3F95A

Crystal structure of extra c-terminal domain (x) of exo-1,3/1,4-beta-glucanase (exop) from pseudoalteromonas sp. bb1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
175
Chain Sequence
SDSHPLFVRSLAKNMTWQLADTSTQKVLASGASATSGDKQSLLMQSVNLSYQEDGRGFNWRAQAALSLSYLEPTPLDSKFSTGYLELKMRIDKAPEQGANLQVMCSESNCLRDIDFSSFSQLMADKSWHTLAIPLHCQPITDALRITSQNLSLAIADVALTIKPSDDSISLTCAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase
publication title Structure and activity of exo-1,3/1,4-beta-glucanase from marine bacterium Pseudoalteromonas sp. BB1 showing a novel C-terminal domain
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 39
structure length 175
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18559 Exop_C Galactose-binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3f95A00
4LJHA 1WCUA 2KR2A 3F95A 1W90A 3ORJA 4LK6A 4YW6A 3ZYBA 4BQ2A 1OH3A 1W8UA 4LKFA 1W9FA 1UOJA 4AL9A 4YWAA 2C24A 2JWPA 1GWMA 1HN0A 4BQ3A 2VXJA 2LRPA 1L7LA 2O14A 4BQ5A 4CP9B 4CP9A 1GWKA 4YW7A 1OKOA 1W8TA 1W8WA 2LROA 2WYFA 3UT0A 4CPBA 4LKEA 1W8ZA 2K46A 4LKDA 4A6SA 2Q1FA 1WZXA 3ZYFA 1GWLA 1V0AA 4CPBD 3ZYHA 1WMXA 4BQ4A 4LK7A 5D21A
chains in the Genus database with same CATH superfamily
2V5DA 5AVAA 1EUUA 2PHLA 4DIQA 3GGLA 1FATA 3ST7A 3RNSA 4AAXA 2A6WA 2VUAA 5FYZA 1Q8VA 3MIFA 1DBNA 1AF9A 1DLCA 1NCQC 3RJRA 4B7EA 5IVYA 2CAUA 3FL7A 4CP9B 2R1BA 1KD7A 4Q26A 4F83A 1NA1C 3WINE 3SXWA 5KBFA 2JG8A 1J84A 2HWC1 1HXS1 4MADA 5FXVA 3TNQA 4O61A 2NMOA 3AZXA 5LW9A 2R043 4QX0A 4Q4Y3 4UFKA 2HWB3 4WM7C 3J8F2 3JB4C 5FZEA 1XNDA 5LATA 3BTYA 1OC1A 4GB33 2Y33A 1AXKA 4XOGA 3LA7A 3ACLA 4IE0A 5JVVA 3NSTA 2NP0A 4UFLA 5T5PA 5BNNA 3OGGA 1LAJA 1UU5A 1WMEA 3DYPA 4GKYA 2EA7A 2K0GA 2RDQA 3IN9A 4M0HA 4PIYA 4XURA 1S4CA 4ORFA 4ATEA 1V70A 1RGSA 4LR4A 4QX1A 3ZFEB 5C3QA 3RFRA 4AFDA 1BHGA 2W1QA 3RYRA 4CDXB 4E27A 2JJ6A 4KG8A 3H8RA 1WKYA 3ZO0B 3L2HA 2EF6A 4XABA 3M1HA 3MLKA 4XPVA 5J1XA 3ON7A 5FXWA 1OF4A 3VBOB 4YZ3A 4Y5TA 2CDOA 4ZU4A 4C91A 1FPN3 3T2QA 3W9AA 5FY0A 3KCYA 1SQ4A 4EWDA 1O4ZA 2YHJA 3CU7A 2BV4A 4GMP0 1H6XA 3FJSA 3MF9A 2RG4A 4M0NA 3N9QA 2AEZA 1UZWA 2AENA 5DAVA 4YPJA 3UJOA 3V65A 4AWDA 1R1A1 1JU3A 5CB7A 1TE1B 2MEV1 2GN7A 3AJYA 1SPPA 1ZRRA 1UMZA 2C6SA 2D6OX 2ZKNA 1COV1 1NCRC 2VMFA 4MGQA 5KHIA 4UF0A 3U0ZA 4AYUA 1LGBA 1O8PA 1C28A 1FMD2 1MVEA 3LD8A 4M4RA 5EYXA 2PN5A 4E2SA 4C1XA 4EZ4A 1SCRA 1O4YA 4C0HA 3GJBA 1X36A 4P9JA 5ACA3 2FCVA 2A1XA 4JRLA 1QJY3 3QACA 5BNNC 1DGLA 2CTVA 4P9GA 5EFUA 4YFWA 2VCCA 4ASLA 4D7TA 5C71A 1E5RA 1GANA 3I54A 4MUVA 3S0MA 3C8XA 4Q4X1 1XJAA 2D93A 4UFMA 2FD8A 4HSLA 5FZOA 5D8AB 3URFA 4XHBA 4BJ0A 4BM8A 4XF0A 4DY5A 1AR63 5CEHA 4XFBA 4L0PA 1CZSA 3GXUA 3SQOA 5CADA 1DYOA 4N8MA 4O65A 2ZEWA 1HRV3 1W9YA 4GMP1 1FYUA 3KCCA 3M2MA 5FZKA 3HEIA 4MV2A 4Z82A 1BCXA 1GQPA 1W8ZA 2W1UA 2D6KA 1WW4A 1QNYA 3U1XA 4QB1A 4PDWC 1IPKA 3CJIB 1MPXA 4LHSA 4AI2A 2WZEA 4XAAA 3T4VA 3VUOA 1GOGA 5J37A 1ODNA 5FMOL 1OLME 4IEVA 4AEDA 2W3JA 2WBKA 4X6QB 2W1SA 4E2GA 1OH3A 5KHGA 1VBC3 5CKQA 5A7WB 3VZMA 2FDGA 4CCJA 1RUD3 4EN7B 5CZKA 5DDJ3 5BNQA 1I3HA 4PLMA 2JKXA 4I09A 5CA6A 4DINB 3PMEA 2ZGNA 5FZHA 4I01A 2VZ1A 4XE9A 2ZHLA 2JDKA 2G1MA 1VBD2 3LZZA 2GH2A 1ST8A 3T30A 2YV8A 1PO21 1I1EA 5C7GA 4S2DA 1QXPA 4MGZE 4Y1YA 5C8CC 4IDZA 1ASJ3 5LY2A 3E1F1 3NAPB 3MIEA 3PDQA 1Z7S3 5FZAA 1KGYA 5IATA 3POWA 4LJHA 4JKMA 4CXWA 4KGQA 2MPFA 5A80A 1LRHA 4BQ2A 3H7YA 1VB4A 2XL7A 2JDPA 1W9FA 4LE3A 4PCRA 1ODMA 1RMU1 4QPYA 5LBEA 3WR0A 1XNBA 2D44A 5CFDA 4FVVA 2TBVA 2VOKA 1VMFA 4IESA 1PO11 1QQP1 2PQQA 4QXCA 4IEUA 3WCSA 3WDVA 3ZDVA 2JD4A 1O3RA 4DXZA 5IK5A 2R063 2XHKA 2CGOA 1AZDA 4AI3A 2PLV3 4XUQA 3VHNA 1IS3A 2PAEA 1HRI1 4OQ9A 4BE3A 1AL22 3RYPA 1US2A 1TMF3 2NYYA 1IGOA 3VBHC 4CA9A 2WNVB 4QQ2A 4CDQA 1QU0A 1YCIA 2NN8A 4MGYE 2GP5A 4AQ2A 5I93A 5FQ0A 2KXLA 1VLNA 3ASIA 3MIHA 1ULFA 4M3CF 4Y22A 4DXSA 1XRUA 3FLRA 1UN1A 1EAH1 3KB5A 1KFUL 2A75A 2V72A 2BVVA 2D7FA 3KS7A 3KT1A 4Z1VA 1MR5A 4QXHA 4Y20A 2G4IA 4CUGA 1Q8PA 3N9OA 1QJU1 1BVP1 3JBG1 4HT1T 3JZVA 4BK4A 5LEKA 2L9LA 4JKLA 3ZFGC 3EB7A 4LUMA 4NHKA 3E6CC 3UKNA 2YY1A 4QM8A 2FDKA 3NWKA 4AQTA 2RS52 5GZCA 1NA1B 1VBB2 1B09A 2ES3A 4Y24A 4R4ZA 1XOYA 2YU2A 5IAXA 1MQTC 3R6SA 1AX1A 4MXWB 1JZ3A 4QKNA 5IW0A 1CWPA 2DBNA 3ZYBA 3U14A 3HBZA 1IS6A 4Y1UA 3OGRA 2NPIA 4M3CB 3AMNA 5FY7A 2C5DA 2PAKA 2YROA 5AC91 5L19A 1GU3A 4QQHA 3ZSKA 1XYNA 2LW8A 1W6NB 1OQDA 4GWMA 3V0BB 4YVSB 3I3DA 3RWNA 1ZBE1 2GDFA 2W95A 4SBVA 4CUAA 3EO6A 3WF1A 4WV8A 4DOUA 4K20A 4PF5A 1ZZCA 2QQIA 1JODA 1PNFA 1SBDA 2Z4FA 2V73A 3SC7X 4YM2A 2R1DA 3WZ1A 5JI9A 3OB8A 2XBO2 4HSJA 2Y26A 3EMRA 4HL0A 4R52A 5A32B 4CU9A 5B4NA 2IVIB 4A41A 4I0BA 4NHMA 2BFUS 2WUHA 4YW1A 2AEYA 3HMYA 1OXCA 3MIGA 4ISRA 4LBMA 3VBUB 1YFUA 4HK8A 3B9CA 4LA3A 4H7LA 1LEDA 5ABJC 3BOWA 1WCSA 3VKMA 2VD7A 5JIUA 2BEOA 1YJKA 1HKDA 4CUCA 1Q8SA 2CNAA 2ZABA 4HMZA 1EV12 3KLSA 3IAPA 2G9FA 1ULPA 2GMMA 3R4SA 3VBRB 2A3YA 5HV0A 4MHRA 4RHV2 2BOIA 3THDA 3RDIA 3N3HA 3J8F1 2VNVA 2RR13 1AR82 1Q5OA 2PAMA 4UFJA 4BLJA 4A45A 3T09A 5F5CA 5A6XA 1DP0A 4BPZA 3ZXFA 4Q27A 5DUVA 3K4ZA 4Y4YA 2O1QA 1ZM1A 4LIVA 4PT6A 1ENXA 4MSVA 4QB6A 1UY1A 1GNZA 4CDQC 5JZGC 1JS9A 1MS9A 2RS12 4ZY9A 3ZSLA 3W21A 4AF9A 5L7OC 4MGTA 1W8WA 1JH5A 3K77A 4WVMB 2VCAA 4H7MA 2VH9A 1KS5A 1AYN3 1LEMA 4CCDA 3K3NA 1U5IA 2W1WA 4RGGA 1UIJA 4QPIC 4O7XA 5C9AB 1GV9A 4QX3A 2H0VA 3H1MA 2CSGA 5FZ8A 4LXLA 4YG0A 2YYOA 3ZFFA 5FYVA 1DQ1A 4K7JA 3AZVA 1WCQA 4CDUA 2WNEA 1W2UA 1OUSA 4EN8B 5FUPA 2K2SA 1OLMA 4RS5C 4XUPA 1HV1A 3JQXA 1H1IA 2YPJA 3POJA 1Q43A 1ZA7A 2VUJA 5FY1A 2Z2SB 5FZGA 4HKLA 5JWPA 4PI2A 3MPBA 4CEYA 4QQOA 1E5SA 4NE9A 2QJVA 3KHBA 2SLIA 2ZEYA 3OGJA 1ENQA 4P9YA 2JG8B 1VMHA 2O8OA 1QJX2 4CEWA 3VL9A 4QGLA 1FMD1 2LM3A 2UWAA 1UWWA 1HXS3 2Y34A 1UY0A 4J6GA 2ZGUA 3NJXA 3H50A 4W65A 1YO8A 2QCSB 2ZZJA 4XBQA 4BQWA 4MZUA 4LO4B 1I5PA 4AEMA 2VMIA 2HWD3 4BA6A 1RJ8A 5FPLA 1CGPA 1UY4A 1STMA 3NKTA 5A7SA 2R6QA 1PX3A 2R7EB 1K3IA 1PZ7A 4QQPA 4QX8A 2PTMA 2CV6A 2I45A 1UAIA 5BNNB 1O6UA 1BK1A 4D0QA 3NRUA 4TLFA 4MLOA 1MZ5A 1V6OA 4D6QA 3X29B 3LCPA 3TAYA 4UAPA 3WDXA 4XMAA 4B4RA 5DAQA 3ENRA 3THPA 4LLOA 1S0IA 1HQLA 2CDPA 1RUF2 4AOCA 5CKNA 2QQWA 1JMUB 3MIDA 1CJDA 1HJFA 1RUE1 3GBGA 3UT0A 2UWCA 3ABZA 2RS33 1JZ4A 1QEXA 3DXTA 2XG3A 1VB2A 1XU2A 4PQQA 1W6PA 4CPBD 4XXPA 3O1PA 4FP2A 1DG6A 2PHDA 1YFYA 3U11A 5BNPA 3TNPB 3PMSA 3MLJA 2HJIA 3BGAA 4A44A 1ZYBA 5A3WA 3C7HA 1FNZA 1NAEA 2WR9A 4K21A 4KL1A 4XEZA 5FP7A 1O8SA 3UK9A 1UOJA 2GNTA 5FYSA 2YZ4A 1MEC1 1C3HA 4YVWA 1OURA 1Z0HA 1SPPB 1FAYA 1RUI3 2WZ8A 4XJAA 4Z2WA 2JEMA 4MO3M 2MEV3 1V6NA 3IZOA 2BNMA 3N9LA 3B3QE 4A6OA 3RZJA 4ZU7A 3ZPYA 4UF0B 3WNOA 1OVPA 3VDBA 2QQKA 3AYAA 4LKEA 1H0BA 2BFUL 5I8YA 2A6YA 2XGXA 1SBEA 5IFTA 1FV3A 3SH5A 3E6DA 3NNMA 3F95A 4R9CA 2YGLA 1IG3A 5FZOB 1LGCA 5E8AA 3VDDA 2GC1A 3ZYGA 3PUQA 5APAA 4AEKA 3DPRC 5JSOA 4NIHA 3DN7A 2WABA 5A1FA 2BBAA 1RHI3 1SFNA 1YQ8A 5ERLA 5EQUA 3VLBB 1G9CA 4CCMA 4QDQA 2LTNA 4DXRA 1H30A 4UBHA 3BKZA 2XLAA 2WINB 4NRMA 2VVEA 2P3KA 3DV8A 3H0OA 1AL21 2PHXA 4KWLA 4AI0A 1CVNA 1FOD2 2NM1A 2RV9A 1K42A 2B9VA 3C7FA 3ZPOA 5IWFA 1DGRN 2FDJA 3D6EA 4AEDB 5F37A 4FPYA 4FCAA 4QD2A 2HWE2 2PXJA 2ZHKA 4GALA 1JI6A 2P37A 4RQPA 1SMVA 1UMIA 4A7KA 2P17A 4ITCA 2J42A 1PGW1 4YARA 4IV3A 1K12A 4ZKTB 1V9U2 1S0GA 4NIAA 4AVTA 2XVGA 4NPMA 2W39A 1Q8QA 4JC1A 5FYMA 2Y0OA 5FMCA 1W99A 4MX3A 2ZEZA 1OSGA 1S0JA 2B5HA 5F2WA 1NT0A 2ZMLA 1LNSA 2WZR2 3I2KA 3AKTA 3LEIA 2WT2A 2WT0A 5M0TA 3CNAA 2ARCA 5FPVA 2WNUC 1KEXA 2H6BA 3DL3A 3I2GA 4COVA 3I2OA 2FHRA 5FPAA 3FLPA 3WT3A 1UYZA 1JYTA 3A0KA 4EN0A 5FYHA 1LENA 2VTFA 1RVF3 2R32A 2VZSA 3WY6A 1ULGA 4ATFA 5CFDB 3BU7A 4AGGA 5A3NA 1RMU3 4XETA 1EYBA 2X29A 5HCBA 2HWF3 3PLQA 4YZ2A 5KXCA 2TEPA 2WO2A 1U5XA 3PU3A 3OSDA 2XWBB 3AP9A 3BTXA 3RG0A 4FI9A 2DBIA 4YW5A 5GKAC 2Y6GA 5F3GA 4CDQB 1HRI3 3MICA 4FPKA 5FQ0B 2PQSA 4FFGA 2XB6C 3QLQA 2PHWA 4BXFA 3O5SA 3VB9A 3MHZA 4Y22B 2BGCA 3ZXDA 3BOPA 2XBO1 5SV8A 5HCAA 3AX4A 2QTWB 2OPKA 4LKFA 4U2AA 4Y20B 1AR91 1OVSA 3HWJA 1O5UA 1WLTA 1ZZBA 3P1IA 4XBLA 5J98B 2IXCA 4YZ5A 1SFPA 1W8HA 4Y4RA 1MS5A 3KQRA 2OUJA 1BEV2 1F31A 1MS4A 1F9KA 2DUOA 2E7TA 2XJPA 4GJYA 4IV1C 3SEEA 2EALA 1HLCA 2QQNA 4XIKA 4DUWA 1KRIA 1UPSA 1W8TA 1TME2 2AUYA 4J25A 4AE2A 3WD5A 3W59A 3I2IA 2FDIA 1EV11 3AXDA 5A7NA 4CDWC 4IE7A 2LALA 3LDKA 3LSEA 1YEWA 4OUMA 1OA3A 3JD72 3KHCA 3F2ZA 1VBE1 2ZKLA 4RHV1 1W05A 1CIWA 3O1UA 4BXSV 1LHOA 4ZS3A 3TOJA 4I30A 1RUC2 1AR81 1JU4A 1LU1A 1NOVA 3EJKA 5KHHA 1CN1A 4CCOA 2VBBA 3PUSA 4XVHA 3TYJA 2Q8EA 4HPKA 3N9PA 5AC93 4XJZA 4XZUG 2WNOA 5LBFA 4NIIA 3GBFA 2DU1A 3FHQA 3AKPA 3SH3A 1MS1A 2VQAA 2RS11 2J1UA 1S1AA 1ZBE3 1LU2A 1SLTA 1NCQA 2W5FA 3ZKYA 3JU9A 4NJ4A 