXMA 1ND2B 2NPIA 3KVAA 5E8AA 1S2KA 3FHQA 4YSFA 2VG9A 3D6EA 4Q4Y2 4MGIE 3LKJA 2KXLA 2YROA 4IEPA 1W0OA 2AR6A 2FCUA 1C1FA 3KCYA 3ZFEB 1GP4A 2CL2A 1YC61 4HL0A 4ITCA 2FMDA 5IVCA 1CD3G 1LHWA 2XJVA 4LLOA 4KMQA 5JI7A 2YC0A 2EIDA 4XQDA 1OFSA 5EQUA 4LTAA 3B3QE 3TRSB 1YRZA 4XJAA 2Y6HA 1PVXA 3MDPA 2JE7A 3Q8AA 2ZA9A 2VBPA 3PNAA 1RMU3 2D93A 2E51A 2ES3A 4XXPA 5A6ZA 4CDUC 5CFDB 3MGUA 1Q8SA 3BI3A 4ZXKA 1Z0HA 5E6HA 4COWA 4IQPA 3WQ0A 4A3XA 1DU3D 2ID4A 2VPVA 3AP6A 4PDWA 5IK4A 2EAKA 5IVEA 5IFPA 4GMP3 2ADEA 5JVVA 1W8ZA 2XBO2 2Y26A 4KGQA 4PLMA 2WZPP 1ZREA 4DEVA 2FDKA 4IEWA 3HNBM 3FBYA 3T08A 3T0AA 3BPSA 4IW3A 3E5XA 3CEWA 3DYMA 3I54A 4LBQB 4CEWA 1LESA 3Q8FA 5L9BA 2NMOA 3GALA 4CVUA 4XACA 1TMF3 4LR4A 4IGQA 3KT1A 5FZLA 4F3JA 2ARAA 2C0ZA 3K4AA 1TNFA 2VNVA 2I07B 2E31A 3AXDA 5A33A 3LWCA 1LOCA 1ACCA 2ARCA 3OPTA 5LBBA 3WG1A 3CJIB 1W8FA 2ENRA 4CEYA 1DHKB 3I3DA 1JU3A 1AR81 5F3IA 1V6KA 4BQ1A 1BK0A 2W2IA 5JSPA 5D2AA 3IDCB 1LRHA 4QPYA 4XXAA 1POV1 3I4IA 4YNIA 1BYHA 2VXJA 3VDDA 3L9JT 3AL6A 3H7JA 4N7UA 1IG3A 2PLV3 4ES9A 1GP6A 4HK9A 5CIRA 4BB3A 5BNNC 4FAGA 2VCMA 1YJKA 1WZXA 4DXSA 5FWJA 3TYJA 2A6VA 3OCPA 3UETA 5CZKA 1YLLA 4XJZA 2XPJA 3U75A 2GMEA 2GC3A 4BZ4A 2YBSA 1UN1A 4W50A 1Q8OA 4OLLA 1ZBA3 4LK6A 1OMIA 3RI8A 3UESA 3KCXA 1JUIA 3K51A 5EWSA 2DCTA 3J8F1 3ZLIA 2R49A 1RUD3 4B29A 1OKOA 1QJZA 1BJQA 2J1UA 2PN5A 4G9SB 5C6CA 1H30A 3WDWA 2X5IB 3NAPC 4ORFA 3OG2A 3UGGA 3K2OA 1GP5A 1AYM2 1S2EA 1V6MA 3VBOB 2ILMA 4XILA 1BZWA 3UYJA 1TVGA 1YCIA 1OF3A 3O0VA 5FO7B 2Y8KA 4JTOA 4Q8KA 5ABJA 1OPMA 4YG6A 5L36A 1S0BA 4QGNA 3T1LA 1X36A 2DUQA 4LKDA 1D4M3 3VHRA 3T09A 5JOYA 2GN7A 4KU7A 2K9ZA 3WW2A 1G9AA 5FXWA 1V6IA 1WCDJ 4IV1C 5I93A 2WNUB 5K0UB 5JPNB 5DAXA 1ULOA 2WWJA 5C71A 4ZY9A 2HYXA 4Q2FA 2EA7A 3LDKA 1AX1A 2XQRA 4NHMA 2ETEA 1VBA2 4JGZB 4NIHA 2AGSA 3PJQA 3MEPA 3O7OA 4IEZA 1ZVFA 4Q4W3 2P6CA 4CP9A 1YI9A 5BYNA 1UNBA 5LWBA 5JUVA 4QX8A 4AFMA 1OBNA 2DYCA 3TNQA 1CJPA 1UZWA 1NXD1 1HRI2 1E5HA 3WCRA 1ZA4A 5ACA2 2WR9A 4AVCA 2ZGLA 5C4WA 3T4VA 4Z07A 4Q4V3 4OMCA 4KBZA 4X6RB 5DDJ1 4RYDA 3T3YA 3U4XA 4NIAA 1SACA 4QX0A 1PZ8A 3WQBA 2WO2A 4AYUA 4D6QA 5FYBA 4Y1ZA 3W5MA 3GJAA 4YW2A 4I30A 5CVRA 1O8SA 5FZMA 1GQHA 3WD5A 4URTA 5FUPA 2WABA 4ZS2A 1QH7A 2D6LX 5IT6A 3LSDA 1EUUA 1PGSA 1DZRA 4OHWA 5FMOL 4OQ8A 1O3TA 2D40A 3W21A 1WKYA 1R093 4GH4C 3M1HA 4AW7A 3WDYA 3BTYA 2A1XA 1O5UA 2HWF1 2J1AA 1ND3B 4BWOA 5JDBA 3LAGA 2ZGUA 4ZONA 5HCBA 1UY2A 3GBGA 5M0TA 1G9FA 3ZFFC 5GALA 4WVVA 5JZGA 3MIHA 3MIDA 1W8WA 5D8AA 5F7UA 1HQWA 2FDGA 1VBC1 2A7AA 5A3OA 4MZUA 2TBVA 4YPJA 1WW6A 3FX3A 1X9TA 