3NV4A

Crystal structure of human galectin-9 c-terminal crd in complex with sialyllactose
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
136
Chain Sequence
HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv4A00
1DFQA 3D4KA 2ZMNA 2PHTA 3O0WA 5GZDA 1LJ7A 1YO8A 5JOWA 4LBQB 3BODA 3I4IA 4BMEA 2B7YA 3L2YA 2GN7A 3BTAA 5T5OA 4DRRA 5BYNA 1JXNA 2V73A 1Q56A 4YZ5A 5KXCA 2ZAAA 2D44A 1AXYA 2DU0A 2D6MA 2E7TA 3VKOA 1MS8A 1AX1A 3PMEA 2EF6A 2G4IA 2ZGPA 5IK8A 4YGBA 3GNEA 1O4YA 4YW1A 4D69A 1W0PA 4C1XA 2A6ZA 1DIWA 1OFSA 3U4XA 1WLWA 4HANA 3M3OA 3WCRA 1SBDA 1UPSA 1GZWB 2ARXA 4PBPA 2NN8A 1Q8PA 1LOFC 2UWAA 1V6IA 5HCBA 3AZVA 1LGNA 2SBAA 3WG2A 4YG3A 2PHWA 3A0NA 2OUHA 1WW7A 1S0IA 1V6LA 2D3RA 4BQ1A 1FAYA 1W6PA 5KXEA 2ZBJA 2Q5TA 1SBEA 4DRVA 1QNYA 2CWSA 1LECA 3M3QA 1MZ5A 4CTEA 2A70A 5DUXA 3W59A 1S1AA 2A6YA 2ZACA 4FPJA 4NO4A 4XXAA 5DG1A 4C1WA 3ZXEA 2EXIA 1QOTA 1A78A 4P9WA 1ENQA 1B09A 2DTYA 3USUB 4AGVA 1BYHA 1W6OA 3VKFC 3VKMA 3AZZA 3SISA 3T2TA 4Y1ZA 3PJQA 4Y1XA 2WNEA 4FOYA 5CA6A 3RQ0A 2WSVA 3UJQA 5T5PA 1VAMA 3JUUA 4FP3A 1N3QA 4GWMA 4FVVA 4P9XA 1DQ4A 1G9DA 3ZYPA 2A3XA 1S0CA 3RMXA 5IK4A 1ENRA 2P2KA 3AJYA 4XMAA 2ZGNA 3SH3A 4K1YA 4L8QA 1MVEA 4ISRA 2VW2A 4AWDA 1CESA 1LEDA 2XB6C 2HYKA 3OYWA 3V0BA 1FATA 1LOCA 1DQ2A 2ZGMA 2DVFA 5H9SA 1JBCA 1ULEA 3ZSLA 5JOXA 2GNMA 2WLQA 2R49A 5DXDA 4ZXKA 2DYCA 4FPLA 3IPVA 2D3SA 5GZCA 5JOZA 1W6MA 4FP2A 1LOFA 3C2UA 4YFWA 4YG6A 3FUQA 1LHVA 1ZA4A 1S0JA 2AREA 1V00A 3N3HA 4YW5A 4WVWA 1C1LA 1V6KA 2ZGRA 4LBNA 1XQNA 4PF5A 3R4UA 3OY8A 4XJ8A 3WG1A 2VW0A 3H0OA 4IQPA 1ULCA 2D7FA 4Y24A 4BM8A 2JDZA 5IUQA 5FREA 1FV3A 2ZHNA 4XMIA 2NMOA 3W58A 1CQ9A 2ZABA 2ZGTA 3B9CA 1G9BA 3ILRA 2DURA 1GNZA 3HR9A 4GWNA 1G86A 2AH2A 3KQRA 2P37A 1AJOA 1V6NA 2GMPA 3AZWA 1H9WA 4WV8A 3WDTA 2E51A 3FBYA 1HQLA 4FPHA 3RRDA 1QU0A 3AYCA 3IMNA 1UN1A 3BOPA 4ATEA 1ZM1A 2SLIA 4RL7A 3Q9OA 5SV8A 1Q8OA 3BIWE 1PZ9A 4AVTA 1W6PB 2ZHKA 1N1VA 5LK5A 1JW6A 2GMMA 1UKGA 2DWRA 2ES3A 4YM3A 2A71A 2Z42A 5H9QA 3AP7A 1AVBA 3N7KA 4Q2FA 5T5LA 1RIRA 4YGEA 3ZXKA 1S0GA 1Y7BA 1CJPA 4YZ3A 2P3KA 1W6OB 1V6OA 1LGBA 5HCFA 1UAIA 3UK9A 3ZYRA 3NV2A 5GLVA 4Q8KA 4XE9A 3RG0A 2W52A 4ASMB 3NV1A 4LBKA 4XHXA 5DUWA 5DZEA 2ZGOA 3LSEA 3RMYA 1N3OA 1QKQA 3WZ1A 3R4SA 4LBOA 3POSA 3FLTA 1G9AA 3SH5A 1G8WA 2A75A 3N7JA 1LENA 1IS3A 1Z78A 1S0FA 2EXJA 3ILFA 2UWCA 1LESA 1QMJA 4FPOB 2E6VA 3AZYA 3SH4A 5KXBA 1LEMA 3N7LA 3WDYA 2E53A 5JDBA 1G9CA 4XYXA 2NYYA 2WQZC 3OYWB 1MS4A 1TEIA 4R9CA 3V0BB 1YRZA 4JRAA 5GM0A 1RITA 1F9KA 1AX2A 4Q8LA 2D6NA 1PZ8A 1W6QB 3TB0A 1IKPA 4W65A 5GALA 5T50A 3HMYA 4CRQA 4PQ9A 3POYA 2DUOA 4Y20A 4FPFA 1QOOA 2JJ6A 3IPVB 4Q1PA 1YXWA 4YW2A 1SLBA 1W6MB 1EPWA 2ZGQA 3T1MA 1FV2A 1CPNA 4XBQA 3KM5A 4XJAA 1S0BA 4FQ4A 3T1LA 3IN9A 1X50A 3O12A 1KJLA 2WT1A 1SACA 3ZSMA 1YIFA 4YFZA 3OY8B 3WDXA 3ZXJA 3V65A 1SLIA 3FLRA 2PHFA 3OBTA 1MS0A 5H9PA 3VV1A 1CPMA 1LULA 3O0VA 2PHRA 4WZFA 3AFKA 2RHPA 2JKBA 2VXRA 1YYNA 3UL2A 4ISQA 4AVVA 2KM2A 3WNXA 1Q8QA 4M3CE 3AP6A 4XJUA 1FNYA 2ENRA 1RINA 2ZHLA 4M00A 4FOQA 4Y1VA 4ATFA 1FNZA 4LBMA 4DPNA 1G9FA 1DHKB 1DZQA 1HLCA 3D5OA 4K20A 4M3CF 4TZDA 4XOGA 5T54A 1DYPA 3NWKA 4FPEA 4JCKA 2VW1A 2EALA 3FFZA 1AX0A 2FHRA 3MPPG 4GALA 4UW5A 2BQPA 2ZGSA 3MEPA 3OPZA 4FOWA 2ZHMA 5T52A 3WLUA 4U2AA 1IS6A 4LBJA 1LODA 1W6QA 1FX5A 1F31A 2P3IA 3IKWA 2NZ9A 2W68A 2CY6A 1HKDA 1GKBA 3AXDA 2EXKA 3DGTA 5IK7A 2I2SA 4YZ1A 1AXKA 2ZGKA 1QGLA 2ARBA 4GXLA 4FQZA 1LOAA 2VH9A 3B00A 1GANA 2A6XA 2E7QA 1N1TA 1NXD1 4Y22A 1UZYA 1QNWA 5DZGA 3PVNA 1CR7A 1BKZA 3V0AA 1MS5A 4UW4A 2A5ZA 3RSJA 2TEPA 2AR6A 1SLLA 2AYHA 2ZZJA 4ITCA 5T55A 3FLPA 2EAKA 2DTWA 4YW4A 5AVAA 2A6WA 2W08A 4R9AA 4P9YA 1N1YA 4CZSA 3B3QE 3AP4A 4XIOA 2PHUA 2UURA 3WV6A 4H55A 1UMZA 3ZXFA 1C4RA 5EWSA 2P34A 1LU1A 3WUDA 3MW3A 2JE9A 3ZXLA 4XTMA 1KQRA 2WSUA 2GNTA 4Y1UA 4M01A 2OUJA 1QDOA 1SCSA 1MACA 1QOSA 3N7MA 5E8AA 2ZGUA 3UJOA 4BLIA 1UX6A 5F9TA 4M3CA 2GDFA 4XILA 3LCPA 1WCSA 4Y20B 3IM0A 1PZ7A 1LU2A 1W6NA 4FPGA 1DQ6A 3SITA 2A7AA 1WW4A 3ATGA 3QCWA 3AXEA 1OQ1A 2LALA 1URXA 2DVDA 2V5YA 1LTEA 2EIGA 5DUUA 5F5QA 1S0DA 4K1ZA 2XG3A 4Z8BA 4XIKA 1AZDA 1SLAA 3MW4A 2DVBA 2VUAA 4FPYA 1DQ5A 3WVJA 1IKQA 4UW6A 4BMBA 1LOGA 3TAYA 2JD4A 3NV4A 3B01A 2AUYA 1H30A 2A3YA 4XBLA 1DLLA 1G7YA 1LGCA 2D3PA 3WDWA 4AYUA 2R16A 3M3EA 1CN1A 2OVUA 2DU1A 3WOGA 1AXZA 3AYAA 2DUPA 4YM1A 1V6MA 2JE7A 1LOBA 3PVEA 2W39A 3WUCA 4YZ2A 5GLUA 1DBNA 2PHXA 4FOVA 5FRAA 3AK0A 4WVVA 2D6OX 1GZ9A 1JUIA 2R1BA 1KDMA 3INAA 3CNAA 1VLNA 4GKYA 4OZXA 1FYUA 1NLSA 1Q8SA 2UWBA 1GLHA 2YXSA 5DG2A 5EYYA 1WW5A 1WUVA 1O4ZA 4HL0A 1APNA 3AYEA 4Q27A 4DQAA 1ULGA 2A6VA 3ASIA 1HDKA 5KXDA 1ENSA 4I30A 4LBLA 4YGDA 2D43A 3DUIA 5EXOA 5IT6A 2CTVA 4XJ9A 1N1SA 3V64A 3M1HA 4XZPA 4Y22B 2NMNA 2A3WA 3ENRA 1QF3A 2YMZA 3OJBA 3V0AB 3M2MA 1N3PA 1MS9A 1Q8VA 1W0OA 4JC1A 3WDVA 2NM1A 4F83A 4XJWA 2ZMLA 2ZKNA 3N35A 2YROA 3ILNA 2EXHA 3PVOA 5CBLA 1A8DA 1BZWA 4GA9A 4Q1RA 4AGGA 1LHNA 2GNBA 3I8TA 2VU9A 1H9PA 1MZ6A 4UW3A 4AVSA 1GSLA 3POWA 1MS3A 2AGSA 1WD4A 4NOTA 1V6JA 2WT2A 3B69A 3AJZA 3ZSKA 4ZKTB 1LCLA 1ONAA 1DQ1A 2ZGLA 3JU9A 2D6PA 4MYEA 1C1FA 4YG0A 2FMDA 4TYSA 1WLCA 1R1ZA 