3ACLA

Crystal structure of human pirin in complex with triphenyl compound
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title A small-molecule inhibitor shows that pirin regulates migration of melanoma cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 74
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aclA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aclA01
3KGZA 4X6RB 3H1MA 1I5ZA 4Q29A 2GC3A 3BPZA 1UW8A 3M3IA 3U11A 1J3PA 3E6DA 3ST7A 4N9IA 5CVRA 2BNNA 4MGZE 3OCPA 4PIXA 4AQ6A 2GC2A 3HIFA 5CU1A 4XF9A 2Q4SA 5CADA 4IERA 1CAWA 3USSA 2OYZA 5JSPA 1O5UA 2D40A 5JAXA 2UYAA 3NL1A 4YRDA 3I54A 1ZZBA 5LEKA 1J3QA 4IEZA 4WBBA 3CL1A 3IDBB 5BUVA 5FLIA 1ZRDA 3UKNA 5E16A 1CAWB 2Q1ZB 1ZRRA 3N4MA 4AVAA 1EPZA 1SQ4A 2PQQA 2WFPA 1ZX5A 1YFUA 4XFCA 1DZTA 4LA2A 1NXMA 4WVZA 4GULA 3VHRA 5FDBA 2WC2A 2VECA 3RPQA 4XF3A 4HVQA 5J7MA 3HT1A 5I8YA 3WW2A 1UIKA 4OFGA 3BB6A 2ZCWA 4IEVA 2PYTA 1YFXA 5KBFA 2PHLA 3R6SA 2HJIA 1VP6A 3QACA 4HBNA 4TLFA 1H1IA 5EZWA 4LULA 1O3SA 1CAUA 4H7LA 4LTAA 3RNSA 5D1IA 2XHKA 3QOPA 2UYBA 3E5QA 3CLPA 3E6BA 3ES1A 4F8AA 1NE4A 4E2SA 1YFWA 4HZFA 4IEXA 3PVBB 2ET7A 4FT8A 3NW4A 1CGPA 4I0AA 3MZHA 1CAUB 3ES4A 2CGPA 1WGPA 1XE8A 1SFNA 3RYRA 2PHDA 5KHKA 1YLLA 1J3RA 1DGWA 4XF4A 4BIFA 2ATFA 4P9GA 3I7DA 2GH2A 3H3UA 3LA7A 3SCGA 2CV6A 4HSLA 3KMHA 4ONUA 1O4TA 4XFBA 2K9ZA 4QGMA 4XF0A 1EP0A 1UPIA 5I93A 3RZZA 3H50A 2IXJA 4CYDA 2GZWA 2XLAA 3S7EA 3OF1A 4Q0SA 1U12A 5C6CA 4AVBA 2XKOA 1L3JA 3IDCB 5C8WA 3E97A 1J59A 1SEFA 3RYPA 4WZCA 3WW3A 4YYOA 4HMZA 2QJVA 5K8SA 5I8TA 4XEZA 4HN1A 5FQ0A 2OA2A 1RUNA 4OLLA 4PIYA 2IXIA 2GC1A 2V09A 4MGKE 5T3NA 4FAGA 4IESA 4QXKA 2EA7A 2IXKA 5JR7B 3UKTA 4D7TA 5FPZA 4Z82A 4YNIA 2C0ZA 3TNPB 1ZRFA 5I0RA 2B8MA 4JTOA 5BXXA 5FCCA 5I8SA 1I6XA 3IWZA 3DV8A 4HVOA 1ZZCA 5FQ0B 1LRHA 3RDIA 5J3UA 4YSFA 1H1MA 2IXCA 2QCSB 2ETEA 2IXHA 1LR5A 2D5FA 4HVRA 2Q0AA 1FXZA 1Y9QA 1ZNPA 1YWKA 2D93A 3NVCA 4FAHA 3H7YA 1G6NA 3SMHA 3WW1A 2Z69A 4NVPA 1YHFA 2EVXA 3S7IA 4I01A 4KWKA 3KCCA 5HI0A 1DZRA 2F4PA 5FLJA 1X8MA 3G7DA 4K8FA 2B9UA 4DINB 3EQEA 3FZ3A 2E9QA 4YARA 3IBMA 4A2UA 3GBFA 5JSOA 1TQ5A 4Q0PA 1PM7A 2H0VA 2XGXA 2OZJA 3NKTA 2FMYA 1OFNA 1CX4A 4QGNA 2ET1A 3MYXA 3MPBA 1RL3A 4MX3A 4R8HA 4J1XA 2OZ6A 4I2OA 4R52A 3FE5A 3LZZA 3DN7A 4IEOA 4EROA 2VPVA 2PFWA 4XF1A 3D0SA 2GC0A 3E5UA 2P17A 3FJSA 4KU7A 1J58A 1ZVFA 1NZCA 3SHRA 1J1LA 2PAMA 1GQGA 2CAUA 3S0MA 1IPKA 2PA7A 1Y3TA 3ROUA 3WW4A 2XKPA 5KHJA 3PNAA 2GU9A 3BALA 2QDRA 3NJZA 3SXWA 1CAVA 3H8UA 2MHFA 3B02A 3ETQA 2N7GA 3LOIA 1Q5OA 4RD7A 4MGYE 5BV6A 2FQPA 4Q0UA 4D7SA 1X82A 5FLHA 4B29A 5FPXA 2PTMA 2O1QA 5F1RA 3FWEA 3SCHA 4IEYA 2IXLA 3HQXA 3M70A 3GYDA 3RYKA 1OD5A 1Q43A 4EWAA 1CAVB 3IIAA 3OTFA 4Q0QA 4KL1A 3H1YA 4HLTA 2XL9A 4XFAA 1ZREA 4AVCA 2MNGA 5I91A 1NYWA 4MGIE 5J48A 2UY9A 1QWRA 2K0GA 4E2QA 4ZU5A 4BH9A 4JTNA 4LLOA 1ZZ8A 4Q0VA 1XE7A 2IC1A 1UCXA 3SCFA 1WA4A 3FX3A 3E5XA 1ZZ9A 4QX5A 2QVSB 2Z2SB 2XLFA 4IEPA 2BNMA 4FBFA 4Z07A 4XFHA 1RGSA 2GAUA 1IPJA 1CAXA 4J1WA 1DGRA 4LA3A 1Q3EA 1O3RA 2HKXA 1OMIA 2EAAA 2I45A 4O9GA 1UD1A 1O3TA 3O14A 1EYBA 4IETA 4EV0A 3DKWA 4QMAA 1O3QA 3OGJA 4IEUA 4I0BA 2Y0OA 3TNQA 1CAXB 2QNKA 3CJXA 3LAGA 3EJKA 4LEJA 4UBGA 4XETA 3HT2A 4L2NA 3C3VA 5LEJA 3FHIB 1OI6A 3DL3A 3LWCA 2O8QA 3ZDSA 3BU7A 3L2HA 2VQAA 1O5LA 3H3ZA 2KXLA 4HN0A 4LUKA 4KWJA 1RUOA 4PJYA 3NSTA 1VJ2A 2B5HA 4I3PA 3D82A 3KGLA 4UXAA 3U0ZA 1RTVA 4META 3D0JA 1RC6A 4ORFA 4EWEA 3KSCA 4BYYA 4QM9A 4UBHA 4QGLA 4JVAA 5KHIA 4EWDA 4F7ZA 2H6BA 2H6CA 4E2GA 4N9HA 4XFFA 5I0SA 3H7JA 1O7FA 2BGCA 5BPXA 4QM8A 1QXJA 3FFQA 3EO6A 1GQHA 4KU8A 2PAEA 5JCTA 3EBRA 1ZZ6A 1ZRCA 2DCTA 4I09A 3H9AA 1LB2A 4IEWA 1UIJA 4AXOA 3PLQA 1EY2A 3LA2A 2Q30A 1LKNA 1WLTA 3UKVA 4X6QB 2XL7A 4LUMA 5AVPA 1ZZ7A 5EFUA 1QY4A 5I0TA 1FT9A 3BCWA 3U10A 4MH0E 4BHPA 4ZU7A 5KHGA 3CEWA 2BNOA 1X8EA 1JUHA 2UY8A 4IEQA 4I02A 5LRRA 4JV4A 3CO2A 4HSJA 4ZU4A 3MDPA 4MUVA 5JSRA 4PIZA 3LA3A 1VR3A 3E6CC 4L11A 1PMIA 1HW5A 2CAVA 5E1RA 1NE6A 1X7NA 4XFGA 3I59A 3ELNA 2BEOA 4KWLA 2XLGA 5BY5A 3CF6E 2D5HA 3OD0A 4XFIA 2PAKA 3JZVA 2BYVE 4MV2A 3H1WA 1YUDA 5KHHA 2OPKA 1V70A 3ACLA 4AQ2A 1QXRA 1XRUA 2MPFA 5LRSA 1FI2A 1YFYA 2ZKLA 4O9EA 4MZUA 5I0UA 3I59B 3EHKA
chains in the Genus database with same CATH superfamily
3VZOA 1FMD2 2O14A 4PQ9A 2HH9A 2RS11 5FYTA 1NOVA 5T52A 2A5ZA 4Y3OA 5DAVA 1R082 5A3UA 1AR61 4CDUB 3ZSKA 1UW8A 1HRV3 1C5IA 1F4AA 4EYUA 3U11A 3LEMA 3A23A 4Y22B 4DB5A 1HDKA 1OLMA 1J3PA 3ITQA 4OQ9A 1W0OA 3HVDA 2XOMA 4NIHA 4A6OA 4AEDA 5ABJC 4CDXB 1F9KA 2Y6LA 3C7EA 4AQ6A 2GC2A 3HIFA 3O5SA 5CU1A 4HPKB 5K9YA 1NQJA 2AC1A 4TTGA 2VBBA 3GXUA 5FZ4A 2WN2A 2D6PA 1O6UA 1PX3A 4LO7A 5IVEA 1LCLA 4PT6A 3WNMA 4CUCA 2HWD1 4YRDA 1OD3A 1W6MB 3H8XA 1ZZBA 2AENA 4NN0A 1S1AA 2QZ2A 4YVWC 5HXVA 5LEKA 1J3QA 3AMMA 3WDUA 3IMMA 3ACHA 1RUG3 5FLIA 3WDVA 1ZRDA 3UKNA 4BWOA 1BZWA 4N43A 4Q4V1 1R1A1 3AJZA 2Q8EA 4D6QA 2IFWA 3C7GA 5C4WA 4INDA 1CAWB 1AX1A 1W8HA 4AVAA 2JE8A 5JXJA 1OQDA 1EPZA 3IB3A 2YG0A 3OGSA 1DIWA 3U75A 4B8EA 4CVUA 5FYMA 3R4UA 2EALA 2XUEA 3VZLA 1ZX5A 1DZTA 3O1TA 3AM2A 1QJU3 4WVZA 2ZMLA 3V0BA 5KXBA 2VMFA 1GLHA 1BCXA 5T54A 3T1LA 2HWB1 