3ACLA

Crystal structure of human pirin in complex with triphenyl compound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Pirin
publication title A small-molecule inhibitor shows that pirin regulates migration of melanoma cells
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aclA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aclA01
1RC6A 1O7FA 1EPZA 4LA3A 2Z69A 2E9QA 4ZU5A 1CGPA 4O9GA 5E16A 3EHKA 1XRUA 4ZU7A 5LEJA 4KWKA 1O3TA 1EYBA 1YFXA 5CADA 1X8MA 4XFAA 5I8YA 2OPKA 3H50A 1PMIA 1YUDA 1QY4A 2H6CA 3FJSA 3SMHA 1Y3TA 4JV4A 4IESA 3OGJA 3EJKA 3CO2A 4HZFA 4UBGA 5BY5A 2QCSB 4Q0PA 5AVPA 1ZZ7A 3E6DA 4D7TA 1XE8A 4YNIA 2QJVA 4WBBA 4IETA 4PIZA 5KHJA 4IERA 3IDCB 3OF1A 2VECA 2ETEA 4XF9A 4I2OA 3JZVA 3FE5A 4UXAA 4R8HA 3WW3A 3I59A 4XF1A 2UYAA 2QVSB 5I93A 4XF4A 4AXOA 3FZ3A 2EA7A 3RNSA 1UW8A 4JTNA 3SXWA 2PTMA 1Y9QA 1DGWA 3U10A 2IXCA 4FBFA 2Y0OA 3SCHA 1XE7A 1UIJA 1GQGA 2GC0A 2UY9A 1G6NA 1SQ4A 3RZZA 3MZHA 4XFIA 1ZZ8A 4XFFA 4IEQA 1HW5A 2MPFA 2D5HA 5I91A 4N9HA 1X82A 4KU8A 4IEYA 3U0ZA 3NVCA 2OZ6A 2OYZA 2I45A 4I01A 2BYVE 3RDIA 2PHDA 3QACA 1NZCA 3O14A 4O9EA 2PAMA 3S7IA 5I8SA 1QXRA 1GQHA 2XL7A 4XFGA 2Q30A 4LTAA 4N9IA 3SCGA 1LB2A 4FAHA 2XLFA 5FQ0B 3EQEA 3BB6A 4XF3A 1YFUA 2GC1A 2IXHA 4LUMA 3UKNA 3SHRA 2Z2SB 3USSA 1YLLA 5CVRA 2PAEA 4PIYA 4EWEA 3WW2A 3ZDSA 2FMYA 4BH9A 2CAVA 4CYDA 5JSPA 3S0MA 3KGZA 2ET1A 1JUHA 1NXMA 1SEFA 5K8SA 4IEZA 1X8EA 3PVBB 2DCTA 1RUNA 4YYOA 1UCXA 5I0TA 2EAAA 2ET7A 1I6XA 4L2NA 3RYKA 4R52A 4WVZA 4MV2A 3IDBB 1OI6A 1SFNA 4LUKA 3QOPA 3NL1A 2WC2A 3GBFA 4XEZA 2GC2A 1EP0A 1UPIA 3N4MA 2PYTA 5EFUA 4IEPA 3ETQA 2OZJA 1ZVFA 1O5UA 4HVRA 2IXJA 4UBHA 3LA3A 3VHRA 1WLTA 1I5ZA 4X6RB 2D40A 2GAUA 3H1WA 4MGIE 2BNOA 2PA7A 3GYDA 3CLPA 3PNAA 4XFHA 2H0VA 5F1RA 1WA4A 1J3RA 2BEOA 2P17A 2C0ZA 1J59A 4IEVA 2ZKLA 1J3PA 3I54A 3RYRA 1VP6A 4HVOA 2Q4SA 3LWCA 4TLFA 1ZREA 4EWAA 5FQ0A 3ACLA 1O3RA 3NJZA 5FLJA 5JSRA 5JSOA 3SCFA 4QM8A 2VPVA 4AQ6A 4AVCA 2D5FA 3WW4A 3U11A 5CU1A 1CAXB 4AVAA 1DZRA 4L11A 3MDPA 3FX3A 2BNNA 3C3VA 3H9AA 4BHPA 1YFYA 1YFWA 3KSCA 3LOIA 2CV6A 1ZZBA 4HLTA 2GU9A 4YARA 3RYPA 4D7SA 1ZRRA 3HIFA 1YHFA 4EV0A 5KHKA 2N7GA 2HJIA 4QM9A 4LEJA 5J3UA 4HVQA 3ES1A 4I0AA 1ZRCA 4E2GA 3IWZA 3LA2A 3UKVA 1RUOA 2PFWA 3D82A 4I02A 1LR5A 4KWJA 4MX3A 4X6QB 2IC1A 5KHGA 4MGZE 3OTFA 3KGLA 4KU7A 3E5XA 4IEUA 5BV6A 2XLAA 5KHHA 5BXXA 4META 4H7LA 3MPBA 1ZZ9A 4HSJA 1V70A 1O3QA 3M3IA 3S7EA 4K8FA 1U12A 3ROUA 2BGCA 3CF6E 3TNQA 4MGYE 3ES4A 3NKTA 2Q0AA 2PAKA 3FWEA 2V09A 4Q0SA 2Q1ZB 4Q0QA 4MGKE 4FT8A 1NYWA 5T3NA 4HN0A 4NVPA 4PJYA 4Z82A 1DZTA 1LRHA 3HT1A 5FLHA 2D93A 3B02A 4IEWA 1QXJA 1VR3A 1UIKA 1CAXA 2F4PA 3PLQA 4WZCA 1J3QA 4QX5A 1ZNPA 5I8TA 1OD5A 1O5LA 1RGSA 1RTVA 2BNMA 5JR7B 4XF0A 4QGMA 1OFNA 4EROA 3I7DA 1Q5OA 3H7JA 3MYXA 2IXLA 2OA2A 3CEWA 4A2UA 3R6SA 5C8WA 2GC3A 1QWRA 4I09A 4QMAA 1VJ2A 3RPQA 4ZU4A 3OCPA 5HI0A 2XL9A 3D0JA 4IEOA 2VQAA 5JCTA 3CJXA 4QGNA 5FLIA 5JAXA 1H1MA 3KMHA 3TNPB 4XFCA 1NE6A 4ORFA 2B5HA 3H8UA 1CAUB 1Q43A 1ZX5A 3BPZA 4F8AA 4HMZA 5LRRA 3UKTA 4AQ2A 5E1RA 4DINB 4GULA 4ONUA 5LEKA 2FQPA 1Q3EA 4KWLA 4BIFA 3E5QA 4OFGA 3OD0A 4Q29A 4FAGA 2PQQA 3L2HA 4E2QA 1ZRDA 1ZZCA 1WGPA 2ATFA 4QGLA 2B8MA 4I0BA 5I0RA 3H1YA 3ST7A 2CGPA 3H3ZA 3FFQA 4PIXA 2K9ZA 4LA2A 2QNKA 5C6CA 2XKPA 1FT9A 3NW4A 4J1XA 4AVBA 1H1IA 2XLGA 3IBMA 5J7MA 4OLLA 3DKWA 3DN7A 4BYYA 4E2SA 5FPXA 1IPKA 4JVAA 3BCWA 1ZRFA 1CAWB 2GH2A 3DV8A 1O4TA 3BU7A 2WFPA 3WW1A 4RD7A 1CAVB 5LRSA 4J1WA 2XGXA 4LLOA 2KXLA 1X7NA 4B29A 4P9GA 5I0UA 2GZWA 1LKNA 3FHIB 2UY8A 4YRDA 1J58A 4HN1A 1EY2A 3HT2A 2H6BA 1CX4A 4QXKA 1OMIA 5FDBA 4Q0VA 3D0SA 5KHIA 1DGRA 2ZCWA 3BALA 2QDRA 2K0GA 2MNGA 4F7ZA 2MHFA 4JTOA 1J1LA 3H3UA 4IEXA 1NE4A 1CAUA 4MZUA 5FCCA 5J48A 3H7YA 5D1IA 5I0SA 2HKXA 1ZZ6A 3CL1A 2XHKA 4EWDA 1IPJA 4I3PA 1RL3A 4XETA 5BPXA 3LAGA 5BUVA 2IXIA 1FXZA 3ELNA 3EO6A 2CAUA 3E97A 3LZZA 5KBFA 1PM7A 1L3JA 3NSTA 1FI2A 3I59B 3M70A 1O3SA 2IXKA 5FPZA 3IIAA 4HBNA 4KL1A 2PHLA 3G7DA 3HQXA 2O1QA 4MUVA 3H1MA 2EVXA 5EZWA 1CAWA 2O8QA 4Q0UA 1CAVA 1UD1A 4Z07A 2B9UA 4LULA 3EBRA 1YWKA 2XKOA 3E6BA 2UYBA 3KCCA 4XFBA 4MH0E 3E6CC 4YSFA 3LA7A 1TQ5A 3E5UA 4HSLA 3DL3A
chains in the Genus database with same CATH superfamily
2WUHA 2E9QA 3AB0A 4YGBA 5A32A 3KD4A 4EN8B 1UKRA 5BNOA 5E16A 5IVBA 4JRAA 4N43B 4RR3B 5DAXA 4IGQA 3T2TA 3T4HB 1CIYA 3WSOA 3MLJA 5FP8A 1O3TA 1X8MA 5I8YA 4OI0A 5FY4A 3SMHA 1QY4A 3J8F2 1W9TA 1Y3TA 3WP3A 5F3CA 3GALA 2P6CA 4Q4X3 2JKBA 3OGJA 2A71A 1RVF3 5BNOC 1XNKA 5FZ4A 1RUH1 3PJQA 2QZ3A 3CO2A 1XBFA 4UBGA 5BY5A 2B46X 3L9JT 4P5HA 1UYZA 1WD3A 4Q0PA 1ZZ7A 5A80A 3GJAA 3AJZA 4JX0A 4NHMA 1DQ0A 1WD4A 4XUQA 2XJUA 4S2FA 1BBT1 4IETA 3K4DA 4PIZA 5CKNA 3AKQA 2DCJA 3KS7A 3JB8A 2VECA 3J8F1 3WHUA 5K0UB 4I2OA 1LENA 2CDPA 3B3QE 4Y1ZA 3ZSKA 3MV11 1V0AA 1HB2A 2A6WA 4P9XA 1PM4A 2W46A 3GJBA 3AYDA 5HBAA 1GNHA 2QQMA 1TZOA 2BBAA 2EA7A 4LXLA 3RNSA 2RS32 5C70A 3GCWA 5JOWA 1A34A 4A3ZA 4GB33 3SCHA 2MEV2 3ZR6A 5JI7A 1GQGA 2GC0A 2V72A 4BMEA 5C5UA 1G6NA 4UW4A 2LUWA 4KGGA 3MLLA 1EAH3 1LHWA 2YMZA 4CDUB 1RYYA 1POV1 2Y6FA 1SLTA 4K3UA 2Y34A 1UQXA 2Y6KA 5EXOA 3KCXA 3CZUA 5T54A 