3F95A

Crystal structure of extra c-terminal domain (x) of exo-1,3/1,4-beta-glucanase (exop) from pseudoalteromonas sp. bb1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
175
Chain Sequence
SDSHPLFVRSLAKNMTWQLADTSTQKVLASGASATSGDKQSLLMQSVNLSYQEDGRGFNWRAQAALSLSYLEPTPLDSKFSTGYLELKMRIDKAPEQGANLQVMCSESNCLRDIDFSSFSQLMADKSWHTLAIPLHCQPITDALRITSQNLSLAIADVALTIKPSDDSISLTCAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-glucosidase
publication title Structure and activity of exo-1,3/1,4-beta-glucanase from marine bacterium Pseudoalteromonas sp. BB1 showing a novel C-terminal domain
pubmed doi rcsb
source organism Pseudoalteromonas sp.
total genus 39
structure length 175
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18559 Exop_C Galactose-binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3f95A00
4YW6A 4AL9A 1W8WA 4LK7A 4CP9B 1W8TA 1UOJA 4BQ4A 4LKEA 3UT0A 4YWAA 1WMXA 2WYFA 4A6SA 1GWMA 1V0AA 4LKDA 2C24A 1WZXA 1HN0A 2K46A 2O14A 5D21A 2JWPA 2LRPA 4BQ5A 1GWLA 2VXJA 4CPBD 4CP9A 3F95A 2Q1FA 1OKOA 3ZYBA 3ZYFA 1W8ZA 2KR2A 1L7LA 1W8UA 4YW7A 1OH3A 2LROA 3ZYHA 4BQ2A 1GWKA 1W90A 3ORJA 4LJHA 4LKFA 1W9FA 4LK6A 4BQ3A 4CPBA 1WCUA
chains in the Genus database with same CATH superfamily
5KXEA 5D1IA 1ENRA 1TME3 2TBVA 4PLNA 3KCCA 3WW2A 4KWKA 3WY6A 3J4UH 4V2VA 3U37A 1EPWA 1UN1A 3OY8B 3AKPA 1SMVA 2IXLA 1R1ZA 4LKDA 3B3QE 3TB0A 3A4UA 3AJYA 4EN0A 3O1MA 3NJXA 1CGPA 1RUC2 2RJ2A 2ZXQA 3OY8A 4P08A 2K0GA 4SLIA 4IV3B 4MHUA 4IV1C 1W8ZA 2QVSB 2H6BA 4XJZA 1H30A 1VAKA 1AR72 1V9U1 1GQPA 1VBC3 4IV3A 2WUHA 4K1ZA 4U36A 3WCSA 1NKGA 3FMGA 1FATA 3SC7X 2YV8A 4XBLA 5FZCA 2ZHKA 5JPMB 4Q4V1 2PFWA 4QDQA 3KS7A 2HWB1 1C57A 5FXWA 1O91A 2EIGA 2VZRA 1XYPA 4I3PA 1NZCA 5JIUA 1XQNA 4H2AA 4NRPA 4QPGB 5FREA 5IJRA 3JZVA 3ZKYA 3ZXEA 5LEKA 4N43B 5FRAA 2VZQA 3RMXA 3RJ2X 1BBT1 4QPGA 3BI3A 1J3PA 5FMDA 4N43A 1H1AA 2JDAA 4RHV1 3W9AA 2JDMA 4FPHA 1AR92 3PUAA 4YW2A 1VMHA 4EROA 2VUCA 1HB1A 2OXBA 5LCWL 2RDNA 4MH0E 1IG0A 4O61A 5FZMA 4PIXA 1JUIA 4BISA 2XLGA 1O5LA 4QQ2A 4MGKE 5KHIA 5K0UC 5F7UA 1LGCA 4LPLA 3I3EA 5A32B 5C6CA 1JYXA 3FHIB 3H1MA 4QX3A 2DF7A 1ZZ9A 2YY1A 1W8TA 3B00A 3CMGA 4DXTA 3MZHA 3LSDA 3BIWE 1F35A 4RHV3 5A32A 2E7AA 1CD3G 2W47A 3WNLA 1SBEA 4QPYA 1O3TA 1ZRIA 1AL0G 3ES4A 3IN9A 5T50A 1HLCA 4XUPA 4ZY9A 4PBPA 2Q4SA 2UURA 3CL1A 2W1QA 4ARXA 1Q5OA 4LO4B 4B1MA 1H8TB 1W0NA 4AK3A 4FPJA 1JN2P 3I3QA 3LEMA 4V2WA 3PU3A 1DZRA 1S0CA 3AMQA 1H8TA 4ATEA 5FYHA 3O14A 1DFQA 1OBNA 1ZZ7A 3LFIA 4IEOA 2QCSB 4LHKA 2DCKA 4IE7A 5FV3A 4XEZA 4MLOA 1QXPA 4K7JA 2RMU1 5FP9A 4XDOA 4CP1A 2XHKA 5FZDA 2BGCA 3E5QA 1ZA7A 4AVBA 2HJIA 4PLMA 1K45A 2WJSA 4HK8A 4DMIA 4E27A 3MUY1 1RUE1 3WDYA 1VBB1 2Z42A 3OD0A 2YMZA 4YZ4A 3TOJA 2NLRA 3NO8A 3PLQA 3U14A 3WINE 1OMIA 2RS51 2PLV2 3VBRB 5AFBA 1LOAA 2B7YA 2RS11 4LBQD 1C1LA 3ZXAC 3I3BA 3MF6A 5IK8A 3J8F3 3R4SA 2VMGA 3VBRA 3ZXDA 5IFTA 1I6XA 1VRH2 1UQXA 1GFF2 3M7AA 3N3HA 2GC3A 2DDUA 2O1QA 2A73B 5JOZA 5A1FA 2XBO2 1TMF3 1D0HA 4OMCA 4QGLA 2NZ9A 5I0RA 2A71A 1LECA 3QBQA 4FFIA 5KR7A 4TYSA 2P3IA 3O0VA 1VP6A 4UF0B 4L92A 4GMP1 2RS13 5T5OA 4EE2A 5EJZB 4V1PA 1BLZA 4EN8B 3OGGA 5FR3A 4PJYA 2YBPA 4UF0A 1LOCA 3QLQA 4BIOA 2VUJA 2B45X 4CUGA 3ACGA 5B4XA 1R64A 3FJSA 2Z5WA 4ATFA 3O0WA 5K8SA 4LR4A 3EBRA 1A8DA 3I59B 1GR3A 1YUDA 3K2OA 4CTEA 5I93A 3N9PA 1PMIA 1XNCA 1FOD1 1WMDA 2WABA 1TEIA 4CEWB 1NLQA 4HVQA 3O5SA 5EYXA 3I59A 5LW9A 5FIXA 4C91A 3VBSC 2MPFA 5FKBA 4LXLA 4GMP3 4S2HA 5FY8A 3HN1A 3ZXKA 2R0HA 4FAGA 4CEWA 1FMD1 3WF0A 1ZVFA 4ISQA 2BTVC 4C0BA 2GC1A 4CCCA 5JIAA 3AJZA 3FUQA 3UNPA 2WWUA 1K5MC 5C3SA 3WQ0A 4DQAA 4EWEA 2PHFA 1YI7A 4S2FA 1GP4A 4P9WA 4KG8A 2XGXA 3OG2A 3AYEA 3TNPB 3ZFEC 1PIV1 1Z7S1 4Q4W2 2VOTA 1OLQA 2D3PA 5FQ0B 4Z1VA 2Q1ZB 2VXRA 4P9YA 1RJ7A 1JYNA 3WNXA 2UWCA 1HB3A 2P17A 4XDPA 2XL9A 5FQ0A 4FOYA 4LMFA 3LOBA 4BZ4A 4YZ3A 5DABA 2WZPP 4NUBA 4BWOA 5FO9B 3HJRA 1KFXL 3OJBA 5A3MA 3WW1A 1VBD2 1QJX2 3H50A 1FX5A 4BPZA 1PIV3 2WIIB 3KQ4B 4RFRB 3WUCA 1W6PB 3AKSA 2EIDA 2OX0A 3VV1A 2WZ8A 4M3CB 1WW4A 4Q8KA 1YC61 5C9AB 2XPJA 1GKBA 2WT2A 3AZYA 1W6PA 2HEYF 2KXLA 3VDAA 4JV4A 3UKNA 2C0ZA 4M3CA 4ZU5A 2CGOA 4M01A 2Q1FA 3WNPA 5C9AA 1RUI1 3R05A 3GBFA 3BIEA 2AEYA 1ZBE3 4HN1A 4I0AA 2XB6C 3VKMA 2NM1A 1UOBA 4MXVA 4UWDA 5DQ0A 1CQ9A 1R1A1 3KMHA 1NUKA 3WG3A 4FPEA 4QXKA 4DB5A 1GZWB 2Y38A 4TXWA 2P3YA 2ZEZA 4FPGA 2BYVE 4YW5A 3TN92 4CPBA 4HKLA 2EXKA 2BDRA 5FMOL 4IEWA 3CEWA 2LM3A 4NRQA 1GZWA 4D8MA 1I5PA 3K51A 3AL5A 1K42A 1MQTC 4UFIA 3POEA 5FYBA 5KHGA 1RUI3 3ZSLA 1JZ8A 1ND3B 1UYZA 4BK4A 3O12A 4IL7A 4E4DX 4PCRA 2JG9C 2ADEA 4R9AA 1D2QA 1ND3A 4JCKA 2HWC2 1QJY1 4BXSV 4M3CF 1QGLA 3AVRA 3I2KA 5GZCA 2JXAA 4FPOB 1ULPA 2X53S 3LOIA 2KM2A 3Q9OA 4CU8A 4LHSA 4N90A 3ES1A 3NJVA 3GZEA 3R6SA 4AFAA 4Y4RA 4B4QA 4BQ3A 4JX0A 1K3IA 1I9RA 5AFEA 3BOPA 1IPJA 3HR9A 4YZ2A 5FY9A 2DBIA 2SLIA 4QQOA 4EWAA 1RXGA 1PO22 2V5DA 4QHOA 4IE0A 1N1SA 2VUDA 4ZXEA 3SH4A 5CFDC 1H2LA 2K2SA 1W6MB 5LASA 1LHVA 1QJY3 3CF6E 2W91A 4FP2A 3OPTA 2VVEA 2BERA 3WNNA 4AQ6A 1W6MA 3ZVXA 1HN1A 2D93A 4FPLA 3K4AA 3DV8A 1OA2A 3LFMA 4CDXB 4A7YA 4MHRA 1CAXB 1FAYA 1OH3A 2X8KA 4P9IA 5FO7B 4CDWB 1RVF2 4CDXA 1NY71 4MX3A 1AR83 4FAHA 1SCRA 3JU9A 3H9AA 1CAXA 4YG6A 4BM8A 4CDWA 1XSQA 5AVPA 1LKNA 4LK6A 3KF5A 3OB8A 4KL1A 4BLJA 1A8MA 1QU0A 5E89A 2H0VA 1W2NA 2NPIA 3RPQA 2A3XA 2BNOA 3WF3A 3WW4A 5LEJA 1H4HA 1H8VA 4WM7B 2FZ1A 1X33A 2ET7A 4KNCA 4Y22B 5J37A 1AR61 1C8M2 3POYA 5FJKA 3DGTA 4L97A 1XE8A 4WM7A 4Y22A 4XABA 3VHRA 4JRLA 2HWD1 5BXXA 4AHWA 4XFCA 4DOUA 5M0TA 4M0HA 5CG8A 5LBFA 5LY2A 3ORJA 1QJU2 4GULA 2WA3A 5LBEA 5L9RA 1TME2 1WWYA 3CJIB 3WF4A 5GLZA 4CP2A 2VQTA 3B9IA 1WCUA 2FCTA 1MR5A 2WAOA 1CZTA 3E6DA 3CJIA 4J1XA 4Q27A 1IKPA 2PN5A 3VZJA 1PVXA 2ZGKA 3AFGA 4YVWC 2C24A 3A0KA 1FV3A 1HN0A 1OOPB 2JG8C 2CGNA 3DKWA 5CKMA 3ZR5A 4Y24A 1RUJ1 2OIIA 1VBC2 4MXWB 2AUYA 4JDNA 1DZQA 1J83A 5CZKA 1OOPA 1IPKA 1OQ1A 4HLTA 1SPPB 2GNMA 5T5PA 4AGRA 5FAXA 3A7QA 4MXWA 3BALA 1QQP3 3JD71 2V72A 3M3QA 2WKKA 1SPPA 1V6KA 4K9SA 2W46A 4OQ8A 1PK6C 2HYKA 1NG0A 2B9VA 3MYXA 5L73A 4YFWA 3T0BA 1XXNA 1JI6A 2LW8A 2VTXJ 3D0SA 3LZZA 1G9FA 3PJQA 3PVOA 4WV8A 1CX4A 3B5LB 4M00A 1NE6A 1XYNA 4H14A 5FUIA 2E9QA 2Y33A 3FE5A 2QQUA 1UF2C 4XJ9A 2W92A 3JD73 1F31A 1BEV3 5A7WB 3ZYBA 3KGLA 1MVQA 5A3TA 1WBLA 3I97A 2E7TA 1HRV2 5A7WA 4HKOA 2GDFA 2BNNA 2G4IA 1AXYA 5F32A 2JE8A 1YLLA 4FBFA 4X6RB 2PHLA 1RHI3 3ME2A 4XZUG 2WQ4A 2VCCA 2ZGMA 3DUIA 4P9XA 2GMPA 5FP8A 3VBFC 5HCHA 1TZOA 1DBNA 4GH4B 1AR91 2PMWB 3PUIA 3U07A 3ZYRA 1W05A 1POV1 3HEIA 5DG2A 1X36A 1O5UA 1LEDA 5D21A 4NRMA 4GH4A 4CEYC 2JE7A 5FBJA 4BB3A 4CPBD 2JD4A 2JB4A 5G05L 3AYDA 5J48A 2VVDA 4BJ0A 1JYIA 4Q5OA 2D43A 4E4SA 2G1MA 1UU5A 4QDSA 3ZLIA 1KITA 2BWAA 2Q8CA 2YBSA 3PJYA 4ZHNA 4D7YA 3DKQA 1XPWA 4Y5TA 1W2UA 3I3DA 4MUVA 1SCSA 1HRI1 4A41A 1F5JA 4IEYA 3MFAA 1TNFA 2D7FA 1W8HA 5TSWA 2ZBJA 1D4VB 2QZ3A 2BFUS 2HKXA 1ODMA 3KT4A 2Q8OA 1S0FA 1QJFA 3LEGA 1HXS3 2I2SA 2NMOA 3AM2A 3OUJA 4AVAA 1J3RA 3AZXA 1LR5A 3A0NA 2JKXA 2IXKA 3J8F2 4INDA 4XFFA 3ZSEA 4BQXA 1OI6A 5A1LA 1JZ2A 1YO8A 3AB0A 1HRI3 4XUTA 4BQ2A 4YM2A 5LA9A 5F37A 5DZGA 2DV9A 4G4FA 4B1LA 1TMF2 1UZWA 1PGL2 4XOGA 2W5FA 3GDBA 2RV9A 2VL4A 3PHMA 1AYM1 4DUWA 3K4DA 3IIIA 2PLV1 2RS12 4GKYA 3WR0A 4DXRA 1QHDA 4Y1XA 1JYTA 2DVBA 4DFSA 3K77A 4CSWA 3NKGA 4XFAA 3C7EA 3H8XA 1ZYBA 1LNSA 4W8JA 3B69A 3N9QA 2VBBA 3DXTA 5GLWA 3VD3A 4QD2A 3C3VA 2GNDA 2XBO1 4WVZA 1AJKA 5FYYA 3I2OA 2FDHA 1JZ4A 4ZS2A 2LTNA 4ES8A 5JDBA 1AYM3 2WNOA 5FLJA 2BZDA 3L2YA 2R6QA 1U5IA 4LJHA 3LDBA 5A70A 1Y7BA 1OQDA 4PF5A 1IOAA 1GICA 2A6WA 1PO12 1XJAA 2JECA 1LHUA 4IGQA 3NV1A 1UZZA 3VBHB 2EA7A 2CHHA 2RDRA 4AVVA 2IUWA 2QQVA 4P5YA 1NAEA 4UFMA 1SLAA 1VMFA 3VBHA 4GQ7A 3TAYA 1JU4A 1XB9A 3MBWA 4WM8C 3JBG1 1BXHA 3NNLA 4GD4A 4P9LA 4CUAA 1LRHA 2F17A 3E97A 3GXUA 2FDJA 4NPLA 4XBQA 5FPBA 4S2DA 1CJPA 5EJ3A 2EAAA 5C4WC 1W6QB 4TLGA 3C7OA 5I91A 3S57A 2VG9A 5GZEA 3U10A 4Q4Y3 1XNAA 4IGPA 4XTMA 4MYEA 5J96B 1W6QA 2J7MA 2W0XA 3ZYGA 1UD1A 4IV1B 1H2KA 5I0TA 5EPAA 1IS3A 2GH8A 3JBG3 4BQ4A 5FZIA 1MZEA 3KHBA 1HIXA 5FZAA 3B9CA 1KS5A 1K12A 2BWCA 2QTWB 2YHJA 3OUIA 1ZBE2 2D6MA 2W9XA 1VBD1 3IDEA 1QJX1 4YPJA 2Y34A 2VUAA 4UFLA 5CISA 1MS3A 1OPMA 1ZX5A 3QH7A 4WZCA 2QFEA 4BMEA 5FTTC 3VD9A 1SLCA 4I01A 2OUHA 4XIOA 1TG7A 4PQQA 1W06A 1LHWA 3WCRA 1MACA 4G3YC 4Y3OA 3UESA 2VZ1A 5CBLA 2D6PA 1RUI2 4XUNA 1W8WA 4XC9A 2JDYA 3BKZA 1U12A 1FV2A 2OA2A 2XWBB 3MIBA 1EUUA 4DUXA 4L2NA 2OKXA 2OZJA 1Z0HA 5T52A 2W52A 5K0UB 3IT8A 3CU7A 1XNBA 1UKRA 1HV1A 5D8AC 3J7MA 2WR9A 4NAOA 4Z82A 5JOYA 1J1LA 1WCQA 4QPWA 4QKDA 4XJ8A 4XQWA 1UAIA 4YNIA 5K0UA 2VO5A 5HXMA 3W5MA 2C26A 2I07B 1RUOA 4GIQA 3ACFA 4K8FA 2HWE3 3AP7A 4MGZE 