3HAGA 5DABA 4DXSA 2BBVA 1DQ6A 1PVC1 4RR3C 4WM8A 4URAA 5FPLA 1MQTC 1Y9MA 4OFGA 3BB6A 2FHRA 4BMEA 4CDQA 4XJ9A 3U4SA 4ASKA 3WINE 3W5NA 1AYN1 1FOD3 1N1VA 2FZ1A 3JQXA 5EV7A 2ZHLA 5EZWA 4A42A 1KXGA 4O65A 1K12A 4LTAA 4RQPB 2VG9A 3NV1A 1F35A 1CX1A 2UYBA 1AUYA 1GMMA 2WFF1 1AX0A 4NPLA 3ZN6B 4UWDA 4F8AA 1H9PA 2WNUC 3VBSA 4NAOA 1WCSA 4E2SA 4NRQA 1U0AA 1DQ1A 2ZMNA 5DZFA 2ZAAA 4OMDA 5AC92 4IGOA 1UYYA 1V6LA 3NJVA 2ET7A 3PVBB 2Y6KA 4HK9A 4HONA 4FT8A 3WQ7A 4E4SA 5BNOA 2ADEA 3NW4A 4UFHA 1KD7A 4CDXC 3D4KA 4GMP3 4D8MA 1CAUB 1ZBE1 2CL2A 2WA4A 4QPIB 2VULA 4NPMA 2W1QA 5E89A 1XE8A 1LHNA 2IFRA 4FQZA 4Q4X3 4GB31 2B42B 2PHDA 1AR92 1UZWA 3MV01 5HBAA 4XBQA 5LCWL 4BK4A 3NWKA 5F3CA 3WXPA 3I2DA 3LFIA 4B7KA 3WR0A 4YGCA 5FZDA 4ZXKA 5CFCB 1ASJ3 1XNTA 2XPJA 5JMOA 4QPGA 2P3JA 2WZR2 3AKSA 4BIFA 3I7DA 3KZ4C 1Z7S3 4UFLA 5A70A 4N7UA 1DFQA 1PX4A 4S2GA 2XJUA 4ONUA 5A7SA 1AL21 2YGMA 4NAMA 5FY1A 2JJ6A 3PUQA 1APNA 2G9FA 3VZJA 3ZIWA 2C9AA 3HBKA 3FLRA 1QNYA 3M3EA 1JZ6A 2WO7A 3FLTA 1DQ2A 2LTNA 5C3SA 2RM23 1H4HA 4RSUA 1H0BA 5C8CA 1GUIA 4MGSA 2RJLA 1DP0A 1RUE1 1JHNA 2NMOA 5FYUA 3ZMNA 5C6CA 4CCNA 4RGGA 3TN92 4COWA 1SFYA 2GN7A 4UT5A 3V64A 3AVSA 4AHYA 1L3JA 3IDCB 4P5YA 3VBFB 3VDDC 3E97A 1REEA 1ULCA 3C2UA 1IS5A 1UN1A 2BOJA 1B35A 4FFFA 2YPDA 4WZCA 4XACA 4Q8KA 3RMXA 5GZCA 4CPBD 3H42B 3D5OA 5C9AA 3H0OA 3KM5A 2VOKA 2R071 4XEZA 2DUPA 5FIXA 4QPWA 2ZBJA 2WLPA 1YJLA 5FQ0A 2R043 2W5FA 4XCBA 5F5CA 3LFMA 1OOPA 1ENQA 3B3QE 5T3NA 1I1EA 5JOZA 3G6JB 1RUF1 3GALA 3MW3A 2YGLA 4XXPA 2WL1A 2B8MA 5BXXA 1LNSA 1I6XA 4K1YA 2JX9A 1NZIA 4CCDA 2VQUA 2TUNA 3NAPA 3DV8A 1COV2 2WRAA 1ACCA 1UOGA 3JCIA 3WF2A 1HV1A 1ZZCA 5BNNB 2ZXQA 4IE0A 5JZGA 1MEC1 1SCRA 5FBJA 3NRUA 1UKGA 1BYHA 5F7UA 1NA1B 4C1XA 4UFIA 1GNYA 2DUQA 4IV3A 2IXCA 2VUDA 4OCTA 4XC9A 2D5FA 3SH4A 3FLPA 4NIIA 1M4WA 1S0IA 4CRQA 4ZY9A 1FXZA 1Y9QA 4PHZA 1YWKA 2D93A 3NVCA 5JXIA 2VE1A 5CZKA 3OB8A 2AACA 2VOVA 3WW1A 2LALA 5IK4A 3LKJA 4BQ2A 4NVPA 2B46X 1GWLA 1OUXA 2XBO2 2EVXA 1SBEA 2ZEZA 4LBMA 5LASA 3ZSEA 3AP5A 5FLJA 4CU8A 4K8FA 2B9UA 4YW3A 3GGLA 4UI9L 5GLVA 3WEZA 4DINB 4CXWA 1MVEA 4Q4Y1 4JKMA 5FUIA 2E9QA 4DY3A 3BVCA 2UWCA 1VB4A 3VKMA 1TQ5A 5JR2A 1FATA 1JUIA 2H0VA 5FYCA 1WCUA 2OZJA 3NKTA 4D69A 1OFNA 1CX4A 1SBFA 5BNPA 2ET1A 2ARAA 2QZ3A 2ZGPA 3IZOA 3MO4A 3MYXA 4JDMA 3K4DA 2JDHA 4B1LA 4DUVA 3MPBA 4MX3A 3AKQA 3VBFC 4MO3M 1KS4A 5F3IA 3RQ0A 3UV9A 4HG6B 1YYNA 3FE5A 3MIBA 3VL8A 2VZVA 1IPSA 5L7OA 1W99A 4KGQA 4IEOA 4EROA 3O1OA 1RUH1 4C0HA 5KC5A 3T2QA 3B01A 5IVJA 2GC0A 2ZEWA 4Y1XA 1GICA 2BBAA 4OUEA 1PO12 1J58A 1WUVA 5FV3A 3WZ1A 3J7HA 4ZZ8A 1EV12 1GQGA 3KHBA 1IPKA 2AH2A 5FZKA 4OZXA 3ROUA 1MPXA 5LK5A 1EAH1 1PNGA 1DGRN 3EMRA 5KHJA 1SACA 3VKFC 2VZ1A 2GU9A 3HQRA 4BXSV 3HWJA 1PK6B 3PMSA 1VBB3 1S4CA 4LPLA 3OY8B 3JXSA 3ZPYA 3TEYA 1NCQA 3KHCA 2E53A 1OLRA 2R062 3H8UA 4UW4A 1RXFA 4XURA 3Q8CA 5GJ6A 3B7MA 3ETQA 4RD7A 1V6KA 2JWPA 4QHOA 4CEYC 3GNEA 3Q9OA 4Q0UA 3L9JT 5HV4A 1X82A 2PTMA 3AL5A 1RHI1 3J8F1 4AW7A 2VH9A 1HQNA 3VBRB 5A32A 2P6CA 2IXLA 3I2JA 5FPAA 2Z42A 4WVMA 4XBNA 1CIWA 3M70A 1WKYA 3GYDA 5KXDA 4XQDA 2WZR3 1QKQA 4HT1T 4EWAA 5CKNA 1CAVB 5EYYA 2V5DA 2WAAA 2IZWA 2WYFA 4HLTA 4K3UA 1QHDA 2FMDA 2XL9A 4GIQA 4JCKA 4PCRA 3NNGA 4FPEA 4XFAA 2Q1MA 3O7OA 3RWKX 4AEMA 4AQTA 4BQ1A 4AVCA 1QOSA 4K8RB 5IVFA 5I91A 1FX5A 1W8ZA 3OBTA 5J48A 5LY2A 4E2QA 4UW5A 1OPOA 1WMFA 2DU1A 4WVWA 1JOBA 2C4XA 1UYPA 4JTNA 4LLOA 2ENRA 2HLEA 5FAXA 4EZ4A 5FPUA 5FZGA 3EXUA 5DXDA 3E5XA 3TN93 3V0AB 1HV0A 4BQ5A 2FDKA 3WHTA 2XLFA 4CDUA 2BNMA 1NLQA 2HWE1 2D6OX 5FXWA 4FBFA 5LZ6A 2FDGA 1OQ1A 2J1VA 5D21A 1W3XA 5A1AA 2WQ8A 4OI0A 2VBPA 1Z0HA 1PZ7A 4AQSA 1AYM2 2VZTA 1PO21 2ZEYA 3POEA 2ZX2A 2E33A 1JMUB 2HKXA 1W0NA 3HMYA 2A7AA 2GP5A 4YW5A 3RZLA 1WD4A 1OUSA 3KCXA 4RGAA 2DYCA 5A3TA 5GZEA 1VB2A 4KQ7A 4AGRA 4NO4A 4IEUA 2W68A 2D6MA 4CDWA 3DPRA 1XPWA 2EIEA 1RMU3 1X36A 3IAQA 1WMDA 1AR81 3MIHA 3LAGA 4XTMA 1D4M3 4UBGA 5F3GA 4XETA 4EN7B 2YC4A 5FMBA 2JDNA 4JC1A 5A6XA 3C3VA 1JH5A 3ILRA 3FC0A 1COV3 1V6NA 1UZYA 2RR13 3DL3A 4UW3A 5FK7A 3ZYFA 2VQAA 1NLSA 1O5LA 4XOGA 3PHMA 3H3ZA 3N36A 4HN0A 4K21A 5BYNA 4KWJA 2J22A 1RUOA 3ZR6A 5HCFA 4BQYA 3VBRC 2EF6A 2HWC3 4I3PA 3POSA 1IG0A 4AEKA 3J7NA 2YROA 3RZJA 1AR72 3JB4C 1G9DA 2PXJA 3U0ZA 1RTVA 2ZGMA 2Y60A 4AGVA 4YM3A 2CTVA 3APBA 3IT8A 1UZZA 1JU3A 3N7MA 4QGLA 2GNTA 5KHIA 1C8M3 4URTA 2RMU1 5BNQA 3ZFFB 4CP1A 1NX9A 5DUUA 1FPN2 2NPIA 5HPOA 2AEZA 4E2GA 4XBLA 3H7JA 1O7FA 4QKBA 1IS4A 1QXJA 5LB6A 5LK7B 4UF0B 5LA9A 5FZMA 1CD3G 3KV6A 4WVVA 5A3MA 3DECA 3UESA 2P3YA 1CQ9A 2QQPA 2PAEA 5L9VA 3CJIA 3LDKA 4QDSA 3ZN6A 2LUWA 5ACA2 2FD8A 4AI0A 1YO8A 2P37A 4XTPA 1UOBA 1G7YA 2JDUA 2WNOA 2WWUA 1TVGA 2Y33A 3KVAA 5A7NA 3OD4A 4P9YA 2W39A 4I09A 5CFDB 2VW1A 3H9AA 1YJKA 2HBUA 4Y5SA 1RUD1 4AXOA 4O61A 1M06G 4KGGA 3KD4A 1WWYA 4OQ8A 5A33B 3U14A 3T30A 5JDBA 1PO13 2YC2A 1PNFA 1WLTA 4RS5A 4KBBA 2GMMA 4YW2A 3RJ2X 3UKVA 5FZOB 3RZHA 3R0RA 2AREA 3VBOB 2XMLA 5EFUA 4W8JA 1BBT2 1GZTA 2CGOA 3AMPA 4JRLA 5ANNA 4PDWB 3WV6A 3ZXLA 1GOHA 2CGNA 4YZ1A 3F2ZA 2AEYA 3U10A 2A70A 3PIGA 4MH0E 5H9QA 5IJRA 1YNAA 2J7MA 3VDAA 3WNKA 3PJYA 1N3PA 1JZ3A 2R063 2DBIA 