3NV4A

Crystal structure of human galectin-9 c-terminal crd in complex with sialyllactose
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
136
Chain Sequence
HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 32
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv4A00
1N3OA 2OW4A 2WT2A 1GYKA 3IPVB 4Y26A 5H9RA 3T2TA 1LENA 1S0GA 4BMBA 1LOAA 2A6VA 2ZACA 1LHVA 5T5LA 3SLIA 4ATFA 4FQ4A 3ZSKA 2ARBA 4LBQB 2A75A 2R0FA 4M3CE 4XYXA 1YI7A 5DUXA 2CY6A 4ZXKA 1LJ7A 4Y1XA 1VAVA 1IS4A 2ZGNA 1LOGA 3RMYA 4AGVA 3HR9A 3FUOA 2DVGA 4PBPA 1APNA 4Q1RA 2EXJA 2SBAA 2ZGQA 4Z8BA 1LU2A 3QCWA 3ENRA 4YG0A 4Q2FA 2GNDA 2P37A 4GA9A 1AF9A 1WW5A 3A0NA 1WD3A 2EAKA 3A4UA 4YG6A 4XTPA 5IK4A 3POSA 2JKBA 4XTMA 3UK9A 5BYNA 3AZYA 1W6NA 2R16A 3O0WA 1LGCA 4D69A 2NMOA 3MEPA 1GBGA 3DGTA 5JLVA 1SLLA 2WJSA 3CNAA 1CIWA 4FOYA 4RL7A 2DYCA 3NV4A 4WZFA 3WHTA 2E51A 2A3YA 1D2SA 2W68A 4P9XA 1MS9A 3C2UA 4Q26A 1DLLA 4FPYA 1FNYA 3RS6A 3AX4A 4FOWA 1CJPA 3N7KA 1ULGA 4Y1YA 5F5QA 4FVVA 1QOTA 4YGCA 4Q8KA 1G9FA 2DTWA 1H30A 2D3PA 2EXHA 5GZGA 4UW5A 2ARXA 1DQ5A 3ZXJA 1BZWA 1QDCA 3M3QA 1LHOA 1S0IA 1DBNA 2WKKA 3SH3A 3V64A 2NM1A 2A3XA 2NZ9A 1MZ5A 1F9KA 2ZGOA 2VW2A 4WVWA 2DV9A 5T5PA 1RINA 1PZ9A 1JBCA 2CYFA 2AYHA 1HLCA 2R1BA 3OYWB 4P9WA 4XHBA 4I30A 3ZXKA 2UWAA 3WG3A 2GNTA 2EXKA 4FPCA 5CBLA 1ULFA 3OBRA 1LU1A 1JN2P 4BQ1A 5E89A 3MW4A 4XJZA 4M3CB 2YXSA 1Q8PA 2D7FA 1DYKA 1GICA 1JW6A 1LGBA 3N35A 3N3HA 3WDYA 4AYUA 5DUWA 5GJ6A 4YFWA 1G9DA 5DG2A 2A6WA 2P3KA 1MVQA 3I8TA 4YGBA 1MS3A 1Q8VA 3AP4A 1VLNA 4YFZA 4XHXA 1S1AA 2PHFA 1FATA 1OFSA 2DUOA 3BIWE 3TB0A 1DQ6A 1LCLA 1Z78A 2AR6A 1I1EA 5E8AA 1C1LA 3AYCA 1SLTA 1F5FA 3AZXA 1LOEA 2DVDA 1FV3A 1Q8QA 3USUB 1MVEA 1GZCA 1SBDA 3N7JA 5T54A 4XZPA 2GN7A 3ZSJA 4Y20A 4AVSA 2JE7A 2ZHNA 1IOAA 2A6YA 1FYUA 1LOCA 5DUVA 5GLZA 4YZ1A 1G9CA 1GZ9A 3O0XA 5FRAA 3WDXA 3FLTA 1NXD1 1G9BA 3VKFC 3WV6A 2GDFA 1RIRA 3AZVA 4DRVA 3R4SA 5CB7A 1ZA4A 1DFQA 3SH5A 1AXZA 1FNZA 2OUHA 3LCPA 3PVOA 1O4YA 4NO4A 3UJOA 1MS1A 4M3CF 2WSUA 5H9SA 1LEMA 3QLQA 1A78A 1ULCA 3WDUA 2DVFA 1KRIA 3RMXA 3HN1A 1F31A 4NOTA 2YMZA 3PVNA 5GM0A 3N36A 2ZABA 3AXEA 3ZPYA 4FPLA 1S0FA 2E53A 3WUDA 4XJUA 1SCRA 2CNAA 1HQLA 1CN1A 3U4XA 1ENRA 5KXDA 4YZ3A 1QKQA 4LBJA 1IS5A 2A7AA 4XE9A 3ZXLA 1MS5A 5EYYA 1V6JA 3WZ1A 2A3WA 1QMJA 3WDTA 4C1WA 3GNEA 4HL0A 4GXLA 4PBOA 3FBYA 1IS3A 3IPVA 3APBA 5E88A 1SLCA 4YG3A 3AXDA 3WOGA 2CWSA 4LBQD 4FPGA 4FOVA 1UAIA 5T5OA 2A6ZA 2DUQA 4LBQA 5H9QA 2R1DA 3PMEA 1AX2A 3PJQA 1VIWB 3V0BB 4LBMA 4XXAA 5T50A 4K1ZA 4P14A 1SACA 5IK7A 2VW0A 1Y7BA 3R05A 1V6OA 1B09A 4AVTA 2PHUA 2D44A 4R9AA 5F9TA 2A70A 3AP9A 2JE9A 1D0HA 4R9CA 2ZGUA 2P34A 2UWCA 4PF5A 1LHUA 4FP3A 2ZMKA 1N47A 1QOOA 3N7LA 1GLHA 4FPKA 2AREA 4LBLA 4DQAA 3V65A 3MPPG 4JRAA 3ZSLA 5JOZA 1XQNA 1WW4A 5DZFA 2NMNA 2A71A 4PCRA 3UJQA 3WCRA 4CTEA 4H55A 2WLQA 1JHNA 4Y24A 4YW4A 2JJ6A 4K21A 3SH4A 4BM8A 2DVBA 3O0VA 1SLAA 4U36A 1A8DA 2XB6C 1N1YA 1AXYA 4YW1A 1LESA 4YLZA 3WUCA 3VKOA 3BTAA 1CESA 5T52A 2BQPA 1WBLA 2LTNA 1UKGA 2WQZC 3OY8A 3O12A 1SLBA 1KDMA 1CQ9A 4JCKA 3VKLA 2ERFA 4XBLA 4M01A 5DUUA 4LBKA 4FP2A 1WUVA 2EF6A 3B69A 3TAYA 4DFSA 2PELA 4R9BA 1ZM1A 3WDVA 4FQZA 3W59A 2ZGKA 1YXWA 3OYWA 3DUIA 4Y1VA 1W6OB 4L8QA 1WLCA 5GALA 2ZMNA 3NWKA 4FPFA 1DGLA 1N1VA 4XMAA 1CPNA 4YW2A 4M3CA 4U2AA 1AXKA 2DURA 4Y22B 1IS6A 1KITA 1WW7A 1QU0A 3ZXFA 3AYEA 2ZHKA 1UZYA 2SLIA 1DYPA 3AJZA 5GLTA 1KQRA 1IKPA 1VALA 2CTVA 1MACA 1V6LA 4LBOA 4YGEA 2NN8A 1WLWA 3WCSA 1GZWB 1WBFA 4HANA 3WVJA 1FAYA 3POYA 3A0KA 1X50A 4M00A 4UW4A 5JOYA 3RG0A 3R4UA 2VXRA 3USUA 3FUQA 1G8WA 1LECA 2P3IA 4XJ9A 3AJYA 2HYKA 1LOFA 5IT6A 1ENQA 4XXPA 3V0AB 1G7YA 2H0BA 5CNAA 3AP6A 3O5SA 4XDQA 4YW5A 4JC1A 1CVNA 1WD4A 1V6IA 4BMEA 4DRRA 3SNMA 2D6LX 3RRDA 2AENA 3B3QE 3T1MA 5EYXA 2EIGA 4YW3A 2CL2A 2ZGTA 4AGGA 1Q56A 1DQ4A 2AH2A 3NV2A 4WVVA 2GMPA 1H9WA 3OGGA 3L2YA 1MS0A 2ZKNA 4GWNA 2VY0A 1AVBA 5FREA 1TEIA 1W6MB 3PVEA 3VKMA 1G9AA 2E7QA 2B7YA 2ZGSA 3HMYA 3AYAA 1R1ZA 1ULDA 2ES3A 3AP7A 3I4IA 3KQRA 4FPHA 4XIOA 3T1LA 5GLWA 4AWDA 1DHKB 3D5OA 2UURA 1Q8SA 4SLIA 2DTYA 2ZA9A 4W65A 5DZGA 1GSLA 4C1XA 4ATEA 1N3QA 1GV9A 2A6XA 2PHXA 1JYIA 1LHNA 2JDZA 4R9DA 2D43A 1YYNA 1U0AA 1S0CA 2JD4A 1C4RA 2W52A 5GZFA 4F83A 2WSVA 1VAMA 4BLJA 3B9CA 1FV2A 2GALA 1N3PA 4GKXA 3D4KA 3IM0A 1YIFA 2DVAA 1O4ZA 4YM2A 4AGRA 4TZDA 1CPMA 1W6PB 4RA0A 4XOGA 2P3JA 1OKQA 1W0PA 1AJKA 2E7TA 2V73A 3AFKA 4Y1UA 3WNXA 3WLUA 3SITA 2KM2A 1MR5A 1AX0A 5IUQA 1G86A 5T5JA 1W6QB 4ISQA 1FX5A 3BODA 2D6KA 3UL2A 1BYHA 1BXHA 1Q8OA 5JOWA 4CZSA 2W08A 3FFZA 2V5YA 2D3SA 4XMIA 1AZDA 3V0BA 1UX6A 4DS0A 2ZGRA 2OVUA 1Z0HA 2ZGMA 1EPWA 3ZVXA 2GMEA 2ZGLA 5H9PA 1LOFC 2P2KA 5JOXA 4GWMA 3OJBA 2WNEA 3AK0A 2CWMA 5JDBA 2NP0A 2Z42A 2ZMLA 1QGLA 1GKBA 1OQ1A 4YM1A 3M3EA 3B01A 1BJQA 2GMMA 2RHPA 2ZHLA 1HQWA 1PZ8A 2PHRA 3WG1A 5KXCA 1AX1A 2VW1A 4XJ8A 2C5DA 4KBBA 1A3KA 1S0JA 2VU9A 2OUJA 1N1SA 2ENRA 1SCSA 3ZYPA 5KXBA 2ZGPA 2NYYA 2VUAA 1W6NB 4YZ2A 4P9YA 1RITA 3MW3A 3OBTA 3POWA 2UWBA 1J1TA 1MS8A 1V00A 2D6PA 1CR7A 3WHUA 2R49A 4FPOB 3D6EA 1DIWA 1V6MA 4BOWA 1JUIA 1DQ0A 1UPSA 2DUPA 3WG4A 1W0OA 3W58A 2YY1A 1V6KA 3SISA 5HCFA 2YROA 5JVVA 