4HVQA 3LEKA 5GZGA 2CGPA 2FDFA 1S2BA 2ZGPA 4IEXA 1YIPA 1CAWA 2IVJA 3S7IA 2P34A 3ITQA 1A8MA 4DQAA 2BPA2 3ACIA 4LBLA 4Q0SA 1U5YA 1FT9A 4BHPA 4WM7A 4HANA 3ELNA 2ZHNA 3AB0A 4NWWA 5FP8A 1WBLA 1VIWB 3KV4A 5D2AA 4BQ3A 3ZR5A 1VAVA 4TSVA 1QKQA 2CWMA 5E16A 3QD6A 4RR3C 2WWUA 2E32A 4AGVA 2YXSA 3AKSA 3ETQA 1LHUA 2CYFA 1BXHA 2UURA 4B29A 4DRVA 4INDA 2W9XA 1PVC2 3FC0A 2WA3A 4MVTA 5CU1A 1NE4A 3A4UA 1NLQA 1WZXA 2A70A 2B9UA 2XONA 1FI2A 5FLIA 3ZYFA 5FP3A 4Q4V2 5CKMA 1XYOA 2ZGQA 5GLVA 4E4SA 1W28A 3CDZB 4RGKA 5J09A 2DVDA 4Q0PA 3TEWA 1UKRA 1ULEA 1VRH2 2C0ZA 4K9SA 3KV5A 1LESA 4TLGA 1AX2A 2GC3A 2WAAA 1PIV2 1WA6X 3AK0A 4FTEA 3TN93 1WCDJ 5FZ4A 4IERA 4P5HA 4YGCA 1XU1A 5EP9A 1DGWX 4Q5OA 4LHLA 2BBVA 4LA2A 4L97A 1LOFC 3ECQA 1TG7A 3IDCB 2V4VA 4G3YC 1RUF1 1WLCA 3MPPG 4NROA 4CPBA 3H8OA 1NCRA 2ARXA 2GC2A 3K75B 3ZM8A 1MS0A 1YXWA 3FX3A 4XJWA 1UZVA 2VNRA 2YBPA 2A7AA 1XE0A 4PHZA 5C8WA 1GICA 4D3WA 5IT6A 2HEWF 4PLNA 4XFGA 4AFCA 2GMPA 1W90A 4LK6A 3ZFFB 5H9QA 5CBLA 2PYTA 4CDUB 5T54A 4Z92B 5BNOC 1UYYA 5FK8A 3QCWA 4Y3OA 2Y0IA 2QDRA 3B94A 3VBSC 3ZN4A 5FMDA 5JOYA 5A70A 3H1WA 4M01A 2X09A 3LB9A 4CEYB 1F2NA 4A2UA 4LHNA 4AI8A 1JN2P 2EXHA 2RM23 4B8EA 1OKOA 4CEWB 4LE4A 4EYUA 1YFXA 1H1MA 3ZIXA 1CPNA 4NIGA 1F4HA 1V00A 1W39A 5FZ9A 3O1MA 2F6BA 3RS6A 1RUOA 1GZTA 3GNEA 2H0BA 3GZEA 4LHKA 2MHFA 4GD4A 4NRQA 1UY2A 2KM2A 3LAGA 1H2MA 1QOTA 1C4RA 3BTAA 4XF9A 4PBPA 1W04A 2FMDA 4PDWA 1TVGA 3N4MA 3HVDA 4QX7A 3AKQA 4RL7A 1LB2A 1KDKA 4XXAA 1HDKA 4GWJA 1GWMA 2J7MA 3ILFA 2WO3A 1QH7A 1GP6A 3W5NA 1OH4A 4KU8A 5JDBA 2OQ7A 2WS92 3ROUA 3ACHA 3S30A 4UW6A 2DUPA 4D8MA 1RINA 3H3ZA 1M06G 2A3XA 2WYFA 4OYUA 1B35C 4XQDA 5A1LA 5K7PA 1W6QA 3D0JA 5IK8A 1AR73 3M3EA 1RUE3 3AZZA 5KHKA 4JGYC 2VGDA 3ZVXA 4UW3A 2VW2A 3ME2A 1W6PB 2QZ3A 2DVAA 5L9VA 2A5ZA 1Q3EA 1FOD1 2D3PA 4H2AA 3M3QA 3E5QA 4Q4W2 4DO0A 5BNPB 2OS2A 5C8CA 2XVLA 3E97A 3OPWA 5K4LA 4FBFA 1OLQA 4JAAA 4YYOA 1YQ2A 4MGKE 5CIRA 1PGSA 1VE0A 4YVWB 1AYM1 1ZBA1 1BJQA 1ZZ9A 2HWE1 3AMMA 4AI1A 2GNMA 5DN2A 5CFCC 1MEC3 2W94A 2ZJCA 4XW3A 5FZ0A 3T08A 1RUG3 1H2NA 1I9RA 1V9U1 2RMU1 1H2LA 2YUEA 3MGUA 5D1IA 3ZXEA 3FZ3A 5EWSA 3T0AA 3T0DA 4AXOA 4CU7A 4RD7A 2ET7A 2ZX4A 3SEPA 3ZKUA 1HJGA 3ZYIB 3MIBA 2XQXA 1JYXA 2WZR1 1OKQA 3WW1A 1RUH2 2JX9A 4I0AA 4NR1A 1VBA2 3VBHA 4NWVA 4OI4A 3WEZA 1JZ7A 2BJSA 4FAGA 2JE8A 1JOBA 5FZ7A 4IGOA 3ZXGA 3FWEA 5FY5A 2RVAA 1R093 2GMEA 1WWYA 3VDDB 4BQ1A 3BIWE 4HKWA 1AUYA 4EWEA 2PHFA 3LKJA 4BK5A 5A3PA 5J3UA 2VY0A 1NLSA 2KD7A 3FLTA 4N43C 3WXPA 1BBT3 2H6CA 3JUUA 5LK7B 4XBNA 3ETPA 1DZQA 3OYWA 3H8UA 1UL9A 1D7PM 3ZFGA 5JUVA 1RITA 4KG0A 3ZXLA 4URTA 4JDNA 3ZYHA 2K9ZA 2XXZA 3NJZA 3ZN5A 1LHNA 2UU8A 1G9DA 1AX0A 1S0DA 2XPJA 3WDTA 4ZZ8A 2VAUA 4YG6A 5ISLA 1RUJ1 2VBPA 2XJUA 4C8DA 1MQTA 1CAUA 3HPNA 4RQPB 4LULA 1R083 2PMWB 1J1TA 4X8PA 2E9QA 5E1RA 4ZU5A 1H9PA 4IV3B 4PQ9A 4CRQA 2C9AA 2IUWA 1CPMA 3BIEA 3B7MA 4JTNA 3ZSMA 1TME1 2DTYA 1WW5A 2WA4A 4B3NA 3I3BA 3D82A 4XF3A 5AVPA 5BV6A 4P02B 2Q1ZB 5I0TA 1HX6A 3JD71 5EHDA 4FPOB 5KWRA 1UF2C 1A78A 4ARYA 3ILNA 1WUVA 4UT5A 4BU2A 4LBJA 1RUC1 3I8TA 1OBNA 2OKXA 2HEVF 1LODA 2VCBA 5HPOA 1G9AA 1PGL2 5LA0A 3POFA 3N35A 3TRSB 4LT5A 3SCHA 3B9IA 5J36A 1MZ6A 2R042 2V09A 3JQWA 4KQ7A 2IWGB 2HWB2 4Q4Y2 1WA4A 1JXNA 1QGLA 3KF3A 4GB32 4IEZA 5SV5A 3LOIA 5ABJA 5JXHA 1D0HA 1WMDA 4E9KA 3C3VA 1POV1 2NLRA 3MUY1 5FP4A 3A21A 4OHZA 3DYMA 2LS6A 2VULA 4KH9A 4IE4A 4OI1A 2ENRA 2ZBJA 3AZYA 5LBBA 3VL8A 4XDOA 1O5LA 1TEIA 1IS4A 2BRTA 2VCMA 1DU3D 3WQBA 1GYKA 4QPGC 5LRRA 1D4M3 4L99A 2XJTA 3POIA 3UJQA 4AHZA 2A3WA 2BWCA 1AR93 1F5JA 1NKGA 2BWAA 1H8TC 5J48A 3ILRA 3PUHA 2GSYA 4Z8BA 3GALA 4XF1A 4W50A 1FPN2 4CU8A 1NZIA 3KT7A 4OVEA 1V6LA 2YDEA 4D7SA 1DGWA 5LZ6A 5IAVA 5FPBA 1PVC1 5JZGA 3H8XA 1S0FA 5L7OA 2P3IA 3NKGA 4ASMB 2ZZQA 2F4PA 1UOGA 1ND3C 1IPSA 1DDLA 3GHNA 3WNPA 1UU6A 1LOCA 2AYHA 3ZX7A 1VBE3 1J3RA 5FK7A 5LBCA 2Q8CA 2C4XA 2W91A 4QPIA 2IXJA 2JG9C 3NNFA 1PIV1 1DQ6A 1Q56A 4HPKB 1YYNA 4CUBA 1GFF2 4FSJA 3CHXA 3UYJA 1R64A 4LO8A 2J1SA 1A3KA 2DCZA 1NYWA 4ES8A 5ACA2 3BU0A 4RS5A 1R1ZA 1QJY2 1JHNA 1UMHA 3TEZA 4DUXA 1GZWA 1NCQB 3I49A 2NZ9A 2IXKA 2B4KA 4NRPA 3WX5A 4FOQA 3ACGA 4QGNA 2X5IC 4BZ4A 4F7ZA 1TNRA 1GWLA 3N7LA 1VMJA 4MGSA 1CAWB 1ULOA 3GF6A 1KS4A 2OZ6A 5FBJA 4YW3A 1AR62 4YW2A 4QAWA 4CP0A 2OZJA 4IUGA 5FLHA 1RIRA 4FTSA 2ZEXA 4OHXA 2WRAA 4FPCA 4J1XA 2OW4A 2ZX2A 4WM7B 3LFMA 5JMOA 4NHXA 1HRV2 2W0XA 3OF1A 4LBNA 2JDAA 1SCSA 4S2FA 4WM8A 5FZDA 5A7OA 1RL3A 5ANNA 3RSJA 5DZFA 5C4WC 2VMCA 3CMGA 1AXZA 3PVOA 3THCA 3BODA 3WOGA 3I3QA 1SG3A 3BYWA 1J3PA 2D40A 2Q5TA 3RI9A 5F3IA 1MVQA 5LA9A 4OI0A 1LHVA 4FOYA 3HIFA 3UKTA 5JIAA 5FO7B 1ND2C 3IPVA 2BW8A 4HVRA 4DB5A 1VBC2 2DF7A 4XACA 2RDRA 4LLFA 3OEBA 1RUD2 2EXIA 1NE6A 4Q1PA 2WWSA 5DDJ2 3U4SA 4IW3A 3M7AA 4LBQD 5GLZA 2OA2A 2WWJA 2W08A 3UESA 4YFZA 2X53S 2E51A 5FZ6A 3GZAA 4DZGA 1JUIA 3SHRA 5CVRA 4EJRA 3CEWA 1ASJ2 1W06A 2DCTA 3T0BA 2W87A 5K0UC 1QJEA 2ADDA 2FMYA 1Z7S2 2CGNA 1UX6A 3WNKA 2UWBA 3PJQA 4R9AA 1C8NA 2WFF3 5FZIA 4A6SA 1NCRB 5C3RA 4K40A 5IVVA 2OUHA 4KWKA 1C1FA 4A7YA 3B69A 1CR7A 3O0XA 2FZ2A 5A6YA 2ZGRA 2VVDA 2KA3A 5FBZA 3VD5A 1OPMA 5C3SA 4FOVA 2OPWA 3GCWA 3KVAA 1PK6C 3B5LB 2R062 1PVXA 3HJRA 2HKXA 1UPIA 4AR2A 2PLV2 3TBDA 5LASA 3IT8A 4XFHA 2ILMA 4AGRA 1TMF2 4N9HA 1QNWA 1HQWA 5FY9A 5C5TA 2DWRA 1ULDA 1C8M3 1YNAA 2Q30A 4EZHA 3DPRA 3Q8BA 3VKOA 3VKNA 4PLOA 3EHKA 3H7JA 4I2OA 1UOFA 3LOBA 4ARXA 3BN6A 2R073 1NQJA 1JYWA 4XJ8A 3SCFA 2AH2A 4FPFA 1GKBA 5GZDA 4PIZA 4XHXA 3FHAA 2BVBA 2JDUA 3BVCA 3LIHA 3SCGA 1RUH1 3H9AA 2ATFA 1NQDA 2XVKA 4QHOA 1VBA1 3K46A 2YGMA 4YLZA 4PDWB 2NQYA 3WG3A 2E7QA 2ZXQA 4Y5SA 2VZUA 3GZTB 5IUQA 4RGAA 4GH4C 1CJPA 1TZOA 5E6HA 1W8NA 1RB8G 1X82A 1QJFA 1RTVA 1WBFA 2VPVA 3NV1A 3PNAA 5DAWA 4Z2AA 3GYDA 3WLUA 3B93A 3R05A 5I8TA 2HH9A 1UZZA 4HK9A 3U37A 3I3MA 3W20A 1N3OA 2VW0A 1W6QB 2OXBA 2JIGA 4IEPA 3SLIA 2HWC3 2I74A 2YFZA 1FXZA 1HV0A 2BGPA 3A23A 1YQ6A 4XQWA 4ZXKA 4RA0A 2HLEA 2EXJA 2N7GA 4WM8C 3VD3A 4B4QA 5C8CB 2YPDA 2C9KA 2W92A 2XKOA 4P00B 5JLVA 3SH4A 4B7KA 2AC1A 4KI5M 4N7IA 4YZ4A 1O7FA 5FO9B 5FWEA 2WNUA 4TZDA 5FKBA 3L2YA 1S0BA 4UXAA 1IG0A 3PUAA 4TWTA 5F5IA 2P3JA 1AYM3 1ZBA3 1YI9A 5GJ6A 3CQOA 3FE5A 3RZGA 2Z79A 2BU9A 4AEJA 3HNYM 3ZXJA 2VJXA 2WQ8A 1W9WA 2RMU3 4CZSA 4HXCA 4CTEA 3K2OA 4DRRA 3FHIB 5A3UA 2CY6A 4UWDA 3SISA 1WMXA 4D69A 5JCTA 2VVFA 2VOWA 2HEYF 3VBHB 1OFNA 1UYPA 3T4HB 2YBKA 4XDPA 3ORJA 1SBFA 4YW6A 1OOPC 3PUIA 3RZZA 5FWJA 3M4FA 3PJYA 2E26A 5JSPA 3WG2A 5KXEA 4OZXA 4U36A 1AJOA 2A71A 4NHYA 3LWCA 4L8QA 5B4XA 4ZXEA 1UNBA 5FLJA 2X05A 3RZLA 4KBBA 4BQ5A 1R1A3 3WNLA 2O0OA 3S5QA 2TUNA 4LQRA 2RDSA 2WT1A 4KU7A 3KM5A 4FQ4A 1COV3 1W3VA 4UBGA 2QUOA 4MG2A 1UOBA 3O1VA 1K5JA 1GOHA 1VBD1 1UX7A 1UCXA 1DF0A 1VJ2A 2R041 1OI6A 2HWB1 3OYWB 1SLIA 4JGZC 2JDYA 2RR12 2VE1A 3CF6E 4GB31 3H42B 4GKXA 4IV1A 2E53A 3ZFGB 3BPZA 5BXXA 3O0VA 2JB8A 1JYCA 1T6GC 2Y6LA 5F9TA 4CDWA 2Q0AA 1G7YA 2VZPA 1OPOA 2YC0A 4G4FA 4D94A 4WVWA 1SEFA 5DAPA 5I8SA 1MQTB 5C5UA 1QY4A 1CAUB 4Q4X3 2JE7A 1RUJ3 2QQVA 3ATGA 3JXSA 2XUEA 4PF1A 4BWOA 3WQ7A 3VBFA 4ASKA 1AYN2 4AG4A 4C0BA 5L36A 2IXHA 1IKPA 2UY8A 3POBA 1UXXX 2VTXA 4A3XA 3NW4A 2ZX1A 4GMP3 4QPWA 1XPWA 3Q9OA 3ZR6A 1XBFA 2XJSA 4OI2A 2Z42A 3AVRA 3U10A 3WUDA 1LR5A 5FR3A 3VHRA 5FAXA 2AGSA 1SLCA 2XR4A 1KJRA 4YRDA 3WNXA 5GLUA 5A7PA 5ANQA 1SDWA 3BB6A 4AL9A 3T2PA 5L9RA 4N53C 2JE9A 4XFIA 2VC9A 3RQ0A 4EQVA 2CL2A 1F15A 1JUHA 1S2EA 1W2AX 3APBA 2Q8OA 3RVHA 5LB6A 1HXS2 2RHPA 2LUWA 1ZVFA 4K3UA 3N7KA 4FOWA 1S0EA 4QGMA 5DPNA 5ABJB 1V6KA 5ACA1 2HWD2 5A6QA 2GH8A 1QJY1 1OA4A 1PZ8A 3PL0A 1PO23 4R4XA 2VZTA 4NHLA 4RR3A 4LMFA 3PVNA 4I3PA 2RS51 1H1AA 5JI7A 5JOWA 1DHKB 1VBB1 4XQ4A 4Y33A 4N9IA 3DCQA 1ACCA 2KR2A 4X6RB 2XUMA 3NJVA 1AR61 3O0WA 3VZLA 2Q4SA 1AHSA 2BDRA 3FUQA 1U5ZA 1Y43B 4XUNA 1K45A 1QJZA 5A1AA 4HVOA 1HRV1 1X7NA 1Z78A 5DZEA 4LKSA 5DQ0A 4OULA 2P3YA 2RS32 1PO13 1QQP3 1GP4A 1GMMA 4HG6B 5T5OA 4EV0A 4QX2A 1BKZA 1E5HA 2XMLA 2K46A 4Z07A 2ZOEB 2R30A 4H55A 2VU9A 1LJ7A 3K3OA 5JZGB 4LBQA 1LOFA 5L7OB 4QMAA 5FZLA 3WP3A 1M4WA 4XJUA 3KWVA 2PHUA 1BQPA 4HN0A 4EWAA 3S5AA 2ZAHA 1VBC1 1MS3A 2VMDA 2JDHA 3LA2A 1RUD1 1RUI2 1YJLA 3O1SA 2ZMKA 3NL1A 3GHMA 1BZWA 1GZ9A 2MEV2 3J7HA 3LPFA 4QPIB 2CWSA 1WGPA 3MFCA 4JHTA 3MW4A 1EAH3 3Q8CA 4H14A 2LRPA 1Y4WA 3GDBA 5IVJA 4JRAA 2WSVA 2P4EA 5FDBA 1QJU3 3JBG3 1JOJA 3EBRA 3OBTA 1ASJ1 1L7QA 3USSA 5BNOA 4JVAA 3QOPA 4RS5B 1JZ5A 3MF6A 3POSA 5GZFA 3VBSA 1GZWB 4Q2FA 1GUIA 2YU1A 2DV9A 3CLPA 2CHHA 4NAMA 1JTZX 1VRBA 3K4AA 4C90A 5F1RA 3E6BA 1UQXA 4AFBA 2ZACA 4S2GA 1N1VA 1A6CA 1AXYA 3C2UA 5IJRA 3G7DA 3WF4A 2ID4A 2WC2A 1G86A 3D4KA 1RHI2 1H4HA 3ZFEC 3U07A 3VBFC 2ARBA 4WM8B 2BYVE 1UU4A 4CDXC 4YGDA 2QNKA 