3K4AA 4YVSB 3USUA 2BNOA 3GCXA 3HN1A 2UY8A 3UNPA 5DDJ3 2LRPA 3POGA 3POBA 4ZS2A 2EXKA 4JV4A 1POV1 3VD4A 4UYBA 4FFGA 1G86A 4AEDC 2RS53 3POYA 4MUVA 4FVVA 1VR3A 4DMIA 4QX3A 2RS32 5FFOC 5E1RA 3ZSJA 1W03A 3W59A 5KXEA 1X7NA 1G9FA 2GSYA 3OGVA 3DEMA 4CCKA 2XLGA 2D6LX 3WHUA 3ZFFC 4CEWB 2JG8A 2KA3A 2PAKA 5FY4A 4IUGA 3JZVA 5T5OA 2BYVE 3J4UH 5KHHA 1CJPA 2OPKA 1V70A 3MICA 1ND2B 1SLTA 5FPVA 1A78A 4N43C 1QXRA 3WG1A 4AQ2A 2MPFA 1BVVA 3BN6A 1HRV2 4O9EA 4XMAA 5C3QA 2UU8A 5C4WC 1UMHA 5FKCA 2MEV1 4RL7A 3NV3A 2EXIA 5K0UA 3KGZA 1HN1A 2HEYF 2VVDA 2JDZA 4JGYB 4LBQA 3WD5A 4M00A 1RUI3 2QFEA 2BFUS 1R093 3VDCA 2RDRA 2YC0A 3M3IA 1ZBE2 2WUHA 1MVQA 1JOJA 4AI9A 3B94A 1GP5A 3V56A 1C1FA 2PQSA 4RFRB 4WM8C 2JENA 4MGZE 1T6BX 3S5QA 1FAYA 1BJQA 1RUG2 2Q4SA 5A80A 3I3MA 1NY71 4CDQC 4FCAA 5CKQA 3VBOC 1WCKA 1HIXA 2OYZA 1VBA1 5JSPA 1TMF3 5EHDA 1LECA 2D40A 4PDWC 1AXYA 5F5AA 2G19A 1E5HA 2XH6A 1ZBA3 3NL1A 4HOOA 3I54A 5TSWA 1AJOA 5DN2A 1CZTA 2VXRA 3CL1A 3IDBB 1UAIA 3D8CA 4S2DA 5FUNA 4YVSC 3ZKYA 4IV1B 4GZ9A 1T6GC 1PHMA 1QJU2 2ORXA 2BV4A 3IAPA 3VBSC 3T2TA 2DCJA 4QHZA 3M2MA 1CR7A 1MACA 2ZGOA 1TME1 3TEZA 5CG9A 3FN9A 4AVSA 3ZXEA 3UT0A 3FBMA 4MVTA 5BNOC 3ACIA 2PQQA 5FXXA 5L73A 1VE0A 3VV1A 1YFUA 4XFCA 3I2FA 2VQ0A 5DAXA 4Q4W1 3TBDA 3T4HB 2VJXA 3KLSA 1YQ2A 3ASIA 2VZUA 4MADA 4NWWA 1DLLA 1MZFA 3RSJA 5F2WA 3UYJA 3MPPG 5FXZA 1UY4A 4C91A 5FDBA 1QJX2 1FOD2 2XJPA 4GWJA 1FYUA 2QQNA 4JQRA 2YB7A 4M3CB 4I30A 3VHOA 1H4GA 4LKSA 5I8YA 3WW2A 3NO8A 2ZCWA 2PYTA 2WO1A 2Y34A 5KBFA 2RS13 1LGCA 1VBD2 3WUDA 2HWF1 5FYSA 4W50A 1HJGA 1RUJ2 1XYNA 4Q2FA 5CNAA 1AR63 4LHKA 1JYVA 4TLFA 3LEIA 1O3SA 4JZRA 4QXCA 5ABJB 3W58A 2AZ5A 1OLQA 1W9TA 3B69A 3E6BA 5CISA 1MS5A 1N1TA 5C8CC 1NE4A 1OBNA 3MW4A 2CY6A 2W92A 4QD2A 1UOJA 3NMBA 2A3XA 1PK6A 5FYBA 1ODMA 1YFWA 5FRAA 3OY8A 3BI3A 4LBOA 1QQP1 1PIV1 1TEIA 1CGPA 3ENRA 4YVWB 3MFAA 2IUWA 5LWBA 3MZHA 2XVGA 4NE9A 1SCSA 2CGPA 5IVVA 1PGW1 2WLQA 5FKBA 2WBKA 3CIHA 5ANQA 1BBT3 1Z7S2 2VM9A 4AL9A 4CP9B 1KJLA 2VR4A 3LDBA 1UXZA 3VBUB 3VD9A 2JDYA 1R1A3 4Q4V3 2ARXA 4U36A 1QDCA 5LA2A 5H9RA 4GKYA 1HB3A 5C33A 2Y38A 3TEWA 1ENSA 5FP4A 2WA3A 3IPVB 2ORZA 3H3UA 4E27A 2OUHA 4HSLA 1XNDA 5FR3A 1NQDA 3WNLA 3R05A 3UJQA 4LHLA 4D6SA 4E9KA 3SH3A 1O4TA 4ATFA 1BLZA 2K9ZA 3JBG1 3ZXDA 4RR3B 1C1LA 2DFCA 3MUZ1 4FPCA 2HWB3 3NAPC 5GZFA 4DZGA 1MQTB 3H8OA 1PVC3 1UPIA 4GWNA 3M8LA 3VZKA 2GZWA 3Q8EA 4YG0A 2G4IA 3OF1A 4QQHA 1LTEA 3NKGA 1JN2P 4CCJA 1CESA 3JB8A 4IV3C 3O1SA 4HFSA 4HXCA 5FZAA 5GLTA 4Y1UA 4AVBA 4DRVA 1HX6A 3H3LA 1H1AA 1AYN3 2DCYA 3A22A 2F4LA 4BLJA 2R042 4XE9A 5JIAA 1K5MB 1SEFA 2YZ4A 4Q8LA 1W2AX 4XAAA 1W2OA 1D2SA 1DQ4A 2WNUB 3GM8A 2C24A 1YQ6A 2WFF3 4OMCA 4CCLA 2WNVB 2XWJB 5I8TA 5FP9A 4FPLA 4HN1A 5JOWA 4XIOA 3EYPA 2E7TA 2K46A 5L19A 3I2OA 2WAOA 3KVBA 1ND3C 1BEV1 2V09A 3ACFA 1ZYBA 4E8CA 4IESA 1VBC1 1IS6A 5JWPA 2VD7A 3T4VA 5FPZA 3WDYA 1ZBE3 1PGL2 5I0RA 4Y20B 5A7WA 1OHFA 1ALYA 3FUQA 2A3YA 1GWMA 3AKRA 1IKQA 3ETPA 4GB33 4ISRA 5BNPC 1WW6A 4EQVA 4AVTA 1V9U2 4XQWA 1SPPA 2JG9B 1UU5A 1H2MA 3W5MA 1O4YA 3WDWA 3SNMA 5G05L 4NMIA 3RDIA 2VGDA 1A8MA 3PMEA 3WF1A 2QCSB 3VBUC 2ETEA 2IXHA 3ZSLA 3ZFGB 4XQ4A 2Q0AA 1W28A 3OSDA 1ZNPA 2D6KA 1AL23 3DYOA 4FAHA 4OUMA 1G6NA 4YWAA 1NCRA 2Z69A 2W91A 3SEEA 1YHFA 4KBZA 1QJY1 5SV8A 1AL0G 3THTA 4LKEA 1RIRA 4I01A 1DYOA 2F4PA 2GN3A 1X8MA 1YQ5A 1V00A 3AZYA 4XW3A 3UGGA 3AP9A 3EQEA 2BW8A 4C0BA 1RUE3 2ARCA 2I2SA 3FZ3A 4N7IA 4Y26A 1NCQC 3VDDB 1WBLA 1CONA 3ATGA 5FWEA 3RJRA 3CQOA 5JSOA 4Y24A 4N53A 1AXKA 2XGXA 4Q0PA 3ZIXA 5LA0A 4AI1A 2QQVA 5IK5A 1VPHA 2FMYA 2YDEA 1QJX3 4QGNA 3BKZA 1ULOA 3I2HA 1H2NA 1W9FA 1VBE1 4FP3A 4MYEA 2BVBA 2R073 1RXGA 2Z79A 3MF9A 2VNRA 4XABA 4IE6A 4TN7A 1ODNA 1K5MC 2X09A 4I2OA 4R52A 4DY5A 1REDA 1VBD3 4YGBA 1CWPA 4L92A 3MLJA 1RUJ3 1E5RA 2WNVC 3QH6A 3E5UA 2P17A 4BM8A 1RUF3 2EICA 2KR2A 3I4IA 3SITA 4ITCA 4Z2AA 2GP3A 1UF2C 1VBB2 1DU3D 2Y6GA 3HPNA 4I3GA 4YFZA 2VZSA 3AX4A 3C8XA 5IAXA 1GOGA 2PA7A 2QQLA 2R0FA 3O1UA 1ULGA 1GNZA 2GNDA 5EQUA 2Q8OA 3WW4A 2XKPA 3J7LA 3P5BA 4NROA 4A4AA 4Y33A 1MS9A 1MEC3 4Y1VA 4A7YA 2W2IA 2D44A 5SV5A 1C5HA 3PTYA 1OXCA 2RJ2A 3AL6A 1EUUA 3NJZA 3SXWA 3WG2A 1CVNA 5T5PA 2EXHA 2MHFA 2PLV1 3I3DA 5JI9A 5KWRA 2JG9C 2C6SA 2N7GA 1L7QA 1Q5OA 5BV6A 5FY0A 3HJRA 1A3KA 3ZN4A 4AYUA 2FDIA 2BZDA 1GBGA 4QAWA 4BK5A 3C7FA 3OYWB 1UOFA 2OX0A 3ZFGC 4RN5A 3SCHA 5JMCA 1RVF1 4IEYA 4F83A 1UX6A 2ZS6B 1G9BA 1RUC1 5D8AB 3MV11 4BA6A 4GA9A 1Q43A 2RMU2 1UY1A 2EIBA 3O0XA 4AOCA 4COYA 1IG3A 2GNBA 3DPRC 3WP4A 2P3KA 3JQWA 4J6GA 4Q0QA 3I2IA 3KV4A 4YGEA 4V2VA 1GZWB 4Y5TA 1ZREA 1KGYA 2Y0IA 1ND2A 3ZOIA 4GD4A 4JGZA 1NYWA 3LIHA 2VMGA 4MGIE 1S0BA 5FMOS 2G9GA 2K0GA 4HETA 2CSGA 4AF9A 4YZ5A 2Q5TA 5LY1A 2WO2A 4XJ8A 2WS91 3FMGA 4OHYA 2D43A 1WA4A 3MIEA 2VVFA 3ZYHA 2B39A 4LE3A 4RHV2 2D97A 2XVKA 5LBFA 3ZYBA 1GOFA 2SBAA 1HRI1 1CZSA 1SDDB 2JIGA 2V73A 1CAXA 1UKRA 3AFGA 1SMVA 4J1WA 4EN6B 1FV3A 1LULA 3QBQA 4YM2A 5C5UA 4XZUG 2VAUA 1RMU2 4OHZA 4YM0A 3VHNA 1O8PA 2Y6JA 3LPFA 4JHZA 3UGHA 1D4M2 1O3TA 1JZ5A 1GQPA 1EYBA 1PVXA 1H9WA 4EV0A 2ARBA 2BVVA 4QMAA 4M3CE 3ZFEB 1JYWA 5F3EA 1JYXA 3RFRA 3N9OA 1W2NA 4I0BA 2RR12 2ZJCA 