1GNZA 2W91A 4KU8A 3VBFB 3ZYGA 3M3CA 2DV9A 2OQ6A 2OZ6A 1RXFA 2RS31 3FUQA 4DRVA 1VE0A 4GD4A 3RDIA 3QACA 1NZCA 2MEV1 2W1SA 2WAOA 3MIBA 2RJKA 2ZX0A 2PAMA 2BFUS 1HN0A 2F17A 1X9TA 3A0KA 5I8SA 1HKDA 2QZ2A 2YZ4A 1GQHA 1SG3A 4S2HA 5F3IA 4CXXA 5FZLA 1I9RA 4M4PA 1WKYA 1RMU2 1CVNA 4K1ZA 5FP7A 4FAHA 1W8FA 4K8RB 4DEVA 1Q8OA 1YFUA 4OQ8A 3JXSA 5FK8A 2E53A 1LESA 2ARAA 2GMMA 1RUE3 2G1MA 4NRPA 4DXTA 4E4SA 1VBE2 5T50A 3KVAA 4Q4W1 3LF7A 4Y22B 1SBFA 1PIV2 1AXYA 2WNUA 4BH9A 1MPXA 2GMPA 3KGZA 1GZWA 3WT3A 5GZGA 2JDPA 2C9KA 2D6KA 1JUHA 1NXMA 1J83A 3GZEA 2WZEA 1RMU1 3BTYA 1SEFA 5A3TA 1X8EA 2ADEA 5A3PA 4AFAA 3MW3A 2WKKA 4CP2A 2WNUC 3L2YA 5IVCA 4Y1VA 2OKXA 2DCTA 3W9AA 2K2SA 4BXSV 4NIHA 4XHBA 1DGLA 1VBE1 1GOFA 1X33A 1Y4WA 1JHJA 4L2NA 5I0TA 4AEMA 1POQA 1PIV1 3CDZB 4AZZA 4CZSA 4MV2A 2W95A 2JB4A 2CGOA 4ZS3A 4L92A 3OBRA 2WC2A 3WF0A 1UXZA 1HJFA 2JE8A 2FCVA 1E5IA 1VBA3 2HWF2 2OW4A 3SISA 3WEZA 1EP0A 3B5LB 3LIGA 5EFUA 1OQEA 3ETQA 1KS5A 2OZJA 1IKQA 3CQOA 4RS5A 2RR13 4YG0A 3FMGA 5AVAA 4L97A 3WCRA 3EXUA 3RGBA 2YG0A 4EN0A 4XQDA 3E1F1 5CEHA 3T09A 1LOCA 2NM1A 4KNCA 4X6RB 3P3NA 5LB6A 3ZIXA 4AEJA 1OF3A 1DGWX 3N9PA 2DVDA 4CP0A 2BNOA 3BODA 1JYVA 2F6BA 3LE0A 4D6SA 4NE9A 4YW2A 4BK4A 4RS5C 2YBKA 1POV0 1PVC1 4CU8A 4XPVA 1WA4A 2FHRA 2WIIB 1BHGA 4FTSA 2ZKNA 3WNOA 1V6MA 2JJ6A 1ZBA2 3FUOA 4MXWB 3Q8FA 3GNEA 3ZMOA 2HWD3 1J59A 2JDAA 1AVBA 2YDEA 2ZKLA 4IEVA 4N8MA 1J3PA 4P9YA 3I54A 1MR5A 2R6QA 3J4UH 2R16A 4OCTA 3AZZA 4LHSA 2RVAA 3UGGA 2XB6C 4EWAA 4Q8KA 1VAMA 2A7AA 3ACLA 5L36A 4MHRA 1MVEA 5FLJA 5FK7A 3I2DA 5IW0A 2B4KA 3SCFA 4QM8A 2VPVA 2NQYA 4AQ6A 1AF9A 4RHV2 4YW3A 4QXBA 1UYXA 4GH4B 4DNYA 1HRI2 1UAIA 5FV3A 5C3PA 5FWJA 2VUJA 1GR3A 1LECA 3THDA 2WT2A 3WLUA 5DZGA 5C3SA 3VZMA 1RUJ3 1F4AA 4IV1A 4TSVA 3IPVB 2HWE1 4ZPIA 5DDJ1 2HWC3 3K2OA 1W99A 2Y6LA 1XU1A 2X05A 4G4FA 2I2SA 3KSCA 2CV6A 3DPRB 3P5BA 1H2KA 4FFHA 5A70A 2CNAA 4RHV1 5JWPA 5GLTA 2WA3A 4S2DA 2P5BA 1CD3G 1YHFA 1LOEA 1ULCA 1S0GA 2P3YA 2W0XA 1UY4A 4IV1C 4M3CA 4Q8LA 5T5OA 3WNNA 4XE9A 1HRI1 1QH7A 2YY1A 1GP4A 1W6OA 4E4DX 1K3IA 1LCLA 1O59A 1SPPB 4QM9A 1H2LA 2HWF3 3Q8BA 4JGYA 5FWEA 2WYSA 1SLLA 3ES1A 4I0AA 4YWAA 2BQPA 3HN1A 4K9SA 1ZRCA 4TN7A 4A6OA 4Q2FA 4YVWB 2RM23 1W0PA 3QH7A 4QPWA 2ZXQA 3KLSA 4UT5A 2PFWA 3AP7A 4KWJA 3RG0A 4BIOA 1RUOA 4AYUA 5IK8A 4Q5OA 3SEPA 3OTFA 4JGYC 3UETA 1ALYA 4EN7B 4D7YA 4KU7A 3E5XA 4YG6A 5GKAC 5BXXA 4META 1F8VA 2E63A 2D43A 4H7LA 4EN6B 1RUF2 4E27A 5J96B 5CFCB 2QKDA 2YU1A 2YB7A 4N43A 1LGBA 1AL0G 1Z7S2 3M3IA 4M3CF 4K8FA 1CZSA 2XVKA 4XAEA 1ZBA3 4LO7A 2BGCA 4MVTA 4PI2A 1FATA 4YGEA 3TNQA 1HQWA 5L73A 3N7MA 1SLBA 4YZ1A 1C1LA 2ZHLA 1H9PA 1RUD2 5DAQA 4OQ9A 3FWEA 1QOSA 1FV3A 3H3LA 1WMXA 5LATA 4FOQA 2R061 2Q1ZB 4N43C 1A8DA 3NQHA 4IW3A 4Q0QA 5T5LA 3U4XA 5FZ6A 3PIJA 3VBHA 5T3NA 2VTXJ 3K46A 5FYCA 1EPWA 4LBQD 1SZBA 5GLZA 3TEYA 4U2AA 3LD8A 3OJBA 4Z82A 4CDXB 2QFEA 1YCIA 2QQWA 3O5SA 5FZHA 5FO7B 4SBVA 3NNFA 5L19A 3HOBA 1NKGA 1PZ9A 1F5JA 4IEWA 3WQ0A 2DTWA 1ND3B 3ZSEA 3VBHC 1RUD1 2A6VA 1UIKA 2AACA 2F4PA 4NAOA 4YW6A 5GLUA 4QX5A 4OHZA 1AYN2 4UWDA 2XBO2 2W52A 3AP6A 1QJY3 3PU8A 4KH9A 4H14A 4R4ZA 1JYTA 1O5LA 1RGSA 5JR7B 1XYPA 3HWJA 4BLJA 1BXHA 2W1QA 4ITCA 3GXUA 1SCRA 4EROA 3BTZA 3VBRA 1ZBE3 1Q5OA 3ATGA 4QB1A 1DU3D 2E7QA 1S0EA 2XJVA 4LHLA 1F35A 2EIDA 4BWOA 2ZACA 3CEWA 1YNAA 3VD3A 4WZFA 4CUCA 1MEC2 4PHZA 1QXPA 3SH4A 5A3NA 2WO1A 1QH6A 1R64A 3AMQA 3I8TA 4K6BA 1OVSA 1HB4A 1QQP3 2WO7A 4LMFA 2XBO1 2WL1A 1N47A 2AR6A 4XUPA 3VBRC 4XC9A 1YYNA 2DCKA 4DIQA 4XDPA 5DG2A 4WVMB 1VJ2A 5F3EA 2RS11 1QJX3 1JMUB 2AUYA 5IVVA 3MLKA 5F32A 4ASLA 3C7EA 3DF0A 3OCPA 4N90A 2ZABA 4DB5A 1R1A2 5IHRA 1US3A 1BEV2 2Y64A 1WZXA 3JBG1 5EV7A 2LROA 1LULA 2R043 5F8PA 4OI1A 3TB0A 4CSWA 4C90A 1H6XA 4B3NA 5JCTA 3VD9A 1RUF3 1J1TA 1ND2B 4KWUA 5FUIA 1F15A 3ZFGA 3VBOA 4NHLA 4HKWA 2E7TA 4LO8A 4D8MA 3H8XA 1CIWA 4XACA 5LASA 1KJLA 5FLIA 1W2AX 3PURA 4MGSA 3NAPB 4B1LA 4NPMA 4K21A 2ZMKA 3ZFFB 5IK4A 3ETPA 2HEVF 5BNPB 2C4XA 4C0BA 2FZ2A 3TNPB 5J36A 3OGGA 4XFCA 3VBSB 3N9MA 2VH9A 1Q43A 3ZFGC 3KHBA 3ZKUA 1R1A1 4Z2WA 3BPZA 1GWLA 1C8M2 2ZAAA 1VAVA 4HMZA 2VULA 5DXDA 2CWSA 1H2MA 2XJSA 4URTA 2BTVC 5A6YA 1CN1A 4XILA 2WSVA 4DOUA 4TTGA 3B01A 2P3KA 5FP4A 4GJZA 2RJLA 4QHBA 3HR9A 4LHNA 1I5PA 3RSJA 1G9BA 3R4DB 2IFRA 2ARXA 3K4AA 3E5QA 4DZGA 2VBBA 1UL9A 4B7KA 3V0AB 3I2FA 4OFGA 4FAGA 1RUH2 1ZZCA 2ATFA 2OXBA 4GJYA 3J7NA 3HMYA 3O1UA 1W6PA 1QJZA 2NN8A 3H1YA 5IWFA 3ST7A 2CGPA 3F2ZA 1WBLA 1AYN3 2L9LA 3FFQA 2FDIA 3EYPA 2K9ZA 1W39A 4BPZA 1XNTA 3TEZA 4LOSA 3S57A 2D97A 4J1XA 4AVBA 1H1IA 1TMF3 4LE3A 3IBMA 1TNFA 1UMHA 3ZXDA 3IT8A 4BK5A 1XOYA 2RDSA 3DN7A 4PQQA 1IS6A 5F6KA 1UOBA 4R9CA 1MEC3 2GH2A 5D8AA 3DV8A 2ZA9A 3O1VA 3BU7A 3LSEA 5FZGA 3DUIA 2YGLA 4IE6A 4LBQA 4B4PA 4J1WA 1EV12 5JSOA 2NYYA 3VL8A 1CZVA 2VVDA 4XBQA 4QB2A 2WN2A 1U5IA 5JVVA 3FHIB 1AR83 4YRDA 5D8AC 4HN1A 3BI3A 5H9RA 1BEV3 2Y26A 4L9BA 1WCSA 2DU0A 4HONA 1S0BA 1YQCA 3LPFA 5FY8A 2XOMA 1S0FA 4WV8A 5KHIA 5GLVA 1DGRA 2ZCWA 1JZ8A 5IAVA 5A32B 4LK6A 5EJ1B 3BALA 1G9CA 4OMDA 1LGCA 3K51A 3KVBA 3KV9A 1BKZA 3R05A 2VMCA 3KQRA 4Y4RA 1HN1A 4YM2A 2VXRA 1SLCA 5EHDA 2VQUA 