3ACLA

Crystal structure of human pirin in complex with triphenyl compound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title A small-molecule inhibitor shows that pirin regulates migration of melanoma cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aclA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aclA01
1UCXA 5FQ0B 3CEWA 1OI6A 1X7NA 5I0RA 4O9GA 2UY9A 3BPZA 2PQQA 3H8UA 3HIFA 2MPFA 3FFQA 1UPIA 4XEZA 3H50A 2Y0OA 4KWKA 3GBFA 1EY2A 4LTAA 4I01A 1ZZ9A 3U10A 2BNNA 2BNMA 3ES4A 1RUNA 2D40A 3DL3A 3CL1A 3KGZA 3OCPA 2IXHA 1WA4A 2CV6A 1O3TA 4QXKA 5JSPA 5FPZA 2IXKA 3HT2A 4IEQA 3WW2A 5I91A 4PIYA 3S7EA 4XF4A 2VQAA 4JTOA 1SEFA 2HKXA 4Q0VA 4FAHA 5I93A 1ZZBA 2B5HA 1LB2A 3B02A 4AQ2A 3S0MA 3EJKA 1VP6A 2QCSB 2XLAA 1WLTA 3E97A 2H0VA 3O14A 1I6XA 1IPJA 3MPBA 1DZRA 2K0GA 2PYTA 4UXAA 1ZREA 1OFNA 4E2GA 4MGKE 3MDPA 4WBBA 1U12A 3SCHA 2WFPA 4META 4KL1A 2XGXA 3IIAA 5I0TA 3KCCA 4MZUA 5CU1A 1SQ4A 2IXLA 4IETA 3FE5A 4HVQA 2XL9A 4EWEA 2GZWA 2UYAA 3I7DA 4KWJA 1FT9A 4XFGA 1X82A 3N4MA 1SFNA 5I8TA 3LOIA 3FJSA 3H9AA 2QNKA 2XKPA 2GAUA 3FWEA 3EBRA 5CADA 1J59A 3USSA 3ROUA 5E16A 4Q29A 4YNIA 3GYDA 2PFWA 5KHKA 2QJVA 2V09A 1X8MA 3NVCA 2MNGA 2XKOA 4UBGA 5BV6A 4JV4A 4HZFA 1QWRA 1YLLA 2ZKLA 2IXIA 2BYVE 1FI2A 3ETQA 2BNOA 4AVCA 1FXZA 2IXCA 3PLQA 1QXJA 2B8MA 3LAGA 1RC6A 1NE4A 3LA7A 5I8SA 2XLFA 4XF1A 5C8WA 1X8EA 4EROA 4UBHA 2GC2A 1EP0A 4R8HA 4OLLA 4I02A 1O3QA 4XF3A 4K8FA 3IWZA 4MV2A 4N9HA 4EWAA 4R52A 3RNSA 1J3RA 4MX3A 2VPVA 4AXOA 2IXJA 3KMHA 4MUVA 4TLFA 3FZ3A 1ZVFA 2PAKA 3I59B 3RDIA 5J48A 1XE8A 2D5FA 2PAMA 3S7IA 3E6CC 2H6BA 1GQHA 4X6RB 3RZZA 3LA3A 5F1RA 4XFHA 2BGCA 4LLOA 3H1YA 3ZDSA 1ZZ8A 4BYYA 1EYBA 4H7LA 3IDCB 1UW8A 2GU9A 1UIJA 4QGNA 5KHIA 5K8SA 1Y3TA 4RD7A 1RGSA 3QOPA 4HVOA 4IEUA 2Q1ZB 3DKWA 2Z2SB 5LRSA 4YRDA 3NKTA 2EAAA 4LUMA 2K9ZA 4X6QB 4QGLA 3C3VA 1QY4A 1Q43A 4QGMA 5KHJA 2D93A 5FLHA 2O8QA 4ONUA 5BY5A 4XFAA 4IEWA 4PIXA 4XFBA 3U0ZA 5FLJA 3SCFA 1O5UA 2OA2A 1XRUA 3U11A 3D0JA 3CJXA 4XFFA 4PIZA 4GULA 4Q0PA 1J1LA 2E9QA 1ZRCA 4HLTA 3H1WA 3G7DA 5AVPA 2ET7A 2VECA 3WW4A 3OGJA 3TNPB 4LULA 3UKTA 2XLGA 3BCWA 1RTVA 1CAUB 3D82A 4EWDA 1OD5A 5I0SA 2ZCWA 2Q0AA 1IPKA 1VJ2A 3E6DA 3NSTA 3NW4A 3PVBB 4D7SA 2GH2A 3WW1A 2EA7A 4IEVA 1VR3A 4Q0UA 4QMAA 1J3QA 4Q0QA 5JCTA 3BU7A 2Q30A 4HSJA 1L3JA 4MGYE 3HT1A 4D7TA 4E2QA 4MH0E 5C6CA 3I59A 1ZRDA 1EPZA 2Z69A 4EV0A 1XE7A 4YYOA 2PA7A 5BXXA 2UYBA 3SHRA 4AQ6A 4ORFA 5D1IA 4IEZA 4XFIA 2OZJA 4LEJA 2ATFA 4I0BA 2XHKA 2EVXA 2IC1A 4KU8A 4E2SA 4A2UA 3CF6E 1QXRA 3LZZA 3ES1A 4J1XA 2F4PA 4Z82A 2D5HA 5E1RA 1O4TA 1NXMA 4XFCA 1GQGA 1O7FA 1OMIA 2UY8A 4HSLA 2GC3A 3CLPA 5T3NA 4QX5A 3IDBB 4FT8A 1CX4A 3BB6A 1YWKA 3QACA 1CGPA 2QDRA 1LRHA 1ZZCA 3E5XA 4LA2A 2OYZA 3L2HA 3H7JA 3SCGA 3E5QA 3E6BA 5BUVA 2GC1A 5I8YA 1ZRFA 2O1QA 1NE6A 4L2NA 5FCCA 4J1WA 2QVSB 5KHHA 5BPXA 1CAVB 4Q0SA 5FDBA 1YFYA 4I0AA 4PJYA 5LEJA 5FLIA 3ELNA 4FAGA 4DINB 2CAUA 2DCTA 3M70A 4HN0A 1TQ5A 4QM9A 1HW5A 4I3PA 4B29A 1UD1A 4IEOA 1YUDA 3NJZA 1ZRRA 5JAXA 2GC0A 4OFGA 3IBMA 4WVZA 4KU7A 5EZWA 1O5LA 2N7GA 4AVAA 3NL1A 2MHFA 3FHIB 1Q3EA 3ACLA 3CO2A 1CAUA 3LWCA 5JR7B 3I54A 2I45A 4O9EA 3H3ZA 4AVBA 4YARA 1I5ZA 1O3RA 4IESA 3OD0A 2ET1A 3D0SA 4KWLA 3E5UA 5EFUA 1H1MA 4F8AA 1DGWA 1ZZ7A 3DN7A 1NZCA 1PM7A 4L11A 4BH9A 4F7ZA 3ST7A 1RUOA 4XETA 1CAWA 1J3PA 3OTFA 4WZCA 1WGPA 4ZU4A 2C0ZA 4MGIE 5J3UA 1O3SA 4BIFA 4MGZE 5JSOA 2FMYA 3EO6A 2CAVA 1ZX5A 4I2OA 1CAXA 1Q5OA 4P9GA 3R6SA 2PHLA 3KGLA 4NVPA 2FQPA 2P17A 1G6NA 2PHDA 4Z07A 1J58A 1H1IA 4IEPA 5KBFA 2PTMA 1ZZ6A 3RYRA 4BHPA 5KHGA 3RYPA 4LUKA 3FX3A 3H7YA 5I0UA 2Q4SA 3JZVA 3WW3A 4FBFA 2ETEA 5FPXA 3BALA 3PNAA 1CAWB 2OZ6A 3HQXA 1DGRA 4JVAA 1V70A 1Y9QA 2WC2A 1YFUA 3OF1A 1CAXB 4ZU7A 3SMHA 4QM8A 4HVRA 1ZNPA 3KSCA 3UKNA 1CAVA 2OPKA 3TNQA 2HJIA 1YFWA 3UKVA 3MZHA 3SXWA 4JTNA 2CGPA 5FQ0A 4IEXA 4IEYA 5CVRA 3LA2A 1YHFA 5JSRA 5LRRA 2PAEA 1RL3A 2KXLA 3RPQA 4HBNA 5J7MA 3M3IA 4IERA 1NYWA 3VHRA 3RYKA 2BEOA 4HN1A 3DV8A 1PMIA 5LEKA 3EQEA 1DZTA 5HI0A 4I09A 4CYDA 1LKNA 3H3UA 2XL7A 1YFXA 4HMZA 1JUHA 4YSFA 3MYXA 4N9IA 1UIKA 2H6CA 3EHKA 4LA3A 4XF0A 2B9UA 3H1MA 4XF9A 4ZU5A 1LR5A
chains in the Genus database with same CATH superfamily
1BHGA 2KR2A 2E7QA 3CEWA 2YPJA 2JB4A 2VUDA 1RUE1 2MEV1 1OFSA 4A6SA 1JH5A 4QPGA 5T5OA 4D69A 3HN3A 1LNSA 2GP5A 2OT7A 2PQQA 3AMPA 3H0OA 3HIFA 5BYNA 5IJRA 2UURA 1UPSA 2Q8EA 4XEZA 5IVFA 2W08A 4TN7A 5C3RA 4KWKA 1EY2A 4NUBA 3ZOIA 2VQTA 3U10A 3AVSA 4CUAA 2BNNA 5GLWA 2DTWA 3VKFC 1ENRA 1JZ5A 3B9CA 3WG3A 2IVIB 1QQP2 5K9YA 2ARXA 2QE3A 3KGZA 1OQEA 3MLJA 5FYYA 1WA4A 2CWMA 2I2SA 1YI7A 3WNNA 3DGTA 1NLRA 1URXA 1MVQA 1BLZA 1GBGA 4KMQA 2JENA 4IEQA 5BNPA 4OHWA 3N7KA 1W8NA 4XF4A 2VQAA 1H0BA 1RUF1 2BUKA 4NIIA 4Q0VA 4FAHA 3POFA 4QX1A 2VOVA 1CIYA 1W8FA 4AGRA 4C1WA 2J1UA 2ES3A 3ZO0B 4BISA 2H0BA 4OHYA 1SCSA 1LB2A 2RJLA 3IMMA 1NCQC 3NNFA 1ND3C 4BQ5A 4XQDA 3O1SA 4XDQA 5FZMA 2XLAA 1OH3A 1GZ9A 1LOFA 4BE3A 1D4M2 2PHTA 4J25A 1OPMA 2PYTA 1IPJA 3MPBA 5GKAC 3ZFEC 1UY4A 1GU3A 2FCUA 1MS9A 5AC91 1IS3A 1C5HA 3LFIA 4WBBA 4HK8A 1N3QA 3CBNA 3O0WA 2Y33A 3SCHA 5DAPA 5DDJ3 3AB0A 5A32B 1DYKA 3I4IA 