4CCOA 1JU4A 2G1MA 1QMJA 3PUIA 4CEYB 3AZVA 5AFEA 5GZGA 3T08A 3GJBA 4DOUA 1YI7A 1F4HA 3AMQA 2VNOA 5DUWA 5LEJA 3FHIB 2P5BA 4LBKA 3NJXA 2DWRA 3CJIC 1OI6A 4MXWB 5GKAC 2HWC2 5DUXA 1ZM1A 3TEXA 1RHI3 3J8F3 1V9U3 4W6XA 3ACGA 4AI2A 4MSVA 4E4DX 4EE2A 4P08A 1OA4A 4GH4B 4B1MA 4GMP1 1XU1A 2D98A 1F5FA 2NN8A 5FYVA 4BDVB 4ZKTB 1KDKA 4XZPA 1K5JA 4QT6A 1LOCA 1OSGA 1RJ8A 1C8M2 1W6QB 3AYAA 3LCPA 2B5HA 5FWJA 1TG7A 3KGLA 5D8AC 1YEWA 4RS5C 5GALA 3F95A 3M7AA 4P9WA 1RYYA 4PF1A 4UXAA 1O91A 1WW7A 1ASJ1 1RC6A 5A6YA 1UQXA 2A73B 4BYYA 4QM9A 2ZAHA 4JVAA 4BLIA 3WDTA 3WUCA 5APAA 4CCMA 2FDJA 3N7LA 3S30A 4XHXA 5KC6A 1ENXA 3FL7A 4UFJA 2MEV2 1QOTA 4N9HA 4HKLA 4JHTA 1AJKA 3VD5A 4OI1A 1KRIA 1NG0A 2HWE3 4QM8A 4LIUA 5FXVA 2RM21 2E32A 4G3YC 1VALA 5FZHA 4L9BA 1SLIA 3D3AA 1DGLA 4RYDA 3O0WA 3Q8BA 5CAZA 1DCSA 1HQLA 2OVUA 2VCMA 2VUCA 5LBBA 2FCUA 2LS6A 4OZOA 5JCTA 5JLVA 3VUOA 3O1MA 2V72A 5GLZA 4QX8A 1ZA4A 2VXJA 4L97A 3OPWA 2HYKA 5FYHA 4AWDA 3WF3A 1UMIA 2JB4A 4P9XA 1Q8SA 4QHBA 1LB2A 2NLRA 4XDQA 4A7KA 1C28A 4CUGA 3P3PA 2PHUA 4Y1ZA 2VZRA 3KV9A 3QLQA 4KG8A 1D0GA 1OC1A 3P6BA 2BU9A 1PMJX 1AR83 1QF3A 1EY2A 1XXNA 3LA2A 2JG8C 4PBOA 4L0PA 4XAEA 4M4RA 5H9PA 3VZMA 5EJ1B 3ZFEC 3T0DA 3R4SA 2Z5WA 1FMD1 3RZMA 2ZACA 1RITA 1W6NA 5DDJ2 3AFKA 5ISLA 1R081 2WZEA 1KEXA 1BQPA 2W46A 1W2UA 4JDOA 4FPYA 4BHPA 1W8WA 4ZU7A 2NZ9A 1FV2A 2ZHNA 5K0UC 3N35A 2RS52 3GBWA 4Q1RA 4Q5OA 4JRAA 4WM7A 1JUHA 2XJTA 1D0HA 4N8MA 4Q26A 4GH4C 3POJA 2VTFA 3KQRA 1W6OA 4RR3A 3SQOA 3VBHB 4HSJA 2C9KA 4LBQD 4A3XA 3MDPA 4EJRA 2BERA 2Y8KA 3S57A 3VKNA 4CP0A 3WDXA 5JSRA 3LA3A 3K46A 1QEXA 3T3YA 1WW5A 4XHBA 2RMU3 1W90A 3PVEA 1NE6A 2A75A 4ASMB 1VRH2 2W47A 3CZJA 4FPOB 1V0AA 1HXS2 2CNAA 2ZX1A 1J84A 1H8TC 4AVVA 5BY5A 5JIUA 3CF6E 5FP7A 2FCTA 4AI3A 3OD0A 2EIGA 1NAEA 2RV9A 3KQ4B 3MLLA 4FOWA 3H1WA 1YUDA 3LE0A 2X10A 3P1IA 4MV2A 4BQWA 1X9TA 2P2KA 1XSRA 1RUI2 4NR1A 4Y22A 4DO0A 2FDHA 3VN4A 1R1ZA 5B4XA 4NRMA 1R092 4IW3A 2RVAA 1P8JA 2WJSA 4BB3A 4CDXA 3WF4A 4BISA 3VD7A 3I59B 4QXBA 1KFXL 4LO5B 4X6RB 3H1MA 4RHV3 4FPJA 4IXLA 4HPKA 3ZVXA 1CN1A 1RUD3 1JBCA 1BXHA 2ZMKA 4GAZA 4Q29A 4YW4A 5FZ1A 2GC3A 2OS2A 3AP7A 1LODA 1YCIA 2BFUL 3ABZA 2ZZJA 4KI5M 5E88A 3POIA 1W04A 4W6WA 2VVEA 2J1TA 1W6MA 3WOGA 5F2SA 4B4PA 5FYIA 1TMF2 2ZGKA 1W6PB 3AC0A 4N9IA 1ZBA2 2BNNA 5EPAA 3OGRA 1UMZA 4PIXA 1G9AA 2ID4A 3PURA 2ZPXA 1LGNA 4AE2A 4XF9A 1O8SA 3GCWA 5CADA 3WQ0A 1CAWA 1F2NA 3USSA 1UYXA 1XC6A 4ISQA 2J1EA 1O4ZA 4NHYA 5JAXA 3OEAA 3S5AA 2X5IC 2VZ3A 4XPVA 1K3IA 5CBLA 3LGRA 5CIRA 2P4EA 2PELA 5G04L 4AEDB 4JKLA 4WBBA 5AC91 3KB5A 1POV3 1NUKA 5BUVA 4FTEA 3N9NA 3P3NA 5FMCA 3I2KA 1VAVA 3MF6A 4AEJA 2A6WA 3ALQA 1MZ5A 5A1FA 1W3VA 4IE7A 2A6YA 2JE7A 1ZRRA 2Q1ZB 3VBHC 3FBYA 4R4ZA 3OBAA 2JKBA 1XE0A 2JDAA 4R4XA 1S0CA 2ZZQA 1SQ4A 3VDDA 1AR91 2HBTA 5HXMA 4FSJA 2WFPA 1TZOA 3WCSA 4AI8A 4AFDA 5K7PA 2DFBA 3LF7A 1JXNA 1S0FA 2YPJA 3VHRA 4CCEA 1PM4A 1SFPA 2RDQA 1RJ7A 4MG2A 1GANA 3PUAA 4N43B 4TSVA 2PHFA 2WZR1 2RS12 3SLIA 4Y1YA 3VDBA 2PHXA 5HCAA 1B09A 1OPMA 2WQZC 3KF5A 5C4WB 2WC2A 4RQPA 3RPQA 4XXAA 3QD6A 4YW7A 4HVQA 1AR62 2IVIB 3PVOA 5J7MA 1Q56A 3QCWA 5GLWA 1MS4A 1UIKA 2YFZA 3U1XA 2MEV3 4UFKA 1G8WA 1ULFA 2BJSA 1ENRA 2C5DA 1YFXA 3V0BB 3LOBA 1JZ2A 1JW6A 1W8NA 2HJIA 4BXFA 3ZYPA 1UX7A 4R9BA 5F32A 3ZMOA 1H1IA 1ZRIA 2DVAA 5EYXA 3DF0A 5DAWA 1CAUA 4QPIA 1W9WA 4H7LA 2P1BA 5D1IA 2XHKA 4WM8B 3E5QA 3I8TA 3TN91 1VAMA 2ZHMA 3PU8A 5DG1A 4Q1PA 2HWD2 3ES1A 4LXLA 5EP9A 1W05A 2OPWA 4CDQB 4XJZA 2ZTNA 4HKOA 1W0PA 4LBJA 2J1UA 3ZXAC 2OIIA 4HZFA 4IEXA 3N7KA 2DVFA 2E51A 4BQXA 5CFCA 2LROA 1IKPA 5A7QA 1JZ4A 5A3WA 4Q4V2 1R1A2 5FZLA 3IDAA 1VBA3 4CA9A 5A1LA 4I0AA 4CZSA 3POFA 1OVSA 4OYUA 1SLAA 2HEVF 1UPSA 2H0BA 2ZKNA 4FXKB 1QU0A 4A7ZA 4FI9A 3BU0A 3RYRA 4MLOA 5FZ9A 2WWJA 3VHPA 4EN9B 5KHKA 5EXOA 3K48A 1XOYA 1K45A 1YLLA 2X8KA 1C3HA 1SDWA 1J3RA 3SKJE 3VBSB 5A7PA 3PIJA 4XF4A 4MHRA 2VTXJ 4IQPA 5BNOB 1YIPA 5FY5A 4BPZA 2BQPA 1TME3 2DF7A 3LPGA 2HWB2 4FFHA 1FNYA 2GH2A 1PVC2 2GH8A 3SCGA 2CV6A 1COV1 4B3NA 1U5IA 2BTVC 4UW6A 3IIIA 1XNCA 2KD7A 4Q4W3 5L36A 3ECQA 3VBFA 2YV8A 4QGMA 3X29B 4XF0A 3VKOA 3U37A 4B4QA 1WCDJ 5FBZA 1AYN2 5I93A 3WY6A 1XNBA 2VZPA 3RZZA 3JD71 3H50A 1S2BA 3GJAA 4QPGB 1XYPA 1VRH3 1IQAA 1S0EA 1HXS3 3C7OA 1JODA 1X9PA 2WFF2 2XBO1 2XKOA 1HJFA 3IN9A 2HWF3 5AVAA 4QKNA 2YYOA 5FMDA 4YPJA 5C8WA 4KMQA 1J59A 3CBNA 4E4HA 1YQ8A 3K3NA 1VMHA 1IHMA 3LIGA 1CIYA 1NCRC 1DBNA 1S0JA 1GP4A 5C8CB 2XG3A 2W1UA 4HMZA 2IVJA 2QBXA 3TOJA 2QJVA 1AF9A 4R9CA 2I74A 4LK6A 5LA1A 5BNNA 2VUJA 4OLLA 4PIYA 4GB32 5DQ0A 5A7OA 2IXIA 3RVHA 3T1MA 3ILFA 2GC1A 4IGPA 1FNZA 3VL9A 4D6RA 4MGKE 1NA1A 1E5SA 1PIV3 2IXKA 3UKTA 4D7TA 1VAKA 5GZDA 1B35B 4O7XA 4N53C 3TNPB 2WZ8A 4JTOA 5C9AB 1IS3A 3KT1A 1V6OA 4P9LA 5KXCA 2JB8A 4JX0A 3IWZA 4LBNA 4XDPA 4LOTA 4HVOA 2JKXA 1HB4A 5FQ0B 1AL22 1XQNA 5CA6A 4HKWA 2CWSA 2ZA9A 5CEHA 1YQCA 4K9SA 3BTZA 1OOPB 1HB2A 2CHHA 3HEIA 5A3PA 5J3UA 3MFCA 1H6YA 2XHNA 4GJZA 1BK1A 1EV11 4DEVA 4OI2A 5JXGA 3RG0A 5C3PA 1H1MA 3B00A 3HNYM 1D2QA 1URXA 2VL4A 4HVRA 1NLRA 2BGOA 2D3RA 1ULPA 5JUVA 1RUE2 3NAPB 3H7YA 3KV5A 1A34A 1KDMA 4LMFA 1H2KA 3KS7A 5JZGB 1OA3A 1GP6A 