4AVVA 3IKWA 3M2MA 4CRQA 4Q1PA 5GZDA 3WG2A 3N7MA 1WCSA 3M3CA 4BPZA 5CAZA 1SBEA 2R0HA 1W6OA 4ITCA 4TYSA 3OY8B 3JU9A 3ZSMA 4BLIA 1JXNA 3ATGA 4XJAA 5EXOA 2VH9A 5CA6A 5SV8A 3WDWA 1CONA 3FLPA 5HCAA 2G4IA 3ZXEA 1S0BA 4Y22A 3ILNA 3VUOA 2LALA 5LK5A 1DZQA 1KJRA 1UMZA 2D6OX 2EXIA 1SBFA 4XJWA 1WLDA 4XILA 2D3RA 2PHWA 1GNZA 2UU8A 1ULEA 1PZ7A 5GLVA 4DPNA 5GZCA 1KDKA 1LEDA 1GZWA 1I3HA 1C1FA 1DQ1A 1URXA 2C9AA 4K1YA 4Y1ZA 1DQ2A 1LTEA 1NLSA 4Q8LA 1QNWA 1UN1A 2DWRA 3Q9OA 5AVAA 3ILRA 4MYEA 1YO8A 5IK5A 3V0AA 5DXDA 1WW6A 3AZWA 3IMNA 1QOSA 4XBNA 3VV1A 3AYDA 3H0OA 3OPZA 2I2SA 5HCBA 2GN3A 4ISRA 5JMCA 4IQPA 2PHTA 1LULA 4GALA 5KXEA 3NV3A 1MS4A 1SLIA 2E6VA 3M3OA 4YM3A 3LSEA 3MW2A 3JUUA 1UZZA 2Q5TA 2DU1A 3NV1A 4Y20B 1ONAA 1LODA 2D6NA 5T55A 1GANA 4YZ5A 3INAA 1W6MA 3M1HA 3VKNA 1N1TA 2GNMA 2ZBJA 2FMDA 3IN9A 1LOBA 1LGNA 2AUYA 3ZYRA 4ASMB 1AJOA 1HKDA 1GNHA 4YM0A 3RSJA 1JYCA 3AP5A 4OZXA 2D6MA 2TEPA 2WT1A 1YRZA 4Q27A 4UW3A 5EWSA 5GZEA 2FHRA 2WT0A 3GALA 4YGDA 1MZ6A 2ZZJA 1QDOA 1S0EA 3B00A 3FLRA 1IKQA 4LBNA 4GKYA 2YV8A 2JECA 4FOQA 2YZ4A 1QNYA 2ZAAA 4ZKTB 4PQ9A 1W6PA 1JOJA 1HDKA 2GNBA 2AGSA 2EALA 4K20A 3ASIA 3BOPA 3LSDA 4UW6A 5DG1A 1KJLA 1W6QA 1H9PA 2DU0A 4WV8A 2A5ZA 1LHWA 5DZEA 1SFYA 4FPEA 2XG3A 4XIKA 1BQPA 3KM5A 4FPJA 5IK8A 1UL9A 3AZZA 1ENSA 2ZHMA 1BKZA 1S0DA 5GLUA 3RQ0A 5L73A 2W39A 4YZ4A 4XBQA 1V6NA 3ILFA 1QF3A 1C57A
chains in the Genus database with same CATH superfamily
3LIGA 2WT2A 1JOBA 2PHLA 3THPA 3GHNA 5FMOS 3C7GA 1LENA 3H8UA 5E1RA 5T3NA 2A6VA 3SKVA 5BNPC 4JGZA 4MO3M 1O8PA 3ZSKA 2ARBA 4LBQB 4M3CE 3N9NA 5DUXA 2CY6A 1CD3G 1LJ7A 2RS53 1JYVA 4COUA 2YC4A 1RUE2 3CLPA 2W1WA 4LPLA 4QAWA 3RJRA 4LKFA 4CA9A 4F8AA 3ZFFA 1I5PA 5FP8A 2VTXJ 2SBAA 1EP0A 2WNVC 1OSGA 4YG0A 3WF3A 2WFF3 2GNDA 2P37A 3KHCA 4GQ7A 2R063 4NHXA 1H0BA 4QPIC 5C5TA 1Y9QA 1ZRDA 2YGLA 2BGOA 4XTPA 5C7GA 2JKBA 1W2TA 1CZVA 1W8UA 2Y6HA 2R16A 2JD9A 3AZYA 4QX3A 3ZSEA 3BTZA 1OH3A 2RJLA 1GBGA 3F2ZA 3VD9A 4YW6A 3LOIA 1RUF1 1CIWA 3GDBA 3NSTA 3C7OA 5G04L 2B8MA 3ZKUA 1W2UA 4Q4V3 5LBEA 4AFMA 4EV0A 1DLLA 4YW7A 2WZPP 3WX5A 3H3LA 3AX4A 5C71A 4FOWA 2MPFA 4COWA 3C7EA 1FMD2 5F5QA 4YGCA 4TSVA 2NPIA 4A6OA 2X5IB 4Q8KA 4QPWA 2D3PA 5FP7A 3CJIC 2Q1FA 1ZBA2 3NJVA 4ZS2A 5FPUA 1SHWB 1KEXA 3BIEA 1LHOA 3WT3A 1QJY2 1RB8G 4QQPA 3H1WA 1NXMA 5CEHA 4AQ2A 2NZ9A 2XLGA 3VL8A 1YIPA 2ZGOA 2R042 5I0TA 2VW2A 4CEYA 5CFCB 3EBRA 1GU3A 1RMU3 3WW2A 3WNPA 1RUH2 2LROA 2R1BA 2AYHA 3OYWB 4JKKA 4P9WA 4XHBA 4GZ9A 5I0SA 3O1UA 4FPCA 3ZFEB 4Q4W2 4BH9A 1Q3EA 2BWAA 4BQ1A 5BNOC 3VN4A 4GIQA 4LIVA 1Q8PA 1EV11 4OI2A 1DYKA 1LGBA 2XHKA 3N35A 5D1IA 4QKBA 3WDYA 4XABA 1XNAA 5DUWA 5GJ6A 1HRV3 3LDBA 5DG2A 3R6SA 3I8TA 4IE7A 1MS3A 3H1YA 1CJDA 2F4LA 4XHXA 1S1AA 4QX5A 4XUOA 3BB6A 1YFXA 1W0NA 1WGPA 2AR6A 1Z78A 3I59B 3TB0A 4CPBA 1BCXA 1EPZA 2Y8KA 2HWF1 3BU0A 3KF3A 3AZXA 5A33B 1QQP2 5FKBA 3BTXA 2X53S 4JGYC 3HD8B 4CCJA 4IGPA 4BQ2A 3MYXA 4E2GA 3WEZA 2ZXQA 3KZ4C 3ZSJA 3PIGA 2VZRA 5CIRA 4Y20A 3VHPA 4FAGA 3H7JA 1LOCA 1V6NA 4ORFA 2VR4A 5DUVA 3O0XA 1PGL2 3FLTA 3AMQA 2BNMA 1RIRA 4DRVA 1GZTA 4A42A 1FPN2 1UMHA 2FQPA 1AXZA 1H1IA 2G9GA 2OUHA 3LCPA 5JSRA 3UJOA 1MS1A 5JXJA 2X5IC 1UYYA 2C6SA 3SHRA 2WSUA 3ZN6B 1UKRA 2YPDA 3HN1A 1F31A 4A7KA 3BOWA 3S5AA 4AL9A 1NE6A 2LUWA 1YUDA 5HI0A 3EYPA 1RUE1 1GOHA 3A22A 4QD2A 1NUKA 4FFFA 3MBWA 5J98B 4CDUA 3WUDA 4HZFA 4JVAA 2BGPA 4A2UA 4AXOA 1HQLA 5FOBB 1C3HA 2JWPA 2IXLA 5ANNA 5KXDA 3U4XA 3BCWA 5F32A 2QQWA 2X09A 5DABA 3ZFEC 1JYTA 5EYYA 1JS9A 3VHNA 2A3WA 2VNGA 5I8SA 3WDTA 1W04A 4OCTA 1ND2B 3T4HB 1YWKA 1SLCA 3ACIA 2CWSA 1PX3A 3IIAA 1ALYA 3N9PA 2Q1MA 2IXIA 2MEV3 3P6BA 3WNLA 1JYXA 3PJQA 4Q4X3 2WNUB 4CUAA 1JHJA 3DN7A 2PA7A 1PO23 5BV6A 3V0BB 5LEJA 4LBMA 3Q8BA 4K1ZA 2D97A 2RS12 4PLNA 1FMD1 2VW0A 2W47A 2RMU2 4LE4A 4AFAA 1V6OA 3MLKA 1RUG2 2BOJA 2IWGB 1D0HA 4KWKA 1PNFA 1TNFA 4AR2A 1YC61 3CIHA 5SV5A 2W91A 2XR4A 1RUI2 1PK6B 1LB2A 1J83A 1QJY1 1NCQC 3P1IA 4DQAA 2BTVC 2OZJA 3MPPG 4OI1A 2VMCA 3ZSLA 4Z1VA 2R041 2F4PA 4Z92B 2GAUA 4CEWB 1JZ7A 3WCRA 4JTOA 5FWEA 2VMHA 4Y24A 3SH4A 4CTEA 4LORA 4Z07A 3TBDA 1MZFA 4XF3A 4U36A 4Y4YA 1VBB2 2HWE1 4Z2WA 1AXYA 1H1MA 2HWB3 3KWVA 1AYN3 1CESA 1VMHA 1WBLA 5F37A 3J7HA 1X8MA 4Q4Y3 3O12A 4BWOA 1X7NA 1KDMA 1CQ9A 4P5HA 2ERFA 3HQUA 2JENA 4DY5A 5DUUA 5K9YA 4GB32 1R1A3 3UGFA 3I2DA 4HN1A 3O1VA 1IPKA 5DN2A 2UY9A 4MOAA 1QQP1 3K46A 1TG7A 2P5BA 4DFSA 1NYWA 1K42A 4R9BA 1ZM1A 4D6SA 4FQZA 3W59A 4ES9A 3HNYM 4DOUA 5CG8A 1ND2C 3LA7A 4QMAA 3VD4A 3NWKA 5C3QA 1TME3 4NIHA 1DGLA 3LEIA 4MVTA 4DNYA 1DP0A 2HJIA 4ASLA 1SDDB 1US2A 3GZTB 4YW2A 1OOPB 2OS2A 3FN9A 4M3CA 5I0UA 5ACA3 5FXWA 1PGL1 2DURA 4Y22B 2WLPA 3ZXFA 2WNUC 4EN9B 2QUOA 4AFBA 5BNQA 1W8ZA 5BNNC 1FPN1 2ZHKA 4GMP1 2SLIA 1DYPA 3KQ4B 5GLTA 2J1VA 4PI0A 4YGEA 4N9HA 5FMBA 3MUZ1 3V56A 2NN8A 4CDXC 1WLWA 2RS52 1ODNA 3WCSA 5C8CA 1GZWB 3IDEA 5E6HA 3SC7X 3ZYJB 4OVEA 1W8TA 3WVJA 4CU9A 3ZX7A 1FAYA 3ZR5A 3LOBA 3POYA 4DXTA 3A0KA 4M00A 4UW4A 5A3MA 1CGPA 3R4UA 2WA4A 1H2KA 1PK6C 3USUA 1GP4A 1T6GC 1PVXA 2FZ1A 3FUQA 2XL7A 4N43C 1AYM1 1LOFA 5IT6A 1ENQA 2J42A 5CNAA 1US3A 1RXGA 2Z79A 3AP6A 4KGGA 4L0PA 5F2SA 3WSOA 4XDQA 5IVBA 