4PBOA 3LSDA 1HQWA 2C5DA 3D6EA 1GV9A 2OW4A 3WG3A 4M3CB 1F5FA 1DYKA 2CWMA 1JHNA 3WDUA 2VY0A 4SLIA 5GZGA 1W6NB 4LBQD 1CONA 1I1EA 4LBQA 2UU8A 5GLWA 3AZXA 3A4UA 4KBBA 1SLTA 1WBFA 3RS6A 1AF9A 1ULDA 4GKXA 2JECA 4BPZA 2CL2A 3VKLA 1KDKA 1VIWB 1YI7A 3HN1A 4Y26A 1UZZA 3R05A 1J1TA 1BJQA 3AYDA 3OBRA 3WHTA 1QDCA 4XTPA 1SLCA 3NV3A 4R9BA 2P3JA 2GMEA 2ERFA 4FPKA 2D6KA 2YY1A 1GNHA 5GLZA 3ZSJA 1IOAA 1SFYA 1VAVA 1WLDA 4YGCA 3VKNA 4AGRA 1GZWA 2CYFA 4XDQA 3N36A 1WBLA 3QLQA 1WD3A 4XJZA 3ZVXA 3ZPYA 5IK5A 2PELA 1AJKA 2WKKA 1SCRA 1DQ0A 5CNAA 1GBGA 1BQPA 1BXHA 5H9RA 1N47A 1JYCA 2C9AA 3O5SA 1GICA 4BLJA 4R9DA 5L73A 4BOWA 1C57A 4P14A 2NP0A 1Z0HA 1MR5A 5DZFA 1KRIA 1D2SA 1WW6A 5GJ6A 3MW2A 4Y1YA 1ULFA 3SLIA 5EYXA 1JYIA 4XBNA 5CAZA 4PCRA 1IS4A 4FPCA 1A3KA 3AP5A 4YM2A 1SBFA 5GZFA 2D6LX 4YLZA 3APBA 3USUA 1LHWA 1D0HA 4K21A 1KITA 1LOEA 4U36A 4YZ4A 2R0HA 5JVVA 2CNAA 3O0XA 5E88A 1MVQA 1LHOA 4YW3A 2DUQA 5JOYA 1CVNA 2WJSA 3AX4A 2AENA 1OKQA 5GLTA 3WCSA 3VUOA 4YM0A 1U0AA 2ZMKA 2DVAA 1MS1A 2GNDA 5HCAA 1GZCA 5CB7A 4XXPA 5T5JA 1KJRA 2YV8A 2ZA9A 3GALA 3OGGA 3WHUA 2R0FA 2GALA 4Q26A 1JN2P 2GN3A 5DUVA 3FUOA 4DS0A 1I3HA 1CIWA 2H0BA 1VALA 1UL9A 5E89A 1JOJA 3AP9A 5JMCA 2YZ4A 5JLVA 1GYKA 2WT0A 3SNMA 1LHUA 1DGLA 2DV9A 2R1DA 1S0EA 3M3CA 4RA0A 3WG4A 4XHBA 4DFSA 2DVGA 1IS5A 2LTNA 5GZEA 3A0KA
chains in the Genus database with same CATH superfamily
2VUDA 2PHTA 2V4VA 1PVC2 2CAVA 2JG9A 1CAWB 2YPDA 4J25A 4QAWA 4WZCA 1REEA 5JOWA 3K46A 4LBQB 2BGCA 3BODA 4BMEA 2YHJA 3GXUA 4MSVA 2B7YA 1EY2A 2GN7A 3SXWA 4DEQA 5BYNA 5FY4A 4FO9A 1JXNA 2AC1A 2QQLA 1RUC2 4YZ5A 2ZXQA 2NQYA 2R061 3H50A 1NCQA 4JDMA 2D44A 4KGQA 1JODA 1L7LA 1Y3TA 2E7TA 2JG8B 4RHV2 4B7EA 4F7ZA 2ZGPA 3KZ4C 4Y3OA 5BXXA 4B8EA 2VOWA 4V1PA 5L7OC 3WP6A 3TEYA 1LR5A 3KB5A 2VVDA 3K2OA 3PIGA 4D69A 1W0PA 3HWJA 4C1XA 2A6ZA 1DIWA 3U4XA 4XETA 4D3WA 4SBVA 5A7OA 3E1F1 4JRLA 3M3OA 1JZ2A 2ARXA 3QACA 1JYXA 2VNRA 1SMVA 3J8F1 1LOFC 3R6SA 3SQOA 3M7AA 3AM2A 2R062 4MADA 3WXPA 4AW7A 3MUY1 1W90A 2QZ3A 3B93A 1FAYA 4DNYA 5C9AC 4AFAA 5FOJB 5LRSA 1HJGA 4NHKA 4YVWA 4DRVA 1BLZA 1LECA 4JDNA 4CTEA 3W59A 3NL1A 2ZACA 1K45A 3B5LB 5DG1A 1WA6X 3JZVA 1WCQA 4Q0SA 3ZXEA 5JWPA 1ENQA 2VJXA 2P6CA 4JDOA 1B09A 5CFDA 5C6CA 2HWC3 5M0TA 2VZPA 3DXUA 3MIBA 4IGOA 3VKMA 4CE8A 3VD7A 1CGPA 1VRH1 5JCTA 3PJQA 2WNEA 4BIOA 4E4DX 5FP4A 5CA6A 5FXXA 5T5PA 3KQ4B 1ZBE1 2W9XA 5FMOS 3S57A 4AHXA 1N3QA 3GCXA 4IE0A 4P9XA 2B39A 4TTGA 1G9DA 3RZKA 1MZFA 1QJY3 3UNPA 4NROA 5JZGB 5A3MA 3ZIWA 4CEWC 1JH5A 1R1A3 3KWVA 4L8QA 4ISRA 1TMF2 4PLMA 3O1SA 3VBUA 4AHZA 2HYKA 1QQP3 4UWDA 5C3PA 3V0BA 1KXGA 2ARCA 4AR2A 1OC1A 3RNSA 2DVFA 1NY72 1UU5A 4URTA 2ET7A 5SV5A 4UFHA 5FZ6A 2WAAA 2GNMA 4GULA 4CP2A 3SEPA 2W1QA 3IPVA 3HAGA 1ZX5A 2BV4A 4AFBA 5DN2A 4Q0UA 4YG6A 4QXCA 1LHVA 3VBRA 4NAOA 2AREA 5C7GA 1OMIA 1V00A 2FDFA 2ZGRA 1PGL2 1WWYA 3I2DA 3I2GA 3POEA 2J7MA 3OY8A 5FZLA 4WVMB 2YC4A 1WLTA 3WG1A 5DQ0A 1XSQA 1RUNA 3KV5A 1BK0A 2MEV3 2WYSA 3H0OA 4IQPA 4LMFA 1OQDA 5BNQA 3DECA 2RM22 3VHOA 2RS33 4HOOA 5C3SA 1FV3A 3DYOA 3K3OA 4XMIA 5TSWA 2NMOA 2B4KA 4V2WA 1WGPA 2ZEXA 4MXWB 3W58A 3CO2A 2ZGTA 5LZ6A 1G9BA 3JD73 4IGPA 3ILRA 2W0XA 2BYVE 2BVVA 3V56A 1HB2A 2GU9A 2P37A 3NJVA 3KGZA 4IEVA 2VMEA 2IWGB 3WDTA 4L2NA 1E5HA 5JSOA 1FOD3 1US3A 3PUIA 4ZU5A 1V9U1 3RRDA 1OH3A 3DPRB 4LHKA 5FYCA 4AQ6A 2JE8A 3T4VA 3IMNA 2GP3A 5FPAA 5FXVA 1RUJ2 4HMZA 2VXJA 1W2AX 3IMMA 1Y4WA 1Q8OA 4IV3B 1PZ9A 2Y34A 4PT6A 1SEFA 1UIJA 1ZZ6A 1RVF3 1VBB1 1XSRA 5KC5A 5LK5A 1JW6A 3UV9A 3E6BA 4AI2A 1R093 4AVBA 3AB0A 3R0RA 1K5MC 4LKEA 4IE6A 3ZN6B 3N7KA 4N8MA 2VZTA 4B3NA 4AI0A 1RIRA 3HPNA 1V9U2 4W4ZA 5LEKA 2P3KA 3OG2A 4TSVA 1LGBA 1GQPA 4KH9A 2WNVB 4XDOA 5AC93 1O3QA 4Q8KA 4AVCA 2QQIA 1RTVA 1NKGA 3NNMA 3NV1A 1AL0G 1VBB2 2VVEA 2ZGOA 3LSEA 3VBHC 1CJDA 4R52A 1CWPA 5FQ0B 1GOGA 2VBBA 4LBOA 3SH5A 2XJUA 4Q5OA 4LK7A 1NE4A 2VNOA 1IS3A 2EXJA 2UWCA 1JS9A 4PDWA 1LRHA 5JDBA 1DU3D 1B35A 1XJAA 2Z5WA 1MS4A 2D5FA 3OYWB 1HXS2 1YRZA 3U4SA 1AX2A 1VP6A 4W6YA 2WWJA 4XUPA 3H3ZA 5T50A 5CFCB 4Q4Y1 1NX9A 4PQ9A 3POYA 5BNNB 3H1MA 2VG9A 1XE8A 2WRAA 4UXAA 2QFEA 3Q8EA 5ABJC 2XUEA 3K4AA 1AHSA 4Q1PA 4YW2A 5LBCA 3C7EA 3BB6A 3VZJA 5A3NA 3ON7A 3KM5A 4LITA 1O6UA 1X50A 3ZYIB 1XU1A 4HONA 4YFZA 2W92A 2D40A 4NE9A 3V65A 3FLRA 1YUDA 4NPRA 2JB4A 5FAXA 4CPBD 3TN92 3O0VA 2PHRA 3MI8A 1W2OA 2JKBA 3LF7A 1YYNA 4OHVA 4Q0PA 5IVVA 1QWRA 1PO11 4K40A 4LO8A 3O1MA 3WNMA 4K9SA 1RUE3 2ENRA 4JVAA 4M00A 5JPMB 1FNZA 1G9FA 3UESA 4K20A 4XUTA 4BQ2A 3NWKA 3FHIB 4CCLA 1KFXL 4P02B 2BQPA 2LRPA 2K46A 2ZHMA 1C8M2 3WLUA 2Y6HA 4DMIA 1LODA 2VQAA 1W6QA 1P8JA 4IUGA 1HRV2 2Q1FA 1W99A 5I0UA 2OA2A 2JDYA 1GKBA 1VE0A 3H42B 4NHYA 3NQHA 3ZYBA 2DCTA 2VZVA 4QD2A 1QGLA 1TE1B 5A3OA 2JDKA 4INDA 4FQZA 3LPFA 4MGYE 1ZRIA 3VGIA 5ACA3 4QQ2A 4WM8A 4QPGA 3PU8A 4WM7C 2B42B 3UKVA 1ZBA3 4JGZB 3J7LA 5FJKA 1JI6A 2X10A 4CEYA 2HYXA 3V0AA 1AR81 1GR3A 4N43B 2WFF3 2A5ZA 2RS51 1CX1A 3E6DA 4AEMA 5D8AA 2TEPA 2AR6A 2W5FA 1COV3 2LROA 1SLLA 3BPSA 1RUF2 4GWIA 4ITCA 5FKBA 2EAKA 5AVAA 5FV3A 5T55A 1VBE1 1H8TB 5F32A 4P9YA 1WMXA 1W06A 2VUCA 4KQ7A 1HV1A 4XFBA 4AOCA 1EUTA 4LO5B 2PHUA 2UURA 