4XZUG 3FMGA 3GNEA 5CKMA 5F5CA 1VRH1 5JMCA 1XNBA 2ZGOA 1XOYA 1RXFA 3RZMA 3KHCA 4QPIC 2QQJA 3ZXDA 2IC1A 3MIEA 4RGAA 1PZ9A 3I8TA 5L7OB 2A6ZA 3ILNA 4NPRA 1FOD1 2BUKA 2XL9A 2G9ZA 4GB31 2Q8DA 4E4SA 2DBNA 2HBTA 4LO7A 1H8TC 1PIV1 1REDA 2QQMA 1RUH2 1N3OA 1IPJA 2BWCA 1NLSA 4Y20B 5A7WA 3LQCA 1U5XA 1CZVA 5FYSA 4AR2A 4B4QA 4BISA 2A5ZA 4DUVA 5FZAA 3SHRA 4WV8A 4QX5A 4WM8C 4XTMA 3KV5A 3M3OA 3N35A 4M4PA 5A1LA 1K3IA 2XG3A 3NNFA 1S0DA 2GH2A 2BFUL 2V09A 5T5LA 3N7KA 2HJIA 1T2XA 3ZM8A 2R062 1WWYA 4LO6B 4QXBA 4XCBA 4TWTA 3E1F1 2FD8A 4QWNA 3FUOA 1PMHX 4COZA 2VXRA 4QXHA 1UYPA 1H0BA 3AZYA 1BMV1 3FN9A 5FZOB 5B2GB 1O3QA 3M3IA 2WNVA 3ZMOA 3CZUA 2NP0A 5GLUA 3MFAA 2P3JA 1AZDA 3VBFB 1RUE1 4Q4X2 4W6WA 4AFAA 3P5BA 1UOBA 2YMZA 2HWB2 4ZXEA 4AXOA 3LA2A 1AL22 1AR83 1HN1A 1JUHA 1QJU1 3U4SA 3BIEA 1FX5A 2E7AA 1ULDA 4HSJA 1POV3 1SLBA 2QDNA 1MR5A 5A7NA 4FFIA 2PQQA 5E88A 3ACFA 1AXKA 1CAXA 3VBRA 5FYTA 5KC6A 2A3YA 2Y33A 3C7GA 3A4UA 4QPGB 1UF2C 3WCSA 1DQ6A 1N1TA 1O91A 1KJRA 2O14A 3KF5A 3P6BA 4BYYA 4AHYA 1ND2A 5EHDA 1PVC2 2B39A 2Q1FA 3ZIWA 4AGGA 1I5PA 1RIRA 5A7PA 3N4MA 5FXVA 2EXHA 1XC6A 2R1DA 3J8F3 5FDBA 3ZFEA 1L7LA 2YU2A 3K3NA 4QB6A 2SBAA 4R8HA 4V1PA 5FYYA 2MEV2 4UOJA 3UK9A 3ZDVA 1PK6C 2JECA 5EZWA 2KR2A 4K3UA 3CMGA 3D0SA 5CFDA 5F3EA 4RGKA 3LFIA 4EN8B 1VBB2 2E63A 1XB9A 1XE8A 3CQOA 4LBQD 5AFBA 3CNAA 2QBXA 1SFYA 5FP7A 4YYOA 3WHTA 5E16A 4AVSA 2LTNA 2AZ5A 2ZEXA 2UWBA 3DPRB 1SLIA 3ZIXA 4LBQA 1KRIA 4FPYA 2D3RA 2RVAA 1H4HA 3AZZA 2VQAA 3OGRA 1AYN2 1C5HA 4LKSA 4QDRA 3VBUB 4KG0A 1KFUL 1TNRA 5A7OA 3WEZA 3OEBA 5ANNA 3JZVA 4Y1YA 4BHPA 3VDAA 5LZ6A 4EV0A 5KHGA 1YFXA 1RB8G 2QQUA 1EUTA 1MVEA 4C0BA 3CJIA 5T5PA 3C2UA 1UOJA 4PHZA 4LA3A 2Z69A 1NZCA 4Q0UA 3V56A 4XBLA 3HT2A 4TLGA 2Q8OA 1EV12 5DDJ3 3NKGA 4XUQA 2WAAA 4MGYE 5GLWA 1NZIA 3NJXA 5FYZA 4AFCA 2C9AA 2XR4A 3B94A 2KM2A 2ZHKA 1YJLA 5BV6A 3NV4A 5K4LA 4CCNA 1GLHA 3UJQA 1H6XA 1AL0G 2WIIB 3NV3A 3VKMA 1G9DA 3PVBB 1SEFA 3I2DA 4CUCA 3N7JA 3WP6A 2V4VA 4CUGA 1JYNA 5J48A 1COV2 2J22A 1XU2A 3SEEA 4FXGB 2X5IA 1TZOA 3IPVB 2F17A 1ENSA 4XPVA 4PQQA 4LE3A 3O1VA 2HWF3 2K2SA 4XURA 2WS92 2CNAA 4UT5A 2WSUA 4XFBA 3JB4C 3VBOA 3KLSA 1QQP1 4PF1A 1UU5A 1OLMA 2CDPA 3PUQA 3POEA 3FL7A 5CNAA 5FYMA 2EAAA 3VN4A 2P2KA 5LCWL 5E89A 4KWJA 2RG4A 3DYOA 3KF3A 4J1WA 1VBC3 3FHIB 4N9HA 1LOAA 1BKZA 4K40A 4RFRB 3POFA 1OVSA 2OVUA 3TNPB 1K5JA 1VRH3 1ALYA 2F6BA 3R4DB 5LK5A 2GH8A 3WDXA 4N53B 5K0UA 1AXYA 2WNUA 4JZRA 3SQOA 2XVKA 5DPNA 4CDXB 4MOAA 1LODA 2VOXA 4HPKB 4QU1A 4XMIA 4C90A 1FOD3 2CDOA 2RE9A 3AP4A 4GB33 4Y1XA 4FOYA 4I09A 4JGZA 