2O0OA 1QKQA 4JTOA 5LK7B 5JIUA 2ZX4A 3K48A 1C8M3 2WINB 2PHUA 2DUQA 5FCCA 5J48A 2X09A 5GLWA 3MIFA 4AL9A 2AREA 1AJOA 5FPLA 5DAWA 2RG4A 4QHZA 3U37A 4UYBA 1R092 1TE1B 1XYNA 4HK9A 4YW1A 2VJXA 2DVFA 2ZGKA 1IPJA 4FFIA 1KDMA 4XETA 2Q8DA 3NMBA 2LTNA 4D3WA 2ZGRA 5FXXA 1WW5A 3IN9A 1MS9A 2CAUA 1OXCA 1Q56A 4QB6A 4D6QA 1WWYA 3HEIA 2DWRA 1WLCA 3NSTA 2GMEA 2WBKA 1MS8A 3B93A 4A45A 2QQKA 4ZY9A 4AGRA 5FZCA 3LPGA 5FZ8A 5FPZA 2UWCA 1VBB2 3D4KA 2DFCA 2OVUA 2VW1A 3OPTA 3HQXA 1JBCA 4NPRA 1WA6X 2CHHA 1JTZX 2RE9A 2X53S 3ITQA 1L7RA 4I0WB 4MUVA 2EVXA 4P08A 2R32A 4FOWA 2VZRA 1L7LA 4NROA 3U75A 3UJOA 3VKLA 2CY6A 1EV13 3NV4A 2RJ2A 3LFMA 4YM3A 4Q0UA 3WDVA 3CKHA 4PCRA 1WCDJ 5FBJA 4LBLA 3BIWE 4D6RA 5IFTA 3RZKA 2J1RA 2JIJA 2EXKA 1LU2A 3S5QA 4BQ5A 2UURA 5F5IA 1ACCA 1W2OA 4DY5A 2QQJA 4EE2A 3MI8A 3A7QA 2F4LA 3UT0A 4Q1RA 2DVGA 4XJZA 4NHXA 4AFBA 4EQVA 1DGRN 2VZ3A 4YVWC 1H2NA 5CU1A 1RC6A 4AFDA 4M00A 3VLBB 2XQXA 2P4EA 3AZVA 4LE4A 1CWPA 1COV1 4O9GA 3EHKA 4ZU7A 5DZEA 5FBZA 3FL7A 2DBIA 3POWA 4RYDA 5LEJA 4KWKA 5CADA 4BDVB 4A7YA 3AZWA 3FJSA 2YBPA 3D5OA 1AL22 5A1AA 2ZBJA 3EJKA 1R093 2VTXA 3OGVA 4HZFA 4Y1UA 2FZ1A 5AVPA 2WNUB 3E6DA 4FOYA 5LWBA 2E6VA 3VZOA 3ZM8A 4YNIA 3HAGA 1GZWB 4ZS2A 2QJVA 4WBBA 4FO9A 5IFPA 4V2WA 2ZX3A 4IERA 1RHI1 2FCTA 3IMNA 3IDCB 5IUQA 1XQNA 4L0PA 4BJ0A 4XF9A 1PGL2 1KDKA 1XNAA 3LIHA 1I1EA 2Y8KA 1VBB3 3WW3A 2ZGNA 1AR71 1ND3C 2ZGQA 5FO9B 2UYAA 2QVSB 3ZSLA 1YO8A 3J26N 2DBNA 4GWNA 1X9PA 5A3UA 3I3MA 5FXVA 4A6SA 1LHOA 4AI1A 1DIWA 4RN5A 1H8TB 2ERFA 5CG8A 3WDWA 3WQ7A 1W9FA 5AFBA 2IXCA 5FJHA 2Y0IA 3N9NA 1WBFA 4RS5B 1UIJA 2R072 1AXZA 2RMU1 1W8HA 4HFSA 1SQ4A 2OUJA 4M3CE 4CP9A 2YC2A 1JN2P 1TME1 2KD7A 4QKNA 2FBEA 4G3YC 1HW5A 2W08A 4UOJA 5J09A 3VD7A 4AFCA 3KT4A 5I91A 3HNYM 5FZOA 2OUHA 1QHDA 4GMP3 1X82A 2ZEZA 1ULFA 2FDKA 3VZLA 1N3QA 5CIRA 4E4HA 5A7QA 1F4HA 1OBNA 1FMD1 2AEZA 2CU5A 4I01A 1GOHA 3ZFFA 4O65A 1ZA4A 1ULOA 1MVQA 5LCWL 4O9EA 2R071 4IL7A 1K5MA 3RS6A 4AOCA 2HH9A 4DXRA 1QXRA 2VMFA 2WLQA 4NMIA 4NIGA 1W9YA 4XAAA 3R0RA 4N9IA 4JCKA 3SCGA 4F83A 2QQLA 1W9SA 4J6GA 2ZGLA 4KBZA 1AL23 2Y60A 3ZFFC 4BCUA 3TN92 3I3BA 3LCPA 4ATEA 4NWVA 1Q8VA 1C3HA 2GC1A 3HBKA 4Y26A 1K5MC 2BDRA 1V9U2 1ASJ2 2PHXA 4A4AA 1OC1A 3KHCA 2YFUA 2Z2SB 5CA6A 2PAEA 4EWEA 2EIGA 3MUY1 5A1FA 3ZN6A 5HPOA 4ES9A 3S0MA 1GU3A 4RL7A 4EZ4A 4IV1B 3PUIA 3USUA 4CRQA 3O1MA 4Q4X1 5EJZB 2V73A 1IS4A 1RVF1 5FUPA 4WM7A 5F9TA 1ULEA 5FYVA 4FTEA 5K8SA 3KWVA 3ME2A 1W6NA 5FMCA 3MIDA 2XVGA 3VZNA 1IZ3A 2VXJA 2VZPA 2YHJA 1W8ZA 3VDAA 2XHNA 4FP2A 5FKBA 4XXPA 4L99A 4M3CB 4N7UA 1I6XA 1LHNA 4WVVA 4QQOA 4WM7C 1W6OB 1SLIA 4GB32 1G8WA 3IDBB 5D21A 2B42B 2GALA 2R0FA 1SFNA 4JGYB 3IDAA 4QX3A 1C5IA 3QCWA 3B7MA 4FOVA 1EAH2 5FZIA 3ZR5A 2D98A 4K1YA 1D7PM 1UPIA 3MFCA 3N4MA 5FYMA 1N1YA 5JOZA 1YQ6A 2W68A 2IXJA 2GNBA 3LA3A 4KGQA 1WLTA 2D3RA 3F95A 1I5ZA 4CUGA 4D94A 1FNYA 4LBKA 3OOXA 5EQUA 3H1WA 4GB31 5C3OA 1CZTA 3CLPA 2ZPXA 3PNAA 1SDDB 5CB7A 3C7FA 1O8PA 4XFHA 4FPGA 1NCRA 1EAH1 3RMYA 5IVYA 5JOXA 1V6NA 2P1BA 1QU0A 1J3RA 3MICA 4LBOA 4BLIA 4XJUA 4AFMA 3RZLA 2VAUA 3MIHA 4XYXA 2QQPA 1FOD2 4OHXA 1ODMA 3V65A 3OB8A 4OUMA 2Q5TA 5HCBA 3RZMA 1XSQA 2UWAA 1VP6A 3TN93 3RWKX 2Q4SA 3PJYA 3M2MA 1NCRC 1RUE2 3LWCA 3VBHB 5FTTC 1V9U3 3T1LA 5FQ0A 1ASJ3 2BGOA 2IVIB 3ACHA 4IE4A 3I49A 2JDMA 1B35A 3A23A 5FYZA 4A7ZA 1W05A 4AR2A 3MIGA 2VW2A 2I07B 4QXCA 1AX1A 2WQ8A 1Q8QA 4B4RA 1YEWA 5T5JA 1NUKA 2EXJA 5M0TA 1QJEA 1NZIA 2ZEXA 5GZDA 1DZRA 1JS9A 4L11A 2VCMA 4YM0A 2J1UA 1LJ7A 3HQRA 3BYWA 1B35C 1MS3A 3T2QA 1S0JA 1RUE1 3ZYJB 2WNVA 4NN0A 3JD73 4QD2A 3LDBA 2JICA 4UFMA 3S30A 3VBRB 1DDLA 1UN1A 2PHRA 4Y5SA 1LEMA 1DLLA 5F5CA 2WDBA 3HIFA 3RYPA 4D7SA 5FYIA 4PQ9A 1VBA2 2ZHNA 4MHUA 3FLPA 4CDWA 4D0QA 3ON7A 2WNVC 1VBD2 4R9AA 2WAAA 4FPOB 4KQ7A 2RR12 1UF2C 2A75A 5J3UA 1O6UA 3R4UA 4JGZA 5E89A 3PUHA 4E2GA 3N9QA 4AAPA 5C9AA 2JX9A 2R1DA 4CDWC 1SCSA 1LAJA 2OS2A 3IB3A 3UKVA 1W2UA 5LZ6A 1LR5A 1D0GA 3NNJA 1XE0A 4JDOA 2VG9A 3WCSA 3AVRA 4H2AA 3NO8A 3RFRA 4A3XA 5T52A 2XH6A 3J9SA 4IEUA 1VBA1 3ZFGB 4CCCA 2XLAA 4JGZC 5BV6A 3VBOB 2WS92 3MPBA 1OKOA 5C9AC 2TUNA 1ZZ9A 3RZGA 4QQ2A 2RR11 2XJQA 4JKLA 5LBFA 1GUIA 4CA9A 3PIGA 2HWD2 3OSDA 4KG0A 3M3QA 3PU3A 3LB9A 3CF6E 1J84A 3GHNA 1FOD3 4O61A 3IZOA 1SMVA 1ENXA 3KF3A 3AKPA 3VBOC 1SDWA 4CXWA 2VBPA 1OOPA 3AKTA 4DXZA 3WDTA 2IWGB 1HRV2 1UOFA 3I3DA 2LALA 4YFWA 2WZPP 4MGKE 3BOPA 1QJFA 4LITA 2VW0A 2ZX1A 4FT8A 4XCAA 4SLIA 1T6GC 4BQWA 1CQ9A 5T55A 1OOPC 1DZTA 3AVSA 1LRHA 2HWD1 2QBXA 2VUAA 3HT1A 1HLCA 3GGLA 1RUJ2 4LJHA 5DUXA 2R49A 4R9DA 1W6PB 2P6HA 1MQTA 4CCKA 3B02A 2XQRA 2HWC2 2JD9A 1VR3A 3ZYHA 4O7XA 4UW6A 1W28A 4WZCA 1CAXA 3LDRA 5CFDA 5I8TA 1ZNPA 1C5HA 5J98B 3ZXKA 3NNMA 2ZGOA 1RTVA 5IK7A 2BNMA 2J42A 3GCXA 3HPNA 4XURA 4Y5Z0 4GIQA 4GKYA 1MQTC 1W03A 1C4RA 3IAQA 5FOBB 2VZOA 1XPWA 4EV0A 1GV9A 5HCFA 3SKJE 5GZCA 4LT5A 1H8TA 5D8AB 3RQ0A 5CFDC 3ZFEA 2WLPA 5JI9A 2C1FA 1RUJ1 2ORZA 4LBQB 4A2UA 4CPBD 3R6SA 5C8WA 5BNNA 3T0DA 1VBD3 5AFEA 2HWC1 4AWDA 4XHXA 2EIEA 2IVJA 2YROA 3TBDA 2RM22 3B69A 4U36A 2CWMA 4R9BA 4I09A 5LW9A 5H9QA 4B8EA 4QAWA 1H8TC 4LPLA 3MW4A 3ZFEC 4BA6A 4ZU4A 1ZRIA 2PN5A 