2W47A

Clostridium thermocellum cbm35 in complex with delta-4,5- anhydrogalacturonic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
135
structure length
135
Chain Sequence
ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSANAFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 28
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w47A00
1JU3A 2VL4A 4M4RA 2J1AA 1CZTA 1OH4A 2VZUA 2R7EB 3T0BA 4LQRA 4P5YA 3A22A 1UX7A 3MO4A 1D7PM 1ULPA 3C7FA 3OGVA 2VO5A 2CDPA 4BK5A 1PMHX 3WQBA 4E8DA 2WAOA 4QB2A 3THDA 2J7MA 2WBKA 2RVAA 4DXTA 2E31A 4A41A 2Y6KA 3HNMA 3HNYM 3DECA 5LA2A 3SKVA 3NNGA 1EUUA 2J1TA 2YC4A 4E8CA 5IFPA 2VCCA 3I3EA 2J22A 1P8JA 1JZ6A 2PQSA 4DXRA 2JDAA 3HPNA 1US3A 3NRUA 4M4PA 3K77A 2YC2A 2BERA 3WNLA 3F2ZA 3THCA 4GWIA 2ZEYA 2VZVA 5EJ1B 2X10A 3I2IA 3P6BA 3OB8A 2YFUA 3K4ZA 2VCAA 3HNBM 2J1VA 4DUWA 2W5FA 3OGSA 2WO1A 4ARYA 5C71A 1O8SA 3WNPA 3PUHA 1DP0A 2CDOA 3K46A 2JKXA 2W1SA 2XOMA 3A23A 1R64A 2ORXA 4QX2A 1JZ4A 3I97A 4FI9A 4CU6A 2WZEA 3T2QA 2VJXA 2QQNA 4A6OA 4XUTA 3IDAA 2ORZA 5J1XA 1TVGA 4D0QA 3T0DA 3UETA 2KD7A 1W99A 1JYWA 2X05A 3ETPA 2VMCA 5HPOA 2WABA 2QQOA 2WDBA 3VDBA 2WO2A 5JR2A 4A42A 3T2OA 5LA0A 2VM9A 2BGPA 3LEIA 2E26A 4A44A 3LE0A 3LPGA 2VR4A 3I3BA 3NJXA 3GDBA 1ULOA 1KEXA 3LEKA 1UXXX 2XONA 3C7OA 1GOFA 2ZXQA 4W50A 2W47A 1EUTA 5EIYB 1I5PA 3WF3A 1W8NA 2WZ8A 4CUCA 1JU4A 2VTFA 3J7HA 1K3IA 4ARXA 3FHAA 2VQUA 2BGOA 4L0PA 3ACFA 2QBXA 3VD9A 4LKSA 3VD7A 1RYYA 3SEEA 4XUNA 1SHWB 3OGRA 1MPXA 3IAQA 2DDUA 2Z4FA 1GQPA 4QDSA 2C4XA 2QQJA 1YQ2A 4UAPA 1UMHA 2B9VA 4IUGA 2DCKA 1JZ5A 4AG4A 4KWUA 3I2FA 5C7GA 3T08A 3IB3A 4JKLA 4P08A 5DN2A 3I2GA 2EIEA 4XUQA 5CZKA 2VZSA 3EB7A 2W46A 4DEVA 5JXHA 4RYDA 1UY0A 5JMOA 1JZ2A 2WYSA 4ZZ8A 5EJZB 2DCJA 1NKGA 3WNMA 1UYXA 3T2PA 3ACGA 3GGLA 4GWJA 4OYUA 1W9SA 5IJRA 3VD5A 4Z2AA 5DMYA 2XHNA 2VZRA 4TTGA 4JHZA 1LNSA 4CVUA 3MUZ1 1UYZA 2VCBA 3AC0A 3MUY1 4XZUG 4BK4A 1K45A 2ZEXA 3VDCA 4W8JA 1NX9A 4OMDA 3MV11 1XC6A 1L7RA 3HN3A 2WO3A 2QQMA 1TG7A 4GZ9A 2EIBA 2W91A 2W3JA 1CIYA 1IQDC 4KI5M 1CZSA 3NQHA 4P00B 4QAWA 3FL7A 2HLEA 3CQOA 2W87A 4HG6B 1J84A 5IHRA 2QQKA 3T09A 4OUEA 2YG0A 1F4HA 1XNTA 2YB7A 2VZTA 4OZOA 3PUIA 3W5MA 4A45A 1T2XA 4A4AA 2C26A 2LW8A 3EYPA 1WCQA 3CIHA 4ET7A 1PX3A 2QQLA 2YFZA 3BN6A 2Y6GA 4QX1A 1H6YA 1PMJX 3GM8A 4W4ZA 4ZY9A 3DYMA 3FN9A 2Y6HA 1OT5A 3W5NA 1US2A 2W9XA 3C7HA 3IAPA 3A7QA 2HYXA 5LA1A 1GOHA 4PF1A 4JKMA 1HN1A 3CZUA 3C7GA 3K4DA 2OKXA 1UY4A 2VZ1A 3NJVA 2W95A 4QDQA 1JHJA 3K75B 3HEIA 2W1UA 1J83A 3I2HA 3K4AA 1JZ8A 4CU9A 2VZ3A 3WF1A 3WNNA 1KGYA 4BXSV 5F7UA 3CMGA 1JYVA 2Y6LA 1JYNA 3WF4A 5JXIA 4BJ0A 1UY3A 3LEGA 2ZEZA 4YPJA 4QX0A 4PQQA 1W0NA 2VMEA 3T0AA 3FHQA 3CDZB 1UXZA 3C7EA 4DUXA 1L7QA 5JXJA 3ACHA 2C9KA 2RV9A 3SEPA 3A21A 3DYOA 3IIIA 2VQTA 1GMMA 2JD9A 2WUHA 3OEAA 5LCWL 1JZ7A 2QQIA 4MADA 1UZ0A 1SG3A 4OMCA 1O8PA 2J1EA 5DPNA 3UNPA 2EIDA 5G04L 2RJ2A 2V72A 4RN5A 4QDRA 4JKKA 1OF3A 1XPWA 1W8OA 2B4KA 1XNAA 4CU8A 4DXSA 1O59A 2J1UA 4UI9L 4XUPA 2VMDA 1DLCA 3LQCA 2LS6A 3GXUA 2VC9A 1JI6A 1F4AA 2WQ8A 1OD3A 1CZVA 2Y6JA 3VD4A 4LHSA 2L9LA 2W1QA 4UOJA 3DYPA 3WNOA 2BBAA 2WAAA 3WF2A 5B4XA 3E1F1 3ABZA 3OBAA 4AAXA 