3S7IA 5J36A 4LIVA 2ZEXA 5FZFA 5DUVA 5HCHA 1LHWA 4E4ZA 2YU1A 3W20A 1D7PM 3FHAA 3G7DA 2QUOA 4IV3B 3N9QA 4EN0A 4YARA 2QQUA 4XDOA 3ME2A 4OHXA 3A0NA 4RGKA 2R072 2XDVA 2GALA 5K4LA 3VGIA 1WCQA 4QPGC 4V2WA 3SKVA 4L8QA 3W21A 1N1YA 3HOBA 3T0AA 4YM1A 3TWIA 2QKDA 3GHMA 5EJZB 4ARXA 1OH3A 4YG6A 4QKDA 4R8HA 3B93A 1RUF2 3VKLA 4J1XA 2Z4FA 3O12A 4NJ4A 1ND3B 4NPRA 4QX0A 4QQ2A 1W39A 1IGOA 5FYYA 1U5XA 2Q8CA 4DPNA 1BEV3 2VPVA 2XJVA 4XF1A 3WT3A 4K6BA 3D0SA 3WNPA 1VBC3 2PHTA 1MEC2 4OVEA 1ZVFA 4NUBA 2A3WA 1NZCA 3IKWA 4JKKA 3SHRA 5BNPB 1LOFA 4JGZC 4NHMA 3WG4A 3AB0A 4BJ0A 2A6XA 2HWD3 3OEBA 1UL9A 2VMHA 1B35C 1YIFA 3VBRA 4FPGA 3ZKUA 5DZEA 5L7OB 5FOJB 4XUPA 5C9AC 1S2KA 2IWGB 1AYM1 3PNAA 3T0BA 1KQRA 2ZHKA 1JS9A 3BALA 1VMFA 5LBEA 1CAVA 2JICA 2DTYA 3C7HA 1KS5A 3KT7A 4PLOA 1S55A 3B02A 2YBKA 2ZX0A 4PLMA 4QU1A 3ZDVA 4MGYE 4OHVA 3GZUC 1OOPC 4D7SA 5FLHA 4Q4Y2 3UK9A 3WQ1A 3VZNA 2W94A 2EAKA 1XU2A 1JYCA 1REFA 4Z1VA 2JECA 2VTXA 3MIDA 4ZHNA 1Q8QA 1QJY3 4XJUA 4FPKA 4QX2A 1H30A 2QQWA 1NCQB 3IIAA 3OBRA 1DGWX 1GU3A 4X8PA 1POQA 4KL1A 3V0AA 1LENA 5JZGC 2NP0A 1WMXA 3M3CA 2TBVA 5J98B 1HB1A 3OBZA 2DCZA 3S6PA 2D3PA 5CYYA 4CXYA 3I49A 2Y6FA 4AAXA 5A32B 4MOAA 4QB6A 2UY9A 1QWRA 3B9CA 2R6QA 1RUH2 4ZU5A 4WVMB 4BH9A 4AHXA 1ZZ8A 4Q0VA 1X33A 3HNBM 3BPSA 3SEPA 1AR71 2IC1A 1UCXA 4P9JA 1SLBA 5A6QA 4YFWA 4QX5A 3I3BA 2QVSB 4M0NA 4COZA 2Z2SB 4XCAA 1NXD1 4IEPA 1A8DA 4Y4YA 2X29A 5IAVA 4XFHA 3GBGA 2K2SA 4FPHA 4NRPA 5JVVA 4YZ2A 1EAH2 5LBCA 1IPJA 4K40A 1V6JA 1DGRA 4LA3A 1O3RA 1QGLA 1FPN1 3IMNA 4GWIA 4DS0A 1OMIA 1W06A 4FO9A 4LBLA 1Y9GA 2A1XA 4O9GA 1UD1A 3BGAA 1Y43B 3N3HA 5FO9B 3R4DB 1DZQA 2W3JA 1O3QA 5J1XA 5JPMB 1C57A 1RHI2 1MS0A 3J8F2 5FJKA 2Y0OA 3NV4A 4N90A 5DAPA 4H2AA 5ACA1 3TNQA 2DCKA 2QNKA 4G4FA 1UU4A 5I0DA 3EJKA 3B9IA 2PLV3 1MS1A 1EPWA 3HT2A 3FFZA 4IDZA 5F5QA 4A41A 4C8DA 5L7OC 2UWAA 5J37A 2WR9A 3RRDA 3OOXA 4XYXA 1J1TA 3OJBA 5IVBA 5ERLA 5JOXA 1SLLA 2V4AA 3THPA 2XR4A 3DXUA 1RVF3 4X8NA 2NQYA 2QQIA 3AK0A 1QNWA 3DPRB 4K20A 3WP5A 3K2OA 4CDWB 1NT0A 5B2GB 1RUC3 4LUKA 3RI8A 3ZFFA 5C3RA 3E1F1 3U78A 1JOPA 3HBZA 4PJYA 3NSTA 1BBT1 1N1SA 2LM3A 2UWBA 3WX5A 1BMV1 1VJ2A 2OW4A 3O1RA 1IOAA 1W2TA 3CKHA 1YC61 5C3OA 2VOTA 5GLUA 4LHSA 4UF0A 1LHUA 3BYWA 3D0JA 3NNFA 3T09A 2TEPA 2A6ZA 5FP3A 2HWE2 4QQOA 2R30A 3ZYIB 2ZGQA 2ZGUA 5HCBA 4EWDA 5IATA 4AFCA 1T2XA 1I9RA 1VRBA 2VMCA 3ORJA 4PF5A 4F7ZA 2WS93 3HR9A 1DDLA 3I97A 2H6BA 1PO22 1QJZA 1W8OA 2H6CA 1SBDA 4XVHA 4XFFA 5CFDA 5I0SA 1NKGA 4WM7C 2WO3A 5JOYA 2SLIA 5BPXA 2D3SA 1IZ3A 3FFQA 2RS31 4DIQA 4KG0A 2P34A 4M4PA 4NIDA 1HRI3 1KFUL 5A33A 1GQHA 2WT1A 2R49A 2JDKA 3URFA 3OG2A 5IT6A 1S0GA 3O1VA 3PUSA 4TZDA 1ZZ6A 3K77A 4UOJA 5FZOA 1AR82 3UL2A 4YG3A 1W9YA 3VBOA 3LD8A 4DQAA 1ZRCA 4LQRA 1UO9A 2VY0A 4P9IA 2R7EB 1N47A 5FZ3A 3M4FA 4PDWA 5JPNB 2DCTA 1HKDA 4IEWA 1GR3A 1UIJA 1WW4A 3K4ZA 1BHGA 4LO6B 3MUY1 3PUHA 4UFMA 4Z2WA 2VNGA 4DUWA 4FTSA 4L99A 3PLQA 4YVSA 1MZ6A 1HRV1 2QQKA 3AZZA 3CJIB 5FUPA 5FZEA 4A44A 3WVJA 4LITA 4CDUC 2VQTA 4HANA 4LUMA 2QQJA 5AVPA 2VZOA 3WLUA 4BMBA 4XJWA 1A6CA 1POV0 2DVDA 1QY4A 1XNKA 2E63A 5I0TA 5F6LB 4BQ4A 2JD4A 4JDNA 3NJYA 3OPZA 4A45A 1I5PA 4CU6A 2R1BA 2EIDA 3WNNA 1EUTA 1CJDA 1OH4A 1HN0A 4LO8A 5FY9A 3WCRA 5DG2A 1OA2A 4ARYA 5C7GA 2OQ6A 2WDBA 4RS5B 1JYIA 3N9PA 5IFTA 4I02A 2O0OA 4CDWC 2BUKA 2XONA 4GQ7A 4A6SA 3CO2A 4Q4Y3 3RMYA 1RUG1 2WWSA 1F31A 4DRRA 4CEWA 4GALA 3MHZA 2E7AA 4M3CF 5FO8B 3O1PA 1DQ0A 4D94A 2E7QA 1UZVA 4WV8A 3E6CC 2WKKA 3A0KA 2RDSA 3O0VA 1HW5A 2C1FA 5D2AA 4XFGA 3USUB 1XBFA 2YMZA 4C1WA 2F6BA 2RHPA 1I3HA 3ELNA 4JGYA 4KWLA 2W08A 1QJU1 4AHZA 2D5HA 1JYNA 2JDMA 3ZM8A 4XFIA 1STMA 3THCA 2GMEA 2GDFA 1DYKA 1SZBA 1ULDA 1QH6A 3AKTA 1RUD2 3POWA 1RUH3 2R1DA 3IM0A 2WIIB 3ILNA 5CKMA 3NQHA 3MIGA 1FI2A 1US3A 1YFYA 2Q1FA 2ZKLA 4MZUA 4GKXA 2ERFA 5I0UA 3WW3A 1GSLA 2YY1A 4AR2A 1PMHX 3J9SA 1U5YA 1I5ZA 2QDNA 4FOVA 1QJX1 1FOD1 2JG8B 4MGQA 1EAH3 5H9SA 5A6ZA 3BPZA 5FY8A 4DEQA 1X50A 3I2GA 4J25A 4LO4B 1G9CA 4PI2A 3E6DA 1KJRA 4YLZA 5IVCA 1HQWA 3ST7A 1FMD3 3WP6A 1W8FA 2BGPA 4RQPC 4SLIA 1VBD1 1DF0A 2F17A 3AP4A 5CVRA 3OCPA 4IV1A 5K0UB 1LESA 1E5IA 1R083 1RUJ1 1UNBA 4LBQB 1RINA 3DGTA 2YHJA 4IERA 5E8AA 4CP2A 1JHJA 1YRZA 2ZX4A 3MEPA 4LHNA 1O5UA 1DQ5A 2YU2A 3OUHA 2R0HA 1H2LA 2VO5A 4AK3A 2UYAA 2BOIA 1LOAA 3AVRA 4YW6A 5JXHA 5IW0A 2RDNA 1Q8VA 2XVLA 4Q4X1 4IEZA 4QPIC 5T5LA 4Q27A 3RGBA 3GZAA 4PBPA 2PMWB 3WNOA 2VMIA 2VW2A 4LR4A 3TYJA 5E16A 3ZXGA 1YI9A 1GV9A 4CUAA 2UURA 4QB2A 1LJ7A 4W4ZA 5DZGA 3N4MA 2V4VA 1AZDA 4BU2A 3AZXA 3JD72 2WSVA 4M3CA 1H8TB 1LU1A 1Z7S1 3LB9A 4RA0A 5CFCC 2W1SA 3EB7A 1WBFA 5FY7A 4YW1A 4OULA 1XB9A 1BKZA 1NXMA 1YXWA 4LA2A 3ZPOA 4GULA 2BWAA 1LOGA 3GHNA 2PHWA 1GZCA 3NNLA 3ZR5A 4SBVA 5ABJA 2V5YA 3JU9A 4ZXEA 2VECA 4QWNA 4AFBA 5C5TA 4XF3A 4XUQA 1TE1B 1Z78A 1ND3A 3HT1A 1PO23 4TWTA 1XYOA 4V1PA 4M01A 1OF3A 2BWCA 2BPA2 2WT2A 5AFBA 1GKBA 2VMDA 2XWBB 4IEVA 4XMIA 2PHLA 2X53S 3AMNA 4FXGB 3R6SA 3BIEA 1VP6A 3KT4A 3QACA 4Y5Z0 4HBNA 5FO7B 4YVWA 4LULA 2W95A 3KWVA 1NY72 3I3EA 3OPTA 3RNSA 5LATA 3TRSB 3QOPA 3VB9A 4AHWA 4Z92B 1VBA2 3CLPA 5C70A 1QXPA 2YXSA 5EIYB 2VC9A 2WINB 2DVGA 2NMNA 4CP9A 