2A73B 2XMLA 4AEKA 5BNNC 3WQBA 2E26A 5HI0A 1WMEA 2XWBB 2HWF1 3WG1A 2VOXA 4JKMA 3RJRA 4CE8A 1C8NA 2WS93 4ASMB 4HPKA 1CONA 1OURA 2UWBA 3NKGA 5GZFA 5A7SA 4CEYB 5F2SA 3BVCA 4Z2AA 2RM21 3ZOIA 2BGPA 4LKEA 4AGGA 3PTRB 3WNKA 2D7FA 1HB1A 2W3JA 2ZTNA 2IFWA 3PUQA 4CCNA 1JH5A 1JXNA 5C33A 2JD4A 4TYSA 1NE6A 4XUTA 3ZYRA 3H8UA 3PMEA 1HRV3 1MZEA 4F8AA 1KQRA 2WN3A 3N9OA 4Y5TA 3UKTA 1XU2A 4YM1A 4OYUA 4DINB 1H8VA 2W1WA 3OD4A 3ZPYA 2FQPA 4FPCA 1ZBA1 1V6LA 1Q3EA 3V0BA 3WG3A 2ZEYA 5DZFA 1W8TA 4RGKA 3OD0A 1BZWA 1PNGA 1QOOA 3L2HA 4QXHA 5DUVA 2DDUA 1WGPA 1H30A 2X10A 4QGLA 1QJY2 2B8MA 3N35A 4I0BA 5I0RA 2JIGA 3H3ZA 2JEMA 4CDQA 4H7MA 1NQDA 2WFF2 4E9KA 1CX1A 1FT9A 1ZBE2 4OVEA 3RVHA 2CTVA 2YBSA 1KS4A 4HXCA 5A3LA 4CDQC 2G9FA 3OPWA 2YC0A 2BWCA 4H55A 1RINA 4Q26A 1CJDA 4ZZ8A 2JDNA 1QQP2 4HT1T 2WFPA 3WW1A 1QJY1 5K7PA 2O14A 5FY5A 2YUEA 2XGXA 1WW6A 2D44A 1QJX2 5L7OA 1REFA 1YIFA 2KXLA 3PVOA 1X7NA 2RV9A 3ZO0B 5EIYB 1JYWA 1MS5A 5ACA3 4P9GA 4MGTA 2GZWA 1GSLA 1ZBE1 3IMMA 3HBZA 5FFOC 1J58A 2R042 3P1IA 4P02B 3U07A 2XUMA 1TVGA 2DTYA 1CX4A 2WQ4A 3KV5A 3FLRA 4QXKA 5FDBA 1URXA 4YGDA 5L7OC 1RUC3 1OKQA 2D6PA 4W4ZA 3D0SA 3PHMA 2BUKA 1Y7BA 4OULA 4XZUG 2E33A 5JOYA 5LA1A 1OPMA 1V6KA 1E57A 3FN9A 3ORJA 2QDRA 1QJX1 1F2NA 5CG9A 2Q8EA 4CPBA 5FR3A 1S0IA 1H4GA 4CCOA 2W9XA 2R041 1E5HA 1J1LA 2XJRA 2FDJA 1N3PA 3AXDA 4J25A 4NAMA 2G19A 1RUF1 4MZUA 1OF4A 1Z7S1 2HKXA 2R1BA 3B9IA 3UGFA 1GWKA 5KR7A 2WZR3 3PTYA 3SH5A 2XHKA 3I2OA 4DMIA 4QX7A 1ONAA 3T0AA 2K46A 3OUJA 5L9RA 1JZ3A 4BXFA 5IVFA 4AVTA 4Q4V2 4LK7A 3EO6A 3KZ4C 4TXWA 5JDBA 4BQ1A 2WFF3 4HKLA 4PBOA 3WZ1A 1TMF2 4JHTA 3JQWA 3VD5A 2XJTA 2PQSA 3MF9A 3DYMA 1FI2A 4XBLA 5FY1A 1VMHA 3WF2A 1GKBA 3O7OA 1ZA7A 2IXKA 3O1RA 3O0XA 3QD6A 3J7LA 3R4SA 1DLCA 1NX9A 3AP9A 3WDXA 1QJU2 1M06G 4A44A 4RGGA 5B2GB 1OLRA 4C8DA 5FY9A 1YJLA 1AYN1 1G86A 3POJA 4M0NA 2GP5A 2VNGA 4C91A 3VKFC 2ZGUA 1G9DA 4CP9B 1AR82 5F3GA 4B7EA 1TMF1 4CCDA 5FYTA 1CAVA 5KC6A 2DCZA 4Z07A 3GZTB 4XDQA 1XXNA 2HWB2 2JDUA 2NMOA 3E6BA 1VRH2 1MEC1 2JE7A 4OZOA 5FZOB 3KCCA 4XFBA 4MH0E 3WD5A 3TEXA 4ATFA 5KXCA 2JE9A 2XONA 3S6PA 4QQHA 5IT6A 2XXZA 4V1PA 4NIAA 2WWUA 4XDOA 2VMGA 5JMOA 1O7FA 3HVDA 1EPZA 2Z69A 1K5MB 4PLNA 1AR81 2W2IA 5LBCA 3POFA 1CGPA 1MZ5A 5F37A 1BEV1 4GALA 1DG6A 5LA9A 4NR1A 4AQTA 2ZOEB 3OYWA 4FFGA 3AP5A 3THCA 1X36A 1YFXA 4XFAA 1PMIA 2VVEA 1YUDA 2H6CA 1VIWB 2Q1MA 3AFGA 2A3WA 2JG9A 4JV4A 4UW5A 5LY1A 2ARBA 4IESA 1PO12 2WJSA 3N36A 1OQDA 1U5XA 2JB8A 1UOGA 3SNMA 2QCSB 4QT6A 3ZN6B 1PVXA 4WVWA 3LOBA 4D7TA 1XE8A 5JXHA 4Q4V3 5I0DA 5JZGA 1YC61 4WM8A 3USUB 3OUIA 5JXGA 1C8M1 2JG9C 2VCCA 3QH6A 4P9WA 3PUAA 1JU3A 4WM7B 1PX3A 2SLIA 3WY6A 5KHJA 2HYKA 4RGAA 1OUXA 1W6NB 5ANNA 5F2WA 3VZJA 2GSYA 2ETEA 3TEWA 2BU9A 1MS4A 2KR2A 5FMBA 3JZVA 3FE5A 4UXAA 5JZGC 3DYPA 1AUYA 1WW4A 2JG8A 3N7KA 4JZRA 4M01A 4WM8C 4CEWA 2QUOA 3EB7A 1LGNA 2X29A 1KITA 1QJU3 1VPHA 5I93A 1HJGA 4PDWA 5FZ3A 4AXOA 3JQXA 3LDKA 4QQLA 1UMIA 3HD8B 1GP5A 1XNBA 4FPFA 5FZ7A 3KV4A 4LQRA 5A33A 1UW8A 3DECA 4IQPA 3KV6A 4QPGA 2VCBA 4NHKA 2PTMA 1E5RA 3VB9A 2JG8C 1DGWA 5FMOL 2J1SA 1DZQA 4RSUA 4AQSA 1DQ5A 4CEWC 3NNGA 5FZBA 5A7PA 3THPA 5F39A 1OVPA 3AMMA 3ZN4A 2UY9A 5C4WB 4PDWC 5FPBA 2HWB3 4GA9A 4XFIA 4E4ZA 4UF0A 1VRH3 3C7HA 5FZMA 3X29B 3OG2A 5JMCA 5JIAA 1O8SA 4QPGC 2MPFA 4GWJA 3IKWA 1ENQA 1QMJA 4RQPA 1LTEA 1LOBA 1EV11 4CEYA 4IEYA 5FPVA 1YQ2A 3U0ZA 3BU0A 1NCRB 3NJXA 3O12A 3OEAA 1IQAA 1DYPA 2OYZA 2I45A 1OD3A 1TNRA 1ULGA 1UOJA 2BYVE 2PHDA 1GMMA 4P5YA 2ARCA 5K9YA 5JUVA 3VBUB 5FYHA 5HCAA 1GWMA 3Q8EA 1LOFA 3S7IA 4RQPC 3VN4A 4Y20B 5DAPA 1LODA 2EALA 2YYOA 3SKVA 1UU6A 2VQTA 3NNLA 3POBA 4XFGA 4CEYC 3C8XA 4LTAA 1OLMA 1UYPA 1RUG3 3VGIA 1UY0A 3ILNA 1FV2A 2XLFA 5FQ0B 3EQEA 4DRRA 1PO13 4YW5A 1OA3A 1JOBA 2D6MA 2IXHA 4LUMA 1B35B 1KEXA 1LOFC 1SBEA 1BQPA 1EUUA 4Q4Y2 2WO2A 4QDRA 5FZ9A 3UKNA 1KFXL 1PO23 1YLLA 3A4UA 2VR4A 5CVRA 4PIYA 1PNFA 2NP0A 4Y1YA 3WW2A 5CNAA 1RUI2 1UU5A 2FMYA 5DN2A 2VM9A 4RA0A 4KI5M 1R083 1VMJA 3BGAA 1O91A 2E51A 2J7MA 1KXGA 4FCAA 4GZ9A 1XB9A 3K75B 5CBLA 1R091 5FOJB 1T6BX 2WNVB 3RZHA 4DQAA 2X8KA 3ZXEA 4COVA 4LKFA 4QDQA 1DQ6A 2ZX2A 3AC0A 5HCHA 1NT0A 1FYUA 2GNTA 4UFKA 1RUNA 5DABA 3I2HA 4YYOA 4CDWB 5B4NA 1UCXA 2EAAA 1A6CA 2B9VA 4R52A 5GZEA 2RS53 3BTAA 1OI6A 1HQLA 1PMHX 1NA1A 3WNLA 4NWWA 3QOPA 2XWJB 1VBB1 3LGRA 2VQ0A 3C7OA 4JGZB 1UXXX 2CGNA 4XEZA 2GC2A 1W9WA 2O8OA 4QKBA 1YI9A 5C9AB 1HQNA 2PYTA 3WQ1A 1ULPA 4IEPA 5H9PA 5CKQA 2XPJA 1O5UA 2W92A 3MHZA 3POSA 5FIXA 1NA1C 1UZZA 1HV0A 3AMPA 5FXZA 3WDYA 2GAUA 4AAXA 1VB4A 5HXMA 2SBAA 3N7LA 5DUWA 4MGIE 4YVSA 5G04L 1JODA 2WQZC 3GYDA 5BNQA 3WF4A 3K3OA 2TNFA 2NPIA 2RDNA 2ZGTA 5C5TA 5F1RA 4MO3M 4FI9A 2BEOA 4FQ4A 2P17A 4JHZA 4Q27A 1OOPB 3ACIA 4ZHNA 1H9WA 4YVSC 2WA4A 4AEDA 3UNPA 2PMWB 4GMP1 1TG7A 5T5PA 2FDHA 4XQWA 3RYRA 3OBTA 5A1LA 3H8RA 3ZYIB 1Z0HA 2GN3A 2J1EA 3MPPG 3KT1A 4Q4Y3 1A8MA 2GNMA 1O3RA 4XIKA 3NJZA 4XJAA 5JSRA 4CP1A 2D3SA 2Z4FA 4AEDC 5FP3A 1AX2A 1RUI3 4HETA 2PHTA 1MQTB 1FPN2 2D5FA 3ZXAC 2XJPA 5AC92 4EJRA 3EMRA 4CCEA 4I30A 2BFUL 3U11A 3WW4A 1JYXA 5CFDB 1AL21 1CAXB 3POYA 5D2AA 5FZ1A 4AVAA 1U5ZA 2WNOA 1ZYBA 1N1SA 