3VD4A 1PIV3 1VP6A 4FFHA 3B01A 5H9QA 1MS3A 3VKOA 4OZXA 1WCSA 4QQHA 1ZZ7A 4KGGA 4JTNA 2RJ2A 3WP4A 3AYAA 3O12A 2XMLA 3KHBA 2YPDA 2DU0A 2HKXA 4YW7A 5A70A 4AG4A 4EN6B 3OD4A 1ZRFA 5JR7B 5JOZA 1RUF1 4HANA 4XABA 2DF7A 4JAAA 2VU9A 4L11A 4MX3A 4NE9A 3S6PA 2IFWA 5IAXA 2D97A 1CN1A 2PQSA 2JE8A 1ASJ1 3PL0A 1X8MA 5FZ4A 4HMZA 3Q8EA 4DY5A 3WG3A 5FK8A 2VJXA 3AFKA 2VOTA 2V5YA 3AB0A 2BGOA 5T3NA 3PMEA 4GQ7A 1O4YA 1G86A 1WMEA 2Q4SA 1JHJA 2WUHA 4W6XA 5FWEA 4XC9A 1QDOA 2PHXA 4GALA 4BXFA 1XNAA 1DGRN 3PUHA 1RUE3 1F31A 1MS1A 1F9KA 1J58A 4AEDB 2WN2A 2G4IA 3LA3A 2OUHA 1C57A 3THDA 1QJU3 3HN1A 1Q5OA 5HV0A 4K7JA 4YM1A 1G7YA 2BWAA 4L92A 1ND3A 2ZEWA 2WZR1 1LJ7A 2ZS6B 1DGLA 1JOBA 4GKXA 4JDOA 5BNPC 3M2MA 1GBGA 4NVPA 3AKTA 1NA1C 4TTGA 4XFCA 4MGZE 5JPMB 5L73A 5I8SA 3PUSA 2DBIA 2W5FA 3U11A 2VVEA 4Q0PA 5IATA 4CDWB 3RYKA 2KD7A 2BPA2 3WDVA 2ZMNA 1ODMA 1RGSA 2WC2A 3N36A 3X29B 3BU7A 2C24A 5FZHA 1BQPA 1ZRCA 2D6KA 1H2MA 2ZGRA 2JXAA 4P00B 3RMYA 2J1RA 2IVJA 5L7OA 5J37A 1W03A 3IN9A 4HLTA 4XQ4A 1ZBE2 3BOWA 4L9BA 5JXIA 4M3CB 4BLJA 1LECA 4CU6A 1HXS2 3ELNA 3GDBA 2ZMKA 1UZZA 1LCLA 1BHGA 2DU1A 4Y20A 4X6QB 2BZDA 2ORXA 1FMD1 2AACA 4UW3A 1J1TA 3MIFA 4FTBA 1OF4A 1V70A 3ORJA 3DV8A 1C8M2 1JOJA 4QX3A 2FQPA 2GC2A 3EMRA 5LBCA 5K8SA 1HQNA 3I2GA 3BALA 3VKFC 4BA6A 2J1EA 5LBFA 1QNYA 4FI9A 4DXTA 1C4RA 4CU9A 4PQ9A 3Q8BA 2P37A 4DIQA 2O8OA 4OMDA 2W68A 1K5MB 1W04A 2NYYA 2ZPXA 5L9VA 3TN91 4NWVA 1O5LA 1UXXX 1NYWA 4GWMA 5FZOA 5IVBA 5BXXA 5BNQA 4XJUA 1AF9A 1RUG1 4XETA 5IK7A 3ETQA 1YI7A 1RC6A 3VBFA 4CDQC 4AFDA 4ISRA 4E2GA 5C9AB 3RYPA 4RQPC 1IGOA 4NOTA 3ZXFA 5B4NA 5HCAA 2XVGA 1JN2P 3E5UA 4PI2A 5FKCA 1RHI3 1XYPA 2B42B 2RJLA 1V9U2 3N9NA 1RUC1 4FXKB 4IETA 2RS31 2HWD1 2JDYA 4QPGA 5A32B 5FY4A 2P17A 2VGDA 4QQLA 1EAH1 5BPXA 1F5FA 2A73B 2UY9A 4UI9L 4XYXA 4AVTA 2FCTA 2ZEZA 3GCWA 4WZCA 2BOIA 1OVPA 1OFNA 2QQIA 3ES4A 4Z92B 4O7XA 4RD7A 2ARXA 2YUEA 1ZRRA 2XLAA 3PU8A 1DLLA 5J1XA 2YG0A 1NCRC 1HN0A 4DB5A 1ULFA 4XFIA 2WFF1 3WW3A 4MLOA 5CKNA 5T50A 2P3YA 4XE9A 2JIJA 1OI6A 4YGDA 1A34A 2VVFA 4X8NA 4A45A 5EJZB 1QQP3 1D0HA 4CU7A 2XUMA 4XUNA 1EY2A 2VOWA 4R9BA 4D7SA 1WD4A 3A23A 3ILFA 5CFCB 1UX6A 3O1TA 4CZSA 4XUPA 4MV2A 4PBPA 4QXKA 4GULA 1YQ8A 2C4XA 3T2PA 3K4DA 1W3XA 2JG8C 2JX9A 3I49A 2JD9A 4N43B 3AMPA 1H8VA 1OH4A 1PMJX 2RMU2 1WCQA 4NHXA 5D1IA 1MZ5A 3DPRA 1TQ5A 4A3ZA 3RJ2X 4A4AA 2ZZJA 3EHKA 3VBUA 5FZ3A 1W05A 2JG9C 4IV3B 5BNOB 1JZ6A 2H6BA 1OC1A 3L2YA 1LHUA 3AMNA 4B1LA 2DWRA 1HJFA 5I0DA 3TWIA 3OF1A 4IUGA 1RMU2 2CAVA 3HQXA 3G6JB 4IXLA 5GZGA 4YM2A 3BU0A 2GALA 1RUF3 3ZSEA 1HB1A 