4QPWA 1K42A 1GNYA 2V4VA 2WN2A 3P1IA 5C70A 4XUOA 3OG2A 2XQXA 4P02B 2J1RA 1BHGA 2ID4A 3WSOA 5IFTA 1UY2A 4LPLA 4JX0A 1W9WA 3VDAA 3BGAA 2VZQA 3ECQA 2W94A 1GOGA 4MGQA 2X09A 1H6XA 5HXMA 5G05L 3HOBA 2Y8KA 5JXGA 1NAEA 5CYYA 5DQ0A 1UYYA 4CUBA 4MGSA 4PT6A 2WN3A 3MBWA 1DYOA 3HJRA 1NUKA 4CUAA 4QB6A 1UY1A 4A3ZA 3C8XA 4DEQA 4DUVA 3VD3A 5FUIA 2VMFA 2EICA 1CX1A 2V5DA 1SDDB 3UESA 1W9TA 1JYXA 3CZJA 3CKHA 4ZZ5A 2W92A 2Y64A 3U37A 3I2KA 3SKJE 4BDVB 5I0DA 3JXSA 1UMIA 1K12A 2E32A 1JZ3A 2BZDA 3D3AA 3LPFA 4TXWA 5B4NA 2VOTA 2ZEWA 5IYYA 4XVHA 3WNKA 3OEBA 1UWWA 4QB1A 4CU7A 4KMQA 4XURA 1PX4A 4QX3A 3WF0A 2VZPA 3WEZA 3ZM8A 2J1SA 3I2JA 2VZOA 1GU3A 1OF4A 2E33A 3MV01 3I3DA 5JUVA 4D8MA 2JE8A 5A1AA 4MO3M 1WKYA 4ZXEA 3ACIA 1GUIA 2W1WA 4MOAA
chains in the Genus database with same CATH superfamily
2XHKA 3BTYA 3O1SA 2ZKNA 3RFRA 1B09A 4XHBA 5FZBA 1OH4A 1Z7S3 5AC93 2XLAA 2VGDA 3T0BA 4LQRA 1UX7A 1S0CA 2WNUA 5J7MA 2RG4A 1ULPA 1W8ZA 2WJSA 3RZGA 4PBOA 4JRLA 1IHMA 3I54A 3OGVA 3VBUA 1QNYA 1RJ7A 2CDPA 5FPXA 1PMHX 5KXBA 2BJSA 4A2UA 4QB2A 3VUOA 4AQ2A 4YVWC 2WINB 2XVKA 2A75A 2WBKA 4IE4A 1WMXA 4MH0E 4DXTA 3Q8FA 5FMOS 4EQVA 5BNOA 1XSRA 3APBA 1BVVA 1WCUA 3ZYRA 2J1TA 4E9KA 1E5SA 2GC1A 3I3EA 4KBZA 5T5JA 3WT3A 2J22A 3LDBA 1YI9A 3NJYA 1HXS2 3LA3A 3VZOA 3PVBB 1POQA 1RVF2 3HPNA 5LEJA 4MX3A 3L2YA 3NRUA 5E16A 3KV5A 5FZ8A 1UPSA 5C33A 5CU1A 3LDKA 1HW5A 1VRH1 2B45X 4XJ9A 1WGPA 2WYFA 2JDUA 2W68A 1UOJA 3F2ZA 3PTRB 5FKCA 4GWIA 1SBFA 1UIJA 4NUBA 1FATA 5KHGA 5F2WA 2A3WA 2SLIA 1H1MA 1LOBA 1DF0A 4Q4W2 4FOYA 3H3LA 3JB4C 5DZFA 4GB33 4YZ4A 4AQSA 2GAUA 2JIGA 2X10A 4NVPA 1CQ9A 4S2FA 3O12A 3OB8A 4QHBA 1XYOA 2D6LX 1NXD1 4UBGA 2J1VA 4IV1B 2JXAA 1DYPA 2ZGTA 2W5FA 2OA2A 4YRDA 5H9QA 1FMD1 2VH9A 1DCSA 1GWMA 4NHXA 2HEVF 2PHWA 5FYCA 1EP0A 3MFCA 5KR7A 5DZEA 3NV1A 1GFF2 4YM0A 5CA6A 1DP0A 3HAGA 3K46A 2RS51 1ENXA 2W1SA 3A23A 2ORXA 3FHIB 4N43C 3INAA 4Q0QA 1FNZA 2JDHA 2G4IA 1TMF2 3AP4A 4IGOA 4R9BA 5FWJA 2P34A 3ZFFA 3ST7A 4NWWA 3RG0A 4UFMA 4AGGA 4Q0PA 4QGLA 3WHTA 1LHUA 4NHYA 2VJXA 3T4HB 2WO7A 4ZS3A 4A6OA 3AX4A 3LOBA 4YW2A 5LY2A 1OQEA 1C4RA 5EWSA 5DAQA 1XE8A 4GMP0 1FXZA 2ORZA 2HWD1 4CDXB 2HYKA 5IK5A 5BNOC 1QQP3 1TVGA 2RMU1 4AWDA 2E63A 4B7KA 1FPN3 4IV3B 1OA2A 1LJ7A 4AYUA 4H2AA 4MGYE 1QXRA 3CO2A 1Q8QA 2IFWA 1XBFA 2KD7A 3VBSA 1W99A 2WZR1 5FCCA 1S2KA 4EN6B 2X05A 1D0HA 1AYN1 1VBD3 2D97A 2VMCA 3ETPA 3NVCA 3MFAA 4I0BA 1LOFA 4QXHA 1GANA 4DY5A 1AL23 4XAAA 4LLOA 2VCMA 5FK8A 5F3CA 4LA2A 3I49A 3LKJA 2DWRA 2ZGKA 4I2OA 1RITA 4ZU4A 3ATGA 3NNMA 4AW7A 1UZVA 1NQDA 2VM9A 4OZXA 5IT6A 4GWMA 4GJZA 4UFJA 4Y4YA 3KV4A 5A6ZA 3M8LA 1W03A 4WVMB 2E9QA 3PUSA 4PI0A 1C1FA 3I3BA 4ORFA 1G8WA 3RDIA 3GDBA 1VRH2 3SCFA 1W6OA 1D2SA 1KEXA 3LEKA 1W6NB 4KWJA 2ENRA 3J8F3 2IFRA 2W2IA 2BWAA 4K7JA 5KHJA 1EUTA 2XKPA 5EIYB 4QHOA 4XYXA 3UV9A 3I59A 4G9SB 2Y33A 2VTFA 3KT1A 4MLOA 4ARXA 3FHAA 4IDZA 4JQRA 2GN7A 3I3MA 3ZR5A 1F8VA 2R0HA 4UW3A 3RMXA 4UFKA 4FBFA 4P9YA 1D0GA 1FMD2 4PQ9A 3N9MA 3AFKA 5ABJC 1H8TC 3GCXA 3L2HA 4TSVA 2JIJA 5DABA 3VBFC 3WXPA 1MPXA 3DPRA 2RS52 3PVNA 2DDUA 2TNFA 3WV6A 4YSFA 4HMZA 1HQNA 2BUKA 3D82A 1D4M1 2Q8DA 5H9PA 1PVC3 4P14A 3VBSC 