1KD7A 5FZCA 4DEQA 4D94A 1AR91 4KL1A 4DXTA 5B4NA 1UZVA 3HVDA 2Y0IA 3P5BA 4LK7A 3TEYA 5LK7B 3M4FA 1SQ4A 2QFEA 2VH9A 2W39A 2VC9A 5KR7A 1POV1 2YC2A 4BPZA 4EWEA 5A7OA 2PHFA 1REFA 2PLV2 3VUOA 1GFF2 4XFGA 1X82A 4CTEA 3N4MA 5I8TA 3ZR5A 1EV13 3V64A 3LOIA 4OI4A 4AQSA 3FJSA 4IW3A 2XKPA 2GAUA 1HN1A 5FR3A 5CADA 2D7FA 3USSA 1HKDA 2EAKA 4LBQB 1YQ6A 1ACCA 2YMZA 4LE3A 4XPVA 3WVJA 1UWWA 3VBHA 1PO11 2RS51 3WOGA 4JGZB 1V6IA 2PFWA 5A70A 2CGNA 3NVCA 2WABA 5FIXA 2XKOA 3X29B 4FPLA 3EB7A 3LD8A 3KT4A 4Q27A 1XU1A 4JV4A 3PTYA 2A70A 5DAXA 4QD2A 1N47A 5FKCA 5FPBA 3W59A 4CDUA 3SKVA 2IFWA 2BYVE 4BMBA 1UOGA 1WW4A 4AVCA 2IXCA 3N3HA 2Q8CA 1QXJA 4LBJA 3WNPA 1SLCA 3ZR6A 3RMYA 1RC6A 1F15A 3ZXKA 1NE4A 1W6NA 5ERLA 2VOXA 3IKWA 3LA7A 5JOZA 4IGQA 4UF0B 1JYWA 3O1MA 1MS5A 1Z7S2 2WS93 1EAH3 1BEV2 2SLIA 3H42B 1W8TA 2VD7A 3FLRA 4NHMA 4WZFA 4EROA 4ET7A 2DVAA 2GC2A 5A6QA 4ZZ8A 2VZVA 4AZZA 4XXAA 2DCKA 5DUWA 2YROA 4IL7A 3IPVA 1ODNA 3IMNA 4P5YA 2B4KA 4R8HA 4E4SA 1O3QA 1QQP1 1H8TC 4DZGA 2EIBA 4XUTA 4BJ0A 4XF3A 4K8FA 2AYHA 5FTTC 2E26A 5L9BA 1SBDA 1W05A 4R4ZA 4R52A 2VPVA 3UETA 3KMHA 3NAPB 1W8ZA 3WDYA 1JZ6A 2XHNA 3RDIA 1W3VA 4CP0A 1NLSA 3HR9A 4R9AA 3W58A 5B2GB 5A7SA 1PGW1 1TNFA 2W92A 1LGNA 1UZYA 2D43A 3FUOA 2SBAA 1W3XA 2NQYA 1H2MA 4MXVA 5A3LA 5IT6A 3T0DA 1GP5A 2H6BA 3BI3A 4YVSC 2Z79A 1RUG2 2WJSA 3LA3A 1FPN2 4YGCA 4A41A 1WD3A 4FOQA 1YRZA 1EYBA 1XSRA 4H7LA 4C8DA 1D4M1 5BNNC 4BOWA 3IDCB 4UFMA 5DUXA 4CCOA 5AC93 3AX4A 2HWE3 3DKQA 4L92A 4QQHA 1ENQA 2YU1A 3OGVA 4QHZA 3RI9A 4QGNA 1UIJA 3WNLA 1LODA 2E7TA 3KD4A 3ZYFA 5C3OA 5K8SA 1AJKA 1OLME 1XE0A 1AR93 1RGSA 3N7JA 4PI0A 4RD7A 2D44A 2Z2SB 1T2XA 2C6SA 5LRSA 1ULDA 2E31A 4MO3M 5DAWA 3MFAA 4CUBA 4UOJA 4CEYC 5JOYA 1POV3 4XDOA 1BK1A 2K9ZA 3VGIA 4BXSV 1KDKA 3USUB 2QQWA 5HV4A 4OHVA 4CU7A 1QY4A 2PLV1 5ABJB 1Q43A 3BTAA 3N9NA 1V6NA 3LPGA 5KHJA 4BK5A 2D93A 2ZGSA 2O8QA 3LB9A 5JXGA 4CA9A 3KCYA 2JE9A 4XFAA 3RQ0A 4PIXA 1UO9A 3LEKA 3FFZA 4OI1A 3WCSA 3DCQA 4K3UA 1PO13 2RS53 3SCFA 1O5UA 2J22A 1W0PA 3ZIXA 5FZ9A 1IOAA 3U11A 2XH6A 3CJXA 4XFFA 2BPA2 4CUGA 4GULA 1HXS1 4Q0PA 1VBE3 3VL9A 1J1LA 5FY7A 3ZM8A 2D3SA 5FZEA 2GNTA 5J98B 1W2UA 3WDXA 5C33A 5AVPA 2DV9A 2C24A 5G05L 3JBG1 3WW4A 3SKJE 1PX3A 1LHOA 2GMEA 3F2ZA 4FOYA 4O7XA 2NN8A 4HOOA 1BQPA 5J36A 1K3IA 4UF0A 3URFA 3M3CA 3K4AA 3AFGA 1BK0A 3BCWA 5FZ3A 2JDYA 1J83A 1Q8PA 1Z7S1 2ZGRA 3D82A 1BEV1 5I0SA 5EXOA 4D8MA 5IVJA 2Q0AA 1AJOA 2P6CA 5GLUA 5FZKA 4AR2A 3C7FA 2NPIA 3FLTA 2Q1MA 4Q5OA 4LE4A 1IS4A 2ZGUA 5FZ4A 1QQP3 1G7YA 4F83A 4HKOA 2GH2A 1PZ8A 1S2KA 2EA7A 1DHKB 3SEEA 5JCTA 2Y8KA 4YZ1A 1GMMA 3BU7A 4XVHA 3GCXA 4S2HA 5K0UB 3G6JB 3K3NA 2E7AA 2YBKA 5IHRA 2C9KA 1L3JA 3NJXA 3AP5A 3HT1A 3GZEA 2WDBA 3S57A 4TWTA 3MV01 2JDZA 4YYOA 1UKGA 3BYWA 1QDCA 3JD72 1VMHA 2VZ1A 1I3HA 4AQ6A 1OA2A 3V56A 2WA4A 1N1TA 1RUG1 1M06G 5FUNA 3RG0A 2ZX1A 3AZXA 1D4M3 1DQ2A 5ANQA 1MVEA 2GP3A 2UWCA 3ABZA 3VBSB 5IUQA 5A7QA 4LOSA 3J9SA 4IUGA 5FFOC 4QXHA 2YBPA 4Z82A 5E1RA 4XFCA 1H6XA 5EHDA 5FO7B 1OMIA 2WNUB 2UY8A 2GC3A 3CLPA 2I07B 2K46A 2QUOA 2XVGA 5T3NA 3AJYA 4QX5A 5A3PA 2VY0A 2P3YA 4AFDA 1CX4A 3INAA 1HIXA 1UF2C 2A3XA 2ZEYA 4XUNA 2R6QA 1LRHA 3USUA 2JKBA 2PLV3 3DPRA 2OYZA 5IVCA 4BQ4A 2XMLA 5ABJA 4XUQA 5HBAA 1PNFA 2VZQA 3VDDB 3H7JA 5CISA 3OYWB 5FWJA 1RUC2 2W68A 4IDZA 5FYCA 3ACHA 3OUJA 4S2DA 4CEWB 4CDXC 1DGLA 5L7OC 2GC1A 4H2AA 1YYNA 4NHKA 1N1VA 2BRTA 2O1QA 4EN7B 5F5CA 1BBT2 3M3OA 4J1WA 1W0NA 4IE0A 4XUPA 4BQ2A 3DXUA 5GZDA 1JS9A 4COWA 5FDBA 4CU9A 4MLOA 4AFAA 1GWLA 1U5ZA 1WLDA 1JXNA 5LEJA 3OBZA 4JDNA 2ERFA 1JYCA 2W2IA 5FLIA 3ELNA 2R32A 3FMGA 2J1AA 4IV3A 4GZ9A 4WM7A 3OB8A 4FPEA 4Q4Y3 2XQRA 3FHAA 2BZDA 1TQ5A 3LE0A 3SITA 1HW5A 2AGSA 4Z92B 1KITA 3CJIA 2ZPXA 4IEOA 2ZEZA 4JX0A 1IQAA 4N43C 2ZHMA 1JYIA 1XB9A 4XAAA 1ZRRA 3ZN6B 3UL2A 3T1LA 5EZWA 3VBRC 1AXKA 1O5LA 2N7GA 3C7OA 4GJYA 2YU2A 1OA4A 3AYDA 4M0NA 4M3CA 4C0BA 2ZGKA 3J26N 3TRSB 1Z7S3 3TAYA 1BEV3 2JE8A 1VB4A 1FOD2 2ZX3A 3AP7A 3D5OA 1MPXA 2D6OX 2D6MA 2BFUS 2VW1A 4LBOA 4YM3A 3MIEA 3LGRA 3GM8A 4UWDA 1QH6A 5F32A 4AF9A 1WCKA 1HB3A 1RXGA 4EN9B 2EIGA 2W3JA 3OD0A 4OUMA 5BNOC 5GLZA 4RQPC 1W8OA 3D0SA 4KWLA 5T50A 3ZN4A 1XYPA 4XJAA 1PMJX 1YNAA 5K0UA 2R49A 4L11A 4BH9A 4Q8KA 5FZIA 5LA0A 4QX8A 4BB3A 4P9YA 3ST7A 2XJSA 1RUOA 3HBZA 1KXGA 4KWUA 4YGEA 4WVWA 1PK6B 1TMF1 1YCIA 5FBZA 2WN3A 3LEGA 4YFZA 3HEIA 3N9OA 4WZCA 3WY6A 5A7NA 3RZMA 3SC7X 3ACFA 4MGIE 1GOGA 3B69A 3JD71 1V9U2 2CHHA 4YPJA 2X29A 1VBB2 1O3SA 1JU4A 2YB7A 1QJX1 4MGZE 4N8MA 4UW3A 4W4ZA 4CDQB 1TNRA 4IE6A 4I2OA 1RUG3 1YIFA 1FPN3 1F31A 3AMMA 4GH4B 4EN8B 2OX0A 2P17A 2LROA 1AVBA 2R062 3KB5A 4BM8A 1JHJA 4OHZA 4E9KA 2BWAA 3MUZ1 3VBSA 2WQ8A 2DUQA 3M7AA 3NKGA 1H1IA 1F8VA 1NCRC 5GLTA 1STMA 4AEMA 3KF3A 5JMCA 5KBFA 3R4DB 3ACGA 1TME1 1GQPA 5HCAA 2ZX0A 1V6KA 4M4PA 4LUKA 3KHBA 4A44A 1NOVA 1JW6A 2YYOA 2ZAAA 4QB1A 3I3QA 3JZVA 4RS5C 4QPGC 5GZFA 1HRI2 1YI9A 2G9ZA 1CAWB 2Y6KA 3AMNA 2WWJA 3BALA 3GNEA 3WF0A 5B4XA 5A3OA 1HJGA 2WL1A 3VDDA 1UQXA 3OYWA 2ARBA 1Y9QA 3ZMOA 1D2SA 3WDVA 4CEWA 3ECQA 1RUC1 1LHVA 4U36A 3AL5A 3VN4A 1Z78A 2ZMNA 3S5QA 3SMHA 3FBYA 4HVRA 4P5HA 3UKNA 2BVVA 1B35B 1BBT1 