4AGVA 5FYSA 4E4HA 2ZHLA 5FO8B 1QJY2 2HWC1 4IEUA 2JE9A 5F5QA 3N7LA 2VQUA 3NNFA 5FYZA 1S2BA 1CZVA 4QAWA 1JOJA 1GP5A 1V6LA 2ZTNA 2E51A 2Z2SB 2YGMA 4I2OA 1W9YA 2JIJA 1KJRA 1J84A 3AP6A 3LSEA 1AR82 3M3EA 1PO21 2ORXA 1LODA 1UMHA 1UYPA 4XE9A 4IE6A 1UY2A 2HEVF 5BNOC 5FZEA 5L9VA 2PXJA 1VJ2A 1YNAA 5IATA 2ZX1A 1DGRA 3DECA 4NJ4A 3KB5A 1W39A 5FJHA 3AMHA 1DYOA 4JGYC 1D7PM 5FZ0A 3RZMA 1N1TA 4UBGA 4GB33 1JUHA 5FY5A 4AI2A 5KC6A 2CU5A 3ZYIB 1JBCA 4B7EA 4MGSA 2OVUA 1NY72 5FLHA 2WT0A 4LUMA 3GHMA 2IWGB 4MADA 1UW8A 3MDPA 3POWA 3RWNA 2AEZA 3FX3A 4XXAA 1YI9A 1NLSA 3ACHA 4CU6A 1MZFA 3NV4A 3AZWA 4LBJA 1G9BA 5IVFA 2NQYA 4JHZA 2HBTA 4B29A 2FMDA 4MVTA 4XTPA 4IETA 5DDJ3 5FYMA 2VQ0A 2KD7A 3PVEA 1CONA 2XHNA 2NP0A 4NHXA 2OYZA 1OLME 2ZPXA 4XZPA 5F5CA 1H1IA 1T6BX 4IESA 5FYCA 3ZIXA 5A33B 3KGZA 3MUZ1 3POJA 1C8M1 2D6OX 3GBGA 5BV6A 4OMDA 1NOVA 4GJYA 3D4KA 3KT1A 5F3IA 5JXIA 5A33A 4AFMA 1QEXA 2WRAA 2D40A 1XU2A 1S0EA 1YQ6A 3BPZA 1W8FA 4LUKA 2W68A 3BUCA 2DTWA 2WQZC 1QJU1 1YIPA 3VBSB 4XUOA 2XDVA 3HNYM 3ON7A 1TME1 3H3LA 1YFXA 2VVFA 1SG3A 2XJUA 2Y6JA 3WG4A 3DF0A 4WBBA 3ZN5A 4F8AA 3GJAA 3VBSA 1QQP2 2O8QA 3NJYA 1K5MB 2UWBA 2AC1A 4LHNA 3I3MA 2WFF1 4IW3A 1HQWA 4UW6A 4X6QB 4AAXA 1I1EA 2H6CA 3J7HA 4CCKA 1K5MA 2ZZJA 3E5XA 5FZ7A 3THCA 3ZFEB 4BQ1A 1GOHA 2UY8A 2PHXA 2YUEA 3WUDA 3LKJA 1P8JA 2G9FA 3AKRA 1GUIA 1XRUA 4AVCA 5FP4A 3FFZA 1WW5A 3ZFEA 4CCLA 5CG9A 1Y9MA 4ASMB 5I0SA 1FNZA 4IXLA 4YG3A 2Y8KA 3JD72 2VMFA 1YFYA 1BEV2 2WFF3 4CDUC 3D82A 3S0MA 3NJZA 5C8CC 1GWLA 3NQHA 5FP3A 3ZFGC 3W5NA 2JX9A 2HEWF 2VZ3A 4XF0A 5HXVA 3RZHA 5EXOA 1UCXA 4MG2A 5A3PA 1SDDB 1NQJA 1OF4A 1UYYA 1W03A 3PNAA 3VD5A 3KSCA 3ZX7A 4LLOA 1RHI2 3RZGA 4CXWA 1WW6A 2WNUC 2BEOA 2E7QA 2JIGA 2W39A 4BQWA 5CB7A 1COV3 1C1FA 2QQMA 4RN5A 3M2MA 1OT5A 5CVRA 1VBE2 1AJOA 3J26N 3AC0A 2K9ZA 1XC6A 1X9PA 2QZ2A 2VU9A 3I4IA 4HOOA 1WW7A 3PIJA 5FZ1A 4P9JA 3LD8A 4Q29A 1HRV1 1OC1A 4LHLA 1UU6A 3L2HA 4S2GA 4R9CA 3SLIA 1YHFA 2W94A 4Y4YA 1STMA 3UGHA 3OPZA 2J1VA 3T2QA 2ORZA 1Q3EA 3UJOA 2D6NA 2WQ8A 1MQTB 3ENRA 3OBTA 4XCBA 4BE3A 4JDMA 2XJTA 3RI8A 2FCUA 4FXGB 4NWWA 1BQPA 1TNRA 2XKOA 1OUSA 1LB2A 2VNGA 2ZGQA 1HRV3 1MQTA 4QXCA 1HB2A 5GM0A 3T08A 2JG9B 2MEV3 2B9UA 1HXS2 1MS5A 1V6IA 2D3SA 2QUOA 3POIA 4FPFA 2ZX3A 2NMNA 5DN2A 4NROA 3RGBA 4Y5Z0 2JG9A 1OUXA 3MLLA 3URFA 4Q0QA 5EQUA 4LBOA 1H9PA 1HRI2 5LWBA 1PHMA 2QJVA 4AI0A 5EWSA 2VW2A 1G86A 3B01A 1EY2A 5FYVA 2IVJA 1XU1A 3VZLA 1WKYA 5CFDB 2A1XA 2VTXA 3CQOA 2XONA 4IEXA 1AX2A 3FLTA 4QB1A 2XQRA 4A2UA 4QX5A 1ULDA 3D3AA 1G8WA 3FLPA 1KS4A 1ASJ1 1YXWA 2R062 4KBBA 2BNMA 4QM8A 5CFDA 3T30A 3U4SA 4CCMA 5F5IA 4P02B 3WP5A 2YFZA 5KWRA 1LOEA 3SEPA 3J8F1 3WHUA 4JHTA 2GSYA 3DYPA 3U78A 3VDBA 4YFZA 4YYOA 1YJKA 3FZ3A 4BXFA 1AZDA 4KBZA 2Y6HA 3S5AA 5DAWA 3WX5A 1W0OA 1OF3A 1TMF1 3OBAA 4Y33A 2DU1A 1PGL1 4PLOA 4EQVA 1A34A 2J1EA 4CP0A 5L19A 1ASJ3 1AYM2 1AX0A 3QCWA 4OUMA 2D6LX 1RUD3 4YM1A 3EQEA 1CAWB 4BA6A 2ZEXA 3VZOA 2WO1A 2YC4A 2DFCA 2YC0A 1ACCA 4BIFA 3AMPA 5C5TA 5DMYA 1TQ5A 2N7GA 5CKNA 1JYVA 4C90A 2B5HA 1CAWA 4P00B 1ZZ6A 5FZFA 1LENA 1CX1A 2R043 4B4RA 2VCAA 4GXLA 5FYIA 1AX1A 1FYUA 2R1BA 4QT6A 1OLRA 4JRAA 1LHNA 1OFNA 4BQYA 2BUKA 3BPSA 4UYBA 5FDBA 3AP9A 1PX4A 1MZ5A 1NZIA 3KZ4C 3NL1A 5FZLA 3UKVA 1LOGA 3GHNA 3Q8FA 4JQTA 1IPSA 2JB8A 3IAPA 2W95A 3VL8A 2WDBA 2WZEA 3BTAA 2PQSA 1U5YA 5A3WA 4JGZC 1UO9A 1PO11 5F9TA 4K1YA 4QHBA 4NIAA 2E33A 1MEC3 2ZMLA 3MHZA 1UMZA 5T55A 2VOWA 2AENA 4RD7A 2BP6A 4YW4A 3VL9A 3AXDA 4LOSA 4Q4Y2 1W9WA 3PUSA 4YVWB 2JG8B 5KBFA 5J98B 1JS9A 3JBG2 5JR7B 2Y6KA 4YVWA 2Q5TA 2JG8A 4LQRA 4XHXA 4HANA 1ZRCA 1PO13 4HZFA 1AYN2 1LGNA 4QX1A 1ENXA 1US2A 2R16A 1VAVA 2UYBA 4JQRA 2XLAA 1PK6B 3N7JA 4K8RB 4NAMA 5A7NA 3O1TA 1L7LA 2P4EA 3MEPA 5EV7A 4JKLA 1PK6A 2JDKA 1GLHA 2JENA 3IDAA 3KCXA 3GJBA 4J1WA 1C5HA 2WBKA 3Q8AA 5LA2A 1LOFC 1PGSA 3PDQA 5F1RA 4R52A 2ENRA 1UXZA 3OGRA 1ZBE1 4RA0A 4N9HA 1IS4A 3FL7A 1FNYA 3GZAA 4QU1A 4O9GA 5JI7A 1X82A 4EN9B 4NVPA 3T2TA 3P5BA 2QQNA 4YWAA 2XH6A 2YZ4A 1U5ZA 2Q30A 2GMMA 3WDVA 1DQ0A 2XJQA 4OYUA 5CEHA 1LJ7A 4KGQA 1QIQA 5JSRA 2ID4A 2YPDA 3PL0A 4EYUA 1PNGA 4QKBA 3VDDC 1AXZA 4XACA 3VBFB 5IFPA 1W9SA 5ACA1 2A6VA 1RUF2 2HWE2 3OUHA 1BVVA 1DHKB 1DLLA 2ZMKA 2XUEA 3OD4A 2LS6A 4I3GA 5T5JA 5DUWA 1NX9A 2QQOA 4AZZA 4W50A 1EAH3 3VBFA 4CEYB 3VHPA 4LO6B 1OH4A 4DO0A 1WCSA 1V6MA 3J7LA 5JXJA 2VMEA 2R072 3SKJE 4NIGA 4GWIA 4CEYA 4Q1PA 4AI9A 5FPLA 3WVJA 3ITQA 1QXRA 5FYUA 3FFQA 2XKPA 3NRUA 5ACA3 5JXGA 2GC2A 4PIYA 4QB2A 4FSJA 1GZ9A 4FCAA 3ZKUA 1I5ZA 4JZRA 3QOPA 5FMOS 4YW1A 3SH5A 3THTA 1EV13 3NNGA 2WAAA 1W8UA 2CNAA 1R083 3M8LA 4COUA 4OHZA 5FZ4A 5LZ6A 3H1YA 3KD4A 4AAPA 4K40A 4C0HA 4GB32 1ZZ8A 4H55A 2EAKA 5F2SA 4FPYA 3SITA 1IQDC 1UY1A 1AR81 2PQQA 3ELNA 2RM23 1WLWA 2V09A 4H3WA 4N53C 1W3XA 2G9ZA 3ACIA 3OOXA 4I0BA 1FT9A 4Y1ZA 3W58A 2P1BA 3PURA 3VKLA 1A6CA 2XR4A 4UFKA 1OKOA 2VJXA 4LBLA 1J1TA 5DDJ2 3VZMA 2GC0A 4ZPIA 2VY0A 1CIYA 4WVMB 1UOFA 2W1UA 1POQA 3ZSKA 1SFYA 5AVAA 2WNVC 2B39A 5DXDA 4TN7A 4NIHA 1KGYA 1GBGA 4MSVA 4WVMA 3WLUA 1G9AA 1O4TA 2Y0IA 1PVC3 4ZONA 4E9KA 1NA1C 3RYKA 5FXVA 2UY9A 1N3OA 3PVBB 4CP9B 5HCBA 3I49A 5C71A 3I2GA 2XVGA 4XBNA 1CAVB 5A6ZA 2BBVA 2Q1MA 2DCTA 2RR13 1GNZA 3SXWA 4CP9A 2AR6A 4SBVA 2J1UA 5FK7A 4HK9A 1W6NB 5GKAC 1CAVA 3SHRA 2WSUA 1W2TA 3LPGA 1X50A 4RGGA 4XMIA 2KR2A 3N9MA 4ASKA 1DP0A 4XILA 1REEA 2ZEWA 2V4AA 1APNA 1W6NA 2PAMA 4CCOA 2VZSA 5KC5A 3RRDA 3AYAA 4Q0SA 4IEVA 4LLFA 2RDQA 1D4M3 3AMNA 4WM8B 2DCJA 2OUJA 3WD5A 4D6RA 1WD3A 4YW6A 4RQPC 1VR3A 1SDWA 1PZ9A 4DRRA 1QQP1 2WFF2 4WM8A 2ZGTA 3RQ0A 1GQGA 2DU0A 2GZWA 2QNKA 2QQLA 2VCBA 2VZTA 5LRRA 1V0AA 1QOOA 5C4WB 3O1UA 1BKZA 4DY3A 3DXUA 1ND2C 5JSPA 4DXSA 2JDHA 2RE9A 5C4WA 4Z2WA 4Q4X3 3I54A 4ZXKA 5E1RA 4QX0A 5DUXA 4NR1A 1MS9A 2FBEA 3B93A 5FPZA 3M4FA 4Y1UA 4ASLA 1COV2 2WLQA 1W8NA 4IDZA 3ZSJA 1BEV1 3BTYA 3BYWA 3HBZA 5JVVA 1ENQA 3D0JA 4R8HA 2Y6FA 3K3OA 1T6GC 1JYCA 3MW2A 1JZ5A 5GZGA 3UL2A 1JZ7A 2KA3A 4K20A 1H6YA 1HKDA 3PVNA 1UWWA 4WZFA 1W3VA 1BJQA 3JB4C 4OQ9A 4F3JA 1RHI1 2OS2A 1NCQB 5IT6A 4LEJA 3GBWA 3OEBA 1AL22 1F5FA 5A1AA 3IM0A 2DYCA 2PHDA 4QDRA 2RS33 5LRSA 3WF2A 4LIVA 4DY5A 1NCQA 4GMP0 3ABZA 1VBE1 5C5UA 2A75A 3RNSA 4JVAA 5FPUA 1OPOA 1XOYA 2MEV2 2JDZA 4AHYA 4YW3A 1WLCA 2VOVA 1LHOA 1MS0A 1SHWB 2PAEA 3NMBA 4QU2A 4QWNA 5D8AB 1F4AA 4Q0UA 5FUNA 1S2EA 5FZOB 1YEWA 3AZZA 2IXCA 4H7MA 1EUTA 4H7LA 5D8AA 1VBE3 3H8OA 2OT7A 4LULA 3KVBA 3ZO0B 1NT0A 1BHGA 1SACA 5DZEA 5FZOA 1O3QA 5DAXA 3S7EA 2E32A 3ZMNA 1ZA4A 3GZUC 5K4LA 5FZGA 1H2MA 1Q43A 1YFUA 1HXS1 1SBDA 2OQ7A 2PHRA 3PUHA 2VOXA 2UYAA 1ENSA 5IVBA 5IVVA 1KEXA 3CHXA 5GLUA 3WQ7A 2OZ6A 3WDXA 2VNRA 3U4XA 3T3YA 2AACA 5C3PA 1W6OB 3VHOA 1URXA 2HYXA 4EV0A 1YIFA 2JJ6A 4AF9A 4HONA 5C8WA 5JZGC 2CAVA 3LQCA 5DUUA 1W6OA 4HL0A 4IGOA 1ASJ2 4YGDA 2R061 5BNOB 2DUOA 1RUD2 3ILRA 5I8SA 3EJKA 5AC91 3OF1A 2BQPA 3NAPC 4JGYB 2XJVA 4MOAA 5BNOA 2Y60A 3K75B 4QKFA 3U0ZA 5IW0A 4OI4A 3JUUA 1N3PA 2R042 4JGYA 4JTNA 4KI5M 1LOBA 1V6OA 1VIWB 1W9FA 3WT3A 1OSGA 4DNYA 2FDIA 3HT1A 1JH5A 2R063 4FVVA 3DYMA 1AVBA 1ZBA3 2EXHA 4QGNA 4QPIC 4YM3A 1CPNA 4LITA 5AC93 4DEVA 5BNPC 3HD8B 1JHJA 1YRZA 4D6QA 4UI9L 4F83A 3TEYA 3VD7A 3T09A 1MEC2 4LO5B 4OZOA 2J1RA 3F95A 4MO3M 1UNBA 3RYPA 2JICA 4QXHA 2TNFA 2XJPA 3HOBA 4XFBA 4A6OA 4OUSA 3ZYHA 4AG4A 1RIRA 2W1WA 2ZZQA 4RL7A 2QQJA 4JDOA 1CAUB 3D5OA 3FBYA 5JXHA 5HV0A 5A7OA 2P37A 3GCWA 3FBMA 3IMNA 3V56A 4CDXC 3C2UA 1CAUA 2B8MA 2VMIA 1OQEA 2V4VA 2D3RA 3OYWB 3C7GA 1DGRN 3RWKX 5ISLA 3N4MA 3MW3A 1L7RA 3OYWA 1E5IA 4Q4Y1 1VPHA 3GGLA 3RJRA 3FHQA 4AWDA 2D5HA 3K48A 3N9LA 5FPAA 3ZFFC 1PM7A 1S55A 1ULFA 1S0DA 4PHZA 5A7PA 2VOKA 4CXXA 1LAJA 1OD5A 1YQ8A 1Y9QA 5A3UA 1B35C 3O1OA 4D7SA 5HBAA 5IVJA 5BNQA 1UMIA 1V6NA 4XAAA 5HCAA 2WO3A 2VAUA 1LU1A 4LTAA 4CDUB 1AYN1 5DAPA 3UETA 1DQ1A 4QQLA 3V65A 5C8CB 5LK7B 3FC0A 1H0BA 3ZFGB 2ZGOA 1VBA3 1YFWA 2BRTA 3AL6A 2IFWA 4PI0A 4CDUA 5SV5A 2BJSA 3WG1A 3WDTA 5C8CA 2W2IA 5FZKA 3ZFGA 3I2HA 4DRVA 2PHUA 3BVCA 3S30A 1US3A 4QMAA 4O65A 4IV1A 1O6UA 3FWEA 3SCHA 2WNUB 3H7JA 4MV2A 2J1SA 4AI3A 2VMHA 1QH7A 3W20A 4BK5A 1RUH1 1YQ5A 2B4KA 1AYN3 1S0BA 2HH9A 4FXKB 2QBXA 2WNUA 5LK5A 1IHMA 3WQBA 4CU9A 1EAH2 1KXGA 2WINB 1G9DA 3P3PA 3POFA 5FFOC 2UWAA 1H9WA 2R0FA 1S0GA 2WA4A 2BW8A 5EHDA 1UY4A 5FUPA 4NE9A 3ILNA 1CWPA 4A45A 5APAA 4Z07A 2XLFA 4I02A 3ZXJA 3DPRC 2IFRA 4HFSA 4LK7A 3ZYPA 4UW5A 1YYNA 5ACA2 4GAZA 1RUH3 3BGAA 4BOWA 2A5ZA 1RUF1 2WT1A 2HWE1 3UV9A 4JTOA 3MIFA 5A3OA 4PIZA 5A3NA 5LBCA 1AF9A 2ZHMA 3IAQA 1EV12 2BOJA 2GALA 2WC2A 4YVSC 1KFUL 5F2WA 1R082 4B7KA 3USSA 1SLIA 2R071 3ZYFA 3MIHA 4FFHA 1QXJA 4E8CA 3AK0A 2VW0A 2F6BA 1RUG2 1LEMA 2ZEYA 1TE1B 1DYKA 4IEQA 3ZM8A 3ACLA 2DBNA 5FZ3A 1WMFA 1RUF3 