3MDPA 3KCYA 5C3QA 5IVJA 3FX3A 1KGYA 3H9AA 2RDRA 4LNVA 1XYOA 2C26A 2CL2A 1RIRA 2WZ8A 1PX4A 3PL0A 4QX1A 1YFYA 3NWKA 3ZSJA 1ZZBA 4R4XA 4CVUA 4LIUA 3ZFEB 2GU9A 2VMIA 4YARA 1IOAA 1H6YA 1UYYA 5BNNB 4DUWA 1PGL1 3RZJA 1AZDA 1OA4A 4QPIA 1AYM2 3FFZA 5HXVA 2HJIA 2OPWA 1ENSA 1GZTA 1OSGA 3I4IA 1C1FA 3FBMA 1OQ1A 1W06A 2AENA 2WT1A 1IS3A 4OHVA 5GALA 4L8QA 3AX4A 3IWZA 3KM5A 4OHWA 1US2A 3ENRA 4PF5A 3D82A 4I02A 4HK8A 4QPIC 4MX3A 1S4CA 1V6JA 2IC1A 3CJIA 4HKOA 2ZS6B 3WNXA 3KGLA 1GNYA 4MG2A 2W1UA 4HPKB 1GOGA 1QDCA 4AE2A 3OPZA 1BMV2 4JQTA 4Y33A 3VKNA 3LEIA 1NQJA 4HSJA 4HG6B 1JUIA 1O3QA 1W6QA 3K77A 3P3PA 2A3XA 3CJIC 3ROUA 4UW3A 4MGYE 2D6LX 1NCQA 4XBNA 2DURA 4N53A 2AZ5A 2W39A 3ES4A 4OUEA 4ARYA 1G7YA 3NKTA 5F7UA 1DBNA 1WCQA 3THTA 5FZEA 1NG0A 2LS6A 4Q0SA 1BVP1 1PMJX 3RMXA 2EXHA 2QQVA 4X8NA 2KA3A 2P34A 1UMZA 5A7WA 5A6XA 3V0BB 3J7HA 1NYWA 3VHOA 2LRPA 1BMV1 4HN0A 4NVPA 1NCQC 1WMDA 4GMP0 4N53C 3APBA 4ES8A 2VZVA 1W6MA 4PJYA 1FPN3 5A7NA 5ABJA 5DUUA 5AC93 2D3PA 2GH8A 4NHYA 2LW8A 4CU7A 4CDQB 3IM0A 3TN91 4NIDA 1AR93 4Y1XA 1QXJA 5C3RA 3T1MA 2QQOA 1OFSA 1V9U1 1HXS2 1ASJ1 3JD72 3PLQA 5FYSA 1J3QA 4AVVA 4CCJA 1OD5A 2E31A 2YXSA 5ABJC 4F3JA 1AR62 3HN3A 2DUPA 1NOVA 1U0AA 1QDOA 5CZKA 1V6IA 2J1AA 1JOJA 1OFNA 4LIVA 3AZYA 3NV3A 1PGSA 4YZ3A 3I7DA 3BN6A 1W2TA 4OZXA 5SV5A 1ENRA 1RJ8A 3U78A 3H7JA 2IXLA 2OA2A 1TEIA 1KFUL 1AYM3 1IG0A 4DXSA 5IAXA 2GC3A 1XSRA 5C4WA 5L7OB 2KM2A 4AGVA 1UWWA 1S1AA 4COUA 4LOTA 1ULDA 1W0NA 2VZ1A 1V00A 3JD71 4HOOA 4NUBA 1GZCA 2Z42A 5E8AA 3UYJA 4MOAA 2YPDA 3DYOA 4P9JA 4BQXA 3MF6A 1D4M3 1VB2A 4JQRA 3M3OA 4W65A 1S2EA 1K12A 5C4WC 5IVEA 2XL9A 4IEOA 3WR0A 2AC1A 4K20A 3QLQA 3GHMA 2QTWB 2BOIA 3FLTA 3CJXA 4LO6B 3BPSA 3VBUA 4QHOA 3ZDVA 4FSJA 5HV4A 4QGNA 4ISRA 3GBGA 1YRZA 4Y20A 1AHSA 2ORXA 3VKMA 1VBC3 2BERA 3RWNA 3AJYA 2WYFA 1H1MA 4FPKA 3KMHA 3K3NA 4ORFA 3VD4A 4FPYA 3VBUC 5JXJA 4NPLA 1LHUA 4FQZA 4QX2A 1BBT2 1UZVA 1CPMA 1F31A 2PLV3 3CZJA 5E1RA 4AQ2A 5J37A 2FD8A 3I2GA 3N7JA 4BQ4A 1UY2A 4C1WA 2GN7A 4KWLA 1FOD1 3SITA 3AK0A 2A3YA 4Q29A 1BK1A 3W58A 3AM2A 4XABA 3PUSA 4XUNA 1HXS3 3ZXJA 1K5JA 2QE3A 3IAPA 1DFQA 4MGQA 3VDDA 1VAKA 3AL5A 2AEYA 4QU1A 4KBBA 1AR63 1GZ9A 3TOJA 5C6CA 1Y9MA 4MADA 4MLOA 3O1TA 5JLVA 2A6YA 4OLLA 4XJWA 1Q8PA 3ALQA 3ZMNA 4BYYA 5FPXA 1IPKA 3VDDC 2GNDA 4IGOA 4JVAA 4IDZA 3BCWA 4PT6A 2D6NA 1ZRFA 3ZYPA 4UFJA 4FXGB 2V5YA 1OH3A 2P3JA 4LLFA 1DQ4A 1CAVB 2B45X 5GM0A 4TZDA 4CCMA 4LLOA 4LBJA 3MW2A 4B29A 3VHNA 3T2OA 1FNZA 5KXEA 1W8NA 4LKSA 5TSWA 1LKNA 2UY8A 2FDFA 1S55A 4OHYA 2Y38A 5FYUA 2H6BA 2VC9A 2XR4A 3LKJA 4JC1A 3HJRA 3ILFA 3AMNA 2A6ZA 4NRQA 1VBD1 4QDSA 5BNPC 5JR2A 2BBVA 4MYEA 1D0HA 1O4YA 4Z1VA 5F5AA 3T2PA 3LFIA 4JDMA 4LBMA 5EYYA 3UGHA 2CDOA 2WT0A 1QGLA 3A22A 5LY2A 2VY0A 2B7YA 2XVLA 1MACA 1RUH3 2JXAA 2W47A 3U1XA 2DFBA 3ZYFA 2EAKA 1JZ2A 1YI7A 3OYWB 3GZUC 4F7ZA 4CXYA 2MHFA 4Q4W2 1UNBA 3H3UA 2JG9B 4QX8A 5FRAA 5H9SA 2A70A 2WS91 1NE4A 5C7GA 2BVBA 1BBT3 1MZ6A 1SLAA 1CAUA 4DO0A 4RFRB 5D1IA 1WLWA 2AGSA 5KXBA 1SHWB 3ZIWA 3J8F3 1OLME 1PK6B 3CL1A 4K7JA 4TLGA 4AI0A 5JZGB 4WM8B 4YW7A 3ZKYA 1OH4A 1UO9A 1Y9GA 2PELA 2Y6JA 1RL3A 2ZAHA 4PLMA 3LAGA 2ZZJA 2TBVA 5EJ3A 2OT7A 5BUVA 2BRTA 1REEA 1FXZA 1HRV1 1NLQA 2IXIA 3ELNA 3NJVA 2VOKA 4YPJA 3WNPA 3LZZA 3MBWA 5A6QA 1DQ2A 1BCXA 3GDBA 3MIEA 2BV4A 1VALA 2OQ7A 2JG8B 4CEWB 2B39A 1WCUA 3K4ZA 2WO3A 3MEPA 3H42B 4QPYA 1O3SA 1E5SA 4GKXA 3WG4A 2VOVA 4QKDA 4CU6A 2OIIA 3MGUA 4PDWB 4N7IA 3KT7A 3D8CA 4HBNA 3C2UA 5C8CA 3G7DA 4P9LA 2O1QA 4AVSA 5IJRA 5A33B 4QPGB 4DFSA 1OUSA 1POV3 1HB3A 4KMQA 5FJKA 5LBBA 2GP3A 4CUBA 3AZXA 5EZWA 1CAWA 5ACA2 3C7GA 1HIXA 3JB4C 4IE5A 3AFKA 1IKPA 1N1VA 3AMHA 4LKDA 1UD1A 4ISQA 2RS33 5A3WA 2EICA 4UF0B 3ZSMA 5C8CC 4XZPA 4LULA 2YGMA 1DYOA 2Y6HA 1PVC2 3EBRA 3GBWA 4IV3A 4BZ4A 2XKOA 4XQ4A 2MEV3 2GDFA 1A78A 5L9BA 1XNCA 4ZXKA 1RUC2 2UYBA 4RQPB 2DVAA 2VMHA 4PF1A 5ERLA 2PHWA 4COZA 1S2BA 4LBNA 1H0BA 5FKCA 1XC6A 3LA7A 4Y24A 3E5UA 4HSLA 1LU1A 1GLHA 3ACGA 3DL3A 4IV3C 4XVHA 5ACA1 4LA3A 3TRSB 1JOPA 4Y4YA 4AW7A 1NXD1 4ZU5A 4AHXA 3O1SA 1XRUA 4PI0A 4UFIA 1QF3A 4Q4W3 2VZSA 1EYBA 1RUC1 2VCAA 2DF7A 2W5FA 2OPKA 3H50A 3AKSA 1R1ZA 2WZR2 3WHTA 3ASIA 3FBYA 1CPNA 1RMU3 3B00A 5FZ0A 4JRLA 1UX7A 2J1VA 2HWE2 3FHAA 4BOWA 4CTEA 5DDJ2 4DEQA 5DQ0A 3VV1A 3D6EA 4K40A 4BQ2A 3SLIA 2CSGA 3I3EA 2YPJA 1NLRA 3JUUA 4LHKA 4UFLA 2Q8OA 1KRIA 1VBE3 2Q8CA 1AJKA 4I3GA 5JPMB 3PVEA 1PIV3 4XCBA 1ODNA 2NZ9A 3OF1A 4YW4A 2QQUA 4JAAA 1NY72 2WZR1 4R8HA 3I59A 3AYAA 2BWAA 3ZPOA 4XF1A 4AI8A 2A5ZA 3WF3A 4P14A 2ENRA 2HEYF 4XF4A 4FVVA 4YLZA 3O0VA 3UJQA 1CJPA 2ZHMA 3FZ3A 1NA1B 2WFF1 2W94A 3HQUA 2HBUA 4JTNA 3SXWA 4BQYA 1Y9QA 2V5DA 3U10A 4FBFA 2Y0OA 4LR4A 2JDHA 1XE7A 1VRBA 3CIHA 4NO4A 5L9VA 5ANQA 5E6HA 3OEBA 1NY71 1PVC3 3I2IA 1SACA 4TWTA 1ZZ8A 4XFFA 3RZZA 3BTXA 3MZHA 4IEQA 2X5IB 3O1OA 3WNMA 2VMEA 1QNYA 1XJAA 3INAA 2NMNA 1EUTA 1QQP1 2D5HA 4FPHA 4YVSB 4N9HA 3J7MA 5HV0A 3VKOA 4EN9B 1DHKB 3MO4A 3RI9A 2YU2A 3T3YA 3GF6A 3NVCA 2WABA 3OY8A 1ST8A 2R062 2WRAA 4IE0A 3VZKA 3O14A 4GQ7A 4AHZA 4E8CA 4AEDB 2QQIA 2ZGPA 2V4AA 4FPLA 1O4ZA 2C6SA 2XL7A 4Q1PA 3AXEA 4RR3A 2VGDA 2Q30A 1LB2A 4FPJA 1JU4A 