1F15A 2ADDA 4EYUA 1A6CA 2D6MA 2DDUA 1OOPB 1FV2A 2XBO1 2ZXQA 5FPVA 2EXKA 1ZZ8A 2LUWA 3IIIA 1ASJ3 2JICA 2B4KA 5FUNA 3ZX7A 1VB2A 2ET1A 4JDMA 2JWPA 4LNVA 4YZ2A 3O1PA 4QKDA 4A44A 1KS5A 5CG9A 2Y0IA 1TMF2 3VD9A 3CHXA 4MHUA 1GZTA 2R0FA 5CA6A 4XIKA 1LGBA 4PIYA 3T0BA 2DFBA 3IPVA 2XJQA 3POIA 2ZABA 3QOPA 4QB1A 1CX1A 1YHFA 3LIHA 3QCWA 4XJ9A 2Q1ZB 1UU6A 2ZX1A 3GF6A 1XRUA 2WZR3 3CDZB 2W08A 2W92A 3HR9A 5C8CB 1SLCA 4FFGA 5EXOA 3CKHA 5A3UA 1H2KA 3WW4A 3AZWA 2DCZA 3SLIA 1LOEA 2PLV2 5LASA 1BEV2 2WNEA 1U12A 4OVEA 4UAPA 2WQZC 2VQ0A 3HJRA 4AQTA 5IYYA 3WV6A 1PO11 1BBT1 1QJFA 1R1A1 3VZLA 3ZR5A 4DPNA 2P6HA 5CEHA 5DMYA 4BQ5A 2YB7A 1T6GC 1REEA 3DXTA 4P14A 4R9AA 4WM7C 1O8PA 5E1RA 1LOBA 3AVSA 4E4HA 3VBHC 4N53A 4GA9A 5KHIA 3TAYA 4JHTA 1NUKA 1ST8A 1ZBA2 4CDXA 1MQTC 4DO0A 4A2UA 5F3CA 3AKPA 4HPKA 3SNMA 2A70A 4XDPA 1RUD2 1W6PB 5HCHA 3KMHA 5EPAA 4UFHA 4NHKA 2PXJA 5LA2A 2XHKA 2GAUA 3LB9A 2OPKA 1H9WA 4ARYA 3JB8A 1HX6A 1UYXA 1OD5A 4RR3B 5HPOA 2GNMA 1FMD3 1ZZ6A 3H3ZA 3RWKX 3WZ1A 2GZWA 1H2NA 1SCSA 4ES8A 4RS5C 2WLQA 3HQUA 1QXJA 5I8YA 1I6XA 3N7LA 1U5ZA 4LBKA 3MI8A 5JSOA 4D7TA 1JZ3A 2D6NA 1AXZA 2VUCA 1D4M2 2QFEA 4P9YA 3MBWA 4N8MA 4C8DA 1ZYBA 5FJKA 1QJEA 2YBPA 5JAXA 3RZKA 4QKFA 2NZ9A 3FBMA 4LJHA 5FZ1A 3ZYJB 2D44A 4D6SA 4ET7A 1PGL2 3T30A 5BY5A 1LR5A 1DGRA 2GP3A 2PFWA 5F32A 1CR7A 3TN93 1POV0 4COVA 5FPXA 3H8UA 2E26A 4BM8A 1DG6A 1RUG3 1FNYA 1S0FA 4TXWA 1IQAA 2ZZQA 2VZVA 1WLCA 4FPJA 4AEDA 3I3BA 4YVWC 2XUEA 1VBD1 4Q4W2 2XJPA 5IVVA 4HFSA 1UMHA 3H42B 2LALA 3EB7A 4H7MA 4EWDA 2X05A 3N9LA 2WO7A 4YM0A 1QJX2 1RUC3 2LW8A 4MUVA 3H50A 2RS33 2HWD3 1DFQA 2IXKA 3OUHA 5FZEA 1NLRA 2VMGA 2O8QA 1H9PA 1NCQC 1GQGA 1T6BX 1N3PA 1UO9A 5KXCA 1BCXA 1EAH3 3LPFA 2W46A 4HBNA 4Q4V2 2P34A 1EPWA 1US2A 4OI4A 3ZKYA 3I2FA 3DEMA 4CU8A 2BTVC 4RHV1 4TLFA 3KS7A 1UD1A 2A3XA 2J42A 5FLIA 4AAPA 4CDWA 2L9LA 4Q1RA 1KITA 5HCFA 5T5JA 1O3SA 5DG1A 1XYNA 2VMFA 1FAYA 4PIZA 4A7KA 5I0TA 4JV4A 1YFWA 1Q8PA 3H1MA 2WL1A 4NROA 2BP6A 2WFPA 2WFF3 5FZCA 4GJZA 5DZEA 4CUBA 3MPBA 5KHJA 4M3CA 4AQ2A 1R092 4K8RB 1PGW1 3VBSC 4RFT0 4YW6A 1WW7A 3MLLA 2AUYA 4LBOA 3MV11 3MF6A 3IMNA 5A7SA 3ROUA 3TEXA 2VW2A 2W1UA 3ZSKA 4NIDA 2WDBA 1B35B 2FZ2A 3Q9OA 2JDUA 3RZJA 3DN7A 1SHWB 2IXLA 4HETA 4HVQA 4FQ4A 1GNZA 3N3HA 5FREA 2TUNA 4LHSA 4DY3A
chains in the Genus database with same CATH topology