3PMSA 1Y3TA 1RMU3 3MV11 5IYYA 2RM22 1TVGA 3M3IA 1JOPA 5JCTA 2CWMA 1O8SA 3UKTA 2R073 2P34A 3P1IA 4AEMA 1DLCA 2ZCWA 2YYOA 1WBFA 3CIHA 2BPA2 1LGBA 1DCSA 2YG0A 3HVDA 3PU8A 3WZ1A 2YGLA 2ES3A 4W65A 4AQ2A 4GB31 2VULA 5DPNA 4RR3C 3OGJA 3WNMA 1PX3A 2VW1A 1MS1A 3EYPA 1NCRC 1JW6A 4UW3A 4AFDA 4TTGA 1W90A 5FMCA 5H9RA 4IERA 2QQKA 5BPXA 1PVC2 2J1TA 4LIUA 4META 5FKCA 3NSTA 2BOIA 2C4XA 2OPWA 3Q8CA 3NNMA 1W0PA 5DDJ1 1OVPA 3MFCA 2RR12 3GALA 3U1XA 3S7IA 2WO2A 4GWMA 3T2OA 1ZM1A 1N1YA 3WDWA 1RYYA 3ZSMA 4KWLA 5FP7A 4AEKA 1MPXA 1JU3A 1H2NA 3K3NA 4LOTA 3SCGA 3TNQA 4HT1T 5BYNA 1HQLA 4CUCA 1POV0 5EZWA 1JMUB 4A3ZA 2BV4A 4GJZA 1JTZX 4BCUA 3T4VA 1PZ8A 1CR7A 1D4M2 1ULEA 4I09A 3HQRA 3VKNA 1F15A 3SMHA 4BMBA 4MGYE 4AOCA 1C28A 4JGZB 2JDNA 3VKFC 4PT6A 3CJXA 3ZPYA 3ASIA 4JGZA 5IK5A 2GNBA 3MIEA 1PGW2 1RTVA 5FWJA 1FXZA 5JR2A 3LAGA 2A6ZA 3LE0A 5L9BA 3VBUC 4Q4X2 3D6EA 4D69A 1PMHX 4MZUA 3V64A 5JSOA 4QXBA 3MGUA 2VC9A 1PMJX 3H42B 1QJZA 4CCEA 4Z2AA 1J3QA 1NXMA 3HPNA 3E6BA 4JKKA 4OI2A 5J36A 4OCTA 4UW4A 4XF1A 5FY7A 4AHXA 3DL3A 4JKMA 4OHYA 3H1WA 1O4YA 1QDOA 4CU7A 3VBOC 2Y26A 2ZACA 4OHWA 3WV6A 1Z78A 2X5IC 4A7ZA 2ZMNA 3I2FA 1GNYA 4ISRA 4UT5A 2C9KA 4D7TA 3CKHA 3ZPOA 2P3JA 5BNNC 1COV1 3AKQA 2WZR3 2RS32 3X29B 4Z92B 1BVP1 4IEPA 1OLMA 4A42A 4IE5A 4ZU7A 2TUNA 4TLFA 2ZOEB 3TYJA 1LOFA 3IMMA 3T1LA 5HI0A 3RSJA 3C7HA 4RS5C 3ZOIA 4ITCA 1X9TA 4OZXA 2FCVA 1W99A 3W59A 1UIKA 4JAAA 1UZ0A 1PM4A 1W9TA 4W6XA 2ARAA 2HWF3 4EWDA 1Y4WA 1BMV2 1M4WA 1AL21 3IDCB 4XQDA 3FLRA 4U2AA 1QKQA 2JKBA 3AP4A 2DVDA 3I2JA 5KHJA 1K5JA 1UZYA 3UGGA 3MPPG 3VDDB 2FZ2A 2AH2A 1OA4A 2X05A 4XHBA 2H0BA 3I2IA 2WYFA 2RDSA 4XVHA 4E4ZA 3JQWA 5FXXA 1VAMA 3SNMA 3VDDA 5A6YA 2GAUA 4PQ9A 5CU1A 2E31A 2EIBA 3OCPA 2MEV1 4XCAA 4CZSA 5F6KA 5ABJC 1QOSA 2YROA 3LIHA 2PTMA 2GU9A 4XURA 1KD7A 2O8OA 1AL23 1J59A 3EMRA 3WW3A 1KJLA 1HX6A 4ET7A 4YZ1A 4AHZA 2X09A 1N47A 4JC1A 4W6YA 3T2PA 3HAGA 4NPMA 2XG3A 5CKQA 4CCJA 1DF0A 1OD3A 4AVSA 3RZKA 1UZVA 2AREA 1V9U3 1OA3A 2ZGPA 3ZN4A 5JMCA 2XXZA 3BU7A 3DCQA 1N3QA 2P5BA 1HB4A 2WN3A 5FWEA 3T0DA 4Q4V3 2DURA 4LBNA 1XE0A 2HWB3 2D6KA 3TEWA 4QGMA 3WDUA 4PDWC 3IDBB 3RI9A 4D0QA 5B2GB 4Y5SA 2W08A 1FI2A 4XUQA 2I74A 4XIKA 5B4NA 4NHLA 4N53B 2C5DA 3LWCA 2E63A 4IEZA 5GALA 2SBAA 1RJ8A 4KWUA 1ZBA2 5CIRA 1RUD1 3BODA 4HETA 5AC92 1BBT3 1S0IA 3DN7A 4N53A 1S2KA 2YB7A 3T0AA 2JD9A 3N35A 1BK1A 4AEDC 1DIWA 4CCDA 1DQ5A 3UT0A 2WNVB 2ZGSA 3DYOA 4QX2A 3AZVA 2RVAA 2R041 1KRIA 1YQ2A 1ONAA 1HDKA 1R092 1ULGA 2CTVA 3S6PA 3WEZA 1O3SA 2WNVA 4TZDA 1CIWA 2BU9A 3POGA 1BCXA 1NA1B 1WA6X 4FPCA 2D98A 1RINA 2ZKLA 2VBDA 4EJRA 1DG6A 3OBRA 1NA1A 4ZZ5A 2W3JA 4NO4A 2R1DA 2WS91 3MW4A 2VNVA 4FOVA 4OI1A 1V70A 3HT2A 2ETEA 1MEC1 2WN2A 2WSVA 3A22A 3A21A 3LEKA 3QD6A 4PI2A 4CDQC 1BZWA 2VH9A 3NW4A 2EXJA 3ZXGA 2XWJB 2ZABA 3L9JT 3RVHA 1U0AA 1OURA 1F4HA 1QY4A 3N36A 5FXZA 4AR2A 2I45A 4CVUA 4LBKA 4ZKTB 2ZA9A 1RL3A 4Q1RA 1UY0A 2WS93 2QQIA 2B46X 4RQPB 2VGDA 4GWNA 5I8TA 2C6SA 3AYCA 4J6GA 4FQ4A 2RMU3 5H9SA 4B3NA 3MO4A 4I30A 3WP6A 4RQPA 1VBA2 2DUQA 4K6BA 3M70A 1QMJA 2P3KA 1ND2B 4P14A 2D44A 4UFHA 4D3WA 1RUE3 3EO6A 1VBB3 4DPNA 1F2NA 2QDRA 2BGOA 2FDKA 4M4PA 2WLPA 1JZ3A 2WWJA 4R9BA 1XBFA 2FQPA 1ND2A 2RS53 3TBDA 1VRBA 2DWRA 4FOWA 1EP0A 1G6NA 1UL9A 5BY5A 1OVSA 5J3UA 3OGVA 4KG0A 4DINB 2O14A 5L7OC 1AHSA 2K46A 2OPKA 1CJDA 1VMJA 5F39A 1VE0A 2J1AA 2VTFA 5KXCA 4FPKA 3ST7A 4KQ7A 1H1MA 4O9EA 3UJQA 4AFCA 5DZFA 1UKGA 2QDNA 3B7MA 5DUVA 3MICA 3WXPA 5CFCC 2EF6A 1KQRA 3BOWA 5JUVA 4M3CE 1RXFA 3W21A 1O4ZA 1S4CA 4P9GA 1A78A 4GALA 2GN7A 4ZU4A 5FOBB 1VB4A 2J42A 2PHTA 3LF7A 4L99A 1D0GA 4UFJA 2CYFA 5D2AA 5EP9A 5FZ8A 1RUH2 2CY6A 5I0UA 5FY0A 1UIJA 4AQTA 4YRDA 4LT5A 3OBZA 5A6XA 4LKEA 5JPNB 5LA0A 1EAH1 2R49A 5F8PA 5LBBA 2EIEA 2GP3A 4HMZA 3ZMOA 4HG6B 2FMYA 1CVNA 2ZX2A 2YXSA 3BB6A 1FOD3 4OUEA 5CADA 4CXYA 2ARXA 4XF3A 1PZ7A 5JWPA 1ULCA 1GOFA 1X8EA 2LUWA 4COYA 2OQ6A 4L0PA 1FMD3 4WVVA 4YW7A 3V0BB 4F7ZA 4IUGA 4COVA 1RMU2 3V0BA 1W8OA 5IWFA 4AI1A 2CGPA 4DXZA 1EV11 3SQOA 1GOGA 4IV3C 1FPN2 4NHYA 1R081 1Z7S3 2O0OA 2D97A 2DVFA 1ZZBA 5T3NA 1EYBA 3EHKA 1DQ2A 1RUG1 4NWVA 3R4DB 5ERLA 3WOGA 1GZTA 2J22A 1SEFA 3E1F1 4LO8A 2CWSA 3KCYA 3P3NA 1PNFA 4I0WB 4AVTA 2C1FA 5HPOA 4K21A 4OVEA 4CCNA 4YLZA 1MZ6A 5C3OA 3IB3A 2RM21 5DAVA 5JZGB 4QPGC 2VBPA 4DEQA 1IG3A 4N43C 2DFBA 3GYDA 3UK9A 3EXUA 5JZGA 3FHAA 3TEZA 1RUG3 1C8NA 4XFHA 5KXBA 2BVBA 3AP5A 1X8MA 3NAPB 4RSUA 2BGPA 5BUVA 2ZHNA 1UU4A 4N8MA 4OI0A 2HLEA 3NAPA 3WSOA 5IVEA 1YJLA 1PVC1 2LRPA 1R1A3 3QACA 2VZUA 3CBNA 4HSJA 2IZWA 3UGFA 4ZZ8A 5FCCA 3SKVA 4HSLA 5FZBA 3CLPA 4QPIB 3GZTB 2A3YA 2RR11 3S5QA 4FTEA 2E53A 5BNPB 5JMOA 2GP5A 4D6SA 4N9IA 4K3UA 2VZVA 5JLVA 5JI9A 1MS4A 3O7OA 4B4PA 3HNBM 4QPIA 2CV6A 1CESA 4Q2FA 5BNPA 3KV9A 3GCXA 1IQAA 1Q8PA 3RYRA 1HJFA 1REFA 1H8TC 4DZGA 3E6CC 2JDUA 5IAVA 1IS6A 4HXCA 4XF9A 3MIDA 5A80A 1GWMA 1S0JA 2E6VA 3U11A 3BTXA 4LE4A 5E6HA 2FD8A 1D4M1 5CYYA 5FPXA 4XQ4A 1SLLA 3O1PA 2IXIA 4XJAA 4URAA 2VR4A 4HVOA 5EFUA 2VZPA 4MGIE 5JAXA 2RG4A 5CNAA 5A7QA 4LKSA 4QQPA 3KV5A 3G7DA 3MF9A 3O1VA 3ZDVA 3O0XA 2ZGUA 4KGGA 1PGW1 3ZFFB 4FQZA 4KWJA 1YQCA 3H3UA 5C3QA 3VBRC 3KT7A 4Q4X1 2QQPA 4Q0PA 2G19A 2EVXA 1B35B 4NIIA 3N7MA 4BDVB 5IK4A 3ZFFA 5SV8A 2WZR2 2CAUA 1IZ3A 4NHKA 3VZKA 1B35A 4E2SA 4E2QA 4HBNA 3IWZA 4FO9A 4CYDA 4BQ5A 3VUOA 1WA4A 3AXEA 3CNAA 3PMEA 4BU2A 3B02A 2MNGA 1AXKA 4XYXA 1LCLA 2XMLA 3RZZA 2IXHA 3LDRA 2FDFA 1JXNA 3LPFA 3VLBB 3H0OA 3POBA 5HCFA 3SCFA 4A3XA 1MS8A 1AUYA 2HWF2 4AYUA 1SZBA 3T1MA 3KHCA 2RS31 1ULOA 3TRSB 1AR63 2DCZA 3IBMA 3RMYA 1ZRFA 2F4LA 2NN8A 2EXIA 1Q8SA 2ILMA 1UOJA 1NYWA 1SQ4A 1UPIA 1VB2A 4CEWC 2HWD3 2Y6LA 1Y43B 1RC6A 4XJUA 4BYYA 3KVAA 3NVCA 1BK0A 1GP6A 4XFGA 3LA7A 1KDKA 3SISA 2IXJA 1SLTA 4X8NA 4X8PA 5E16A 4R4XA 4XJWA 2Q8EA 1BMV1 4LA3A 1QWRA 5IK7A 4MGTA 3DPRB 3VN4A 4YGEA 1GSLA 2QKDA 1GANA 3ZDSA 3VD4A 1G9CA 5CA6A 2XVKA 4CUBA 2XUMA 3HQUA 5A7SA 3DPRA 4PBOA 4Y1VA 2B42B 2YC2A 4YVSB 5FY1A 1RUC1 4URTA 2FHRA 4Q0VA 4OULA 3KV4A 4XFIA 5E88A 3MLJA 2QE3A 5GLVA 4RGKA 1OHFA 3HNMA 1RUJ3 1V9U2 1UOGA 4E8DA 4YVSA 1AR71 3ROUA 2XJRA 5FMBA 1DDLA 3P6BA 1GYKA 4Q4V2 3IIAA 4ES9A 1WZXA 3KQRA 3PTYA 2CDPA 2HWB2 3ECQA 4LNVA 3Q8EA 2ET1A 2X29A 2R7EB 4YARA 2DTYA 5GLTA 5DAQA 4OLLA 1JZ6A 1RUC3 2VD7A 2YU1A 4Q8LA 2R32A 3PTRB 2P6CA 4BHPA 5F3EA 1GWKA 2XOMA 5FY4A 2V5YA 3POSA 5C9AC 1Y9GA 1AR73 1BBT2 2VZOA 4NN0A 4UBHA 4RHV2 2ZGRA 1E5RA 2DVAA 2ZAHA 4RR3B 4Y20B 1IKQA 4EZ4A 1O3RA 1ST8A 3G6JB 2GMEA 3J9SA 3BU0A 1NCRB 1QJEA 1VLNA 4LBMA 4OFGA 4ZS3A 2DVGA 4MGQA 5C70A 1XSRA 3GF6A 1XYOA 4RR3A 4Y20A 3K4ZA 1WGPA 4A4AA 4W4ZA 2JWPA 1NCRA 1VALA 1WUVA 4HKWA 3TWIA 2XL7A 3LA3A 3WP4A 1ZBA1 3MV01 2ZKNA 3MPBA 4DUVA 1M06G 2C9AA 2RHPA 2VMCA 4YSFA 2L9LA 5IHRA 1AR93 2BFUL 4Q26A 5IVCA 1ND3C 2EALA 1POV3 4LKFA 3ZN6B 3O1RA 4PF1A 3M1HA 1H6XA 5FOJB 1X7NA 1R091 2ARBA 5F5AA 1JODA 2V73A 2XVLA 5T54A 4KMQA 1QNWA 1ODNA 3ZN6A 4XETA 2P6HA 3RDIA 3T4HB 1T2XA 1GQHA 4B8EA 1WLDA 2Z69A 3WNOA 4NMIA 3AFKA 3MIGA 2WS92 2WO7A 3N9OA 2VCMA 5F3CA 1GV9A 5JOWA 1CN1A 2RJKA 4AGGA 4EZHA 4L11A 3AVSA 2VMDA 3AKTA 5FK8A 2RMU2 1R093 1W2OA 1SFNA 1XNKA 1O59A 4O7XA 3CZJA 5F3GA 5H9PA 4ARYA 3ZIWA 1DQ4A 4ONUA 1YCIA 2JEMA 1MVEA 4C1XA 2Y0OA 3VGIA 5C33A 1DU3D 1RUE2 4AQSA 1VBB2 3GM8A 4XF4A 1A3KA 2YPJA 3USUB 3H7YA 4N7IA 3Q8BA 5I8YA 3VBUB 2RS52 3MI8A 3PUQA 4AI8A 3JQXA 3E5UA 1WCDJ 3HN3A 4RYDA 2BBAA 1V00A 4UAPA 5T5LA 1BYHA 5ANNA 4YG0A 3USUA 2NYYA 4CDWC 5L36A 4E2GA 4GZ9A 2ZJCA 3VBUA 3ETPA 1VRH1 3C7FA 5FYTA 1NE4A 4P5HA 1WCKA 2ATFA 1VBA1 2RJLA 2YFUA 5KXDA 3NKTA 5C7GA 5J7MA 3BTZA 2X10A 5H9QA 3VBOB 3HBKA 2TEPA 1LTEA 2FDGA 2X5IB 1W04A 4L8QA 2WYSA 3SEEA 2P2KA 2DCYA 4AE2A 2PLV3 2Z4FA 1WLTA 3VBOA 1IGOA 1ZREA 4L9BA 4WM7C 4EN7B 2X5IA 4FFGA 1LESA 1O7FA 5BNNB 4AFBA 2VE1A 4DS0A 3C8XA 1QH6A 1VRH3 3I7DA 3K46A 3KV6A 2GN3A 2VQAA 4KU8A 4AL9A 5BNNA 2XBO3 2CDOA 4CE8A 4Y26A 3NV3A 3CZUA 3VDCA 1FOD2 5E8AA 5FPVA 2IVIB 1QDCA 4AXOA 4TSVA 1WMXA 3VB9A 4LORA 5KHKA 3H3ZA 2GNTA 4XXPA 4RS5B 1ZZCA 1GU3A 1SBFA 2ZGLA 5FLIA 4AW7A 1RB8G 3VZNA 3CJIC 2YBKA 1FMD2 3ATGA 2LALA 1HJGA 5FZ6A 5K7PA 2A7AA 4UOJA 4FFFA 4RS5A 4FP3A 2JDPA 1S1AA 3D8CA 2LROA 3HIFA 4BLIA 4D94A 1C5IA 1QOTA 2ADDA 3ZXLA 3ZR6A 2XQXA 3NWKA 1DYPA 4FI9A 4A44A 4CRQA 1OOPC 3INAA 1U5XA 3APBA 1PIV2 1Z7S2 3A23A 5FZ9A 3WNKA 4Q4W1 4XW3A 1F8VA 1XNDA 2AGSA 1NLRA 5ABJB 4FT8A 4NIDA 2HBUA 2R30A 1QF3A 2EICA 3HMYA 2YDEA 3JCIA 5F6LB 5I0DA 2PHWA 1E5SA 2ZGNA 4NHMA 5ABJA 4OHXA 3LB9A 3HWJA 3LIGA 5HV4A 1RMU1 2PA7A 3JB8A 5LY1A 4NPRA 1CPMA 1SLBA 1GZCA 3MLKA 3RFRA 4COWA 5LA1A 5EYYA 3OTFA 2CL2A 1FPN1 3LCPA 3CO2A 1EPZA 3IKWA 4Q4W3 1Q8QA 2QQWA 1Q8VA 2Z79A 3OPWA 5GZFA 4COZA 2Q0AA 2VECA 3LDKA 4EN6B 4XAEA 