2Z5WA 2OPKA 5A6XA 2HJIA 3MZHA 3KS7A 5IATA 4K1ZA 2W52A 2GMPA 4IEXA 2R073 1W9SA 2E51A 2VL4A 3JXSA 3BVCA 1DDLA 5JUVA 3BU0A 3LCPA 5LRRA 2PAEA 5BNPC 3ZKYA 1LJ7A 3RPQA 2C4XA 5J7MA 4IERA 2VMDA 1NYWA 1ULOA 2AEZA 2W1SA 3B7MA 4Q4X1 3VHRA 1LU2A 2WWSA 4JKMA 4XJ9A 3SISA 5KC6A 3ZN6A 4N43B 2ZXQA 3Q8CA 2A7AA 4MGSA 1W9TA 1VAKA 3NV1A 2FDGA 3WLUA 2JICA 4FCAA 1S0BA 5TSWA 4LLFA 4ZKTB 4UT5A 1FOD1 4UAPA 5DN2A 1YEWA 5CFDC 2JDNA 1OSGA 1LOFC 2O0OA 2VVFA 1WUVA 2OPWA 1GANA 2VBPA 4HMZA 3A22A 1JUHA 5SV5A 2Y6JA 3C7GA 3M8LA 4XHBA 2RG4A 1GLHA 4YFWA 3RVHA 3UJQA 4AL9A 4Z2AA 5A3NA 4LBMA 1JN2P 2KD7A 3THCA 4RQPB 2JG9A 2QQUA 2J1TA 4XF9A 1AYN3 5FQ0B 4CCNA 2VOKA 3O0VA 5FYIA 3SLIA 4QPIB 1PK6A 3OGSA 1OKOA 3C8XA 2FCTA 1CZVA 1L7LA 3JCIA 3ME2A 1B09A 2UY9A 4YZ2A 1W9FA 3I2OA 1DCSA 3WHUA 2MPFA 3FFQA 3TEXA 1V9U1 3MHZA 3H50A 3ZIWA 2Y0OA 3GBFA 2B45X 2VBBA 2WT2A 3M1HA 4UFKA 1JOBA 4GH4A 3IM0A 3PIJA 3WDWA 4DIQA 4BLIA 4CDWB 4FFIA 1IG0A 2HWC2 2RM22 1XYNA 2R061 4A7YA 1GOHA 3VBHC 2J42A 1NXD1 5C9AA 5T5PA 2BBAA 2P34A 2WNEA 4W50A 3KV4A 4DXZA 5FPZA 5C5UA 1OF3A 3H8OA 2QTWB 2IXKA 5HCBA 4Q1RA 5I91A 2W9XA 4QWNA 1RUE2 3M2MA 3MBWA 5A7WB 1SEFA 1LGCA 2HKXA 1S55A 3K77A 2WZPP 1IG3A 5I93A 4DQAA 1DQ1A 1HRI1 2O8OA 4QPGB 1H6YA 1S0FA 4GB33 1OQDA 5BNQA 3DUIA 4CSWA 2EIEA 3ZYBA 2B5HA 4P9IA 2W94A 4AQ2A 3EJKA 1OVPA 1EUTA 1RUC3 3ATGA 5GLVA 1UX7A 2QCSB 2ORZA 3OJBA 4IE5A 2FDFA 1N3PA 1RVF2 1WLTA 1BBT3 2H0VA 3UK9A 1B35A 2K0GA 4UXAA 1W6PB 4CCKA 1ZREA 1OFNA 1QIQA 4A7ZA 4MGKE 1FMD2 1F9KA 3A4UA 2RE9A 4JHZA 1SLIA 2WWUA 1JTZX 1U12A 4HK9A 1DFQA 2WFPA 4META 1UN1A 1D2QA 4AI8A 3RJ2X 4GWMA 1DQ6A 1U5YA 3IIAA 4Y24A 1LOEA 2RJ2A 2UU8A 2XUEA 4LKEA 4O65A 2IXLA 4P9XA 1JMUB 2XL9A 5DG2A 2WBKA 4EZHA 5KXEA 1RUF2 3I3EA 5FZBA 3B00A 1FT9A 3IB3A 3BIWE 3I2IA 1ND2A 2PELA 3AJZA 2RR11 1SFNA 3H3LA 4Q1PA 4X8NA 3WG1A 1JZ3A 3JB8A 1ZA4A 1FOD3 1JHNA 1X9PA 3FC0A 1J59A 1JZ7A 3FWEA 3EBRA 2ZAHA 1S2EA 5E16A 3VV1A 3HJRA 4AOCA 4NPLA 1QNYA 4YNIA 5FMOL 3ZFFB 3ZVXA 1KRIA 3R05A 5C8CB 5CKMA 1PX4A 1O4ZA 1UU4A 3K48A 3VZKA 1AYM2 3T3YA 5KHKA 4W6XA 1X8MA 1CR7A 2D6KA 1S0GA 4RHV1 1QU0A 4HZFA 1WBLA 1YLLA 5FP9A 1O6UA 4QPIA 4ATFA 3IDAA 5FK8A 1FI2A 4EN0A 3ETQA 2BNOA 1FYUA 2ENRA 1K5MB 2DFBA 2GALA 3PLQA 1LOAA 2B8MA 3UNPA 2HBUA 4YZ5A 1MS3A 2P4EA 1HN0A 1V9U3 1KJRA 1VBB3 2E33A 4W6WA 5DQ0A 3RWNA 3VKOA 1ZBA2 5DAVA 2OIIA 2Y60A 1NKGA 1W6QB 2V4VA 3VBUA 2FDIA 1ASJ2 1QHDA 3AFKA 4NO4A 3A21A 4MYEA 4YM1A 1E5RA 3RJRA 3MIBA 4CDWA 4H55A 2R063 4LHSA 2HWC1 2RM21 4CU8A 3T09A 2XJPA 3CU7A 3QBQA 4FI9A 4OLLA 2GN3A 1RYYA 3ITQA 4QU2A 2FZ1A 3B93A 4LMFA 3QH7A 3N7LA 1SLAA 5FMBA 1COV2 4EWAA 2X5IA 3GGLA 2XG3A 5FZ1A 5J37A 2HEYF 4AQTA 3T0BA 4AXOA 4CCDA 2IXJA 1UYYA 4RN5A 3NNJA 2GDFA 4DO0A 5KXCA 5GM0A 4TLFA 4D0QA 1WBFA 1ZVFA 2PAKA 1VE0A 3OBTA 4Q4V1 1I5PA 2RJKA 5A7WA 4CDUB 3O1RA 4ZY9A 2D5FA 3ZXAC 4NHYA 1HRI3 2RMU2 5JIAA 5ISLA 2PAMA 1XNBA 5IFTA 1A8MA 1MQTA 3E6CC 4OUSA 3J7NA 2VMCA 3AMHA 3W5MA 2QDNA 4GWNA 3OY8A 1S1AA 2X8KA 1W6NB 5F1RA 1NY72 3ZPYA 1VRBA 4B7EA 4DOUA 2G1MA 1OUXA 4BYYA 1RVF1 1OURA 4A4AA 2DBNA 4CZSA 1W6PA 3O5SA 3POIA 4D7YA 3AZYA 2QQPA 4PI2A 1FMD1 2GU9A 5EJ3A 3IPVB 4HG6B 3MIGA 5FZLA 2F4LA 1SZBA 4XQWA 3W9AA 1VRH1 2UWAA 4OQ9A 3C7EA 3ETPA 2BW8A 3NO8A 4CCJA 2WQ4A 3THTA 1H2KA 3NAPC 3NKTA 3GDBA 4K21A 3NMBA 2EAAA 2WINB 4M3CF 1RUI2 4RGGA 2PMWB 5A6ZA 5IK4A 4X6QB 1VPHA 2IFRA 5F39A 3C3VA 4MHUA 1PGW2 2XONA 3ZYGA 4A42A 3AYCA 5FLHA 3RZGA 2DFCA 4HL0A 1JU3A 3ZFGA 4R9CA 5EJZB 1REDA 5FMDA 4NHLA 3VHOA 1ST8A 3ZFFA 3C2UA 3RZLA 3AYEA 5C8CA 1UKRA 1SACA 1XRUA 5FAXA 1C3HA 3D0JA 3Q8FA 4RA0A 3VDBA 1AYM1 2XJUA 2HWD2 1AZDA 3T0AA 2VXJA 4DY3A 2XOMA 4TYSA 2XBO2 1WA6X 3GZAA 4AI9A 3BIEA 2CY6A 2WRAA 4LIVA 3QD6A 3PJQA 2Y6FA 3G7DA 2V4AA 2WT1A 1K5MA 2ZHNA 3TNPB 4CUCA 4FPKA 1LULA 5FYBA 5E6HA 2BGPA 1GZTA 1OT5A 2CL2A 4LULA 1YO8A 4MOAA 4R4XA 4A3ZA 1YXWA 5ABJC 5LK5A 3BN6A 1ZBA1 1W6QA 4LKSA 4MGQA 2X53S 4AEDB 4B1MA 3NV3A 1ASJ1 1HJFA 2BDRA 2ZCWA 3PJYA 4NAOA 1W2AX 1HX6A 1SBEA 1WZXA 3I3BA 4I3GA 1IPKA 1VJ2A 2HWC3 2RM23 3NW4A 4OULA 3ZMNA 3PVBB 5FOBB 1QJFA 3O0XA 4BK4A 2CTVA 1UOFA 5A3UA 4QMAA 1CD3G 4Q0QA 4IV3C 1COV1 2Q30A 4WM7C 4QDQA 1HXS2 2WLPA 4MGYE 4RGAA 1CX1A 4GJZA 4E2QA 5C6CA 1RUE3 3CJIC 2MEV3 5A3MA 4K9SA 1EPZA 3N9MA 1R64A 5FZ7A 4QB6A 4QQPA 4EV0A 3I97A 1E5IA 2RMU1 1JUIA 3JBG2 4FPOB 2UYBA 4RFRB 4WM8B 4PDWB 5IW0A 4NAMA 2GSYA 2WN2A 4I0WB 2VNVA 2OZJA 4YWAA 4FFFA 4ZXKA 2ATFA 1PZ9A 1W9WA 2XUMA 3MO4A 4OI2A 4Y1VA 1NG0A 1DGWX 1GV9A 1NY71 1UYXA 1OD3A 1RVF3 2AR6A 1LHNA 1Q8VA 4QX2A 4JDOA 5LWBA 1QXRA 1FMD3 1M4WA 5IVYA 4DUXA 4IGPA 4PQ9A 2F4PA 2WAOA 2D5HA 5FPAA 1O4TA 1NXMA 3LEMA 2VNGA 1GICA 1GQGA 2JDAA 3U1XA 3P6BA 4IGOA 5K0UC 1KQRA 5FXWA 1XJAA 3IDBB 1VLNA 2PHUA 4FT8A 1YWKA 1GNHA 4HXCA 4JQRA 1FATA 1NUKA 3I2KA 1RUF3 1RUI1 3E5XA 4LA2A 4GWJA 5EWSA 2A1XA 5CFCA 2RS32 2YFZA 3HAGA 1PZ7A 5GJ6A 1CJDA 1FV2A 3KV6A 4BCUA 2A3YA 4MXWA 5T52A 1TZOA 4L8QA 1C1LA 5BUVA 1WCSA 2WO1A 2Y38A 2W47A 3K2OA 3KQ4B 3MIDA 4WV8A 4Y4RA 4YG0A 1UU6A 2VCMA 5L9RA 2ZHLA 1NE6A 3UGHA 2DYCA 2FMDA 2QVSB 5ANNA 4L0PA 5BPXA 3TOJA 3VBSC 1CAVB 4PCRA 2W1QA 3JQWA 3NWKA 1PIV2 4Q0SA 1QJU2 