2FCTA 4E4ZA 1OA3A 1QY4A 4YPJA 4JV4A 3ZXFA 2O0OA 3H3UA 1W04A 3E5QA 1W05A 4XQDA 3VBSA 1XXNA 4HXCA 4D0QA 4DO0A 5JOYA 1RHI3 5DDJ2 3CJIC 3N7MA 5IATA 2B5HA 1UOGA 1UX6A 2E32A 1XNAA 4XF9A 1OSGA 3CIHA 4M3CA 1XOYA 4XILA 2BNNA 2YGLA 5FZ4A 5DMYA 2YU2A 5DAXA 3OGRA 3IM0A 3F2ZA 1LU2A 3ZFEB 4FPGA 3WF2A 1WW4A 1RUI3 5KR7A 4OYUA 4HBNA 2DVDA 3K51A 3B9IA 4GMP0 3FZ3A 5HXMA 4A3ZA 3VDDB 2D97A 4XIKA 2JIGA 1J3QA 1BEV1 1OH4A 1QJU1 2J1EA 3MUZ1 2VC9A 4UI9L 1DQ5A 1BMV1 4UW6A 3MBWA 4N53C 4NIAA 3MYXA 1ASJ1 3OEAA 5C3OA 3NV4A 1DYOA 2RDSA 1H30A 1OKOA 2A3YA 5FZ9A 5C4WA 2XVLA 1LGCA 2HEWF 4AYUA 3PVBB 2R16A 4GB31 1HRI1 1ND2B 2ATFA 4AI3A 2XJVA 5CISA 2XQXA 4LUMA 1V6MA 5L9RA 1LOBA 4OQ8A 4YZ2A 1DBNA 2PHXA 2WLPA 2BBVA 1WKYA 2R1BA 4KI5M 4I0WB 1C8NA 2FDIA 1BMV2 1OD5A 2WS91 2XPJA 4OZXA 1J83A 4Y33A 3AMNA 1R081 5DG2A 3O1UA 2GP5A 4JGYA 2QUOA 3VBOC 1APNA 3AYEA 4GB32 4Q27A 2BGOA 1HDKA 3AKPA 2PAEA 1IG3A 2P1BA 1F15A 3ASIA 2YFUA 2XLAA 5CYYA 5FBZA 4I30A 2IFWA 5EXOA 2Q8EA 1NQDA 1RL3A 1N1SA 3ACHA 2DCYA 3HBZA 1TME3 1VBA2 1IPJA 2C0ZA 5KWRA 2A3WA 2ZJCA 3ENRA 2Y0IA 4JHZA 4BLIA 3E5UA 5FY8A 1D4M1 3NNLA 1R082 2VPVA 1H2LA 1T2XA 3M2MA 4X6RB 1RUD2 1X8EA 4AZZA 4JC1A 5BNPC 4XJWA 2ZMLA 5F2WA 1S2KA 4Q0VA 4COZA 4XFFA 2EA7A 1J84A 1WCUA 3KHBA 4PI0A 4ZS3A 2FDJA 2GNBA 3IDBB 2RE9A 4CCMA 4AVSA 3POWA 3T2QA 4NOTA 5BNOC 1GOFA 1V6JA 3B69A 5FP9A 3ZSKA 1PO23 4D94A 4QDRA 5F2SA 3UKTA 3I3EA 5JXHA 5J48A 4CDQB 4RQPC 3VDAA 1STMA 2RR12 3UT0A 3I59A 2HWE3 1R1ZA 1HX6A 4PBOA 4WBBA 3WR0A 3D6EA 2ZEZA 4AI1A 2OW4A 1VBD3 1U12A 3WG3A 5AFBA 4Q4V1 2VD7A 1CAWA 5F1RA 5CG8A 3WDUA 3ZR6A 1W6NB 2K9ZA 1I1EA 4LBQA 1XB9A 2VZRA 4OI2A 1SLTA 2Z4FA 4W6WA 3ZKUA 4QX5A 1ULDA 2FCUA 2R043 2JECA 1J3RA 3H9AA 4XZUG 4BPZA 3IBMA 4GD4A 4CDUB 1YI7A 5LA2A 2LS6A 4ZY9A 2JG8A 2A73B 4AK3A 1IG0A 3RDIA 1SLCA 2VMFA 1J58A 4ZPIA 3H1YA 2ERFA 1HQNA 1W9YA 2D6KA 2YY1A 4NN0A 3BVCA 1HJFA 3PNAA 4LA3A 4XQWA 3ZSJA 4AGRA 2CYFA 1JZ3A 2VMCA 1WD3A 3GBWA 4XJZA 3ZPYA 5K0UB 1W9FA 2WKKA 5FZMA 2RDQA 2JG9C 4B4RA 5H9RA 1N47A 5C3RA 4YVSC 4C0BA 2OIIA 1H1IA 2VZ3A 2ZX1A 4FAGA 4BLJA 4UBGA 4P14A 1Z0HA 5DZFA 2B9VA 1D2SA 5A6YA 4Y1YA 4GH4B 1X9PA 1NCQC 1W8ZA 1A3KA 3WNNA 1YQ8A 2D5HA 2YC0A 3APBA 2XHNA 5A1FA 2H6CA 4RR3B 4HN1A 4YZ4A 1KITA 3BCWA 5JVVA 3VL9A 1UOJA 2CGNA 1W2TA 1K12A 4QKBA 3SCHA 5E88A 4CCOA 1MVQA 5FPUA 3SC7X 2O8OA 3AX4A 2J1SA 5F3GA 1AR72 2AENA 5FY5A 5JXJA 2PLV3 3I3MA 2ZEYA 3PLQA 3VBFB 2V5DA 1U0AA 2ZMKA 4JQTA 4B1LA 4Y4YA 4QX7A 2DVAA 4HVOA 4QX1A 5JZGA 2WUHA 4XXPA 2XBO2 1KJRA 2YV8A 5T5JA 3TOJA 1OFNA 2VAUA 5A3WA 1JUHA 1JHJA 4YVWC 3T0BA 4A7YA 3Q8CA 4DS0A 3J7MA 1HV0A 4AFMA 5A3PA 4H7LA 4HPKB 5JMCA 2YZ4A 1VBC2 4LO7A 4IV1B 2QTWB 3T2PA 5LW9A 5FTTC 3AFGA 3ZFGB 2DV9A 5CFDC 5FUIA 1GU3A 3WG4A 4XHBA 1O3SA 4LHLA 3GHMA 4DFSA 5A7SA 4A3XA 4HKOA 4FTEA 4OVEA 1EUUA 1DZRA 3OEBA 4A45A 4HKLA 1PIV1 4A41A 5CG9A 3JBG2 5GZDA 2BDRA 4OULA 3BU0A 1ZZ8A 4PLNA 1YO8A 1BBT3 4MZUA 4ZONA 3UKNA 3VZLA 1XNKA 2IZWA 2GC3A 2P4EA 3L2YA 4WVMA 4NVPA 1PMIA 3BTAA 3AL6A 2Q8DA 2RMU2 4HG6B 3U10A 2ZAAA 4Q4X2 3VBUC 1W8NA 2R7EB 2D6MA 2X53S 3PUAA 3W20A 3VKOA 1MS8A 1AX1A 3PMEA 4FT8A 4A7ZA 2G4IA 2HWF1 2HEYF 4MXWA 2XKPA 4PI2A 4DY3A 5IK8A 4Z92B 3RZMA 1W8FA 3GZEA 4EWDA 3GNEA 5FPLA 5F3CA 5HV0A 3KCCA 4YW1A 2ZS6B 3OOXA 1WLWA 4CXWA 1UZWA 4HANA 3WY6A 4N90A 3WCRA 2BVBA 1IHMA 5L7OB 2VTXA 2XONA 3H7YA 5FK8A 5FYYA 3DPRA 4CDXB 3VBRC 1RMU2 2WBKA 3WG2A 2J1TA 4P9GA 3T0DA 2PAMA 3LKJA 4IV3A 4AAXA 1A34A 3U11A 1EV13 4P9JA 1SBEA 2BRTA 2UYAA 1UZ0A 1W8HA 2CWSA 3WNKA 3MIGA 1OLME 2WWSA 2HWB3 1DZTA 4FPJA 5L9BA 1AYM1 2IXHA 3ZN6A 4XUOA 4EN9B 4E2GA 5FO8B 2EXIA 1QOTA 1SPPB 4CSWA 3ACLA 3USUB 4AGVA 4EROA 1BYHA 1O8PA 5CU1A 5FUPA 3VKFC 2WNVA 3SISA 3T2TA 1SZBA 1W3XA 3GM8A 1X36A 3AMHA 1FMD1 4IDZA 3SEEA 4CDWB 3NVCA 4Y5TA 3UJQA 4YWAA 3TYJA 3JUUA 5FQ0A 4FP3A 4GWMA 1DQ4A 1AL21 1ALYA 3ZYPA 1S0CA 3ZFFB 1RUH1 1ENRA 2P2KA 2LM3A 2VM9A 3AJYA 4XMAA 1QJZA 3FMGA 1MVEA 2I45A 2DFCA 3ELNA 2C24A 1CESA 2XB6C 2JDMA 3OYWA 3K48A 3IB3A 4Q4W2 2XHKA 1YCIA 3ZPOA 4LEJA 1AR61 5CFCA 3DCQA 1BK1A 3O1TA 3SCFA 3OD0A 1I6XA 4EN7B 2XVKA 4DXZA 1W39A 5JOXA 5BNNA 2WLQA 5DXDA 2HH9A 3T09A 4I0AA 1UY2A 5T3NA 3BKZA 3NO8A 3WNLA 5D21A 1WA4A 4META 2WIIB 4HK9A 1WCDJ 5FY1A 5FZCA 2QQVA 4Z1VA 1F8VA 3IIAA 2E63A 1FPN2 4YW5A 1CAVB 3GZTB 3S30A 3ACIA 4PF5A 4P9IA 2PFWA 1GNYA 2TNFA 2W94A 2QNKA 4CUGA 4MO3M 2VW0A 4AEDB 1GUIA 4BDVB 1B35C 3NNFA 1IGOA 1MEC2 5FKCA 2JDZA 4BM8A 1PK6C 1SFPA 4DEVA 1CIYA 2ZHNA 1Y43B 3HIFA 2IUWA 3A22A 3B9CA 4OHXA 5FZKA 2F4LA 2DURA 3LD8A 3BTZA 3LEIA 1OA4A 2AH2A 1WMEA 3KS7A 2GMPA 3N9MA 4E2SA 3AZWA 1TG7A 2B9UA 2E51A 2WZR3 1JTZX 1QJEA 4M0HA 5JI9A 1HQLA 4QB2A 2Y38A 4B1MA 4A2UA 3BOPA 1F4AA 4ATEA 2QQWA 4RL7A 3J7NA 4AVTA 1QJX2 4G9SB 2Y26A 5HV4A 1N1VA 1CZSA 2GMMA 4I02A 4IE7A 2QQOA 2ES3A 1PVXA 5EV7A 5FYIA 3CZUA 3N9NA 4HLTA 1OOPC 4AE2A 2H0VA 4QWNA 5T5LA 3VLBB 4OLLA 4YGEA 4JGZA 5FYMA 3ZXKA 4EE2A 1CJPA 4QHZA 4MGKE 2J1AA 1UAIA 4N43A 1W03A 5CKQA 1SQ4A 1K5MB 5IW0A 3ZYRA 3O1PA 1PVC3 3NMBA 3RG0A 1GOHA 5IJRA 2BP6A 2Z79A 1N3OA 2GH8A 2RS12 3I49A 1H8TA 3WZ1A 5BY5A 3HD8B 5FY9A 3AKQA 2X5IB 1EPZA 3K4ZA 2VNGA 4AI9A 