1UW8A 2TNFA 4B7EA 1K5MA 4XTPA 2EXIA 2NLRA 2VULA 4A7ZA 1UIJA 1UKRA 4BLIA 3ZVXA 4HZFA 4H14A 5HXVA 4AF9A 5C9AA 3WP5A 4TZDA 3SXWA 3AX4A 1APNA 3VUOA 2H0VA 3AP5A 3EBRA 3ZFGB 5LEKA 1IS5A 2GNBA 3E6BA 3BODA 2RS51 1KDKA 3SITA 3DGTA 2RR11 4BPZA 2BVVA 5A32A 2XBO3 1PZ7A 2H6CA 1KQRA 4FCAA 4QMAA 5GM0A 1NOVA 3UV9A 2YZ4A 1S0GA 5CBLA 1WA4A 4QT6A 3WY6A 3FUQA 5DUWA 4JGYC 2ZHNA 1MEC1 1HRV1 3QH7A 4B3NA 4YW4A 4OI1A 4CP2A 2XLGA 1N1VA 2D43A 1NG0A 4MXWB 4YZ5A 4FOWA 2YYOA 2JKBA 3C3VA 4D3WA 3OJBA 4K6BA 1LTEA 2VOKA 1A78A 2JD4A 1AR82 2BVBA 2OIIA 4DXZA 5CFCA 4M00A 4XZPA 2E7TA 2VNGA 2R30A 4J6GA 2OZ6A 5J3UA 1J3RA 3GHMA 4N90A 4N43A 1PO13 1BBT3 1R1A3 1Q3EA 4OULA 1F2NA 4PDWC 1I5ZA 1SLLA 1MZ6A 4XFFA 3AM2A 1ZZBA 1JYIA 1RJ7A 1RUI1 4OUMA 5EYYA 1HQLA 3FLTA 1HKDA 3FZ3A 3S30A 3J8F2 4EWEA 4CEWC 1DQ2A 2RS11 4KH9A 1C8NA 4IV3A 5BNOA 3WW1A 4XHBA 3D5OA 2CWSA 2B5HA 2RHPA 4FPLA 4LEJA 1JYCA 4IEXA 2QNKA 3E97A 4RA0A 4CEYC 1S1AA 3AP7A 1WW5A 1OA2A 1SBFA 2R041 1OOPA 3VDDC 4BH9A 3P3PA 2OUJA 1MZFA 2ZCWA 1CIWA 1VAKA 1U5IA 3CLPA 4ATFA 4E2SA 4OFGA 2Z42A 1GANA 3NKTA 1XQNA 3RRDA 1ONAA 3NVCA 3PVNA 3MZHA 1QGLA 3EO6A 1UU4A 1VBD3 1JH5A 4I0WB 1NE4A 3RJRA 3D8CA 4YVSB 2Q1MA 1DDLA 2PA7A 3MW3A 2R6QA 5C8CA 4IEOA 4M0HA 3BOPA 3DL3A 2E9QA 1AR91 3PHMA 5DDJ2 4AEJA 1LEDA 4RHV3 2X53S 1OLRA 4IEYA 5ABJC 2HWE1 3RMXA 1W6QB 2NN8A 4Q0SA 3R4UA 5FTTC 1LHVA 1AR61 3MF9A 3B9IA 4P9JA 1IS4A 3APBA 4WVWA 1C3HA 4YGCA 2A71A 1W6PA 3WXPA 3O5SA 5EV7A 3L2HA 2Q0AA 2DVDA 4NR1A 1GSLA 2HWF2 2XVLA 4RR3A 4WVMB 4CDUB 3KT4A 1D4VB 2HWC1 2E7QA 4FP2A 2QZ2A 2R0HA 2VECA 4LO4B 5C4WC 1VBC2 2QUOA 3MW4A 1G8WA 1V6JA 1YWKA 5F1RA 5FAXA 1V6LA 3U0ZA 1VRH2 1ZNPA 1MS9A 5FO9B 3QD6A 4BMBA 1QXPA 5FFOC 1XXNA 5KHHA 1FOD2 4GB32 4I01A 5K9YA 3ZYIB 1PIV2 1X7NA 3GBFA 3V0BB 3ASIA 4R4ZA 1FPN1 1U5YA 2ZAAA 2C1FA 1RUOA 3ZXJA 2GDFA 1OA4A 1Q8QA 2RS53 2CV6A 2RR13 3ZYRA 2RM21 4X8PA 5BNNB 5CG8A 1RHI1 4XOGA 3OBTA 4AVBA 3SCFA 2ZGTA 2A3WA 1DQ1A 1R081 5JZGC 1JBCA 1SBEA 5D8AC 1DF0A 4YW1A 1MEC3 1HRV3 4XBQA 4K1YA 5C33A 4LBJA 2D5HA 1RJ8A 2EIGA 1BMV2 4M3CF 1AX2A 5A3LA 3NAPB 2N7GA 2XKPA 1PO22 2ZTNA 2R071 1RUE2 3NV1A 1A8DA 1UPIA 4AHXA 5BUVA 4UW6A 3ACLA 2QCSB 2HYKA 1QJU2 2WT1A 4N7IA 4XF0A 3S7EA 4CYDA 2SLIA 1F8VA 4YGEA 5SV5A 1SCRA 4P9XA 4OI2A 3FWEA 1B35A 3LA7A 1IS6A 3BB6A 1UIKA 3RI9A 2GMPA 3PTYA 3OBRA 1V6OA 1VAVA 5F6KA 1RUI3 4IV1B 5A3MA 1FXZA 4LUKA 1S2BA 1HIXA 5KWRA 2K0GA 1VBE1 1G9BA 2UYAA 2DTWA 2RS13 1QDCA 3ZMNA 5SV8A 1RVF1 3H1WA 4Y22B 4J1XA 4W6YA 4GWNA 4DRRA 2DV9A 3AXEA 2PYTA 5DUVA 3RG0A 2WNVC 1SBDA 3B02A 5AC91 3HMYA 4Q0QA 3ZFGA 2ZGMA 3VHOA 3WR0A 4Z1VA 2R043 1QOOA 2Z79A 2DUOA 3IM0A 2KA3A 4YG3A 3VBRC 1AR71 3MLKA 3WOGA 4HN0A 5CB7A 3J26N 2P3KA 2DVGA 3HAGA 2OYZA 1SLAA 1ND2C 4L99A 4FOQA 5JLVA 4QQ2A 2HEWF 3MLJA 4YRDA 3NSTA 4D69A 4MXWA 4LT5A 