2CYFA 4CTEA 4IL7A 3VBUA 1W8TA 2P6HA 2R041 2WQ4A 3UJOA 4CU7A 2JEMA 2BP6A 2AGSA 1DG6A 1V6MA 4BZ4A 2X5IB 4R9DA 3ZYJB 1OKOA 2CDOA 2R16A 2O8OA 1LGBA 2DVBA 3DXTA 4QQPA 3DCQA 5EJ3A 1LU2A 3IPVA 4AFAA 1WD3A 2HEWF 3W9AA 3ZYGA 1DHKB 1H6XA 3ES4A 3Q8FA 4S2HA 1WGPA 1TME2 4RFT0 4TYSA 1SFNA 1XSQA 3WP3A 4QQLA 5FTTC 5AC93 2Y6HA 1QH7A 3DYMA 3KCYA 1CPNA 3UETA 2VUAA 4K7JA 3J26N 4QXHA 3T2OA 1DGWA 1LEMA 4Q4W2 2W0XA 1PGL1 1MQTA 2NM1A 2HYXA 3M3OA 5BNNC 2B7YA 3HN3A 3MBWA 2E6VA 4Z8BA 2VCCA 4LT5A 2ATFA 4P9GA 1AR93 4ZS3A 3LA7A 1NA1C 3A4UA 2BRTA 1LEDA 2AR6A 2ES3A 3DUIA 3KMHA 1V9U1 5FJHA 4K1ZA 1UY3A 4XFBA 4ES9A 4CSWA 2G9ZA 4EZHA 2J42A 5IYYA 3LSEA 1K5MA 1JTZX 2FZ2A 1W8UA 1EP0A 2HWF2 2DU0A 1J83A 1IQDC 2JIJA 2WNUA 4LKDA 2DTWA 2IXJA 4CYDA 2XLAA 4D3WA 3AYDA 3GDBA 3S7EA 4KH9A 2WNVA 1U12A 4Q0SA 3MW2A 5FZ7A 2E31A 1GNHA 2R32A 2VW0A 2XJRA 2W87A 3BODA 1OQEA 2QE3A 3KF3A 4H55A 4PQQA 5IVYA 2VNVA 5T55A 3RYPA 3AP6A 3WG3A 1QQP2 4Y20A 1PIV2 4FP2A 3MIFA 4YYOA 2RG4A 1MS3A 5K8SA 4MGTA 1JYTA 2OA2A 1PGW2 1RUNA 2JG9A 4CE8A 3D6EA 2I07B 3LSDA 4FAGA 1S2EA 1VIWB 2J1SA 4QXKA 5FOBB 2EA7A 5JR7B 4COVA 4Z82A 4YNIA 2C0ZA 4ZZ5A 1ZRFA 3ZFGA 1DYPA 3RZKA 1N3QA 4TLGA 3NNMA 2Y26A 4FFIA 4LORA 1AVBA 2BDRA 4XUTA 3I3QA 5FCCA 1UWWA 2RE9A 5I8SA 2QQMA 1MR5A 4OHWA 4A3ZA 3DKQA 2JDPA 1OURA 1OKQA 4Y4RA 5DAQA 4P02B 5J09A 5IUQA 1LRHA 2CWMA 1WLDA 3JBG2 1VBB1 1ONAA 3MGUA 4YSFA 4CPBA 1SHWB 1LR5A 1PK6C 4HL0A 3CMGA 4JAAA 1QJFA 2Y64A 2DBNA 3AXEA 5A7WB 2NYYA 3ZN5A 4LJHA 3MLKA 3RWNA 2ZGTA 1LOFC 2CU5A 1WLCA 5GM0A 3CDZB 5DPNA 5L9BA 3SMHA 1SPPB 1LAJA 4ZPIA 5L9RA 1XJAA 4NHXA 1HLCA 4PI0A 4KWKA 3KCCA 4UAPA 1DZRA 2B4KA 5HI0A 3JD73 1LOEA 5T50A 2WNEA 1PZ8A 4LE4A 5J96B 1C8NA 3IBMA 4A2UA 4FTBA 1PZ9A 3SC7X 3GBFA 2XBO3 4NHLA 1LHVA 1Q8PA 2PHRA 1PM7A 2KM2A 2XB6C 1NCRB 2OT7A 5T5JA 3AJYA 4ET7A 1F5JA 4DXTA 1BEV2 2J1AA 1D4VB 4KNCA 5HV0A 1RL3A 2DV9A 3K3OA 1VBC2 4I0WB 3RI9A 3RZGA 3ZLIA 3U07A 2OZ6A 2DURA 3AYEA 4NOTA 1GYKA 1OF4A 4LNVA 5FZ6A 3LZZA 3DN7A 2W1WA 4N53B 1OT5A 2AUYA 2ADDA 2WYSA 4H7MA 4OI4A 2PFWA 3LDRA 1K42A 4KU7A 1Y7BA 3FJSA 4OUSA 2OKXA 3BTYA 1J1LA 4YZ3A 2PAMA 5FZ8A 1WZXA 2CAUA 4RHV1 4NIAA 4ES8A 3S0MA 1VMJA 3OYWA 5JI7A 1Y3TA 3PL0A 3PVNA 4GXLA 2XJQA 4XILA 4KWUA 3AKPA 2W52A 4IE5A 5A3OA 3NV2A 1GWKA 2OXBA 1RMU1 2YFUA 4U2AA 5D8AA 5FZCA 2QDRA 3AYCA 3H8RA 1EV13 1QJY2 1D4M1 1MZEA 4XIKA 2FDFA 5KR7A 4P00B 1QDOA 2EXJA 3LOIA 1BMV2 2FQPA 1GZWA 3J7MA 3OUIA 1PGSA 4B29A 1JI6A 2B45X 4FQ4A 4H14A 5FPXA 2O1QA 4GWMA 1V6IA 2ZGLA 4COUA 2RR11 5F1RA 2VOWA 3FWEA 3A21A 4P14A 3HQXA 4XUOA 1ULEA 1SG3A 1OD5A 3K51A 3RYKA 1JZ7A 2ZGRA 4ZONA 1UXXX 1H8VA 2VBDA 3OTFA 2HWC1 4YGDA 3H1YA 1CPMA 1VBE2 4QB1A 3GZEA 3L2YA 3ZXKA 4FOYA 3CNAA 3CU7A 4ASLA 5FZ0A 4E8DA 3PDQA 2MNGA 1SLCA 3FHQA 4AGGA 2OUJA 4DXRA 2B9VA 3V65A 2VZQA 5FYZA 2VMEA 1C8M1 2OQ7A 2XJSA 3ZXJA 5IFPA 1XE7A 5F8PA 3SCFA 3FX3A 1AHSA 4HK8A 5FK8A 2L9LA 1ZZ9A 2J1RA 2XQXA 3ZFEA 3Q8AA 1L7LA 4PLNA 5M0TA 4DUXA 4Z07A 3VD3A 2YUEA 1RGSA 2X05A 1UY0A 2GAUA 2VU9A 4JGZB 4CEYA 4GJYA 5E6HA 2XUMA 1QQP3 3SH5A 2VCAA 1Q3EA 2XQRA 5IHRA 4TXWA 3INAA 4AFMA 1N3OA 2EAAA 2I45A 2JXAA 2WN3A 2D7FA 4DNYA 2PLV2 3O14A 3N7JA 4MXWA 1QOOA 3N9MA 1OFSA 2A6VA 4IETA 1Q8OA 1GFF2 4LKFA 4CCCA 3DKWA 1O59A 3FUOA 4BCUA 1QJEA 4GH4A 3BIWE 3OGJA 4GMP0 1AYM3 4AAPA 3B5LB 5CFDC 1MS8A 1PO11 1CAXB 1RVF2 3CJXA 4LEJA 4QDQA 1GZ9A 4MXVA 3ZX7A 1W6QA 4B7EA 1RUC2 1E57A 1WLWA 4L2NA 2QQOA 2ZABA 3BOWA 1F8VA 2A71A 2WSUA 3U4XA 4JQTA 1R64A 2E26A 1W9SA 3CHXA 3VLBB 4C90A 5F9TA 3LWCA 5FP8A 2O8QA 3ZDSA 1KITA 3BU7A 3L2HA 2WT0A 2P3IA 1BVP1 3AMHA 1S0DA 3N9LA 3JBG3 1H8TA 2KXLA 5F6KA 1UZ0A 3HQUA 4B4RA 2GNMA 2R061 3TAYA 2YBSA 4MHUA 5DDJ1 4NHKA 4F3JA 4NIGA 4LOSA 3D82A 1UY2A 1ZA7A 2WS92 1LOBA 4QX7A 4QPYA 5A3NA 3IDEA 2QTWB 2GMPA 4META 4DFSA 2RS51 4ORFA 4ATEA 4EWEA 2D6NA 3KSCA 1VLNA 4UBHA 4IE4A 2TNFA 3BOPA 3WNXA 4XUNA 3M1HA 5EWSA 1CZVA 1HRI2 4LK7A 4D0QA 1AR73 4CUBA 3ZYRA 1BK0A 2WZPP 3GF6A 1U5ZA 2W9XA 1TNFA 1RB8G 2BGCA 5B4NA 5IK8A 3EO6A 3QH7A 2Q8DA 4KU8A 4W6YA 5CG8A 4CEWC 1VRH1 1XNAA 5A3LA 3LQCA 5LW9A 3EBRA 1FPN3 4M0HA 1AX2A 4YZ4A 4IGQA 4WZFA 3ZSMA 1HXS1 3WQBA 3HNMA 3NNJA 2LW8A 3AXDA 1ND2C 5C71A 2X5IA 4D7YA 4BQ3A 4CXXA 2XXZA 4R9AA 3WSOA 1RUI1 3OUJA 4JGYC 4FPFA 3SISA 4BIOA 3PTRB 5ACA3 1R091 4XJAA 1QIQA 1UU6A 2Q30A 1LKNA 3HD8B 3T2PA 4X6QB 2XL7A 1ZZ7A 3BTAA 5FPBA 4Q4X2 2ZGNA 3VBHA 3CZUA 3RS6A 1Y4WA 2VOXA 1FT9A 2C26A 2ZOEB 3BCWA 3AZWA 4W65A 2ZGSA 1OVPA 4QU2A 2JE9A 3LEKA 2DUOA 2RJKA 1C4RA 1WMEA 1ASJ2 4LLFA 4BOWA 2FCVA 1TMF1 4DXZA 5KHGA 3CEWA 4BE3A 4CU9A 1X8EA 1ZBA1 1US2A 3OGGA 5DMYA 4IEQA 1TNRA 5LRRA 5F5IA 1JZ8A 1UYZA 4G9SB 3ON7A 1W6NB 3UGFA 4ZU4A 3BTXA 1L7RA 1DLCA 3MI8A 2YBPA 3GZTB 1AXZA 1LHOA 3A7QA 3LEGA 2AYHA 4PIZA 1OLME 4L11A 3M3QA 1PMIA 4IV1C 4QKFA 2CAVA 2RM22 5F39A 2WABA 5FMOL 4AZZA 4QX1A 4WM7B 5F37A 5FZBA 3I59A 4QDRA 1VBE3 4H3WA 2BEOA 4P5HA 4FOQA 2VCBA 4S2FA 1W6OB 5CB7A 3BUCA 2CDPA 2ZX3A 3WF0A 4EN8B 1WA6X 2RS33 3PU3A 2PN5A 3PJQA 5FREA 4AG4A 3DYPA 5FZIA 5IK7A 2JD9A 4NWVA 3ACLA 1XRUA 5LRSA 2DDUA 3TB0A 1W6PA 3JUUA 3K75B 5IWFA 2ILMA 3ZXFA 2FBEA 1F15A 3THDA 3ZO0B 1ST8A 3EHKA