4A3XA 2WT2A 2EXHA 2BYVE 1OA3A 2AR6A 2HWB3 3K48A 4HK8A 4AG4A 3ETQA 4WVVA 2VNRA 4YGDA 4K20A 2VOKA 5IWFA 2YHJA 1TEIA 1H4HA 4FT8A 1KS4A 2HWD2 1GQHA 3H50A 2EIEA 2RMU2 1ZRRA 2P2KA 2ES3A 3EB7A 5FKBA 3AFGA 2UYAA 4RQPC 2WZR2 4PDWC 1NLQA 4CEWA 4R4XA 1AYN2 4QD2A 2OW4A 3OGGA 4N9IA 4Q4X3 1JZ2A 4OULA 3MIBA 1NA1C 3ZYJB 5FZ7A 1AHSA 2C1FA 2DCJA 1NKGA 1S55A 1UKGA 2F6BA 2VUCA 1GYKA 1LEDA 5IJRA 1W9SA 2LM3A 5AFBA 3OPWA 2VZRA 4CCCA 5I91A 4TWTA 3ZKUA 1WUVA 3POGA 4RD7A 4YM2A 1KITA 3RZHA 1UYZA 1SFNA 3MUY1 2PTMA 1K45A 1ZBA1 3BALA 1YWKA 2ZEXA 2CWSA 4Y1YA 5A32B 3OCPA 1W6MA 2DVAA 5FYYA 4AEMA 3WVJA 3ZFGA 3IDBB 1MS4A 4BIFA 3MV11 5LASA 4W6XA 4NROA 3PVOA 3HN3A 2FBEA 4NMIA 4RGKA 4WZCA 2ERFA 2XJRA 1MS8A 3VZLA 5FDBA 1QHDA 2X5IC 3ILNA 4Y33A 4XZPA 1ULDA 1OA4A 4GZ9A 2JB8A 1XJAA 3BPZA 4A7ZA 4YVSB 1CIYA 4LJHA 5JCTA 2WFF3 3N7JA 3JD73 1YFUA 1HV0A 2ZGOA 5FMDA 4YZ2A 4H7LA 1FYUA 2W87A 4M00A 1YCIA 3NNLA 2C0ZA 4HG6B 3V0AB 1NCQB 5IHRA 4OUEA 2YG0A 1XNTA 4RS5B 1HQWA 2D6NA 5FV3A 5LRRA 4E27A 2CU5A 1VBE1 3WCSA 2LW8A 4MGIE 3LF7A 4CCDA 1D4M2 2WS91 3ZMNA 1WCQA 1O3SA 1VJ2A 4IEZA 4XCBA 3CIHA 4AI2A 5ANNA 1PX3A 3BN6A 4ET7A 5JPNB 2Y6GA 1LECA 3AKRA 3SCHA 1QH7A 3ME2A 3M3QA 5EFUA 1JN2P 2ZHKA 2WNUB 1O91A 3DYMA 5FUPA 1RUG3 4EV0A 1ZZCA 4HETA 4Y24A 4L9BA 1OT5A 4B1MA 3VBUB 5IW0A 1DGWA 4KU7A 4V2WA 5FZCA 3VBHC 1QH6A 3OF1A 4R4ZA 4GALA 1W2OA 2A7AA 1BK0A 1IKQA 1SBDA 1HJFA 1H30A 2P3KA 3A7QA 4UF0A 2MPFA 4YGCA 2YU1A 4R9DA 1MZEA 1U5ZA 1VP6A 4YW3A 2OKXA 5LB6A 3VDDC 2W52A 1NOVA 2DUQA 5FO7B 4Z8BA 1FV2A 5FIXA 4XQWA 4NR1A 2P6HA 1JHJA 3RZJA 1VR3A 2XLGA 5FXVA 5I0RA 4Y20A 4KBBA 3B3QE 3ZXKA 3H3UA 4QX5A 1KDMA 5H9SA 2O0OA 3M3IA 1WCSA 1ZBA2 4YM1A 4AI3A 5F5QA 3T30A 4MXVA 5I0TA 1JZ8A 3JQXA 1BZWA 4CU9A 4DPNA 1VMFA 4OQ9A 3IMMA 1H2KA 1CIWA 1KGYA 4I30A 5A3PA 3VZNA 4CSWA 2VPVA 3ES4A 4LO6B 4Q0UA 3PVEA 1AXYA 1OKQA 2XL7A 3FWEA 3SHRA 3A4UA 2LALA 1AL0G 3LA7A 2EXJA 2H6BA 2QVSB 1GQGA 2XJQA 1DQ0A 2PHXA 5FY5A 5KHHA 4FPJA 5I8YA 3KD4A 5AVPA 1AR61 4X8PA 4AQ6A 1VB2A 2ZX3A 4Q0SA 3O5SA 4HVQA 5FZGA 3ORJA 2BVVA 4PQQA 3WP3A 1PGW1 1W0NA 4CCJA 2QQVA 5F2SA 2JEMA 1VBE2 4FP2A 1CN1A 3ZFFB 1UXZA 4LHLA 2WS92 3GZUC 2R041 5BNPA 1HJGA 5CFCC 3A0KA 3DYOA 3IIIA 3WG4A 3RVHA 5FPAA 3WDVA 1JZ7A 5AVAA 5JOWA 2RR11 4BWOA 5JMCA 1QIQA 1L3JA 2AUYA 4GXLA 2IVIB 2KM2A 1XB9A 2CY6A 3TN93 4BQYA 3RZKA 4UXAA 1CAWA 3SH4A 5DPNA 3UNPA 2QQWA 5G04L 4D7TA 2V72A 1Z7S1 4RN5A 5AC91 3HIFA 3ZKYA 4Y3OA 1MZFA 1WW4A 1O3QA 1H8VA 1XPWA 1ZM1A 2A6ZA 1OD5A 2FCVA 3D8CA 1NCRA 5GZCA 3DV8A 1FMD3 4CU8A 2VMHA 2OZ6A 2ARBA 3NV3A 4QHZA 2QDRA 1WLCA 3LQCA 3LFIA 1OMIA 1UKRA 1CZVA 2RS53 2Y6JA 3JCIA 2AEYA 2DBNA 5FREA 1PIV3 1J3PA 1T6GC 2QCSB 4GAZA 4A7KA 1K5MA 5FUNA 2I07B 4OHYA 4Y1XA 5B4XA 3MW2A 4AAXA 3RJRA 1K42A 1W6OB 1A78A 5FPLA 1VBC3 1UNBA 1PO13 2C5DA 2GNMA 2PAEA 3H7YA 4FOVA 2XQXA 4XUOA 1LU1A 5D21A 5FZ4A 3ZN5A 3O1UA 3KHBA 3WUCA 1UY2A 3I59B 1W9WA 3TEZA 3BGAA 2VZQA 2XJUA 1Y7BA 2RMU3 3LB9A 3LFMA 4IW3A 3OY8A 1KJLA 5FPBA 5GZGA 2JECA 1H6XA 2FD8A 4IQPA 5JOXA 1VLNA 3AB0A 3WDUA 5JZGC 5JI7A 4GB31 1AYN3 2DTYA 3KM5A 4HKOA 3LGRA 1VBA3 1NAEA 3KZ4C 4AVBA 3DPRB 5CYYA 5F37A 1AR62 2RDQA 4GMP3 1UYYA 