2EIBA 3ZXGA 3JU9A 2WNEA 3BB6A 2VOTA 2V4VA 3POIA 1JYIA 2JENA 4FPEA 4XF3A 2QQNA 4OUSA 4YG3A 2HWE3 1W0OA 1S0DA 5FP9A 5DDJ3 3BKZA 2ZZQA 3SHRA 3DXTA 1BJQA 2VZQA 3USSA 1VMFA 4RR3C 3LEMA 3I2JA 3W20A 4DUXA 3ZDSA 3RI8A 1RJ7A 2VVFA 4FTBA 2G9ZA 2CAVA 4CYDA 5JSPA 4BQ3A 3PDQA 4RHV3 1G9AA 3POEA 2BVVA 4QQPA 3WP5A 4XXAA 2VUDA 2HLEA 4A41A 2ET1A 4ASKA 4OMCA 1BK0A 1HRI3 2VBDA 5JPNB 4DPNA 2ILMA 3ACFA 3MUZ1 4IEZA 1QNWA 2C5DA 5LBEA 3WXPA 3NV1A 1LOAA 1QEXA 2R30A 4IUGA 4XUOA 5K0UA 3PVBB 4Q4V1 5CYYA 5G05L 3SEEA 2VMDA 5C71A 1YQ8A 5J1XA 2ET7A 3RYKA 2RS12 4WVZA 1MZFA 4QPIB 2UU8A 3WP6A 2YFZA 2QDNA 4LUKA 3NL1A 1WUVA 4UFHA 5DG1A 5K0UC 1I3HA 2VU9A 3GBFA 3JBG2 4IGPA 5JXIA 2PHFA 3W5NA 2VO5A 2ID4A 4C1XA 4CCLA 1QJU1 1KJRA 2CYFA 1ZVFA 1GYKA 4NRMA 4HVRA 4UBHA 1PGW2 1YQ5A 3CJIB 1D2QA 3AYEA 5FZDA 3VHRA 3W59A 2Z5WA 3PMSA 5FZFA 2C24A 1LNSA 1YXWA 2E32A 4CDUA 5A6ZA 2ZHKA 2D40A 2J1TA 3O1PA 4BB3A 3M8LA 2PA7A 1AX0A 4NIIA 1Y43B 2WSUA 2R063 1W6QB 3VBFA 2D6OX 2HWB1 4DY3A 2H0VA 2JDZA 3H8OA 3HNBM 4ZXEA 1VRH1 1OPOA 4AHWA 1NCQB 2XDVA 1A3KA 4N53B 4CDUC 1RUG2 1BYHA 1IQDC 2C0ZA 4P9IA 3V56A 4AI3A 3U4SA 1RB8G 4GAZA 1Z7S3 4PLOA 1PGW1 1AXKA 2JWPA 3QBQA 4EYUA 5APAA 3VBFC 1W04A 4ARXA 3I2KA 4HVOA 2Z79A 1WLDA 5A7WB 3ECQA 3TAYA 1PO22 3DGTA 1V6OA 4TLFA 1ZREA 3H0OA 1PK6A 1RUD3 4H3WA 2H0BA 1W6MB 5ABJB 1W3XA 1ZM1A 2Q1FA 4AI2A 1R082 4AVCA 3M3EA 5EWSA 3WX5A 1L7QA 1UY1A 2BJSA 1T2XA 5KC5A 3ABZA 4IE7A 5CISA 5IYYA 1RUG1 5IK5A 4Y22A 4XW3A 2AH2A 2HYXA 5FZAA 5A3MA 5DMYA 2Y6GA 1PK6C 1LOGA 1RITA 1PO11 3CBNA 3O0WA 5CAZA 5BYNA 1PO21 2BNNA 3C3VA 5FY7A 4BHPA 1YFWA 3LOIA 2XBO3 2RS52 1KD7A 4UAPA 1NAEA 4HLTA 4Z8BA 1R081 2OX0A 2P37A 2RS13 3CU7A 4W50A 4COYA 1ZRRA 2I74A 2ZGMA 2A1XA 3NJYA 3LQCA 1IPSA 5KHKA 2N7GA 5FYYA 5A3OA 4ET7A 1HDKA 3JBG3 1GQPA 4LEJA 1PZ7A 2R7EB 3A0NA 4YFZA 4HVQA 4FFFA 1Q8SA 4G9SB 4PBPA 2EXIA 3LA2A 4LO4B 2Y33A 1JZ7A 1W90A 1S0CA 2RS51 5GJ6A 2VZUA 1UY3A 4X6QB 2C9AA 3OBAA 5KHGA 4MGZE 4YGCA 2VNRA 5KHHA 3ZXFA 4EZHA 1R1A3 4XOGA 3T4VA 3WF1A 3T30A 1V70A 1GANA 1REDA 2WWJA 3S7EA 1U12A 2VNVA 4W6WA 3DXUA 4GXLA 1YIPA 1SFPA 3NRUA 3N3HA 5BNOB 1APNA 1OLQA 2BZDA 3Q9OA 2Q0AA 2IZWA 3VDCA 2PAKA 1H4HA 2BOJA 2V09A 4MXWA 1DCSA 3PVNA 1OHFA 2ADDA 4YZ5A 4M4RA 3VL9A 4BISA 4XMIA 1UPSA 1DP0A 3MV01 3WUDA 1WMFA 3Q8AA 5IATA 5FPAA 3AP4A 1OT5A 3BUCA 5FLHA 2ZJCA 5FYBA 5SV8A 2D93A 2LM3A 1WW7A 1LHVA 2VD7A 2ZEWA 4NOTA 3WINE 3A21A 3LEKA 4GH4A 3VDDB 4JDNA 2W87A 4W6XA 2G4IA 4Q4Y1 3LEGA 2JKXA 1YJKA 5FMDA 1JZ5A 3IPVA 1PZ8A 5A7OA 3KF5A 1RUI1 4XF0A 4QGMA 1UX6A 4QWNA 4RFT0 3ZVXA 2VOWA 5KWRA 1W8WA 5FUNA 4GH4C 1JW6A 5CKMA 3DPRA 4ZZ5A 2P3IA 3MYXA 3SC7X 4W8JA 1K42A 2JECA 1W2NA 4UI9L 4AHYA 4A42A 5LK5A 1QWRA 5EPAA 3HNMA 2XG3A 1PHMA 1SPPA 2X5IA 3OUHA 4QMAA 3B94A 3DPRC 2WR9A 3RPQA 4IXLA 4X8PA 4B4QA 2XUEA 2G9GA 1COV2 4YVWA 5FZKA 1X50A 5B4XA 2J22A 1DQ1A 1GFF2 1QOTA 3D0JA 3WVJA 2VQAA 3WV6A 1Z78A 5FAXA 4DUVA 3I3QA 2X5IC 4INDA 3ZN5A 3AL6A 2VUCA 1N3OA 4CU9A 2IUWA 4HANA 5CFCA 5JAXA 3NV2A 4AF9A 3SH3A 1GBGA 4XIOA 4BM8A 4ZKTB 4GWIA 1JYCA 2B5HA 1CAUB 3M7AA 2YC4A 1ZX5A 5FO8B 3W5MA 4E8DA 4MSVA 5LRRA 2VNOA 1JI6A 3CNAA 1FX5A 3UV9A 5CFCC 3AKRA 3IDEA 3M1HA 1RHI2 3I97A 4GULA 4ONUA 1K45A 5F5QA 5LEKA 4LO5B 1OA2A 2TEPA 2WWSA 4A7KA 4BIFA 1AR92 1F9KA 1LEDA 2DU1A 4OI2A 1AR72 1ZRDA 2PQQA 4YZ4A 4E2QA 1D2SA 4CDXA 4D69A 2VZTA 3OBZA 4FP3A 4FXKB 5FY0A 1VLNA 2ZMLA 4PIXA 2DYCA 4LORA 1W3VA 1IS5A 1ND3A 4LA2A 4ZONA 2QNKA 3SQOA 1STMA 2XKPA 5LA0A 3NW4A 2BP6A 4HL0A 3U14A 3ZLIA 1FPN1 5C8CB 5AC91 1GICA 2XLGA 4OI4A 3URFA 4CDXC 5J7MA 3POGA 4XTMA 2RMU2 1N1TA 3P6BA 4DS0A 3DKWA 1AR91 3KB5A 4COWA 4E2SA 1TME2 3FC0A 4XMAA 4GWMA 1CAWB 1B09A 1O4TA 3FHQA 1IG3A 2R0HA 4RD7A 5LRSA 3OGRA 1JYNA 2VE1A 1D4M2 1JHNA 5K4LA 4IV3B 3S5AA 1MS0A 3WP4A 5I0UA 1SFYA 4AG4A 1FMD2 3RRDA 1CESA 1COV3 1EY2A 3HT2A 4WVMA 1GP6A 1AYM1 1QIQA 1G9FA 3G6JB 4QX0A 4M0HA 3LSDA 1OMIA 1IGOA 3Q8CA 4Q0VA 2PXJA 4JKKA 1H1AA 1IHMA 1VBC2 2DCYA 1JZ4A 4XJ8A 3MFAA 3W21A 3UESA 2P2KA 1F5FA 2VL4A 4V2VA 1ND2A 4XJ9A 2FCUA 1UU4A 1D4M1 3M4FA 5E88A 2EF6A 3B9CA 3WG2A 1CR7A 1WCKA 3N9LA 3GM8A 4XTPA 2K0GA 4URAA 2BW8A 2MNGA 3NAPA 3OGSA 3TYJA 5EP9A 2PLV2 5BNPA 1UKGA 3WOGA 2NLRA 4IEXA 1UZWA 1UZ0A 3DKQA 3VBSA 3VDBA 3VHPA 1ND2C 4S2GA 3H7YA 1RHI3 2JDKA 4Q4X2 5I0SA 1C28A 1DYKA 4Z92B 3ILRA 4MXVA 1RVF2 1VBC1 1ZZ6A 1BVVA 3CMGA 4NJ4A 3ZYBA 4CUAA 3NAPC 5KXDA 2AYHA 4EWDA 3WUCA 3DEMA 1NLSA 3ZXLA 3UK9A 1AR73 2JDYA 2ZGSA 4AI9A 4I3PA 3KQ4B 1C57A 3BOWA 5EYXA 5BPXA 4AK3A 1M4WA 3VBSC 3V64A 3V0AA 4B1MA 2HBTA 1DF0A 3E97A 5FMOS 3UL2A 3ZX7A 4BMBA 2PLV1 3TWIA 1PM7A 1W8UA 5KBFA 1L3JA 3AYCA 2DVBA 2FMDA 3DCQA 3I59B 3M70A 5FXWA 2BPA2 1S2KA 4BE3A 1XNDA 3GZAA 4C0HA 5FPUA 2RHPA 1W8OA 4KG8A 2RMU3 2FDGA 3IIAA 3IIIA 2YV8A 4KL1A 2PHLA 3RJ2X 1HV1A 4YZ2A 1TME3 1U5YA 1FAYA 2RDQA 3JCIA 1HXS1 2ZMNA 1D4VB 3H1MA 4QU2A 2A6XA 4BU2A 4P00B 1AR61 1UZYA 2O8QA 4W6YA 5DAVA 5FREA 3WDUA 3VUOA 3BIEA 5F6LB 3T08A 2E7AA 2B9UA 1MS1A 1FMD3 3CHXA 1YWKA 4QKFA 2R073 2HEWF 1SBDA 2ES3A 1HX6A 5DPNA 5LA2A 3E6CC 3D3AA 1RXGA 1JZ6A 1P8JA 1BLZA 3OY8B 4Y3OA 4YSFA 5ISLA 1TQ5A 2VTFA 3T0BA 2DUOA