1CVNA 4UXAA 5D8AB 1WD4A 5FZOB 2G19A 5LBFA 1XE7A 2D6LX 2AENA 3B3QE 2EIGA 1ODMA 2CL2A 4WM8C 1JZ2A 4AGGA 1OF3A 3PHMA 2E31A 5FZFA 2VCMA 1K3IA 1VBC3 3NV2A 2GMPA 5F5IA 1RVF2 3OGGA 3L2YA 4LHLA 5I0RA 2ZKNA 4GWNA 1AR91 4Q0SA 2JG8B 5JXIA 3T0DA 3VKMA 1QJX3 2IXCA 1ULDA 3AP7A 3I4IA 1S2EA 3KQRA 3S57A 4LTAA 4UBGA 1SDWA 2J1RA 1Q8SA 2DTYA 3I3BA 3I2OA 1JH5A 4K9SA 1XU1A 4W65A 1IQAA 3ZMNA 5BUVA 2R6QA 2RMU1 3VBRA 1GP5A 2WO2A 3BTYA 1U0AA 1RUG1 2W52A 3KLSA 4ARXA 3CZJA 1VAMA 4IGQA 2GALA 1N3PA 4QXHA 3D4KA 4AGRA 1YIFA 3JBG3 1O4ZA 4TZDA 2XJPA 1CPMA 3OBAA 4NWWA 1D7PM 1RMU2 1OKQA 2BW8A 2QQMA 4H3WA 4LK7A 3AFKA 1PIV3 4KWJA 2KM2A 2HWD3 1VBE2 4YWAA 3R0RA 1W6QB 3FHAA 3WP6A 1NY72 3BGAA 3BODA 1F4AA 1NA1C 1X9PA 2VOWA 1ND3B 2ZEZA 1VBB1 4Y33A 1AR81 1HXS2 4XQDA 4FTSA 4Z82A 2ATFA 3I2JA 3OF1A 3ECQA 2H6CA 4LO4B 1S2BA 2ZGRA 2OVUA 3T09A 3VBFB 2ZGLA 4NPMA 2P2KA 4CDWB 4C8DA 1RXFA 3H7YA 4TLFA 4LK6A 1RGSA 2V5DA 4D3WA 2PLV2 3HNBM 2WNEA 3AK0A 2NP0A 2ZZQA 2Z42A 2ZMLA 1GKBA 1POQA 4YM1A 5A80A 1BEV2 2JG9C 5D8AC 3C7FA 4GB31 5ABJB 2GMMA 4WM7A 3DEMA 2J7MA 2J1UA 4G9SB 1K45A 1FOD2 2C5DA 4KG0A 1A3KA 2HYXA 3DKWA 2OUJA 4BQ5A 1ACCA 1RUC2 2ENRA 2JG8C 4SBVA 5FWJA 1XE0A 2NYYA 3LEGA 1GMMA 1K5JA 5IVYA 5CG9A 4P9YA 1NZCA 2WWUA 4AQTA 4QU2A 1BBT3 1KD7A 2BYVE 1W2NA 1CR7A 1DU3D 4YRDA 3VDBA 4LEJA 2R49A 3FHIB 3LEMA 1DIWA 5KHJA 4HPKA 3MV01 5FUIA 1YJKA 1UPSA 5FO9B 2YY1A 3TRSB 3ZYGA 3JQXA 4HONA 3M2MA 4YVSB 1TZOA 1RUJ3 2VQUA 4O7XA 1UYZA 1WCSA 4OMCA 4W6XA 5GKAC 1AL23 1GQPA 4JQTA 3AMHA 4AVBA 2QQKA 1EUTA 2DCTA 5FMDA 3ACHA 3JU9A 2F6BA 4K7JA 4E8DA 5EXOA 2BV4A 5SV8A 3ZFGA 5JIUA 1CONA 2CGPA 1VBA1 4B29A 1S0BA 1YNAA 3ILNA 4CUGA 2LALA 5FY7A 3H3ZA 1UMZA 4DY3A 1U5YA 5DPNA 2EXIA 3ZPOA 3VBOC 5KBFA 3N9LA 3VBFC 4A3XA 1RVF1 1AR63 2PHWA 4IGOA 4OMDA 1ULEA 1PZ7A 3K4DA 5IYYA 1D4VB 4KBZA 4DPNA 5GZCA 2FDFA 1H4GA 1URXA 1XRUA 5D21A 4EWAA 2OIIA 2QNKA 1DQ2A 3KCXA 4P02B 1NLSA 4GH4A 4N90A 2JDKA 4W8JA 4Q8LA 1QH7A 1UN1A 2VBBA 2YFZA 3ILRA 2VZPA 2WABA 4XPVA 2B45X 5IK5A 3V0AA 1WW6A 5FO7B 2Y26A 5FZ7A 3IMNA 2VNRA 3OPZA 3H0OA 3VV1A 2ORZA 1C8NA 3PU8A 4E9KA 4HVRA 5I8TA 1JUHA 4QX7A 2ZPXA 5KXEA 3NV3A 1OT5A 2VTXA 3M3OA 3PNAA 3G7DA 2DCJA 1JOPA 1A34A 5L7OC 3NV1A 1O91A 2BJSA 5F2WA 5B2GB 1W6MA 1NY71 2GC0A 4QPIA 3VKNA 2GNMA 5JCTA 3KD4A 5A7SA 4MGSA 1W2AX 1WWYA 2AUYA 5FYUA 1AJOA 1ZYBA 3PTRB 4Q4Y2 4LHNA 1U5XA 3MIBA 1YRZA 5FPVA 4UW3A 2BNOA 2D5HA 4GWJA 2RDSA 1XPWA 3GBWA 1VPHA 3D8CA 3U37A 3K4ZA 2BDRA 1PGSA 4YGDA 3B00A 1OKOA 2WZR3 3FLRA 2BUKA 4PI2A 3PUSA 3U78A 3U11A 4EROA 1MPXA 4G3YC 5CFDB 2PLV1 2JECA 4HG6B 4WVMB 2YZ4A 4Y5Z0 5AVPA 4LO6B 3ZMOA 5J09A 5JPNB 4C0BA 3MIEA 2YBSA 1HDKA 4XW3A 1E57A 1BEV1 4XFFA 2EALA 4BQXA 5A32A 3O7OA 2XQRA 3BOPA 3HBZA 3J26N 3TNQA 2ADDA 1HB2A 2JDAA 5DG1A 2Q4SA 1CWPA 4QHZA 1VBD2 1FOD1 3NJXA 3PURA 2Q8EA 4GJZA 1NCRA 5ACA2 1MEC1 2XG3A 3HEIA 2XLFA 3UV9A 1O3SA 1CAUB 3A21A 3KM5A 1RUC1 1UL9A 3LFMA 4FPJA 4LA3A 3I3MA 3E6BA 4HBNA 3DV8A 4PF1A 5L73A 3ILFA 3ZDSA 2QQOA 2OW4A 3IPVB 3TNPB 3B9IA 1EAH1 1QJU1 1S0GA 3KV9A 4XEZA 4BMBA 3DPRA 2ZACA 3AL5A 2A73B 1RUD3 1QXJA 4NROA 5T5LA 4ATFA 4NR1A 3VBUB 5BNOA 1YI7A 2FCVA 1COV2 4PT6A 1DG6A 1ZRCA 1VAVA 1VRH2 2OQ6A 3J9SA 2WNOA 1NT0A 1JMUB 3JCIA 1W28A 2LS6A 5LW9A 5AC92 2HWE3 4BDVB 4QPGB 2WDBA 1APNA 4F3JA 2EXJA 2ZGQA 4Z8BA 5FIXA 3ENRA 5FZHA 5E16A 4Q2FA 4GA9A 3LEKA 4OQ9A 5FPXA 1UCXA 1T2XA 1Z7S1 2EAKA 1OI6A 2K9ZA 5IK4A 3BPZA 4XTMA 3UK9A 3VBSA 1UPIA 1W6NA 4JGYA 3I3EA 2ILMA 5CVRA 1Q43A 2NMOA 3MEPA 3KT7A 3GJBA 1VAKA 5KHGA 5JLVA 1HJFA 4RL7A 2DYCA 2P6CA 4NIDA 4WZFA 3WHTA 2A3YA 4UF0A 2BPA2 2G9ZA 1D4M2 3U4SA 2VZSA 1D2SA 1RHI3 2XBO2 4JTNA 4FPYA 2VZ1A 4AI1A 2X29A 3A23A 3BU7A 1Q5OA 1QOTA 2VMFA 5FZ9A 4OFGA 3VLBB 4BIOA 5F3CA 2DTWA 2EXHA 3T0BA 5IAXA 3TEZA 4UW5A 4HETA 2XQXA 2JDHA 3JXSA 1DQ5A 3UGGA 3ZXJA 5FBJA 1S0IA 4KMQA 2WKKA 5FYVA 4BYYA 1ZRRA 4PJYA 2NM1A 2A3XA 5I8YA 1F9KA 4IE4A 5APAA 2PN5A 1WZXA 1W9WA 2DV9A 3GGLA 5C9AB 5CISA 4FCAA 1EY2A 1WMFA 2GNTA 3VBHB 2HWC2 5JI9A 1UOJA 3I49A 2QQVA 1AYM3 4XJZA 3ZDVA 1RYYA 1HV0A 2VL4A 3N3HA 1CZSA 4PIZA 4LO8A 2PYTA 3OPTA 3VBUC 4AYUA 4S2FA 1G9DA 3E6CC 1O7FA 2BFUL 3AP4A 5FY0A 4CUCA 1V9U3 1FATA 3TYJA 4CPBD 3BIWE 4BIFA 2VBPA 1TNRA 2QQIA 1I6XA 4PLMA 3HT1A 5LA9A 3EHKA 5CKMA 3AYCA 1SLTA 2CU5A 1J1LA 3J8F3 5FZDA 1FV3A 4LO7A 1Q8QA 1NZIA 1MVEA 4CDQB 2EA7A 4R8HA 3VD7A 4RSUA 4MLOA 3OSDA 1SFNA 4QX2A 1X36A 2J1TA 4AW7A 1IOAA 2I45A 2ZEWA 1C8M2 1JYWA 1VBD1 2HEYF 2WUHA 2WQ8A 3NRUA 3ME2A 4CYDA 1G9BA 2WIIB 3EJKA 1NCQA 2VCAA 2ZX1A 4AVAA 4ZU5A 3JD72 3R4SA 1K5MB 3KV6A 4NUBA 1DFQA 4PDWC 1IHMA 2VZTA 1FNZA 3NNFA 3SH5A 3VZLA 1NQDA 4P08A 1CAWB 2W1SA 1F2NA 2GH2A 2W94A 2XH6A 4PHZA 1IPJA 3QBQA 4M3CF 4RGAA 2W5FA 1GQHA 1LEMA 1ULCA 2JIJA 4QT6A 1UOBA 4TXWA 2ARCA 1KRIA 1PHMA 3RMXA 2BGCA 2ZX0A 3VZKA 4NOTA 5J48A 1COV1 3PVNA 1VRH1 2W9XA 3CF6E 1E5IA 4KU7A 3FX3A 1AR83 4I0AA 3ROUA 5AC91 1OA2A 1UU5A 1S0FA 3ZN4A 5JSPA 1QJFA 1UY2A 1ZZ7A 4LJHA 2RM22 1SCRA 4ES8A 4XURA 1H6XA 3AFGA 3LFIA 3MV11 3CBNA 4OI0A 4ZONA 3ZXLA 3OGRA 2QDNA 5L19A 5FY5A 4NAOA 3RWKX 2H0VA 3ES4A 5E88A 4BQ4A 4ZU4A 3RYPA 1CAXB 3AXDA 3WOGA 4KL1A 3TN93 4N53C 1JTZX 