3MIFA 4K1ZA 3AKTA 2AZ5A 4NO4A 5A3NA 1PGW2 3OUJA 5DUUA 5KWRA 2Q30A 2WN3A 2A70A 2DU0A 5H9RA 4M01A 4UFIA 2BBVA 4LKEA 5E1RA 1DYOA 1LHNA 1UX6A 2IXIA 4UFHA 5F9TA 1NUKA 2VTXJ 1RXGA 2R042 2WT0A 3NMBA 4CUAA 1I5ZA 2BQPA 4A3ZA 1LGBA 2P5BA 3C8XA 3I3QA 5GLVA 4DEQA 4ISRA 2RR12 4OUSA 2MHFA 3WHUA 3EBRA 4IERA 1HB4A 4ASKA 2VMFA 3RWNA 2VNGA 3BUCA 2V5DA 3DN7A 3PUQA 5C8CA 4OUMA 3S5AA 4BIOA 1AZDA 1Z7S2 1SBEA 2P17A 4CEWB 5AC92 3EXUA 4B1LA 2RE9A 5FYHA 4CP9A 1K5MC 1QQP1 1JYXA 5L19A 1QXJA 3AP9A 4FAGA 1FPN1 2BEOA 4WBBA 3UYJA 3WG1A 4MG2A 1WMDA 1WMEA 2EALA 2VXJA 4OHZA 4YFZA 2NQYA 4UW4A 4XABA 1UMIA 1K12A 2DFCA 2E32A 3TNQA 1VBD1 1CJPA 2BZDA 1XU2A 3D3AA 4Q1PA 4XW3A 1AL21 5F5IA 3ZYIB 4DRVA 2VOTA 2GDFA 1RXFA 5BNNA 4XVHA 4QMAA 4P5HA 4IE5A 3GYDA 3S5QA 5I8TA 4XXAA 1DQ4A 4O61A 5JOZA 3ZFGB 4XURA 5F5CA 1LTEA 4QX3A 1OQDA 1X8MA 3D6EA 3BODA 2QDNA 3HT2A 4FFIA 4DY3A 1KS5A 3ZFEA 2Q1FA 3AYCA 3MF9A 4G4FA 4IE7A 2XG3A 5SV5A 1OF4A 2D5FA 1AXKA 1TE1B 2YGLA 1LAJA 4Q8KA 3GZTB 3LSDA 3UKNA 4DINB 3KT4A 4MO3M 1O3RA 1H9WA 3VZJA 1K5JA 2JDZA 2YBSA 3GJAA 4AZZA 3Q8EA 3E6BA 3WG2A 3MLJA 5EQUA 2X53S 5C6CA 3AKPA 2E51A 1CZTA 1V70A 3RNSA 4NWVA 3MGUA 4LR4A 2R7EB 2XUMA 3A22A 1LGCA 4QGMA 1D7PM 3SCGA 2ADEA 3VLBB 2LRPA 5FYIA 4COWA 2B7YA 3I4IA 5DUXA 2QTWB 4XFGA 4CA9A 2HJIA 1WWYA 4H3WA 1C5IA 2VO5A 3DUIA 3VHNA 3C3VA 2QZ3A 3B00A 3WQBA 1OKOA 2G9ZA 4HVRA 4XJZA 5FYVA 1PVC1 3U4SA 2XUEA 2RVAA 1MACA 4BHPA 4A41A 1WBLA 4BMBA 3HNMA 2D98A 2HWB1 2VTXA 4IEUA 5HBAA 3E6CC 1CAVA 1W3XA 2ZABA 3CHXA 4IV1C 1EUUA 2YC4A 1ZZBA 4IETA 4E8CA 1CPNA 4UF0B 2VCCA 1ZNPA 2YBKA 1ENQA 1RB8G 1C28A 1QQP2 1JZ6A 4AHYA 1FPN2 2PQSA 5FMOL 1VAVA 1SDWA 1IGOA 3THTA 3RQ0A 5A7WA 2BERA 1X33A 3WNLA 3JB8A 1XQNA 1VBD2 4EWAA 2DCTA 4Q4X1 5CG8A 1AL22 4Y20B 4KL1A 1U5IA 1DZRA 3N9PA 1VBE3 5EJ1B 1QU0A 1STMA 3PNAA 3I2IA 3P6BA 4AI1A 4QU2A 3W20A 3K4ZA 4CDQA 2VCAA 3HNBM 1GZWA 1UZWA 2ZAHA 4K40A 4CTEA 4CDXC 3D4KA 4FPYA 4HVOA 1LEMA 1JODA 5FJHA 5FZ6A 4IV3C 1JHNA 1DYKA 3K2OA 5FZFA 5A33A 5C71A 4CCOA 4EZHA 4GJYA 2JKXA 2XOMA 5C5TA 4PLMA 2DVDA 3UL2A 1JZ4A 4AE2A 2DFBA 1MQTA 4DMIA 2WZEA 3IDCB 3PUAA 2CTVA 1MR5A 3USUA 1YEWA 2QQNA 1TNRA 1LOEA 3WQ0A 2WFF1 2QQPA 3JD71 4AR2A 2JB4A 1XNCA 4BPZA 5A1LA 4ZKTB 2HEWF 4LULA 1NE6A 4OHXA 5J1XA 1JXNA 3GBWA 3PU8A 4EN9B 2P3YA 1HLCA 1Y9MA 4BQXA 5BNPB 5GKAC 5DDJ3 3T0DA 3DKQA 1W04A 3Q8CA 3VL9A 4BQ2A 1POV0 3SC7X 5FY0A 4M3CA 1CAWB 2HWE3 1PVC2 5HCFA 2WABA 2QQOA 3DF0A 1S0EA 4HT1T 2CNAA 1VPHA 2VU9A 2XBO3 2VMIA 5FTTC 4B29A 2HWB2 3HN1A 4A42A 5CIRA 4LEJA 2IZWA 4FPEA 3BU0A 5BV6A 1RUG1 1JUHA 1ODNA 1GZ9A 3DEMA 1NCRB 1CGPA 3LEIA 5F6LB 2F4LA 2RHPA 4NHLA 5KC5A 5KHKA 4KG8A 4UYBA 3KGLA 5CBLA 3LPGA 1R1A3 3OBRA 3POJA 2R073 1E5HA 3RSJA 3S57A 1DU3D 4D6QA 3NJXA 1KDKA 2GMMA 1AR63 2ZMKA 5CAZA 3VV1A 2WA4A 3O1TA 3VKMA 3C7OA 1GOFA 2ZXQA 4W50A 4Q4X2 2GC0A 4OCTA 5LEKA 1I5PA 1W8NA 2JWPA 3LD8A 4Z2WA 4CUCA 2GZWA 5K8SA 4TZDA 1K3IA 1DLLA 4N90A 1JYCA 3W21A 1PNFA 2YROA 4FXGB 2NLRA 4LXLA 3ACFA 4ASLA 5C3QA 3RZLA 4XFHA 1AYM3 1QNWA 1EYBA 3BCWA 5FR3A 2RR13 5JIAA 4HN0A 3POWA 3ALQA 4NIGA 1RYYA 1M06G 3OY8B 3LZZA 1XYNA 1N1TA 2RJKA 3FLRA 1AX0A 5F3EA 4BE3A 3HQUA 1GQPA 2AYHA 