chains in the Genus database with same CATH topology
2E9QA 3AB0A 4YGBA 5A32A 3KD4A 4EN8B 1UKRA 5BNOA 5E16A 4JRAA 4N43B 4RR3B 3T2TA 3MLJA 1O3TA 1X8MA 5I8YA 4OI0A 3SMHA 1QY4A 3J8F2 1Y3TA 3WP3A 3GALA 4Q4X3 2JKBA 3OGJA 2A71A 1RVF3 5BNOC 1XNKA 1RUH1 3PJQA 2QZ3A 3CO2A 4UBGA 5BY5A 2B46X 3L9JT 4P5HA 1WD3A 4Q0PA 1ZZ7A 3AJZA 4NHMA 1DQ0A 1WD4A 2XJUA 4S2FA 1BBT1 4IETA 4PIZA 3AKQA 2DCJA 3KS7A 3JB8A 2VECA 3J8F1 3WHUA 5K0UB 4I2OA 1LENA 3B3QE 4Y1ZA 3ZSKA 2A6WA 4P9XA 3AYDA 5HBAA 1GNHA 2EA7A 3RNSA 2RS32 5JOWA 4GB33 3SCHA 2MEV2 5JI7A 1GQGA 2GC0A 4BMEA 1G6NA 4UW4A 2LUWA 4KGGA 3MLLA 1EAH3 1LHWA 2YMZA 4CDUB 1POV1 1SLTA 4K3UA 5EXOA 3KCXA 5T54A 1GNZA 4KU8A 3VBFB 3ZYGA 3M3CA 2DV9A 2OZ6A 3FUQA 2RS31 4DRVA 3RDIA 3QACA 1NZCA 2MEV1 3MIBA 2RJKA 2ZX0A 2PAMA 2BFUS 3A0KA 5I8SA 1HKDA 2QZ2A 2YZ4A 1GQHA 4S2HA 1I9RA 1RMU2 1CVNA 4K1ZA 4FAHA 1Q8OA 1YFUA 2E53A 1LESA 2GMMA 4E4SA 1RUE3 1VBE2 5T50A 4Q4W1 4Y22B 1SBFA 1PIV2 1AXYA 2WNUA 4BH9A 2GMPA 3KGZA 1GZWA 3WT3A 5GZGA 1JUHA 1NXMA 2D6KA 1RMU1 1SEFA 1X8EA 4AFAA 3MW3A 2WKKA 4CP2A 2WNUC 3L2YA 4Y1VA 2DCTA 3W9AA 2K2SA 4XHBA 1DGLA 1VBE1 1X33A 5I0TA 4AEMA 4L2NA 5GZCA 1PIV1 4CZSA 4MV2A 2CGOA 4L92A 3OBRA 2WC2A 1VBA3 2HWF2 2OW4A 3SISA 1EP0A 3B5LB 5EFUA 1OQEA 3ETQA 1KS5A 2OZJA 1IKQA 4RS5A 4YG0A 2RR13 5AVAA 3FMGA 3WCRA 4L97A 3EXUA 4EN0A 4XQDA 1LOCA 2NM1A 4KNCA 4X6RB 3P3NA 3ZIXA 4AEJA 1DGWX 2DVDA 4CP0A 2BNOA 3BODA 2F6BA 4YW2A 4RS5C 1POV0 1PVC1 4XPVA 1WA4A 2FHRA 2WIIB 4FTSA 2ZKNA 1V6MA 2JJ6A 1ZBA2 3FUOA 4MXWB 3ZMOA 3GNEA 2HWD3 1J59A 4IEVA 1AVBA 2YDEA 2ZKLA 1J3PA 4P9YA 3I54A 1MR5A 2R6QA 3J4UH 2R16A 3AZZA 2XB6C 4EWAA 4Q8KA 1VAMA 2A7AA 3ACLA 5L36A 1MVEA 5FLJA 5JSOA 3I2DA 3SCFA 4QM8A 2VPVA 2NQYA 4AQ6A 1AF9A 4RHV2 4YW3A 4GH4B 4DNYA 1HRI2 1UAIA 2VUJA 1GR3A 1LECA 2WT2A 3WLUA 5DZGA 3VZMA 1RUJ3 4IV1A 4TSVA 3IPVB 2HWE1 5DDJ1 2HWC3 1XU1A 4G4FA 2I2SA 3KSCA 2CV6A 3DPRB 1H2KA 2CNAA 4RHV1 5JWPA 5GLTA 2WA3A 4S2DA 1CD3G 1YHFA 1LOEA 1ULCA 1S0GA 2W0XA 4IV1C 4Q8LA 4M3CA 5T5OA 4EV0A 4XE9A 1HRI1 1QH7A 2YY1A 1W6OA 4E4DX 1LCLA 4QM9A 1H2LA 2HWF3 4JGYA 1SLLA 3ES1A 4I0AA 2BQPA 3HN1A 4K9SA 1ZRCA 4Q2FA 4YVWB 2RM23 1W0PA 3QH7A 3RG0A 3KLSA 1RUOA 2PFWA 3AP7A 4KWJA 4BIOA 4AYUA 5IK8A 3OTFA 4JGYC 4EN7B 1ALYA 4D7YA 4KU7A 3E5XA 4YG6A 5GKAC 5BXXA 4META 1F8VA 2E63A 2D43A 4H7LA 4EN6B 1RUF2 4E27A 5J96B 5CFCB 2QKDA 4N43A 1LGBA 1AL0G 1Z7S2 3M3IA 4M3CF 4K8FA 2XVKA 1ZBA3 4LO7A 2BGCA 4MVTA 1FATA 4YGEA 3TNQA 1HQWA 5L73A 3N7MA 1SLBA 4YZ1A 1C1LA 2ZHLA 1H9PA 1RUD2 3FWEA 1QOSA 1FV3A 4FOQA 2R061 2Q1ZB 4N43C 1A8DA 4Q0QA 5T5LA 3U4XA 3VBHA 5T3NA 1EPWA 4LBQD 5GLZA 4U2AA 3OJBA 4Z82A 4CDXB 2QFEA 1YCIA 3O5SA 5FO7B 4SBVA 5L19A 1PZ9A 1F5JA 4IEWA 3WQ0A 2DTWA 1ND3B 3ZSEA 3VBHC 1RUD1 2A6VA 1UIKA 5GLUA 2F4PA 4OHZA 4QX5A 1AYN2 2XBO2 2W52A 3AP6A 1QJY3 4KH9A 4R4ZA 4H14A 1O5LA 1RGSA 5JR7B 1XYPA 3HWJA 4BLJA 1BXHA 4ITCA 1SCRA 4EROA 3VBRA 1ZBE3 1Q5OA 3ATGA 1DU3D 2E7QA 1S0EA 2XJVA 4LHLA 4BWOA 2ZACA 3CEWA 1YNAA 4WZFA 1MEC2 3SH4A 1QXPA 1QH6A 3AMQA 3I8TA 4K6BA 1QQP3 2XBO1 2WL1A 1N47A 2AR6A 3VBRC 1YYNA 2DCKA 5DG2A 4WVMB 1VJ2A 2RS11 1QJX3 2AUYA 3MLKA 4ASLA 3DF0A 3OCPA 4N90A 2ZABA 4DB5A 1R1A2 1BEV2 3JBG1 5EV7A 2R043 1LULA 4OI1A 4C90A 3TB0A 4B3NA 5JCTA 1RUF3 1J1TA 1ND2B 3ZFGA 3VBOA 4NHLA 4HKWA 2E7TA 4LO8A 1CIWA 1KJLA 5FLIA 3NAPB 5IK4A 3ZFFB 4K21A 2ZMKA 2HEVF 5BNPB 4C0BA 2FZ2A 3TNPB 5J36A 3OGGA 4XFCA 3VBSB 2VH9A 1Q43A 3ZFGC 4Z2WA 1R1A1 3BPZA 3VBOC 1C8M2 2ZAAA 1VAVA 4HMZA 2VULA 5DXDA 2CWSA 1H2MA 2XJSA 4URTA 2BTVC 1CN1A 4XILA 2WSVA 4DOUA 3B01A 2P3KA 4QHBA 2RJLA 3RSJA 3HR9A 4LHNA 1G9BA 3R4DB 2IFRA 2ARXA 3E5QA 4DZGA 1UL9A 4B7KA 3V0AB 4OFGA 4FAGA 1RUH2 1ZZCA 2ATFA 3HMYA 1W6PA 1QJZA 2NN8A 3H1YA 3ST7A 2CGPA 1WBLA 1AYN3 3FFQA 2K9ZA 1W39A 4BPZA 2D97A 4J1XA 4AVBA 1H1IA 1TMF3 4LE3A 3IBMA 1TNFA 3ZXDA 3IT8A 3DN7A 1IS6A 5F6KA 4R9CA 1MEC3 2GH2A 5D8AA 3DV8A 2ZA9A 3BU7A 3LSEA 3DUIA 2YGLA 4LBQA 4B4PA 4J1WA 1EV12 2NYYA 3VL8A 2VVDA 4XBQA 1U5IA 5JVVA 3FHIB 1AR83 4YRDA 5D8AC 4HN1A 5H9RA 1BEV3 2Y26A 4L9BA 1WCSA 2DU0A 1S0BA 4WV8A 1S0FA 5KHIA 5GLVA 1DGRA 2ZCWA 5A32B 3BALA 1G9CA 1LGCA 3K51A 1BKZA 3R05A 3KQRA 4YM2A 2VXRA 1SLCA 2O0OA 1QKQA 4JTOA 5LK7B 5JIUA 2ZX4A 3K48A 1C8M3 2WINB 2PHUA 2DUQA 5FCCA 5J48A 5GLWA 3MIFA 2AREA 1AJOA 1R092 1TE1B 1XYNA 4HK9A 4YW1A 2DVFA 2ZGKA 1IPJA 1KDMA 4XETA 2LTNA 4D3WA 2ZGRA 1WW5A 3IN9A 1MS9A 2CAUA 1Q56A 2DWRA 1WLCA 3NSTA 2GMEA 3B93A 1MS8A 4AGRA 5FPZA 2UWCA 1VBB2 3D4KA 2DFCA 2OVUA 2VW1A 3HQXA 1JBCA 4NPRA 2RE9A 1JTZX 2X53S 4I0WB 4MUVA 2EVXA 2R32A 4FOWA 3VKLA 3UJOA 2CY6A 1EV13 3NV4A 4YM3A 4Q0UA 3WDVA 4PCRA 1WCDJ 4LBLA 3BIWE 2EXKA 1LU2A 2UURA 4DY5A 3MI8A 4Q1RA 2DVGA 4XJZA 4AFBA 1DGRN 4YVWC 1H2NA 5CU1A 1RC6A 4AFDA 4M00A 3VLBB 4LE4A 3AZVA 1COV1 4O9GA 3EHKA 4ZU7A 5DZEA 5FBZA 3POWA 5LEJA 4KWKA 5CADA 4A7YA 3AZWA 3FJSA 3D5OA 1AL22 2ZBJA 3EJKA 1R093 4HZFA 4Y1UA 2FZ1A 5AVPA 2WNUB 3E6DA 4FOYA 2E6VA 3VZOA 4YNIA 3HAGA 1GZWB 2QJVA 4WBBA 4FO9A 2ZX3A 4IERA 1RHI1 3IMNA 3IDCB 5IUQA 1XQNA 4XF9A 1PGL2 1KDKA 1I1EA 1VBB3 3WW3A 2ZGNA 1AR71 1ND3C 2ZGQA 5FO9B 2UYAA 2QVSB 3ZSLA 1YO8A 3J26N 4GWNA 1LHOA 4AI1A 1DIWA 1H8TB 2ERFA 5CG8A 