1UAIA 1D4M1 2DUQA 1F4HA 5DDJ3 5FXVA 3ZKYA 3PMEA 4CCKA 1B35B 1W99A 1NCRB 2Y6LA 1AX2A 2B39A 3P5BA 1PX4A 1X33A 1H8VA 2WC2A 2VUCA 5IK7A 1W9SA 1HN0A 5BNNA 4WBBA 1B09A 5IJRA 2D44A 3K3OA 2WS91 1VMJA 3VDDA 3AP9A 2JE9A 4R9CA 2Y6GA 4CDXA 2Y6JA 2P34A 4PF5A 2DDUA 4RR3B 2IUWA 3BKZA 1QOOA 3N7LA 4CU8A 1PNGA 5FDBA 2BWCA 2X10A 5J96B 3WP5A 3AMNA 1UZ0A 1WW4A 2ZX4A 3AMMA 4D6QA 2RR13 1JU3A 4PCRA 5LA2A 2VCBA 1JHNA 1XNDA 4RS5B 2JJ6A 4K21A 5C4WB 2DVBA 3O0VA 1SLAA 1PMJX 2YC0A 3AKSA 3K3NA 4MGKE 2VE1A 2CHHA 1W39A 2HWC1 2XB6C 3IT8A 1AR73 1N1YA 1ZZBA 4PQQA 3VZNA 5FYYA 1LESA 4Q29A 4LE3A 3GZAA 3UGHA 3KSCA 4WM8A 2BQPA 2ARAA 2LTNA 1VBA3 4Y5SA 3MHZA 1W8NA 2WQZC 4C91A 2I74A 1R083 4JCKA 5FBZA 3VKLA 1H8TC 2PQQA 4FFGA 4I01A 5FR3A 3PLQA 3EB7A 3LA2A 2Q8DA 3MIHA 3OUIA 4CCDA 3B69A 1VJ2A 2CDPA 3B93A 4IV3B 5HXMA 2ZGKA 3DUIA 1POV1 4L8QA 1MQTB 3LE0A 1PO13 5FK7A 5GALA 4V1PA 1IG3A 5JXHA 3OEBA 3SKJE 4FPFA 2FDJA 2KXLA 3LZZA 4NWVA 1C8M1 2MNGA 3E5QA 3PUIA 4IV1B 1R093 4MZUA 1J59A 1IS6A 1KITA 2YFUA 2XVLA 3HWJA 1QU0A 3OCPA 4CXWA 3JD71 3VHRA 1UZYA 2GP3A 3PJYA 5FFOC 3AJZA 4J1XA 1VALA 3O1SA 2JDUA 4QXKA 2YPJA 5FYSA 1NA1A 3IDBB 3SEPA 4AQ6A 1YQ2A 2IXJA 2GH8A 4G4FA 4HANA 4YVWB 4I2OA 2WYFA 5JR2A 4UT5A 4Z2AA 4BE3A 4DB5A 2VXRA 1J58A 2WWJA 1LECA 5L9VA 4OHZA 3O1MA 3NAPB 1NOVA 2DFBA 2BNNA 1G7YA 2RS32 1SMVA 4FI9A 2HBTA 4RS5C 3GCXA 1UMIA 4YW5A 1W90A 5A3LA 2Q0AA 5C3RA 1V6IA 3H8OA 2FDIA 2JG9A 3EXUA 1ZBE3 4XCBA 5EYXA 4YW3A 2QKDA 4RQPB 2P1BA 2I07B 1DQ4A 2RDQA 3NJYA 4WVVA 1H9WA 3NJZA 3U75A 5FZLA 5A7PA 5A1AA 3ES1A 2DCYA 2V72A 5FREA 3VDAA 1UYXA 4IEVA 4ZXEA 3HMYA 4FPHA 2PFWA 4AE2A 4UFJA 5GLWA 5DAQA 2EAAA 2OQ7A 4AHZA 2W3JA 1TMF3 4TLGA 4BISA 5CFCC 2VG9A 2YYOA 5DZGA 5JUVA 4ATEA 5JMOA 2A6XA 3GBFA 4HKWA 4JKLA 4LXLA 4QGLA 5A3PA 1LHNA 4KH9A 2D43A 1YYNA 3BPSA 1FI2A 1XYPA 2WSVA 1EAH3 4AEDB 5IFPA 1QJU3 3DXTA 2DVAA 3ST7A 3X29B 1W6PB 1GWLA 3L2HA 4ONUA 5FPAA 5KC5A 3HAGA 1AJKA 5K0UA 3WLUA 3UYJA 4B7KA 4AI8A 1Y4WA 1HB1A 1AX0A 4H7LA 3ORJA 5FJHA 1ZRIA 4ISQA 1FX5A 1GOFA 1WMDA 4ASKA 5LY1A 3WQ7A 4JDNA 3UL2A 1BXHA 1Q8OA 5KR7A 5FZ6A 3QH6A 1YQCA 1OHFA 3M8LA 2R073 2V5YA 4D94A 3POBA 1Y3TA 2YG0A 1AZDA 4HT1T 3T0AA 4S2HA 5FOJB 4FTEA 4DS0A 2XVKA 4HLTA 2ZGMA 1EPWA 4DINB 3FFQA 3SCHA 1DGWX 1ZBA1 4JGZB 1XNBA 4BQWA 5JDBA 1QGLA 1OQ1A 1OPMA 1OLMA 3M3EA 5ISLA 3WQ1A 1XNKA 4KQ7A 3ZFFB 1RUH1 2XXZA 5EP9A 4ZZ5A 4A7YA 3MI8A 4KBBA 4Q4W1 4NIGA 2BP6A 1D0GA 1N1SA 2E26A 2ZGPA 4QXCA 1PVC1 1YFUA 1RITA 1NG0A 2OZ6A 1ZX5A 3POWA 1J1TA 1MS8A 4ZS3A 5L7OA 1V00A 2ZKLA 5FLIA 5FQ0A 1C5HA 3Q8AA 2YB7A 3DKQA 1V6MA 3MFCA 2KR2A 4N8MA 2DUPA 3T2PA 1V6KA 3SISA 5HCFA 5KHHA 4AVVA 5JPMB 4XFHA 5KWRA 2VZUA 2XUEA 3PIJA 2JIGA 3WG2A 3F95A 1UNBA 4BPZA 4K40A 1CAVA 2HBUA 1HRI3 1W6OA 2WO3A 4ITCA 5I93A 1WCUA 3K2OA 4TTGA 2W87A 3H1MA 2C0ZA 1NX9A 1JXNA 3PTYA 5EZWA 2RS31 4R4XA 5LBBA 1JYNA 3WDWA 5FZ0A 2JDMA 2O0OA 2Q8OA 2XPJA 4CEYB 1O3RA 5FK8A 4EE2A 5C3PA 1DZQA 1KJRA 1IQDC 1JODA 2GZWA 2J1AA 2BZDA 2IXKA 4XJWA 2FD8A 1AHSA 2BRTA 5FCCA 5DDJ2 2D3RA 3U0ZA 4FTBA 1F5JA 1KDKA 1LEDA 4YARA 1DQ1A 1UZWA 4MH0E 2C9AA 3E5UA 4JGZC 4A6SA 3LWCA 2HEVF 3WP4A 5AVAA 2QFEA 3Q9OA 4XDPA 2WFF2 3CU7A 5FP4A 2R062 1WCKA 4P5YA 4IEUA 5F1RA 4CEWC 1YO8A 3VD3A 4XF0A 3ZFFC 5IATA 1BMV2 4INDA 1XNCA 3M70A 5C8WA 3AZWA 1STMA 1ASJ3 4JRLA 1VRBA 4XCAA 1SPPA 1W2OA 2W2IA 2RJKA 5A3OA 3UETA 2GN3A 1JI6A 3MIFA 4D7TA 4JHZA 5A7OA 4IEXA 4RHV3 4GALA 4EYUA 5JMCA 2W0XA 1MS4A 2E6VA 2RDNA 2B42B 3S30A 3ZM8A 3NKGA 5IVFA 4Q4V2 5FYZA 2DU1A 3BN6A 3AM2A 3L9JT 4LQRA 4Y20B 1ONAA 5T55A 4DO0A 3S0MA 4YZ5A 2QE3A 1AR72 1N1TA 2ZBJA 1A8MA 3ALQA 4IEYA 5F3GA 4V2WA 1LGNA 2OYZA 3ETQA 2WWSA 1OVSA 2RS11 4IUGA 4C1WA 4D6RA 2TEPA 2TBVA 1F15A 2FHRA 1PVC3 2XJVA 1O5LA 2G9FA 3FC0A 5JWPA 1OVPA 2ZZJA 1S0EA 2PQSA 3PVBB 1LNSA 1W03A 3K77A 4XC9A 2YV8A 1RUI1 4FOQA 5A3TA 2BBAA 4OHWA 1OOPC 4PQ9A 3ZOIA 2C9KA 1M06G 2GNBA 1GOGA 1LR5A 4BZ4A 1JZ6A 1OURA 1OC1A 3LSDA 4CEYC 3H9AA 1GP6A 5LRSA 4N9IA 4CDUB 1ULOA 2CV6A 3MUY1 4LO5B 1H9PA 2G1MA 3G6JB 3GZUC 1SFPA 5LWBA 1LHWA 3POFA 2JICA 2OKXA 4XIKA 1HRV2 1O3QA 5GLUA 1S0DA 3GZEA 3CJXA 1XNTA 1DF0A 3H42B 5CKQA 1N3OA 1I9RA 3WXPA 4X8PA 5F6LB 3O14A 3RDIA 3OUJA 4LKDA 2Q1ZB 3IMMA 1RUF3 3SLIA 4O9GA 5FPBA 4ZXKA 4XFAA 1HW5A 1UZVA 2VZOA 2WYSA 2ZGNA 3OGJA 1YFYA 2NLRA 1LOGA 5A7WA 3RMYA 4QDQA 4AFDA 1V70A 3HR9A 4HVOA 3WNOA 2DVGA 2GP5A 3GCWA 1GWKA 3HBKA 5JZGA 1NQJA 3JB4C 4QKFA 4JDMA 4QM9A 1WD3A 3IDAA 3A4UA 5J7MA 4LLOA 3VHOA 3POSA 3RZKA 5BYNA 4P9IA 2JB4A 1LGCA 4IEOA 3KCCA 5A6ZA 3DGTA 3DYMA 2IXHA 1UY3A 3CNAA 4FOYA 4LHKA 3IWZA 2PAKA 2RS51 4IEQA 2VOKA 2WN3A 2W68A 4P9XA 4UFKA 2Y33A 3MFAA 2RDRA 3PUAA 2D98A 4IE0A 4BXSV 2ET7A 3I2HA 1FNYA 3RS6A 4M0HA 1CJPA 3NVCA 3N7KA 1ULGA 5FZ8A 5BXXA 4PDWA 2CDOA 1EV13 4RGGA 4WVZA 5FZKA 2WFF1 5A6YA 5KC6A 1WLTA 1H30A 3WINE 2R061 4DXRA 3S7EA 2CAVA 1BMV1 2ARXA 2PTMA 3RZZA 2TUNA 1BVVA 1BZWA 4A3ZA 4LOTA 4DIQA 1DBNA 1ND3C 3V64A 5FP3A 3EQEA 3T3YA 1AL0G 1ZRFA 2HWF3 4HKOA 3U07A 2XKPA 1O6UA 4WVWA 5CYYA 3URFA 4C0HA 2AC1A 1VB2A 4CP0A 5FLJA 4NAMA 1HLCA 1JZ5A 1RJ7A 4Q4V1 2MEV2 2UWAA 2VVFA 4Q4X2 4CDWC 3SCGA 2EVXA 1PO22 1E5HA 1JN2P 1F35A 3VGIA 