2G9GA 2E26A 2W1SA 4FTBA 1NCQC 4M4RA 3LEIA 3RZLA 3PIGA 5IUQA 3WF1A 5C3RA 4YGBA 5K9YA 1DZTA 5DG1A 1JOBA 4Y1YA 1W2AX 4QQHA 4XMAA 2Q8DA 4YGCA 4PDWB 3N9NA 3DEMA 4R9DA 4M0NA 1VBD3 3VHNA 1FPN3 1QJX3 1R1A2 2AYHA 4LE3A 4C8DA 3OSDA 1ZRDA 4XPVA 4RFT0 3KM5A 1W28A 4PDWA 4UXAA 3THPA 1ALYA 3TN91 4NOTA 3F2ZA 1DGWA 4KH9A 4QB6A 4G9SB 1UXXX 3H8UA 4QX7A 4QX8A 1H4GA 3ALQA 4GH4C 3KWVA 1DGWX 2W87A 2ZAAA 3N7KA 1L7QA 4AEDB 4AEJA 4A7KA 3IZOA 2GH2A 5J09A 2Y6GA 1RGSA 3M3CA 3BN6A 5J1XA 4GA9A 3GNEA 4AEDA 1SFPA 1DGLA 5ANQA 3THDA 1WD4A 5JOXA 2ERFA 1N1VA 1G7YA 5CAZA 1CZSA 1OXCA 4WVWA 2CSGA 5G04L 1XE7A 3TN93 1IS5A 3O1SA 4IQPA 1KDMA 1RUNA 3HQXA 3FN9A 3I2DA 2A6YA 2WL1A 1Q8OA 4C1WA 5IAXA 1UX6A 3QH6A 1J58A 1L3JA 2WWSA 2XJSA 3OGSA 4FOQA 1OKQA 3IPVB 1O8PA 5GZDA 1ZNPA 4FTSA 1D2SA 5EJ1B 1YWKA 4QM9A 4CDQB 1JYWA 5IVYA 1I3HA 3IPVA 2F4PA 1E57A 2A3WA 2HWC3 4HN0A 1ZRRA 3RG0A 4KU7A 3BCWA 3LA2A 4QHZA 4YM0A 4GKXA 4CDQA 4YZ5A 3R0RA 3FUOA 3R4UA 3WHTA 1HW5A 4LBQB 4CA9A 3WQ1A 4QKNA 5LATA 2ZX4A 3JXSA 4LBQA 3M3OA 5KHHA 3J7NA 1UYXA 1V6JA 4LO7A 1RVF1 2ZS6B 1PO23 4XDQA 5EIYB 3AX4A 1LU2A 3U75A 4LA2A 1DQ6A 4DIQA 3UYJA 1OFSA 2DUPA 1B09A 2IC1A 4IE4A 3NV2A 5FBZA 3EB7A 3ZYJB 3KLSA 1HV0A 1NXD1 2YU2A 1UPSA 1RITA 1Q56A 3KF3A 5FZHA 3AMMA 2WZR1 2PELA 2WFPA 2PAKA 5L7OB 1AR62 3NNJA 1RVF3 1C3HA 2A70A 2OW4A 2Y64A 1GNHA 2AZ5A 4ORFA 1GMMA 2HWD2 1HQNA 2VPVA 4R4ZA 1XNTA 4TWTA 5L7OA 3V0AB 3CDZB 2BVVA 5CFCB 5A3LA 1UX7A 3RS6A 1WMEA 3LGRA 1UY3A 3VKOA 3WG2A 4HVRA 3ZXFA 4A6SA 2ARCA 4N7UA 3H8RA 4HPKB 3V0AA 5GJ6A 4GWJA 2HWF1 4W6WA 5CFCA 3OEAA 3ILFA 3ETQA 2VXJA 3WP3A 2A6XA 4HPKA 5LB6A 1NQDA 1C8M3 4Z8BA 2WNEA 1F9KA 3VBHC 4BH9A 2MHFA 1E5HA 1JHNA 2D5FA 3TEXA 4OHVA 2PYTA 3I8TA 2ZX0A 1C4RA 4RGAA 4J25A 1REDA 3RZJA 3B94A 1LULA 1RUJ2 2UU8A 2VM9A 1QJU3 1QNYA 2VNOA 5A6QA 1VBC1 3SH3A
chains in the Genus database with same CATH topology
4YW6A 4AL9A 1W8WA 4LK7A 4CP9B 1W8TA 1UOJA 4BQ4A 4LKEA 3UT0A 4YWAA 1WMXA 2WYFA 4A6SA 1GWMA 1V0AA 4LKDA 2C24A 1WZXA 1HN0A 2K46A 2O14A 5D21A 2JWPA 2LRPA 4BQ5A 1GWLA 2VXJA 4CPBD 4CP9A 3F95A 2Q1FA 1OKOA 3ZYBA 3ZYFA 1W8ZA 2KR2A 1L7LA 1W8UA 4YW7A 1OH3A 2LROA 3ZYHA 4BQ2A 1GWKA 1W90A 3ORJA 4LJHA 4LKFA 1W9FA 4LK6A 4BQ3A 4CPBA 1WCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YW6 A;  4AL9 A;  1W8W A;  4LK7 A;  4CP9 B;  1W8T A;  1UOJ A;  4BQ4 A;  4LKE A;  3UT0 A;  4YWA A;  1WMX A;  2WYF A;  4A6S A;  1GWM A;  1V0A A;  4LKD A;  2C24 A;  1WZX A;  1HN0 A;  2K46 A;  2O14 A;  5D21 A;  2JWP A;  2LRP A;  4BQ5 A;  1GWL A;  2VXJ A;  4CPB D;  4CP9 A;  3F95 A;  2Q1F A;  1OKO A;  3ZYB A;  3ZYF A;  1W8Z A;  2KR2 A;  1L7L A;  1W8U A;  4YW7 A;  1OH3 A;  2LRO A;  3ZYH A;  4BQ2 A;  1GWK A;  1W90 A;  3ORJ A;  4LJH A;  4LKF A;  1W9F A;  4LK6 A;  4BQ3 A;  4CPB A;  1WCU A; 
#chains in the Genus database with same CATH topology
 5KXE A;  5D1I A;  1ENR A;  1TME 3;  2TBV A;  4PLN A;  3KCC A;  3WW2 A;  4KWK A;  3WY6 A;  3J4U H;  4V2V A;  3U37 A;  1EPW A;  1UN1 A;  3OY8 B;  3AKP A;  1SMV A;  2IXL A;  1R1Z A;  4LKD A;  3B3Q E;  3TB0 A;  3A4U A;  3AJY A;  4EN0 A;  3O1M A;  3NJX A;  1CGP A;  1RUC 2;  2RJ2 A;  2ZXQ A;  3OY8 A;  4P08 A;  2K0G A;  4SLI A;  4IV3 B;  4MHU A;  4IV1 C;  1W8Z A;  2QVS B;  2H6B A;  4XJZ A;  1H30 A;  1VAK A;  1AR7 2;  1V9U 1;  1GQP A;  1VBC 3;  4IV3 A;  2WUH A;  4K1Z A;  4U36 A;  3WCS A;  1NKG A;  3FMG A;  1FAT A;  3SC7 X;  2YV8 A;  4XBL A;  5FZC A;  2ZHK A;  5JPM B;  4Q4V 1;  2PFW A;  4QDQ A;  3KS7 A;  2HWB 1;  1C57 A;  5FXW A;  1O91 A;  2EIG A;  2VZR A;  1XYP A;  4I3P A;  1NZC A;  5JIU A;  1XQN A;  4H2A A;  4NRP A;  4QPG B;  5FRE A;  5IJR A;  3JZV A;  3ZKY A;  3ZXE A;  5LEK A;  4N43 B;  5FRA A;  2VZQ A;  3RMX A;  3RJ2 X;  1BBT 1;  4QPG A;  3BI3 A;  1J3P A;  5FMD A;  4N43 A;  1H1A A;  2JDA A;  4RHV 1;  3W9A A;  2JDM A;  4FPH A;  1AR9 2;  3PUA A;  4YW2 A;  1VMH A;  4ERO A;  2VUC A;  1HB1 A;  2OXB A;  5LCW L;  2RDN A;  4MH0 E;  1IG0 A;  4O61 A;  5FZM A;  4PIX A;  1JUI A;  4BIS A;  2XLG A;  1O5L A;  4QQ2 A;  4MGK E;  5KHI A;  5K0U C;  5F7U A;  1LGC A;  4LPL A;  3I3E A;  5A32 B;  5C6C A;  1JYX A;  3FHI B;  3H1M A;  4QX3 A;  2DF7 A;  1ZZ9 A;  2YY1 A;  1W8T A;  3B00 A;  3CMG A;  4DXT A;  3MZH A;  3LSD A;  3BIW E;  1F35 A;  4RHV 3;  5A32 A;  2E7A A;  1CD3 G;  2W47 A;  3WNL A;  1SBE A;  4QPY A;  1O3T A;  1ZRI A;  1AL0 G;  3ES4 A;  3IN9 A;  5T50 A;  1HLC A;  4XUP A;  4ZY9 A;  4PBP A;  2Q4S A;  2UUR A;  3CL1 A;  2W1Q A;  4ARX A;  1Q5O A;  4LO4 B;  4B1M A;  1H8T B;  1W0N A;  4AK3 A;  4FPJ A;  1JN2 P;  3I3Q A;  3LEM A;  4V2W A;  3PU3 A;  1DZR A;  1S0C A;  3AMQ A;  1H8T A;  4ATE A;  5FYH A;  3O14 A;  1DFQ A;  1OBN A;  1ZZ7 A;  3LFI A;  4IEO A;  2QCS B;  4LHK A;  2DCK A;  4IE7 A;  5FV3 A;  4XEZ A;  4MLO A;  1QXP A;  4K7J A;  2RMU 1;  5FP9 A;  4XDO A;  4CP1 A;  2XHK A;  5FZD A;  2BGC A;  3E5Q A;  1ZA7 A;  4AVB A;  2HJI A;  4PLM A;  1K45 A;  2WJS A;  4HK8 A;  4DMI A;  4E27 A;  3MUY 1;  1RUE 1;  3WDY A;  1VBB 1;  2Z42 A;  3OD0 A;  2YMZ A;  4YZ4 A;  3TOJ A;  2NLR A;  3NO8 A;  3PLQ A;  3U14 A;  3WIN E;  1OMI A;  2RS5 1;  2PLV 2;  3VBR B;  5AFB A;  1LOA A;  2B7Y A;  2RS1 1;  4LBQ D;  1C1L A;  3ZXA C;  3I3B A;  3MF6 A;  5IK8 A;  3J8F 3;  3R4S A;  2VMG A;  3VBR A;  3ZXD A;  5IFT A;  1I6X A;  1VRH 2;  1UQX A;  1GFF 2;  3M7A A;  3N3H A;  2GC3 A;  2DDU A;  2O1Q A;  2A73 B;  5JOZ A;  5A1F A;  2XBO 2;  1TMF 3;  1D0H A;  4OMC A;  4QGL A;  2NZ9 A;  5I0R A;  2A71 A;  1LEC A;  3QBQ A;  4FFI A;  5KR7 A;  4TYS A;  2P3I A;  3O0V A;  1VP6 A;  4UF0 B;  4L92 A;  4GMP 1;  2RS1 3;  5T5O A;  4EE2 A;  5EJZ B;  4V1P A;  1BLZ A;  4EN8 B;  3OGG A;  5FR3 A;  4PJY A;  2YBP A;  4UF0 A;  1LOC A;  3QLQ A;  4BIO A;  2VUJ A;  2B45 X;  4CUG A;  3ACG A;  5B4X A;  1R64 A;  3FJS A;  2Z5W A;  4ATF A;  3O0W A;  5K8S A;  4LR4 A;  3EBR A;  1A8D A;  3I59 B;  1GR3 A;  1YUD A;  3K2O A;  4CTE A;  5I93 A;  3N9P A;  1PMI A;  1XNC A;  1FOD 1;  1WMD A;  2WAB A;  1TEI A;  4CEW B;  1NLQ A;  4HVQ A;  3O5S A;  5EYX A;  3I59 A;  5LW9 A;  5FIX A;  4C91 A;  3VBS C;  2MPF A;  5FKB A;  4LXL A;  4GMP 3;  4S2H A;  5FY8 A;  3HN1 A;  3ZXK A;  2R0H A;  4FAG A;  4CEW A;  1FMD 1;  3WF0 A;  1ZVF A;  4ISQ A;  2BTV C;  4C0B A;  2GC1 A;  4CCC A;  5JIA A;  3AJZ A;  3FUQ A;  3UNP A;  2WWU A;  1K5M C;  5C3S A;  3WQ0 A;  4DQA A;  4EWE A;  2PHF A;  1YI7 A;  4S2F A;  1GP4 A;  4P9W A;  4KG8 A;  2XGX A;  3OG2 A;  3AYE A;  3TNP B;  3ZFE C;  1PIV 1;  1Z7S 1;  4Q4W 2;  2VOT A;  1OLQ A;  2D3P A;  5FQ0 B;  4Z1V A;  2Q1Z B;  2VXR A;  4P9Y A;  1RJ7 A;  1JYN A;  3WNX A;  2UWC A;  1HB3 A;  2P17 A;  4XDP A;  2XL9 A;  5FQ0 A;  4FOY A;  4LMF A;  3LOB A;  4BZ4 A;  4YZ3 A;  5DAB A;  2WZP P;  4NUB A;  4BWO A;  5FO9 B;  3HJR A;  1KFX L;  3OJB A;  5A3M A;  3WW1 A;  1VBD 2;  1QJX 2;  3H50 A;  1FX5 A;  4BPZ A;  1PIV 3;  2WII B;  3KQ4 B;  4RFR B;  3WUC A;  1W6P B;  3AKS A;  2EID A;  2OX0 A;  3VV1 A;  2WZ8 A;  4M3C B;  1WW4 A;  4Q8K A;  1YC6 1;  5C9A B;  2XPJ A;  1GKB A;  2WT2 A;  3AZY A;  1W6P A;  2HEY F;  2KXL A;  3VDA A;  4JV4 A;  3UKN A;  2C0Z A;  4M3C A;  4ZU5 A;  2CGO A;  4M01 A;  2Q1F A;  3WNP A;  5C9A A;  1RUI 1;  3R05 A;  3GBF A;  3BIE A;  2AEY A;  1ZBE 3;  4HN1 A;  4I0A A;  2XB6 C;  3VKM A;  2NM1 A;  1UOB A;  4MXV A;  4UWD A;  5DQ0 A;  1CQ9 A;  1R1A 1;  3KMH A;  1NUK A;  3WG3 A;  4FPE A;  4QXK A;  4DB5 A;  1GZW B;  2Y38 A;  4TXW A;  2P3Y A;  2ZEZ A;  4FPG A;  2BYV E;  4YW5 A;  3TN9 2;  4CPB A;  4HKL A;  2EXK A;  2BDR A;  5FMO L;  4IEW A;  3CEW A;  2LM3 A;  4NRQ A;  1GZW A;  4D8M A;  1I5P A;  3K51 A;  3AL5 A;  1K42 A;  1MQT C;  4UFI A;  3POE A;  5FYB A;  5KHG A;  1RUI 3;  3ZSL A;  1JZ8 A;  1ND3 B;  1UYZ A;  4BK4 A;  3O12 A;  4IL7 A;  4E4D X;  4PCR A;  2JG9 C;  2ADE A;  4R9A A;  1D2Q A;  1ND3 A;  4JCK A;  2HWC 2;  1QJY 1;  4BXS V;  4M3C F;  1QGL A;  3AVR A;  3I2K A;  5GZC A;  2JXA A;  4FPO B;  1ULP A;  2X53 S;  3LOI A;  2KM2 A;  3Q9O A;  4CU8 A;  4LHS A;  4N90 A;  3ES1 A;  3NJV A;  3GZE A;  3R6S A;  4AFA A;  4Y4R A;  4B4Q A;  4BQ3 A;  4JX0 A;  1K3I A;  1I9R A;  5AFE A;  3BOP A;  1IPJ A;  3HR9 A;  4YZ2 A;  5FY9 A;  2DBI A;  2SLI A;  4QQO A;  4EWA A;  1RXG A;  1PO2 2;  2V5D A;  4QHO A;  4IE0 A;  1N1S A;  2VUD A;  4ZXE A;  3SH4 A;  5CFD C;  1H2L A;  2K2S A;  1W6M B;  5LAS A;  1LHV A;  1QJY 3;  3CF6 E;  2W91 A;  4FP2 A;  3OPT A;  2VVE A;  2BER A;  3WNN A;  4AQ6 A;  1W6M A;  3ZVX A;  1HN1 A;  2D93 A;  4FPL A;  3K4A A;  3DV8 A;  1OA2 A;  3LFM A;  4CDX B;  4A7Y A;  4MHR A;  1CAX B;  1FAY A;  1OH3 A;  2X8K A;  4P9I A;  5FO7 B;  4CDW