1RUC3 1S0FA 4TXWA 1LESA 1VMFA 4FPOB 4LXLA 3WDYA 1OXCA 1U5ZA 4RHV3 2NYYA 4LHNA 4P5YA 4JRAA 5GM0A 2D6NA 2FDGA 4GWJA 4XF4A 1IKPA 1KFUL 1UY1A 3HN3A 5GALA 4WM8C 5FZDA 4QPGC 2Z2SB 1UIKA 4QGLA 4Z2WA 4QU2A 2QJVA 1JYNA 4CVUA 3MIFA 1TZOA 3D8CA 2K0GA 4QMAA 5J1XA 4PHZA 4CEYC 4XCBA 3HEIA 1YXWA 3ZFEA 1SLBA 3A23A 3WNOA 4CYDA 2Q0AA 4GIQA 2RG4A 1QXRA 2ZGQA 3T1MA 1QH7A 1W9SA 5D8AC 1CPNA 3G7DA 1I5PA 4UAPA 1SFNA 1PNGA 3QBQA 5ABJB 3IN9A 4RGAA 5KHJA 2I07B 3G6JB 3VDDA 4KWUA 3GZUC 3ZSMA 1KD7A 1YC61 2VMHA 3WQBA 3J8F2 3ZXJA 2HWC1 3M4FA 1SLIA 3BPZA 4XCAA 3VDBA 2PHFA 1C3HA 1OVSA 2VL4A 1D0GA 3ZX7A 3FWEA 5H9PA 2MPFA 5JXGA 4DIQA 2PQSA 5C5UA 4IGQA 2CHHA 4OUEA 3VBSC 4RS5C 3ZDSA 4CPBA 2RHPA 2VXRA 4KMQA 4AXOA 2W3JA 1ND2A 4D6SA 2XDVA 3KV9A 4I3GA 4AVVA 2BWAA 4V2VA 5A7QA 1E57A 4DPNA 1QJY1 1X8MA 4QXKA 3UETA 1R1A1 5T54A 4UFLA 1C5HA 1DYPA 3ZN5A 3FFZA 1AX0A 1K5JA 3HOBA 3WQ0A 1QQP1 1ODMA 2JEMA 4U2AA 1IS6A 1VRH2 2GC2A 1TMF3 1FX5A 1F31A 2D93A 3IKWA 5F5IA 2VQUA 3NJYA 4FXKB 5LA1A 3CDZB 3GCWA 1ZBE2 2FBEA 4RFT0 1AXKA 2IXJA 2LUWA 2ZGKA 4DOUA 4YZ1A 1QJY2 4GXLA 4PIXA 3T0AA 1UOBA 5F3EA 2A6XA 3ZMOA 1NXD1 5C4WC 1JU3A 2QZ2A 4X6QB 2J1UA 2ZX0A 3QH7A 4JAAA 1QNWA 1S2EA 4B4PA 2XQRA 5LBFA 4BXFA 3KHCA 3LEGA 1L7RA 3N9QA 5A32B 1MS5A 4BHPA 4CU6A 1SG3A 3KVBA 4HVRA 1NCRB 4TLGA 3RSJA 5K9YA 2VR4A 2MEV1 2AYHA 2ZZJA 3Q8AA 1H2MA 4YW4A 2A6WA 4R9AA 2WA4A 3WW2A 3RGBA 5FYZA 3B3QE 1TVGA 1EAH1 4JGYC 4M4RA 1DGRA 2VCAA 3JD71 5HXVA 2RM23 3RFRA 2JDPA 3O14A 3ZM8A 2Q30A 5KHHA 5EWSA 1JZ6A 1ZRDA 5C3QA 3RZHA 3WUDA 4CDQA 5JXIA 3ZXLA 1FOD1 3LA7A 3MLJA 4LTAA 2ETEA 1KQRA 4XTMA 3ZYJB 5J36A 4M01A 2OUJA 1QDOA 5E8AA 3DV8A 5FR3A 2VOVA 1WMFA 3I2KA 2VTFA 2GDFA 1UYZA 4Y20B 4MGZE 3POBA 4YYOA 1W6NA 3SITA 1EAH2 2F4PA 1UXZA 3AXEA 1RUJ3 2RDRA 2AACA 1AYN3 3L2HA 5FYSA 1PMJX 5J09A 1R091 2WFPA 4QPIB 5DUUA 3O7OA 4K1ZA 4CDUA 3URFA 4Z8BA 4JHTA 4COUA 1AZDA 1SLAA 1VAKA 3LA3A 3ZIXA 2DVBA 5DPNA 4G3YC 3KD4A 2WQ4A 4BMBA 4DXTA 1LOGA 3I2IA 4LO6B 4R4ZA 2YU1A 1XU2A 2JD4A 5EP9A 3VL8A 3I2JA 3ZN4A 1H8VA 1M4WA 3BYWA 1REDA 3HT2A 4H3WA 4LE3A 1OI6A 4R4XA 3M3EA 1CN1A 3KV4A 1IQAA 4N53B 1W2NA 1NA1C 2QCSB 5K0UA 3WX5A 1L7QA 4KNCA 5HBAA 3IDEA 3AK0A 4AEJA 1JUIA 1KDMA 2JDHA 3INAA 4COVA 4FBFA 3VD9A 1HB3A 2GZWA 1GQGA 3CNAA 4R8HA 5FK7A 3NKTA 5I8SA 4GKYA 3MIEA 1FYUA 1NLSA 1PM4A 1GLHA 2YXSA 5F3IA 1QHDA 1L3JA 4A6OA 1WUVA 4GH4A 4AVAA 4ZZ8A 4DQAA 1ULGA 3MZHA 1HXS3 3HNBM 3T08A 1ENSA 1O4TA 2JG8C 2BFUL 4YGDA 1JOBA 4AQTA 2D43A 3DUIA 3I3DA 3VBOB 4RR3A 2OKXA 4RGGA 3M1HA 4CU8A 3LA2A 4F3JA 2WZPP 3WEZA 2WQ8A 2KXLA 4HETA 3GYDA 2WN2A 4JKKA 3VBFA 1ND3B 2YBSA 1N3PA 3H8UA 4RN5A 4UFMA 1Q8VA 1W0OA 1GP6A 3P1IA 2DDUA 1CX4A 2NM1A 4IEXA 4MGIE 4Q4Y2 1W0NA 4D6RA 4NPMA 2ZKNA 1OF4A 4EWAA 4XACA 2BJSA 3CL1A 1LHNA 4MGQA 2G9ZA 1H9PA 1MZ6A 4UW3A 2MHFA 2AGSA 3LOBA 3OPTA 4HFSA 1RUE1 2WT2A 1H6YA 3AVRA 3TN93 4CP9B 2BZDA 1IZ3A 1W8OA 3CF6E 4IV1A 2VVFA 4ZKTB 1ONAA 1ZZCA 2RV9A 2KD7A 2O1QA 3K4DA 3ZFGA 1YQCA 3MF9A 2R6QA 3JU9A 4K3UA 1UY3A 1VMJA 2VZSA 1KS4A 3EO6A 3AMQA 4TYSA 1WLCA 4O61A 4UFJA 4YG0A 3KSCA 1VPHA 4C90A 4RSUA 2QQJA 1GV9A 3AVSA 4FSJA 1F5FA 4OI1A 1JHNA 2IXCA 1C8M3 2XLFA 1VB4A 3RWNA 2UU8A 3NNGA 3TBDA 2QQPA 3A4UA 3OGSA 1PO12 2OXBA 5JZGC 3WNPA 1EP0A 2B8MA 1HRV3 4OUSA 5ACA1 4ARXA 5FZOB 3VKLA 5LATA 1KDKA 1VIWB 4RGKA 3USSA 3EJKA 4I01A 4OHZA 3M8LA 3C7GA 1ZBA1 1W9WA 4Y26A 1UZZA 1BJQA 1H4HA 3AYDA 2WO1A 3PL0A 1MPXA 2WFF1 3RYRA 3WHTA 3C7FA 1D2QA 5K8SA 2P3JA 2GMEA 1COV1 4JKMA 1GNHA 5A3LA 2JKXA 4XDQA 4CUBA 3TEWA 1CAUB 3N36A 5L7OA 3GDBA 3LAGA 5AVPA 5DDJ3 3EB7A 4CDXA 1JYVA 1LB2A 5D1IA 4A6SA 1RUF3 2JDNA 4DXSA 1DQ0A 1UOFA 1UY0A 1BQPA 1ZA7A 3LPGA 3TRSB 5A70A 1JYCA 1RXFA 2ZPXA 3NAPC 3O5SA 1GICA 4R9DA 5L73A 1KRIA 1DP0A 4HVQA 1Z7S3 5I0DA 3VDCA 1AR82 2HBTA 3MW2A 1RHI1 2I74A 2RS52 4Q0QA 4YVSB 4QXBA 3SKVA 4JX0A 4PCRA 4MX3A 1VBE2 1SPPA 4KU7A 4YLZA 4NRPA 1AR93 3USUA 4NPLA 4OCTA 3ZR5A 4G4FA 1D0HA 1RUI1 1NCQB 2BTVC 2R0HA 2CNAA 4AHYA 4YW3A 3MO4A 1NLQA 2W95A 1POV3 1CVNA 2OQ6A 4CDWA 1UMHA 3WCSA 5GKAC 3FX3A 4L0PA 1GP5A 3FJSA 4YM0A 3S7EA 2BU9A 3EHKA 2QQKA 3DPRC 5LK7B 4QKNA 3ZFFA 3LDKA 5HCAA 5FY7A 5IVCA 4E9KA 5CB7A 5DAWA 2BNOA 5LY2A 2ZA9A 4OMCA 2WDBA 2R0FA 2GALA 5EFUA 2GN3A 3NRUA 1OURA 2BUKA 2YUEA 1I3HA 5FLHA 3BTYA 3JXSA 5DAPA 1JOJA 2B45X 3D0JA 3IZOA 4O9GA 4EN8B 1X9TA 5JLVA 2WT0A 1LHUA 2G1MA 3TWIA 3PUQA 1XNTA 1DGLA 1NUKA 3U75A 3WP5A 5IVBA 1JZ7A 1BEV2 1QJU2 1S0EA 2CDOA 4MGSA 3ST7A 2WN3A 2WNUB 5LBBA 3LZZA 3A0KA 4IE5A 1ASJ2 4QGNA 3IDCB 1CAVA 5FZFA 2O14A 2K2SA 4MOAA 4E4HA 1HRI2 3RI8A 1NT0A 3I4IA 5EPAA 2JD9A 2Y33A 4QB6A 4DRRA 1X33A 2Y6JA 4AEDA 1Q56A 2JDUA 1TME1 2ZX4A 4YW7A 1AXYA 1KS5A 4EN6B 4OQ9A 4IL7A 5JAXA 2WS92 3SCGA 4CCEA 5C33A 1VBA3 5CFCC 5JSRA 4E27A 2OYZA 2DBIA 3ETPA 4I0BA 3K75B 4QPYA 4XDPA 1OFSA 1R083 3ZXGA 5IVFA 2RJ2A 1YJLA 1GZWB 1QXJA 4QKDA 1RUD3 1U5YA 2NN8A 4HSLA 1V6IA 2WWUA 3CJXA 4W6XA 4L9BA 2SBAA 1XNBA 3PTYA 2PHWA 5JIAA 5F5AA 1GWMA 1WW7A 5C8CB 1YIPA 4BQ1A 1PO21 1V70A 5KXEA 2Q5TA 5K4LA 1D4M2 2Q4SA 3Q8FA 4BWOA 3VD4A 5KHIA 3SKJE 1MZ5A 2HWE1 1ZREA 1O91A 2A6YA 1ZRFA 4C1WA 4GMP3 1FXZA 1K42A 1VBD1 4O9EA 3L9JT 5FP3A 