1TME1 1RUJ1 4LO8A 1DYPA 1OQEA 3IWZA 4GH4B 1OSGA 3ZFEC 1UPSA 1Y43B 4XF1A 5DZGA 5KXBA 2G9GA 1FATA 2YV8A 3WNXA 2QKDA 1JW6A 2D6OX 1S55A 4O9EA 3ZFFB 3ZO0B 3H1YA 1AR93 1QH6A 1YXWA 2E53A 4C1XA 5CFDC 4MGKE 4U36A 2HWE3 4JCKA 3JCIA 3KB5A 3WG2A 1Q8VA 5LRSA 1AR63 4LBMA 3GYDA 3JD71 3B00A 4MXVA 1GKBA 1WW4A 5KXEA 1DGWA 1MVQA 1N47A 4QPIB 1W6OB 1FYUA 4HKLA 4I2OA 1YUDA 1NY71 3RS6A 4YW5A 1AUYA 3OYWB 3M70A 3WP3A 1H8TB 2ZKNA 2WT0A 2I45A 1LU2A 1Q43A 1PM7A 1VJ2A 2ARBA 4U2AA 1OA3A 4QQOA 2W52A 3HIFA 2WQ4A 5AVPA 2D3PA 1QQP2 3CJXA 2HWC3 3POSA 2EVXA 1ENXA 3CJIC 4WM8B 1JTZX 3POWA 4HKWA 4OHXA 3E6CC 1GV9A 5JOXA 2ZBJA 1AJOA 1LOFA 4FO9A 2YPJA 1M4WA 4AI1A 3U07A 3VHNA 3EJKA 4I0BA 3CO2A 3PLQA 3R6SA 4KU8A 3JBG1 1V00A 4FPFA 3ZXGA 1XU1A 2Z2SB 1QXRA 4HSLA 1CPMA 5C8WA 1D2QA 4OUSA 1QY4A 5J09A 4PIXA 5EJ3A 1FPN3 1ZZ9A 4LLFA 4I0AA 4UXAA 3WQ7A 2X5IC 4DOUA 3WX5A 4YVSA 4QGLA 1J3PA 1LULA 1MACA 1GICA 1MS4A 5K7PA 3VBOC 2RM23 4XF4A 1QJY1 1R1ZA 2FHRA 5KHKA 3AKRA 3H3UA 1RUF2 1VALA 1XNCA 5HI0A 1J1LA 2DCJA 2QJVA 1R083 1W6QA 5J7MA 5DXDA 1ASJ2 1IS3A 3POYA 1O7FA 4OHYA 2DCKA 2X8KA 5H9SA 4YARA 2ET7A 5K0UC 2WNUC 2Y0OA 2YGMA 2R073 1PK6B 4XMAA 1KXGA 3QACA 3WT3A 4JGZC 2BNNA 4WVMA 3M3QA 3M3CA 2H0BA 4P5HA 2XWBB 3VLBB 4CDUA 2WZR2 5GZCA 5JOWA 1Z7S1 1UKGA 4TYSA 1BVVA 2A75A 1LHOA 3S0MA 1CAWB 1VLNA 4FPOB 3VL9A 3B69A 1Y3TA 3AJZA 1JXNA 4C91A 5FOJB 1LOGA 1VBE3 2GN3A 1O4ZA 4Q4Y1 1L3JA 4PJYA 1RVF3 4XW3A 3TBDA 2P3IA 4AWDA 1WLDA 2OA2A 4E9KA 4JDNA 3V0BA 4FPCA 5J98B 5AC93 1REFA 4I02A 1FMD2 3G7DA 2R16A 2CYFA 2PAKA 4DZGA 1ND3C 5BNNA 2R32A 4XHXA 1AR73 1GZ9A 2NM1A 1D0GA 4DS0A 3ZXAC 5DUXA 4LO5B 2DTYA 5JWPA 2F4PA 3NO8A 4NHLA 3OY8B 4GKYA 3VZMA 4M01A 3TN92 1LEMA 4IL7A 1TME3 1RUJ3 4XDQA 1CGPA 4JC1A 1DYKA 1RUG2 3NAPA 3RDIA 3EXUA 2WINB 4R9CA 3WG4A 3ZSLA 3FE5A 4B8EA 4Z2WA 5L7OC 2DFCA 1OLQA 2GC1A 4SBVA 4AGRA 3I59B 3OD0A 5AFEA 2AREA 4HVOA 3U10A 1RUC2 4K20A 2DCYA 2RS32 2HWD2 3ZYPA 4E27A 3LOBA 3O0XA 1I1EA 1EAH2 4ISQA 3ME2A 4ONUA 2A6WA 3VHPA 3NL1A 1SMVA 3BIWE 2WA4A 3JD73 1NQDA 4WBBA 1A3KA 3ALQA 1GNHA 4IV1A 5I91A 1UZYA 1LENA 4ASMB 1OQ1A 4QM9A 3SH3A 1DGWX 4RL7A 3T1MA 2ZACA 3W9AA 3DKWA 1URXA 4Y22A 4EJRA 4INDA 2WFF2 4P9IA 3CU7A 4EN9B 1X8EA 2GU9A 3LCPA 1NQJA 3W59A 4F83A 1QHDA 3VBFC 1AYM1 2YHJA 4FTEA 4LBNA 1DQ0A 1PNGA 3RWNA 2VOVA 4AE2A 4XFAA 2IXHA 4QPGC 3OGJA 1CESA 1SFNA 3AKQA 1O4TA 3JBG3 4Y1UA 1RTVA 3I7DA 1H1IA 4B4PA 5JIUA 5GZEA 4PBOA 2W39A 2WA3A 5T5OA 1W39A 3AJYA 1OHFA 4S2DA 4F8AA 4GH4A 1CAVB 4PLNA 2NMNA 1H4GA 1GZCA 1MS8A 1VBA1 2B7YA 1RL3A 3HWJA 1AX0A 3VZKA 5DG2A 3SISA 