3LEGA 4G9SB 4JDMA 2AREA 4A4AA 1TMF1 2XQRA 3MV01 1ZNPA 1XXNA 2R0HA 5T3NA 2OT7A 3OD4A 4COUA 1K5MA 4OCTA 4IE6A 4P5YA 3IPVB 3D8CA 2ZGTA 1C57A 1DQ0A 3RZHA 2RJLA 2J22A 2YMZA 2VUDA 4BMBA 1W9TA 1B35A 4PI0A 3VGIA 4NVPA 5F2SA 5FIXA 4JGYA 1PHMA 4KMQA 3WSOA 4URAA 1IS5A 5FUNA 2A73B 2VBDA 2CU5A 5FPUA 3W5MA 5FPZA 2UY9A 4MXVA 3E5UA 3PTYA 5HBAA 3BPSA 2E33A 2VR4A 4NUBA 4XIOA 4I02A 4L11A 5E89A 1CQ9A 2YC4A 1IHMA 2YC2A 2EICA 1IZ3A 4BH9A 5EV7A 3I4IA 3DGTA 4Q0VA 2WQ4A 2P6HA 5CFCA 3P3NA 1CAXA 4FPLA 1DQ2A 1G9BA 1QJX1 1SFYA 2D5FA 3HNBM 4SLIA 4E4ZA 1O3QA 5HV4A 1D2QA 3T1LA 4CCEA 4EE2A 5D8AC 1OQ1A 1RVF2 4JGZB 3VKLA 5J96B 2MNGA 1RMU2 2XOMA 4P9LA 3WP5A 2Y6JA 4K1YA 1CAVA 1HW5A 2D6LX 2FCTA 2HWF2 2PHTA 3J8F3 3N9NA 5HI0A 1SDDB 4MH0E 2A6XA 1V6MA 3OD0A 2VW1A 3D0SA 4QKFA 1WCKA 2VNOA 3DKWA 3WQ1A 4ISQA 4IQPA 5F5AA 1HRI2 1F8VA 3MFAA 3CJIC 3OUHA 4BCUA 2P2KA 1W0NA 3ZYPA 2ZMNA 3DPRB 4XTMA 1H2KA 4UW4A 5AFEA 1PM7A 1L7RA 5FOJB 2WN3A 1Y9GA 5GALA 1MZFA 2B42B 2Y64A 2BZDA 4N43A 4HFSA 5KHJA 1VR3A 5D21A 5LCWL 1O3TA 1NUKA 2XDVA 3S7EA 4FFIA 1UO9A 1OMIA 1CZTA 2VUCA 3OPZA 3BUCA 1OUXA 5FY8A 3GM8A 3DXUA 4R8HA 2X10A 5L73A 5LEJA 4Q8LA 2YB7A 3V0AA 4YGBA 3HD8B 5FOBB 1W0OA 3J7MA 4YW4A 2G9GA 2HBUA 1EUTA 3G6JB 1X8MA 3NAPC 4N90A 3N36A 3WF3A 3UGHA 3K51A 2X8KA 1MZEA 5KC6A 4CXYA 5DZGA 3KCXA 1XSQA 4Y1ZA 1O91A 4AZZA 3KQ4B 5FRAA 4AFAA 3K4DA 4JX0A 2G19A 1S2KA 2RR11 3J7NA 4A42A 1FMD3 1KDMA 1SLAA 1XE7A 1VAKA 4COZA 5I0UA 5AC92 3UGFA 4DXTA 3H1YA 2WNUB 3GBWA 1ZBE2 1K5MC 2WNVC 5FYTA 4A3ZA 2RJ2A 5T5JA 4HBNA 2GC0A 5A33A 2ORXA 3CBNA 3PVEA 1WD4A 1DZTA 4XFFA 3HN1A 4XJ9A 1GQHA 2R0FA 1URXA 2JDMA 1CX4A 2UYBA 3LE0A 1GNHA 1LGNA 4GAZA 4LIUA 5C6CA 1WW6A 2Q1FA 5IFPA 1CX1A 1QF3A 4H3WA 4FTBA 5A7QA 3N9MA 1BK0A 4GQ7A 3CIHA 5LRSA 1F5FA 4XCAA 5FYBA 4WVVA 5FJKA 4RSUA 2VM9A 4WZCA 2WJSA 3T1MA 5FZBA 1W2TA 3OPTA 3WNNA 3WP6A 1BVVA 2VG9A 2VL4A 4XC9A 4OMCA 1QDOA 2OIIA 1PX4A 1X8EA 4BIOA 1XNCA 2B39A 2VTXJ 3IAQA 4QQLA 2EIDA 2P1BA 2XKPA 3I7DA 3AVSA 3ES1A 1W2OA 2D5HA 2XHNA 4NAOA 4QPGA 3VZNA 5E88A 3MYXA 1JOPA 5FTTC 4CP2A 4R9BA 1H8TA 4NO4A 1G9FA 5I0DA 3TEYA 4LNVA 2E6VA 5CYYA 1VBD3 1GNYA 4Y26A 1SHWB 2W2IA 4IV1B 2HWD1 2ZCWA 5LA1A 5LWBA 4ZZ5A 5FP9A 3UV9A 5LA2A 3M8LA 3TN92 2JECA 3AKRA 4COYA 1QWRA 4CDWB 4B4PA 1DQ5A 3GCXA 1UXZA 3OOXA 2I07B 4YVSC 1ND3A 2C24A 1XE8A 4XZPA 3OY8A 4AHWA 2FDHA 5FJHA 3NVCA 4AQSA 1IQDC 2EXKA 3VBFB 1ZX5A 4O9EA 2O8QA 3H3UA 4IEOA 2RS31 5F3EA 2QQOA 2JG9A 4MOAA 3U4XA 3KSCA 5A3OA 3R0RA 4EN9B 2DYCA 3IMNA 3Q8AA 1UKGA 3LIGA 1U0AA 5JOXA 2VMEA 3WHUA 5IVEA 4YG3A 3AP6A 4NOTA 4R9DA 3GJAA 4YNIA 1GR3A 1AL23 4GA9A 3UKVA 3VBUC 3ZN6A 4AVSA 3FN9A 1YHFA 2HBTA 4I3GA 1UD1A 1UZ0A 2ZGKA 5FZFA 3VN4A 3ZSEA 4OHYA 1QXJA 1KITA 2JDNA 2X5IA 3FFQA 3NO8A 3OEAA 4QU2A 1RUI1 2VZRA 3SKVA 1SACA 2GNDA 2QQJA 3THTA 2XL9A 2ZGSA 1DCSA 2RM22 1N47A 2EAAA 3ZMNA 4HETA 4TYSA 1BMV2 3H3LA 4QKBA 2JICA 1OD5A 1POV0 4NPLA 1A8DA 1DYPA 1ZRIA 3KV9A 1XYPA 3VBRC 4HOOA 5C4WA 1BEV1 4FP3A 4HN1A 2DVFA 5FV3A 2ZX0A 3SITA 2C1FA 3WVJA 1S55A 2V5YA 4GWIA 4W4ZA 2E7AA 1ZZ6A 3KGZA 2D97A 4RR3B 2VZVA 4XILA 2EIGA 4ZS2A 2BP6A 1REEA 4FXGB 1YWKA 3WW3A 4K8RB 3AC0A 3VD7A 2RS53 5JXGA 4Y5Z0 1WCUA 1IPJA 1LOEA 1VBB3 4QHBA 1ND2A 2TNFA 2WN2A 5F6KA 5GLWA 3ZSJA 1OQEA 1H6YA 1REFA 3USUA 1RHI1 4Q0UA 3KT4A 4IEQA 4NIDA 2W52A 3IIAA 1W8OA 3R4DB 3MO4A 3N7MA 4RFT0 1JYNA 1AR72 1RUE2 2J1EA 2QFEA 3B00A 4F8AA 2DDUA 4FPHA 5T52A 1YRZA 2GALA 4LO7A 4AAPA 5GLTA 1FX5A 3KGLA 5C9AC 1UIKA 3IDBB 3E5XA 1ZZ8A 1DFQA 2IXIA 2ZA9A 4W6XA 4XAEA 1KJLA 1C5HA 2VZOA 5K0UA 2Y8KA 4LBQB 3QH7A 3TWIA 2D98A 5JPMB 1HB3A 2IZWA 4LK7A 4CCCA 2JB4A 2XH6A 3V56A 1LECA 1OLRA 1Y7BA 1MEC2 3KZ4C 3VD9A 3VZJA 3ZDSA 2ZPXA 3PHMA 2VQUA 4RFRB 2XBO3 2IFWA 1RUG2 1W6MA 2QZ2A 2VQTA 1ONAA 4CCLA 4KGGA 2JG8C 5FMBA 4CXXA 5KXBA 3AP5A 1W3XA 1LCLA 4NPRA 5G04L 5I0SA 1L7LA 1PK6A 3A22A 5BNOB 1XSRA 2BERA 1CD3G 2ZHMA 2WO1A 3IWZA 4OMDA 4TXWA 4W6WA 1I5ZA 4ZONA 5EPAA 3VBSB 3MI8A 4WZFA 3A7QA 1RXFA 5CG9A 4W8JA 2GP3A 4JDOA 2DU0A 1N1SA 2W46A 3MV11 4CVUA 3EYPA 4C1WA 2WZPP 3SKJE 1IOAA 2A6VA 1D4VB 2EIEA 1BYHA 3AP7A 3QH6A 1R092 3POEA 1EV13 4BQXA 1APNA 1J3QA 2Q8DA 3SNMA 1LOGA 4Q4V1 5JSRA 1RVF1 3OTFA 4L9BA 4IETA 1HB1A 2WSUA 1NG0A 4RHV3 1VRH1 5K9YA 2HWF1 5EJ3A 5A3TA 4Q0QA 1AR83 1BBT2 3DF0A 3O1TA 5BUVA 2XJRA 1DGRA 4Y1VA 2QBXA 3VKFC 2JENA 1GWKA 1L3JA 4JQRA 2OYZA 5JMCA 4GH4A 2ERFA 3POYA 1AVBA 2B7YA 2I2SA 1REDA 1K5MB 3RJ2X 4E8CA 3PTRB 3BCWA 1PMIA 4E8DA 4L2NA 4AVVA 4P14A 2RS13 3AMQA 2RDNA 5F6LB 2D43A 4FPGA 2QKDA 1B35B 2ORZA 3HN3A 3NMBA 5T55A 3ZIWA 2VO5A 1CIYA 1DZRA 2G9ZA 2C26A 1R082 4HZFA 4JGYB 4CCKA 4DS0A 1GLHA 1Y9QA 2QQMA 3M3OA 4FXKB 3FBYA 3I2FA 4GIQA 2VOXA 3VZOA 1PGW2 3HOBA 4LBOA 1O3SA 1ZRCA 4LBKA 3ALQA 3I59A 1PZ9A 2VOVA 1UYXA 3IKWA 3NNLA 3OG2A 2D6PA 2IFRA 3AYDA 3LDBA 4V2WA 4UFIA 4X8NA 4GULA 4YGEA 1KQRA 5H9RA 2Y6HA 1OFSA 5CFCB 1CAXB 3CL1A 3OCPA 4GJZA 5DMYA 5FY4A 4K6BA 1CESA 3RZMA 1QJX3 4ES9A 5EXOA 3LDRA 3RZKA 2VMGA 3NNGA 1CAVB 2ZGOA 3DUIA 4WVZA 2ZAAA 5JXIA 3VV1A 1G8WA 3HR9A 4JV4A 4NN0A 4UOJA 4QDRA 3O1OA 4PIXA 4BISA 1MACA 1QMJA 2DFCA 4QB2A 1OOPA 3AFKA 4QHZA 4QKDA 2OX0A 5FZCA 4YM1A 2PA7A 3HQUA 4UI9L 4B1MA 4HLTA 1QH6A 2A6ZA 2WS91 4GWNA 4AEDC 2W68A 1RUF3 2J1RA 4AHXA 4DY3A 1V0AA 4N43B 1W6OA 1NX9A 3OBRA 4DEQA 3IDEA 4AFMA 4LUKA 1D4M2 1IKQA 3I97A 4LOSA 2QQPA 4JGZA 2DUQA 1AR92 3I2HA 5FZ1A 4Q4W1 3IBMA 3MLLA 2BQPA 5FZ3A 1F4AA 3V0AB 3J7LA 4GZ9A 2DCKA 2VNGA 4QT6A 3T2TA 3ZYJB 2VZQA 2BGOA 1NXD1 3KF5A 3IM0A 1CONA 4QXBA 1J83A 1I6XA 4LORA 2VZ3A 1D0GA 4XCBA 1GBGA 3LEMA 4RN5A 1QOOA 4DUVA 5BYNA 4JQTA 1X50A 1VBE2 1VP6A 3UL2A 2QE3A 1HQNA 4AVCA 2DCYA 1PMJX 1OT5A 3DECA 3LF7A 3HQXA 3HT2A 3ZYRA 1XB9A 5CFDC 5JR2A 2GU9A 3B01A 2Z5WA 1QHDA 3TN91 3O1RA 4CE8A 4OZOA 3A0NA 3LQCA 3OBZA 3WDWA 5HCFA 2E31A 4XFAA 5DG2A 2B8MA 2JIJA 1P8JA 3WUCA 4QU1A 2CAVA 5B2GB 3BTZA 4MGIE 3V64A 5JAXA 5F7UA 2F17A 1UY3A 2Z69A 4N53A 4XDQA 3ES4A 5A33B 1QIQA 1GOFA 1MS8A 2OQ6A 2DURA 4JTOA 1O59A 2P5BA 5EZWA 4LTAA 1DYKA 5GZEA 3O14A 1SLBA 1PMHX 1V6IA 1X9TA 2ZS6B 3LFIA 2QQUA 3NJYA 4MHUA 3VHOA 3WG4A 1FV2A 4FQZA 1FOD3 2PELA 2WDBA 3RMXA 3FUOA 2VOTA 3HNMA 1JYIA 4IEWA 1TNFA 3WP4A 2JD9A 3B02A 4QDSA 3HAGA 1PNGA 1YI7A 5FYYA 4I0WB 2O14A 2RM21 2BTVC 3MZHA 2HWE3 1JBCA 1EPWA 4QPGB 4V1PA 4D6SA 3LA3A 3I2DA 1NY72 3TB0A 1BMV1 1LULA 1H8TB 1H4GA 1Y9MA 5JPNB 1V9U3 4XUTA 1WLDA 3GZUC 2F4LA 2J1TA 4ZPIA 5LY1A 1VPHA 5JXJA 1LTEA 1E5IA 2IC1A 3IIIA 1GZCA 5G05L 4BQ4A 1OHFA 2ZTNA 4OHVA 1J59A 2RE9A 2WZR3 5T50A 3HBKA 1LOBA 1POQA 4S2HA 5EJZB 1OD3A 1ND3B 1YC61 4YWAA 2JWPA 4LOTA 3OY8B 4CSWA 2VXRA 3S57A 3MDPA 2WYSA 2WFF2 4P9XA 4AHYA 3PIJA 1ZREA 4CP9A 3SMHA 1PGL1 3LGRA 5T5LA 1AR71 2JG9B 5FYCA 2DVGA 4OQ8A 5A3LA 2QVSB 4Q4Y1 3ZXAC 5FPXA 5I0RA 5DXDA 4EN6B 1RXGA 2ZX3A 3ZN6B 1JZ8A 4M3CE 5I91A 1KXGA 1YUDA 4P08A 1GP5A 3VZKA 4YZ1A 3AP4A 1WMFA 2X5IB 2EVXA 5GM0A 1JYVA 5K8SA 4B1LA 4AQ6A 1C8M2 2D6MA 1RUG1 2ETEA 3FMGA 3PIGA 1CZVA 3OJBA 3ZFEA 3AYEA 1XC6A 5HCHA 1N1TA 3TEXA 1GSLA 2R072 3U78A 4CDXA 5F8PA 5C4WB 4LPLA 4AVAA 3AL6A 4LKDA 3R4UA 1FPN1 1BEV3 1RJ7A 2HYXA 1DLLA 2VMHA 3VBOA 2WLQA 5KR7A 2IXLA 1TME3 2GAUA 3WW4A 3O7OA 3Q8FA 5FKCA 4BQYA 4OLLA 3RMYA 2ARAA 1YQ5A 1R091 4IXLA 1ND2B 4XFCA 1T2XA 2AR6A 3DYOA 4FPJA 3JD73 3P6BA 3BALA 3UGGA 3USUB 5KC5A 1W0PA 2AACA 3NNJA 5J7MA 3M70A 4KBZA 3EQEA 1RUC3 1BBT1 3D5OA 3NQHA 3Q8EA 4KNCA 2GN3A 1KFXL 3FFZA 2HWC2 3I2JA 1ZZ7A 3P3PA 3J9SA 2OVUA 2YFUA 3AM2A 1WW7A 2LROA 2W47A 1F35A 4LEJA 1JW6A 3MBWA 1WLWA 3ZFFC 2RJKA 3NV4A 4ET7A 4BB3A 2PFWA 5K0UB 2DTWA 3I3EA 1S0CA 4CDUC 2V4AA 4WBBA 2VECA 4V2VA 1Q8OA 1QXRA 3PVBB 1POV3 2BOJA 3AMHA 3ZOIA 5C3PA 5FZMA 1JZ6A 5TSWA 3U75A 1AYM2 1ZBA2 4XUOA 4CEYC 1R081 2HYKA 5FFOC 5D8AA 1W6MB 3INAA 4A7ZA 2XWJB 3NV2A 2GZWA 4CEWC 3AXEA 3MW3A 3O12A 4HONA 1VALA 4XMIA 2RMU2 5H9PA 3KV6A 1PK6B 1GQGA 5FXZA 1YQCA 4NMIA 3IB3A 3MEPA 4KWJA 3T3YA 4E4DX 4DNYA 4OHWA 2AZ5A 3WDUA 4IGQA 3IMMA 3AMPA 2FBEA 4PJYA 3CJIA 3WF2A 2JXAA 1AL0G 3HT1A 3KMHA 4L92A 1PVC3 5EYYA 4QM9A 1NLRA 4F3JA 3ZMOA 3OBAA 5IYYA 1QOSA 5DDJ1 1H9WA 1R1A2 4Q4V3 1ENRA 1LKNA 5A7WA 3CO2A 4ONUA 4UW5A 4DPNA 4E4HA 1EPZA 1COV2 2WAOA 4E2QA 4Q8KA 1JZ2A 1VRH3 2VXJA 2D3SA 2Y60A 2JDZA 1JHJA 1W8FA 2FQPA 5FXXA 4YM3A 1HIXA 1W03A 1PIV3 3FBMA 2FCUA 4HKOA 4XTPA 2EAKA 4GH4B 5CAZA 2DCJA 1VAMA 4BYYA 1PM4A 1EY2A 5BNPC 3EXUA 3OUJA 3OGVA 5JOZA 1Z7S1 4CCNA 4FT8A 4M00A 2D3RA 1ALYA 4M4PA 3NAPA 4OUEA 3WDYA 5C3OA 4FPEA 4PBOA 1QDCA 3AL5A 1G6NA 1X33A 2R49A 4YVWC 5LK5A 3T2OA 4IGPA 4Q4X2 1D4M1 1RUJ2 4RYDA 5FREA 1U12A 4FFHA 5C33A 3C7EA 2YG0A 4AK3A 3HQRA 1ENSA 1Y3TA 3M3CA 3DEMA 3CZJA 5IVBA 1HN0A 3CKHA 2R061 3I59B 4J1WA 5BPXA 5A3MA 4Q29A 1E57A 5F32A 5CG8A 2PLV1 