4FTEA 4Q2FA 4QQLA 1GKBA 5A6XA 3KGZA 2QQJA 4UAPA 1FV3A 2VECA 5FRAA 1UMHA 3H8RA 2VUDA 1S0GA 5FP9A 4IE6A 2MEV3 4AF9A 3M7AA 3MLLA 5LY1A 1AR83 2WFF2 2FHRA 3T08A 5JSRA 3JD72 4BQ5A 3H3ZA 5T5PA 5A3UA 3I2GA 4BQ3A 2Z2SB 5GZFA 5LRSA 3FMGA 1OLMA 3H42B 3CJIA 1KRIA 4Q8LA 3POBA 5CZKA 3X29B 3KMHA 2BWCA 1W9FA 1SLCA 2J42A 4E2QA 3E5UA 2ZX2A 4YWAA 1ULEA 1W8UA 4HONA 1UZYA 3FLPA 4AVAA 1F31A 1X7NA 2DTWA 1AVBA 1EPZA 2ZKLA 5J3UA 5JMOA 2ZA9A 4ZZ8A 5C8CB 1ENRA 3LCPA 4JQTA 4OI2A 5F32A 2WWUA 3OOXA 5EJZB 5C3SA 4B4QA 1UD1A 3WNMA 3JZVA 4YVSC 3GGLA 3QCWA 4CP9B 3TNPB 3ASIA 3V64A 3TN91 2XHNA 1IPKA 1RUG2 2BGCA 2VXRA 2WNVA 1V6KA 1S0FA 5JDBA 4UW5A 4XZUG 3AC0A 1NCQC 3MIHA 4RS5C 3VDCA 4W8JA 2FDHA 4YNIA 2VQ0A 4IESA 4OMDA 3U11A 5FP8A 5BNNB 4LBOA 4NJ4A 1XC6A 1L7RA 2PHFA 4ZONA 5CKNA 3VKLA 1JH5A 2XJTA 2GMEA 1W0OA 2WA3A 4MGKE 5D8AA 3E5QA 4CXWA 1GWLA 4BQ4A 2EIBA 1C8NA 4H7MA 5FZHA 3V56A 3MZHA 2WNUC 3PIGA 1N47A 2WRAA 4X6QB 3ZFEB 1PIV1 3UJOA 5DZGA 2C9AA 3RRDA 3VBUC 3NQHA 4QPIB 4QAWA 3BIWE 2IXHA 3FL7A 3EQEA 3LOIA 5B2GB 4KG0A 4XILA 5FYZA 2EAKA 3ZYPA 2ILMA 1LOGA 1VBC1 4QQHA 1PO11 2QQKA 4C1XA 4BU2A 2D3PA 3D5OA 4OZOA 3PUIA 4DZGA 2ZGQA 2PELA 5CADA 3OSDA 4I0AA 2C26A 3AM2A 1Q8PA 1OQ1A 1YLLA 4EN0A 1DGLA 3BU7A 4E2GA 1PZ7A 1TME1 5CKMA 2JE9A 1AX2A 1BCXA 3EMRA 1J59A 1WW6A 1VMJA 2A73B 3WW2A 1OLRA 5ACA1 4NRMA 1BXHA 2VNOA 5E8AA 1X9TA 4IE0A 1RUJ3 1IPSA 4P9LA 3WW4A 4DB5A 5J96B 1VBA1 4FQZA 3W5NA 3MIGA 5HCBA 3ZXDA 4GMP1 3FLTA 4JV4A 1OH3A 2D93A 5FMBA 4A6SA 4D94A 4KGGA 2CSGA 1AXZA 1KXGA 3R4DB 1W90A 4LHKA 5EHDA 1GOHA 2JDPA 2QQUA 4MXWA 5F6KA 4Y5TA 2IVJA 1QGLA 4Q4Y3 3BYWA 1CAVB 1RMU3 3CZUA 3ZSMA 3K4DA 1QEXA 2PYTA 2R1BA 3WY6A 2UWCA 3ZOIA 1H2LA 2V5YA 2W95A 4QDQA 1LKNA 1IQAA 3N9OA 3TN92 4Q29A 5GLZA 2ZHNA 5CNAA 1OVPA 4JC1A 2AC1A 3AXEA 5HI0A 2R6QA 5A7WB 1G9FA 2W1UA 1J83A 3SXWA 3W9AA 3UKTA 1LB2A 4L11A 1REFA 4FXKB 4MYEA 3I2OA 1I9RA 3LIGA 2G9GA 1JYTA 3ZFFC 1AR73 2H6CA 2VZ3A 3WP5A 3WNNA 1UQXA 3OGJA 1SFYA 1CAXA 2A6YA 4XFCA 4E4DX 2EVXA 5JWPA 3UGHA 3QBQA 4CDQB 2D40A 3U78A 1GZWB 3CMGA 1CPMA 2R30A 4WM7A 5GJ6A 3LDRA 3D0JA 2Y6LA 5FLHA 3LSEA 1OURA 1PIV2 3KB5A 3OPZA 5A7SA 5A33B 3G7DA 1GSLA 2WKKA 2JG9A 1NQJA 1UY3A 3UT0A 1LOAA 1QY4A 3MF6A 2OVUA 4YPJA 1C3HA 3H1WA 5JSOA 2RJLA 1VBC2 4QX0A 2OYZA 4HFSA 1B35A 1LOFC 1PO12 2PAKA 3CNAA 2JDYA 2VMEA 4N8MA 3WDTA 5A3LA 3FHQA 2TBVA 4FCAA 1F35A 4R9AA 2PLV3 2WIIB 1MQTB 2P3IA 3KCYA 1EAH1 3NNJA 2NN8A 4I3PA 4N53A 3N7LA 4QX7A 2G9FA 3ZYFA 4CCEA 3USUB 4COVA 1H2MA 1TME2 3WP4A 3A21A 1MS1A 4ZXKA 2VQTA 5IVBA 1GMMA 5FK7A 2GNDA 1DGRA 3S7IA 4MADA 5ACA2 3FJSA 5E89A 5JI9A 1BEV3 5EYYA 4JVAA 2ARXA 1SG3A 3MEPA 4ES9A 1VBA2 1LRHA 1QJX3 3MYXA 2ARCA 4QDRA 1Q3EA 4HBNA 4C1WA 1YQ8A 1OXCA 4O7XA 4URAA 5LK7B 4M3CB 4C90A 1WD4A 2B9UA 4BH9A 3GALA 3FUQA 5L9BA 1X9PA 2B46X 4K9SA 1NLRA 5T5LA 4OI1A 3VBRA 2RDNA 3IBMA 2GH2A 4XJWA 2LS6A 3M3OA 4IEPA 4X6RB 3ZLIA 4PIZA 4AVTA 1GNHA 3QACA 1SLAA 1JI6A 2WQ8A 4IEVA 1OD3A 3NAPA 2BNOA 5DAXA 1UOFA 1KFXL 5T55A 3ZSKA 3ROUA 1APNA 4UOJA 3DYPA 3WNOA 2A6WA 3DPRC 3MW3A 5J98B 1LOCA 1S2EA 3FE5A 3WF2A 3ZR6A 1ZRFA 1GNYA 3N35A 5A7OA 2VVFA 3VHOA 1CESA 4BXFA 4IEQA 3SLIA 1VB4A 