5GALA 1AYM3 2LTNA 4JCKA 3MLKA 2D97A 4NIDA 1KGYA 4DINB 2QBXA 5LA1A 2CAUA 2WNUC 3WNMA 1NQJA 2HWD1 2OUHA 5F6KA 2BQPA 3WNOA 3MW2A 2XBO1 4LNVA 4QM9A 4I3PA 5DZEA 3SH3A 3TEWA 3WINE 1UD1A 3OBRA 4B29A 3TN91 2FDHA 4FOWA 1PGSA 3K46A 3JU9A 2ZOEB 5CNAA 1H2LA 3NJZA 4AG4A 4BZ4A 3VZMA 2DVFA 5KXDA 4BA6A 3KT1A 2JWPA 4QX3A 4Y1YA 5FBJA 3JB4C 3O1OA 3BTYA 3RZJA 4EE2A 1GSLA 2HWB1 4BQYA 5JDBA 1ZBA3 2D6PA 3DECA 3DPRB 2MHFA 3VDDC 5CEHA 1Q3EA 1ASJ3 2BU9A 4CEWC 4AEDA 1U5XA 4COZA 3LDRA 1DG6A 3I54A 4HFSA 3PTRB 1MS0A 1IZ3A 4KG0A 1AXZA 1UYZA 4YARA 2AUYA 5JVVA 4QQOA 3WG4A 1H1AA 1Q56A 1O3RA 1OLRA 4LO6B 4H3WA 1K42A 3J4UH 3CMGA 1MEC1 3SNMA 4B1LA 1COV3 2B39A 1QF3A 2YFUA 1NZCA 1PM7A 1SMVA 1ONAA 2NMNA 4URAA 1Q8QA 1POQA 4IV3B 4XMAA 4WM7B 5A33A 3WF2A 4B8EA 4QQLA 4XETA 3WQ0A 4RYDA 2RMU3 2VUAA 5FPVA 3CJIB 4AFMA 1UMZA 4WM8A 1GP6A 5JLVA 2VZRA 4Z2WA 4PDWA 4GXLA 1YC61 3HWJA 5FP4A 4AHZA 5IYYA 2B7YA 3J7MA 3EO6A 4NROA 2R0FA 1ZX5A 4FFHA 5F2WA 1CN1A 3T2PA 4M3CB 1Q5OA 4P02B 3OEBA 3R6SA 5A3TA 4K20A 4K7JA 5HXMA 3W5NA 2A6VA 1JYVA 1G6NA 3GCWA 4NOTA 4PLOA 1CJPA 1GZWA 1RJ7A 2VM9A 2PHDA 2ZGLA 4P14A 4QKBA 1SHWB 2VTXJ 3UJOA 4AAPA 1WW5A 1J58A 3GXUA 1QJZA 3PUHA 4OVEA 4XC9A 4CP9B 3AZVA 5EIYB 5FO9B 3WUCA 3B01A 3N36A 3RYRA 3S5AA 1WLCA 1JZ4A 4BHPA 5FK7A 1S0IA 1ALYA 3HOBA 5F7UA 4LIUA 3K51A 1BVP1 1AF9A 2I74A 1MACA 4QDSA 5I0UA 3AVRA 2Q4SA 4EZ4A 1UY1A 1UXZA 1PK6C 4D6QA 4FBFA 2HEVF 2VUCA 4GIQA 1TMF2 5FYTA 4DPNA 4YVWA 4URTA 1IS6A 2OZ6A 2BBVA 4QX0A 4HONA 1DGRA 4QX7A 2CDOA 2RS31 2ZEXA 1QH7A 3I2JA 2WC2A 4CDQC 1QJX2 3AP6A 1ULPA 1YFUA 1H4GA 1S0JA 4GH4C 4S2GA 1F35A 3OF1A 1W90A 4QM8A 4GALA 2DWRA 4MSVA 4Q26A 4Y22B 1H2NA 4NRQA 5HPOA 4YW5A 4ASKA 3VZJA 1KS5A 2IVJA 1CAVA 3MPPG 5JI7A 3ZX7A 3EYPA 1U0AA 1AUYA 2XJVA 1PIV1 1QJU1 3RWKX 2HWD3 4CXYA 1SLBA 4IEYA 5C9AC 5CVRA 2XBO3 1TME2 3LA2A 4FPHA 4XMIA 5J96B 3PUIA 5JI9A 2DCJA 3RYKA 2ZZJA 3VD7A 3LSEA 5KC5A 4N7UA 3KV9A 2BEOA 4D3WA 3B94A 5FZDA 4HN1A 5FY5A 4GA9A 3MICA 2XXZA 3BTXA 4NIGA 2P3KA 5DXDA 4BWOA 3BOWA 2JX9A 5FXZA 5FY0A 1LKNA 4GKXA 3D6EA 2HYKA 1ULFA 2ZGPA 2WO7A 5AVAA 1LOBA 5EP9A 3QLQA 1G9BA 1B35C 5I0DA 2J1VA 3WNKA 5J09A 3MYXA 2ZA9A 1UIKA 4Y26A 2WSVA 4ARXA 2H6CA 4GWIA 4TSVA 3H1MA 4ZU5A 2WAAA 3WQ7A 1W6OB 1BMV2 1CWPA 1UCXA 4J6GA 1HXS3 3SH4A 3HD8B 5FY1A 2P2KA 4DRVA 5I0RA 3RFRA 2Z42A 2XJQA 5A1LA 5FY8A 1UU5A 2PN5A 3JBG3 4NWVA 4LPLA 3ZXLA 3BPZA 4Q4X2 3H8UA 2RS12 1MZ6A 5A6YA 2R041 1UPIA 3NJVA 5HCHA 2R1DA 4I01A 1ZZ9A 2KA3A 1LGBA 1DF0A 4XJ8A 4KNCA 1AXYA 2ZS6B 1V6JA 1VBD2 2QZ3A 1UZ0A 4QPWA 1RUNA 3AXEA 4FPJA 1I1EA 1OQ1A 2JDPA 3I3MA 2NP0A 5IK7A 2OS2A 3H8XA 1UMIA 2QQNA 3CL1A 3OCPA 2Q8DA 2IXHA 4DNYA 4CP9A 2O14A 3IDEA 3WX5A 5AFEA 2BOIA 2CV6A 3P3NA 4DMIA 4QXKA 2JDHA 1IPSA 5JSPA 4PHZA 3MF9A 2DVBA 2JG9B 3WF4A 4QAWA 3VZLA 3HPNA 1O8SA 3HT2A 1RMU2 1X50A 1NA1B 2OXBA 2P1BA 4PIYA 4QPIC 3WW2A 3S7EA 4BQXA 2ZACA 3RZKA 4AEJA 4FSJA 1RUD2 4MHRA 4NRMA 3AP4A 1QKQA 1ZZBA 3N9QA 2RS33 3GF6A 2RDSA 2YZ4A 2EICA 5DZFA 3W21A 1DLLA 2P3JA 3PURA 2D3RA 1UY0A 1SFYA 2QQOA 4IV1A 2VU9A 4YW7A 3VBUC 3LIGA 2XR4A 4Y33A 4ZS2A 3L9JT 4BDVB 5LW9A 2WYSA 5C4WB 1RB8G 3OGGA 4Y22A 3E97A 4QU1A 4CDWC 2E63A 3O14A 1AL0G 5FPUA 2YHJA 5CZKA 3PDQA 1IKPA 3PMEA 1S0DA 1PIV3 1RUJ2 1G8WA 1QJU3 3RS6A 3VD5A 4YG6A 1W9YA 4B4PA 4JAAA 4ES9A 5E88A 4N53B 4KGGA 2ID4A 2CNAA 3EMRA 4JQTA 5EJ1B 3B9IA 2JD9A 3A7QA 5C9AB 2XGXA 1AX2A 3K4DA 4QT6A 3WV6A 4MZUA 1HQLA 3ASIA 1YIPA 2ILMA 2JG8A 2VULA 2YY1A 5DUVA 5SV8A 2A5ZA 2VZOA 5JIUA 1IKQA 1Z0HA 2EF6A 1HB4A 4YG3A 3I7DA 2UYAA 1E5HA 4KWJA 4YVSA 5HCFA 1MQTC 3WQ1A 1KEXA 1MZFA 1ULCA 3B3QE 4GD4A 1UYPA 4A3XA 1A3KA 2OQ6A 5A80A 1LEMA 3H9AA 2RVAA 5FYHA 2K2SA 4Q29A 3PHMA 1HB2A 4LXLA 1WMXA 3IN9A 4FXKB 1BYHA 3GYDA 5D8AB 4OZOA 3T4HB 4PLMA 2V09A 2MNGA 3F95A 4FQ4A 4XAEA 1DLCA 1W6MB 1W6OA 5FMOS 3J7LA 1FAYA 3NV4A 5BV6A 1BMV1 3ZKUA 4E4HA 1QWRA 2CSGA 2FBEA 3CIHA 4OMDA 1PNGA 2IXIA 3LF7A 5D21A 1ULEA 4PQQA 1FXZA 1RJ8A 2C26A 2VOWA 4L99A 4W8JA 2RS11 5I8SA 4XOGA 3O12A 4AI3A 2XLFA 1IHMA 1US3A 2RR12 5C8WA 1ND2B 4B3NA 1DIWA 4UBHA 5HV0A 1BXHA 1ENSA 4ZZ5A 3Q9OA 3WHTA 1VBD1 2WZ8A 4IE7A 4WVMA 1RITA 2W46A 3ZFGC 4XJWA 1SFPA 1J1TA 3ZFFC 4I02A 5C8CC 2BTVC 1WWYA 4YW3A 4B4RA 1WCQA 4MV2A 4Z8BA 1W0OA 5C7GA 2WLQA 2L9LA 1VAVA 1BZWA 3PVNA 4YW2A 4FFGA 5FYSA 4ZXEA 3DXTA 2EALA 4RHV2 4BLJA 4MUVA 3BOPA 1NA1A 3FZ3A 2TNFA 3KLSA 4YM0A 1RMU1 4MADA 4AVVA 4V2WA 2XDVA 1ULGA 1TMF3 2EXHA 1K5MC 3S7IA 5KXBA 1RUD1 5FREA 5CB7A 1EUUA 5ACA1 3OGRA 4QKFA 5FZ8A 3JD73 3WT3A 1QJEA 3PVOA 4SLIA 1S0EA 2VZSA 1QJX3 2NM1A 5C5TA 1C28A 3MIFA 4Y4YA 3WR0A 3PU3A 4XFHA 4LITA 3VD9A 2Y6LA 5C4WA 3VBUB 4Z1VA 3ZDSA 3VHNA 4CRQA 4SBVA 4LO5B 4K6BA 5FY9A 4FP3A 3EXUA 1RUJ1 5KHIA 5GZEA 2WQZC 1HQWA 4N53A 5H9SA 4MG2A 1Y3TA 2ZMKA 4AYUA 5FZGA 3QOPA 2D6LX 3LDKA 3ZSEA 3DKWA 2JDUA 3BGAA 1TME3 5K4LA 3ZYRA 4CCLA 5FY4A 2YG0A 2X5IB 3PUSA 3BUCA 4NIHA 4CDUC 3LOBA 5D2AA 2J1RA 4Q4V2 3KV5A 2BFUL 5IVVA 4IQPA 2R16A 1WW7A 3T2TA 4ES8A 2QQJA 3HMYA 2JDKA 1WMDA 1MQTB 3POBA 2W5FA 2NMOA 3KM5A 4DUWA 5J1XA 1X9TA 5BY5A 3OY8B 3VBFB 4PF5A 3MLLA 1R081 3OPWA 4G4FA 4IEWA 4XFBA 4XZUG 4FPCA 3O1UA 2QQLA 4AE2A 