3N9OA 1OF3A 4P9WA 1J3PA 3TNQA 2RR13 3FC0A 2XJTA 5JPNB 1UNBA 3ITQA 3AZZA 1GZTA 1K5MA 4E2QA 2JX9A 3VD5A 1JOPA 2YG0A 4Y1XA 5FP8A 2R041 1QXPA 1ZVFA 2Y6GA 4K7JA 4QB1A 2WSVA 3KF5A 1VAMA 4JTOA 1HW5A 3X29B 4FVVA 3P3PA 2X5IA 3OUHA 3RMXA 5FO9B 3S5QA 3MF6A 2ZGNA 3KT7A 4K1YA 4EZ4A 1ODNA 4Q4V2 2VW2A 2DF7A 4AWDA 3RZZA 1LEDA 1H6XA 1UZVA 3H3LA 1FATA 1LOCA 1DQ2A 4P08A 2ZGMA 1UO9A 4NIGA 3RJRA 5H9SA 5F5CA 4XUNA 5I93A 1JBCA 3VZNA 5EJ1B 4JGZC 2R49A 5JI7A 5KBFA 2DYCA 3C3VA 5B2GB 2EAAA 2D3SA 5F6KA 5GZCA 3U0ZA 4FP2A 3UGFA 2JB8A 1A8MA 1ZA4A 3UYJA 4BQ3A 3N3HA 5ABJA 2B46X 4LBNA 2BW8A 1XQNA 1H8TC 3GBFA 2E33A 1HB4A 2EVXA 3A7QA 1YI9A 3I2HA 1D7PM 3MGUA 5EZWA 2UY8A 4N7IA 1OLMA 4EN0A 3LE0A 5IUQA 1ZZ7A 5FREA 3W9AA 4ES9A 5A7WB 3ROUA 1QH6A 1M06G 2HBUA 3LDBA 2Z69A 2R071 1AR73 3HR9A 4XFIA 2OQ7A 4GWNA 1PK6B 4UYBA 3HVDA 4L11A 1V6NA 1H9WA 2VZ1A 3FFQA 3ZFEC 5JR7B 2XR4A 3RWKX 5A7PA 4FPHA 3LDRA 1QU0A 4DINB 2RJLA 2XBO3 1S2BA 1GMMA 1ZM1A 4IEOA 5DABA 2JENA 4A44A 1GWKA 4OUMA 5SV8A 4E8DA 4EV0A 3TNPB 3BIWE 2ZX2A 1W6PB 3THPA 2ZHKA 4ET7A 4DUVA 5FMCA 5JUVA 1UKGA 4ONUA 4YM3A 3DXTA 2R072 2A71A 2Z42A 5H9QA 1D4VB 1RYYA 1VBC3 3AP7A 3JB4C 1S4CA 1AVBA 2XOMA 5ANQA 2PXJA 3LEMA 1MQTB 4JQRA 1S0GA 1ND2C 1Y7BA 1YQ6A 4YZ3A 1SDWA 1OOPB 1BBT1 1W6OB 1RGSA 5A32A 1RUG1 2YYOA 3UK9A 1PHMA 3P3NA 1NCRA 3NV2A 3DEMA 5GLVA 3CU7A 4XE9A 3GJBA 3HQUA 3JBG3 1H4GA 4LBKA 4BK5A 5DUWA 2R30A 1JU4A 4D7SA 2QDNA 2VCMA 1QKQA 3Q8BA 4FFFA 1RXGA 2MNGA 3R4SA 1HIXA 3POSA 3FLTA 1G9AA 1W28A 1F35A 2FMYA 3D3AA 2RMU3 1C28A 2XJQA 4Q4X3 4OHYA 3SH4A 2E6VA 3AZYA 5LRRA 1A6CA 1LEMA 1PIV2 4XYXA 3POGA 1TEIA 4R9CA 4MHRA 1RUG2 4OMDA 3K77A 3OBAA 3OTFA 5DAVA 1W6QB 1OBNA 4W65A 5FUNA 4NIDA 4AI8A 3HMYA 4LK6A 5LCWL 1DCSA 4CRQA 2BFUS 3W5MA 4GZ9A 2X09A 3FBMA 4Y20A 1QOOA 1PGSA 1UCXA 4S2GA 1EV11 5A7NA 1W6MB 1RMU3 2HWF2 3J9SA 5FCCA 4I3PA 3WF3A 1GP4A 4LPLA 4XBQA 4E4SA 2ZOEB 4QQHA 1S0BA 3JCIA 4QPIA 3T1LA 4CCKA 3O12A 1SACA 5C9AB 2ARAA 3T3YA 3THCA 3B02A 2X8KA 2HWD3 1RB8G 3U14A 4MV2A 3FHAA 3OF1A 2L9LA 2ET1A 3OBTA 1MS0A 1E5RA 3VV1A 1CPMA 4M4PA 3ES1A 4Z82A 4WZFA 3MDPA 5FDBA 3AFKA 1OD3A 2R32A 3RYKA 4CDQC 4N53A 3UL2A 3BUCA 1Q8QA 2Y6FA 3I54A 4XJUA 1FNYA 3ZO0B 1RINA 4ATFA 4FOQA 2AEYA 4RS5B 4IE4A 4LBMA 5B4XA 3VBSB 4BU2A 1DZQA 1AYM2 3H8XA 4XOGA 3LFMA 2ILMA 4FPEA 4JCKA 1RJ8A 2VW1A 2IC1A 3FE5A 4GALA 4UW5A 4YNIA 5T52A 2C26A 4FOWA 3H1WA 1UF2C 4XVHA 5BUVA 4K6BA 3MPBA 1TNRA 1PGW1 4ASLA 4CEWB 3LOIA 1FMD2 4BJ0A 2GSYA 2W68A 5FZGA 1XNCA 4DXRA 5C8WA 2EXKA 1DG6A 3BALA 3DGTA 4GAZA 1OT5A 2I2SA 4Q4W3 4QHOA 2PYTA 5FZ0A 3VBOA 1AL22 1LOAA 1RUH2 2QKDA 2ZKLA 3B00A 3E5XA 1N1TA 1DF0A 1UZYA 1YJKA 2EIDA 3NNJA 5F8PA 5CZKA 1DDLA 2YPJA 3CZJA 3PVNA 3ZYFA 1IPSA 1BKZA 1ND3A 3KCYA 4LHSA 3IIIA 2YGMA 5FYBA 1FPN3 1AR62 2E9QA 2W1WA 4NIIA 3AKRA 4LLOA 4PDWC 3IWZA 2W08A 4CXXA 3WT3A 1N1YA 4CZSA 2QVSB 3N4MA 2FDHA 3S7IA 3AP4A 3TEXA 3EBRA 3HQXA 5E1RA 1MEC3 4CP9A 4KWJA 2G19A 3MIDA 5JR2A 1C4RA 4PLOA 1ULPA 1W8UA 1LU1A 4HZFA 2WZR1 1WCKA 5EHDA 4Z2AA 1XC6A 4UF0B 3NW4A 2Y64A 1SCSA 1MACA 1QOSA 2J42A 2ZGUA 3NJZA 4BB3A 2VOXA 2QE3A 2CV6A 3RI9A 1UQXA 1FT9A 4CP0A 1WCSA 5FPZA 4QX2A 1T6GC 1PZ7A 1TNFA 2Y60A 4QM9A 1DQ6A 3I7DA 3QCWA 4XAEA 4COWA 5A33B 1URXA 1O7FA 5K7PA 3KMHA 1QJX3 1LTEA 1YWKA 3DYPA 5HI0A 5F39A 4NAMA 5F5QA 5FZOA 3S0MA 3RZJA 1UX7A 2XG3A 3MLLA 3AMMA 4MG2A 1ENXA 2OZJA 4X8NA 4XUQA 2VUAA 1GFF2 2W47A 1PNFA 3E97A 3WVJA 2VE1A 4EZHA 5IHRA 3TAYA 4BYYA 3ZYHA 2ADDA 4IV1C 3B01A 2AUYA 1PVC1 1H2NA 1DLLA 2D3PA 2Y6LA 3SMHA 3ZFGC 2VOTA 3BOWA 1O59A 2OVUA 1CAUA 2DU1A 4X8PA 3AYAA 3WOGA 2JE7A 1YFYA 3PVEA 2W39A 1RUC1 5LB6A 3FHQA 4FOVA 1Y9QA 1DGWA 1REFA 2RS13 4N7UA 2IVJA 1YFUA 3VHPA 3VBHB 1NA1B 4RHV1 4F8AA 2XUMA 1OLQA 4OI4A 1VLNA 2GC0A 2OPKA 5EYYA 2UWBA 2YC2A 4AEKA 2FQPA 2DCJA 3I3BA 3WF1A 1WW5A 3CEWA 2QQMA 1O4ZA 3ETQA 4YVSA 4BQYA 1H0BA 5FYVA 1C5IA 4LORA 2A6VA 2IXLA 1NZIA 5KXDA 1JMUB 1RC6A 3VZKA 3F95A 2E31A 3MLKA 2YBPA 2J22A 4FFGA 5IAXA 2VULA 2C9KA 4KWLA 2HEVF 4LKSA 4XZPA 2R063 4Y22B 1POQA 3PU3A 2WZ8A 1QF3A 3ZMNA 1MZEA 2BOIA 3D82A 2BWCA 2YMZA 5KHGA 3OJBA 5IAVA 2VGDA 4XAAA 3J4UH 4CDXC 2GH2A 1MS9A 2XJRA 2W1UA 3DKWA 1UD1A 4M0NA 4QM8A 3W5NA 2WC2A 2BEOA 2PHDA 4F83A 2OS2A 3N35A 1YQ5A 2YROA 2ZCWA 3ILNA 3PVOA 4PF1A 5BV6A 1BZWA 3J8F3 4GA9A 4Q1RA 5G05L 3I8TA 5CBLA 1GSLA 2ZX3A 3CKHA 2ZTNA 4CXYA 4IEWA 2VMIA 1DQ1A 1F2NA 2VCCA 2ZGLA 3LEKA 5F7UA 1UKRA 4D7YA 4MYEA 1LKNA 1C1FA 1BVVA 4ZU7A 4LT5A 2FMDA 2WO7A 1KEXA 2HWC2 2WNUA 1HQWA 2C5DA 4CDWC 1QIQA 1TMF1 1DYKA 2VY0A 3PTRB 3PURA 1CONA 1W9TA 3M70A 5FMBA 3ZXDA 3GGLA 4XEZA 4KBBA 1VRH3 3ZFFC 1WBFA 2Y0OA 1NY71 3ZDVA 3RS6A 1AF9A 4GKXA 4QGMA 4S2HA 1JZ4A 2CL2A 4J6GA 5E16A 1XBFA 4LQRA 3CLPA 1R1A2 1ZBE3 3HN1A 5FBJA 1XPWA 4FTSA 1SDDB 1QQP2 3ES4A 1UYPA 3OBRA 4UFIA 1JZ8A 1QDCA 4XTPA 2FCVA 3NV3A 5I0TA 4R9BA 4WM7B 1UYXA 1PGL1 5EIYB 1HN0A 2PA7A 5GLZA 2X05A 1WLDA 1SFYA 3A21A 1NAEA 3I3QA 1GZWA 1SHWB 3QLQA 5IK5A 2QDRA 2RS31 4OI0A 1AJKA 1E5SA 5J7MA 1SCRA 5CNAA 4TLFA 1BXHA 2RM21 5C8CA 4NR1A 2QBXA 4LR4A 4BOWA 3B94A 3LWCA 3ORJA 3VHRA 1UWWA 4BA6A 4D6QA 3KF3A 1Q43A 5GJ6A 4CCJA 4NRQA 1ZNPA 3EQEA 3GF6A 