5C70A 3NKGA 1UU4A 3D0SA 3OG2A 4KH9A 2ID4A 5M0TA 4FPHA 3ZMOA 4LPLA 4JX0A 1UPIA 5CFDA 5L9RA 2DVFA 3CU7A 1PVXA 3NJZA 4AVSA 1W2TA 3ECQA 2UY8A 3POEA 4LHNA 4LA3A 1HDKA 2X09A 3QLQA 4INDA 1W6QA 1WCKA 1ST8A 1H0BA 2P4EA 4JZRA 1QOOA 2CL2A 3AJYA 5FLJA 2OQ7A 3KV9A 4NPMA 2DBIA 2NYYA 4BB3A 2D3RA 5JXGA 2PHRA 3U07A 3KHCA 4G3YC 5C5UA 4J25A 3Q8BA 4IXLA 5DQ0A 4CEWC 1IG0A 2JDMA 1RUE1 1NG0A 1O6UA 3N7MA 4LTAA 3E97A 1OVSA 4CUBA 4MGSA 5HCHA 3EJKA 1UAIA 1VAKA 5K0UA 1NLSA 2QJVA 1ND2A 1EAH2 1QDOA 4K21A 4V1PA 1PM4A 5J48A 1POV3 1YIPA 3CJXA 1UY1A 3VBOA 3IM0A 2ZCWA 4RGGA 1GP5A 2OT7A 5T5OA 1C5HA 1WA4A 2Y0IA 4D3WA 1FI2A 2I2SA 3AYEA 3CJIB 4XETA 5D2AA 5HV0A 1R093 3ZFGC 4LITA 1WW7A 4AQTA 1J3QA 3AZVA 3H7JA 3JQWA 3KCXA 2W0XA 3AL5A 1QJZA 2OPWA 2ZGLA 3AK0A 5EXOA 4XAEA 3WZ1A 3O1RA 2FCTA 2W92A 1RUD1 1S1AA 2Y64A 5DDJ1 3U37A 3SKJE 4BDVB 2ZGMA 3B9IA 3N36A 1W2UA 2TUNA 5I0DA 5FWEA 2YZ4A 4EYUA 1JOJA 5J09A 3AL6A 4LIVA 2WNVB 2HWE1 1PZ8A 3LPFA 4KGQA 1QXPA 3ZO0B 2G19A 5J37A 4YG3A 2X29A 2XBO1 5IYYA 2VULA 3HQXA 3WNKA 3UK9A 4D7YA 4QB1A 1CJDA 2DURA 4CU7A 1ND3A 5BUVA 4QXCA 1V0AA 3WX5A 2NMNA 2CGOA 3DGTA 4Q26A 1H9PA 2GSYA 3WF0A 5LBFA 3EO6A 1O5UA 2VZPA 3FBYA 4NIDA 3WEZA 2ZBJA 3ZM8A 2J1SA 1R1A1 2ZGRA 4FFGA 4ONUA 2R071 2YU2A 4L2NA 1I6XA 5D8AB 1QJY3 5DUVA 1HKDA 2JD4A 3WINE 2OUJA 4FVVA 1XYPA 4XFBA 5JIUA 2JE8A 5FOBB 4GH4B 2BOIA 4ZS2A 3QOPA 3U1XA 3ZDSA 1WKYA 4PIYA 3ACIA 3J7MA 1DQ1A 4ES8A 5BYNA 2JG8A 3FFQA 5FYTA 4ISQA 3T1MA 1AR91 4Y22A 4PI2A 4COZA 1DZQA 3GBGA 4EN7B 1JU3A 3RPQA 4M4RA 3O7OA 2R063 4Q5OA 4BLJA 2UYBA 1AYM1 1I3HA 1RUE2 1YC61 1OOPA 2C6SA 4IEYA 3KS7A 2WLPA 3V0BA 2NPIA 4C0HA 4D6RA 5L7OA 4E4ZA 3C7FA 5I0UA 4Y5Z0 4AL9A 5KXEA 5IUQA 3IN9A 5FZ3A 4N9HA 1W8HA 4JGZA 1IOAA 2WAOA 4S2HA 4Y4RA 5T50A 1X82A 2Q8CA 5C9AA 4LMFA 4XFIA 4CZSA 2WR9A 2J7MA 4P9JA 1IS5A 5JVVA 4C91A 1DGRN 2E31A 2MEV1 4O9GA 4LBMA 2Y6KA 5JSPA 5CKQA 1AR81 5CG9A 1JUIA 4QPGA 5LBCA 3SKVA 3KQRA 4MXWB 3N3HA 4LOSA 5DAPA 2O8OA 4OQ8A 1P8JA 4SBVA 4DXRA 1BBT1 2Y6FA 4AXOA 1RUD2 1US3A 2A71A 1W2AX 3K77A 5DDJ2 5A7PA 4AHZA 2A6XA 3THCA 3I8TA 1PK6B 1ONAA 2HWE2 3BPSA 3TEYA 4M0NA 4DXZA 4JGYA 4P9GA 2XBO2 1N1VA 2GNTA 4URTA 4LE4A 1O3TA 5FPZA 4EWEA 4YZ3A 1SACA 2GC3A 4BZ4A 2XVLA 3VKOA 3H1YA 1YFYA 1TME3 5FXXA 5FZ1A 4LKFA 4QQPA 1RL3A 3DKWA 1CAXB 2WO1A 4YW1A 3ZIXA 5ACA3 5BNPC 1O8SA 1R1A2 2P1BA 2XGXA 2AREA 2R072 4LIUA 3PUHA 2JENA 3R0RA 4HSLA 3ENRA 4WM7B 5C4WA 1R64A 2CGNA 1HRI3 2CWMA 4M0HA 3I97A 2FQPA 5FY1A 4CEYA 1NZCA 3OTFA 1Q5OA 3POYA 2QE3A 2YC0A 5FZMA 2JG9B 2Y0OA 2ZHMA 5FPUA 1AR92 1MS5A 4HOOA 1B35B 3PIJA 2DCYA 5C3RA 3AP6A 1NCRC 1AYM2 4XUTA 4E2SA 4CDWA 2OZJA 3NW4A 5J36A 4J6GA 4N53B 1BVP1 4META 3VZMA 3OUIA 4D0QA 1OUXA 3M70A 4K8FA 1F15A 3UETA 3WD5A 1QJFA 2JE7A 4FFFA 1MEC1 2BV4A 2A3YA 3CF6E 1H2NA 4TLFA 3T4VA 3U10A 4MUVA 4B3NA 2WT1A 4LBKA 5HPOA 2QNKA 4AEDA 5L36A 4QXBA 4AI0A 1QWRA 2MEV2 2WDBA 2WNOA 3ZSEA 3VDBA 2WO2A 1UZZA 3SNMA 1AR82 4NHKA 4BMEA 3T2OA 2F4PA 3ZYGA 4CPBA 2BGPA 4LK7A 1RUJ1 1NY71 1DQ2A 3ES1A 3ZXGA 1MVEA 2AGSA 3ZXFA 2V09A 4S2DA 4NIAA 2VVDA 3VBRB 1BBT2 4XFFA 4A44A 2IXJA 3J26N 3FBMA 3LE0A 2D6PA 4EE2A 4C8DA 3WQ7A 2DUPA 3NAPB 4NAOA 1M4WA 