2OA2A 2WKKA 5JOWA 3TWIA 1D0HA 5D8AA 4Y5SA 2ARCA 4PIZA 2B46X 2VBDA 1VRH2 1W6MA 4CCCA 1IGOA 4XCAA 4YM2A 5EQUA 5F6LB 2E9QA 2FDKA 1MR5A 5IFPA 2XVLA 2V73A 3Q8EA 1CQ9A 3WDTA 1OHFA 1QOTA 3ZXGA 1O8PA 1DP0A 4YGDA 5FYZA 5DUUA 3WP3A 4QHBA 4Q4X3 5JMOA 2RS13 4XTMA 5LY2A 2IUWA 1ENXA 1KS4A 2DBIA 4JRAA 5LBEA 4CDXA 2ZHKA 1F5FA 5L7OA 3PIGA 5F3CA 4XHXA 2EXIA 1RTVA 5FXVA 1CAUB 4EWDA 3VBOB 1VBD3 1CIWA 3ZYJB 1TEIA 3NSTA 1KDMA 1DU3D 3MUY1 3ZFGB 2Q8OA 4L9BA 4Q8LA 1D7PM 1QJY2 3N9PA 1QDOA 2QQKA 3WW1A 3FLPA 4E4DX 4IEVA 2NLRA 1C8NA 1K12A 1J3QA 4FPGA 4ITCA 4M4RA 2A75A 2ZGMA 4E8CA 3W20A 4HSJA 4AGVA 5JXIA 1RMU3 4M3CE 4D7TA 4AFCA 1LEDA 1UZZA 2VG9A 1YQ5A 3CNAA 4ISQA 4XABA 1KFUL 3ZLIA 2Z69A 1C4RA 1RUD3 4XBQA 4ASLA 4COVA 2BGOA 2PA7A 5BXXA 4C91A 3SHRA 1ZYBA 4IEZA 1GKBA 2W87A 4XFIA 4LEJA 3PUAA 1F4AA 2JD4A 4I0BA 2OVUA 3HN1A 2EVXA 1SDDB 5IWFA 4AEDC 4E4ZA 1SBFA 4GAZA 2VMGA 2IC1A 1DYPA 4KU8A 2EXJA 2EXKA 4PT6A 4E2SA 4A2UA 4JHTA 3UV9A 1A6CA 1RUJ3 1WD4A 1GWMA 3ES1A 4NIAA 4RR3B 5LY1A 4J1XA 2V5YA 2JXAA 2OUJA 3AXDA 4UYBA 3O1PA 3O1VA 4S2FA 4XUOA 2WO2A 1YQCA 4C0HA 5C3SA 1PGL2 2ZEWA 3MW3A 5DAQA 1TVGA 3BPSA 2VW2A 2VMFA 5E89A 1L7RA 1X33A 2G19A 2OQ7A 2Q5TA 3NV2A 2QDRA 1ZA7A 4Q4W2 1W28A 1ZZCA 2ZKNA 4WM8C 4AWDA 4FTBA 4PDWC 5FZHA 2UWBA 3L2HA 2CU5A 4N90A 1AR72 4EYUA 2ZZQA 4MGTA 2ZX2A 1V00A 3VKNA 3L2YA 2HWF2 1C1FA 2YBSA 3SCGA 3LFMA 1WMEA 3E6BA 3O1TA 3VBFA 1FX5A 3ILRA 4AEKA 5I8YA 4COYA 1PMHX 4HANA 4LO8A 4L2NA 4OYUA 5FCCA 4LJHA 1NCRA 5KHHA 3TYJA 3GBWA 5JWPA 4NPMA 1A78A 3HNBM 4I0AA 4TXWA 5F5IA 4PJYA 4KH9A 4P9JA 4FAGA 1VBE2 4UFIA 2FD8A 3ALQA 3R4SA 2VGDA 1UNBA 3MI8A 2R1BA 1NLQA 1O91A 2QQVA 4RGKA 3M70A 4HN0A 4RS5A 1TE1B 3ZSKA 3WP5A 1DBNA 2J7MA 1YUDA 3MV11 2G4IA 5HXVA 2G9FA 4YVWC 5JAXA 4PLNA 1XQNA 2GC0A 3GHMA 4WVZA 3IBMA 4KU7A 4KBZA 2W1UA 2ZTNA 3DYPA 4AVAA 4UW4A 3D4KA 1XNDA 3FL7A 2WS91 1WMFA 1EAH1 3S30A 5A1FA 2RR13 3ACLA 4IXLA 2HEWF 1GNZA 1IQDC 1G9FA 2JECA 4OCTA 2HLEA 1CAUA 3CO2A 2XVKA 3LWCA 4CXXA 3VBOA 2I45A 4O9EA 2F17A 2TUNA 4QPYA 4E8DA 3H3ZA 4MXWB 4AVBA 3V0BA 2BVBA 4ZHNA 2HYXA 1XOYA 1DQ0A 4CPBD 3ZSMA 2P37A 3H8RA 1O4YA 3DF0A 1QJY1 3A0NA 1RIRA 3PMSA 1YQ2A 3E5UA 1UX6A 1S0CA 3HQRA 4WVVA 5EFUA 4CP1A 1DGWA 1ZZ7A 1LU1A 3DN7A 4P00B 4XXPA 5A1AA 4FTSA 2YV8A 4RHV3 4F7ZA 4XILA 1OPOA 4AI2A 4CPBA 1N3OA 3OD4A 3KVAA 5FZFA 5L36A 3OTFA 4FP2A 3TN92 1QEXA 3GBGA 4GKYA 1CZSA 3ZYIB 1YJKA 1Y9MA 3VZOA 3POWA 5J3UA 5JPNB 2BV4A 2CGOA 4AVSA 1BJQA 2FMYA 2HWB2 3DPRC 3OPZA 2YGLA 5CFDA 1CAXA 2XJTA 4P9WA 4P9GA 2PHLA 3KGLA 2A6ZA 4DB5A 3J7HA 2VMHA 4XCBA 4JGYB 5F3EA 2HWE1 1V6MA 2Q1FA 4RR3A 2AACA 4OI0A 1NX9A 4Y1ZA 2RDQA 1MEC2 3TB0A 3NJYA 1PGL1 5KHGA 3AL6A 1OOPB 1R1A2 5JZGB 1I9RA 2X10A 3FX3A 4LBNA 3H7YA 2AH2A 4O61A 2VZUA 2R0HA 2QKDA 4CU6A 4Q4V3 1JYTA 3WCRA 1XPWA 4OHXA 5A33B 1OUSA 5FPXA 4Q4W1 2WNVB 3A0KA 3HQXA 1W2TA 5CYYA 1G9DA 3V0AB 4ATEA 4JVAA 4QQ2A 1AR71 3SQOA 3WNXA 5FYMA 1DQ4A 5LB6A 1QOSA 5LASA 3D3AA 4JDMA 1HRV2 1HQNA 2HWF1 2NYYA 5L73A 5FMCA 4R9DA 1WCDJ 1W8UA 4DXSA 3RMXA 3JUUA 3GZTB 3TNQA 1GZWB 2D6NA 4XACA 3SXWA 3CKHA 4YLZA 5T5LA 3U75A 2IZWA 4AAXA 2BP6A 2A73B 1W8HA 5FO8B 4Q4Y2 4Y20B 1VRH3 2VCAA 3SEPA 3ZXFA 1VBE1 1SLLA 1W03A 1YHFA 5JSRA 1W06A 2A6XA 5FPLA 3RI8A 2VZTA 4XZPA 4DFSA 5LBBA 4QB2A 5CAZA 4XJUA 5LZ6A 4QKDA 4EJRA 3OUIA 5JOXA 3DV8A 1PMIA 2LS6A 4Y1XA 4YVWB 5M0TA 3P1IA 3POGA 1UOBA 5HI0A 4IV1C 2VMIA 3T30A 4BXFA 3U14A 2YC0A 4LR4A 1XNAA 4UFHA 4TZDA 5CKNA 2ZGOA 2W95A 3QCWA 4NJ4A 2VVEA 1K5JA 5CFCB 1XXNA 2JB8A 2P5BA 2XL7A 1YFXA 2XB6C 5G04L 1QJY3 2DU0A 4YSFA 2JE7A 1BKZA 1VIWB 4PBPA 4RL7A 1G9AA 3EHKA 3AZWA 4LA3A 2X05A 3TEZA 4Y5TA 2B9UA 3K4ZA 4ZPIA 4GQ7A 1LR5A 2QQMA 1OI6A 1OA3A 1VMFA 2ZMLA 1X7NA 1VBA2 3LEIA 1NZIA 5A3WA 3GALA 5L9VA 2PQSA 2DUPA 3VD3A 4FXGB 2WZR2 3ZPOA 2JG8C 1A34A 4JRLA 5FYVA 4AHWA 4HETA 4O9GA 1VAMA 1OVSA 1SCRA 3UT0A 2AENA 3O7OA 2CDPA 4U2AA 1PVC2 1NCQB 1JBCA 2VMEA 4LTAA 1ND3B 1E57A 3ZYHA 4BMEA 3N35A 4XBLA 2BNMA 3ES4A 2D40A 1AX1A 4JGYA 3FN9A 3DL3A 5K7PA 3ZFEB 5DG1A 4AW7A 1WLWA 5DPNA 2E6VA 4YW1A 5LA9A 5A32A 3KVBA 4FVVA 1O3TA 2WFF2 3ZSJA 1OOPA 2RDNA 5JZGA 5C3PA 1REEA 4AVTA 1R1A1 2J1EA 1D0GA 2VZ3A 4LBQD 3GJBA 4JTOA 3KWVA 3K75B 4OZXA 1GR3A 4Q4W3 1APNA 1JI6A 1FNZA 2WNVA 3BODA 3WZ1A 1AR62 3V0AA 1AR73 1K45A 4FQZA 3B02A 2R042 4XYXA 3VL8A 3S0MA 1VP6A 2VXRA 3WD5A 4LT5A 2HWF3 3ZXEA 1H8VA 1HRV1 4LBQA 3POJA 3CDZB 4AFBA 5GZGA 4CVUA 4AI0A 3I2HA 2RDRA 4ISRA 5FOJB 3V65A 4JGZA 1I6XA 1DZRA 1F5JA 4E2GA 2GNDA 3MDPA 1BVVA 3LSDA 3Q8BA 2R072 3DEMA 3ILNA 1HV0A 5T55A 2VOTA 3VKMA 4Y20A 3OEAA 2Y64A 3VB9A 2DUOA 4Q4Y1 1MZEA 2WYFA 3WXPA 3ACIA 4W65A 4TTGA 3VDCA 2HBTA 2JG9C 2DCZA 5I0TA 1C57A 3KCCA 1NA1C 5CU1A 1LHWA 2ZBJA 4IETA 3FE5A 3ZDVA 3AK0A 1V0AA 2LALA 2VTXA 4HVQA 3HQUA 5CBLA 3AYAA 3I3DA 1W39A 1RUI3 3I49A 3T2OA 2GNBA 2GZWA 3N9LA 2WSUA 4LKDA 3IZOA 1YJLA 1UAIA 2VR4A 2GH8A 1R092 3DYMA 3LDBA 3OUHA 4KGQA 2QNKA 5FP8A 5KWRA 1JYNA 5IK8A 4IV1B 1QXPA 3ROUA 5C4WC 3AKTA 4NWWA 1CONA 3U4XA 3B5LB 1LCLA 5F5AA 1RXFA 3NNMA 3AKSA 1H8TB 2FCVA 4XBNA 3T2QA 2ZGNA 2W1WA 1Y4WA 1AR82 2QJVA 2WT0A 2YUEA 1AYN2 2LRPA 4N53C 3U07A 4DXRA 5H9RA 3NAPA 3ORJA 4XW3A 4UBGA 4DS0A 2G9GA 2WA3A 2RV9A 2VW0A 2WR9A 4AGGA 4D6RA 2JJ6A 1VBA1 2ZKLA 3ZXDA 3AKPA 4K40A 5DMYA 3VHPA 1S4CA 4P9LA 4KBBA 2FZ2A 3TN93 2WZR1 1LOGA 1W04A 3WSOA 5LATA 1JZ2A 2JG8B 4M01A 2WZEA 1T6BX 3LAGA 2OKXA 2D3PA 3DYOA 2HWB3 1N1YA 1NCQA 4YVSB 4XF1A 1FPN1 1ND3A 1PVC1 5T54A 4UW6A 1X8EA 3UGGA 4P08A 2JKXA 3J8F2 3HNMA 2ADDA 3KT7A 4GMP0 2WIIB 5BNNB 1EP0A 3T08A 1MZ5A 3ZFEA 2AREA 3NRUA 4LHLA 1HDKA 2YXSA 5D8AC 3OPTA 2VNOA 4M00A 1MEC3 3IWZA 4XDPA 4N9HA 4YW6A 5FZOB 4QHOA 3VZNA 2BOJA 1R1A3 2WFF1 1J3RA 2NZ9A 5FUIA 2BERA 4MX3A 3RNSA 3WF1A 4A45A 3ILFA 2VAUA 3C7HA 3RGBA 4AI1A 2A6WA 4CEYB 1S2BA 3I59B 4LKFA 2BWCA 3MF6A 3GZUC 5J48A 1NQDA 1XE8A 4QXBA 4GB32 5IVEA 1VMJA 2C9AA 4LHNA 1CVNA 2VNRA 1JOPA 4AHXA 1AR61 1OF4A 1XU2A 3PU8A 5EYXA 5T5JA 1W99A 2C5DA 3WEZA 1AL22 1VB2A 4QDRA 2X09A 4PBOA 1HRV3 1GQHA 4X6RB 3RZZA 3S6PA 1ND2C 3K3OA 3OG2A 4Q2FA 2BGCA 1OKQA 2VO5A 3H1YA 1ZZ8A 4LLOA 5L19A 1C8M2 2DF7A 1LENA 4WVMB 4FOVA 1UW8A 2QQIA 5IAVA 4XIKA 1BCXA 2R071 4LBKA 1PO22 1MS8A 4KG8A 5FJKA 4V2VA 4HVOA 1AHSA 4IEUA 2Q1ZB 4PF1A 5CKQA 4YRDA 1J84A 5LA2A 4ASMB 2XQXA 1WW6A 5FJHA 3M3QA 4LUMA 1HLCA 1LHUA 2CYFA 1UOJA 3TBDA 2TBVA 5E8AA 3UYJA 1V6OA 3KQRA 4QGLA 4RSUA 5DABA 1LAJA 4YW4A 2LUWA 1PM4A 3M3EA 5ACA2 4QGMA 1XC6A 1CESA 1NAEA 2A3WA 1RHI2 1KJLA 4IE4A 4ONUA 2B42B 1R091 1W8WA 1SPPB 2KM2A 3I2GA 4HT1T 1U5IA 1XYOA 2ZX4A 3CZJA 4XJZA 4G3YC 5FLJA 3U0ZA 4X8PA 1JYXA 1EPWA 1XNKA 4CCEA 1RUH2 1H8TA 3OSDA 2WNOA 4KQ7A 3PUQA 1UY3A 4COUA 5JXHA 3AC0A 4LHKA 1AR81 3AP9A 1AYN1 1QOOA 3IAQA 1VBC2 3CZUA 1GWKA 2A6YA 3WQBA 1VBA3 2CWSA 4B4QA 3HNYM 4HLTA 1ZRCA 2X5IC 4RFT0 1V6LA 3H1WA 5FV3A 2WZR3 1HV1A 3LQCA 3MFCA 1LECA 2ET7A 4NRPA 2VECA 3WP4A 3I8TA 3OGJA 4C90A 3CQOA 3NQHA 2ZJCA 1R1ZA 2W0XA 2IWGB 3HBKA 3UKTA 4H7MA 2XLGA 2P6HA 1PVC3 4XURA 1ZBE2 2ADEA 3BTZA 4FPFA 3SH5A 3POSA 4XTPA 1OD5A 1UZWA 3FBMA 5LCWL 3VBFC 4JKLA 3E6DA 3N7MA 3J8F1 4UFJA 1R082 1LESA 4EN6B 2ARAA 4NN0A 5BNNA 3MIHA 3MGUA 1LTEA 4D7SA 4NE9A 1UL9A 5FP7A 1JZ8A 2WNUA 2RHPA 1H30A 4Q0UA 1VR3A 4FO9A 3ENRA 4K1YA 5FZOA 2J1SA 5GZCA 2WFF3 4F3JA 1LOCA 1UY2A 3ZSLA 4OUEA 4CEYA 4MH0E 1ZRDA 1ODMA 3I59A 5H9QA 1WCUA 3KCXA 4KI5M 4UI9L 4A6OA 1XE7A 2R7EB 1UMHA 4GB31 4QXCA 1AR63 1YQ8A 2Z4FA 1OBNA 2ORXA 3RRDA 2VJXA 4ORFA 5D1IA 5C70A 2R043 1GZCA 2VTFA 1AL21 4CDXB 5FZAA 2DDUA 3WF3A 2XHKA 4GMP1 5L7OB 4JC1A 4W6YA 4XE9A 3VBOC 3VKLA 4LK6A 1Q8OA 3P3PA 4EQVA 5EV7A 3GHNA 1US2A 1C8M1 3CF6E 4LO4B 3LZZA 2PXJA 4DEVA 4LORA 3KHCA 1DQ5A 1QNWA 1Y7BA 5AFBA 1O7FA 1PO21 4HSLA 3U78A 5CG8A 5FRAA 2DVDA 2B9VA 1NT0A 5A7PA 3BB6A 1SDWA 3JQXA 3QACA 3THPA 1CGPA 3U4SA 3GJAA 4XIOA 2XJRA 3IIIA 4JKKA 2AZ5A 3VBRB 1SLTA 3IAPA 2YPDA 5CG9A 2HH9A 1C5IA 5IVBA 1A8DA 1R093 1RHI1 3E5QA 1SPPA 2DCYA 2PHWA 1W2NA 4ZS3A 1ZRFA 4AK3A 1OC1A 3LPFA 5FXXA 1AX0A 1X36A 1CZTA 1ZRIA 2JDMA 5FYUA 1DYOA 5LBFA 3RSJA 5BNOB 2P3IA 3AMQA 1YFYA 1RUH1 2LW8A 2ZGQA 4RR3C 4YZ3A 1AR83 5F37A 3WP6A 4D6SA 2DU1A 2PHXA 2DCTA 5DDJ2 3E1F1 4DY5A 3LIHA 3PVEA 1TG7A 1VBC1 5APAA 4A7KA 4OQ8A 2VE1A 2VCBA 3MW4A 4G9SB 3I2DA 1P8JA 4BQWA 2XWJB 1W2OA 1VBB1 4OFGA 4CDQA 4ARYA 1XSQA 2XPJA 1DGRN 3NL1A 3FHIB 2XWBB 1EV12 1ZBE1 2Y6GA 2YDEA 4BQ3A 4HPKB 5JR7B 1OLQA 3OOXA 3I2FA 5C71A 4BQ1A 3J8F3 3AZZA 5CA6A 2E32A 2W91A 5JR2A 4I30A 1GNYA 1F4HA 1FV3A 1I5ZA 1Y43B 1T6GC 2JIGA 3KZ4C 4L97A 4NMIA 4XQ4A 4UFLA 4IESA 5H9PA 4E27A 2Y6HA 3FHQA 4TLGA 1N1SA 5FWEA 1JODA 1NCRB 2C1FA 1Y9GA 1QGLA 2ET1A 3R4UA 4OMCA 5F3IA 5LBCA 1H1MA 1Q8SA 1SG3A 4F8AA 1O59A 1GOFA 5FZ0A 3U37A 1CPNA 3THDA 2JEMA 4MVTA 2MEV2 1XNTA 3NNGA 2QZ2A 1FNYA 5EYYA 3FUQA 4FPYA 1CAWA 1J3PA 1OH4A 2VUJA 4RS5B 1DZQA 1WGPA 3VLBB 3BKZA 4ZU4A 1GUIA 1GYKA 2C0ZA 4CE8A 1F2NA 4LOTA 1G86A 4JZRA 4Y5Z0 3ZN5A 4K8RB 4NPRA 1AL23 4BU2A 4BIFA 1XNCA 5JSOA 4QKNA 2CAVA 2TEPA 4GMP3 5CFCC 2WS92 1EAH2 2GMMA 3AKRA 2ZABA 4INDA 2AEYA 2A71A 2YC4A 4NVPA 4R9BA 3POYA 2FQPA 5FUPA 1MS4A 5JXJA 3AKQA 3IT8A 1JOJA 1C8M3 4UW5A 5DZGA 3V0BB 1QMJA 2D98A 4Z07A 4B7KA 4LO7A 4CCMA 3ZYPA 4FTEA 3T1MA 3CHXA 4IEPA 3UESA 2PTMA 1PO23 2AC1A 3R0RA 1ZZ6A 4YZ4A 1IS5A 4N7IA 1WKYA 5IAXA 1XBFA 1PVXA 3RYPA 2VCCA 4HKWA 2VQUA 5BNPB 2E53A 1RINA 5FP3A 3WW3A 4CXWA 5F2SA 2ETEA 4N43A 4ZONA 3RZHA 3D8CA 3PNAA 2JIJA 1E5SA 4Y1UA 2VVDA 1OLMA 3VBRA 1POV0 5ACA3 4NHXA 2LM3A 1V70A 1RHI3 2OW4A 1HB1A 3T4VA 5FZ6A 2VQ0A 5F3GA 1GP4A 1CAXB 2EIDA 4DRRA 4ZU7A 5CFDB 1ZNPA 3AM2A 3PL0A 1KFXL 3KSCA 3Q8AA 5F8PA 3MEPA 3VD4A 4JGYC 4LBLA 1RUH3 2DVGA 5AC92 5BNOA 4NR1A 1D4VB 1YFWA 2HWE2 4RQPA 3UKVA 2CGPA 4JTNA 1ZM1A 3WG2A 4AHYA 2Y26A 2FDJA 2BJSA 5FQ0A 1PHMA 1AR92 1VBC3 2GNMA 1OOPC 1UXXX 3POEA 5DDJ1 5C3QA 1H9WA 5JZGC 2PHRA 1RL3A 5F5QA 2KXLA 3UGFA 4HBNA 3M3IA 4LQRA 2FHRA 5EPAA 2V72A 5F9TA 1OXCA 1H4HA 1L7QA 2ZGTA 2R30A 5FKBA 5IK5A 1G9CA 2WNVC 1H9PA 3A23A 3QH6A 4BIOA 4DUVA 4H14A 5LEKA 3VDAA 1ZBE3 2GN7A 3EQEA 4HKLA 3WUDA 1DZTA 2F6BA 5CIRA 1EV11 2V5DA 4HPKA 3WDUA 4I09A 4CP2A 4CYDA 2DURA 3NNLA 4M0HA 3LKJA 1R083 3APBA 3H3UA 4YGBA 3ZXJA 2Y34A 4JGZC 2DTYA 3KF5A 1PO12 2RS52 1CPMA 3OBAA 3ON7A 1MS1A 1VALA 4V1PA 3VBHB 2WO3A 2WUHA 2YGMA 2VZPA 4N9IA 5JPMB 4C1XA 4XF0A 4Y3OA