5EYXA 4AEDC 3NAPB 4XBNA 5CAZA 4AQSA 2MEV2 1IS4A 4O7XA 3AP5A 2VCBA 3U78A 3AC0A 2YDEA 3SHRA 1VB2A 2RS32 1O3TA 5FFOC 1YFWA 4K21A 4U36A 3U1XA 1RVF1 2CAUA 1RUJ1 2XGXA 3CJIB 1AYN1 3JD72 3O0XA 2VMDA 5FZEA 1OUSA 2XWBB 4JTNA 4L99A 4LA2A 5F37A 3VN4A 4DY5A 1EAH3 2WO3A 3I2OA 3VUOA 4B29A 5C5TA 3J26N 1FOD2 3KT1A 1MS1A 4FI9A 5FO7B 2J1RA 2GNDA 1NYWA 1RJ7A 1G6NA 2VZUA 4CU7A 3W21A 3PUHA 3OGGA 2PN5A 1H1MA 2VZQA 4XQ4A 3WHUA 5AC91 1ZZ9A 1JN2P 1GQHA 1V9U3 2YFZA 1RVF2 4CA9A 1AYN2 1TQ5A 1VALA 2VBDA 3OB8A 2J1VA 1R092 2HLEA 3QH6A 4XFAA 3SNMA 1VBB3 4NHLA 2R1DA 2PQQA 3M3CA 3GHNA 2PMWB 2VMGA 5L19A 5ISLA 4FTBA 3WW3A 5DAQA 1FI2A 2DVGA 2UYBA 2LTNA 3CMGA 2DCKA 5AC92 1DFQA 1XRUA 2ID4A 3D4KA 2ZMNA 4GJYA 2P3YA 4PIZA 3ZYGA 5I91A 3KLSA 4OZOA 5IVJA 2OZ6A 3O0WA 4IEZA 1LJ7A 4XF3A 1HXS1 3HT1A 4KL1A 5I0RA 2VTXJ 5CEHA 2X5IC 4WVZA 4IEYA 4QX3A 5T5OA 2XL7A 4QX0A 2V73A 5FXWA 4RFRB 4NUBA 5KXCA 5L9VA 1K3IA 2VECA 4CUCA 2DU0A 2JXAA 4IETA 5IFTA 2EF6A 3BU7A 3POIA 4LOSA 4TWTA 5A7WA 3AKSA 4YGBA 2BNMA 4FFIA 5FMDA 1O4YA 4MXVA 2DCZA 1PK6A 5HCHA 3C7HA 2BGPA 1QJFA 1SBDA 1UPSA 1XNDA 3FL7A 4PBPA 5FYUA 1OLRA 1Q8PA 2UWAA 5HCBA 3RZGA 2P17A 3AZVA 1LGNA 4Q4Y3 1CZTA 4YG3A 4BISA 5FYTA 3A0NA 2OUHA 2G9GA 5BNPB 3TN91 1S0IA 3VHNA 4YSFA 1V6LA 2D3RA 4J1WA 3ZOIA 4HPKA 4ZZ5A 1W6PA 2YB7A 2ZBJA 3KT4A 5A1LA 2A1XA 1QNYA 1UY4A 3B7MA 5FZ1A 3OD4A 3M3QA 2A70A 5DUXA 5EQUA 1S1AA 1WMDA 4NO4A 4XXAA 4DUWA 5BNOB 3EYPA 1MQTA 5LY1A 3IT8A 1E5IA 2Q8OA 1A78A 1PX3A 5FP7A 2DBNA 2XKOA 3MFAA 2DTYA 4RQPB 1H2KA 1OOPA 1C8M1 1W6OA 4HN0A 3T4HB 3WW4A 4AAPA 1POV0 3HQRA 5G04L 4Y1ZA 1UMIA 4K8FA 4S2FA 3N9PA 1RUE2 1YNAA 1HRV1 4FOYA 5A80A 5KC6A 4ZU4A 3RQ0A 1ZRRA 1Y9MA 1PO13 1PM7A 4HK8A 2A3XA 5IK4A 5J96B 2V72A 3SH3A 4XW3A 1CAXB 4XF1A 5LA9A 1I9RA 5CKNA 3MIHA 1JYWA 3UGGA 4JZRA 5FZBA 2ZEWA 2EIBA 3HNMA 5DDJ1 4CP1A 4C8DA 5ACA2 1RUF1 5I8YA 1ULEA 3ZSLA 1XYOA 4DZGA 4W50A 2WINB 4ZXKA 3C8XA 4FPLA 3THDA 5JOZA 1ZBA2 3HJRA 1W6MA 1Z7S1 5FLJA 2OPWA 1LOFA 1NCRC 1NXMA 3C2UA 4HT1T 4YFWA 2WFF2 3FUQA 3ALQA 1S0JA 1F4HA 4XPVA 5FY0A 2JIJA 2JG9B 4WVWA 1C1LA 1COV2 1UU6A 1V6KA 3I97A 4HKWA 2VO5A 5C9AA 3DL3A 3R4UA 1AR83 4LJHA 1O3RA 2VUJA 3QD6A 4XFGA 2RS53 4EYUA 4UOJA 4XJ8A 1AR91 4CCCA 2HJIA 3BTXA 1HB1A 1VBE3 3LIGA 2OX0A 1ULCA 1WZXA 3PIJA 1POV1 1UU4A 2CU5A 2D7FA 4Y24A 1Z7S2 5FPXA 1CQ9A 2ZABA 2LW8A 3ABZA 3EXUA 1RHI2 4W8JA 1GNZA 3ACFA 3WP4A 3NJXA 4RS5A 1W3VA 2NPIA 3AKTA 1G86A 3KQRA 1RUOA 2BERA 1AJOA 3IAPA 4LKFA 2VZOA 4WV8A 5ERLA 3VD3A 4IV3C 1AR92 1Q5OA 3FBYA 4P00B 4Q29A 3AYCA 3OGJA 4BZ4A 1O5UA 2W2IA 4MGTA 1RUI2 1UN1A 5CIRA 2WL1A 3VZOA 4QPIC 4COYA 5IWFA 4BK4A 2SLIA 4QQPA 3Q9OA 2BBAA 2WAOA 4LIUA 4CEWA 3GJAA 1HN1A 1Q3EA 4RD7A 5FZ3A 3RYPA 4YVWB 3T30A 2DWRA 4EJRA 4P5HA 2WNVC 5F6LB 5JMOA 4Q2FA 1ZRCA 1BEV3 1QJU3 4TN7A 4QQLA 3NSTA 1U5XA 2Y8KA 4Z07A 5CFDB 2CGPA 1V6OA 5CVRA 2HKXA 5HCFA 4XFHA 4KG0A 1ASJ3 2UY9A 4FCAA 5HPOA 2WA3A 3PHMA 2W52A 4N9IA 3OBZA 5FPBA 4XHXA 4IEQA 4H2AA 4ASMB 4BXSV 5DZEA 2F17A 3PDQA 4GB33 1HRI3 4Y5Z0 4N9HA 3RMYA 3PUSA 5A6QA 1T6BX 4BH9A 3CHXA 3BGAA 1ST8A 1G8WA 2A75A 2PTMA 3N7JA 4MHUA 1LENA 1VBA1 1Z78A 3ILFA 4NJ4A 2GAUA 3DF0A 1QMJA 2F6BA 5JIUA 5KXBA 5LBEA 2VBPA 3N7LA 1G9CA 2E53A 3VBUB 2G9FA 3WD5A 1ACCA 2WQZC 2WS93 3V0BB 2D98A 3D0SA 4JKLA 1RITA 4KWKA 4PIYA 5FZAA 1F9KA 4Q8LA 5BNNC 1PZ8A 2AZ5A 2IXIA 4ZXEA 3TB0A 1RUD1 2XXZA 4UF0A 5LA0A 3R4DB 1DGRN 3BI3A 5FIXA 4BQWA 1TME2 2DUOA 1O8SA 2EIEA 3ZSEA 4FPFA 2JJ6A 3IPVB 3PJYA 4H7MA 3O1RA 1OPOA 1ND3C 2NLRA 1XYNA 4KBZA 5A33A 2QQUA 4AL9A 5FYHA 1YQ2A 1EPWA 4B7KA 1FV2A 3VBRB 2V4AA 4XJAA 4FQ4A 4GMP1 1KJLA 4NWVA 2WT1A 1D4M3 4BQXA 4XFCA 1YIFA 3OUIA 4LUKA 2RR11 3OY8B 1S55A 3WDXA 4EQVA 2IVIB 2X29A 4L92A 2V09A 4NMIA 2RJKA 5I8TA 1LULA 5FLIA 4NRMA 1PO22 1XE0A 4LO4B 3DKQA 4C91A 2FDKA 4GQ7A 4ISQA 3BN6A 5FOBB 2KM2A 5FMOL 3WNXA 4M3CE 3AP6A 4Y1VA 4BQ4A 1QEXA 2ZHLA 2HWE2 2Q1MA 4PJYA 1DHKB 1HLCA 1OVPA 1PX4A 1J1LA 3D5OA 1VBD2 3M3IA 4M3CF 4E8CA 5B4NA 5LWBA 4TZDA 3VBHA 3MPPG 2EALA 4P9LA 1NA1A 2FHRA 4MUVA 1NG0A 2ZGSA 3MEPA 3OPZA 2C6SA 5C70A 4QDQA 1H1AA 4ES8A 4LBJA 4IEPA 4Q4V3 2P3IA 5D2AA 2R042 5FXZA 2NZ9A 4AQ2A 2CY6A 2H6BA 1HKDA 4MH0E 2P6HA 3AXDA 4A4AA 5IK7A 1UYYA 1YLLA 3RJ2X 5I0SA 2IFRA 2ARBA 3MV11 3O1VA 4OFGA 2VH9A 4N43C 4I2OA 1GANA 2E7QA 4Y22A 1NOVA 1XE7A 4IERA 5DZGA 4ZHNA 2W91A 1CR7A 3POFA 3TEZA 4UW4A 2OT7A 2XH6A 5A6XA 4LOTA 2YBKA 4OHWA 3FLPA 2DTWA 1Y9GA 5BPXA 4I09A 5A3UA 2WNOA 5L36A 1OA2A 4XIOA 2PLV1 4BIFA 3H8OA 4H14A 4PDWB 2KR2A 3H7JA 3WV6A 4DUXA 1OUXA 4H55A 3E6CC 1AR71 1UMZA 3I2FA 3DN7A 1B35B 2FD8A 1IQDC 4KG8A 2P34A 5J98B 4FFHA 3WINE 4BQ5A 5IVEA 3MW3A 2JE9A 4K8RB 2WSUA 5FWEA 2GNTA 3OGVA 4Y1UA 4MVTA 4XF0A 3S5AA 4CU9A 1W8TA 3UJOA 2WO2A 2XBO1 3FN9A 3MHZA 4QT6A 5F9TA 4QDSA 3LCPA 1EYBA 2WABA 1CZVA 3VDDC 4EWEA 1VRBA 2A7AA 3ATGA 2PLV2 4NHXA 5EJZB 3UGHA 1OQ1A 2AEZA 2LALA 1U5IA 4RYDA 1VBC1 2V5YA 2EIGA 2KA3A 1S0DA 2FZ1A 3ZKYA 1VR3A 3MW4A 5FZIA 1LNSA 4FPYA 2R073 4LLFA 1ULOA 2IXKA 2BPA2 1IKQA 2Y6KA 3GZAA 4IW3A 3JB8A 4QU1A 1BCXA 5LEJA 1UPIA 2ZZQA 4AFCA 4WM7A 3JBG1 4XBLA 1AUYA 1G7YA 2RVAA 3J7HA 3P6BA 4XURA 3WDWA 2VQTA 5AFEA 3H8RA 