B;  1RVF 2;  4CDX A;  1NY7 1;  4MX3 A;  1AR8 3;  4FAH A;  1SCR A;  3JU9 A;  3H9A A;  1CAX A;  4YG6 A;  4BM8 A;  4CDW A;  1XSQ A;  5AVP A;  1LKN A;  4LK6 A;  3KF5 A;  3OB8 A;  4KL1 A;  4BLJ A;  1A8M A;  1QU0 A;  5E89 A;  2H0V A;  1W2N A;  2NPI A;  3RPQ A;  2A3X A;  2BNO A;  3WF3 A;  3WW4 A;  5LEJ A;  1H4H A;  1H8V A;  4WM7 B;  2FZ1 A;  1X33 A;  2ET7 A;  4KNC A;  4Y22 B;  5J37 A;  1AR6 1;  1C8M 2;  3POY A;  5FJK A;  3DGT A;  4L97 A;  1XE8 A;  4WM7 A;  4Y22 A;  4XAB A;  3VHR A;  4JRL A;  2HWD 1;  5BXX A;  4AHW A;  4XFC A;  4DOU A;  5M0T A;  4M0H A;  5CG8 A;  5LBF A;  5LY2 A;  3ORJ A;  1QJU 2;  4GUL A;  2WA3 A;  5LBE A;  5L9R A;  1TME 2;  1WWY A;  3CJI B;  3WF4 A;  5GLZ A;  4CP2 A;  2VQT A;  3B9I A;  1WCU A;  2FCT A;  1MR5 A;  2WAO A;  1CZT A;  3E6D A;  3CJI A;  4J1X A;  4Q27 A;  1IKP A;  2PN5 A;  3VZJ A;  1PVX A;  2ZGK A;  3AFG A;  4YVW C;  2C24 A;  3A0K A;  1FV3 A;  1HN0 A;  1OOP B;  2JG8 C;  2CGN A;  3DKW A;  5CKM A;  3ZR5 A;  4Y24 A;  1RUJ 1;  2OII A;  1VBC 2;  4MXW B;  2AUY A;  4JDN A;  1DZQ A;  1J83 A;  5CZK A;  1OOP A;  1IPK A;  1OQ1 A;  4HLT A;  1SPP B;  2GNM A;  5T5P A;  4AGR A;  5FAX A;  3A7Q A;  4MXW A;  3BAL A;  1QQP 3;  3JD7 1;  2V72 A;  3M3Q A;  2WKK A;  1SPP A;  1V6K A;  4K9S A;  2W46 A;  4OQ8 A;  1PK6 C;  2HYK A;  1NG0 A;  2B9V A;  3MYX A;  5L73 A;  4YFW A;  3T0B A;  1XXN A;  1JI6 A;  2LW8 A;  2VTX J;  3D0S A;  3LZZ A;  1G9F A;  3PJQ A;  3PVO A;  4WV8 A;  1CX4 A;  3B5L B;  4M00 A;  1NE6 A;  1XYN A;  4H14 A;  5FUI A;  2E9Q A;  2Y33 A;  3FE5 A;  2QQU A;  1UF2 C;  4XJ9 A;  2W92 A;  3JD7 3;  1F31 A;  1BEV 3;  5A7W B;  3ZYB A;  3KGL A;  1MVQ A;  5A3T A;  1WBL A;  3I97 A;  2E7T A;  1HRV 2;  5A7W A;  4HKO A;  2GDF A;  2BNN A;  2G4I A;  1AXY A;  5F32 A;  2JE8 A;  1YLL A;  4FBF A;  4X6R B;  2PHL A;  1RHI 3;  3ME2 A;  4XZU G;  2WQ4 A;  2VCC A;  2ZGM A;  3DUI A;  4P9X A;  2GMP A;  5FP8 A;  3VBF C;  5HCH A;  1TZO A;  1DBN A;  4GH4 B;  1AR9 1;  2PMW B;  3PUI A;  3U07 A;  3ZYR A;  1W05 A;  1POV 1;  3HEI A;  5DG2 A;  1X36 A;  1O5U A;  1LED A;  5D21 A;  4NRM A;  4GH4 A;  4CEY C;  2JE7 A;  5FBJ A;  4BB3 A;  4CPB D;  2JD4 A;  2JB4 A;  5G05 L;  3AYD A;  5J48 A;  2VVD A;  4BJ0 A;  1JYI A;  4Q5O A;  2D43 A;  4E4S A;  2G1M A;  1UU5 A;  4QDS A;  3ZLI A;  1KIT A;  2BWA A;  2Q8C A;  2YBS A;  3PJY A;  4ZHN A;  4D7Y A;  3DKQ A;  1XPW A;  4Y5T A;  1W2U A;  3I3D A;  4MUV A;  1SCS A;  1HRI 1;  4A41 A;  1F5J A;  4IEY A;  3MFA A;  1TNF A;  2D7F A;  1W8H A;  5TSW A;  2ZBJ A;  1D4V B;  2QZ3 A;  2BFU S;  2HKX A;  1ODM A;  3KT4 A;  2Q8O A;  1S0F A;  1QJF A;  3LEG A;  1HXS 3;  2I2S A;  2NMO A;  3AM2 A;  3OUJ A;  4AVA A;  1J3R A;  3AZX A;  1LR5 A;  3A0N A;  2JKX A;  2IXK A;  3J8F 2;  4IND A;  4XFF A;  3ZSE A;  4BQX A;  1OI6 A;  5A1L A;  1JZ2 A;  1YO8 A;  3AB0 A;  1HRI 3;  4XUT A;  4BQ2 A;  4YM2 A;  5LA9 A;  5F37 A;  5DZG A;  2DV9 A;  4G4F A;  4B1L A;  1TMF 2;  1UZW A;  1PGL 2;  4XOG A;  2W5F A;  3GDB A;  2RV9 A;  2VL4 A;  3PHM A;  1AYM 1;  4DUW A;  3K4D A;  3III A;  2PLV 1;  2RS1 2;  4GKY A;  3WR0 A;  4DXR A;  1QHD A;  4Y1X A;  1JYT A;  2DVB A;  4DFS A;  3K77 A;  4CSW A;  3NKG A;  4XFA A;  3C7E A;  3H8X A;  1ZYB A;  1LNS A;  4W8J A;  3B69 A;  3N9Q A;  2VBB A;  3DXT A;  5GLW A;  3VD3 A;  4QD2 A;  3C3V A;  2GND A;  2XBO 1;  4WVZ A;  1AJK A;  5FYY A;  3I2O A;  2FDH A;  1JZ4 A;  4ZS2 A;  2LTN A;  4ES8 A;  5JDB A;  1AYM 3;  2WNO A;  5FLJ A;  2BZD A;  3L2Y A;  2R6Q A;  1U5I A;  4LJH A;  3LDB A;  5A70 A;  1Y7B A;  1OQD A;  4PF5 A;  1IOA A;  1GIC A;  2A6W A;  1PO1 2;  1XJA A;  2JEC A;  1LHU A;  4IGQ A;  3NV1 A;  1UZZ A;  3VBH B;  2EA7 A;  2CHH A;  2RDR A;  4AVV A;  2IUW A;  2QQV A;  4P5Y A;  1NAE A;  4UFM A;  1SLA A;  1VMF A;  3VBH A;  4GQ7 A;  3TAY A;  1JU4 A;  1XB9 A;  3MBW A;  4WM8 C;  3JBG 1;  1BXH A;  3NNL A;  4GD4 A;  4P9L A;  4CUA A;  1LRH A;  2F17 A;  3E97 A;  3GXU A;  2FDJ A;  4NPL A;  4XBQ A;  5FPB A;  4S2D A;  1CJP A;  5EJ3 A;  2EAA A;  5C4W C;  1W6Q B;  4TLG A;  3C7O A;  5I91 A;  3S57 A;  2VG9 A;  5GZE A;  3U10 A;  4Q4Y 3;  1XNA A;  4IGP A;  4XTM A;  4MYE A;  5J96 B;  1W6Q A;  2J7M A;  2W0X A;  3ZYG A;  1UD1 A;  4IV1 B;  1H2K A;  5I0T A;  5EPA A;  1IS3 A;  2GH8 A;  3JBG 3;  4BQ4 A;  5FZI A;  1MZE A;  3KHB A;  1HIX A;  5FZA A;  3B9C A;  1KS5 A;  1K12 A;  2BWC A;  2QTW B;  2YHJ A;  3OUI A;  1ZBE 2;  2D6M A;  2W9X A;  1VBD 1;  3IDE A;  1QJX 1;  4YPJ A;  2Y34 A;  2VUA A;  4UFL A;  5CIS A;  1MS3 A;  1OPM A;  1ZX5 A;  3QH7 A;  4WZC A;  2QFE A;  4BME A;  5FTT C;  3VD9 A;  1SLC A;  4I01 A;  2OUH A;  4XIO A;  1TG7 A;  4PQQ A;  1W06 A;  1LHW A;  3WCR A;  1MAC A;  4G3Y C;  4Y3O A;  3UES A;  2VZ1 A;  5CBL A;  2D6P A;  1RUI 2;  4XUN A;  1W8W A;  4XC9 A;  2JDY A;  3BKZ A;  1U12 A;  1FV2 A;  2OA2 A;  2XWB B;  3MIB A;  1EUU A;  4DUX A;  4L2N A;  2OKX A;  2OZJ A;  1Z0H A;  5T52 A;  2W52 A;  5K0U B;  3IT8 A;  3CU7 A;  1XNB A;  1UKR A;  1HV1 A;  5D8A C;  3J7M A;  2WR9 A;  4NAO A;  4Z82 A;  5JOY A;  1J1L A;  1WCQ A;  4QPW A;  4QKD A;  4XJ8 A;  4XQW A;  1UAI A;  4YNI A;  5K0U A;  2VO5 A;  5HXM A;  3W5M A;  2C26 A;  2I07 B;  1RUO A;  4GIQ A;  3ACF A;  4K8F A;  2HWE 3;  3AP7 A;  4MGZ E;  4AGV A;  5FYS A;  4E4H A;  2ZHL A;  5FO8 B;  1QJY 2;  2HWC 1;  4IEU A;  2JE9 A;  5F5Q A;  3N7L A;  2VQU A;  3NNF A;  5FYZ A;  1S2B A;  1CZV A;  4QAW A;  1JOJ A;  1GP5 A;  1V6L A;  2ZTN A;  2E51 A;  2Z2S B;  2YGM A;  4I2O A;  1W9Y A;  2JIJ A;  1KJR A;  1J84 A;  3AP6 A;  3LSE A;  1AR8 2;  3M3E A;  1PO2 1;  2ORX A;  1LOD A;  1UMH A;  1UYP A;  4XE9 A;  4IE6 A;  1UY2 A;  2HEV F;  5BNO C;  5FZE A;  5L9V A;  2PXJ A;  1VJ2 A;  1YNA A;  5IAT A;  2ZX1 A;  1DGR A;  3DEC A;  4NJ4 A;  3KB5 A;  1W39 A;  5FJH A;  3AMH A;  1DYO A;  4JGY C;  1D7P M;  5FZ0 A;  3RZM A;  1N1T A;  4UBG A;  4GB3 3;  1JUH A;  5FY5 A;  4AI2 A;  5KC6 A;  2CU5 A;  3ZYI B;  1JBC A;  4B7E A;  4MGS A;  2OVU A;  1NY7 2;  5FLH A;  2WT0 A;  4LUM A;  3GHM A;  2IWG B;  4MAD A;  1UW8 A;  3MDP A;  3POW A;  3RWN A;  2AEZ A;  3FX3 A;  4XXA A;  1YI9 A;  1NLS A;  3ACH A;  4CU6 A;  1MZF A;  3NV4 A;  3AZW A;  4LBJ A;  1G9B A;  5IVF A;  2NQY A;  4JHZ A;  2HBT A;  4B29 A;  2FMD A;  4MVT A;  4XTP A;  4IET A;  5DDJ 3;  5FYM A;  2VQ0 A;  2KD7 A;  3PVE A;  1CON A;  2XHN A;  2NP0 A;  4NHX A;  2OYZ A;  1OLM E;  2ZPX A;  4XZP A;  5F5C A;  1H1I A;  1T6B X;  4IES A;  5FYC A;  3ZIX A;  5A33 B;  3KGZ A;  3MUZ 1;  3POJ A;  1C8M 1;  2D6O X;  3GBG A;  5BV6 A;  4OMD A;  1NOV A;  4GJY A;  3D4K A;  3KT1 A;  5F3I A;  5JXI A;  5A33 A;  4AFM A;  1QEX A;  2WRA A;  2D40 A;  1XU2 A;  1S0E A;  1YQ6 A;  3BPZ A;  1W8F A;  4LUK A;  2W68 A;  3BUC A;  2DTW A;  2WQZ C;  1QJU 1;  1YIP A;  3VBS B;  4XUO A;  2XDV A;  3HNY M;  3ON7 A;  1TME 1;  3H3L A;  1YFX A;  2VVF A;  1SG3 A;  2XJU A;  2Y6J A;  3WG4 A;  3DF0 A;  4WBB A;  3ZN5 A;  4F8A A;  3GJA A;  3VBS A;  1QQP 2;  2O8Q A;  3NJY A;  1K5M B;  2UWB A;  2AC1 A;  4LHN A;  3I3M A;  2WFF 1;  4IW3 A;  1HQW A;  4UW6 A;  4X6Q B;  4AAX A;  1I1E A;  2H6C A;  3J7H A;  4CCK A;  1K5M A;  2ZZJ A;  3E5X A;  5FZ7 A;  3THC A;  3ZFE B;  4BQ1 A;  1GOH A;  2UY8 A;  2PHX A;  2YUE A;  3WUD A;  3LKJ A;  1P8J A;  2G9F A;  3AKR A;  1GUI A;  1XRU A;  4AVC A;  5FP4 A;  3FFZ A;  1WW5 A;  3ZFE A;  4CCL A;  5CG9 A;  1Y9M A;  4ASM B;  5I0S A;  1FNZ A;  4IXL A;  4YG3 A;  2Y8K A;  3JD7 2;  2VMF A;  1YFY A;  1BEV 2;  2WFF 3;  4CDU C;  3D82 A;  3S0M A;  3NJZ A;  5C8C C;  1GWL A;  3NQH A;  5FP3 A;  3ZFG C;  3W5N A;  2JX9 A;  2HEW F;  2VZ3 A;  4XF0 A;  5HXV A;  3RZH A;  5EXO A;  1UCX A;  4MG2 A;  5A3P A;  1SDD B;  1NQJ A;  1OF4 A;  1UYY A;  1W03 A;  3PNA A;  3VD5 A;  3KSC A;  3ZX7 A;  4LLO A;  1RHI 2;  3RZG A;  4CXW A;  1WW6 A;  2WNU C;  2BEO A;  2E7Q A;  2JIG A;  2W39 A;  4BQW A;  5CB7 A;  1COV 3;  1C1F A;  2QQM A;  4RN5 A;  3M2M A;  1OT5 A;  5CVR A;  1VBE 2;  1AJO A;  3J26 N;  3AC0 A;  2K9Z A;  1XC6 A;  1X9P A;  2QZ2 A;  2VU9 A;  3I4I A;  4HOO A;  1WW7 A;  3PIJ A;  5FZ1 A;  4P9J A;  3LD8 A;  4Q29 A;  1HRV 1;  1OC1 A;  4LHL A;  1UU6 A;  3L2H A;  4S2G A;  4R9C A;  3SLI A;  1YHF A;  2W94 A;  4Y4Y A;  1STM A;  3UGH A;  3OPZ A;  2J1V A;  3T2Q A;  2ORZ A;  1Q3E A;  3UJO A;  2D6N A;  2WQ8 A;  1MQT B;  3ENR A;  3OBT A;  4XCB A;  4BE3 A;  4JDM A;  2XJT A;  3RI8 A;  2FCU A;  4FXG B;  4NWW A;  1BQP A;  1TNR A;  2XKO A;  1OUS A;  1LB2 A;  2VNG A;  2ZGQ A;  1HRV 3;  1MQT A;  4QXC A;  1HB2 A;  5GM0 A;  3T08 A;  2JG9 B;  2MEV 3;  2B9U A;  1HXS 2;  1MS5 A;  1V6I A;  2D3S A;  2QUO A;  3POI A;  4FPF