chains in the Genus database with same CATH topology
2E7QA 3CEWA 2YPJA 1RUE1 2MEV1 1OFSA 1JH5A 4QPGA 5T5OA 4D69A 3AMPA 3H0OA 2PQQA 3HIFA 5BYNA 2UURA 1UPSA 4XEZA 2W08A 4KWKA 1EY2A 3U10A 2BNNA 5GLWA 2DTWA 3VKFC 1ENRA 3B9CA 3WG3A 1QQP2 5K9YA 2ARXA 2QE3A 3KGZA 1OQEA 3MLJA 1WA4A 2CWMA 2I2SA 1YI7A 3DGTA 1NLRA 1URXA 1MVQA 1GBGA 2JENA 4IEQA 5BNPA 4OHWA 3N7KA 4XF4A 2VQAA 1H0BA 1RUF1 2BUKA 4Q0VA 4FAHA 2VOVA 4AGRA 4C1WA 2ES3A 3ZO0B 2H0BA 1SCSA 1LB2A 2RJLA 1NCQC 1ND3C 4XQDA 4XDQA 2XLAA 1GZ9A 1LOFA 4BE3A 1D4M2 2PHTA 1OPMA 2PYTA 1IPJA 3MPBA 5GKAC 3ZFEC 1MS9A 5AC91 1IS3A 1C5HA 4WBBA 4HK8A 1N3QA 3O0WA 3SCHA 5DDJ3 3AB0A 5A32B 1DYKA 3I4IA 1KD7A 4D94A 1AR91 4KL1A 2Y0IA 5LK7B 3M4FA 1SQ4A 2QFEA 2VH9A 2W39A 1POV1 4BPZA 4EWEA 2PHFA 1REFA 2PLV2 3VUOA 1GFF2 4XFGA 1X82A 4CTEA 3N4MA 5I8TA 1EV13 3V64A 3LOIA 4OI4A 4AQSA 3FJSA 2XKPA 2GAUA 5CADA 2D7FA 3USSA 1HKDA 2EAKA 4LBQB 2YMZA 4LE3A 4XPVA 3WVJA 3VBHA 1PO11 2RS51 3WOGA 4JGZB 1V6IA 2PFWA 2CGNA 3NVCA 3X29B 2XKOA 4FPLA 3KT4A 4Q27A 1XU1A 4JV4A 3PTYA 2A70A 3W59A 4QD2A 1N47A 4CDUA 2IFWA 2BYVE 4BMBA 1WW4A 4AVCA 2IXCA 3N3HA 1QXJA 4LBJA 1SLCA 3RMYA 1RC6A 3ZXKA 1NE4A 1W6NA 2VOXA 3IKWA 3LA7A 5JOZA 1MS5A 2WS93 1Z7S2 1EAH3 1BEV2 2SLIA 4NHMA 3FLRA 4WZFA 4EROA 2DVAA 2GC2A 4XXAA 2DCKA 5DUWA 2YROA 4IL7A 3IPVA 3IMNA 4R8HA 4E4SA 1O3QA 1QQP1 1H8TC 4DZGA 4XF3A 4K8FA 2AYHA 5FTTC 1SBDA 4R4ZA 4R52A 2VPVA 3KMHA 3NAPB 3WDYA 3RDIA 4CP0A 1NLSA 3HR9A 4R9AA 3W58A 5B2GB 1PGW1 1TNFA 1LGNA 1UZYA 2D43A 3FUOA 2SBAA 2NQYA 1H2MA 4MXVA 5A3LA 5IT6A 2H6BA 4YVSC 2Z79A 1RUG2 2WJSA 3LA3A 1FPN2 4YGCA 1WD3A 4FOQA 1YRZA 1EYBA 4H7LA 1D4M1 5BNNC 4BOWA 3IDCB 5DUXA 5AC93 3AX4A 2HWE3 4QQHA 4L92A 1ENQA 5JPMB 3RI9A 4QGNA 1UIJA 1LODA 2E7TA 3KD4A 5K8SA 1AJKA 4RD7A 1AR93 1RGSA 3N7JA 2D44A 2Z2SB 5LRSA 1ULDA 3MFAA 4CEYC 5JOYA 1POV3 1BK1A 2K9ZA 3VGIA 1KDKA 3USUB 4OHVA 1QY4A 2PLV1 5ABJB 1Q43A 3BTAA 1V6NA 5KHJA 2D93A 2ZGSA 2O8QA 3LB9A 3KCYA 2JE9A 4XFAA 3RQ0A 4PIXA 4OI1A 3FFZA 3WCSA 4K3UA 1PO13 2RS53 3SCFA 1O5UA 1W0PA 3ZIXA 3U11A 1IOAA 2XH6A 3CJXA 4XFFA 2BPA2 4GULA 1HXS1 4Q0PA 1VBE3 3VL9A 1J1LA 2D3SA 2GNTA 5J98B 1W2UA 3WDXA 5C33A 5AVPA 2DV9A 3JBG1 3WW4A 1LHOA 2GMEA 4FOYA 2NN8A 1BQPA 5J36A 3URFA 3M3CA 3AFGA 3BCWA 1Q8PA 1Z7S1 2ZGRA 3D82A 1BEV1 5I0SA 5EXOA 2Q0AA 1AJOA 5GLUA 2NPIA 3FLTA 2Q1MA 4LE4A 1IS4A 2ZGUA 1QQP3 1G7YA 4F83A 4HKOA 2GH2A 1PZ8A 1S2KA 2EA7A 1DHKB 5JCTA 4YZ1A 3BU7A 5K0UB 4S2HA 3G6JB 2E7AA 1L3JA 3AP5A 3HT1A 4TWTA 2JDZA 4YYOA 1UKGA 1QDCA 3JD72 1I3HA 4AQ6A 1OA2A 3V56A 2WA4A 1N1TA 1RUG1 1M06G 3RG0A 2ZX1A 3AZXA 1D4M3 1DQ2A 1MVEA 2UWCA 3VBSB 5IUQA 5FFOC 3J9SA 4Z82A 5E1RA 4XFCA 5FO7B 1OMIA 2WNUB 2UY8A 2GC3A 3CLPA 2I07B 2QUOA 2XVGA 5T3NA 3AJYA 4QX5A 2VY0A 4AFDA 1CX4A 3INAA 1HIXA 1UF2C 2A3XA 2R6QA 1LRHA 3USUA 2JKBA 2PLV3 3DPRA 2OYZA 5ABJA 5HBAA 1PNFA 3VDDB 3H7JA 3OYWB 1RUC2 2W68A 4CEWB 4CDXC 4S2DA 1DGLA 5L7OC 2GC1A 1YYNA 4NHKA 1N1VA 4EN7B 2O1QA 1BBT2 3M3OA 4J1WA 5GZDA 5FDBA 4COWA 4MLOA 4AFAA 1U5ZA 1WLDA 1JXNA 5LEJA 4JDNA 2ERFA 1JYCA 5FLIA 3ELNA 2R32A 3FMGA 4IV3A 4WM7A 4Q4Y3 4FPEA 1TQ5A 3SITA 1HW5A 2AGSA 4Z92B 1KITA 3CJIA 2ZPXA 4IEOA 1IQAA 4N43C 2ZHMA 1JYIA 1ZRRA 3ZN6B 3UL2A 3T1LA 5EZWA 3VBRC 1AXKA 1O5LA 2N7GA 4M3CA 1OA4A 3AYDA 4M0NA 4C0BA 2ZGKA 3J26N 3TRSB 1Z7S3 3TAYA 1BEV3 1VB4A 1FOD2 2ZX3A 3AP7A 3D5OA 2D6OX 2D6MA 4LBOA 2BFUS 2VW1A 4YM3A 3MIEA 3LGRA 1QH6A 4AF9A 1WCKA 4EN9B 2EIGA 3OD0A 4OUMA 5BNOC 5GLZA 4RQPC 3D0SA 4KWLA 5T50A 3ZN4A 1XYPA 4XJAA 1YNAA 5K0UA 4Q8KA 2R49A 4L11A 4BH9A 4P9YA 3ST7A 2XJSA 1RUOA 3HBZA 1KXGA 4YGEA 4WVWA 1PK6B 1TMF1 1YCIA 5FBZA 4YFZA 3WY6A 4WZCA 4MGIE 3B69A 3JD71 1V9U2 1O3SA 2X29A 1VBB2 1QJX1 4MGZE 4UW3A 4CDQB 1TNRA 4I2OA 1RUG3 1YIFA 1FPN3 1F31A 3AMMA 4GH4B 4EN8B 2P17A 1AVBA 2R062 3KB5A 4BM8A 4OHZA 4E9KA 2BWAA 3VBSA 2DUQA 3M7AA 3NKGA 1H1IA 1F8VA 1NCRC 5GLTA 4AEMA 5JMCA 5KBFA 3R4DB 1TME1 5HCAA 2ZX0A 1V6KA 4LUKA 1NOVA 1JW6A 2YYOA 2ZAAA 3JZVA 4RS5C 4QPGC 5GZFA 1HRI2 1YI9A 3BALA 1CAWB 3AMNA 3GNEA 2WL1A 3VDDA 3OYWA 1Y9QA 2ARBA 3ZMOA 1D2SA 3WDVA 4CEWA 3ECQA 1RUC1 1LHVA 4U36A 3VN4A 1Z78A 2ZMNA 3SMHA 3FBYA 4HVRA 4P5HA 3UKNA 2BVVA 1B35B 1BBT1 2Z5WA 2OPKA 2HJIA 3MZHA 3KS7A 4K1ZA 2W52A 2GMPA 4IEXA 2R073 2E51A 1DDLA 3LCPA 5LRRA 2PAEA 5BNPC 1LJ7A 3RPQA 5J7MA 4IERA 1NYWA 3B7MA 4OHYA 4Q4X1 3VHRA 1LU2A 2WWSA 3SISA 4XJ9A 5KC6A 3ZN6A 4N43B 2A7AA 1VAKA 3NV1A 3WLUA 2JICA 4FCAA 1S0BA 5TSWA 4LLFA 4ZKTB 1FOD1 5CFDC 1OSGA 1LOFC 2O0OA 2VVFA 1WUVA 1GANA 4HMZA 5SV5A 1JUHA 3M8LA 4XHBA 4YFWA 3UJQA 1GLHA 4LBMA 1JN2P 4RQPB 2JG9A 4XF9A 1AYN3 5FQ0B 2VOKA 3O0VA 3SLIA 4QPIB 1PK6A 3ME2A 3JCIA 1B09A 2UY9A 4YZ2A 3WHUA 2MPFA 3FFQA 1V9U1 3H50A 3ZIWA 2Y0OA 3GBFA 2B45X 2WT2A 3M1HA 4GH4A 3IM0A 3WDWA 4BLIA 4CDWB 2HWC2 2RM22 1XYNA 2R061 4A7YA 3VBHC 1NXD1 5C9AA 5T5PA 2P34A 2WNEA 4DXZA 5FPZA 2IXKA 5HCBA 4Q1RA 5I91A 1RUE2 3M2MA 1SEFA 1LGCA 2HKXA 1S55A 2WZPP 5I93A 4DQAA 1DQ1A 1HRI1 2O8OA 4QPGB 1S0FA 4GB33 1OQDA 5BNQA 3DUIA 2B5HA 4P9IA 4AQ2A 3EJKA 1RUC3 3ATGA 5GLVA 2QCSB 3OJBA 1N3PA 1RVF2 1WLTA 1BBT3 2H0VA 3UK9A 1B35A 2K0GA 4UXAA 1W6PB 1ZREA 1OFNA 4A7ZA 4MGKE 1FMD2 1F9KA 3A4UA 2RE9A 