4BCUA 5BNPB 3URFA 4IESA 5TSWA 1QJY3 2ZAHA 1HRI1 1NA1B 3ZFFA 4FP3A 4Q26A 3D82A 5ACA1 2D7FA 4PLOA 2YXSA 5KBFA 2DVFA 3KGLA 4CP0A 2DUPA 1WLWA 3VZNA 1C5IA 1AVBA 4MVTA 5J36A 4QPIA 1W6OA 3WUCA 3DPRC 2D6PA 1LU1A 4NO4A 3SH5A 2JJ6A 3OYWA 4Q27A 1H8TA 3VBUC 3UKTA 3CL1A 4IEVA 4PF5A 3K48A 2NQYA 1Z7S3 2O1QA 4IEQA 4WM8A 2PHLA 2B45X 4FPHA 1BEV3 1YFUA 2ZKLA 5IUQA 2XJTA 2Q30A 1S0EA 1PO12 1BBT2 1R1A2 3B93A 1ULCA 2EF6A 4AI0A 5GZDA 5GLTA 1H1MA 1QNWA 5FQ0B 3VZJA 4Q4Y3 4E2QA 1OPOA 4BIFA 5GLVA 2QE3A 4AQSA 2BGCA 3ZYGA 1FV3A 3D0JA 3WHUA 4CDQB 4RQPB 1OQDA 3THPA 3MFCA 3QLQA 2ZX3A 2UU8A 4P9WA 1RUH1 3H0OA 2XJRA 5CAZA 5I0UA 3RPQA 5LEJA 5JSRA 4BE3A 5EFUA 2TEPA 4COYA 4EWAA 3SCHA 3V65A 2YY1A 2XGXA 4QM8A 1DQ4A 1F5JA 3SMHA 2R061 1UAIA 1NCRB 4FPGA 1C28A 2IFRA 3MIBA 1PMIA 3V64A 4N53C 4AGVA 1J59A 2V73A 2BNMA 2I2SA 4CDXC 1PK6A 3HBZA 2CGPA 4EN7B 3R0RA 1TEIA 1VBD2 1WBFA 3FLPA 2VNOA 3DUIA 4IEUA 4OHZA 1FI2A 1LGNA 2ZJCA 3THTA 4Q4X1 1QJX3 1FNZA 2HWB1 3M8LA 5FLHA 5J96B 1LKNA 3A0KA 1AL21 1CX4A 3ECQA 4KBBA 3J9SA 2JG8B 4Q1PA 3UKNA 1Z78A 4AFBA 5T54A 3N7MA 1RITA 1CAWA 2WJSA 4AVAA 5JI9A 2ZGSA 4RHV2 3UKVA 4AI3A 4ZU4A 3JU9A 4YZ1A 2ZX0A 3D4KA 4QGMA 3TB0A 2BYVE 1ULEA 3E5QA 4FPKA 1PVC1 2ZGPA 1WBLA 1GYKA 2JG9B 2MHFA 4FT8A 1VR3A 3GHNA 1B09A 2ZHLA 1XYOA 3B5LB 1W6NB 4QU2A 3USUB 1PGW2 3SH4A 2MEV1 3ZXEA 1AYM3 4S2GA 2D5FA 4AEDC 3M4FA 1BK1A 4UW5A 2A6YA 4H7LA 4ZU5A 2GSYA 3E6DA 1GZWB 1ZM1A 1CAUB 1VBB1 1RINA 2WWSA 4CTEA 2PHTA 5I0RA 4UBGA 1G9CA 3TOJA 4FPEA 2CGNA 1FT9A 2UYBA 1W0PA 2BNOA 4BMEA 3OY8A 4CDWC 1GFF2 3AZVA 4XBNA 1LGCA 2RJKA 4S2HA 4UW4A 1AYN1 1QF3A 2UWCA 2X29A 1VBA3 2VUAA 3ZN6B 2EALA 4E4ZA 1KFXL 4CP1A 3FJSA 4L8QA 4AEKA 3I59A 1H1AA 2CWMA 2VNRA 2XWJB 4HT1T 1HRI3 2G9FA 5I0SA 2GNTA 2RS52 4GXLA 2PHWA 2RR12 5ACA3 1HDKA 1I3HA 4META 4WVZA 4FBFA 1SQ4A 4YFWA 1EV11 5F6LB 3M7AA 4WM7B 5HBAA 3ATGA 4EN0A 1W6MB 3VBHB 2IXJA 1MEC2 1HRV2 4NWWA 1MQTB 1EPZA 3QH6A 3NWKA 1PO21 3VKLA 2IZWA 1K5MC 2IXCA 3UL2A 2WSVA 3RYRA 1COV1 2CAUA 3JQXA 5GKAC 1QWRA 3R05A 3MPPG 4Y24A 2WS91 4LUMA 5C9AC 4RS5B 4QQPA 4AHWA 3WUDA 2ZX2A 1M06G 4OI0A 1IKPA 1IOAA 5F5QA 4KG8A 1OKQA 1WUVA 2VMIA 2VMHA 1DIWA 5GLZA 1MS5A 3B9CA 1UCXA 4AK3A 4BOWA 3LZZA 4BIOA 1RUI2 4P9GA 5I8TA 2R1BA 3LSEA 5DUUA 4OHVA 3WINE 5FCCA 4Y1VA 1U0AA 2RS12 5GJ6A 4ZKTB 1WMFA 3CF6E 2D98A 2HEVF 1YNAA 1CAVA 4YVWB 1MZEA 2XLFA 2XB6C 1RUH3 2PAEA 5BNPA 1VAMA 1NCQB 1KS4A 1HV0A 1NA1A 4AVVA 2WKKA 2PELA 5CFCC 2YDEA 5T55A 4ASLA 2R042 1X50A 3VZOA 1QKQA 2UY8A 1IKQA 4JVAA 4K1ZA 1CVNA 4N43C 3NJZA 2R063 3IDBB 5H9RA 5FO8B 1D2SA 2ZOEB 2B9UA 