A;  2ZX3 A;  2NMN A;  5DN2 A;  4NRO A;  3RGB A;  4Y5Z 0;  2JG9 A;  1OUX A;  3MLL A;  3URF A;  4Q0Q A;  5EQU A;  4LBO A;  1H9P A;  1HRI 2;  5LWB A;  1PHM A;  2QJV A;  4AI0 A;  5EWS A;  2VW2 A;  1G86 A;  3B01 A;  1EY2 A;  5FYV A;  2IVJ A;  1XU1 A;  3VZL A;  1WKY A;  5CFD B;  2A1X A;  2VTX A;  3CQO A;  2XON A;  4IEX A;  1AX2 A;  3FLT A;  4QB1 A;  2XQR A;  4A2U A;  4QX5 A;  1ULD A;  3D3A A;  1G8W A;  3FLP A;  1KS4 A;  1ASJ 1;  1YXW A;  2R06 2;  4KBB A;  2BNM A;  4QM8 A;  5CFD A;  3T30 A;  3U4S A;  4CCM A;  5F5I A;  4P02 B;  3WP5 A;  2YFZ A;  5KWR A;  1LOE A;  3SEP A;  3J8F 1;  3WHU A;  4JHT A;  2GSY A;  3DYP A;  3U78 A;  3VDB A;  4YFZ A;  4YYO A;  1YJK A;  3FZ3 A;  4BXF A;  1AZD A;  4KBZ A;  2Y6H A;  3S5A A;  5DAW A;  3WX5 A;  1W0O A;  1OF3 A;  1TMF 1;  3OBA A;  4Y33 A;  2DU1 A;  1PGL 1;  4PLO A;  4EQV A;  1A34 A;  2J1E A;  4CP0 A;  5L19 A;  1ASJ 3;  1AYM 2;  1AX0 A;  3QCW A;  4OUM A;  2D6L X;  1RUD 3;  4YM1 A;  3EQE A;  1CAW B;  4BA6 A;  2ZEX A;  3VZO A;  2WO1 A;  2YC4 A;  2DFC A;  2YC0 A;  1ACC A;  4BIF A;  3AMP A;  5C5T A;  5DMY A;  1TQ5 A;  2N7G A;  5CKN A;  1JYV A;  4C90 A;  2B5H A;  1CAW A;  4P00 B;  1ZZ6 A;  5FZF A;  1LEN A;  1CX1 A;  2R04 3;  4B4R A;  2VCA A;  4GXL A;  5FYI A;  1AX1 A;  1FYU A;  2R1B A;  4QT6 A;  1OLR A;  4JRA A;  1LHN A;  1OFN A;  4BQY A;  2BUK A;  3BPS A;  4UYB A;  5FDB A;  3AP9 A;  1PX4 A;  1MZ5 A;  1NZI A;  3KZ4 C;  3NL1 A;  5FZL A;  3UKV A;  1LOG A;  3GHN A;  3Q8F A;  4JQT A;  1IPS A;  2JB8 A;  3IAP A;  2W95 A;  3VL8 A;  2WDB A;  2WZE A;  3BTA A;  2PQS A;  1U5Y A;  5A3W A;  4JGZ C;  1UO9 A;  1PO1 1;  5F9T A;  4K1Y A;  4QHB A;  4NIA A;  2E33 A;  1MEC 3;  2ZML A;  3MHZ A;  1UMZ A;  5T55 A;  2VOW A;  2AEN A;  4RD7 A;  2BP6 A;  4YW4 A;  3VL9 A;  3AXD A;  4LOS A;  4Q4Y 2;  1W9W A;  3PUS A;  4YVW B;  2JG8 B;  5KBF A;  5J98 B;  1JS9 A;  3JBG 2;  5JR7 B;  2Y6K A;  4YVW A;  2Q5T A;  2JG8 A;  4LQR A;  4XHX A;  4HAN A;  1ZRC A;  1PO1 3;  4HZF A;  1AYN 2;  1LGN A;  4QX1 A;  1ENX A;  1US2 A;  2R16 A;  1VAV A;  2UYB A;  4JQR A;  2XLA A;  1PK6 B;  3N7J A;  4K8R B;  4NAM A;  5A7N A;  3O1T A;  1L7L A;  2P4E A;  3MEP A;  5EV7 A;  4JKL A;  1PK6 A;  2JDK A;  1GLH A;  2JEN A;  3IDA A;  3KCX A;  3GJB A;  4J1W A;  1C5H A;  2WBK A;  3Q8A A;  5LA2 A;  1LOF C;  1PGS A;  3PDQ A;  5F1R A;  4R52 A;  2ENR A;  1UXZ A;  3OGR A;  1ZBE 1;  4RA0 A;  4N9H A;  1IS4 A;  3FL7 A;  1FNY A;  3GZA A;  4QU1 A;  4O9G A;  5JI7 A;  1X82 A;  4EN9 B;  4NVP A;  3T2T A;  3P5B A;  2QQN A;  4YWA A;  2XH6 A;  2YZ4 A;  1U5Z A;  2Q30 A;  2GMM A;  3WDV A;  1DQ0 A;  2XJQ A;  4OYU A;  5CEH A;  1LJ7 A;  4KGQ A;  1QIQ A;  5JSR A;  2ID4 A;  2YPD A;  3PL0 A;  4EYU A;  1PNG A;  4QKB A;  3VDD C;  1AXZ A;  4XAC A;  3VBF B;  5IFP A;  1W9S A;  5ACA 1;  2A6V A;  1RUF 2;  2HWE 2;  3OUH A;  1BVV A;  1DHK B;  1DLL A;  2ZMK A;  2XUE A;  3OD4 A;  2LS6 A;  4I3G A;  5T5J A;  5DUW A;  1NX9 A;  2QQO A;  4AZZ A;  4W50 A;  1EAH 3;  3VBF A;  4CEY B;  3VHP A;  4LO6 B;  1OH4 A;  4DO0 A;  1WCS A;  1V6M A;  3J7L A;  5JXJ A;  2VME A;  2R07 2;  3SKJ E;  4NIG A;  4GWI A;  4CEY A;  4Q1P A;  4AI9 A;  5FPL A;  3WVJ A;  3ITQ A;  1QXR A;  5FYU A;  3FFQ A;  2XKP A;  3NRU A;  5ACA 3;  5JXG A;  2GC2 A;  4PIY A;  4QB2 A;  4FSJ A;  1GZ9 A;  4FCA A;  3ZKU A;  1I5Z A;  4JZR A;  3QOP A;  5FMO S;  4YW1 A;  3SH5 A;  3THT A;  1EV1 3;  3NNG A;  2WAA A;  1W8U A;  2CNA A;  1R08 3;  3M8L A;  4COU A;  4OHZ A;  5FZ4 A;  5LZ6 A;  3H1Y A;  3KD4 A;  4AAP A;  4K40 A;  4C0H A;  4GB3 2;  1ZZ8 A;  4H55 A;  2EAK A;  5F2S A;  4FPY A;  3SIT A;  1IQD C;  1UY1 A;  1AR8 1;  2PQQ A;  3ELN A;  2RM2 3;  1WLW A;  2V09 A;  4H3W A;  4N53 C;  1W3X A;  2G9Z A;  3ACI A;  3OOX A;  4I0B A;  1FT9 A;  4Y1Z A;  3W58 A;  2P1B A;  3PUR A;  3VKL A;  1A6C A;  2XR4 A;  4UFK A;  1OKO A;  2VJX A;  4LBL A;  1J1T A;  5DDJ 2;  3VZM A;  2GC0 A;  4ZPI A;  2VY0 A;  1CIY A;  4WVM B;  1UOF A;  2W1U A;  1POQ A;  3ZSK A;  1SFY A;  5AVA A;  2WNV C;  2B39 A;  5DXD A;  4TN7 A;  4NIH A;  1KGY A;  1GBG A;  4MSV A;  4WVM A;  3WLU A;  1G9A A;  1O4T A;  2Y0I A;  1PVC 3;  4ZON A;  4E9K A;  1NA1 C;  3RYK A;  5FXV A;  2UY9 A;  1N3O A;  3PVB B;  4CP9 B;  5HCB A;  3I49 A;  5C71 A;  3I2G A;  2XVG A;  4XBN A;  1CAV B;  5A6Z A;  2BBV A;  2Q1M A;  2DCT A;  2RR1 3;  1GNZ A;  3SXW A;  4CP9 A;  2AR6 A;  4SBV A;  2J1U A;  5FK7 A;  4HK9 A;  1W6N B;  5GKA C;  1CAV A;  3SHR A;  2WSU A;  1W2T A;  3LPG A;  1X50 A;  4RGG A;  4XMI A;  2KR2 A;  3N9M A;  4ASK A;  1DP0 A;  4XIL A;  1REE A;  2ZEW A;  2V4A A;  1APN A;  1W6N A;  2PAM A;  4CCO A;  2VZS A;  5KC5 A;  3RRD A;  3AYA A;  4Q0S A;  4IEV A;  4LLF A;  2RDQ A;  1D4M 3;  3AMN A;  4WM8 B;  2DCJ A;  2OUJ A;  3WD5 A;  4D6R A;  1WD3 A;  4YW6 A;  4RQP C;  1VR3 A;  1SDW A;  1PZ9 A;  4DRR A;  1QQP 1;  2WFF 2;  4WM8 A;  2ZGT A;  3RQ0 A;  1GQG A;  2DU0 A;  2GZW A;  2QNK A;  2QQL A;  2VCB A;  2VZT A;  5LRR A;  1V0A A;  1QOO A;  5C4W B;  3O1U A;  1BKZ A;  4DY3 A;  3DXU A;  1ND2 C;  5JSP A;  4DXS A;  2JDH A;  2RE9 A;  5C4W A;  4Z2W A;  4Q4X 3;  3I54 A;  4ZXK A;  5E1R A;  4QX0 A;  5DUX A;  4NR1 A;  1MS9 A;  2FBE A;  3B93 A;  5FPZ A;  3M4F A;  4Y1U A;  4ASL A;  1COV 2;  2WLQ A;  1W8N A;  4IDZ A;  3ZSJ A;  1BEV 1;  3BTY A;  3BYW A;  3HBZ A;  5JVV A;  1ENQ A;  3D0J A;  4R8H A;  2Y6F A;  3K3O A;  1T6G C;  1JYC A;  3MW2 A;  1JZ5 A;  5GZG A;  3UL2 A;  1JZ7 A;  2KA3 A;  4K20 A;  1H6Y A;  1HKD A;  3PVN A;  1UWW A;  4WZF A;  1W3V A;  1BJQ A;  3JB4 C;  4OQ9 A;  4F3J A;  1RHI 1;  2OS2 A;  1NCQ B;  5IT6 A;  4LEJ A;  3GBW A;  3OEB A;  1AL2 2;  1F5F A;  5A1A A;  3IM0 A;  2DYC A;  2PHD A;  4QDR A;  2RS3 3;  5LRS A;  3WF2 A;  4LIV A;  4DY5 A;  1NCQ A;  4GMP 0;  3ABZ A;  1VBE 1;  5C5U A;  2A75 A;  3RNS A;  4JVA A;  5FPU A;  1OPO A;  1XOY A;  2MEV 2;  2JDZ A;  4AHY A;  4YW3 A;  1WLC A;  2VOV A;  1LHO A;  1MS0 A;  1SHW B;  2PAE A;  3NMB A;  4QU2 A;  4QWN A;  5D8A B;  1F4A A;  4Q0U A;  5FUN A;  1S2E A;  5FZO B;  1YEW A;  3AZZ A;  2IXC A;  4H7M A;  1EUT A;  4H7L A;  5D8A A;  1VBE 3;  3H8O A;  2OT7 A;  4LUL A;  3KVB A;  3ZO0 B;  1NT0 A;  1BHG A;  1SAC A;  5DZE A;  5FZO A;  1O3Q A;  5DAX A;  3S7E A;  2E32 A;  3ZMN A;  1ZA4 A;  3GZU C;  5K4L A;  5FZG A;  1H2M A;  1Q43 A;  1YFU A;  1HXS 1;  1SBD A;  2OQ7 A;  2PHR A;  3PUH A;  2VOX A;  2UYA A;  1ENS A;  5IVB A;  5IVV A;  1KEX A;  3CHX A;  5GLU A;  3WQ7 A;  2OZ6 A;  3WDX A;  2VNR A;  3U4X A;  3T3Y A;  2AAC A;  5C3P A;  1W6O B;  3VHO A;  1URX A;  2HYX A;  4EV0 A;  1YIF A;  2JJ6 A;  4AF9 A;  4HON A;  5C8W A;  5JZG C;  2CAV A;  3LQC A;  5DUU A;  1W6O A;  4HL0 A;  4IGO A;  1ASJ 2;  4YGD A;  2R06 1;  5BNO B;  2DUO A;  1RUD 2;  3ILR A;  5I8S A;  3EJK A;  5AC9 1;  3OF1 A;  2BQP A;  3NAP C;  4JGY B;  2XJV A;  4MOA A;  5BNO A;  2Y60 A;  3K75 B;  4QKF A;  3U0Z A;  5IW0 A;  4OI4 A;  3JUU A;  1N3P A;  2R04 2;  4JGY A;  4JTN A;  4KI5 M;  1LOB A;  1V6O A;  1VIW B;  1W9F A;  3WT3 A;  1OSG A;  4DNY A;  2FDI A;  3HT1 A;  1JH5 A;  2R06 3;  4FVV A;  3DYM A;  1AVB A;  1ZBA 3;  2EXH A;  4QGN A;  4QPI C;  4YM3 A;  1CPN A;  4LIT A;  5AC9 3;  4DEV A;  5BNP C;  3HD8 B;  1JHJ A;  1YRZ A;  4D6Q A;  4UI9 L;  4F83 A;  3TEY A;  3VD7 A;  3T09 A;  1MEC 2;  4LO5 B;  4OZO A;  2J1R A;  3F95 A;  4MO3 M;  1UNB A;  3RYP A;  2JIC A;  4QXH A;  2TNF A;  2XJP A;  3HOB A;  4XFB A;  4A6O A;  4OUS A;  3ZYH A;  4AG4 A;  1RIR A;  2W1W A;  2ZZQ A;  4RL7 A;  2QQJ A;  4JDO A;  1CAU B;  3D5O A;  3FBY A;  5JXH A;  5HV0 A;  5A7O A;  2P37 A;  3GCW A;  3FBM A;  3IMN A;  3V56 A;  4CDX C;  3C2U A;  1CAU A;  2B8M A;  2VMI A;  1OQE A;  2V4V A;  2D3R A;  3OYW B;  3C7G A;  1DGR N;  3RWK X;  5ISL A;  3N4M A;  3MW3 A;  1L7R A;  3OYW A;  1E5I A;  4Q4Y 1;  1VPH A;  3GGL A;  3RJR A;  3FHQ A;  4AWD A;  2D5H A;  3K48 A;  3N9L A;  5FPA A;  3ZFF C;  1PM7 A;  1S55 A;  1ULF A;  1S0D A;  4PHZ A;  5A7P A;  2VOK A;  4CXX A;  1LAJ A;  1OD5 A;  1YQ8 A;  1Y9Q A;  5A3U A;  1B35 C;  3O1O A;  4D7S A;  5HBA A;  5IVJ A;  5BNQ A;  1UMI A;  1V6N A;  4XAA A;  5HCA A;  2WO3 A;  2VAU A;  1LU1 A;  4LTA A;  4CDU B;  1AYN 1;  5DAP A;  3UET A;  1DQ1 A;  4QQL A;  3V65 A;  5C8C B;  5LK7 B;  3FC0 A;  1H0B A;  3ZFG B;  2ZGO A;  1VBA 3;  1YFW A;  2BRT A;  3AL6 A;  2IFW A;  4PI0 A;  4CDU A;  5SV5 A;  2BJS A;  3WG1 A;  3WDT A;  5C8C A;  2W2I A;  5FZK A;  3ZFG A;  3I2H A;  4DRV A;  2PHU A;  3BVC A;  3S30 A;  1US3 A;  4QMA A;  4O65 A;  4IV1 A;  1O6U A;  3FWE A;  3SCH A;  2WNU B;  3H7J A;  4MV2 A;  2J1S A;  4AI3 A;  2VMH A;  1QH7 A;  