4BLIA 2WLPA 3VBOC 3CJXA 1XQNA 4IE5A 2NMNA 3RYKA 4AVBA 5CNAA 3KD4A 1A34A 4MYEA 3WCRA 1OA2A 1C5IA 2WNVA 2WO7A 5C70A 5IK7A 1YLLA 3S6PA 4BIFA 1ZA4A 4IL7A 2SBAA 4EROA 2XJVA 5FYUA 3RRDA 3AZWA 3VDDC 2P6CA 3VHPA 4JKKA 3WV6A 4LITA 1OF3A 2BNOA 1LHWA 4GXLA 1ZRFA 2XJQA 3CZUA 3RWKX 3RI8A 1D2SA 5HXMA 4QX5A 1BLZA 2J1VA 1US3A 5DABA 5IVFA 5BY5A 3C7OA 1N3QA 2XLFA 2BNNA 4BDVB 1J1LA 3OGSA 5FYIA 4OUSA 5KXDA 4O9GA 2DFBA 3J26N 1OOPB 2GNBA 1J58A 1PO22 1NXMA 3ZXKA 4YW7A 3WG1A 1SLLA 3DKQA 4D7YA 4LO5B 1WD3A 1NZCA 2QQLA 3VDCA 2ZGMA 4COWA 1IQAA 3P5BA 3BI3A 1FNYA 1NA1A 2WS93 4K8FA 3N7JA 1X9PA 1W6OB 2VQ0A 3KVBA 3MW2A 3MUZ1 1UW8A 3LPGA 1N3PA 4MXWA 4RQPC 1HN1A 5DG1A 1TQ5A 5DUWA 4AI9A 1ULCA 5H9SA 4IV3C 5DAXA 5FCCA 5IVCA 1HB4A 3ACFA 3D3AA 4M3CA 4IEYA 4Q4W3 1PO12 1QQP2 2BUKA 3AFGA 4AW7A 3WHTA 2YBSA 3VD4A 1DIWA 1W9SA 4KWUA 1W6NA 4JCKA 4UFHA 3V0BA 1O4TA 3W58A 1T6BX 2WL1A 4D6RA 3NV3A 4YVSA 4UYBA 2PHRA 2EIBA 4K1ZA 4YM0A 4YSFA 4XYXA 1W2NA 4JZRA 1NY71 5EJ1B 3OUIA 3J4UH 4FAHA 4TN7A 2ZGLA 1DQ4A 4XF4A 1LOAA 4LO6B 1C1LA 4DMIA 1EAH2 1XNKA 4Q1RA 5F39A 5A32A 5F5QA 2WIIB 4JHZA 2Q1MA 1HB2A 1W8UA 3IDAA 2B45X 2XLGA 3JCIA 4FO9A 4QWNA 1RUH3 4P9WA 4QXKA 1QJU2 5DUXA 3JBG2 1VBA3 3RPQA 3VBUA 4CP1A 1YIFA 2J1AA 5FO8B 3PURA 3WQ0A 2UYAA 5HXVA 4TTGA 3POGA 2FZ1A 2WFF1 2E63A 4N53B 3QBQA 3M3IA 1AJKA 4Y1XA 3PU8A 5A6ZA 3JB8A 5JR7B 3UETA 2Y6FA 1RYYA 3VBRA 2ADEA 1EP0A 2JKBA 5FUIA 3K48A 5L9BA 3ZLIA 2Y6KA 5F3CA 1N1YA 4W6YA 1SZBA 4BMEA 3VDAA 3UNPA 3RGBA 4DEVA 1V6JA 4META 4OFGA 2QDNA 2D6NA 5DUUA 1C8M1 2WQZC 5CISA 1RC6A 4FFFA 3L9JT 5FMOS 1RUNA 4N7UA 3WW2A 3WNMA 4CU6A 3AYCA 1AYN1 2R071 1ZRDA 4WVMA 3WF0A 1YFWA 1XNAA 2WKKA 3AJZA 5AFBA 4BOWA 4ZHNA 4CYDA 2B46X 5IK4A 5IHRA 1UZYA 2WFPA 3LSDA 2DVBA 2ET1A 4P9IA 5C9AA 4DFSA 3C7GA 2R16A 1H8VA 2Y38A 5EIYB 1XNTA
chains in the Genus database with same CATH topology
4LJHA 1WCUA 2KR2A 3F95A 1W90A 3ORJA 4LK6A 4YW6A 3ZYBA 4BQ2A 1OH3A 1W8UA 4LKFA 1W9FA 1UOJA 4AL9A 4YWAA 2C24A 2JWPA 1GWMA 1HN0A 4BQ3A 2VXJA 2LRPA 1L7LA 2O14A 4BQ5A 4CP9B 4CP9A 1GWKA 4YW7A 1OKOA 1W8TA 1W8WA 2LROA 2WYFA 3UT0A 4CPBA 4LKEA 1W8ZA 2K46A 4LKDA 4A6SA 2Q1FA 1WZXA 3ZYFA 1GWLA 1V0AA 4CPBD 3ZYHA 1WMXA 4BQ4A 4LK7A 5D21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJH A;  1WCU A;  2KR2 A;  3F95 A;  1W90 A;  3ORJ A;  4LK6 A;  4YW6 A;  3ZYB A;  4BQ2 A;  1OH3 A;  1W8U A;  4LKF A;  1W9F A;  1UOJ A;  4AL9 A;  4YWA A;  2C24 A;  2JWP A;  1GWM A;  1HN0 A;  4BQ3 A;  2VXJ A;  2LRP A;  1L7L A;  2O14 A;  4BQ5 A;  4CP9 B;  4CP9 A;  1GWK A;  4YW7 A;  1OKO A;  1W8T A;  1W8W A;  2LRO A;  2WYF A;  3UT0 A;  4CPB A;  4LKE A;  1W8Z A;  2K46 A;  4LKD A;  4A6S A;  2Q1F A;  1WZX A;  3ZYF A;  1GWL A;  1V0A A;  4CPB D;  3ZYH A;  1WMX A;  4BQ4 A;  4LK7 A;  5D21 A; 
#chains in the Genus database with same CATH topology
 2V5D A;  5AVA A;  1EUU A;  2PHL A;  4DIQ A;  3GGL A;  1FAT A;  3ST7 A;  3RNS A;  4AAX A;  2A6W A;  2VUA A;  5FYZ A;  1Q8V A;  3MIF A;  1DBN A;  1AF9 A;  1DLC A;  1NCQ C;  3RJR A;  4B7E A;  5IVY A;  2CAU A;  3FL7 A;  4CP9 B;  2R1B A;  1KD7 A;  4Q26 A;  4F83 A;  1NA1 C;  3WIN E;  3SXW A;  5KBF A;  2JG8 A;  1J84 A;  2HWC 1;  1HXS 1;  4MAD A;  5FXV A;  3TNQ A;  4O61 A;  2NMO A;  3AZX A;  5LW9 A;  2R04 3;  4QX0 A;  4Q4Y 3;  4UFK A;  2HWB 3;  4WM7 C;  3J8F 2;  3JB4 C;  5FZE A;  1XND A;  5LAT A;  3BTY A;  1OC1 A;  4GB3 3;  2Y33 A;  1AXK A;  4XOG A;  3LA7 A;  3ACL A;  4IE0 A;  5JVV A;  3NST A;  2NP0 A;  4UFL A;  5T5P A;  5BNN A;  3OGG A;  1LAJ A;  1UU5 A;  1WME A;  3DYP A;  4GKY A;  2EA7 A;  2K0G A;  2RDQ A;  3IN9 A;  4M0H A;  4PIY A;  4XUR A;  1S4C A;  4ORF A;  4ATE A;  1V70 A;  1RGS A;  4LR4 A;  4QX1 A;  3ZFE B;  5C3Q A;  3RFR A;  4AFD A;  1BHG A;  2W1Q A;  3RYR A;  4CDX B;  4E27 A;  2JJ6 A;  4KG8 A;  3H8R A;  1WKY A;  3ZO0 B;  3L2H A;  2EF6 A;  4XAB A;  3M1H A;  3MLK A;  4XPV A;  5J1X A;  3ON7 A;  5FXW A;  1OF4 A;  3VBO B;  4YZ3 A;  4Y5T A;  2CDO A;  4ZU4 A;  4C91 A;  1FPN 3;  3T2Q A;  3W9A A;  5FY0 A;  3KCY A;  1SQ4 A;  4EWD A;  1O4Z A;  2YHJ A;  3CU7 A;  2BV4 A;  4GMP 0;  1H6X A;  3FJS A;  3MF9 A;  2RG4 A;  4M0N A;  3N9Q A;  2AEZ A;  1UZW A;  2AEN A;  5DAV A;  4YPJ A;  3UJO A;  3V65 A;  4AWD A;  1R1A 1;  1JU3 A;  5CB7 A;  1TE1 B;  2MEV 1;  2GN7 A;  3AJY A;  1SPP A;  1ZRR A;  1UMZ A;  2C6S A;  2D6O X;  2ZKN A;  1COV 1;  1NCR C;  2VMF A;  4MGQ A;  5KHI A;  4UF0 A;  3U0Z A;  4AYU A;  1LGB A;  1O8P A;  1C28 A;  1FMD 2;  1MVE A;  3LD8 A;  4M4R A;  5EYX A;  2PN5 A;  4E2S A;  4C1X A;  4EZ4 A;  1SCR A;  1O4Y A;  4C0H A;  3GJB A;  1X36 A;  4P9J A;  5ACA 3;  2FCV A;  2A1X A;  4JRL A;  1QJY 3;  3QAC A;  5BNN C;  1DGL A;  2CTV A;  4P9G A;  5EFU A;  4YFW A;  2VCC A;  4ASL A;  4D7T A;  5C71 A;  1E5R A;  1GAN A;  3I54 A;  4MUV A;  3S0M A;  3C8X A;  4Q4X 1;  1XJA A;  2D93 A;  4UFM A;  2FD8 A;  4HSL A;  5FZO A;  5D8A B;  3URF A;  4XHB A;  4BJ0 A;  4BM8 A;  4XF0 A;  4DY5 A;  1AR6 3;  5CEH A;  4XFB A;  4L0P A;  1CZS A;  3GXU A;  3SQO A;  5CAD A;  1DYO A;  4N8M A;  4O65 A;  2ZEW A;  1HRV 3;  1W9Y A;  4GMP 1;  1FYU A;  3KCC A;  3M2M A;  5FZK A;  3HEI A;  4MV2 A;  4Z82 A;  1BCX A;  1GQP A;  1W8Z A;  2W1U A;  2D6K A;  1WW4 A;  1QNY A;  3U1X A;  4QB1 A;  4PDW C;  1IPK A;  3CJI B;  1MPX A;  4LHS A;  4AI2 A;  2WZE A;  4XAA A;  3T4V A;  3VUO A;  1GOG A;  5J37 A;  1ODN A;  5FMO L;  1OLM E;  4IEV A;  4AED A;  2W3J A;  2WBK A;  4X6Q B;  2W1S A;  4E2G A;  1OH3 A;  5KHG A;  1VBC 3;  5CKQ A;  5A7W B;  3VZM A;  2FDG A;  4CCJ A;  1RUD 3;  4EN7 B;  5CZK A;  5DDJ 3;  5BNQ A;  1I3H A;  4PLM A;  2JKX A;  4I09 A;  5CA6 A;  4DIN B;  3PME A;  2ZGN A;  5FZH A;  4I01 A;  2VZ1 A;  4XE9 A;  2ZHL A;  2JDK A;  2G1M A;  1VBD 2;  3LZZ A;  2GH2 A;  1ST8 A;  3T30 A;  2YV8 A;  1PO2 1;  1I1E A;  5C7G A;  4S2D A;  1QXP A;  4MGZ E;  4Y1Y A;  5C8C C;  4IDZ A;  1ASJ 3;  5LY2 A;  3E1F 1;  3NAP B;  3MIE A;  3PDQ A;  1Z7S 3;  5FZA A;  1KGY A;  5IAT A;  3POW A;  4LJH A;  4JKM A;  4CXW A;  4KGQ A;  2MPF A;  5A80 A;  1LRH A;  4BQ2 A;  3H7Y A;  1VB4 A;  2XL7 A;  2JDP A;  1W9F A;  4LE3 A;  4PCR A;  1ODM A;  1RMU 1;  4QPY A;  5LBE A;  3WR0 A;  1XNB A;  2D44 A;  5CFD A;  4FVV A;  2TBV A;  2VOK A;  1VMF A;  4IES A;  1PO1 1;  1QQP 1;  2PQQ A;  4QXC A;  4IEU A;  3WCS A;  3WDV A;  3ZDV A;  2JD4 A;  1O3R A;  4DXZ A;  5IK5 A;  2R06 3;  2XHK A;  2CGO A;  1AZD A;  4AI3 A;  2PLV 3;  4XUQ A;  3VHN A;  1IS3 A;  2PAE A;  1HRI 1;  4OQ9 A;  4BE3 A;  1AL2 2;  3RYP A;  1US2 A;  1TMF 3;  2NYY A;  1IGO A;  3VBH C;  4CA9 A;  2WNV B;  4QQ2 A;  4CDQ A;  1QU0 A;  1YCI A;  2NN8 A;  4MGY E;  2GP5 A;  4AQ2 A;  5I93 A;  5FQ0 A;  2KXL A;  1VLN A;  3ASI A;  3MIH A;  1ULF A;  4M3C F;  4Y22 A;  4DXS A;  1XRU A;  3FLR A;  1UN1 A;  1EAH 1;  3KB5 A;  1KFU L;  2A75 A;  2V72 A;  2BVV A;  2D7F A;  3KS7 A;  3KT1 A;  4Z1V A;  1MR5 A;  4QXH A;  4Y20 A;  2G4I A;  4CUG A;  1Q8P A;  3N9O A;  1QJU 1;  1BVP 1;  3JBG 1;  4HT1 T;  3JZV A;  4BK4 A;  5LEK A;  2L9L A;  4JKL A;  3ZFG C;  3EB7 A;  4LUM A;  4NHK A;  3E6C C;  3UKN A;  2YY1 A;  4QM8 A;  2FDK A;  3NWK A;  4AQT A;  2RS5 2;  5GZC A;  1NA1 B;  1VBB 2;  1B09 A;  2ES3 A;  4Y24 A;  4R4Z A;  1XOY A;  2YU2 A;  5IAX A;  1MQT C;  3R6S A;  1AX1 A;  4MXW B;  1JZ3 A;  4QKN A;  5IW0 A;  1CWP A;  2DBN A;  3ZYB A;  3U14 A;  3HBZ A;  1IS6 A;  4Y1U A;  3OGR A;  2NPI A;  4M3C B;  3AMN A;  5FY7 A;  2C5D A;  2PAK A;  2YRO A;  5AC9 1;  5L19 A;  1GU3 A;  4QQH A;  3ZSK A;  1XYN A;  2LW8 A;  1W6N B;  1OQD A;  4GWM A;  3V0B B;  4YVS B;  3I3D A;  3RWN A;  1ZBE 1;  2GDF A;  2W95 A;  4SBV A;  4CUA A;  3EO6 A;  3WF1 A;  4WV8 A;  4DOU A;  4K20 A;  4PF5 A;  1ZZC A;  2QQI A;  1JOD A;  1PNF A;  1SBD A;  2Z4F A;  2V73 A;  3SC7 X;  4YM2 A;  2R1D A;  3WZ1 A;  5JI9 A;  3OB8 A;  2XBO 2;  4HSJ A;  2Y26 A;  3EMR A;  4HL0 A;  4R52 A;  5A32 B;  4CU9 A;  5B4N A;  2IVI B;  4A41 A;  4I0B A;  4NHM A;  2BFU S;  2WUH A;  4YW1 A;  2AEY A;  3HMY A;  1OXC A;  3MIG A;  4ISR A;  4LBM A;  3VBU B;  1YFU A;  4HK8 A;  3B9C A;  4LA3 A;  4H7L A;  1LED A;  5ABJ C;  3BOW A;  1WCS A;  3VKM A;  2VD7 A;  5JIU A;  2BEO A;  1YJK A;  1HKD A;  4CUC A;  1Q8S A;  2CNA A;  2ZAB A;  4HMZ A;  1EV1 2;  3KLS A;  3IAP A;  2G9F A;  1ULP A;  2GMM A;  3R4S A;  3VBR B;  2A3Y A;  5HV0 A;  4MHR A;  4RHV 2;  2BOI A;  3THD A;  3RDI A;  3N3H A;  3J8F 1;  2VNV A;  2RR1 3;  1AR8 2;  1Q5O A;  2PAM A;  4UFJ A;  4BLJ A;  4A45 A;  3T09 A;  5F5C A;  5A6X A;  1DP0 A;  4BPZ A;  3ZXF A;  4Q27 A;  5DUV A;  3K4Z A;  4Y4Y A;  2O1Q A;  1ZM1 A;  4LIV A;  4PT6 A;  1ENX A;  4MSV A;  