chains in the Genus database with same CATH topology
3VZOA 1FMD2 4PQ9A 2RS11 1NOVA 5T52A 2A5ZA 1R082 1AR61 4CDUB 3ZSKA 1UW8A 1HRV3 1C5IA 3U11A 4Y22B 4DB5A 1HDKA 1J3PA 1W0OA 4AEDA 5ABJC 4CDXB 1F9KA 4AQ6A 2GC2A 3HIFA 3O5SA 5CU1A 4HPKB 5K9YA 1NQJA 2D6PA 4LO7A 1LCLA 2HWD1 4YRDA 1W6MB 1ZZBA 2AENA 4NN0A 1S1AA 2QZ2A 4YVWC 5HXVA 5LEKA 1J3QA 3AMMA 3WDUA 1RUG3 5FLIA 3WDVA 1ZRDA 3UKNA 4BWOA 1BZWA 4N43A 4Q4V1 1R1A1 3AJZA 2IFWA 5C4WA 4INDA 1CAWB 1AX1A 4AVAA 1OQDA 1EPZA 4B8EA 1DIWA 3R4UA 2EALA 3VZLA 1ZX5A 1DZTA 3AM2A 1QJU3 4WVZA 2ZMLA 3V0BA 5KXBA 1GLHA 1BCXA 5T54A 3T1LA 2HWB1 3HAGA 2BBVA 1DQ6A 1PVC1 4RR3C 4WM8A 1MQTC 4OFGA 3BB6A 2FHRA 4BMEA 4CDQA 4XJ9A 3WINE 1AYN1 1FOD3 1N1VA 2FZ1A 3JQXA 5EV7A 2ZHLA 5EZWA 1KXGA 4LTAA 4RQPB 2VG9A 3NV1A 2UYBA 1AUYA 2WFF1 1AX0A 3ZN6B 4F8AA 1H9PA 2WNUC 3VBSA 4E2SA 1WCSA 1U0AA 1DQ1A 2ZMNA 5DZFA 2ZAAA 5AC92 1V6LA 3WQ7A 3PVBB 2ET7A 4HK9A 4FT8A 4E4SA 5BNOA 3NW4A 4CDXC 1KD7A 3D4KA 4GMP3 2WA4A 1CAUB 1ZBE1 2CL2A 4QPIB 2VULA 5E89A 1XE8A 1LHNA 2IFRA 4FQZA 4Q4X3 4GB31 2B42B 2PHDA 1AR92 5HBAA 4XBQA 3NWKA 3WXPA 3I2DA 4B7KA 3WR0A 4YGCA 4ZXKA 5CFCB 1ASJ3 2XPJA 4QPGA 2P3JA 2WZR2 3AKSA 4BIFA 3I7DA 3KZ4C 1Z7S3 4N7UA 1DFQA 4S2GA 2XJUA 4ONUA 1AL21 2YGMA 2JJ6A 1APNA 2G9FA 3VZJA 3ZIWA 2C9AA 3FLRA 1QNYA 3M3EA 3FLTA 1DQ2A 2LTNA 2RM23 1H4HA 4RSUA 1H0BA 5C8CA 2RJLA 1RUE1 1JHNA 2NMOA 3ZMNA 5C6CA 4RGGA 3TN92 4COWA 1SFYA 2GN7A 3V64A 4AHYA 1L3JA 3IDCB 3VBFB 3VDDC 3E97A 1REEA 1ULCA 3C2UA 1IS5A 1UN1A 1B35A 4WZCA 4Q8KA 3RMXA 5GZCA 3D5OA 5C9AA 3H0OA 3KM5A 2VOKA 2R071 4XEZA 2DUPA 2ZBJA 2WLPA 1YJLA 5FQ0A 2R043 1OOPA 1ENQA 3B3QE 5T3NA 1I1EA 5JOZA 3G6JB 1RUF1 3GALA 3MW3A 2YGLA 4XXPA 2WL1A 2B8MA 5BXXA 1I6XA 4K1YA 2JX9A 3NAPA 2TUNA 3DV8A 1COV2 3JCIA 5BNNB 1HV1A 1ZZCA 5JZGA 1MEC1 1SCRA 1UKGA 1BYHA 1NA1B 4C1XA 2DUQA 4IV3A 2IXCA 2D5FA 3SH4A 3FLPA 4CRQA 1M4WA 1S0IA 1FXZA 1Y9QA 1YWKA 2D93A 3NVCA 2VOVA 3WW1A 2LALA 5IK4A 3LKJA 4NVPA 2B46X 2XBO2 2EVXA 1SBEA 4LBMA 3ZSEA 3AP5A 5FLJA 4K8FA 2B9UA 4YW3A 5GLVA 4DINB 1MVEA 4Q4Y1 2E9QA 4DY3A 2UWCA 1VB4A 3VKMA 1TQ5A 1FATA 1JUIA 2H0VA 2OZJA 3NKTA 4D69A 1OFNA 1CX4A 1SBFA 5BNPA 2ET1A 4JDMA 2QZ3A 2ZGPA 3MYXA 3MPBA 4MX3A 3AKQA 3VBFC 1KS4A 3RQ0A 3UV9A 1YYNA 3FE5A 3MIBA 3VL8A 5L7OA 4KGQA 4IEOA 4EROA 1RUH1 4C0HA 5KC5A 3B01A 2GC0A 4Y1XA 1GICA 1PO12 1J58A 1WUVA 3WZ1A 1EV12 1GQGA 1IPKA 2AH2A 4OZXA 3ROUA 5LK5A 1EAH1 1PNGA 1DGRN 5KHJA 1SACA 3VKFC 2GU9A 3HWJA 1PK6B 3PMSA 1VBB3 3OY8B 3ZPYA 1NCQA 2R062 1OLRA 2E53A 3H8UA 4UW4A 5GJ6A 3B7MA 3ETQA 4RD7A 1V6KA 4CEYC 3GNEA 3Q9OA 4Q0UA 3L9JT 1X82A 2PTMA 1RHI1 3J8F1 4AW7A 2VH9A 1HQNA 3VBRB 5A32A 2IXLA 2Z42A 4WVMA 4XBNA 1CIWA 3M70A 3GYDA 5KXDA 4XQDA 2WZR3 1QKQA 4HT1T 4EWAA 1CAVB 5EYYA 2IZWA 4HLTA 4K3UA 1QHDA 2FMDA 2XL9A 4GIQA 4JCKA 4PCRA 4FPEA 4XFAA 2Q1MA 3O7OA 4AEMA 4AQTA 4BQ1A 4AVCA 1QOSA 5I91A 1FX5A 3OBTA 5J48A 4E2QA 4UW5A 1OPOA 1WMFA 2DU1A 4WVWA 4JTNA 4LLOA 2ENRA 5FAXA 3EXUA 5DXDA 3E5XA 3TN93 3V0AB 1HV0A 3WHTA 2XLFA 4CDUA 2BNMA 2HWE1 2D6OX 4FBFA 1OQ1A 4OI0A 1Z0HA 1PZ7A 4AQSA 1AYM2 1PO21 2ZX2A 2HKXA 3HMYA 2A7AA 4YW5A 1WD4A 3KCXA 4RGAA 2DYCA 5GZEA 1VB2A 4KQ7A 4AGRA 4NO4A 4IEUA 2W68A 2D6MA 4CDWA 3DPRA 1RMU3 1X36A 1WMDA 1AR81 3MIHA 3LAGA 4XTMA 1D4M3 4UBGA 4XETA 4EN7B 4JC1A 3C3VA 1JH5A 3ILRA 3FC0A 1COV3 1V6NA 1UZYA 2RR13 3DL3A 4UW3A 2VQAA 1NLSA 1O5LA 4XOGA 3PHMA 3H3ZA 3N36A 4HN0A 4K21A 5BYNA 4KWJA 1RUOA 5HCFA 3VBRC 2EF6A 2HWC3 4I3PA 3POSA 4AEKA 2YROA 1AR72 3JB4C 1G9DA 3U0ZA 1RTVA 2ZGMA 4AGVA 4YM3A 2CTVA 3APBA 3IT8A 1UZZA 3N7MA 4QGLA 2GNTA 5KHIA 1C8M3 4URTA 2RMU1 5BNQA 3ZFFB 4CP1A 5DUUA 1FPN2 2NPIA 4E2GA 4XBLA 3H7JA 1O7FA 1IS4A 1QXJA 5LK7B 1CD3G 4WVVA 5A3MA 1CQ9A 2QQPA 2PAEA 3CJIA 3ZN6A 2LUWA 5ACA2 4AI0A 1YO8A 2P37A 4XTPA 1G7YA 3OD4A 4P9YA 2W39A 4I09A 5CFDB 2VW1A 3H9AA 1YJKA 1RUD1 4AXOA 1M06G 4KGGA 3KD4A 5A33B 5JDBA 1PO13 1PNFA 1WLTA 4RS5A 4KBBA 2GMMA 4YW2A 3RJ2X 3UKVA 3R0RA 2AREA 3VBOB 5EFUA 1BBT2 2CGOA 3AMPA 4JRLA 3ZXLA 4PDWB 3WV6A 2CGNA 4YZ1A 3U10A 2A70A 4MH0E 5H9QA 1YNAA 3PJYA 1N3PA 2R063 4YVSB 3USUA 2BNOA 3HN1A 2UY8A 5DDJ3 2EXKA 4JV4A 1POV1 1G86A 4AEDC 2RS53 3POYA 4MUVA 4FVVA 1VR3A 4DMIA 2RS32 5FFOC 5E1RA 3ZSJA 3W59A 1X7NA 1G9FA 2GSYA 2XLGA 2D6LX 3WHUA 3ZFFC 4CEWB 2JG8A 2KA3A 2PAKA 3JZVA 5T5OA 2BYVE 3J4UH 5KHHA 1CJPA 2OPKA 1V70A 3MICA 1ND2B 1SLTA 1A78A 4N43C 1QXRA 3WG1A 4AQ2A 2MPFA 1BVVA 1HRV2 4O9EA 4XMAA 5C4WC 2UU8A 2MEV1 4RL7A 3NV3A 2EXIA 5K0UA 3KGZA 2HEYF 4JGYB 2VVDA 2JDZA 4LBQA 3WD5A 4M00A 1RUI3 2QFEA 2BFUS 1R093 2YC0A 3M3IA 1ZBE2 1MVQA 1JOJA 3B94A 3V56A 1C1FA 4WM8C 2JENA 4MGZE 1FAYA 1BJQA 1RUG2 2Q4SA 1NY71 4CDQC 4FCAA 3VBOC 1WCKA 1HIXA 2OYZA 1VBA1 5JSPA 1TMF3 1LECA 2D40A 4PDWC 1AXYA 2XH6A 1ZBA3 3NL1A 5TSWA 3I54A 1AJOA 2VXRA 3CL1A 3IDBB 1UAIA 3D8CA 4S2DA 4YVSC 4IV1B 1T6GC 1PHMA 1QJU2 3VBSC 3T2TA 2DCJA 3M2MA 1CR7A 1MACA 2ZGOA 1TME1 5CG9A 4AVSA 3ZXEA 3FBMA 4MVTA 5BNOC 2PQQA 5L73A 3VV1A 1YFUA 4XFCA 2VQ0A 4Q4W1 3TBDA 3KLSA 3ASIA 3RSJA 4NWWA 1DLLA 1MZFA 3MPPG 4C91A 5FDBA 1QJX2 1FOD2 2XJPA 1FYUA 4JQRA 4M3CB 4I30A 3VHOA 1H4GA 5I8YA 3WW2A 3NO8A 2ZCWA 2PYTA 5KBFA 2RS13 1LGCA 1VBD2 