3W20 A;  4BK5 A;  1RUH 1;  1YQ5 A;  2B4K A;  1AYN 3;  1S0B A;  2HH9 A;  4FXK B;  2QBX A;  2WNU A;  5LK5 A;  1IHM A;  3WQB A;  4CU9 A;  1EAH 2;  1KXG A;  2WIN B;  1G9D A;  3P3P A;  3POF A;  5FFO C;  2UWA A;  1H9W A;  2R0F A;  1S0G A;  2WA4 A;  2BW8 A;  5EHD A;  1UY4 A;  5FUP A;  4NE9 A;  3ILN A;  1CWP A;  4A45 A;  5APA A;  4Z07 A;  2XLF A;  4I02 A;  3ZXJ A;  3DPR C;  2IFR A;  4HFS A;  4LK7 A;  3ZYP A;  4UW5 A;  1YYN A;  5ACA 2;  4GAZ A;  1RUH 3;  3BGA A;  4BOW A;  2A5Z A;  1RUF 1;  2WT1 A;  2HWE 1;  3UV9 A;  4JTO A;  3MIF A;  5A3O A;  4PIZ A;  5A3N A;  5LBC A;  1AF9 A;  2ZHM A;  3IAQ A;  1EV1 2;  2BOJ A;  2GAL A;  2WC2 A;  4YVS C;  1KFU L;  5F2W A;  1R08 2;  4B7K A;  3USS A;  1SLI A;  2R07 1;  3ZYF A;  3MIH A;  4FFH A;  1QXJ A;  4E8C A;  3AK0 A;  2VW0 A;  2F6B A;  1RUG 2;  1LEM A;  2ZEY A;  1TE1 B;  1DYK A;  4IEQ A;  3ZM8 A;  3ACL A;  2DBN A;  5FZ3 A;  1WMF A;  1RUF 3;  3PMS A;  1Y3T A;  1RMU 3;  3MV1 1;  5IYY A;  2RM2 2;  1TVG A;  3M3I A;  1JOP A;  5JCT A;  2CWM A;  1O8S A;  3UKT A;  2R07 3;  2P34 A;  3P1I A;  4AEM A;  1DLC A;  2ZCW A;  2YYO A;  1WBF A;  3CIH A;  2BPA 2;  1LGB A;  1DCS A;  2YG0 A;  3HVD A;  3PU8 A;  3WZ1 A;  2YGL A;  2ES3 A;  4W65 A;  4AQ2 A;  4GB3 1;  2VUL A;  5DPN A;  4RR3 C;  3OGJ A;  3WNM A;  1PX3 A;  2VW1 A;  1MS1 A;  3EYP A;  1NCR C;  1JW6 A;  4UW3 A;  4AFD A;  4TTG A;  1W90 A;  5FMC A;  5H9R A;  4IER A;  2QQK A;  5BPX A;  1PVC 2;  2J1T A;  4LIU A;  4MET A;  5FKC A;  3NST A;  2BOI A;  2C4X A;  2OPW A;  3Q8C A;  3NNM A;  1W0P A;  5DDJ 1;  1OVP A;  3MFC A;  2RR1 2;  3GAL A;  3U1X A;  3S7I A;  2WO2 A;  4GWM A;  3T2O A;  1ZM1 A;  1N1Y A;  3WDW A;  1RYY A;  3ZSM A;  4KWL A;  5FP7 A;  4AEK A;  1MPX A;  1JU3 A;  1H2N A;  3K3N A;  4LOT A;  3SCG A;  3TNQ A;  4HT1 T;  5BYN A;  1HQL A;  4CUC A;  1POV 0;  5EZW A;  1JMU B;  4A3Z A;  2BV4 A;  4GJZ A;  1JTZ X;  4BCU A;  3T4V A;  1PZ8 A;  1CR7 A;  1D4M 2;  1ULE A;  4I09 A;  3HQR A;  3VKN A;  1F15 A;  3SMH A;  4BMB A;  4MGY E;  4AOC A;  1C28 A;  4JGZ B;  2JDN A;  3VKF C;  4PT6 A;  3CJX A;  3ZPY A;  3ASI A;  4JGZ A;  5IK5 A;  2GNB A;  3MIE A;  1PGW 2;  1RTV A;  5FWJ A;  1FXZ A;  5JR2 A;  3LAG A;  2A6Z A;  3LE0 A;  5L9B A;  3VBU C;  4Q4X 2;  3D6E A;  4D69 A;  1PMH X;  4MZU A;  3V64 A;  5JSO A;  4QXB A;  3MGU A;  2VC9 A;  1PMJ X;  3H42 B;  1QJZ A;  4CCE A;  4Z2A A;  1J3Q A;  1NXM A;  3HPN A;  3E6B A;  4JKK A;  4OI2 A;  5J36 A;  4OCT A;  4UW4 A;  4XF1 A;  5FY7 A;  4AHX A;  3DL3 A;  4JKM A;  4OHY A;  3H1W A;  1O4Y A;  1QDO A;  4CU7 A;  3VBO C;  2Y26 A;  2ZAC A;  4OHW A;  3WV6 A;  1Z78 A;  2X5I C;  4A7Z A;  2ZMN A;  3I2F A;  1GNY A;  4ISR A;  4UT5 A;  2C9K A;  4D7T A;  3CKH A;  3ZPO A;  2P3J A;  5BNN C;  1COV 1;  3AKQ A;  2WZR 3;  2RS3 2;  3X29 B;  4Z92 B;  1BVP 1;  4IEP A;  1OLM A;  4A42 A;  4IE5 A;  4ZU7 A;  2TUN A;  4TLF A;  2ZOE B;  3TYJ A;  1LOF A;  3IMM A;  3T1L A;  5HI0 A;  3RSJ A;  3C7H A;  4RS5 C;  3ZOI A;  4ITC A;  1X9T A;  4OZX A;  2FCV A;  1W99 A;  3W59 A;  1UIK A;  4JAA A;  1UZ0 A;  1PM4 A;  1W9T A;  4W6X A;  2ARA A;  2HWF 3;  4EWD A;  1Y4W A;  1BMV 2;  1M4W A;  1AL2 1;  3IDC B;  4XQD A;  3FLR A;  4U2A A;  1QKQ A;  2JKB A;  3AP4 A;  2DVD A;  3I2J A;  5KHJ A;  1K5J A;  1UZY A;  3UGG A;  3MPP G;  3VDD B;  2FZ2 A;  2AH2 A;  1OA4 A;  2X05 A;  4XHB A;  2H0B A;  3I2I A;  2WYF A;  2RDS A;  4XVH A;  4E4Z A;  3JQW A;  5FXX A;  1VAM A;  3SNM A;  3VDD A;  5A6Y A;  2GAU A;  4PQ9 A;  5CU1 A;  2E31 A;  2EIB A;  3OCP A;  2MEV 1;  4XCA A;  4CZS A;  5F6K A;  5ABJ C;  1QOS A;  2YRO A;  3LIH A;  2PTM A;  2GU9 A;  4XUR A;  1KD7 A;  2O8O A;  1AL2 3;  1J59 A;  3EMR A;  3WW3 A;  1KJL A;  1HX6 A;  4ET7 A;  4YZ1 A;  4AHZ A;  2X09 A;  1N47 A;  4JC1 A;  4W6Y A;  3T2P A;  3HAG A;  4NPM A;  2XG3 A;  5CKQ A;  4CCJ A;  1DF0 A;  1OD3 A;  4AVS A;  3RZK A;  1UZV A;  2ARE A;  1V9U 3;  1OA3 A;  2ZGP A;  3ZN4 A;  5JMC A;  2XXZ A;  3BU7 A;  3DCQ A;  1N3Q A;  2P5B A;  1HB4 A;  2WN3 A;  5FWE A;  3T0D A;  4Q4V 3;  2DUR A;  4LBN A;  1XE0 A;  2HWB 3;  2D6K A;  3TEW A;  4QGM A;  3WDU A;  4PDW C;  3IDB B;  3RI9 A;  4D0Q A;  5B2G B;  4Y5S A;  2W08 A;  1FI2 A;  4XUQ A;  2I74 A;  4XIK A;  5B4N A;  4NHL A;  4N53 B;  2C5D A;  3LWC A;  2E63 A;  4IEZ A;  5GAL A;  2SBA A;  1RJ8 A;  4KWU A;  1ZBA 2;  5CIR A;  1RUD 1;  3BOD A;  4HET A;  5AC9 2;  1BBT 3;  1S0I A;  3DN7 A;  4N53 A;  1S2K A;  2YB7 A;  3T0A A;  2JD9 A;  3N35 A;  1BK1 A;  4AED C;  1DIW A;  4CCD A;  1DQ5 A;  3UT0 A;  2WNV B;  2ZGS A;  3DYO A;  4QX2 A;  3AZV A;  2RVA A;  2R04 1;  1KRI A;  1YQ2 A;  1ONA A;  1HDK A;  1R09 2;  1ULG A;  2CTV A;  3S6P A;  3WEZ A;  1O3S A;  2WNV A;  4TZD A;  1CIW A;  2BU9 A;  3POG A;  1BCX A;  1NA1 B;  1WA6 X;  4FPC A;  2D98 A;  1RIN A;  2ZKL A;  2VBD A;  4EJR A;  1DG6 A;  3OBR A;  1NA1 A;  4ZZ5 A;  2W3J A;  4NO4 A;  2R1D A;  2WS9 1;  3MW4 A;  2VNV A;  4FOV A;  4OI1 A;  1V70 A;  3HT2 A;  2ETE A;  1MEC 1;  2WN2 A;  2WSV A;  3A22 A;  3A21 A;  3LEK A;  3QD6 A;  4PI2 A;  4CDQ C;  1BZW A;  2VH9 A;  3NW4 A;  2EXJ A;  3ZXG A;  2XWJ B;  2ZAB A;  3L9J T;  3RVH A;  1U0A A;  1OUR A;  1F4H A;  1QY4 A;  3N36 A;  5FXZ A;  4AR2 A;  2I45 A;  4CVU A;  4LBK A;  4ZKT B;  2ZA9 A;  1RL3 A;  4Q1R A;  1UY0 A;  2WS9 3;  2QQI A;  2B46 X;  4RQP B;  2VGD A;  4GWN A;  5I8T A;  2C6S A;  3AYC A;  4J6G A;  4FQ4 A;  2RMU 3;  5H9S A;  4B3N A;  3MO4 A;  4I30 A;  3WP6 A;  4RQP A;  1VBA 2;  2DUQ A;  4K6B A;  3M70 A;  1QMJ A;  2P3K A;  1ND2 B;  4P14 A;  2D44 A;  4UFH A;  4D3W A;  1RUE 3;  3EO6 A;  1VBB 3;  4DPN A;  1F2N A;  2QDR A;  2BGO A;  2FDK A;  4M4P A;  2WLP A;  1JZ3 A;  2WWJ A;  4R9B A;  1XBF A;  2FQP A;  1ND2 A;  2RS5 3;  3TBD A;  1VRB A;  2DWR A;  4FOW A;  1EP0 A;  1G6N A;  1UL9 A;  5BY5 A;  1OVS A;  5J3U A;  3OGV A;  4KG0 A;  4DIN B;  2O14 A;  5L7O C;  1AHS A;  2K46 A;  2OPK A;  1CJD A;  1VMJ A;  5F39 A;  1VE0 A;  2J1A A;  2VTF A;  5KXC A;  4FPK A;  3ST7 A;  4KQ7 A;  1H1M A;  4O9E A;  3UJQ A;  4AFC A;  5DZF A;  1UKG A;  2QDN A;  3B7M A;  5DUV A;  3MIC A;  3WXP A;  5CFC C;  2EF6 A;  1KQR A;  3BOW A;  5JUV A;  4M3C E;  1RXF A;  3W21 A;  1O4Z A;  1S4C A;  4P9G A;  1A78 A;  4GAL A;  2GN7 A;  4ZU4 A;  5FOB B;  1VB4 A;  2J42 A;  2PHT A;  3LF7 A;  4L99 A;  1D0G A;  4UFJ A;  2CYF A;  5D2A A;  5EP9 A;  5FZ8 A;  1RUH 2;  2CY6 A;  5I0U A;  5FY0 A;  1UIJ A;  4AQT A;  4YRD A;  4LT5 A;  3OBZ A;  5A6X A;  4LKE A;  5JPN B;  5LA0 A;  1EAH 1;  2R49 A;  5F8P A;  5LBB A;  2EIE A;  2GP3 A;  4HMZ A;  3ZMO A;  4HG6 B;  2FMY A;  1CVN A;  2ZX2 A;  2YXS A;  3BB6 A;  1FOD 3;  4OUE A;  5CAD A;  4CXY A;  2ARX A;  4XF3 A;  1PZ7 A;  5JWP A;  1ULC A;  1GOF A;  1X8E A;  2LUW A;  4COY A;  2OQ6 A;  4L0P A;  1FMD 3;  4WVV A;  4YW7 A;  3V0B B;  4F7Z A;  4IUG A;  4COV A;  1RMU 2;  3V0B A;  1W8O A;  5IWF A;  4AI1 A;  2CGP A;  4DXZ A;  1EV1 1;  3SQO A;  1GOG A;  4IV3 C;  1FPN 2;  4NHY A;  1R08 1;  1Z7S 3;  2O0O A;  2D97 A;  2DVF A;  1ZZB A;  5T3N A;  1EYB A;  3EHK A;  1DQ2 A;  1RUG 1;  4NWV A;  3R4D B;  5ERL A;  3WOG A;  1GZT A;  2J22 A;  1SEF A;  3E1F 1;  4LO8 A;  2CWS A;  3KCY A;  3P3N A;  1PNF A;  4I0W B;  4AVT A;  2C1F A;  5HPO A;  4K21 A;  4OVE A;  4CCN A;  4YLZ A;  1MZ6 A;  5C3O A;  3IB3 A;  2RM2 1;  5DAV A;  5JZG B;  4QPG C;  2VBP A;  4DEQ A;  1IG3 A;  4N43 C;  2DFB A;  3GYD A;  3UK9 A;  3EXU A;  5JZG A;  3FHA A;  3TEZ A;  1RUG 3;  1C8N A;  4XFH A;  5KXB A;  2BVB A;  3AP5 A;  1X8M A;  3NAP B;  4RSU A;  2BGP A;  5BUV A;  2ZHN A;  1UU4 A;  4N8M A;  4OI0 A;  2HLE A;  3NAP A;  3WSO A;  5IVE A;  1YJL A;  1PVC 1;  2LRP A;  1R1A 3;  3QAC A;  2VZU A;  3CBN A;  4HSJ A;  2IZW A;  3UGF A;  4ZZ8 A;  5FCC A;  3SKV A;  4HSL A;  5FZB A;  3CLP A;  4QPI B;  3GZT B;  2A3Y A;  2RR1 1;  3S5Q A;  4FTE A;  2E53 A;  5BNP B;  5JMO A;  2GP5 A;  4D6S A;  4N9I A;  4K3U A;  2VZV A;  5JLV A;  5JI9 A;  1MS4 A;  3O7O A;  4B4P A;  3HNB M;  4QPI A;  2CV6 A;  1CES A;  4Q2F A;  5BNP A;  3KV9 A;  3GCX A;  1IQA A;  1Q8P A;  3RYR A;  1HJF A;  1REF A;  1H8T C;  4DZG A;  3E6C C;  2JDU A;  5IAV A;  1IS6 A;  4HXC A;  4XF9 A;  3MID A;  5A80 A;  1GWM A;  1S0J A;  2E6V A;  3U11 A;  3BTX A;  4LE4 A;  5E6H A;  2FD8 A;  1D4M 1;  5CYY A;  5FPX A;  4XQ4 A;  1SLL A;  3O1P A;  2IXI A;  4XJA A;  4URA A;  2VR4 A;  4HVO A;  5EFU A;  2VZP A;  4MGI E;  5JAX A;  2RG4 A;  5CNA A;  5A7Q A;  4LKS A;  4QQP A;  3KV5 A;  3G7D A;  3MF9 A;  3O1V A;  3ZDV A;  3O0X A;  2ZGU A;  4KGG A;  1PGW 1;  3ZFF B;  4FQZ A;  4KWJ A;  1YQC A;  3H3U A;  5C3Q A;  3VBR C;  3KT7 A;  4Q4X 1;  