3WDWA 3WQ7A 5AFBA 2IXCA 2Y0IA 1WBFA 4RS5B 1UIJA 2R072 1AXZA 2RMU1 4HFSA 1SQ4A 2OUJA 4M3CE 1JN2P 1TME1 2FBEA 4G3YC 1HW5A 2W08A 5J09A 4AFCA 3KT4A 5I91A 2OUHA 1QHDA 4GMP3 1X82A 1ULFA 3VZLA 1N3QA 5CIRA 1FMD1 4I01A 3ZFFA 1ZA4A 1MVQA 4O9EA 2R071 4IL7A 1K5MA 3RS6A 1QXRA 2WLQA 3R0RA 4N9IA 4JCKA 3SCGA 4F83A 4J6GA 2ZGLA 1AL23 3ZFFC 4BCUA 3TN92 3LCPA 4ATEA 4NWVA 1Q8VA 1C3HA 2GC1A 4Y26A 1K5MC 1V9U2 1ASJ2 2PHXA 2Z2SB 5CA6A 2PAEA 4EWEA 2EIGA 3ZN6A 4ES9A 3S0MA 4RL7A 4IV1B 3USUA 4CRQA 4Q4X1 2V73A 1IS4A 1RVF1 5F9TA 4WM7A 1ULEA 4FTEA 5K8SA 3ME2A 1W6NA 3MIDA 2XVGA 3VZNA 1IZ3A 2YHJA 4FP2A 4XXPA 4L99A 4M3CB 4N7UA 1I6XA 1LHNA 4WVVA 4QQOA 4WM7C 1W6OB 1SLIA 4GB32 1G8WA 3IDBB 2B42B 2GALA 2R0FA 1SFNA 4JGYB 1C5IA 3QCWA 3B7MA 4FOVA 1EAH2 2D98A 4K1YA 3MFCA 1UPIA 3N4MA 1N1YA 5JOZA 2W68A 2IXJA 2GNBA 3LA3A 4KGQA 1WLTA 2D3RA 1I5ZA 4D94A 1FNYA 4LBKA 3H1WA 4GB31 3CLPA 2ZPXA 3PNAA 5CB7A 4XFHA 4FPGA 1NCRA 1EAH1 3RMYA 5JOXA 1V6NA 1QU0A 1J3RA 3MICA 4LBOA 4BLIA 4XJUA 4AFMA 3MIHA 4XYXA 2QQPA 1FOD2 4OHXA 3V65A 4OUMA 2Q5TA 5HCBA 2UWAA 1VP6A 3TN93 2Q4SA 3PJYA 3M2MA 1NCRC 1RUE2 3LWCA 3VBHB 5FTTC 1V9U3 3T1LA 5FQ0A 1ASJ3 1B35A 4A7ZA 3MIGA 2VW2A 2I07B 1AX1A 4B4RA 1Q8QA 5T5JA 2EXJA 5GZDA 1DZRA 4L11A 4YM0A 1LJ7A 1B35C 1MS3A 1S0JA 1RUE1 3ZYJB 2WNVA 4NN0A 3JD73 4QD2A 1DDLA 2JICA 3S30A 3VBRB 1UN1A 2PHRA 1LEMA 1DLLA 3RYPA 4D7SA 3HIFA 4PQ9A 1VBA2 2ZHNA 4CDWA 3FLPA 2WNVC 1VBD2 4R9AA 4KQ7A 4FPOB 2RR12 1UF2C 2A75A 5J3UA 3R4UA 4JGZA 5E89A 4E2GA 5C9AA 2JX9A 2R1DA 4CDWC 1SCSA 3UKVA 1W2UA 1LR5A 1D0GA 4JDOA 2VG9A 3WCSA 4A3XA 3NO8A 5T52A 2XH6A 3J9SA 4IEUA 1VBA1 3ZFGB 5BV6A 2XLAA 4JGZC 3VBOB 2WS92 3MPBA 5C9AC 2TUNA 1ZZ9A 4QQ2A 2RR11 2XJQA 2HWD2 4KG0A 3M3QA 3LB9A 3CF6E 3GHNA 1FOD3 1SMVA 1ENXA 3AKPA 1SDWA 1OOPA 3AKTA 4DXZA 3WDTA 2IWGB 1HRV2 2LALA 4YFWA 2WZPP 4MGKE 3BOPA 2VW0A 2ZX1A 4FT8A 4SLIA 1T6GC 1CQ9A 5T55A 1OOPC 1DZTA 1LRHA 2HWD1 3HT1A 2VUAA 5DUXA 1HLCA 1RUJ2 2R49A 4R9DA 1W6PB 1MQTA 3B02A 2HWC2 1VR3A 4UW6A 4WZCA 1CAXA 5CFDA 5I8TA 1ZNPA 1C5HA 5J98B 3ZXKA 2ZGOA 1RTVA 5IK7A 2BNMA 4Y5Z0 4GIQA 4GKYA 1MQTC 1C4RA 5FOBB 4LT5A 1GV9A 5HCFA 1H8TA 5D8AB 3RQ0A 5CFDC 3ZFEA 2WLPA 5JI9A 2C1FA 1RUJ1 4LBQB 4A2UA 3R6SA 5C8WA 5BNNA 1VBD3 2HWC1 4AWDA 4XHXA 2YROA 3TBDA 2RM22 3B69A 4U36A 2CWMA 4R9BA 4I09A 5H9QA 4B8EA 1H8TC 3MW4A 3ZFEC 4BA6A 4ZU4A 2PN5A 2A73B 5BNNC 4AEKA 5HI0A 1WMEA 2XWBB 2HWF1 3WG1A 2VOXA 3RJRA 1C8NA 2WS93 4ASMB 4HPKA 1CONA 3NKGA 2UWBA 5GZFA 4CEYB 2RM21 4AGGA 2D7FA 2ZTNA 2IFWA 1JH5A 1JXNA 5C33A 2JD4A 4TYSA 1NE6A 3ZYRA 3H8UA 3PMEA 1HRV3 1MZEA 4F8AA 1KQRA 3UKTA 1XU2A 4YM1A 4DINB 1H8VA 3OD4A 3ZPYA 2FQPA 4FPCA 1ZBA1 1V6LA 1Q3EA 3V0BA 3WG3A 5DZFA 3OD0A 1BZWA 1PNGA 1QOOA 3L2HA 5DUVA 1WGPA 1H30A 4QGLA 1QJY2 2B8MA 3N35A 4I0BA 5I0RA 3H3ZA 2JEMA 4CDQA 4H7MA 1NQDA 2WFF2 4E9KA 1FT9A 1ZBE2 4OVEA 2CTVA 1KS4A 5A3LA 4CDQC 2G9FA 2YC0A 2BWCA 4H55A 1RINA 4Q26A 1CJDA 1QQP2 4HT1T 2WFPA 3WW1A 1QJY1 5K7PA 2YUEA 2XGXA 1WW6A 2D44A 1QJX2 5L7OA 1REFA 1YIFA 2KXLA 3PVOA 1X7NA 3ZO0B 1MS5A 5ACA3 4P9GA 2GZWA 1GSLA 1ZBE1 3HBZA 5FFOC 1J58A 2R042 3U07A 2XUMA 2DTYA 1CX4A 2WQ4A 4QXKA 3FLRA 5FDBA 1URXA 4YGDA 5L7OC 1RUC3 1OKQA 2D6PA 3D0SA 3PHMA 2BUKA 1Y7BA 4OULA 5JOYA 1OPMA 1V6KA 1E57A 2QDRA 1QJX1 1F2NA 5CG9A 1S0IA 1H4GA 2R041 1J1LA 2XJRA 1N3PA 3AXDA 1RUF1 4MZUA 1Z7S1 2HKXA 2R1BA 3B9IA 2WZR3 3PTYA 3SH5A 2XHKA 4DMIA 1ONAA 4AVTA 4Q4V2 3EO6A 3KZ4C 5JDBA 4BQ1A 2WFF3 4HKLA 4PBOA 3WZ1A 1TMF2 3JQWA 2XJTA 3MF9A 1FI2A 4XBLA 1GKBA 3O7OA 2IXKA 3O0XA 3QD6A 3R4SA 3AP9A 3WDXA 1QJU2 1M06G 4RGGA 5B2GB 1OLRA 1YJLA 1AYN1 1G86A 4M0NA 2VNGA 4C91A 3VKFC 2ZGUA 1G9DA 1AR82 4B7EA 1TMF1 1CAVA 5KC6A 2DCZA 4Z07A 3GZTB 4XDQA 1XXNA 2HWB2 2NMOA 3E6BA 1VRH2 1MEC1 2JE7A 3KCCA 4XFBA 4MH0E 3WD5A 4ATFA 5KXCA 2JE9A 3S6PA 4QQHA 5IT6A 4V1PA 2VMGA 1O7FA 1EPZA 2Z69A 1K5MB 4PLNA 1AR81 1CGPA 1MZ5A 1BEV1 4GALA 1DG6A 4NR1A 4AQTA 2ZOEB 3OYWA 3AP5A 1X36A 1YFXA 4XFAA 1PMIA 2VVEA 1YUDA 2H6CA 1VIWB 2Q1MA 3AFGA 2A3WA 2JG9A 4JV4A 4UW5A 2ARBA 4IESA 1PO12 2WJSA 3N36A 1OQDA 1U5XA 3LOBA 3SNMA 2QCSB 4QT6A 3ZN6B 1PVXA 4WVWA 4D7TA 1XE8A 5JZGA 4Q4V3 4WM8A 3USUB 1C8M1 2JG9C 3QH6A 4P9WA 4WM7B 2SLIA 3WY6A 5KHJA 2HYKA 4RGAA 1W6NB 3VZJA 2GSYA 2ETEA 1MS4A 3JZVA 3FE5A 4UXAA 5JZGC 1AUYA 1WW4A 2JG8A 3N7KA 4WM8C 4M01A 4CEWA 2QUOA 1LGNA 2X29A 1KITA 1QJU3 5I93A 4PDWA 4AXOA 3JQXA 4QQLA 3HD8B 1XNBA 4FPFA 5A33A 1UW8A 4IQPA 4QPGA 4NHKA 2PTMA 2JG8C 1DGWA 5FMOL 4AQSA 1DZQA 4RSUA 4CEWC 1DQ5A 3THPA 5C4WB 3AMMA 3ZN4A 2UY9A 4PDWC 2HWB3 4GA9A 4XFIA 4E4ZA 1VRH3 3X29B 5JMCA 5JIAA 4QPGC 2MPFA 3IKWA 1ENQA 1QMJA 4RQPA 1LTEA 1LOBA 1EV11 4CEYA 4IEYA 3U0ZA 1NCRB 3O12A 2OYZA 1IQAA 1DYPA 2I45A 1TNRA 1ULGA 2BYVE 2PHDA 5K9YA 3VBUB 5HCAA 1LOFA 3S7IA 4RQPC 3VN4A 4Y20B 5AFEA 1LODA 2EALA 2YYOA 1UU6A 4CEYC 4XFGA 4LTAA 1RUG3 3VGIA 3ILNA 1FV2A 2XLFA 5FQ0B 3EQEA 4DRRA 1PO13 4YW5A 1OA3A 2D6MA 2IXHA 4LUMA 1B35B 1LOFC 1SBEA 4Q4Y2 1BQPA 3UKNA 1KFXL 1PO23 1YLLA 3A4UA 5CVRA 4PIYA 1PNFA 2NP0A 4Y1YA 3WW2A 5CNAA 1RUI2 1UU5A 2FMYA 4RA0A 1R083 1O91A 2E51A 1KXGA 4FCAA 5CBLA 1R091 5FOJB 2WNVB 4DQAA 2X8KA 3ZXEA 4COVA 1DQ6A