3WUDA 2HWF1 1RUJ2 1XYNA 4Q2FA 5CNAA 1AR63 4LHKA 4TLFA 1O3SA 5ABJB 3W58A 2AZ5A 1OLQA 3B69A 3E6BA 1MS5A 1N1TA 5C8CC 1NE4A 3MW4A 2CY6A 4QD2A 2A3XA 1PK6A 1YFWA 5FRAA 3OY8A 4LBOA 1QQP1 1PIV1 1TEIA 1CGPA 3ENRA 4YVWB 3MFAA 3MZHA 2XVGA 1SCSA 2CGPA 1PGW1 2WLQA 1BBT3 1Z7S2 1KJLA 3VBUB 4Q4V3 1R1A3 2ARXA 4U36A 1QDCA 5H9RA 4GKYA 5C33A 2Y38A 1ENSA 2WA3A 3IPVB 4E27A 3H3UA 2OUHA 4HSLA 1XNDA 1NQDA 3R05A 3UJQA 4LHLA 4E9KA 3SH3A 1O4TA 4ATFA 2K9ZA 3JBG1 3ZXDA 4RR3B 1C1LA 2DFCA 4FPCA 2HWB3 3NAPC 5GZFA 4DZGA 1MQTB 1PVC3 1UPIA 4GWNA 3M8LA 3VZKA 2GZWA 4YG0A 2G4IA 3OF1A 4QQHA 1LTEA 3NKGA 1JN2P 1CESA 3JB8A 4IV3C 4HFSA 5GLTA 4AVBA 4Y1UA 4DRVA 1HX6A 1H1AA 1AYN3 2DCYA 4BLJA 2R042 4XE9A 5JIAA 1K5MB 1SEFA 2YZ4A 4Q8LA 1D2SA 1DQ4A 2WNUB 2WFF3 5I8TA 2WNVB 2XWJB 4FPLA 4HN1A 5JOWA 4XIOA 2E7TA 5L19A 1ND3C 1BEV1 2V09A 1ZYBA 4IESA 1VBC1 1IS6A 5JWPA 5FPZA 3WDYA 1ZBE3 1PGL2 5I0RA 4Y20B 1OHFA 1ALYA 3FUQA 2A3YA 4ISRA 3AKRA 1IKQA 4GB33 5BNPC 1WW6A 4AVTA 1V9U2 4XQWA 2JG9B 1UU5A 1H2MA 1O4YA 3WDWA 3SNMA 3RDIA 2VGDA 1A8MA 3PMEA 2QCSB 3VBUC 2ETEA 2IXHA 3ZSLA 3ZFGB 4XQ4A 2Q0AA 1ZNPA 2D6KA 1AL23 4FAHA 4OUMA 1G6NA 1NCRA 2Z69A 1YHFA 1QJY1 5SV8A 1AL0G 3THTA 1RIRA 4I01A 2F4PA 2GN3A 1X8MA 3AZYA 1V00A 4XW3A 3AP9A 3EQEA 2BW8A 4C0BA 1RUE3 2I2SA 3FZ3A 4N7IA 4Y26A 1NCQC 3VDDB 1WBLA 1CONA 3ATGA 3RJRA 5JSOA 4Y24A 4N53A 1AXKA 2XGXA 4Q0PA 3ZIXA 4AI1A 5IK5A 2FMYA 2YDEA 1QJX3 4QGNA 1H2NA 1VBE1 4FP3A 4MYEA 2BVBA 2R073 2Z79A 3MF9A 2VNRA 1K5MC 4I2OA 4R52A 4DY5A 1REDA 1VBD3 4YGBA 4L92A 3MLJA 1RUJ3 2WNVC 3QH6A 3E5UA 2P17A 4BM8A 1RUF3 3I4IA 3SITA 4ITCA 1UF2C 1VBB2 1DU3D 4I3GA 4YFZA 3AX4A 2PA7A 2R0FA 1ULGA 1GNZA 2GNDA 2Q8OA 3WW4A 2XKPA 1MS9A 1MEC3 4Y1VA 4A7YA 2D44A 5SV5A 1C5HA 3PTYA 3NJZA 3SXWA 3WG2A 1CVNA 5T5PA 2EXHA 2MHFA 2PLV1 5JI9A 5KWRA 2JG9C 2N7GA 1Q5OA 5BV6A 1A3KA 3ZN4A 4AYUA 1GBGA 3OYWB 3ZFGC 5JMCA 3SCHA 1RVF1 4IEYA 4F83A 1UX6A 2ZS6B 1G9BA 1RUC1 5D8AB 4BA6A 4GA9A 1Q43A 2RMU2 3O0XA 4COYA 2GNBA 3DPRC 3WP4A 2P3KA 3JQWA 4J6GA 4Q0QA 4YGEA 1GZWB 1ZREA 2Y0IA 1ND2A 4JGZA 1NYWA 2VMGA 4MGIE 1S0BA 5FMOS 2G9GA 2K0GA 4HETA 4AF9A 4YZ5A 2Q5TA 4XJ8A 2WS91 3FMGA 4OHYA 2D43A 1WA4A 3MIEA 2VVFA 2B39A 4LE3A 4RHV2 2D97A 2XVKA 2SBAA 1HRI1 2V73A 1CAXA 1UKRA 3AFGA 1SMVA 4J1WA 4EN6B 1FV3A 1LULA 3QBQA 4YM2A 1RMU2 4OHZA 4YM0A 3VHNA 1D4M2 1O3TA 1EYBA 1PVXA 1H9WA 4EV0A 2ARBA 2BVVA 4QMAA 4M3CE 3ZFEB 4I0BA 2RR12 2ZJCA 5AFEA 4CEYB 1QMJA 3AZVA 5GZGA 4DOUA 1YI7A 3AMQA 5DUWA 2VNOA 5LEJA 3FHIB 4LBKA 2DWRA 3CJIC 1OI6A 4MXWB 5GKAC 2HWC2 5DUXA 1ZM1A 1RHI3 3J8F3 1V9U3 4W6XA 4AI2A 4E4DX 4MSVA 1OA4A 4GH4B 4GMP1 1XU1A 2D98A 1F5FA 2NN8A 4ZKTB 1KDKA 4XZPA 4QT6A 1LOCA 1OSGA 1RJ8A 1C8M2 1W6QB 3AYAA 3LCPA 2B5HA 3KGLA 5D8AC 4RS5C 5GALA 3M7AA 4P9WA 4UXAA 1O91A 1WW7A 1ASJ1 1RC6A 2A73B 4BYYA 4QM9A 2ZAHA 4JVAA 4BLIA 3WDTA 3WUCA 3N7LA 3S30A 4XHXA 5KC6A 1ENXA 2MEV2 1QOTA 4N9HA 4HKLA 1AJKA 1KRIA 4OI1A 1NG0A 2HWE3 4QM8A 2RM21 4G3YC 1VALA 4L9BA 1SLIA 1DGLA 3O0WA 5CAZA 2OVUA 1HQLA 5JCTA 5JLVA 3VUOA 5GLZA 1ZA4A 4L97A 2HYKA 4AWDA 4P9XA 1Q8SA 4QHBA 1LB2A 2NLRA 4XDQA 4A7KA 1C28A 3P3PA 2PHUA 4Y1ZA 3QLQA 4KG8A 1D0GA 1QF3A 1AR83 1EY2A 1XXNA 3LA2A 2JG8C 4PBOA 3ZFEC 5H9PA 3VZMA 3R4SA 2Z5WA 1FMD1 2ZACA 1RITA 1W6NA 5DDJ2 3AFKA 1R081 1BQPA 1W2UA 4JDOA 4FPYA 4BHPA 4ZU7A 2NZ9A 1FV2A 2ZHNA 5K0UC 3N35A 2RS52 3GBWA 4Q1RA 4JRAA 4WM7A 1JUHA 2XJTA 1D0HA 4Q26A 4GH4C 3KQRA 1W6OA 4RR3A 3VBHB 4HSJA 4LBQD 4A3XA 3MDPA 4EJRA 3VKNA 4CP0A 3WDXA 5JSRA 3LA3A 1WW5A 4XHBA 2RMU3 3PVEA 1NE6A 2A75A 4ASMB 1VRH2 4FPOB 1HXS2 2CNAA 2ZX1A 1H8TC 4AVVA 5BY5A 5JIUA 3CF6E 4AI3A 3OD0A 2EIGA 3MLLA 4FOWA 3H1WA 1YUDA 4MV2A 2P2KA 1RUI2 4NR1A 4Y22A 3VN4A 1R1ZA 1R092 2WJSA 4CDXA 3I59B 1KFXL 4LO5B 4X6RB 3H1MA 4RHV3 4FPJA 4IXLA 4HPKA 3ZVXA 1CN1A 1RUD3 1JBCA 1BXHA 2ZMKA 4Q29A 4YW4A 2GC3A 3AP7A 1LODA 1YCIA 2BFUL 5E88A 2ZZJA 4W6WA 2VVEA 1W6MA 3WOGA 4B4PA 1TMF2 2ZGKA 1W6PB 4N9IA 1ZBA2 2BNNA 1UMZA 4PIXA 1G9AA 2ZPXA 1LGNA 4AE2A 4XF9A 5CADA 3WQ0A 1CAWA 1F2NA 3USSA 4ISQA 1O4ZA 5JAXA 2X5IC 4XPVA 5CBLA 3LGRA 5CIRA 2PELA 4AEDB 4WBBA 5AC91 3KB5A 1POV3 5BUVA 4FTEA 3P3NA 4AEJA 1VAVA 3MF6A 2A6WA 3ALQA 1MZ5A 2A6YA 2JE7A 1ZRRA 2Q1ZB 3VBHC 3FBYA 4R4ZA 2JKBA 4R4XA 1S0CA 2ZZQA 1SQ4A 3VDDA 1AR91 4FSJA 2WFPA 3WCSA 4AI8A 4AFDA 5K7PA 2DFBA 1JXNA 1S0FA 2YPJA 3VHRA 1RJ7A 1GANA 4N43B 4TSVA 2PHFA 2WZR1 2RS12 3SLIA 4Y1YA 2PHXA 5HCAA 1B09A 1OPMA 2WQZC 5C4WB 2WC2A 4RQPA 3RPQA 4XXAA 3QD6A 1AR62 4HVQA 3PVOA 5J7MA 1Q56A 3QCWA 5GLWA 1MS4A 1UIKA 2MEV3 1G8WA 1ULFA 1ENRA 2C5DA 1YFXA 3V0BB 3LOBA 1JW6A 2HJIA 3ZYPA 4R9BA 3ZMOA 1H1IA 2DVAA 5EYXA 3DF0A 1CAUA 4QPIA 4H7LA 5D1IA 2XHKA 4WM8B 3E5QA 3I8TA 3TN91 1VAMA 2ZHMA 5DG1A 4Q1PA 2HWD2 3ES1A 4CDQB 4XJZA 2ZTNA 4HKOA 1W0PA 4LBJA 3ZXAC 2OIIA 4HZFA 4IEXA 3N7KA 2DVFA 2E51A 5CFCA 1IKPA 4Q4V2 1R1A2 1VBA3 4I0AA 4CZSA 1SLAA 2HEVF 1UPSA 2H0BA 2ZKNA 4FXKB 1QU0A 4A7ZA 3RYRA 4MLOA 3VHPA 4EN9B 5KHKA 5EXOA 3K48A 1YLLA 3VBSB 2X8KA 1C3HA 1SDWA 1J3RA 4XF4A 4IQPA 5BNOB 1YIPA 4BPZA 2BQPA 1TME3 2DF7A 2HWB2 1FNYA 2GH2A 1PVC2 2GH8A 3SCGA 2CV6A 1COV1 4B3NA 1U5IA 2BTVC 4UW6A 1XNCA 4Q4W3 5L36A 3ECQA 3VBFA