2BFUS 3ZYIB 3MW4A 4M3CB 1S4CA 1GICA 1JW6A 3PUQA 4OI4A 4CP9A 4AI9A 2YUEA 5ABJC 4YFWA 3M7AA 2XKOA 1VLNA 5BNPA 2WN2A 2CGOA 3HQRA 4N53A 3PL0A 3SMHA 5C8CB 5E8AA 5JIAA 1OD3A 1C1LA 4MHUA 3I3QA 1KS5A 3OGSA 1RMU1 4P00B 1LOEA 2DVDA 3LA3A 3AKRA 1JZ8A 3USUB 4OHYA 4IEWA 1GZCA 2WNVA 1J84A 3IAQA 3QACA 3NNMA 1VBE1 4XZPA 3SXWA 3LIHA 1RUE3 2A6YA 4LMFA 4DXSA 2HWB2 5GLZA 2Y34A 1AYN2 1GZ9A 1S55A 3GYDA 5FRAA 3WDXA 4CE8A 1HXS1 1NXD1 3EO6A 3VKFC 4W6YA 4RN5A 2WZEA 1QHDA 2IFWA 4NRMA 4AHYA 4RYDA 4YVSC 2E7AA 2Y38A 1ZA4A 3FJSA 5CB7A 4E27A 4XFIA 3S5QA 3SEEA 4PIYA 4EWDA 2Z5WA 3DECA 3LGRA 3MO4A 5DAXA 3RZJA 3D0SA 1XJAA 2K46A 1R1A2 1L7LA 2WL1A 3CL1A 4CSWA 3I7DA 5H9SA 3O1OA 3JB8A 3QLQA 1XOYA 4MX3A 1JU4A 2ET1A 2JDPA 3KT1A 4AHWA 3RNSA 2GU9A 3MF9A 5GM0A 2R30A 3N36A 5ERLA 1TME2 3CJIA 3ZPYA 4BK4A 1KFUL 3GXUA 3VBRB 4AZZA 1FMD3 3LB9A 4H2AA 4XJUA 4COVA 3I3DA 5DAVA 2CNAA 1H8TA 2X8KA 3WP3A 4I09A 1ENRA 5A70A 4XUPA 4YZ3A 4LBJA 4OHXA 4XE9A 2A7AA 5F6KA 2DFCA 2FZ2A 1OQEA 5B4NA 3WZ1A 1V6JA 1ZBA3 4GULA 4LULA 4LOSA 3TEXA 1UOFA 3GNEA 4HL0A 1QJY3 3FBYA 2DCZA 2JXAA 2WFPA 4NHYA 2WQ4A 4ARYA 2R043 2FDHA 2VM9A 1Y9MA 2VUDA 4FOVA 4FPGA 4OZOA 2AZ5A 2A6ZA 4M4PA 2VOVA 1L7QA 3HQXA 3I54A 3CMGA 3I2GA 4LBQA 2R1DA 5C3SA 5FTTC 4COZA 4P9LA 2JKXA 4XXAA 5T50A 4UAPA 4P14A 1SACA 3RGBA 1ZREA 2C4XA 4CP1A 4RFRB 1Y7BA 3R05A 4B7EA 1YHFA 1UD1A 4R9AA 5F9TA 4EN6B 2A70A 4D7YA 1GFF2 3AKQA 1QEXA 1HX6A 5IVVA 2ZGUA 3USSA 2UWCA 4D8MA 4L99A 1VBC2 2ZMKA 5A6XA 4LBLA 3V65A 4WM7B 3ZYFA 5JOZA 1LKNA 5LA1A 2Y6FA 5DZFA 2NMNA 3EMRA 4E4ZA 4E4SA 1QJX2 3M4FA 1QQP3 4V2VA 4DMIA 2PHDA 2WLQA 4IE6A 3TEYA 1O4TA 4FXKB 1UW8A 1YJLA 4YW4A 1RUNA 2VXJA 2MEV1 4Q0PA 4WZCA 5LEKA 5F3IA 1WCQA 5JZGB 4Q4X1 5CFDC 1QXPA 4JV4A 3S7IA 1PO21 3IZOA 5FYMA 4XF4A 4YLZA 1O59A 1XE8A 3VKOA 3WUCA 4BK5A 2BERA 3GBGA 2LM3A 3UKNA 3CDZB 5DMYA 2X5IA 2YU2A 3W21A 1UKGA 4LITA 1ZA7A 3OY8A 4NPLA 1REFA 3H3UA 4B4PA 4GJYA 3JBG2 4XFBA 1SLBA 5F39A 1JZ4A 3ELNA 2XJRA 1FPN3 4GMP3 4HPKB 5LATA 4MGYE 2K0GA 5EJ3A 2PXJA 1PM7A 3B02A 1PIV2 3MPBA 4M01A 1AUYA 1ZZ8A 4LBKA 4AAPA 2HWD2 4NRQA 3VD5A 4AF9A 2EF6A 4HK8A 2FCUA 4NVPA 2PELA 3WDVA 5I91A 3RZHA 1YXWA 3OYWA 4KGQA 4Y4RA 4MSVA 4O65A 2XLAA 5CKNA 5JXGA 2XJSA 3ZFEA 1ZZCA 3BYWA 1PMIA 2HWB1 2YU1A 3CQOA 3ZFGB 2EIBA 3FZ3A 5LZ6A 1J3QA 4GD4A 4Q4Y1 3CKHA 2XVGA 1WW7A 2BU9A 2Z69A 4META 3J4UH 2MHFA 3HIFA 4QPGC 2GSYA 4DUVA 5I0DA 1RUF2 5IHRA 2CTVA 1MACA 1V6LA 5J3UA 3I59A 5HCHA 1R1A1 1AR93 3LPGA 1UXZA 2OXBA 1BLZA 3C3VA 4GH4B 5A33A 5JOYA 1HV1A 4UFLA 2P3IA 4XJ9A 4AEJA 4Q5OA 3AJYA 2HYKA 1TME1 3RYRA 3HPNA 3V0AB 5BNPB 2RS13 5IAVA 2H0BA 3ACLA 2RMU3 4LT5A 1OLME 3O5SA 5ACA1 1RUG3 1SZBA 1BBT2 4BMEA 4HN0A 4MGIE 3RRDA 2VD7A 3MF6A 3T1MA 2AEYA 4QX0A 1REEA 2AH2A 3AB0A 3RWNA 2E32A 4YSFA 3J7LA 4E8CA 1MS0A 1W9FA 2VY0A 1AVBA 5F5AA 1XC6A 1W6MB 2VAUA 3PVEA 4QPIB 1G9AA 2O8OA 3ZN6A 1CX4A 1RUJ2 1UY1A 2B7YA 1R1ZA 3AYAA 3LKJA 4HMZA 3T1LA 4CP2A 4DEQA 1QWRA 4QDRA 4MG2A 1AL22 1DHKB 1REDA 4L92A 5DAPA 1VBB3 1YEWA 3FHQA 3ABZA 1GSLA 5FUNA 3AVSA 5C9AC 2PHXA 4NPRA 4OQ8A 2JDZA 2ZJCA 5GZFA 5CU1A 2QQPA 4F83A 5FLHA 3VBHC 1KS4A 2WINB 3U1XA 4BLJA 4JKMA 3B9CA 5IVEA 1BK1A 2E9QA 2YBPA 4GKXA 2J22A 4KWUA 2EIDA 4YM2A 4FSJA 2HWF2 4RA0A 1UYPA 3ZFGC 2H6BA 1VBC1 3NKTA 4QB6A 2E7TA 5A32B 3WNXA 1AR62 2XDVA 3I97A 1ND2A 4GB33 3SITA 4CU7A 1MR5A 3PDQA 1G86A 4L9BA 3CJIB 1QJX1 5JAXA 2BEOA 2D6KA 3B7MA 5BY5A 2XBO1 1BYHA 5JOWA 3POGA 4NN0A 2W08A 3CO2A 1S2KA 3FFZA 4HK9A 2WNUA 2D3SA 3ZLIA 3RVHA 4XMIA 2QQUA 3V0BA 1UX6A 1XYNA 3W5NA 1UF2C 1VE0A 3K48A 4GH4C 4CDQC 5AFBA 4BB3A 5H9PA 3DPRB 5A1LA 1ZVFA 2JEMA 5JOXA 3JBG1 1H2NA 1R64A 4GWMA 2WAOA 4LIUA 3OJBA 3OD4A 3RI9A 2IC1A 2J1EA 4BU2A 5BNOB 2XWBB 4IEPA 2ZCWA 3DF0A 3A7QA 5G05L 4CCNA 1PK6A 1PIV1 5EIYB 3LQCA 5C5UA 3MGUA 2HWD1 3B01A 1BJQA 4XZUG 4N43A 4A7ZA 3U10A 1K5MC 1HQWA 2PHRA 2D93A 4CEWA 1DZTA 1BK0A 2OA2A 2VW1A 4JDOA 2VNOA 4XJ8A 4MGZE 4DEVA 1JZ3A 5K7PA 2VU9A 3WNMA 3QOPA 3ZYPA 5C3OA 2ZEXA 4XETA 3VBSB 4JGYB 1W6NB 1VR3A 4TWTA 3HNMA 3OBTA 1PM4A 2W1UA 2WBKA 2WZR2 1QJZA 3MLJA 5BPXA 4DUXA 2VQ0A 4UF0B 3UESA 4CCLA 4FAHA 3P3PA 4CXXA 4HSLA 3WG4A 1RVF3 1W0OA 5FZ1A 3W58A 1DGRA 3MDPA 4K8FA 4Q1PA 4KG8A 4MXWA 3N7MA 3O1RA 5K4LA 5CAZA 3HT2A 1UY0A 4UWDA 1I5ZA 2R0HA 4Q0UA 4TYSA 3HN3A 3LAGA 4P9GA 3OY8B 3ZSMA 4BLIA 2VOXA 2ZEYA 1HB4A 4XJAA 2QDRA 2VH9A 4BHPA 4FBFA 5CA6A 3IBMA 1DDLA 2XMLA 3ACGA 1OMIA 2G4IA 1B35C 1BVP1 1H6YA 1NCRC 1OOPA 1OQDA 1W05A 1BBT1 4Y22A 5EJZB 5FZ3A 2QBXA 2R32A 2ZX3A 3D82A 3RZMA 4XVHA 4FXGB 5B4XA 2IZWA 2WO7A 1RUD2 1VMFA 2D6OX 5A7QA 2O14A 2D5FA 1TVGA 3FBMA 5GLVA 3RZLA 4BQYA 1VBE3 2HWE2 1GZWA 3DPRC 4Y1ZA 1RUJ1 3I2FA 1YCIA 4GMP0 5FXZA 4RR3C 1LTEA 5IVCA 1O5UA 1AL21 1QNWA 1VB4A 2DWRA 2XJQA 2PAMA 2B46X 1HXS3 2P4EA 4LHSA 3VZMA 3E6DA 2LW8A 3AVRA 4MYEA 2ADEA 3AC0A 4YNIA 4UFIA 5LCWL 2RM21 5DXDA 3WW3A 5C4WC 4JX0A 3OPWA 5EV7A 3R4DB 1QOSA 5LASA 4FFHA 4XBNA 4ZPIA 5D8AA 5FZOA 5HCBA 2I2SA 4M4RA 3WW4A 4I0BA 5FP9A 2FDGA 4ISRA 4QKNA 4IQPA 4QB2A 1LULA 2PLV3 1SLIA 3VBSC 4YM3A 3LSEA 3MW2A 2ZAHA 1AR61 1RHI2 1BEV3 3JUUA 4YYOA 2VZ3A 4PLOA 3M3IA 2D6NA 1OBNA 3K51A 1GANA 2JG8A 3PU3A 2QQJA 