2IUWA 3CLPA 4JDOA 1UXXX 3N4MA 4JTNA 4Q4Y1 1RUI1 2W47A 1XOYA 1RMU1 3WF3A 4YG6A 2WZ8A 1IS4A 1GR3A 2K0GA 3LIHA 3CEWA 1EAH3 4KWLA 4MHUA 4QPIA 1JU4A 3J7HA 4LE3A 1YQ6A 3AYAA 2OIIA 2BGOA 3Q8AA 4L0PA 5FPVA 3TB0A 1DQ5A 1AJKA 4QKNA 4CDUA 4GWNA 4LKSA 4PLOA 4W65A 3VD7A 4C0BA 5CFDB 1ULFA 4QKDA 3SEEA 4XUNA 1DQ6A 1MS9A 5EV7A 1SHWB 3OGRA 1W6QB 3LA2A 1AR71 3MLKA 2V4AA 3ZN6A 4ATFA 2Z4FA 4QDSA 4Z07A 4UFLA 5EPAA 4EJRA 5C8CC 1U0AA 1KD7A 4GD4A 5GLTA 5IK8A 4YW5A 1YQ2A 4PJYA 3SISA 1HRV3 2B8MA 2BP6A 1W39A 4NE9A 2B9VA 2NP0A 1U5XA 2RDSA 2DCKA 4IUGA 1JZ5A 5I8SA 4MHRA 4KWUA 2PQQA 2CHHA 1OI6A 3IB3A 3AMHA 4JKLA 5K0UB 4AOCA 4P08A 5DN2A 4DS0A 4EROA 1C1LA 5FO9B 1ND2B 3ZN4A 4E4SA 4BM8A 1HB1A 1V6IA 3VBOB 3ZYHA 2BU9A 4QQOA 5BNNC 2W46A 1MEC2 4KQ7A 4BOWA 1ZYBA 2PLV1 5JXHA 2VBDA 4BYYA 4RYDA 1UY0A 5IAXA 2UU8A 1QMJA 4HLTA 4RA0A 3AKQA 2WYSA 4AGRA 2EF6A 4D6SA 2V73A 2BVBA 3POIA 3RWKX 3ZPYA 3PJYA 1G9DA 1UYXA 3T2PA 1SLBA 3ACGA 4OYUA 3ZFEC 1WW5A 1BEV1 2GU9A 4YZ1A 1ZREA 4WZFA 3AJZA 2D6KA 1RUJ2 1NY72 4QPIC 4JHZA 1RUH3 5LBEA 4D69A 2HWF3 2NZ9A 1QJX1 2VCBA 3AZWA 4HPKA 1CAUA 3BTAA 4FAHA 5A3MA 2I74A 2D6MA 5CB7A 1XSQA 4BLIA 1NX9A 4ZU7A 1N3QA 1X50A 1YNAA 3IIAA 1RUE3 4LNVA 3WDWA 1ZA4A 3GNEA 3ZXJA 2WO3A 4EN8B 2JDKA 2QQMA 4IL7A 1RUI2 2H0BA 4Q4Y2 1RINA 1RMU2 1ND3B 4NRPA 1SZBA 4QKFA 3J9SA 5IVEA 5CVRA 1PZ9A 3O1PA 2LROA 3PU3A 1XXNA 1GBGA 2W91A 3OD0A 3OJBA 3HWJA 5T3NA 4COYA 2W3JA 3HR9A 1YUDA 2Q8OA 4KI5M 4LOTA 4Q1RA 1YO8A 1REEA 4XQ4A 4Y26A 3SH5A 1BLZA 1A6CA 1JTZX 2HLEA 4I02A 5APAA 3OUHA 5K7PA 5FFOC 4XBQA 1J84A 4FO9A 4Z82A 4ZU5A 3H0OA 4GKXA 4UW6A 1F4HA 1AR72 5LATA 4WVZA 1YFXA 4XF0A 4I0WB 3L9JT 4AFAA 4TLGA 1T2XA 2JG8B 4A4AA 3RYKA 4Y22B 2QZ2A 3EYPA 5BXXA 1GV9A 3IMNA 1Y9GA 2VW2A 3A0NA 3KQ4B 1RUD3 3ILFA 2QQLA 2YFZA 3P3PA 4NPRA 4RL7A 5T54A 4MSVA 1OOPB 4QX1A 2ARAA 3BVCA 4WM8A 4QM9A 3GM8A 4ZY9A 3S6PA 3V0BB 5L7OB 3FN9A 2Y6HA 3QH7A 2YY1A 5FP4A 1ZBE3 2X8KA 3MIDA 4JGZB 4MVTA 3HVDA 4PBPA 2P3JA 4YM3A 1F5JA 1FOD3 4LBJA 5FZOA 4XDQA 1RJ8A 3LWCA 5C9AB 3C7HA 3AP7A 5LA1A 2PLV2 4Q4V1 5LBBA 1TQ5A 4PF1A 5I0SA 1UW8A 4XDOA 3FFZA 1GZTA 3KCCA 4AVVA 1POV1 1HN1A 4CDQC 4QPYA 4QPGB 1BKZA 3C7GA 3NSTA 1V6MA 4YZ5A 2VZ1A 1ZZ6A 2XJVA 1PGL1 1G86A 4IGQA 1BEV2 1IG3A 1L7LA 3K75B 2DV9A 2FMYA 1R091 5FY9A 1H4GA 4YVWA 1QJX2 2EXIA 3I2HA 5FYBA 1WCDJ 1AR93 1J1TA 3USSA 4QM8A 2GN3A 1W6PB 2PA7A 1EV12 2JX9A 3N9QA 1JW6A 4BCUA 3BKZA 1LENA 1MQTC 3GBFA 4JGYB 3SITA 3VN4A 5JAXA 5KBFA 1MZ6A 4BXSV 4JDMA 3WW1A 4XIKA 2FMDA 4XIOA 5F7UA 2BFUS 1UOBA 1DZTA 5FP3A 3ZSLA 1ZRIA 4QGNA 1JYVA 1W3VA 3R6SA 2EAAA 1ZX5A 1JYNA 1W05A 4ZHNA 3KVAA 4NIIA 5JXIA 1KJRA 1H1IA 3OYWA 5EYXA 2Q1MA 4LUKA 1S4CA 4MV2A 3VKNA 2ZEZA 5C4WB 5AFEA 2D3SA 4B4PA 3PDQA 5FZEA 5JR7B 1S0DA 3UGGA 1ASJ1 1N3OA 3AZXA 5FZDA 4BA6A 4CEYB 4YW4A 3T0AA 1C8M3 3TWIA 3ZYBA 2WC2A 3CDZB 1QJY1 3C7EA 1AF9A 1L7QA 5JXJA 5F3GA 3R05A 4OHVA 1BBT3 2C9KA 3SEPA 2HBUA 4BQWA 3BB6A 4NRQA 4BISA 2HBTA 3B94A 4YG0A 2JD9A 4AFBA 4CDWB 5HXVA 2QQIA 2K46A 1HV1A 4N43A 4OMCA 5FY7A 1FT9A 1VALA 1O8PA 3HBZA 2GNBA 2R061 2VMGA 2EIDA 2OUHA 1HQLA 4FPOB 1U5YA 5FY8A 5SV8A 5IVVA 2VAUA 3KWVA 5FOJB 2FDFA 3T2TA 2IXCA 1CWPA 