4QB6 A;  1UY1 A;  1GNZ A;  4CDQ C;  5JZG C;  1JS9 A;  1MS9 A;  2RS1 2;  4ZY9 A;  3ZSL A;  3W21 A;  4AF9 A;  5L7O C;  4MGT A;  1W8W A;  1JH5 A;  3K77 A;  4WVM B;  2VCA A;  4H7M A;  2VH9 A;  1KS5 A;  1AYN 3;  1LEM A;  4CCD A;  3K3N A;  1U5I A;  2W1W A;  4RGG A;  1UIJ A;  4QPI C;  4O7X A;  5C9A B;  1GV9 A;  4QX3 A;  2H0V A;  3H1M A;  2CSG A;  5FZ8 A;  4LXL A;  4YG0 A;  2YYO A;  3ZFF A;  5FYV A;  1DQ1 A;  4K7J A;  3AZV A;  1WCQ A;  4CDU A;  2WNE A;  1W2U A;  1OUS A;  4EN8 B;  5FUP A;  2K2S A;  1OLM A;  4RS5 C;  4XUP A;  1HV1 A;  3JQX A;  1H1I A;  2YPJ A;  3POJ A;  1Q43 A;  1ZA7 A;  2VUJ A;  5FY1 A;  2Z2S B;  5FZG A;  4HKL A;  5JWP A;  4PI2 A;  3MPB A;  4CEY A;  4QQO A;  1E5S A;  4NE9 A;  2QJV A;  3KHB A;  2SLI A;  2ZEY A;  3OGJ A;  1ENQ A;  4P9Y A;  2JG8 B;  1VMH A;  2O8O A;  1QJX 2;  4CEW A;  3VL9 A;  4QGL A;  1FMD 1;  2LM3 A;  2UWA A;  1UWW A;  1HXS 3;  2Y34 A;  1UY0 A;  4J6G A;  2ZGU A;  3NJX A;  3H50 A;  4W65 A;  1YO8 A;  2QCS B;  2ZZJ A;  4XBQ A;  4BQW A;  4MZU A;  4LO4 B;  1I5P A;  4AEM A;  2VMI A;  2HWD 3;  4BA6 A;  1RJ8 A;  5FPL A;  1CGP A;  1UY4 A;  1STM A;  3NKT A;  5A7S A;  2R6Q A;  1PX3 A;  2R7E B;  1K3I A;  1PZ7 A;  4QQP A;  4QX8 A;  2PTM A;  2CV6 A;  2I45 A;  1UAI A;  5BNN B;  1O6U A;  1BK1 A;  4D0Q A;  3NRU A;  4TLF A;  4MLO A;  1MZ5 A;  1V6O A;  4D6Q A;  3X29 B;  3LCP A;  3TAY A;  4UAP A;  3WDX A;  4XMA A;  4B4R A;  5DAQ A;  3ENR A;  3THP A;  4LLO A;  1S0I A;  1HQL A;  2CDP A;  1RUF 2;  4AOC A;  5CKN A;  2QQW A;  1JMU B;  3MID A;  1CJD A;  1HJF A;  1RUE 1;  3GBG A;  3UT0 A;  2UWC A;  3ABZ A;  2RS3 3;  1JZ4 A;  1QEX A;  3DXT A;  2XG3 A;  1VB2 A;  1XU2 A;  4PQQ A;  1W6P A;  4CPB D;  4XXP A;  3O1P A;  4FP2 A;  1DG6 A;  2PHD A;  1YFY A;  3U11 A;  5BNP A;  3TNP B;  3PMS A;  3MLJ A;  2HJI A;  3BGA A;  4A44 A;  1ZYB A;  5A3W A;  3C7H A;  1FNZ A;  1NAE A;  2WR9 A;  4K21 A;  4KL1 A;  4XEZ A;  5FP7 A;  1O8S A;  3UK9 A;  1UOJ A;  2GNT A;  5FYS A;  2YZ4 A;  1MEC 1;  1C3H A;  4YVW A;  1OUR A;  1Z0H A;  1SPP B;  1FAY A;  1RUI 3;  2WZ8 A;  4XJA A;  4Z2W A;  2JEM A;  4MO3 M;  2MEV 3;  1V6N A;  3IZO A;  2BNM A;  3N9L A;  3B3Q E;  4A6O A;  3RZJ A;  4ZU7 A;  3ZPY A;  4UF0 B;  3WNO A;  1OVP A;  3VDB A;  2QQK A;  3AYA A;  4LKE A;  1H0B A;  2BFU L;  5I8Y A;  2A6Y A;  2XGX A;  1SBE A;  5IFT A;  1FV3 A;  3SH5 A;  3E6D A;  3NNM A;  3F95 A;  4R9C A;  2YGL A;  1IG3 A;  5FZO B;  1LGC A;  5E8A A;  3VDD A;  2GC1 A;  3ZYG A;  3PUQ A;  5APA A;  4AEK A;  3DPR C;  5JSO A;  4NIH A;  3DN7 A;  2WAB A;  5A1F A;  2BBA A;  1RHI 3;  1SFN A;  1YQ8 A;  5ERL A;  5EQU A;  3VLB B;  1G9C A;  4CCM A;  4QDQ A;  2LTN A;  4DXR A;  1H30 A;  4UBH A;  3BKZ A;  2XLA A;  2WIN B;  4NRM A;  2VVE A;  2P3K A;  3DV8 A;  3H0O A;  1AL2 1;  2PHX A;  4KWL A;  4AI0 A;  1CVN A;  1FOD 2;  2NM1 A;  2RV9 A;  1K42 A;  2B9V A;  3C7F A;  3ZPO A;  5IWF A;  1DGR N;  2FDJ A;  3D6E A;  4AED B;  5F37 A;  4FPY A;  4FCA A;  4QD2 A;  2HWE 2;  2PXJ A;  2ZHK A;  4GAL A;  1JI6 A;  2P37 A;  4RQP A;  1SMV A;  1UMI A;  4A7K A;  2P17 A;  4ITC A;  2J42 A;  1PGW 1;  4YAR A;  4IV3 A;  1K12 A;  4ZKT B;  1V9U 2;  1S0G A;  4NIA A;  4AVT A;  2XVG A;  4NPM A;  2W39 A;  1Q8Q A;  4JC1 A;  5FYM A;  2Y0O A;  5FMC A;  1W99 A;  4MX3 A;  2ZEZ A;  1OSG A;  1S0J A;  2B5H A;  5F2W A;  1NT0 A;  2ZML A;  1LNS A;  2WZR 2;  3I2K A;  3AKT A;  3LEI A;  2WT2 A;  2WT0 A;  5M0T A;  3CNA A;  2ARC A;  5FPV A;  2WNU C;  1KEX A;  2H6B A;  3DL3 A;  3I2G A;  4COV A;  3I2O A;  2FHR A;  5FPA A;  3FLP A;  3WT3 A;  1UYZ A;  1JYT A;  3A0K A;  4EN0 A;  5FYH A;  1LEN A;  2VTF A;  1RVF 3;  2R32 A;  2VZS A;  3WY6 A;  1ULG A;  4ATF A;  5CFD B;  3BU7 A;  4AGG A;  5A3N A;  1RMU 3;  4XET A;  1EYB A;  2X29 A;  5HCB A;  2HWF 3;  3PLQ A;  4YZ2 A;  5KXC A;  2TEP A;  2WO2 A;  1U5X A;  3PU3 A;  3OSD A;  2XWB B;  3AP9 A;  3BTX A;  3RG0 A;  4FI9 A;  2DBI A;  4YW5 A;  5GKA C;  2Y6G A;  5F3G A;  4CDQ B;  1HRI 3;  3MIC A;  4FPK A;  5FQ0 B;  2PQS A;  4FFG A;  2XB6 C;  3QLQ A;  2PHW A;  4BXF A;  3O5S A;  3VB9 A;  3MHZ A;  4Y22 B;  2BGC A;  3ZXD A;  3BOP A;  2XBO 1;  5SV8 A;  5HCA A;  3AX4 A;  2QTW B;  2OPK A;  4LKF A;  4U2A A;  4Y20 B;  1AR9 1;  1OVS A;  3HWJ A;  1O5U A;  1WLT A;  1ZZB A;  3P1I A;  4XBL A;  5J98 B;  2IXC A;  4YZ5 A;  1SFP A;  1W8H A;  4Y4R A;  1MS5 A;  3KQR A;  2OUJ A;  1BEV 2;  1F31 A;  1MS4 A;  1F9K A;  2DUO A;  2E7T A;  2XJP A;  4GJY A;  4IV1 C;  3SEE A;  2EAL A;  1HLC A;  2QQN A;  4XIK A;  4DUW A;  1KRI A;  1UPS A;  1W8T A;  1TME 2;  2AUY A;  4J25 A;  4AE2 A;  3WD5 A;  3W59 A;  3I2I A;  2FDI A;  1EV1 1;  3AXD A;  5A7N A;  4CDW C;  4IE7 A;  2LAL A;  3LDK A;  3LSE A;  1YEW A;  4OUM A;  1OA3 A;  3JD7 2;  3KHC A;  3F2Z A;  1VBE 1;  2ZKL A;  4RHV 1;  1W05 A;  1CIW A;  3O1U A;  4BXS V;  1LHO A;  4ZS3 A;  3TOJ A;  4I30 A;  1RUC 2;  1AR8 1;  1JU4 A;  1LU1 A;  1NOV A;  3EJK A;  5KHH A;  1CN1 A;  4CCO A;  2VBB A;  3PUS A;  4XVH A;  3TYJ A;  2Q8E A;  4HPK A;  3N9P A;  5AC9 3;  4XJZ A;  4XZU G;  2WNO A;  5LBF A;  4NII A;  3GBF A;  2DU1 A;  3FHQ A;  3AKP A;  3SH3 A;  1MS1 A;  2VQA A;  2RS1 1;  2J1U A;  1S1A A;  1ZBE 3;  1LU2 A;  1SLT A;  1NCQ A;  2W5F A;  3ZKY A;  3JU9 A;  4NJ4 A;  4HVQ A;  3LEK A;  5GZG A;  2CGP A;  2FDF A;  1S2B A;  2ZGP A;  4IEX A;  1YIP A;  1CAW A;  2IVJ A;  3S7I A;  2P34 A;  3ITQ A;  1A8M A;  4DQA A;  2BPA 2;  3ACI A;  4LBL A;  4Q0S A;  1U5Y A;  1FT9 A;  4BHP A;  4WM7 A;  4HAN A;  3ELN A;  2ZHN A;  3AB0 A;  4NWW A;  5FP8 A;  1WBL A;  1VIW B;  3KV4 A;  5D2A A;  4BQ3 A;  3ZR5 A;  1VAV A;  4TSV A;  1QKQ A;  2CWM A;  5E16 A;  3QD6 A;  4RR3 C;  2WWU A;  2E32 A;  4AGV A;  2YXS A;  3AKS A;  3ETQ A;  1LHU A;  2CYF A;  1BXH A;  2UUR A;  4B29 A;  4DRV A;  4IND A;  2W9X A;  1PVC 2;  3FC0 A;  2WA3 A;  4MVT A;  5CU1 A;  1NE4 A;  3A4U A;  1NLQ A;  1WZX A;  2A70 A;  2B9U A;  2XON A;  1FI2 A;  5FLI A;  3ZYF A;  5FP3 A;  4Q4V 2;  5CKM A;  1XYO A;  2ZGQ A;  5GLV A;  4E4S A;  1W28 A;  3CDZ B;  4RGK A;  5J09 A;  2DVD A;  4Q0P A;  3TEW A;  1UKR A;  1ULE A;  1VRH 2;  2C0Z A;  4K9S A;  3KV5 A;  1LES A;  4TLG A;  1AX2 A;  2GC3 A;  2WAA A;  1PIV 2;  1WA6 X;  3AK0 A;  4FTE A;  3TN9 3;  1WCD J;  5FZ4 A;  4IER A;  4P5H A;  4YGC A;  1XU1 A;  5EP9 A;  1DGW X;  4Q5O A;  4LHL A;  2BBV A;  4LA2 A;  4L97 A;  1LOF C;  3ECQ A;  1TG7 A;  3IDC B;  2V4V A;  4G3Y C;  1RUF 1;  1WLC A;  3MPP G;  4NRO A;  4CPB A;  3H8O A;  1NCR A;  2ARX A;  2GC2 A;  3K75 B;  3ZM8 A;  1MS0 A;  1YXW A;  3FX3 A;  4XJW A;  1UZV A;  2VNR A;  2YBP A;  2A7A A;  1XE0 A;  4PHZ A;  5C8W A;  1GIC A;  4D3W A;  5IT6 A;  2HEW F;  4PLN A;  4XFG A;  4AFC A;  2GMP A;  1W90 A;  4LK6 A;  3ZFF B;  5H9Q A;  5CBL A;  2PYT A;  4CDU B;  5T54 A;  4Z92 B;  5BNO C;  1UYY A;  5FK8 A;  3QCW A;  4Y3O A;  2Y0I A;  2QDR A;  3B94 A;  3VBS C;  3ZN4 A;  5FMD A;  5JOY A;  5A70 A;  3H1W A;  4M01 A;  2X09 A;  3LB9 A;  4CEY B;  1F2N A;  4A2U A;  4LHN A;  4AI8 A;  1JN2 P;  2EXH A;  2RM2 3;  4B8E A;  1OKO A;  4CEW B;  4LE4 A;  4EYU A;  1YFX A;  1H1M A;  3ZIX A;  1CPN A;  4NIG A;  1F4H A;  1V00 A;  1W39 A;  5FZ9 A;  3O1M A;  2F6B A;  3RS6 A;  1RUO A;  1GZT A;  3GNE A;  2H0B A;  3GZE A;  4LHK A;  2MHF A;  4GD4 A;  4NRQ A;  1UY2 A;  2KM2 A;  3LAG A;  1H2M A;  1QOT A;  1C4R A;  3BTA A;  4XF9 A;  4PBP A;  1W04 A;  2FMD A;  4PDW A;  1TVG A;  3N4M A;  3HVD A;  4QX7 A;  3AKQ A;  4RL7 A;  1LB2 A;  1KDK A;  4XXA A;  1HDK A;  4GWJ A;  1GWM A;  2J7M A;  3ILF A;  2WO3 A;  1QH7 A;  1GP6 A;  3W5N A;  1OH4 A;  4KU8 A;  5JDB A;  2OQ7 A;  2WS9 2;  3ROU A;  3ACH A;  3S30 A;  4UW6 A;  2DUP A;  4D8M A;  1RIN A;  3H3Z A;  1M06 G;  2A3X A;  2WYF A;  4OYU A;  1B35 C;  4XQD A;  5A1L A;  5K7P A;  1W6Q A;  3D0J A;  5IK8 A;  1AR7 3;  3M3E A;  1RUE 3;  3AZZ A;  5KHK A;  4JGY C;  2VGD A;  3ZVX A;  4UW3 A;  2VW2 A;  3ME2 A;  1W6P B;  2QZ3 A;  2DVA A;  5L9V A;  2A5Z A;  1Q3E A;  1FOD 1;  2D3P A;  4H2A A;  3M3Q A;  3E5Q A;  4Q4W 2;  4DO0 A;  5BNP B;  2OS2 A;  5C8C A;  2XVL A;  3E97 A;  3OPW A;  5K4L A;  4FBF A;  1OLQ A;  4JAA A;  4YYO A;  1YQ2 A;  4MGK E;  5CIR A;  1PGS A;  1VE0 A;  4YVW B;  1AYM 1;  1ZBA 1;  1BJQ A;  1ZZ9 A;  2HWE 1;  3AMM A;  4AI1 A;  2GNM A;  5DN2 A;  5CFC C;  1MEC 3;  2W94 A;  2ZJC A;  4XW3 A;  5FZ0 A;  3T08 A;  1RUG 3;  1H2N A;  1I9R A;  1V9U 1;  2RMU 1;  1H2L A;  2YUE A;  3MGU A;  5D1I A;  3ZXE A;  3FZ3 A;  5EWS A;  3T0A A;  3T0D A;  4AXO A;  4CU7 A;  4RD7 A;  2ET7 A;  2ZX4 A;  3SEP A;  3ZKU A;  1HJG A;  3ZYI B;  3MIB A;  2XQX A;  1JYX A;  2WZR 1;  1OKQ A;  3WW1 A;  1RUH 2;  2JX9 A;  4I0A A;  4NR1 A;  1VBA 2;  3VBH A;  4NWV A;  4OI4 A;  3WEZ A;  1JZ7 A;  2BJS A;  4FAG A;  2JE8 A;  1JOB A;  5FZ7 A;  4IGO A;  3ZXG A;  3FWE A;  5FY5 A;  2RVA A;  1R09 3;  2GME A;  1WWY A;  3VDD B;  4BQ1 A;  3BIW E;  4HKW A;  1AUY A;  4EWE A;  2PHF A;  3LKJ A;  4BK5 A;  5A3P A;  5J3U A;  2VY0 A;  1NLS A;  2KD7 A;  3FLT A;  4N43 C;  3WXP A;  1BBT 3;  2H6C A;  3JUU A;  5LK7 B;  4XBN A;  3ETP A;  1DZQ A;  3OYW A;  3H8U A;  1UL9 A;  1D7P M;  3ZFG A;  5JUV A;  1RIT A;  4KG0 A;  3ZXL A;  4URT A;  4JDN A;  3ZYH A;  2K9Z A;  2XXZ A;  3NJZ A;  3ZN5 A;  1LHN A;  2UU8 A;  1G9D A;  1AX0 A;  1S0D A;  2XPJ A;  3WDT A;  4ZZ8 A;  2VAU A;  4YG6 A;  5ISL A;  1RUJ 1;  2VBP A;  2XJU A;  4C8D A;  1MQT A;  1CAU A;  3HPN A;  4RQP B;  4LUL A;  1R08 3;  2PMW B;  1J1T A;  4X8P A;  2E9Q A;  5E1R A;  4ZU5 A;  1H9P A;  4IV3 B;  4PQ9 A;  4CRQ A;  2C9A A;  2IUW A;  1CPM A;  3BIE A;  3B7M A;  4JTN A;  3ZSM A;  1TME 1;  2DTY A;  1WW5 A;  2WA4 A;  4B3N A;  3I3B A;  3D82 A;  4XF3 A;  5AVP A;  5BV6 A;  4P02 B;  2Q1Z B;  5I0T A;  1HX6 A;  3JD7 1;  5EHD A;  4FPO B;  5KWR A;  1UF2 C;  1A78 A;  4ARY A;  3ILN A;  1WUV A;  4UT5 A;  4BU2 A;  4LBJ A;  1RUC 1;  3I8T A;  1OBN A;  2OKX A;  2HEV F;  1LOD A;  2VCB A;  5HPO A;  1G9A A;  1PGL 2;  5LA0 A;  3POF A;  3N35 A;  3TRS B;  4LT5 A;  3SCH A;  3B9I A;  5J36 A;  1MZ6 A;  2R04 2;  2V09 A;  3JQW A;  4KQ7 A;  2IWG B;  2HWB 2;  4Q4Y 2;  1WA4 A;  1JXN A;  1QGL A;  3KF3 A;  4GB3 2;  4IEZ A;  5SV5 A;  3LOI A;  5ABJ A;  5JXH A;  1D0H A;  1WMD A;  4E9K A;  3C3V A;  1POV 1;  2NLR A;  3MUY 1;  5FP4 A;  3A21 A;  4OHZ A;  3DYM A;  2LS6 A;  2VUL A;  4KH9 A;  4IE4 A;  4OI1 A;  2ENR A;  2ZBJ A;  3AZY A;  5LBB A;  3VL8 A;  4XDO A;  1O5L A;  1TEI A;  1IS4 A;  2BRT A;  2VCM A;  1DU3 D;  3WQB A;  1GYK A;  4QPG C;  5LRR A;  1D4M 3;  4L99 A;  2XJT A;  3POI A;  3UJQ A;  4AHZ A;  2A3W A;  2BWC A;  1AR9 3;  1F5J A;  1NKG A;  2BWA A;  1H8T C;  5J48 A;  3ILR A;  3PUH A;  2GSY A;  4Z8B A;  3GAL A;  4XF1 A;  4W50 A;  1FPN 2;  4CU8 A;  1NZI A;  3KT7 A;  4OVE A;  1V6L A;  2YDE A;  4D7S A;  1DGW A;  5LZ6 A;  5IAV A;  5FPB A;  1PVC 1;  5JZG A;  3H8X A;  1S0F A;  5L7O A;  2P3I A;  3NKG A;  4ASM B;  2ZZQ A;  2F4P A;  1UOG A;  1ND3 C;  1IPS A;  1DDL A;  3GHN A;  3WNP A;  1UU6 A;  1LOC A;  2AYH A;  3ZX7 A;  1VBE 3;  1J3R A;  5FK7 A;  5LBC A;  2Q8C A;  2C4X A;  2W91 A;  4QPI A;  2IXJ A;  2JG9 C;  3NNF A;  1PIV 1;  1DQ6 A;  1Q56 A;  4HPK B;  1YYN A;  4CUB A;  1GFF 2;  4FSJ A;  3CHX A;  3UYJ A;  1R64 A;  4LO8 A;  2J1S A;  1A3K A;  2DCZ A;  1NYW A;  4ES8 A;  5ACA 2;  3BU0 A;  4RS5 A;  1R1Z A;  1QJY 2;  1JHN A;  1UMH A;  3TEZ A;  4DUX A;  1GZW A;  1NCQ B;  3I49 A;  2NZ9 A;  2IXK A;  2B4K A;  4NRP A;  3WX5 A;  4FOQ A;  3ACG A;  4QGN A;  2X5I C;  4BZ4 A;  4F7Z A;  1TNR A;  1GWL A;  3N7L A;  1VMJ A;  4MGS A;  1CAW B;  1ULO A;  3GF6 A;  1KS4 A;  2OZ6 A;  5FBJ A;  4YW3 A;  1AR6 2;  4YW2 A;  4QAW A;  4CP0 A;  2OZJ A;  4IUG A;  5FLH A;  1RIR A;  4FTS A;  2ZEX A;  4OHX A;  2WRA A;  4FPC A;  4J1X A;  2OW4 A;  2ZX2 A;  4WM7 B;  3LFM A;  5JMO A;  4NHX A;  1HRV 2;  2W0X A;  3OF1 A;  4LBN A;  2JDA A;  1SCS A;  4S2F A;  4WM8 A;  5FZD A;  5A7O A;  1RL3 A;  5ANN A;  3RSJ A;  5DZF A;  5C4W C;  2VMC A;  3CMG A;  1AXZ A;  3PVO A;  3THC A;  3BOD A;  3WOG A;  3I3Q A;  1SG3 A;  3BYW A;  1J3P A;  2D40 A;  2Q5T A;  3RI9 A;  5F3I A;  1MVQ A;  5LA9 A;  4OI0 A;  1LHV A;  4FOY A;  3HIF A;  3UKT A;  5JIA A;  5FO7 B;  1ND2 C;  3IPV A;  2BW8 A;  4HVR A;  4DB5 A;  1VBC 2;  2DF7 A;  4XAC A;  2RDR A;  4LLF A;  3OEB A;  1RUD 2;  2EXI A;  1NE6 A;  4Q1P A;  2WWS A;  5DDJ 2;  3U4S A;  4IW3 A;  3M7A A;  4LBQ D;  5GLZ A;  2OA2 A;  2WWJ A;  2W08 A;  3UES A;  4YFZ A;  2X53 S;  2E51 A;  5FZ6 A;  3GZA A;  4DZG A;  1JUI A;  3SHR A;  5CVR A;  4EJR A;  3CEW A;  1ASJ 2;  1W06 A;  2DCT A;  3T0B A;  2W87 A;  5K0U C;  1QJE A;  2ADD A;  2FMY A;  1Z7S 2;  2CGN A;  1UX6 A;  3WNK A;  2UWB A;  3PJQ A;  4R9A A;  1C8N A;  2WFF 3;  5FZI A;  4A6S A;  1NCR B;  5C3R A;  4K40 A;  5IVV A;  2OUH A;  4KWK A;  1C1F A;  4A7Y A;  3B69 A;  1CR7 A;  3O0X A;  2FZ2 A;  5A6Y A;  2ZGR A;  2VVD A;  2KA3 A;  5FBZ A;  3VD5 A;  1OPM A;  5C3S A;  4FOV A;  2OPW A;  3GCW A;  3KVA A;  1PK6 C;  3B5L B;  2R06 2;  1PVX A;  3HJR A;  2HKX A;  1UPI A;  4AR2 A;  2PLV 2;  3TBD A;  5LAS A;  3IT8 A;  4XFH A;  2ILM A;  4AGR A;  1TMF 2;  4N9H A;  1QNW A;  1HQW A;  5FY9 A;  5C5T A;  2DWR A;  1ULD A;  1C8M 3;  1YNA A;  2Q30 A;  4EZH A;  3DPR A;  3Q8B A;  3VKO A;  3VKN A;  4PLO A;  3EHK A;  3H7J A;  4I2O A;  1UOF A;  3LOB A;  4ARX A;  3BN6 A;  2R07 3;  1NQJ A;  1JYW A;  4XJ8 A;  3SCF A;  2AH2 A;  4FPF A;  1GKB A;  5GZD A;  4PIZ A;  4XHX A;  3FHA A;  2BVB A;  2JDU A;  3BVC A;  3LIH A;  3SCG A;  1RUH 1;  3H9A A;  2ATF A;  1NQD A;  2XVK A;  4QHO A;  1VBA 1;  3K46 A;  2YGM A;  4YLZ A;  4PDW B;  2NQY A;  3WG3 A;  2E7Q A;  2ZXQ A;  4Y5S A;  2VZU A;  3GZT B;  5IUQ A;  4RGA A;  4GH4 C;  1CJP A;  1TZO A;  5E6H A;  1W8N A;  1RB8 G;  1X82 A;  1QJF A;  1RTV A;  1WBF A;  2VPV A;  3NV1 A;  3PNA A;  5DAW A;  4Z2A A;  3GYD A;  3WLU A;  3B93 A;  3R05 A;  5I8T A;  2HH9 A;  1UZZ A;  4HK9 A;  3U37 A;  3I3M A;  3W20 A;  1N3O A;  2VW0 A;  1W6Q B;  2OXB A;  2JIG A;  4IEP A;  3SLI A;  2HWC 3;  2I74 A;  2YFZ A;  1FXZ A;  1HV0 A;  2BGP A;  3A23 A;  1YQ6 A;  4XQW A;  4ZXK A;  4RA0 A;  2HLE A;  2EXJ A;  2N7G A;  4WM8 C;  3VD3 A;  4B4Q A;  5C8C B;  2YPD A;  2C9K A;  2W92 A;  2XKO A;  4P00 B;  5JLV A;  3SH4 A;  4B7K A;  2AC1 A;  4KI5 M;  4N7I A;  4YZ4 A;  1O7F A;  5FO9 B;  5FWE A;  2WNU A;  4TZD A;  5FKB A;  3L2Y A;  1S0B A;  4UXA A;  1IG0 A;  3PUA A;  4TWT A;  5F5I A;  2P3J A;  1AYM 3;  1ZBA 3;  1YI9 A;  5GJ6 A;  3CQO A;  3FE5 A;  3RZG A;  2Z79 A;  2BU9 A;  4AEJ A;  3HNY M;  3ZXJ A;  2VJX A;  2WQ8 A;  1W9W A;  2RMU 3;  4CZS A;  4HXC A;  4CTE A;  3K2O A;  4DRR A;  3FHI B;  5A3U A;  2CY6 A;  4UWD A;  3SIS A;  1WMX A;  4D69 A;  5JCT A;  2VVF A;  2VOW A;  2HEY F;  3VBH B;  1OFN A;  1UYP A;  3T4H B;  2YBK A;  4XDP A;  3ORJ A;  1SBF A;  4YW6 A;  1OOP C;  3PUI A;  3RZZ A;  5FWJ A;  3M4F A;  3PJY A;  2E26 A;  5JSP A;  3WG2 A;  5KXE A;  4OZX A;  4U36 A;  1AJO A;  2A71 A;  4NHY A;  3LWC A;  4L8Q A;  5B4X A;  4ZXE A;  1UNB A;  5FLJ A;  2X05 A;  3RZL A;  4KBB A;  4BQ5 A;  1R1A 3;  3WNL A;  2O0O A;  3S5Q A;  2TUN A;  4LQR A;  2RDS A;  2WT1 A;  4KU7 A;  3KM5 A;  4FQ4 A;  1COV 3;  1W3V A;  4UBG A;  2QUO A;  4MG2 A;  1UOB A;  3O1V A;  1K5J A;  1GOH A;  1VBD 1;  1UX7 A;  1UCX A;  1DF0 A;  1VJ2 A;  2R04 1;  1OI6 A;  2HWB 1;  3OYW B;  1SLI A;  4JGZ C;  2JDY A;  2RR1 2;  2VE1 A;  3CF6 E;  4GB3 1;  3H42 B;  4GKX A;  4IV1 A;  2E53 A;  3ZFG B;  3BPZ A;  5BXX A;  3O0V A;  2JB8 A;  1JYC A;  1T6G C;  2Y6L A;  5F9T A;  4CDW A;  2Q0A A;  1G7Y A;  2VZP A;  1OPO A;  2YC0 A;  4G4F A;  4D94 A;  4WVW A;  1SEF A;  5DAP A;  5I8S A;  1MQT B;  5C5U A;  1QY4 A;  1CAU B;  4Q4X 3;  2JE7 A;  1RUJ 3;  2QQV A;  3ATG A;  3JXS A;  2XUE A;  4PF1 A;  4BWO A;  3WQ7 A;  3VBF A;  4ASK A;  1AYN 2;  4AG4 A;  4C0B A;  5L36 A;  2IXH A;  1IKP A;  2UY8 A;  3POB A;  1UXX X;  2VTX A;  4A3X A;  3NW4 A;  2ZX1 A;  4GMP 3;  4QPW A;  1XPW A;  3Q9O A;  3ZR6 A;  1XBF A;  2XJS A;  4OI2 A;  2Z42 A;  3AVR A;  3U10 A;  3WUD A;  1LR5 A;  5FR3 A;  3VHR A;  5FAX A;  2AGS A;  1SLC A;  2XR4 A;  1KJR A;  4YRD A;  3WNX A;  5GLU A;  5A7P A;  5ANQ A;  1SDW A;  3BB6 A;  4AL9 A;  3T2P A;  5L9R A;  4N53 C;  2JE9 A;  4XFI A;  2VC9 A;  3RQ0 A;  4EQV A;  2CL2 A;  1F15 A;  1JUH A;  1S2E A;  1W2A X;  3APB A;  2Q8O A;  3RVH A;  5LB6 A;  1HXS 2;  2RHP A;  2LUW A;  1ZVF A;  4K3U A;  3N7K A;  4FOW A;  1S0E A;  4QGM A;  5DPN A;  5ABJ B;  1V6K A;  5ACA 1;  2HWD 2;  5A6Q A;  2GH8 A;  1QJY 1;  1OA4 A;  1PZ8 A;  3PL0 A;  1PO2 3;  4R4X A;  2VZT A;  4NHL A;  4RR3 A;  4LMF A;  3PVN A;  4I3P A;  2RS5 1;  1H1A A;  5JI7 A;  5JOW A;  1DHK B;  1VBB 1;  4XQ4 A;  4Y33 A;  4N9I A;  3DCQ A;  1ACC A;  2KR2 A;  4X6R B;  2XUM A;  3NJV A;  1AR6 1;  3O0W A;  3VZL A;  2Q4S A;  1AHS A;  2BDR A;  3FUQ A;  1U5Z A;  1Y43 B;  4XUN A;  1K45 A;  1QJZ A;  5A1A A;  4HVO A;  1HRV 1;  1X7N A;  1Z78 A;  5DZE A;  4LKS A;  5DQ0 A;  4OUL A;  2P3Y A;  2RS3 2;  1PO1 3;  1QQP 3;  1GP4 A;  1GMM A;  4HG6 B;  5T5O A;  4EV0 A;  4QX2 A;  1BKZ A;  1E5H A;  2XML A;  2K46 A;  4Z07 A;  2ZOE B;  2R30 A;  4H55 A;  2VU9 A;  1LJ7 A;  3K3O A;  5JZG B;  4LBQ A;  1LOF A;  5L7O B;  4QMA A;  5FZL A;  3WP3 A;  1M4W A;  