3M1HA 1W06A 1CZTA 2EICA 4CCOA 4KU8A 4UYBA 4X6RB 1FOD3 3IN9A 2QQNA 1LOBA 5LRRA 1NCQB 1MEC3 3ZYRA 4ASMB 1OD5A 1GNHA 1RUC3 2RVAA 4YM0A 1JYCA 4PIXA 5EWSA 5A3WA 1HB3A 4IV3C 4E4DX 1DYOA 3TWIA 1KXGA 2WT0A 1J3RA 1MQTC 3IDCB 4ET7A 2YHJA 4AQSA 3U14A 1FXZA 1C28A 1IKQA 2DBIA 4LBNA 4GKYA 4AG4A 1RJ8A 4NE9A 4K6BA 4XF9A 4W50A 1HJGA 2ZAAA 4ZKTB 1SEFA 1JOJA 4IV1C 3BI3A 2N7GA 4K20A 5FZEA 2BBVA 3H50A 3Q8CA 3ASIA 2VMDA 4UW6A 3RI8A 1AYM2 2DF7A 1KJLA 1W6QA 2WZ8A 1H1AA 1ND3A 2CSGA 5FY8A 1BQPA 2IVJA 5FZ4A 5A6QA 5J36A 3AZZA 1ENSA 2ZHMA 4MGQA 4LNVA 4UFMA 4YVWC 1V9U2 1Z7S3 2W39A 4QM8A 4HXCA 3VBOA 2WO1A 5HXVA 2E7QA 1C57A 4CU6A 2VMEA 4Y26A 1GYKA 2VZQA 5H9RA 3T2TA 3VBFA 3WQBA 2WZR1 3NAPC 1LOAA 5F7UA 4KI5M 4OULA 4CDWA 1AR92 1W8OA 3J8F2 1LHVA 4UI9L 1QXRA 1T6BX 4FQ4A 4XYXA 2A75A 1UY4A 2R0FA 4BCUA 5A1FA 4AOCA 4Y1XA 4GAZA 1U5IA 2C26A 5FMOL 1IS4A 3CZUA 3B5LB 3H8RA 1ZNPA 2NQYA 3ZXDA 4AGVA 5CZKA 3SQOA 4BA6A 5ABJA 3FUOA 1D2QA 5BNNB 4RQPC 3KGZA 4RGKA 4PBPA 4Q1RA 3N4MA 1LU2A 3QCWA 2J1SA 3VDDB 4CDXB 2A1XA 1AF9A 4W4ZA 1WW5A 3A0NA 4C90A 2W1QA 4YG6A 2FMYA 5FO8B 2UYBA 3ZIWA 4CVUA 3DYPA 4D69A 3O0WA 4K8RB 1OXCA 5FZMA 1RL3A 4AI3A 4E2SA 5L36A 1SLLA 2WJSA 4N43B 1RUD1 3FWEA 3HJRA 3NV4A 2E51A 1UIJA 1MS9A 3C2UA 3JZVA 4Q26A 3T2QA 3D0JA 1AR82 4UBHA 4AEDC 2CGNA 1BHGA 4Y1YA 4YVSA 1H4HA 2ZS6B 4WM8B 5HV4A 2VQAA 2VTFA 4FVVA 3J7MA 1G9FA 4IERA 1IZ3A 3LD8A 1OLRA 2HKXA 2Z2SB 2QVSB 1V0AA 1UQXA 1QDCA 4K3UA 3M3QA 4QX8A 3SH3A 2B9VA 4F7ZA 5JSOA 2JB8A 1MZ5A 2VVDA 5D2AA 2AACA 1WMXA 3QD6A 4D7SA 3N9MA 1GR3A 4NHKA 1SQ4A 3TN92 1C5IA 4MXWB 4MADA 1RINA 5T5PA 1PZ9A 1JBCA 2CYFA 2BVVA 4XUNA 1RHI1 4I30A 1QH6A 2IFRA 3WG3A 3ZXKA 3UKVA 4AK3A 1LAJA 2O1QA 2EXKA 4ZU7A 5CBLA 1UXXX 1ULFA 3OBRA 5A3UA 1LU1A 3LDRA 4MHRA 5E89A 1RTVA 2YXSA 2D7FA 1VBD3 5FY9A 3E1F1 2BOIA 4LKSA 4W6WA 2A6WA 2P3KA 1MVQA 4YGBA 5GZGA 1Q8VA 3ITQA 3NO8A 4IESA 4A41A 4CUBA 2KD7A 2PHFA 4QDSA 1QY4A 1OFSA 2DUOA 4YFZA 4NRPA 1NA1B 1DQ6A 1LCLA 1I1EA 2VC9A 1OPOA 3VDDC 4B4QA 5FPLA 1W8FA 2RR12 4D0QA 3ZYHA 1F5FA 2Y60A 2GC2A 3P3NA 4BXFA 1COV3 1SBDA 4R4ZA 4XUQA 2UYAA 1VRH3 4B1MA 3N7JA 4XAEA 5F5CA 2GN7A 4JHTA 5FY4A 5T54A 2JDNA 4AVSA 4EN8B 5AC93 2JE7A 2ZHNA 3FL7A 5FAXA 5FMCA 1G6NA 5FYHA 1FYUA 4QQLA 4AEKA 4YZ1A 1G9CA 4H14A 2XGXA 4S2GA 2VPVA 3WD5A 5EQUA 1LRHA 5F8PA 2IVIB 3WV6A 1TQ5A 3VB9A 1VBA2 1FT9A 1UWWA 2JG9B 2GDFA 2KA3A 2QZ3A 2VMIA 3AZVA 4L97A 2P17A 2ZTNA 1V9U1 4QHOA 2Q8CA 3O1TA 1R082 3K75B 3PVOA 4N7IA 1ULPA 2W46A 1O4YA 4NO4A 5T5OA 2LRPA 4R52A 5CFDA 1RUOA 2FDKA 1A78A 2HEWF 3J8F1 2DVFA 5LBCA 3WDUA 5FZGA 4XACA 4QGNA 4WVMA 4H7MA 2YMZA 1D4M3 2DCKA 4O61A 2VNVA 2ZABA 1PO12 2XBO3 3N9QA 3RPQA 3WNNA 2Z4FA 4JZRA 4MV2A 3Q8FA 3AXEA 2QZ2A 4FPLA 4AI0A 2E53A 3PUHA 1R092 4QQ2A 1CN1A 4XAAA 1UU6A 4P9JA 1QKQA 2WS93 1IS5A 1H2MA 4XQWA 3NNGA 1MS5A 1CAUA 3FMGA 3MIGA 3RYKA 3UKTA 3LDKA 4GWIA 2DBNA 4QGMA 3AKPA 1CX1A 1QMJA 2XUMA 4KWLA 4PBOA 1ENXA 4GXLA 3MIDA 4B1LA 1IS3A 5K0UB 3IPVA 3APBA 3FE5A 3IB3A 4YG3A 4OUMA 1L3JA 5J37A 4LBQD 4EN0A 4IETA 2WAAA 3POEA 5H9QA 3VBUA 4S2DA 4B4RA 2QTWB 3OD0A 1W8HA 4A45A 3B94A 2HWC3 4HFSA 1E5RA 1VIWB 3SCFA 4L11A 4XFCA 2Q30A 4QPGA 5TSWA 2V09A 2XWJB 3J7NA 3VBOB 4AVTA 2W92A 2PHUA 2YGMA 3KCYA 1ZBE2 1XSQA 3MLLA 5IW0A 3WW1A 1LHUA 2TNFA 4FP3A 4HKLA 1N47A 4FPKA 2FCTA 1GLHA 4L2NA 2AREA 2RV9A 4MXVA 3T4VA 3UT0A 4FT8A 4JRAA 4QHBA 1HQNA 1XQNA 2K2SA 4E4HA 3OTFA 4IE5A 1SG3A 2A71A 3TN91 3ZXEA 4EJRA 3UJQA 3NQHA 3HOBA 4H55A 5DDJ1 4BM8A 4ZHNA 2B4KA 1TE1B 3TOJA 4FO9A 4NHMA 1POV3 1TMF2 4EZHA 1A8DA 5FJKA 2F17A 1MEC2 4QQOA 3KGLA 5EJ1B 4YW1A 1C8M3 5HBAA 1GWMA 3BTAA 4URTA 5F3EA 1F8VA 2GC3A 5T52A 2VMGA 2JE8A 1GUIA 5L7OB 1EAH2 2YC2A 4IL7A 5FQ0B 1QJU2 3BALA 3JD73 4CDUC 2XJTA 1KGYA 5C70A 4I02A 4HSJA 2O8QA 1ZZ9A 2EIEA 4XBLA 2VJXA 5LY2A 4A4AA 4LA2A 3T08A 4X8NA 4JAAA 2RR11 1WUVA 4FP2A 4AVCA 2PMWB 3OOXA 3TAYA 2E33A 1CAVB 2R7EB 1W9TA 4CXYA 4Y1VA 4B8EA 5C9AA 1XXNA 1W6OB 3K4AA 1WLCA 5K0UC 1PMHX 2ZMNA 4NMIA 5L9BA 1AR71 3VBHA 2R072 2P3YA 3PMSA 3WR0A 4XMAA 1N1VA 4KNCA 4XQ4A 3E5XA 1Y43B 1Z7S2 3KVAA 1CPNA 2XOMA 1WMEA 4OLLA 2RM23 1NLRA 3KHBA 4U2AA 1P8JA 1AXKA 3GM8A 1WCDJ 3NNLA 3GJAA 3AYEA 1Y9GA 1EYBA 1XB9A 1GQGA 4CCEA 1PGW2 3JQWA 2W95A 4QPYA 5LB6A 1R081 5C33A 1KQRA 1IKPA 3QH7A 3VL9A 4LBOA 1OF4A 2OPKA 3IAPA 4JQRA 3ZIXA 1XBFA 2Y0IA 1WBFA 3THCA 4O9EA 1X50A 4EN7B 4DZGA 1RC6A 3RG0A 2ID4A 4CDQA 1PO11 1G8WA 1NLQA 1OLQA 1X8EA 5FYCA 1YQ5A 1L7RA 4I3PA 4XXPA 2VQTA 3KT4A 5DQ0A 5FYBA 5FYIA 2RJ2A 1R091 4JC1A 1HRV1 3UNPA 1A6CA 1SPPB 4DXZA 4HOOA 4DRRA 3SNMA 5HPOA 3BVCA 1OFNA 4NHLA 4OHVA 4IDZA 1UU4A 2E63A 2ZGTA 1K5MA 5FZBA 3MZHA 1Q56A 4EQVA 4CCMA 5JR7B 3ACFA 3ZYBA 5FPZA 1CAWA 1TEIA 3GF6A 4HVQA 2ZGSA 2B9UA 2ES3A 3IIIA 3OBZA 4XIOA 4AWDA 3D5OA 3ZR6A 3AMPA 1HRI2 2UURA 4SLIA 1ST8A 2VUJA 4COYA 2ZA9A 5FYTA 1UOGA 1YLLA 4MUVA 3S6PA 4C1XA 3BUCA 1N3QA 1GV9A 1JYIA 2ETEA 3NW4A 4R9DA 1S0CA 2JD4A 4NIIA 1C4RA 1DGWA 1X82A 3LF7A 4NJ4A 1O3TA 1FV2A 1ZBE1 2VCCA 2Y64A 3HVDA 3W20A 3IM0A 4URAA 5AFEA 3LPFA 4XOGA 2P3JA 4QWNA 3ZXGA 4AEMA 1W0PA 2V73A 4Y1UA 2VO5A 5C6CA 3DL3A 1NAEA 1MZEA 5IUQA 5T5JA 3CHXA 1GNYA 1CAXA 1OUSA 1RUH3 2QJVA 