4DQAA 4FQZA 2IXIA 1HW5A 2E6VA 1QOTA 4DNYA 4IV3C 5BNOC 3VBSB 3JQWA 4Q4X3 4XF3A 5FLJA 2HWB3 2BQPA 3RQ0A 1BVP1 2GNDA 3FC0A 4N9IA 2D3SA 1AL23 4HN1A 1WCKA 1ULGA 3AZXA 4HKOA 1AR92 3ES1A 2I74A 2Q5TA 4FTSA 5FMOS 1TE1B 2HWE2 3GZUC 4AQ6A 4XF9A 1AR62 2WT2A 1OOPC 3NW4A 5FPZA 1PVC3 4Z8BA 5FQ0A 1EP0A 4YGBA 2DVBA 2ZMLA 1S0CA 1HV1A 1DQ5A 1A8MA 1PHMA 5CU1A 2ERFA 5FBZA 4RGGA 3WLUA 4CDQA 5H9PA 2A6XA 2AYHA 2O0OA 4RQPA 2MEV3 1QMJA 1ZBE1 2EXJA 4W65A 1GR3A 1HXS1 1Y7BA 2MNGA 2HWC2 4KL1A 3VGIA 3PMSA 5C8CC 2MPFA 1VBB3 1UL9A 4YM3A 1ENRA 3P3NA 1C8M1 2XL7A 4F7ZA 1HLCA 5F9TA 1XE7A 4AI2A 4JGYB 4L97A 3FFQA 4XIOA 4YW3A 2PHFA 1DBNA 4MSVA 2DVAA 3S7IA 1NCRA 4P9LA 1AYN3 4M3CE 4LULA 2C5DA 3AYEA 3OTFA 1XNDA 3M3EA 3VL8A 1UMZA 2BFUS 4FVVA 1FPN2 4R4XA 2ZGNA 3AKSA 1X33A 3BTAA 4C0HA 4QD2A 3FLRA 4MYEA 3FFZA 3V0AB 4RR3C 3MIGA 2JG8A 4Q0VA 2RM22 5LRRA 4XJWA 1O3RA 1RHI2 1V9U1 4D7YA 2IWGB 1MS0A 4EROA 1EV13 4DFSA 4PDWB 3MW2A 4LHNA 1R082 1VB4A 1YIFA 3AP9A 2OW4A 4O9GA 2GMMA 3BPZA 4B4RA 4CEWB 2JG9A 2LM3A 4L2NA 3OPZA 1PO23 3BCWA 2QZ3A 4UBHA 1W6NA 2B8MA 3DF0A 2R072 1COV3 3ENRA 3USUA 4COUA 3AMMA 5IK5A 3IBMA 3EQEA 1KD7A 2WS93 5A33B 3IT8A 1SDWA 4MH0E 4CEYB 5JCTA 1CQ9A 3KQRA 2VH9A 1J3QA 2ZGKA 1GZWA 2B46X 1CAUA 2JEMA 1N1SA 1YYNA 3LOIA 3T2TA 3JUUA 3SCGA 3VDDB 4Q29A 5CADA 3MICA 1IHMA 2VVDA 4RSUA 1YFYA 3AYDA 4S2FA 3UJOA 2QQPA 3KGZA 2FZ1A 1C1LA 3R4SA 3ZSJA 2RMU1 1VBE2 5GZFA 4H55A 4Y26A 1RVF2 2WLPA 1NE6A 3VV1A 4Q8LA 4GMP0 3ZN6A 3INAA 4LHKA 3ZPYA 2AENA 1XNKA 5AC92 4YG0A 2XJUA 3W58A 3H9AA 4AEMA 1N1YA 2XJSA 4NN0A 4XFGA 2JE9A 2XKOA 3HT1A 1LHNA 1RMU1 1WLTA 5ABJB 2Z5WA 2W0XA 4R9DA 1B35C 1AR72 2YGLA 1CJDA 2VW1A 3GZTB 4XFHA 4LBLA 4TSVA 4GMP1 4WM7A 1N3QA 4YFZA 1W6MA 3VBHA 2BW8A 2DURA 4M0NA 3RZZA 1MQTA 3O14A 1AHSA 1WMDA 1E57A 2ZHMA 1TME2 1RUJ2 4I3GA 1TMF1 4FOVA 1SLTA 2PHUA 1ZZCA 3WDUA 3MYXA 5DZFA 2JDZA 4RS5A 3WVJA 4CRQA 5KC5A 4KNCA 4ATEA 3ZFGC 3AFGA 1PNFA 4JQRA 5C4WB 1YIPA 3ZXLA 2PLV1 1BEV1 3JD72 3ST7A 4DMIA 4KWKA 3AK0A 4H3WA 1NY72 4G3YC 2PAMA 2VY0A 2FMYA 5T52A 4LA2A 1ZBA1 4LE4A 2BEOA 2VW0A 2BBVA 3WDTA 3NV2A 1W2UA 2ZGQA 3PJYA 3IIAA 1RUD1 2PHDA 4YVWA 1ZBE3 5AVAA 5FOBB 1QU0A 3OGGA 4XQWA 1HXS3 3KZ4C 1Y9QA 5FRAA 4ZU7A 4HVRA 1NCQA 4QHBA 3KT7A 4SLIA 3RSJA 2CGOA 4WZFA 2GC0A 4XEZA 4Z82A 1IZ3A 1C8M3 4DRVA 3USSA 1Q56A 5L19A 5JIAA 5JZGB 2QDRA 3O0WA 5D8AB 3ZXKA 3KCCA 3VKNA 1D4M1 5KXDA 1JHNA 3JBG2 1YO8A 2AH2A 3KD4A 3ZSMA 3H7YA 4E4DX 5LK7B 1ZX5A 1PGL1 3ZN5A 3GBWA 1KDMA 4FSJA 2JENA 3KM5A 4K9SA 1BXHA 4JRAA 1DZQA 2XH6A 3VBSA 1DZTA 3A0NA 2HEYF 1ENQA 4Q4W1 2UURA