4XJU A;  3KWV A;  2PHU A;  1BQP A;  4HN0 A;  4EWA A;  3S5A A;  2ZAH A;  1VBC 1;  1MS3 A;  2VMD A;  2JDH A;  3LA2 A;  1RUD 1;  1RUI 2;  1YJL A;  3O1S A;  2ZMK A;  3NL1 A;  3GHM A;  1BZW A;  1GZ9 A;  2MEV 2;  3J7H A;  3LPF A;  4QPI B;  2CWS A;  1WGP A;  3MFC A;  4JHT A;  3MW4 A;  1EAH 3;  3Q8C A;  4H14 A;  2LRP A;  1Y4W A;  3GDB A;  5IVJ A;  4JRA A;  2WSV A;  2P4E A;  5FDB A;  1QJU 3;  3JBG 3;  1JOJ A;  3EBR A;  3OBT A;  1ASJ 1;  1L7Q A;  3USS A;  5BNO A;  4JVA A;  3QOP A;  4RS5 B;  1JZ5 A;  3MF6 A;  3POS A;  5GZF A;  3VBS A;  1GZW B;  4Q2F A;  1GUI A;  2YU1 A;  2DV9 A;  3CLP A;  2CHH A;  4NAM A;  1JTZ X;  1VRB A;  3K4A A;  4C90 A;  5F1R A;  3E6B A;  1UQX A;  4AFB A;  2ZAC A;  4S2G A;  1N1V A;  1A6C A;  1AXY A;  3C2U A;  5IJR A;  3G7D A;  3WF4 A;  2ID4 A;  2WC2 A;  1G86 A;  3D4K A;  1RHI 2;  1H4H A;  3ZFE C;  3U07 A;  3VBF C;  2ARB A;  4WM8 B;  2BYV E;  1UU4 A;  4CDX C;  4YGD A;  2QNK A;  3LEG A;  4G9S B;  4JDM A;  2ARE A;  4A4A A;  1TMF 1;  2XQR A;  3MV0 1;  1ZNP A;  1XXN A;  2R0H A;  5T3N A;  2OT7 A;  3OD4 A;  4COU A;  1K5M A;  4OCT A;  4IE6 A;  4P5Y A;  3IPV B;  3D8C A;  2ZGT A;  1C57 A;  1DQ0 A;  3RZH A;  2RJL A;  2J22 A;  2YMZ A;  2VUD A;  4BMB A;  1W9T A;  1B35 A;  4PI0 A;  3VGI A;  4NVP A;  5F2S A;  5FIX A;  4JGY A;  1PHM A;  4KMQ A;  3WSO A;  4URA A;  1IS5 A;  5FUN A;  2A73 B;  2VBD A;  2CU5 A;  5FPU A;  3W5M A;  5FPZ A;  2UY9 A;  4MXV A;  3E5U A;  3PTY A;  5HBA A;  3BPS A;  2E33 A;  2VR4 A;  4NUB A;  4XIO A;  4I02 A;  4L11 A;  5E89 A;  1CQ9 A;  2YC4 A;  1IHM A;  2YC2 A;  2EIC A;  1IZ3 A;  4BH9 A;  5EV7 A;  3I4I A;  3DGT A;  4Q0V A;  2WQ4 A;  2P6H A;  5CFC A;  3P3N A;  1CAX A;  4FPL A;  1DQ2 A;  1G9B A;  1QJX 1;  1SFY A;  2D5F A;  3HNB M;  4SLI A;  4E4Z A;  1O3Q A;  5HV4 A;  1D2Q A;  3T1L A;  4CCE A;  4EE2 A;  5D8A C;  1OQ1 A;  1RVF 2;  4JGZ B;  3VKL A;  5J96 B;  2MNG A;  1RMU 2;  2XOM A;  4P9L A;  3WP5 A;  2Y6J A;  4K1Y A;  1CAV A;  1HW5 A;  2D6L X;  2FCT A;  2HWF 2;  2PHT A;  3J8F 3;  3N9N A;  5HI0 A;  1SDD B;  4MH0 E;  2A6X A;  1V6M A;  3OD0 A;  2VW1 A;  3D0S A;  4QKF A;  1WCK A;  2VNO A;  3DKW A;  3WQ1 A;  4ISQ A;  4IQP A;  5F5A A;  1HRI 2;  1F8V A;  3MFA A;  3CJI C;  3OUH A;  4BCU A;  2P2K A;  1W0N A;  3ZYP A;  2ZMN A;  3DPR B;  4XTM A;  1H2K A;  4UW4 A;  5AFE A;  1PM7 A;  1L7R A;  5FOJ B;  2WN3 A;  1Y9G A;  5GAL A;  1MZF A;  2B42 B;  2Y64 A;  2BZD A;  4N43 A;  4HFS A;  5KHJ A;  1VR3 A;  5D21 A;  5LCW L;  1O3T A;  1NUK A;  2XDV A;  3S7E A;  4FFI A;  1UO9 A;  1OMI A;  1CZT A;  2VUC A;  3OPZ A;  3BUC A;  1OUX A;  5FY8 A;  3GM8 A;  3DXU A;  4R8H A;  2X10 A;  5L73 A;  5LEJ A;  4Q8L A;  2YB7 A;  3V0A A;  4YGB A;  3HD8 B;  5FOB B;  1W0O A;  3J7M A;  4YW4 A;  2G9G A;  2HBU A;  1EUT A;  3G6J B;  1X8M A;  3NAP C;  4N90 A;  3N36 A;  3WF3 A;  3UGH A;  3K51 A;  2X8K A;  1MZE A;  5KC6 A;  4CXY A;  5DZG A;  3KCX A;  1XSQ A;  4Y1Z A;  1O91 A;  4AZZ A;  3KQ4 B;  5FRA A;  4AFA A;  3K4D A;  4JX0 A;  2G19 A;  1S2K A;  2RR1 1;  3J7N A;  4A42 A;  1FMD 3;  1KDM A;  1SLA A;  1XE7 A;  1VAK A;  4COZ A;  5I0U A;  5AC9 2;  3UGF A;  4DXT A;  3H1Y A;  2WNU B;  3GBW A;  1ZBE 2;  1K5M C;  2WNV C;  5FYT A;  4A3Z A;  2RJ2 A;  5T5J A;  4HBN A;  2GC0 A;  5A33 A;  2ORX A;  3CBN A;  3PVE A;  1WD4 A;  1DZT A;  4XFF A;  3HN1 A;  4XJ9 A;  1GQH A;  2R0F A;  1URX A;  2JDM A;  1CX4 A;  2UYB A;  3LE0 A;  1GNH A;  1LGN A;  4GAZ A;  4LIU A;  5C6C A;  1WW6 A;  2Q1F A;  5IFP A;  1CX1 A;  1QF3 A;  4H3W A;  4FTB A;  5A7Q A;  3N9M A;  1BK0 A;  4GQ7 A;  3CIH A;  5LRS A;  1F5F A;  4XCA A;  5FYB A;  4WVV A;  5FJK A;  4RSU A;  2VM9 A;  4WZC A;  2WJS A;  3T1M A;  5FZB A;  1W2T A;  3OPT A;  3WNN A;  3WP6 A;  1BVV A;  2VG9 A;  2VL4 A;  4XC9 A;  4OMC A;  1QDO A;  2OII A;  1PX4 A;  1X8E A;  4BIO A;  1XNC A;  2B39 A;  2VTX J;  3IAQ A;  4QQL A;  2EID A;  2P1B A;  2XKP A;  3I7D A;  3AVS A;  3ES1 A;  1W2O A;  2D5H A;  2XHN A;  4NAO A;  4QPG A;  3VZN A;  5E88 A;  3MYX A;  1JOP A;  5FTT C;  4CP2 A;  4R9B A;  1H8T A;  4NO4 A;  1G9F A;  5I0D A;  3TEY A;  4LNV A;  2E6V A;  5CYY A;  1VBD 3;  1GNY A;  4Y26 A;  1SHW B;  2W2I A;  4IV1 B;  2HWD 1;  2ZCW A;  5LA1 A;  5LWB A;  4ZZ5 A;  5FP9 A;  3UV9 A;  5LA2 A;  3M8L A;  3TN9 2;  2JEC A;  3AKR A;  4COY A;  1QWR A;  4CDW B;  4B4P A;  1DQ5 A;  3GCX A;  1UXZ A;  3OOX A;  2I07 B;  4YVS C;  1ND3 A;  2C24 A;  1XE8 A;  4XZP A;  3OY8 A;  4AHW A;  2FDH A;  5FJH A;  3NVC A;  4AQS A;  1IQD C;  2EXK A;  3VBF B;  1ZX5 A;  4O9E A;  2O8Q A;  3H3U A;  4IEO A;  2RS3 1;  5F3E A;  2QQO A;  2JG9 A;  4MOA A;  3U4X A;  3KSC A;  5A3O A;  3R0R A;  4EN9 B;  2DYC A;  3IMN A;  3Q8A A;  1UKG A;  3LIG A;  1U0A A;  5JOX A;  2VME A;  3WHU A;  5IVE A;  4YG3 A;  3AP6 A;  4NOT A;  4R9D A;  3GJA A;  4YNI A;  1GR3 A;  1AL2 3;  4GA9 A;  3UKV A;  3VBU C;  3ZN6 A;  4AVS A;  3FN9 A;  1YHF A;  2HBT A;  4I3G A;  1UD1 A;  1UZ0 A;  2ZGK A;  5FZF A;  3VN4 A;  3ZSE A;  4OHY A;  1QXJ A;  1KIT A;  2JDN A;  2X5I A;  3FFQ A;  3NO8 A;  3OEA A;  4QU2 A;  1RUI 1;  2VZR A;  3SKV A;  1SAC A;  2GND A;  2QQJ A;  3THT A;  2XL9 A;  2ZGS A;  1DCS A;  2RM2 2;  1N47 A;  2EAA A;  3ZMN A;  4HET A;  4TYS A;  1BMV 2;  3H3L A;  4QKB A;  2JIC A;  1OD5 A;  1POV 0;  4NPL A;  1A8D A;  1DYP A;  1ZRI A;  3KV9 A;  1XYP A;  3VBR C;  4HOO A;  5C4W A;  1BEV 1;  4FP3 A;  4HN1 A;  2DVF A;  5FV3 A;  2ZX0 A;  3SIT A;  2C1F A;  3WVJ A;  1S55 A;  2V5Y A;  4GWI A;  4W4Z A;  2E7A A;  1ZZ6 A;  3KGZ A;  2D97 A;  4RR3 B;  2VZV A;  4XIL A;  2EIG A;  4ZS2 A;  2BP6 A;  1REE A;  4FXG B;  1YWK A;  3WW3 A;  4K8R B;  3AC0 A;  3VD7 A;  2RS5 3;  5JXG A;  4Y5Z 0;  1WCU A;  1IPJ A;  1LOE A;  1VBB 3;  4QHB A;  1ND2 A;  2TNF A;  2WN2 A;  5F6K A;  5GLW A;  3ZSJ A;  1OQE A;  1H6Y A;  1REF A;  3USU A;  1RHI 1;  4Q0U A;  3KT4 A;  4IEQ A;  4NID A;  2W52 A;  3IIA A;  1W8O A;  3R4D B;  3MO4 A;  3N7M A;  4RFT 0;  1JYN A;  1AR7 2;  1RUE 2;  2J1E A;  2QFE A;  3B00 A;  4F8A A;  2DDU A;  4FPH A;  5T52 A;  1YRZ A;  2GAL A;  4LO7 A;  4AAP A;  5GLT A;  1FX5 A;  3KGL A;  5C9A C;  1UIK A;  3IDB B;  3E5X A;  1ZZ8 A;  1DFQ A;  2IXI A;  2ZA9 A;  4W6X A;  4XAE A;  1KJL A;  1C5H A;  2VZO A;  5K0U A;  2Y8K A;  4LBQ B;  3QH7 A;  3TWI A;  2D98 A;  5JPM B;  1HB3 A;  2IZW A;  4LK7 A;  4CCC A;  2JB4 A;  2XH6 A;  3V56 A;  1LEC A;  1OLR A;  1Y7B A;  1MEC 2;  3KZ4 C;  3VD9 A;  3VZJ A;  3ZDS A;  2ZPX A;  3PHM A;  2VQU A;  4RFR B;  2XBO 3;  2IFW A;  1RUG 2;  1W6M A;  2QZ2 A;  2VQT A;  1ONA A;  4CCL A;  4KGG A;  2JG8 C;  5FMB A;  4CXX A;  5KXB A;  3AP5 A;  1W3X A;  1LCL A;  4NPR A;  5G04 L;  5I0S A;  1L7L A;  1PK6 A;  3A22 A;  5BNO B;  1XSR A;  2BER A;  1CD3 G;  2ZHM A;  2WO1 A;  3IWZ A;  4OMD A;  4TXW A;  4W6W A;  1I5Z A;  4ZON A;  5EPA A;  3VBS B;  3MI8 A;  4WZF A;  3A7Q A;  1RXF A;  5CG9 A;  4W8J A;  2GP3 A;  4JDO A;  2DU0 A;  1N1S A;  2W46 A;  3MV1 1;  4CVU A;  3EYP A;  4C1W A;  2WZP P;  3SKJ E;  1IOA A;  2A6V A;  1D4V B;  2EIE A;  1BYH A;  3AP7 A;  3QH6 A;  1R09 2;  3POE A;  1EV1 3;  4BQX A;  1APN A;  1J3Q A;  2Q8D A;  3SNM A;  1LOG A;  4Q4V 1;  5JSR A;  1RVF 1;  3OTF A;  4L9B A;  4IET A;  1HB1 A;  2WSU A;  1NG0 A;  4RHV 3;  1VRH 1;  5K9Y A;  2HWF 1;  5EJ3 A;  5A3T A;  4Q0Q A;  1AR8 3;  1BBT 2;  3DF0 A;  3O1T A;  5BUV A;  2XJR A;  1DGR A;  4Y1V A;  2QBX A;  3VKF C;  2JEN A;  1GWK A;  1L3J A;  4JQR A;  2OYZ A;  5JMC A;  4GH4 A;  2ERF A;  3POY A;  1AVB A;  2B7Y A;  2I2S A;  1RED A;  1K5M B;  3RJ2 X;  4E8C A;  3PTR B;  3BCW A;  1PMI A;  4E8D A;  4L2N A;  4AVV A;  4P14 A;  2RS1 3;  3AMQ A;  2RDN A;  5F6L B;  2D43 A;  4FPG A;  2QKD A;  1B35 B;  2ORZ A;  3HN3 A;  3NMB A;  5T55 A;  3ZIW A;  2VO5 A;  1CIY A;  1DZR A;  2G9Z A;  2C26 A;  1R08 2;  4HZF A;  4JGY B;  4CCK A;  4DS0 A;  1GLH A;  1Y9Q A;  2QQM A;  3M3O A;  4FXK B;  3FBY A;  3I2F A;  4GIQ A;  2VOX A;  3VZO A;  1PGW 2;  3HOB A;  4LBO A;  1O3S A;  1ZRC A;  4LBK A;  3ALQ A;  3I59 A;  1PZ9 A;  2VOV A;  1UYX A;  3IKW A;  3NNL A;  3OG2 A;  2D6P A;  2IFR A;  3AYD A;  3LDB A;  4V2W A;  4UFI A;  4X8N A;  4GUL A;  4YGE A;  1KQR A;  5H9R A;  2Y6H A;  1OFS A;  5CFC B;  1CAX B;  3CL1 A;  3OCP A;  4GJZ A;  5DMY A;  5FY4 A;  4K6B A;  1CES A;  3RZM A;  1QJX 3;  4ES9 A;  5EXO A;  3LDR A;  3RZK A;  2VMG A;  3NNG A;  1CAV B;  2ZGO A;  3DUI A;  4WVZ A;  2ZAA A;  5JXI A;  3VV1 A;  1G8W A;  3HR9 A;  4JV4 A;  4NN0 A;  4UOJ A;  4QDR A;  3O1O A;  4PIX A;  4BIS A;  1MAC A;  1QMJ A;  2DFC A;  4QB2 A;  1OOP A;  3AFK A;  4QHZ A;  4QKD A;  2OX0 A;  5FZC A;  4YM1 