5C8CC 1TMF1 4Q4W3 1B35A 4CZSA 2VBDA 5EFUA 4YPJA 3DCQA 2UY8A 1NKGA 1UX7A 1QJEA 3OGVA 1Z0HA 3ZVXA 1E5SA 2GMEA 2BVBA 2QCSB 1ASJ2 4QX1A 5IVJA 2ZX2A 1LOFC 4XUTA 4RHV2 2OPWA 1UIKA 3I2KA 2CWMA 2RE9A 5KHIA 2VGDA 4RR3A 5FV3A 4I3GA 5A7WB 2Y0OA 3ON7A 2V4AA 5EPAA 2RHPA 2D40A 4BJ0A 1W9YA 1PZ8A 2ZHLA 4QQHA 3WG1A 5KXCA 4OYUA 1AX1A 1J3PA 4Y5TA 5FXXA 4RS5A 1QIQA 4DUWA 5C4WA 2XONA 3W5MA 4XDOA 1S0JA 2FBEA 1IGOA 4UOJA 4M0NA 3T30A 2R071 4Y3OA 4LLFA 5CADA 4Q0QA 4MGTA 1SCSA 3ZN5A 2C24A 3OUHA 2ZOEB 5KXBA 3THDA 5DAWA 2VUAA 2RS33 4YZ2A 1W3XA 3OEAA 1PVC2 3POJA 5K8SA 1KFXL 3MW3A 4E2QA 2UWBA 4IW3A 2D6PA 3WHUA 3KB5A 1PGW1 4FPOB 1XYOA 3D6EA 3WF4A 3VBRC 2ORXA 3O1PA 1OUXA 3H8XA 5L9RA 4BOWA 2XJUA 1JUIA 1DQ0A 4QKDA 5JI7A 3KV5A 1W3VA 5CFCA 5JVVA 2YROA 4IEZA 3VZJA 3IKWA 3I2IA 3N9OA 4CRQA 5IK8A 3W9AA 4PDWB 3KMHA 5GZDA 3M3CA 4IV3A 5LK7B 1SBEA 3OB8A 4RFT0 4UFHA 1MQTA 2PAEA 2WS92 3Q8EA 3RFRA 2GC1A 3ATGA 1AYN1 4J25A 2OT7A 2P6HA 4J1WA 1VP6A 3FLPA 4N7UA 4OUEA 3KF5A 3WF2A 5HCAA 1CIYA 1IG0A 2VOTA 4IV1A 5FUPA 3T2OA 1POV0 5HV0A 2JDYA 1HN1A 5FZIA 5EHDA 3WQ0A 3VUOA 5LK5A 5FZAA 3E97A 5FKCA 1YFWA 1NE4A 5FY1A 3D3AA 1XU2A 1SBFA 3MICA 4NIAA 3NNJA 2L9LA 1WLDA 4XILA 3TEWA 2XL9A 2UU8A 1GNZA 3THTA 3WNKA 2QQLA 1DCSA 4LUMA 4EZ4A 3OG2A 2OX0A 1I3HA 4QXBA 5A7NA 1C1FA 4K1YA 3GHMA 4YVWA 5IWFA 3CEWA 4FFIA 4LKEA 5ANQA 5FZCA 2Y6KA 2X05A 3RJ2X 4CP9B 1HRI1 4WM7C 4IXLA 3NAPA 2RG4A 4I0WB 3NL1A 4QU1A 3VDCA 4AFCA 5KHKA 4N53B 4BQ3A 1DLCA 1IPSA 3AL6A 4EWEA 5J1XA 3AKTA 5JZGC 3AYDA 3ETPA 2VVEA 2JX9A 1OH4A 5LA0A 4X6QB 1YI9A 2PHTA 3C7HA 4Q0VA 1DZRA 1RUI3 4ZY9A 2HLEA 3KV4A 3C8XA 1O8SA 4RQPA 2WNVB 4CCCA 3ZXAC 1UZZA 2Q5TA 1LODA 5M0TA 3DXUA 1WA6X 4RD7A 4A44A 3INAA 4ZZ8A 1YQ8A 1H2LA 2FMDA 4QB1A 4TN7A 1EV12 2WRAA 4LR4A 1HIXA 1WA4A 2VULA 1WKYA 1HKDA 3WY6A 2V4VA 3RSJA 3AP5A 4OZXA 2D6MA 2WT1A 3RZGA 3NMBA 1U5ZA 4Q27A 4OUSA 5GZEA 2YBKA 3GALA 1ASJ1 1UO9A 4XFGA 4AI2A 1MZ6A 4AHXA 2XHNA 1QDOA 3VZOA 2HH9A 3KS7A 2CAUA 4RHV1 4AEDA 2WR9A 4J6GA 1QNYA 1XSRA 1W6PA 1W8WA 1DGRN 2VZVA 2AGSA 3WF1A 3ZO0B 5A3NA 3KVBA 3POIA 2WA3A 1OA4A 4LUKA 3WF0A 4AAXA 4XF1A 5IFTA 2DU0A 4WV8A 2A5ZA 5DZEA 1H8TB 1EUUA 2B5HA 1SFYA 4FPEA 1YQ6A 2VECA 4B3NA 3DYOA 1OA3A 1BKZA 3RQ0A 2YDEA 2C1FA 4YZ4A 1X9TA 1K12A 1ZZ6A 4XBQA 2AEZA 1U12A 1M4WA 1QF3A
chains in the Genus database with same CATH topology
2WT2A 2PHLA 3THPA 3GHNA 5FMOS 3H8UA 1LENA 5E1RA 5T3NA 2A6VA 5BNPC 4JGZA 3ZSKA 2ARBA 4LBQB 4M3CE 5DUXA 2CY6A 1CD3G 1LJ7A 2RS53 4COUA 1RUE2 3CLPA 3RJRA 4F8AA 3ZFFA 2SBAA 1EP0A 2WNVC 1OSGA 4YG0A 2WFF3 2GNDA 2P37A 4GQ7A 2R063 4QPIC 1H0BA 1Y9QA 1ZRDA 2YGLA 4XTPA 2JKBA 3AZYA 2R16A 3ZSEA 2RJLA 1GBGA 3LOIA 1RUF1 1CIWA 3NSTA 2B8MA 1W2UA 4Q4V3 4AFMA 4EV0A 1DLLA 2WZPP 3WX5A 3AX4A 4FOWA 2MPFA 4COWA 1FMD2 5F5QA 4YGCA 4TSVA 2NPIA 4Q8KA 2X5IB 2D3PA 3CJIC 1ZBA2 1LHOA 3WT3A 1QJY2 1RB8G 4QQPA 3H1WA 1NXMA 4AQ2A 2NZ9A 2XLGA 3VL8A 1YIPA 2ZGOA 2R042 5I0TA 2VW2A 4CEYA 5CFCB 3EBRA 1RMU3 3WW2A 1RUH2 2R1BA 3OYWB 2AYHA 4P9WA 5I0SA 4XHBA 4FPCA 3ZFEB 4Q4W2 4BH9A 1Q3EA 2BWAA 4BQ1A 5BNOC 3VN4A 4GIQA 1Q8PA 1EV11 4OI2A 1DYKA 1LGBA 2XHKA 3N35A 5D1IA 3WDYA 5DUWA 5GJ6A 1HRV3 3R6SA 5DG2A 3I8TA 1MS3A 3H1YA 1CJDA 4XHXA 1S1AA 4QX5A 3BB6A 1YFXA 3TB0A 1WGPA 2AR6A 1Z78A 3I59B 1BCXA 1EPZA 2HWF1 3AZXA 5A33B 1QQP2 2X53S 4JGYC 3HD8B 3MYXA 4E2GA 3KZ4C 3ZSJA 5CIRA 4Y20A 3VHPA 4FAGA 3H7JA 1LOCA 1V6NA 4ORFA 5DUVA 3O0XA 1PGL2 3FLTA 3AMQA 2BNMA 1RIRA 4DRVA 1FPN2 2FQPA 1AXZA 1H1IA 2G9GA 2OUHA 3LCPA 5JSRA 3UJOA 1MS1A 2X5IC 3SHRA 2WSUA 3ZN6B 1UKRA 3HN1A 1F31A 4A7KA 3BOWA 1NE6A 2LUWA 1YUDA 5HI0A 1RUE1 4QD2A 5J98B 4CDUA 3WUDA 4HZFA 4JVAA 4A2UA 4AXOA 1HQLA 5FOBB 1C3HA 3U4XA 2IXLA 5KXDA 3BCWA 3ZFEC 5EYYA 3VHNA 2A3WA 2VNGA 5I8SA 3WDTA 1ND2B 1YWKA 1SLCA 2CWSA 3IIAA 1ALYA 2Q1MA 2IXIA 2MEV3 3PJQA 4Q4X3 2WNUB 3DN7A 2PA7A 1PO23 5BV6A 3V0BB 5LEJA 4LBMA 4K1ZA 2D97A 2RS12 4PLNA 1FMD1 2VW0A 4LE4A 2RMU2 4AFAA 1V6OA 3MLKA 1RUG2 2IWGB 1D0HA 4KWKA 1PNFA 1TNFA 5SV5A 1RUI2 1PK6B 1LB2A 1QJY1 1NCQC 4DQAA 2BTVC 2OZJA 3MPPG 4OI1A 3ZSLA 4Z1VA 4Z92B 2R041 2F4PA 2GAUA 4CEWB 3WCRA 4JTOA 2VMHA 4Y24A 3SH4A 4CTEA 4Z07A 3TBDA 1MZFA 4XF3A 4U36A 4Y4YA 1VBB2 2HWE1 4Z2WA 1AXYA 1H1MA 2HWB3 1AYN3 1CESA 1WBLA 4Q4Y3 1X8MA 3O12A 4BWOA 1X7NA 1KDMA 1CQ9A 4P5HA 2ERFA 2JENA 4DY5A 5DUUA 5K9YA 4GB32 1R1A3 3I2DA 4HN1A 1IPKA 2UY9A 1QQP1 4DFSA 1NYWA 4R9BA 1ZM1A 4ES9A 4FQZA 3W59A 4DOUA 5CG8A 1ND2C 3LA7A 4QMAA 3NWKA 1TME3 1DGLA 4MVTA 4DNYA 2HJIA 4ASLA 3GZTB 4YW2A 5I0UA 1OOPB 4M3CA 1PGL1 5ACA3 2DURA 4Y22B 2WLPA 3ZXFA 2WNUC 4EN9B 2QUOA 4AFBA 5BNQA 5BNNC 1FPN1 2ZHKA 4GMP1 2SLIA 1DYPA 5GLTA 4YGEA 4N9HA 3V56A 2NN8A 4CDXC 1WLWA 2RS52 3WCSA 5C8CA 1GZWB 3IDEA 3ZYJB 4OVEA 3WVJA 3ZX7A 1FAYA 3LOBA 3POYA 3A0KA 4M00A 4UW4A 5A3MA 1CGPA 3R4UA 2WA4A 1H2KA 1PK6C 3USUA 3FUQA 1T6GC 1PVXA 2FZ1A 2XL7A 4N43C 1AYM1 1LOFA 5IT6A 1ENQA 5CNAA 2Z79A 3AP6A 4KGGA 4XDQA 1CVNA 4UXAA 5D8AB 1WD4A 1XE7A 2D6LX 2AENA 3B3QE 2EIGA 2CL2A 4WM8C 4AGGA 3PHMA 3NV2A 1VBC3 2GMPA 1RVF2 3OGGA 3L2YA 4LHLA 5I0RA 2ZKNA 4GWNA 1AR91 4Q0SA 2JG8B 3VKMA 1QJX3 2IXCA 1ULDA 3AP7A 3I4IA 3KQRA 4LTAA 4UBGA 1SDWA 1Q8SA 