1SLIA 1JTZX 1U12A 4HK9A 1DFQA 2WFPA 4META 1UN1A 1D2QA 4AI8A 3RJ2X 4GWMA 1DQ6A 1U5YA 3IIAA 4Y24A 1LOEA 2UU8A 2IXLA 4P9XA 2XL9A 5DG2A 5KXEA 1RUF2 3B00A 1FT9A 3BIWE 1ND2A 2PELA 3AJZA 2RR11 1SFNA 4Q1PA 4X8NA 3WG1A 3JB8A 1ZA4A 1FOD3 1JHNA 3FC0A 1J59A 3FWEA 3EBRA 2ZAHA 5E16A 3VV1A 1QNYA 4YNIA 5FMOL 3ZFFB 3ZVXA 1KRIA 3R05A 5C8CB 1UU4A 1O4ZA 3K48A 3VZKA 1AYM2 5KHKA 4W6XA 1X8MA 1CR7A 2D6KA 1S0GA 4RHV1 1QU0A 4HZFA 1WBLA 1YLLA 4ATFA 4QPIA 1FI2A 4EN0A 3ETQA 2BNOA 1FYUA 2ENRA 1K5MB 2DFBA 2GALA 3PLQA 1LOAA 2B8MA 4YZ5A 1MS3A 1V9U3 1KJRA 1VBB3 4W6WA 3RWNA 3VKOA 1ZBA2 2OIIA 1W6QB 3VBUA 1ASJ2 1QHDA 3AFKA 4NO4A 4MYEA 4YM1A 3RJRA 3MIBA 4CDWA 4H55A 2R063 2HWC1 2RM21 2XJPA 3CU7A 3QBQA 4OLLA 2GN3A 4QU2A 2FZ1A 3B93A 3QH7A 3N7LA 1SLAA 1COV2 4EWAA 2X5IA 5J37A 2XG3A 2HEYF 4AQTA 4AXOA 2IXJA 2GDFA 5KXCA 5GM0A 4TLFA 1WBFA 1ZVFA 2PAKA 3OBTA 4Q4V1 4CDUB 2RJKA 2D5FA 3ZXAC 1HRI3 2RMU2 5JIAA 2PAMA 1XNBA 1A8MA 1MQTA 3E6CC 4OUSA 3AMHA 2QDNA 4GWNA 3OY8A 1S1AA 2X8KA 1W6NB 5F1RA 1NY72 3ZPYA 4B7EA 4DOUA 4BYYA 1RVF1 4CZSA 1W6PA 3O5SA 4D7YA 3AZYA 2QQPA 1FMD1 2GU9A 5EJ3A 3IPVB 3MIGA 4XQWA 3W9AA 1VRH1 2UWAA 2BW8A 3NO8A 2WQ4A 3THTA 1H2KA 3NAPC 3NKTA 4K21A 2EAAA 2WINB 4M3CF 1RUI2 4RGGA 5IK4A 4X6QB 2IFRA 3C3VA 1PGW2 3ZYGA 3AYCA 5FLHA 2DFCA 4HL0A 3ZFGA 4R9CA 1REDA 4NHLA 3VHOA 3ZFFA 3C2UA 3AYEA 5C8CA 1UKRA 1SACA 1XRUA 5FAXA 1C3HA 3D0JA 4RA0A 1AYM1 2XJUA 2HWD2 1AZDA 4DY3A 4TYSA 2XBO2 3GZAA 2CY6A 3QD6A 3PJQA 3G7DA 2WT1A 1K5MA 2ZHNA 3TNPB 4FPKA 1LULA 2CL2A 4LULA 1YO8A 4R4XA 1YXWA 5ABJC 5LK5A 1ZBA1 1W6QA 2X53S 4AEDB 3NV3A 1ASJ1 2ZCWA 3PJYA 1HX6A 1SBEA 4I3GA 5FOBB 1IPKA 1VJ2A 2HWC3 2RM23 3NW4A 4OULA 3ZMNA 3PVBB 3O0XA 2CTVA 4QMAA 1CD3G 4Q0QA 4IV3C 1COV1 2Q30A 4WM7C 4RGAA 1HXS2 2WLPA 4MGYE 4E2QA 5C6CA 1RUE3 3CJIC 2MEV3 5A3MA 4K9SA 1EPZA 4EV0A 4QQPA 2RMU1 1JUIA 3JBG2 4FPOB 2UYBA 4WM8B 4PDWB 2GSYA 4I0WB 2OZJA 4ZXKA 2ATFA 1PZ9A 2XUMA 4OI2A 4Y1VA 1NG0A 1DGWX 1GV9A 1NY71 1RVF3 2AR6A 1LHNA 1Q8VA 4JDOA 1QXRA 1FMD3 1M4WA 4PQ9A 2F4PA 2D5HA 1O4TA 1NXMA 2VNGA 1GICA 1GQGA 5K0UC 1KQRA 3IDBB 1VLNA 2PHUA 4FT8A 1YWKA 1GNHA 4JQRA 1FATA 1RUF3 1RUI1 3E5XA 4LA2A 5EWSA 5CFCA 2RS32 3HAGA 1PZ7A 5GJ6A 1CJDA 1FV2A 4BCUA 2A3YA 4MXWA 5T52A 4L8QA 1C1LA 5BUVA 1WCSA 2Y38A 3MIDA 4YG0A 4WV8A 1UU6A 2ZHLA 1NE6A 2DYCA 2FMDA 2QVSB 5BPXA 3TOJA 3VBSC 3VZOA 1CAVB 4PCRA 3NWKA 3JQWA 4Q0SA 1PIV2 5GALA 1QJU2 1AYM3 2LTNA 4JCKA 3MLKA 2D97A 4DINB 2CAUA 2WNUC 1NQJA 2HWD1 2OUHA 5F6KA 2BQPA 3MW2A 2XBO1 4LNVA 4QM9A 4I3PA 5DZEA 3SH3A 3WINE 1UD1A 3OBRA 4B29A 3TN91 4FOWA 1PGSA 5CNAA 3JU9A 2ZOEB 4AG4A 1H2LA 3NJZA 4BZ4A 3VZMA 2DVFA 5KXDA 4BA6A 3KT1A 4Y1YA 3JB4C 1GSLA 2HWB1 5JDBA 1ZBA3 2D6PA 3DPRB 2MHFA 3VDDC 1Q3EA 1ASJ3 4CEWC 4AEDA 1U5XA 4COZA 1DG6A 3I54A 4HFSA 1MS0A 1IZ3A 4KG0A 1AXZA 4YARA 2AUYA 5JVVA 4QQOA 3WG4A 1H1AA 1Q56A 1O3RA 1OLRA 4LO6B 4H3WA 3J4UH 1MEC1 3SNMA 1COV3 2B39A 1QF3A 1NZCA 1PM7A 1SMVA 1ONAA 2NMNA 1Q8QA 4IV3B 4XMAA 4WM7B 5A33A 4B8EA 4QQLA 4XETA 3WQ0A 2RMU3 2VUAA 3CJIB 4AFMA 1UMZA 4WM8A 5JLVA 4Z2WA 4PDWA 4GXLA 3HWJA 4AHZA 2B7YA 3EO6A 2R0FA 1ZX5A 1CN1A 4M3CB 1Q5OA 3R6SA 4K20A 4K7JA 2A6VA 1G6NA 4NOTA 4PLOA 1CJPA 1GZWA 1RJ7A 2PHDA 2ZGLA 4P14A 3UJOA 1WW5A 1J58A 5FO9B 1QJZA 4OVEA 3AZVA 3WUCA 3B01A 3N36A 3RYRA 1WLCA 4BHPA 1S0IA 1ALYA 3K51A 1BVP1 1AF9A 2I74A 1MACA 5I0UA 2Q4SA 1PK6C 4FBFA 2HEVF 4GIQA 1TMF2 4DPNA 4YVWA 4URTA 1IS6A 2OZ6A 2BBVA 1DGRA 2RS31 1QH7A 2WC2A 4CDQC 1QJX2 3AP6A 1YFUA 1H4GA 1S0JA 4GH4C 4S2GA 3OF1A 4QM8A 4GALA 2DWRA 4MSVA 4Q26A 4Y22B 1H2NA 4YW5A 3VZJA 1KS5A 3MPPG 1CAVA 5JI7A 3ZX7A 1U0AA 1AUYA 2XJVA 1PIV1 1QJU1 2HWD3 1SLBA 4IEYA 5C9AC 5CVRA 2XBO3 1TME2 3LA2A 4FPHA 4XMIA 5J96B 5JI9A 2DCJA 3RYKA 2ZZJA 3LSEA 5KC5A 4N7UA 4D3WA 2BEOA 3B94A 4HN1A 4GA9A 3MICA 2P3KA 5DXDA 4BWOA 3BOWA 2JX9A 1LKNA 4GKXA 3D6EA 2HYKA 1ULFA 2ZGPA 5AVAA 1LOBA 3QLQA 1B35C 5J09A 3MYXA 2ZA9A 1UIKA 4Y26A 2WSVA 2H6CA 4TSVA 3H1MA 4ZU5A 3WQ7A 1W6OB 1BMV2 1UCXA 4J6GA 1HXS3 3SH4A 3HD8B 4DRVA 2P2KA 5I0RA 2Z42A 2XJQA 1UU5A 2PN5A 3JBG3 4NWVA 3ZXLA 3BPZA 4Q4X2 3H8UA 2RS12 1MZ6A 2R041 1UPIA 2R1DA 4I01A 1ZZ9A 2KA3A 1LGBA 1DF0A 4XJ8A 4KNCA 1AXYA 2ZS6B 1V6JA 1VBD2 2QZ3A 1RUNA 3AXEA 4FPJA 1I1EA 1OQ1A 2NP0A 5IK7A 3CL1A 4DNYA 3OCPA 2IXHA 3IDEA 3WX5A 5AFEA 2CV6A 3P3NA 4DMIA 4QXKA 5JSPA 3MF9A 2DVBA 2JG9B 3VZLA 3HT2A 1RMU2 1X50A 1NA1B 4QPIC 3WW2A 4PIYA 3S7EA 2ZACA 4FSJA 4AEJA 1RUD2 3AP4A 1QKQA 1ZZBA 2RS33 3GF6A 2YZ4A 5DZFA 1DLLA 2P3JA 2D3RA 1SFYA 4IV1A 2VU9A 3VBUC 3L9JT 5C4WB 1RB8G 3OGGA 4Y22A 3E97A 4CDWC 2E63A 3O14A 1AL0G 2YHJA 1IKPA 3PMEA 1RUJ2 1PIV3 1S0DA 1G8WA 1QJU3 3RS6A 4B4PA 4YG6A 4JAAA 4ES9A 5E88A 4N53B 4KGGA 2CNAA 3B9IA 5C9AB 2XGXA 1AX2A 4QT6A 3WV6A 4MZUA 1HQLA 3ASIA 1YIPA 2ILMA 2JG8A 2VULA 2YY1A 5DUVA 5SV8A 2A5ZA 5JIUA 1IKQA 1Z0HA 2EF6A 4YG3A 3I7DA 2UYAA 4KWJA 3WQ1A 4YVSA 5HCFA 1MQTC 4A3XA 1ULCA 1MZFA 3B3QE 1A3KA 1LEMA 3H9AA 2K2SA 4Q29A 3PHMA 3IN9A 4FXKB 1BYHA 3GYDA 5D8AB 4PLMA 2V09A 2MNGA 4FQ4A 5FMOS 1W6MB 1W6OA 1FAYA 3NV4A 5BV6A 1BMV1 1QWRA 2FBEA 1PNGA 2IXIA 1ULEA 1FXZA 1RJ8A 2VOWA 4L99A 2RS11 5I8SA 4XOGA 3O12A 4AI3A 2XLFA 1IHMA