5LASA 3BIEA 4CCNA 5FZ7A 4A42A 1W2UA 4CCDA 5FZHA 1DLCA 4NIHA 1V0AA 1AXZA 2WNUC 2DUPA 4YM1A 3WUCA 2WR9A 2RMU1 5GLUA 2TUNA 5FRAA 3RVHA 4Q4X1 3LQCA 4WVVA 5J37A 2D6OX 1GZ9A 3ZXAC 1X82A 4LKDA 2GC1A 5IYYA 3WQ7A 3T2OA 4NWWA 1BBT2 1Q8SA 4J1XA 2XLGA 5CADA 5IVYA 3AL5A 3HBKA 1PIV3 3JQWA 3NAPA 4HL0A 2WYFA 1UXXX 4QQOA 3WF4A 1RUG3 2VQ0A 4LBLA 3AMPA 3MICA 4AF9A 5IT6A 4KU8A 5KHKA 3U07A 2CTVA 4XJ9A 3V64A 1RMU1 4AFDA 4Y4RA 3CJIA 1OHFA 4WM8B 3MV01 4QPGB 1NE6A 2NMNA 2W87A 2HWB1 1BVP1 2CSGA 2HWF3 2E7AA 4QXHA 1O5LA 1W8WA 4CEYB 2Q1ZB 3V0AB 3WF0A 3ECQA 5D8AB 2HWD1 2WZEA 3HNYM 4XABA 3WDVA 2W46A 5C8CC 3GBGA 2O8QA 3MFCA 1LAJA 4XC9A 4QX8A 4ORFA 2EXHA 1A8DA 4O65A 4AGGA 1EV12 2VU9A 4ZS2A 1NZCA 3LFIA 4UT5A 1MS3A 1WD4A 3OSDA 1GWLA 1CD3G 3AJZA 3VZMA 2HWB2 1VMHA 1LCLA 3JQXA 3VB9A 2XWJB 5EJ3A 5FWJA 5FZ8A 2QQNA 2D6PA 1NQJA 2HWD2 4L97A 3LSDA 1JYTA 1AYM3 4A7KA 1JZ5A 4M3CB 2CWMA 3KV6A 4HSJA 4AHWA 2Q8CA 1DGWX 4CDUC 4SLIA 4B4QA 4LBQD 4ASKA 2ORZA 5GZGA 4LE4A 4Q4W1 4QPWA 5GLWA 3AZXA 3C7OA 3IAQA 3OCPA 2C1FA 3KGLA 1UW8A 3ME2A 1ZYBA 1FMD3 3WQ1A 4Y5SA 5CKMA 1OQEA 1US2A 1BHGA 1KGYA 4KGGA 1X7NA 4YARA 1AL23 3R05A 1J1TA 1RUH3 4LNVA 3ZLIA 3CQOA 4D7TA 2ORXA 1OPMA 1PGW2 4LIVA 1VJ2A 1FPN1 2N7GA 5K0UC 5C4WB 3WW1A 4FPKA 1IOAA 1VAVA 3VKNA 4YGCA 2BOJA 1WBLA 1AR63 2ADEA 3ZVXA 3K3NA 2XJPA 3QOPA 4YW6A 2PELA 3ACGA 4IEUA 1XYPA 4PQQA 1YHFA 3WP3A 3THTA 1GBGA 5BNPA 3EMRA 1IPKA 4GH4C 1MEC1 3KCXA 4FAHA 4UBHA 2C9AA 3DYMA 3KVAA 4FXGB 2CGOA 1R64A 3RZLA 1C57A 5ANNA 2NP0A 1MR5A 5A3TA 1I5ZA 2XVGA 1NLRA 1WW6A 4LULA 3LIHA 3LGRA 4UFKA 2EICA 2JWPA 4JGYB 4RR3C 1ULFA 2W1SA 3SLIA 2PAKA 4C0HA 5BNOA 5IFPA 1JYIA 2RDNA 3POJA 4YM2A 4FPCA 3O1OA 5APAA 1SBFA 3PMSA 5GZFA 2P5BA 1F5JA 2D6LX 4RQPA 3WSOA 1LHWA 3VBFC 1LOEA 2XMLA 4ARYA 3U37A 5JSPA 1LHOA 2DUQA 1QJX1 2WJSA 3LB9A 5GLTA 1OKQA 4CUAA 5A6ZA 4IESA 3P5BA 4D8MA 1YFXA 2WZR2 2ZAHA 2C4XA 2JDAA 5FJHA 4NHMA 4QHBA 4IXLA 4URAA 1PMHX 5FPVA 2VNVA 1GZCA 1J59A 1ZZBA 2CDPA 4DB5A 1CAXA 3GALA 3OUJA 1YEWA 2VOKA 5J3UA 2E26A 4Q26A 5DUVA 3FUOA 3N9LA 4QKFA 1CIWA 2JICA 2H0BA 2TBVA 3OPWA 1UL9A 4GJZA 5E89A 3S6PA 3AP9A 2PHLA 1GYKA 1MQTC 2DFBA 5E6HA 3RPQA 4BCUA 4BE3A 2XJSA 2RS11 3NKGA 4MLOA 3IDAA 5C71A 4RA0A 4AG4A 4S2DA 3I59B 2XL9A 3CBNA 1IS5A 2FZ2A 5GZEA 4YRDA 5A1AA
chains in the Genus database with same CATH topology
2PHTA 1PVC2 2CAVA 2JG9A 1CAWB 4WZCA 1REEA 5JOWA 4LBQB 2BGCA 3BODA 4BMEA 2YHJA 4MSVA 2B7YA 1EY2A 2GN7A 3SXWA 5BYNA 4FO9A 1JXNA 1RUC2 4YZ5A 3H50A 2NQYA 2R061 1NCQA 4JDMA 2D44A 4KGQA 1Y3TA 2E7TA 2JG8B 4F7ZA 4RHV2 4B7EA 2ZGPA 3KZ4C 5BXXA 4B8EA 2VOWA 4V1PA 5L7OC 3WP6A 1LR5A 3KB5A 2VVDA 4D69A 1W0PA 3HWJA 4C1XA 2A6ZA 1DIWA 3U4XA 4XETA 4D3WA 4SBVA 4JRLA 3M3OA 2ARXA 3QACA 2VNRA 1SMVA 3J8F1 1LOFC 3R6SA 3M7AA 3AM2A 2R062 3WXPA 4AW7A 2QZ3A 3B93A 1FAYA 4DNYA 5C9AC 4AFAA 5FOJB 5LRSA 4YVWA 4NHKA 4DRVA 1LECA 4JDNA 4CTEA 3W59A 3NL1A 2ZACA 3B5LB 5DG1A 3JZVA 4Q0SA 3ZXEA 5JWPA 1ENQA 4JDOA 5CFDA 1B09A 5C6CA 2HWC3 3MIBA 1CGPA 3VKMA 1VRH1 5JCTA 3PJQA 2WNEA 4BIOA 4E4DX 5CA6A 5T5PA 1ZBE1 5FMOS 4AHXA 1N3QA 4P9XA 2B39A 1G9DA 1MZFA 1QJY3 5JZGB 5A3MA 3ZIWA 4CEWC 1JH5A 1R1A3 4L8QA 4ISRA 1TMF2 4PLMA 3VBUA 4AHZA 2HYKA 1QQP3 3V0BA 1KXGA 3RNSA 2DVFA 1NY72 1UU5A 4URTA 2ET7A 5SV5A 2GNMA 4GULA 4CP2A 3IPVA 3HAGA 1ZX5A 4AFBA 4Q0UA 4YG6A 1LHVA 3VBRA 2AREA 1OMIA 1V00A 2ZGRA 1PGL2 3I2DA 3OY8A 4WVMB 1WLTA 3WG1A 1RUNA 2MEV3 3H0OA 4IQPA 1OQDA 5BNQA 2RM22 3VHOA 2RS33 1FV3A 4XMIA 5TSWA 2NMOA 3ZMNA 1WGPA 4MXWB 3W58A 3CO2A 2ZGTA 1G9BA 3JD73 3ILRA 2W0XA 2BYVE 2BVVA 3V56A 2GU9A 2P37A 3KGZA 4IEVA 2IWGB 3WDTA 4L2NA 5JSOA 1FOD3 4ZU5A 1V9U1 3RRDA 4LHKA 3DPRB 4AQ6A 3IMNA 1RUJ2 4HMZA 1Q8OA 4IV3B 1PZ9A 1SEFA 1UIJA 1ZZ6A 1RVF3 1VBB1 5KC5A 5LK5A 1JW6A 3UV9A 3E6BA 4AI2A 1R093 4AVBA 3AB0A 3R0RA 1K5MC 3ZN6B 3N7KA 4B3NA 4AI0A 1RIRA 1V9U2 5LEKA 2P3KA 4TSVA 1LGBA 4KH9A 2WNVB 5AC93 1O3QA 4Q8KA 4AVCA 1RTVA 3NV1A 1AL0G 1VBB2 2VVEA 2ZGOA 3LSEA 3VBHC 1CJDA 4R52A 5FQ0B 4LBOA 3SH5A 2XJUA 1NE4A 2VNOA 1IS3A 2EXJA 2UWCA 4PDWA 1LRHA 5JDBA 1DU3D 1B35A 2Z5WA 1MS4A 2D5FA 3OYWB 1HXS2 1YRZA 1AX2A 1VP6A 4W6YA 3H3ZA 5T50A 5CFCB 4Q4Y1 4PQ9A 3POYA 5BNNB 3H1MA 2VG9A 1XE8A 4UXAA 2QFEA 5ABJC 4Q1PA 1AHSA 4YW2A 3BB6A 3VZJA 3KM5A 1X50A 3ZYIB 1XU1A 4YFZA 2D40A 3V65A 3FLRA 1YUDA 4NPRA 5FAXA 3TN92 3O0VA 2PHRA 3MI8A 2JKBA 1YYNA 4OHVA 4Q0PA 1QWRA 1PO11 4K40A 4LO8A 4K9SA 1RUE3 2ENRA 4JVAA 4M00A 5JPMB 1FNZA 1G9FA 4K20A 3NWKA 3FHIB 1KFXL 2BQPA 2ZHMA 1C8M2 3WLUA 4DMIA 1LODA 2VQAA 1W6QA 1HRV2 5I0UA 2OA2A 1GKBA 2DCTA 4QD2A 1QGLA 1TE1B 4MGYE 4INDA 4FQZA 3VGIA 5ACA3 4QQ2A 4WM8A 4QPGA 4WM7C 2B42B 3UKVA 1ZBA3 4JGZB 4CEYA 3V0AA 1AR81 1GR3A 4N43B 2WFF3 2A5ZA 2RS51 3E6DA 4AEMA 5D8AA 2TEPA 2AR6A 5DDJ2 1COV3 1SLLA 1RUF2 4ITCA 5T55A 2EAKA 5AVAA 1VBE1 1H8TB 4P9YA 4KQ7A 1HV1A 4XFBA 4LO5B 2PHUA 2UURA 4E4ZA 1OA3A 1QY4A 4JV4A 3ZXFA 2O0OA 3H3UA 3E5QA 3VBSA 4XQDA 1XXNA 1RHI3 3CJIC 3N7MA 2B5HA 4BLIA 1UX6A 4XF9A 1OSGA 4M3CA 4XILA 2BNNA 2YGLA 3IM0A 1LU2A 3ZFEB 4FPGA 1WW4A 1RUI3 4HBNA 2DVDA 3K51A 3B9IA 4GMP0 3FZ3A 3VDDB 2D97A 4XIKA 1J3QA 1BEV1 1QJU1 1DQ5A 1BMV1 4UW6A 4N53C 3MYXA 