A;  2PA7 A;  3HQU A;  4UI9 L;  4B1M A;  4HLT A;  1QH6 A;  2A6Z A;  2WS9 1;  4GWN A;  4AED C;  2W68 A;  1RUF 3;  2J1R A;  4AHX A;  4DY3 A;  1V0A A;  4N43 B;  1W6O A;  1NX9 A;  3OBR A;  4DEQ A;  3IDE A;  4AFM A;  4LUK A;  1D4M 2;  1IKQ A;  3I97 A;  4LOS A;  2QQP A;  4JGZ A;  2DUQ A;  1AR9 2;  3I2H A;  5FZ1 A;  4Q4W 1;  3IBM A;  3MLL A;  2BQP A;  5FZ3 A;  1F4A A;  3V0A B;  3J7L A;  4GZ9 A;  2DCK A;  2VNG A;  4QT6 A;  3T2T A;  3ZYJ B;  2VZQ A;  2BGO A;  1NXD 1;  3KF5 A;  3IM0 A;  1CON A;  4QXB A;  1J83 A;  1I6X A;  4LOR A;  2VZ3 A;  1D0G A;  4XCB A;  1GBG A;  3LEM A;  4RN5 A;  1QOO A;  4DUV A;  5BYN A;  4JQT A;  1X50 A;  1VBE 2;  1VP6 A;  3UL2 A;  2QE3 A;  1HQN A;  4AVC A;  2DCY A;  1PMJ X;  1OT5 A;  3DEC A;  3LF7 A;  3HQX A;  3HT2 A;  3ZYR A;  1XB9 A;  5CFD C;  5JR2 A;  2GU9 A;  3B01 A;  2Z5W A;  1QHD A;  3TN9 1;  3O1R A;  4CE8 A;  4OZO A;  3A0N A;  3LQC A;  3OBZ A;  3WDW A;  5HCF A;  2E31 A;  4XFA A;  5DG2 A;  2B8M A;  2JIJ A;  1P8J A;  3WUC A;  4QU1 A;  2CAV A;  5B2G B;  3BTZ A;  4MGI E;  3V64 A;  5JAX A;  5F7U A;  2F17 A;  1UY3 A;  2Z69 A;  4N53 A;  4XDQ A;  3ES4 A;  5A33 B;  1QIQ A;  1GOF A;  1MS8 A;  2OQ6 A;  2DUR A;  4JTO A;  1O59 A;  2P5B A;  5EZW A;  4LTA A;  1DYK A;  5GZE A;  3O14 A;  1SLB A;  1PMH X;  1V6I A;  1X9T A;  2ZS6 B;  3LFI A;  2QQU A;  3NJY A;  4MHU A;  3VHO A;  3WG4 A;  1FV2 A;  4FQZ A;  1FOD 3;  2PEL A;  2WDB A;  3RMX A;  3FUO A;  2VOT A;  3HNM A;  1JYI A;  4IEW A;  1TNF A;  3WP4 A;  2JD9 A;  3B02 A;  4QDS A;  3HAG A;  1PNG A;  1YI7 A;  5FYY A;  4I0W B;  2O14 A;  2RM2 1;  2BTV C;  3MZH A;  2HWE 3;  1JBC A;  1EPW A;  4QPG B;  4V1P A;  4D6S A;  3LA3 A;  3I2D A;  1NY7 2;  3TB0 A;  1BMV 1;  1LUL A;  1H8T B;  1H4G A;  1Y9M A;  5JPN B;  1V9U 3;  4XUT A;  1WLD A;  3GZU C;  2F4L A;  2J1T A;  4ZPI A;  5LY1 A;  1VPH A;  5JXJ A;  1LTE A;  1E5I A;  2IC1 A;  3III A;  1GZC A;  5G05 L;  4BQ4 A;  1OHF A;  2ZTN A;  4OHV A;  1J59 A;  2RE9 A;  2WZR 3;  5T50 A;  3HBK A;  1LOB A;  1POQ A;  4S2H A;  5EJZ B;  1OD3 A;  1ND3 B;  1YC6 1;  4YWA A;  2JWP A;  4LOT A;  3OY8 B;  4CSW A;  2VXR A;  3S57 A;  3MDP A;  2WYS A;  2WFF 2;  4P9X A;  4AHY A;  3PIJ A;  1ZRE A;  4CP9 A;  3SMH A;  1PGL 1;  3LGR A;  5T5L A;  1AR7 1;  2JG9 B;  5FYC A;  2DVG A;  4OQ8 A;  5A3L A;  2QVS B;  4Q4Y 1;  3ZXA C;  5FPX A;  5I0R A;  5DXD A;  4EN6 B;  1RXG A;  2ZX3 A;  3ZN6 B;  1JZ8 A;  4M3C E;  5I91 A;  1KXG A;  1YUD A;  4P08 A;  1GP5 A;  3VZK A;  4YZ1 A;  3AP4 A;  1WMF A;  2X5I B;  2EVX A;  5GM0 A;  1JYV A;  5K8S A;  4B1L A;  4AQ6 A;  1C8M 2;  2D6M A;  1RUG 1;  2ETE A;  3FMG A;  3PIG A;  1CZV A;  3OJB A;  3ZFE A;  3AYE A;  1XC6 A;  5HCH A;  1N1T A;  3TEX A;  1GSL A;  2R07 2;  3U78 A;  4CDX A;  5F8P A;  5C4W B;  4LPL A;  4AVA A;  3AL6 A;  4LKD A;  3R4U A;  1FPN 1;  1BEV 3;  1RJ7 A;  2HYX A;  1DLL A;  2VMH A;  3VBO A;  2WLQ A;  5KR7 A;  2IXL A;  1TME 3;  2GAU A;  3WW4 A;  3O7O A;  3Q8F A;  5FKC A;  4BQY A;  4OLL A;  3RMY A;  2ARA A;  1YQ5 A;  1R09 1;  4IXL A;  1ND2 B;  4XFC A;  1T2X A;  2AR6 A;  3DYO A;  4FPJ A;  3JD7 3;  3P6B A;  3BAL A;  3UGG A;  3USU B;  5KC5 A;  1W0P A;  2AAC A;  3NNJ A;  5J7M A;  3M70 A;  4KBZ A;  3EQE A;  1RUC 3;  1BBT 1;  3D5O A;  3NQH A;  3Q8E A;  4KNC A;  2GN3 A;  1KFX L;  3FFZ A;  2HWC 2;  3I2J A;  1ZZ7 A;  3P3P A;  3J9S A;  2OVU A;  2YFU A;  3AM2 A;  1WW7 A;  2LRO A;  2W47 A;  1F35 A;  4LEJ A;  1JW6 A;  3MBW A;  1WLW A;  3ZFF C;  2RJK A;  3NV4 A;  4ET7 A;  4BB3 A;  2PFW A;  5K0U B;  2DTW A;  3I3E A;  1S0C A;  4CDU C;  2V4A A;  4WBB A;  2VEC A;  4V2V A;  1Q8O A;  1QXR A;  3PVB B;  1POV 3;  2BOJ A;  3AMH A;  3ZOI A;  5C3P A;  5FZM A;  1JZ6 A;  5TSW A;  3U75 A;  1AYM 2;  1ZBA 2;  4XUO A;  4CEY C;  1R08 1;  2HYK A;  5FFO C;  5D8A A;  1W6M B;  3INA A;  4A7Z A;  2XWJ B;  3NV2 A;  2GZW A;  4CEW C;  3AXE A;  3MW3 A;  3O12 A;  4HON A;  1VAL A;  4XMI A;  2RMU 2;  5H9P A;  3KV6 A;  1PK6 B;  1GQG A;  5FXZ A;  1YQC A;  4NMI A;  3IB3 A;  3MEP A;  4KWJ A;  3T3Y A;  4E4D X;  4DNY A;  4OHW A;  2AZ5 A;  3WDU A;  4IGQ A;  3IMM A;  3AMP A;  2FBE A;  4PJY A;  3CJI A;  3WF2 A;  2JXA A;  1AL0 G;  3HT1 A;  3KMH A;  4L92 A;  1PVC 3;  5EYY A;  4QM9 A;  1NLR A;  4F3J A;  3ZMO A;  3OBA A;  5IYY A;  1QOS A;  5DDJ 1;  1H9W A;  1R1A 2;  4Q4V 3;  1ENR A;  1LKN A;  5A7W A;  3CO2 A;  4ONU A;  4UW5 A;  4DPN A;  4E4H A;  1EPZ A;  1COV 2;  2WAO A;  4E2Q A;  4Q8K A;  1JZ2 A;  1VRH 3;  2VXJ A;  2D3S A;  2Y60 A;  2JDZ A;  1JHJ A;  1W8F A;  2FQP A;  5FXX A;  4YM3 A;  1HIX A;  1W03 A;  1PIV 3;  3FBM A;  2FCU A;  4HKO A;  4XTP A;  2EAK A;  4GH4 B;  5CAZ A;  2DCJ A;  1VAM A;  4BYY A;  1PM4 A;  1EY2 A;  5BNP C;  3EXU A;  3OUJ A;  3OGV A;  5JOZ A;  1Z7S 1;  4CCN A;  4FT8 A;  4M00 A;  2D3R A;  1ALY A;  4M4P A;  3NAP A;  4OUE A;  3WDY A;  5C3O A;  4FPE A;  4PBO A;  1QDC A;  3AL5 A;  1G6N A;  1X33 A;  2R49 A;  4YVW C;  5LK5 A;  3T2O A;  4IGP A;  4Q4X 2;  1D4M 1;  1RUJ 2;  4RYD A;  5FRE A;  1U12 A;  4FFH A;  5C33 A;  3C7E A;  2YG0 A;  4AK3 A;  3HQR A;  1ENS A;  1Y3T A;  3M3C A;  3DEM A;  3CZJ A;  5IVB A;  1HN0 A;  3CKH A;  2R06 1;  3I59 B;  4J1W A;  5BPX A;  5A3M A;  4Q29 A;  1E57 A;  5F32 A;  5CG8 A;  2PLV 1;  4BLI A;  2WLP A;  3VBO C;  3CJX A;  1XQN A;  4IE5 A;  2NMN A;  3RYK A;  4AVB A;  5CNA A;  3KD4 A;  1A34 A;  4MYE A;  3WCR A;  1OA2 A;  1C5I A;  2WNV A;  2WO7 A;  5C70 A;  5IK7 A;  1YLL A;  3S6P A;  4BIF A;  1ZA4 A;  4IL7 A;  2SBA A;  4ERO A;  2XJV A;  5FYU A;  3RRD A;  3AZW A;  3VDD C;  2P6C A;  3VHP A;  4JKK A;  3WV6 A;  4LIT A;  1OF3 A;  2BNO A;  1LHW A;  4GXL A;  1ZRF A;  2XJQ A;  3CZU A;  3RWK X;  3RI8 A;  1D2S A;  5HXM A;  4QX5 A;  1BLZ A;  2J1V A;  1US3 A;  5DAB A;  5IVF A;  5BY5 A;  3C7O A;  1N3Q A;  2XLF A;  2BNN A;  4BDV B;  1J1L A;  3OGS A;  5FYI A;  4OUS A;  5KXD A;  4O9G A;  2DFB A;  3J26 N;  1OOP B;  2GNB A;  1J58 A;  1PO2 2;  1NXM A;  3ZXK A;  4YW7 A;  3WG1 A;  1SLL A;  3DKQ A;  4D7Y A;  4LO5 B;  1WD3 A;  1NZC A;  2QQL A;  3VDC A;  2ZGM A;  4COW A;  1IQA A;  3P5B A;  3BI3 A;  1FNY A;  1NA1 A;  2WS9 3;  4K8F A;  3N7J A;  1X9P A;  1W6O B;  2VQ0 A;  3KVB A;  3MW2 A;  3MUZ 1;  1UW8 A;  3LPG A;  1N3P A;  4MXW A;  4RQP C;  1HN1 A;  5DG1 A;  1TQ5 A;  5DUW A;  4AI9 A;  1ULC A;  5H9S A;  4IV3 C;  5DAX A;  5FCC A;  5IVC A;  1HB4 A;  3ACF A;  3D3A A;  4M3C A;  4IEY A;  4Q4W 3;  1PO1 2;  1QQP 2;  2BUK A;  3AFG A;  4AW7 A;  3WHT A;  2YBS A;  3VD4 A;  1DIW A;  1W9S A;  4KWU A;  1W6N A;  4JCK A;  4UFH A;  3V0B A;  1O4T A;  3W58 A;  1T6B X;  2WL1 A;  4D6R A;  3NV3 A;  4YVS A;  4UYB A;  2PHR A;  2EIB A;  4K1Z A;  4YM0 A;  4YSF A;  4XYX A;  1W2N A;  4JZR A;  1NY7 1;  5EJ1 B;  3OUI A;  3J4U H;  4FAH A;  4TN7 A;  2ZGL A;  1DQ4 A;  4XF4 A;  1LOA A;  4LO6 B;  1C1L A;  4DMI A;  1EAH 2;  1XNK A;  4Q1R A;  5F39 A;  5A32 A;  5F5Q A;  2WII B;  4JHZ A;  2Q1M A;  1HB2 A;  1W8U A;  3IDA A;  2B45 X;  2XLG A;  3JCI A;  4FO9 A;  4QWN A;  1RUH 3;  4P9W A;  4QXK A;  1QJU 2;  5DUX A;  3JBG 2;  1VBA 3;  3RPQ A;  3VBU A;  4CP1 A;  1YIF A;  2J1A A;  5FO8 B;  3PUR A;  3WQ0 A;  2UYA A;  5HXV A;  4TTG A;  3POG A;  2FZ1 A;  2WFF 1;  2E63 A;  4N53 B;  3QBQ A;  3M3I A;  1AJK A;  4Y1X A;  3PU8 A;  5A6Z A;  3JB8 A;  5JR7 B;  3UET A;  2Y6F A;  1RYY A;  3VBR A;  2ADE A;  1EP0 A;  2JKB A;  5FUI A;  3K48 A;  5L9B A;  3ZLI A;  2Y6K A;  5F3C A;  1N1Y A;  4W6Y A;  1SZB A;  4BME A;  3VDA A;  3UNP A;  3RGB A;  4DEV A;  1V6J A;  4MET A;  4OFG A;  2QDN A;  2D6N A;  5DUU A;  1C8M 1;  2WQZ C;  5CIS A;  1RC6 A;  4FFF A;  3L9J T;  5FMO S;  1RUN A;  4N7U A;  3WW2 A;  3WNM A;  4CU6 A;  3AYC A;  1AYN 1;  2R07 1;  1ZRD A;  4WVM A;  3WF0 A;  1YFW A;  1XNA A;  2WKK A;  3AJZ A;  5AFB A;  4BOW A;  4ZHN A;  4CYD A;  2B46 X;  5IK4 A;  5IHR A;  1UZY A;  2WFP A;  3LSD A;  2DVB A;  2ET1 A;  4P9I A;  5C9A A;  4DFS A;  3C7G A;  2R16 A;  1H8V A;  2Y38 A;  5EIY B;  1XNT A; 
#chains in the Genus database with same CATH homology
 4LJH A;  1WCU A;  2KR2 A;  3F95 A;  1W90 A;  3ORJ A;  4LK6 A;  4YW6 A;  3ZYB A;  4BQ2 A;  1OH3 A;  1W8U A;  4LKF A;  1W9F A;  1UOJ A;  4AL9 A;  4YWA A;  2C24 A;  2JWP A;  1GWM A;  1HN0 A;  4BQ3 A;  2VXJ A;  2LRP A;  1L7L A;  2O14 A;  4BQ5 A;  4CP9 B;  4CP9 A;  1GWK A;  4YW7 A;  1OKO A;  1W8T A;  1W8W A;  2LRO A;  2WYF A;  3UT0 A;  4CPB A;  4LKE A;  1W8Z A;  2K46 A;  4LKD A;  4A6S A;  2Q1F A;  1WZX A;  3ZYF A;  1GWL A;  1V0A A;  4CPB D;  3ZYH A;  1WMX A;  4BQ4 A;  4LK7 A;  5D21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...