2QQP A;  4Q0P A;  2G19 A;  2EVX A;  1B35 B;  4NII A;  3N7M A;  4BDV B;  5IK4 A;  3ZFF A;  5SV8 A;  2WZR 2;  2CAU A;  1IZ3 A;  4NHK A;  3VZK A;  1B35 A;  4E2S A;  4E2Q A;  4HBN A;  3IWZ A;  4FO9 A;  4CYD A;  4BQ5 A;  3VUO A;  1WA4 A;  3AXE A;  3CNA A;  3PME A;  4BU2 A;  3B02 A;  2MNG A;  1AXK A;  4XYX A;  1LCL A;  2XML A;  3RZZ A;  2IXH A;  3LDR A;  2FDF A;  1JXN A;  3LPF A;  3VLB B;  3H0O A;  3POB A;  5HCF A;  3SCF A;  4A3X A;  1MS8 A;  1AUY A;  2HWF 2;  4AYU A;  1SZB A;  3T1M A;  3KHC A;  2RS3 1;  1ULO A;  3TRS B;  1AR6 3;  2DCZ A;  3IBM A;  3RMY A;  1ZRF A;  2F4L A;  2NN8 A;  2EXI A;  1Q8S A;  2ILM A;  1UOJ A;  1NYW A;  1SQ4 A;  1UPI A;  1VB2 A;  4CEW C;  2HWD 3;  2Y6L A;  1Y43 B;  1RC6 A;  4XJU A;  4BYY A;  3KVA A;  3NVC A;  1BK0 A;  1GP6 A;  4XFG A;  3LA7 A;  1KDK A;  3SIS A;  2IXJ A;  1SLT A;  4X8N A;  4X8P A;  5E16 A;  4R4X A;  4XJW A;  2Q8E A;  1BMV 1;  4LA3 A;  1QWR A;  5IK7 A;  4MGT A;  3DPR B;  3VN4 A;  4YGE A;  1GSL A;  2QKD A;  1GAN A;  3ZDS A;  3VD4 A;  1G9C A;  5CA6 A;  2XVK A;  4CUB A;  2XUM A;  3HQU A;  5A7S A;  3DPR A;  4PBO A;  4Y1V A;  2B42 B;  2YC2 A;  4YVS B;  5FY1 A;  1RUC 1;  4URT A;  2FHR A;  4Q0V A;  4OUL A;  3KV4 A;  4XFI A;  5E88 A;  3MLJ A;  2QE3 A;  5GLV A;  4RGK A;  1OHF A;  3HNM A;  1RUJ 3;  1V9U 2;  1UOG A;  4E8D A;  4YVS A;  1AR7 1;  3ROU A;  2XJR A;  5FMB A;  1DDL A;  3P6B A;  1GYK A;  4Q4V 2;  3IIA A;  4ES9 A;  1WZX A;  3KQR A;  3PTY A;  2CDP A;  2HWB 2;  3ECQ A;  4LNV A;  3Q8E A;  2ET1 A;  2X29 A;  2R7E B;  4YAR A;  2DTY A;  5GLT A;  5DAQ A;  4OLL A;  1JZ6 A;  1RUC 3;  2VD7 A;  2YU1 A;  4Q8L A;  2R32 A;  3PTR B;  2P6C A;  4BHP A;  5F3E A;  1GWK A;  2XOM A;  5FY4 A;  2V5Y A;  3POS A;  5C9A C;  1Y9G A;  1AR7 3;  1BBT 2;  2VZO A;  4NN0 A;  4UBH A;  4RHV 2;  2ZGR A;  1E5R A;  2DVA A;  2ZAH A;  4RR3 B;  4Y20 B;  1IKQ A;  4EZ4 A;  1O3R A;  1ST8 A;  3G6J B;  2GME A;  3J9S A;  3BU0 A;  1NCR B;  1QJE A;  1VLN A;  4LBM A;  4OFG A;  4ZS3 A;  2DVG A;  4MGQ A;  5C70 A;  1XSR A;  3GF6 A;  1XYO A;  4RR3 A;  4Y20 A;  3K4Z A;  1WGP A;  4A4A A;  4W4Z A;  2JWP A;  1NCR A;  1VAL A;  1WUV A;  4HKW A;  3TWI A;  2XL7 A;  3LA3 A;  3WP4 A;  1ZBA 1;  3MV0 1;  2ZKN A;  3MPB A;  4DUV A;  1M06 G;  2C9A A;  2RHP A;  2VMC A;  4YSF A;  2L9L A;  5IHR A;  1AR9 3;  2BFU L;  4Q26 A;  5IVC A;  1ND3 C;  2EAL A;  1POV 3;  4LKF A;  3ZN6 B;  3O1R A;  4PF1 A;  3M1H A;  1H6X A;  5FOJ B;  1X7N A;  1R09 1;  2ARB A;  5F5A A;  1JOD A;  2V73 A;  2XVL A;  5T54 A;  4KMQ A;  1QNW A;  1ODN A;  3ZN6 A;  4XET A;  2P6H A;  3RDI A;  3T4H B;  1T2X A;  1GQH A;  4B8E A;  1WLD A;  2Z69 A;  3WNO A;  4NMI A;  3AFK A;  3MIG A;  2WS9 2;  2WO7 A;  3N9O A;  2VCM A;  5F3C A;  1GV9 A;  5JOW A;  1CN1 A;  2RJK A;  4AGG A;  4EZH A;  4L11 A;  3AVS A;  2VMD A;  3AKT A;  5FK8 A;  2RMU 2;  1R09 3;  1W2O A;  1SFN A;  1XNK A;  1O59 A;  4O7X A;  3CZJ A;  5F3G A;  5H9P A;  4ARY A;  3ZIW A;  1DQ4 A;  4ONU A;  1YCI A;  2JEM A;  1MVE A;  4C1X A;  2Y0O A;  3VGI A;  5C33 A;  1DU3 D;  1RUE 2;  4AQS A;  1VBB 2;  3GM8 A;  4XF4 A;  1A3K A;  2YPJ A;  3USU B;  3H7Y A;  4N7I A;  3Q8B A;  5I8Y A;  3VBU B;  2RS5 2;  3MI8 A;  3PUQ A;  4AI8 A;  3JQX A;  3E5U A;  1WCD J;  3HN3 A;  4RYD A;  2BBA A;  1V00 A;  4UAP A;  5T5L A;  1BYH A;  5ANN A;  4YG0 A;  3USU A;  2NYY A;  4CDW C;  5L36 A;  4E2G A;  4GZ9 A;  2ZJC A;  3VBU A;  3ETP A;  1VRH 1;  3C7F A;  5FYT A;  1NE4 A;  4P5H A;  1WCK A;  2ATF A;  1VBA 1;  2RJL A;  2YFU A;  5KXD A;  3NKT A;  5C7G A;  5J7M A;  3BTZ A;  2X10 A;  5H9Q A;  3VBO B;  3HBK A;  2TEP A;  1LTE A;  2FDG A;  2X5I B;  1W04 A;  4L8Q A;  2WYS A;  3SEE A;  2P2K A;  2DCY A;  4AE2 A;  2PLV 3;  2Z4F A;  1WLT A;  3VBO A;  1IGO A;  1ZRE A;  4L9B A;  4WM7 C;  4EN7 B;  2X5I A;  4FFG A;  1LES A;  1O7F A;  5BNN B;  4AFB A;  2VE1 A;  4DS0 A;  3C8X A;  1QH6 A;  1VRH 3;  3I7D A;  3K46 A;  3KV6 A;  2GN3 A;  2VQA A;  4KU8 A;  4AL9 A;  5BNN A;  2XBO 3;  2CDO A;  4CE8 A;  4Y26 A;  3NV3 A;  3CZU A;  3VDC A;  1FOD 2;  5E8A A;  5FPV A;  2IVI B;  1QDC A;  4AXO A;  4TSV A;  1WMX A;  3VB9 A;  4LOR A;  5KHK A;  3H3Z A;  2GNT A;  4XXP A;  4RS5 B;  1ZZC A;  1GU3 A;  1SBF A;  2ZGL A;  5FLI A;  4AW7 A;  1RB8 G;  3VZN A;  3CJI C;  2YBK A;  1FMD 2;  3ATG A;  2LAL A;  1HJG A;  5FZ6 A;  5K7P A;  2A7A A;  4UOJ A;  4FFF A;  4RS5 A;  4FP3 A;  2JDP A;  1S1A A;  3D8C A;  2LRO A;  3HIF A;  4BLI A;  4D94 A;  1C5I A;  1QOT A;  2ADD A;  3ZXL A;  3ZR6 A;  2XQX A;  3NWK A;  1DYP A;  4FI9 A;  4A44 A;  4CRQ A;  1OOP C;  3INA A;  1U5X A;  3APB A;  1PIV 2;  1Z7S 2;  3A23 A;  5FZ9 A;  3WNK A;  4Q4W 1;  4XW3 A;  1F8V A;  1XND A;  2AGS A;  1NLR A;  5ABJ B;  4FT8 A;  4NID A;  2HBU A;  2R30 A;  1QF3 A;  2EIC A;  3HMY A;  2YDE A;  3JCI A;  5F6L B;  5I0D A;  2PHW A;  1E5S A;  2ZGN A;  4NHM A;  5ABJ A;  4OHX A;  3LB9 A;  3HWJ A;  3LIG A;  5HV4 A;  1RMU 1;  2PA7 A;  3JB8 A;  5LY1 A;  4NPR A;  1CPM A;  1SLB A;  1GZC A;  3MLK A;  3RFR A;  4COW A;  5LA1 A;  5EYY A;  3OTF A;  2CL2 A;  1FPN 1;  3LCP A;  3CO2 A;  1EPZ A;  3IKW A;  4Q4W 3;  1Q8Q A;  2QQW A;  1Q8V A;  2Z79 A;  3OPW A;  5GZF A;  4COZ A;  2Q0A A;  2VEC A;  3LDK A;  4EN6 B;  4XAE A;  2G9G A;  2E26 A;  2W1S A;  4FTB A;  1NCQ C;  4M4R A;  3LEI A;  3RZL A;  3PIG A;  5IUQ A;  3WF1 A;  5C3R A;  4YGB A;  5K9Y A;  1DZT A;  5DG1 A;  1JOB A;  4Y1Y A;  1W2A X;  4QQH A;  4XMA A;  2Q8D A;  4YGC A;  4PDW B;  3N9N A;  3DEM A;  4R9D A;  4M0N A;  1VBD 3;  3VHN A;  1FPN 3;  1QJX 3;  1R1A 2;  2AYH A;  4LE3 A;  4C8D A;  3OSD A;  1ZRD A;  4XPV A;  4RFT 0;  3KM5 A;  1W28 A;  4PDW A;  4UXA A;  3THP A;  1ALY A;  3TN9 1;  4NOT A;  3F2Z A;  1DGW A;  4KH9 A;  4QB6 A;  4G9S B;  1UXX X;  3H8U A;  4QX7 A;  4QX8 A;  1H4G A;  3ALQ A;  4GH4 C;  3KWV A;  1DGW X;  2W87 A;  2ZAA A;  3N7K A;  1L7Q A;  4AED B;  4AEJ A;  4A7K A;  3IZO A;  2GH2 A;  5J09 A;  2Y6G A;  1RGS A;  3M3C A;  3BN6 A;  5J1X A;  4GA9 A;  3GNE A;  4AED A;  1SFP A;  1DGL A;  5ANQ A;  3THD A;  1WD4 A;  5JOX A;  2ERF A;  1N1V A;  1G7Y A;  5CAZ A;  1CZS A;  1OXC A;  4WVW A;  2CSG A;  5G04 L;  1XE7 A;  3TN9 3;  1IS5 A;  3O1S A;  4IQP A;  1KDM A;  1RUN A;  3HQX A;  3FN9 A;  3I2D A;  2A6Y A;  2WL1 A;  1Q8O A;  4C1W A;  5IAX A;  1UX6 A;  3QH6 A;  1J58 A;  1L3J A;  2WWS A;  2XJS A;  3OGS A;  4FOQ A;  1OKQ A;  3IPV B;  1O8P A;  5GZD A;  1ZNP A;  4FTS A;  1D2S A;  5EJ1 B;  1YWK A;  4QM9 A;  4CDQ B;  1JYW A;  5IVY A;  1I3H A;  3IPV A;  2F4P A;  1E57 A;  2A3W A;  2HWC 3;  4HN0 A;  1ZRR A;  3RG0 A;  4KU7 A;  3BCW A;  3LA2 A;  4QHZ A;  4YM0 A;  4GKX A;  4CDQ A;  4YZ5 A;  3R0R A;  3FUO A;  3R4U A;  3WHT A;  1HW5 A;  4LBQ B;  4CA9 A;  3WQ1 A;  4QKN A;  5LAT A;  2ZX4 A;  3JXS A;  4LBQ A;  3M3O A;  5KHH A;  3J7N A;  1UYX A;  1V6J A;  4LO7 A;  1RVF 1;  2ZS6 B;  1PO2 3;  4XDQ A;  5EIY B;  3AX4 A;  1LU2 A;  3U75 A;  4LA2 A;  1DQ6 A;  4DIQ A;  3UYJ A;  1OFS A;  2DUP A;  1B09 A;  2IC1 A;  4IE4 A;  3NV2 A;  5FBZ A;  3EB7 A;  3ZYJ B;  3KLS A;  1HV0 A;  1NXD 1;  2YU2 A;  1UPS A;  1RIT A;  1Q56 A;  3KF3 A;  5FZH A;  3AMM A;  2WZR 1;  2PEL A;  2WFP A;  2PAK A;  5L7O B;  1AR6 2;  3NNJ A;  1RVF 3;  1C3H A;  2A70 A;  2OW4 A;  2Y64 A;  1GNH A;  2AZ5 A;  4ORF A;  1GMM A;  2HWD 2;  1HQN A;  2VPV A;  4R4Z A;  1XNT A;  4TWT A;  5L7O A;  3V0A B;  3CDZ B;  2BVV A;  5CFC B;  5A3L A;  1UX7 A;  3RS6 A;  1WME A;  3LGR A;  1UY3 A;  3VKO A;  3WG2 A;  4HVR A;  3ZXF A;  4A6S A;  2ARC A;  4N7U A;  3H8R A;  4HPK B;  3V0A A;  5GJ6 A;  4GWJ A;  2HWF 1;  4W6W A;  5CFC A;  3OEA A;  3ILF A;  3ETQ A;  2VXJ A;  3WP3 A;  2A6X A;  4HPK A;  5LB6 A;  1NQD A;  1C8M 3;  4Z8B A;  2WNE A;  1F9K A;  3VBH C;  4BH9 A;  2MHF A;  1E5H A;  1JHN A;  2D5F A;  3TEX A;  4OHV A;  2PYT A;  3I8T A;  2ZX0 A;  1C4R A;  4RGA A;  4J25 A;  1RED A;  3RZJ A;  3B94 A;  1LUL A;  1RUJ 2;  2UU8 A;  2VM9 A;  1QJU 3;  1QNY A;  2VNO A;  5A6Q A;  1VBC 1;  3SH3 A; 
#chains in the Genus database with same CATH homology
 4YW6 A;  4AL9 A;  1W8W A;  4LK7 A;  4CP9 B;  1W8T A;  1UOJ A;  4BQ4 A;  4LKE A;  3UT0 A;  4YWA A;  1WMX A;  2WYF A;  4A6S A;  1GWM A;  1V0A A;  4LKD A;  2C24 A;  1WZX A;  1HN0 A;  2K46 A;  2O14 A;  5D21 A;  2JWP A;  2LRP A;  4BQ5 A;  1GWL A;  2VXJ A;  4CPB D;  4CP9 A;  3F95 A;  2Q1F A;  1OKO A;  3ZYB A;  3ZYF A;  1W8Z A;  2KR2 A;  1L7L A;  1W8U A;  4YW7 A;  1OH3 A;  2LRO A;  3ZYH A;  4BQ2 A;  1GWK A;  1W90 A;  3ORJ A;  4LJH A;  4LKF A;  1W9F A;  4LK6 A;  4BQ3 A;  4CPB A;  1WCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...