1ASJ1 3NV4A 1H30A 2A3YA 5C4WA 2XVLA 1LGCA 2HEWF 4AYUA 3PVBB 2R16A 4GB31 1HRI1 1ND2B 2ATFA 4AI3A 2XJVA 4LUMA 1V6MA 1LOBA 4YZ2A 1DBNA 2PHXA 2WLPA 2BBVA 2R1BA 4I0WB 1C8NA 1BMV2 1OD5A 2WS91 2XPJA 4OZXA 5DG2A 3AMNA 1R081 4JGYA 2QUOA 3VBOC 1APNA 3AYEA 4GB32 4Q27A 3ASIA 1HDKA 3AKPA 2PAEA 5FBZA 2XLAA 4I30A 2IFWA 5EXOA 1NQDA 1RL3A 1N1SA 2DCYA 3HBZA 1TME3 1VBA2 1IPJA 2C0ZA 5KWRA 2A3WA 2ZJCA 3ENRA 2Y0IA 3E5UA 1D4M1 1R082 2VPVA 1H2LA 3M2MA 4X6RB 1RUD2 1X8EA 4JC1A 5BNPC 4XJWA 2ZMLA 1S2KA 4Q0VA 4COZA 4XFFA 2EA7A 2GNBA 3IDBB 2RE9A 4AVSA 3POWA 4NOTA 5BNOC 1V6JA 3B69A 3ZSKA 1PO23 4D94A 3UKTA 5J48A 4CDQB 4RQPC 2RR12 3I59A 2HWE3 1R1ZA 1HX6A 4PBOA 4WBBA 3WR0A 3D6EA 4AI1A 2OW4A 1VBD3 1U12A 3WG3A 5AFBA 4Q4V1 1CAWA 5F1RA 5CG8A 3WDUA 1W6NB 2K9ZA 1I1EA 4LBQA 4OI2A 1SLTA 4W6WA 4QX5A 1ULDA 2R043 2JECA 1J3RA 3H9AA 4BPZA 3IBMA 4CDUB 1YI7A 2JG8A 2A73B 3RDIA 1SLCA 1J58A 3H1YA 2ERFA 1HQNA 2D6KA 2YY1A 4NN0A 4XQWA 4AGRA 3PNAA 4LA3A 3ZSJA 2CYFA 3GBWA 1WD3A 4XJZA 3ZPYA 5K0UB 2WKKA 2JG9C 4B4RA 5H9RA 1N47A 4YVSC 4C0BA 2OIIA 1H1IA 2ZX1A 4FAGA 4BLJA 4UBGA 4P14A 1Z0HA 5DZFA 1D2SA 4Y1YA 4GH4B 1NCQC 1A3KA 2D5HA 2YC0A 3APBA 2H6CA 4RR3B 4HN1A 4YZ4A 1KITA 3BCWA 5JVVA 3VL9A 2CGNA 3SCHA 5E88A 1MVQA 2O8OA 3AX4A 1AR72 2AENA 2PLV3 3PLQA 3VBFB 1U0AA 2ZMKA 4Y4YA 2DVAA 4HVOA 5JZGA 4XXPA 2XBO2 1KJRA 2YV8A 5T5JA 3TOJA 1OFNA 1JUHA 4YVWC 4A7YA 4DS0A 1HV0A 4AFMA 4H7LA 4HPKB 5JMCA 2YZ4A 1VBC2 4LO7A 4IV1B 5FTTC 3AFGA 3ZFGB 2DV9A 5CFDC 3WG4A 4XHBA 1O3SA 4LHLA 3GHMA 4DFSA 4A3XA 4HKOA 4FTEA 4OVEA 1DZRA 4HKLA 1PIV1 3JBG2 5GZDA 4OULA 1ZZ8A 4PLNA 1YO8A 1BBT3 4MZUA 3UKNA 3VZLA 1XNKA 2IZWA 2GC3A 3L2YA 4WVMA 4NVPA 1PMIA 3BTAA 2RMU2 3U10A 2ZAAA 4Q4X2 3VBUC 2D6MA 2X53S 3VKOA 1MS8A 1AX1A 3PMEA 4FT8A 4A7ZA 2G4IA 2HWF1 2HEYF 4MXWA 2XKPA 4DY3A 5IK8A 4Z92B 4EWDA 3GNEA 3KCCA 4YW1A 2ZS6B 1WLWA 4HANA 3WY6A 4N90A 3WCRA 2BVBA 1IHMA 5L7OB 4CDXB 3H7YA 3DPRA 3VBRC 1RMU2 3WG2A 4P9GA 2PAMA 3LKJA 4IV3A 3U11A 1EV13 4P9JA 1SBEA 2UYAA 2CWSA 3MIGA 2WWSA 2HWB3 1DZTA 4FPJA 1AYM1 2IXHA 3ZN6A 4EN9B 5FO8B 4E2GA 2EXIA 1QOTA 3ACLA 3USUB 4AGVA 4EROA 1BYHA 5CU1A 3VKFC 2WNVA 3SISA 3T2TA 1X36A 3AMHA 1FMD1 4CDWB 3NVCA 3UJQA 3TYJA 3JUUA 5FQ0A 4FP3A 4GWMA 1DQ4A 1AL21 1ALYA 3ZYPA 1S0CA 3ZFFB 1RUH1 1ENRA 2P2KA 2LM3A 3AJYA 4XMAA 1QJZA 3FMGA 1MVEA 2I45A 2DFCA 3ELNA 1CESA 2XB6C 3OYWA 3K48A 4Q4W2 2XHKA 1YCIA 4LEJA 1AR61 5CFCA 1BK1A 3SCFA 3OD0A 1I6XA 4EN7B 2XVKA 4DXZA 1W39A 5JOXA 5BNNA 2WLQA 5DXDA 4I0AA 5T3NA 3NO8A 5J96B 1WA4A 4META 2WIIB 4HK9A 1WCDJ 1F8VA 4Z1VA 3IIAA 2E63A 1FPN2 4YW5A 1CAVB 3GZTB 3S30A 4PF5A 4P9IA 2PFWA 2TNFA 2QNKA 2VW0A 4AEDB 1B35C 1IGOA 1MEC2 4BM8A 2JDZA 1PK6C 2ZHNA 1Y43B 3HIFA 3B9CA 4OHXA 2DURA 1OA4A 2AH2A 1WMEA 3KS7A 2GMPA 4E2SA 3AZWA 2WZR3 2B9UA 2E51A 5JI9A 1JTZX 4M0HA 1HQLA 2Y38A 4A2UA 3BOPA 4ATEA 4RL7A 4AVTA 1QJX2 4G9SB 2Y26A 1N1VA 2GMMA 4I02A 5EV7A 2ES3A 1PVXA 4HLTA 1OOPC 4AE2A 2H0VA 5T5LA 3VLBB 4OLLA 4YGEA 4JGZA 3ZXKA 1CJPA 4MGKE 4N43A 1UAIA 1SQ4A 1K5MB 3ZYRA 1PVC3 3RG0A 2Z79A 1N3OA 2GH8A 2RS12 1H8TA 3WZ1A 5BY5A 3HD8B 3AKQA 2X5IB 1EPZA 2VNGA 1RUC3 1S0FA 1LESA 4FPOB 3WDYA 1U5ZA 4RHV3 2NYYA 4LHNA 4JRAA 5GM0A 2D6NA 4XF4A 1IKPA 1KFUL 5GALA 4WM8C 4QPGC 2Z2SB 1UIKA 4QGLA 4Z2WA 4QU2A 2QJVA 3MIFA 3D8CA 2K0GA 4QMAA 4CEYC 3ZFEA 1YXWA 1SLBA 4CYDA 2Q0AA 4GIQA 1QXRA 2ZGQA 3T1MA 1QH7A 5D8AC 1CPNA 3G7DA 1SFNA 1PNGA 3QBQA 5ABJB 3IN9A 4RGAA 5KHJA 2I07B 3G6JB 3VDDA 3ZSMA 3GZUC 1KD7A 2VMHA 3J8F2 3ZXJA 2HWC1 3M4FA 1SLIA 3BPZA 2PHFA 1C3HA 3ZX7A 1D0GA 3FWEA 5H9PA 2MPFA 3VBSC 4RS5C 3ZDSA 2RHPA 2VXRA 4AXOA 1ND2A 4I3GA 4AVVA 2BWAA 1E57A 4DPNA 1QJY1 1X8MA 4QXKA 1R1A1 5T54A 1C5HA 1DYPA 3ZN5A 3FFZA 1AX0A 3WQ0A 1QQP1 2JEMA 4U2AA 1IS6A 1VRH2 2GC2A 1TMF3 1FX5A 1F31A 2D93A 3IKWA 4FXKB 1ZBE2 2FBEA 4RFT0 1AXKA 2IXJA 2LUWA 2ZGKA 4DOUA 4YZ1A 1QJY2 4GXLA 4PIXA 3ZMOA 2A6XA 5C4WC 1NXD1 2QZ2A 4X6QB 2ZX0A 3QH7A 4JAAA 1QNWA 4B4PA 5A32B 1MS5A 4BHPA 4HVRA 1NCRB 3RSJA 5K9YA 2MEV1 2AYHA 2ZZJA 1H2MA 4YW4A 2A6WA 4R9AA 2WA4A 3WW2A 3B3QE 1EAH1 4JGYC 1DGRA 3JD71 5HXVA 2RM23 3O14A 2Q30A 5KHHA 5EWSA 1ZRDA 3WUDA 4CDQA 3ZXLA 1FOD1 3LA7A 3MLJA 4LTAA 2ETEA 1KQRA 4XTMA 3ZYJB 5J36A 4M01A 2OUJA 1QDOA 5E8AA 3DV8A 2VOVA 1WMFA 2GDFA 4Y20B 4MGZE 4YYOA 1W6NA 3SITA 1EAH2 2F4PA 3AXEA 1RUJ3 1AYN3 3L2HA 5J09A 1R091 2WFPA 4QPIB 5DUUA 3O7OA 4K1ZA 4CDUA 3URFA 4Z8BA 4COUA 1AZDA 1SLAA 1VAKA 3LA3A 3ZIXA 2DVBA 4G3YC 3KD4A 2WQ4A 4BMBA 1LOGA 4R4ZA 4LO6B 1XU2A 2JD4A 3VL8A 3ZN4A 1H8VA 1M4WA 1REDA 3HT2A 4H3WA 4LE3A 1OI6A 4R4XA 3M3EA 1CN1A 4N53B 1IQAA 1NA1C 2QCSB 5K0UA 3WX5A 4KNCA 5HBAA 3IDEA 3AK0A 4AEJA 1JUIA 1KDMA 3INAA 4COVA 4FBFA 2GZWA 1GQGA 3CNAA 4R8HA 5I8SA 3NKTA 4GKYA 3MIEA 1FYUA 1NLSA 2YXSA 1GLHA 1QHDA 1L3JA 1WUVA 4GH4A 4AVAA 4DQAA 1ULGA 3MZHA 1HXS3 1ENSA 1O4TA 2JG8C 2BFUL 4YGDA 4AQTA 2D43A 3DUIA 3VBOB 4RR3A 4RGGA 3M1HA 3LA2A 4F3JA 2WZPP 2KXLA 4HETA 3GYDA 3VBFA 1ND3B 1N3PA 3H8UA 1Q8VA 1W0OA 4IEXA 4Q4Y2 1CX4A 2NM1A 4MGIE 2ZKNA 4EWAA 3CL1A 1LHNA 1H9PA 1MZ6A 4UW3A 2MHFA 2AGSA 3LOBA 4HFSA 3TN93 1RUE1 2WT2A 4ZKTB 4IV1A 1IZ3A 3CF6E 2VVFA 1ONAA 1ZZCA 2O1QA 3ZFGA 3MF9A