2DTYA 1JH5A 4K9SA 1XU1A 4W65A 1IQAA 3ZMNA 5BUVA 2R6QA 2RMU1 3VBRA 1U0AA 1RUG1 2W52A 3KLSA 1VAMA 2GALA 1N3PA 3D4KA 4AGRA 1YIFA 3JBG3 1O4ZA 4TZDA 2XJPA 1CPMA 4NWWA 1RMU2 1OKQA 2BW8A 4H3WA 3AFKA 1PIV3 4KWJA 2KM2A 2HWD3 1VBE2 3R0RA 1W6QB 3WP6A 1NY72 3BODA 1NA1C 2VOWA 1ND3B 1VBB1 1AR81 1HXS2 4XQDA 4FTSA 4Z82A 2ATFA 3OF1A 3ECQA 2H6CA 4LO4B 1S2BA 2ZGRA 2OVUA 3VBFB 2ZGLA 2P2KA 4CDWB 3H7YA 4TLFA 1RGSA 4D3WA 2PLV2 2WNEA 3AK0A 2NP0A 2ZZQA 2Z42A 2ZMLA 1GKBA 4YM1A 1BEV2 2JG9C 5D8AC 4GB31 5ABJB 2GMMA 4WM7A 4G9SB 1FOD2 2C5DA 4KG0A 1A3KA 3DKWA 2OUJA 2ENRA 1RUC2 2JG8C 4SBVA 2NYYA 5CG9A 4P9YA 1NZCA 4AQTA 4QU2A 1BBT3 1KD7A 2BYVE 1CR7A 1DU3D 4YRDA 4LEJA 2R49A 3FHIB 1DIWA 5KHJA 4HPKA 1YJKA 1UPSA 5FO9B 2YY1A 3TRSB 3ZYGA 3JQXA 3M2MA 4YVSB 1RUJ3 1WCSA 4W6XA 5GKAC 1AL23 3AMHA 4AVBA 2DCTA 3JU9A 2F6BA 4K7JA 5EXOA 3ZFGA 5SV8A 5JIUA 1CONA 2CGPA 1VBA1 4B29A 1S0BA 1YNAA 3ILNA 2LALA 3H3ZA 1UMZA 4DY3A 1U5YA 2EXIA 5KBFA 3VBOC 3VBFC 4A3XA 1RVF1 1AR63 2PHWA 1ULEA 1PZ7A 1D4VB 4DPNA 5GZCA 1H4GA 1URXA 1XRUA 4EWAA 2OIIA 2QNKA 1DQ2A 3KCXA 1NLSA 4GH4A 4N90A 4Q8LA 1QH7A 1UN1A 3ILRA 4XPVA 2B45X 5IK5A 3V0AA 1WW6A 5FO7B 2Y26A 3IMNA 2VNRA 3OPZA 3H0OA 3VV1A 1C8NA 4E9KA 4HVRA 5I8TA 1JUHA 2ZPXA 5KXEA 3NV3A 3M3OA 3PNAA 3G7DA 2DCJA 5L7OC 3NV1A 1O91A 5B2GB 1W6MA 1NY71 2GC0A 4QPIA 3VKNA 2GNMA 5JCTA 3KD4A 2AUYA 1AJOA 1ZYBA 4Q4Y2 4LHNA 1U5XA 3MIBA 1YRZA 4UW3A 2BNOA 2D5HA 3GBWA 3D8CA 1PGSA 4YGDA 3B00A 2WZR3 3FLRA 2BUKA 4EROA 5CFDB 3U11A 4G3YC 2PLV1 2JECA 4WVMB 2YZ4A 4Y5Z0 5AVPA 4LO6B 3ZMOA 5J09A 5JPNB 4C0BA 3MIEA 1HDKA 4XW3A 1E57A 1BEV1 4XFFA 2EALA 5A32A 3O7OA 3HBZA 3BOPA 3J26N 3TNQA 5DG1A 2Q4SA 1VBD2 1FOD1 1NCRA 5ACA2 1MEC1 2XG3A 2XLFA 3UV9A 1O3SA 1CAUB 3KM5A 4FPJA 1RUC1 1UL9A 4LA3A 3E6BA 4HBNA 3DV8A 5L73A 3ILFA 3ZDSA 3TNPB 2OW4A 3IPVB 3B9IA 1EAH1 1QJU1 1S0GA 4XEZA 4BMBA 3DPRA 2ZACA 2A73B 1RUD3 1QXJA 5T5LA 4ATFA 4NR1A 3VBUB 5BNOA 1YI7A 1COV2 1DG6A 1ZRCA 1VAVA 1VRH2 3J9SA 3JCIA 5AC92 2HWE3 4QPGB 1APNA 4F3JA 2EXJA 2ZGQA 4Z8BA 3ENRA 5E16A 4Q2FA 4GA9A 5FPXA 1UCXA 1Z7S1 2EAKA 1OI6A 2K9ZA 5IK4A 3BPZA 4XTMA 3UK9A 3VBSA 1UPIA 1W6NA 4JGYA 2ILMA 5CVRA 1Q43A 2NMOA 3MEPA 3KT7A 1VAKA 5KHGA 5JLVA 4RL7A 2DYCA 4WZFA 3WHTA 2A3YA 2BPA2 1D4M2 1D2SA 1RHI3 2XBO2 4JTNA 4FPYA 4AI1A 2X29A 3BU7A 1Q5OA 1QOTA 4OFGA 3VLBB 4BIOA 2DTWA 2EXHA 4UW5A 4HETA 1DQ5A 3ZXJA 1S0IA 2WKKA 4BYYA 1ZRRA 4PJYA 2NM1A 2A3XA 5I8YA 1F9KA 2PN5A 2DV9A 5C9AB 4FCAA 1EY2A 1WMFA 2GNTA 3VBHB 2HWC2 5JI9A 1AYM3 4XJZA 4PIZA 1HV0A 3VBUC 3N3HA 4LO8A 2PYTA 4AYUA 4S2FA 1G9DA 3E6CC 1O7FA 2BFUL 3AP4A 1V9U3 1FATA 3TYJA 3BIWE 4BIFA 1TNRA 1I6XA 4PLMA 3HT1A 3EHKA 3AYCA 1SLTA 3J8F3 1J1LA 1FV3A 4LO7A 1Q8QA 1MVEA 4CDQB 2EA7A 4R8HA 4RSUA 4MLOA 1SFNA 4AW7A 1X36A 1IOAA 2I45A 1C8M2 1VBD1 2HEYF 3ME2A 4CYDA 1G9BA 2WIIB 3EJKA 1NCQA 2ZX1A 4AVAA 4ZU5A 3JD72 3R4SA 1K5MB 4PDWC 5LK7B 1DFQA 3SH5A 1IHMA 3VZLA 1FNZA 1NQDA 1CAWB 1F2NA 2GH2A 2XH6A 1IPJA 3QBQA 4M3CF 4RGAA 1GQHA 1LEMA 1ULCA 4QT6A 1KRIA 1PHMA 3RMXA 2BGCA 2ZX0A 3VZKA 4NOTA 5J48A 1COV1 3PVNA 1VRH1 3CF6E 4KU7A 3FX3A 1AR83 4I0AA 3ROUA 5AC91 1OA2A 1UU5A 1S0FA 3ZN4A 5JSPA 1ZZ7A 2RM22 1SCRA 4ES8A 3AFGA 4OI0A 3ZXLA 2QDNA 5L19A 2H0VA 3ES4A 5E88A 4ZU4A 3RYPA 1CAXB 3AXDA 3WOGA 4KL1A 3TN93 4N53C 1JTZX 1UAIA 1D4M1 2DUQA 5DDJ3 3PMEA 1B35B 1NCRB 1AX2A 2B39A 1X33A 1H8VA 2WC2A 5IK7A 5BNNA 4WBBA 1B09A 2D44A 2WS91 3VDDA 3AP9A 2JE9A 4R9CA 4CDXA 2P34A 4PF5A 4RR3B 1QOOA 3N7LA 1PNGA 5FDBA 2BWCA 5J96B 3WP5A 3AMNA 1WW4A 2ZX4A 3AMMA 2RR13 4PCRA 4RS5B 1JHNA 1XNDA 5C4WB 2JJ6A 4K21A 2DVBA 3O0VA 1SLAA 2YC0A 3AKSA 4MGKE 1W39A 2HWC1 2XB6C 3IT8A 1AR73 1N1YA 1ZZBA 3VZNA 1LESA 4Q29A 4LE3A 3GZAA 3KSCA 4WM8A 2BQPA 2LTNA 1VBA3 2WQZC 4C91A 2I74A 1R083 4JCKA 5FBZA 3VKLA 1H8TC 2PQQA 4I01A 3PLQA 3LA2A 3MIHA 3B69A 1VJ2A 3B93A 4IV3B 2ZGKA 3DUIA 1POV1 4L8QA 1MQTB 1PO13 5GALA 4V1PA 4FPFA 2KXLA 3LZZA 4NWVA 1C8M1 2MNGA 3E5QA 4IV1B 1R093 4MZUA 1J59A 1IS6A 1KITA 3HWJA 2XVLA 1QU0A 3OCPA 3JD71 3VHRA 1UZYA 3PJYA 5FFOC 3AJZA 4J1XA 1VALA 4QXKA 2YPJA 1NA1A 3IDBB 4AQ6A 2IXJA 2GH8A 4G4FA 4HANA 4YVWB 4I2OA 4BE3A 4DB5A 2VXRA 1J58A 1LECA 4OHZA 3NAPB 1NOVA 2DFBA 2BNNA 1G7YA 2RS32 1SMVA 5A3LA 4RS5C 4YW5A 2Q0AA 1V6IA 2JG9A 3EXUA 1ZBE3 5EYXA 4YW3A 2QKDA 4RQPB 2I07B 1DQ4A 4WVVA 1H9WA 3NJZA 3ES1A 2DCYA 5FREA 4IEVA 3HMYA 4FPHA 2PFWA 4AE2A 5GLWA 2EAAA 4AHZA 1TMF3 5CFCC 2VG9A 2YYOA 5DZGA 4ATEA 2A6XA 3GBFA 4HKWA 4QGLA 1LHNA 4KH9A 2D43A 1YYNA 1FI2A 2WSVA 1XYPA 1EAH3 4AEDB 1QJU3 2DVAA 3ST7A 3X29B 1W6PB 3L2HA 5KC5A 4ONUA 3HAGA 1AJKA 5K0UA 3WLUA 4B7KA 4AI8A 1AX0A 4H7LA 4ISQA 1FX5A 1WMDA 3WQ7A 4JDNA 3UL2A 1BXHA 1Q8OA 3QH6A 1OHFA 3M8LA 2R073 2V5YA 4D94A 1Y3TA 4HT1T 1AZDA 4S2HA 5FOJB 4FTEA 4DS0A 2XVKA 4HLTA 2ZGMA 1EPWA 4DINB 3FFQA 3SCHA 1DGWX 1ZBA1 4JGZB 1XNBA 5JDBA 1QGLA 1OQ1A 1OPMA 3M3EA 3WQ1A 1XNKA 4KQ7A 3ZFFB 1RUH1 4A7YA 3MI8A 4KBBA 4Q4W1 1D0GA 1N1SA 2ZGPA 2OZ6A 1YFUA 1RITA 1NG0A 1PVC1 1ZX5A 3POWA 1J1TA 1MS8A 5L7OA 1V00A 2ZKLA 5FLIA 5FQ0A 1C5HA 1V6MA 3MFCA 2DUPA 1V6KA 3SISA 5HCFA 5KHHA 4AVVA 5JPMB 4XFHA 5KWRA 3WG2A 4BPZA 4K40A 1CAVA 1HRI3 1W6OA 4ITCA 5I93A 3H1MA <