4LT5A 1X8EA 1OF3A 4XJUA 2B4KA 4XF1A 1G9CA 3QD6A 3RMYA 4Q4V2 3V65A 3GHNA 4AEDB 3I2DA 4CP1A 2IXLA 1IS6A 5A3OA 4GA9A 1XNAA 5A1FA 2VW0A 4LO4B 2Q0AA 2Y34A 4UI9L 1DLCA 1LULA 2RS31 3OBTA 4RGAA 5IK7A 5E88A 1WLTA 2GH8A 1OPOA 4QWNA 2R1DA 2OXBA 4HZFA 1PGL2 1O7FA 1ZRDA 2BW8A 4JHTA 4M3CF 3M3CA 1R092 2ZX4A 3AP5A 3I7DA 3WQ1A 1EPWA 1Y43B 1PO23 1S0IA 3E1F1 3ABZA 2CYFA 3OBAA 4HKLA 4QPWA 4XCAA 2FDGA 1GLHA 1OC1A 1V00A 2VBPA 2XWBB 3P1IA 4W6WA 4CCLA 4GH4A 5IFTA 2J1RA 1BHGA 3O1MA 3DCQA 3ZPOA 3VDAA 3ZXAC 1J58A 4F8AA 3H8OA 3TEWA 2W94A 3ELNA 2VG9A 4XEZA 4TN7A 1OFNA 1SFPA 4CDUB 2HWC3 2W08A 1MEC3 5G05L 2QUOA 3CJIC 1MS0A 1OFSA 2WSUA 2EIGA 3HOBA 2Y8KA 4XPVA 1SPPA 4F7ZA 5IAVA 1A34A 4I3GA 3ZN6B 3P3NA 4YFWA 3U0ZA 4F83A 4RR3B 1V6OA 1ASJ2 5FYUA 2YUEA 1R081 2ZJCA 5F5AA 2E53A 4LKDA 2KXLA 3TAYA 1JOPA 4JRAA 2Z42A 1QJY2 3MBWA 3WOGA 5EZWA 3WG3A 1ZA7A 1O5LA 5ABJA 1R1ZA 1HRI1 1H8TA 1COV3 2ZGSA 3KLSA 1XU1A 2WNVC 4QB6A 3VL8A 4RSUA 3VZKA 1OPMA 4LBNA 1PGSA 3VBFA 5ANQA 3VD3A 4PCRA 4XDPA 5FUIA 3U14A 2FZ2A 3RYRA 1DHKB 1RUI3 2A5ZA 3H9AA 2R062 5LZ6A 3PURA 2WWSA 1LR5A 2ETEA 3MHZA 1O4ZA 1RGSA 1RUF3 3RS6A 1W9TA 4XXPA 5HCAA 3CZJA 4ZZ5A 1PK6A 5EJ3A 5D8AC 2UY9A 1XNKA 5K4LA 2BPA2 2LTNA 3GHMA 3WR0A 1CONA 3I2KA 3JXSA 2RM23 5LW9A 4XOGA 4GH4C 2RS32 3LEMA 1TNFA 1YRZA 1XE7A 1T6BX 3RI9A 1A3KA 4RHV1 4AFCA 1CD3G 1JZ3A 4HXCA 1CVNA 1Z78A 2BRTA 1LU2A 4RQPA 3SH3A 4PDWA 1WLWA 4HPKB 1WMFA 3W58A 1CAUB 1UWWA 4ZPIA 2FZ1A 4KMQA 5FLIA 1NA1A 1PX4A 2QKDA 4N7UA 3NKTA 4HSJA 3WDXA 4CPBD 4FTSA 3B9CA 2WQ4A 4XTPA 5D1IA 3IKWA 2VVEA 3VHRA 1ULCA 3VKFC 2XDVA 1XRUA 2FCUA 1WZXA 2IC1A 5DAWA 4D8MA 1LHVA 1Q8SA 1Y3TA 1YXWA 2YXSA 4NOTA 2OS2A 2PHTA 2ZZQA 4D7SA 5A1AA 1OSGA 1UF2C 4ZXEA 1RUOA 4XMIA 4CYDA 1GUIA 2W1WA 2W39A 5A6YA 3VB9A 2WL1A 5FBZA 2VL4A 2ZS6B 4FOWA 2J1AA 3ITQA 2X5IA 1Y9QA 2VZUA 4W6YA 1RHI1 4XACA 3FZ3A 5F8PA 5FZIA 1R082 1AJOA 4P5YA 5A7NA 3MO4A 2DVBA 3F95A 1VRBA 3SQOA 4E4HA 1NXMA 2P6CA 4BK5A 1HRI2 1PNGA 3BOPA 4WM8B 1PK6C 4Y5SA 4E8DA 2OX0A 3THDA 1OHFA 1EV13 3B02A 4OVEA 5A3TA 1HRV1 2YYOA 2XLFA 1RUC1 2XQRA 3HNYM 1TZOA 5FZOB 2FDIA 2BDRA 3DECA 1OBNA 5LA2A 3NNGA 5IFPA 5F3IA 2XMLA 2VY0A 4FTBA 1G9AA 3H1MA 2JDAA 5BPXA 1V9U1 4WM7C 5FYMA 4M4PA 5FZKA 4CE8A 2YC2A 2JKBA 1S0BA 5CISA 2DF7A 2RS11 1ODMA 4RHV2 3VBHA 2E7AA 2JG9C 4PHZA 2MNGA 2UWAA 1YJLA 2GP5A 3GZAA 4O9EA 5EP9A 1NT0A 2ZEYA 1VE0A 2VZVA 2XWJB 4XE9A 3KT7A 4YVWB 4DOUA 1B35C 2JJ6A 2VNVA 3GZEA 2YFUA 1PMIA 2A3XA 4I01A 4DO0A 4XBNA 3GJBA 1ZZ9A 2VBBA 2WSVA 1UN1A 2CAVA 3OPTA 4DUWA 1HX6A 1RUH1 2R0FA 3OGSA 1S2BA 4N53C 3VDDA 2JICA 5FY4A 2HWF1 2PFWA 2PMWB 1GNZA 1W8WA 1SQ4A 1N1SA 3GF6A 4L97A 5FZ0A 4ARYA 5LK5A 1BYHA 2VQAA 3WNPA 2Q4SA 4Y1ZA 4A7YA 2CDOA 1F9KA 4K6BA 4P9XA 5DUWA 4QX2A 3B7MA 4FQ4A 1YJKA 2AENA 4B4RA 3KVBA 3ZVXA 4EWDA 5IVJA 2GP3A 1E5RA 3OYWB 4FI9A 4RFRB 4IEOA 4CU6A 2Y26A 1PHMA 3E5XA 4Q4V3 3J7LA 3N7KA 3T2QA 4ITCA 4U2AA 4AHXA 3BI3A 5IVCA 2IWGB 3AVSA 1IS3A 1QF3A 2Y38A 3K3OA 4L8QA 3IDAA 5FO8B 1RHI2 4UWDA 3S30A 3VBRC 1HXS3 2VE1A 1JYIA 1RVF3 2Q1ZB 1RIRA 4JTOA 4NPLA 4OI4A 3NAPC 4AEKA 3ZDVA 4LBQA 4FP3A 4P9WA 1C57A 5FMCA 1Q8VA 3IPVA 4J1XA 1JYWA 2XKOA 4V2VA 3ZXLA 4Q0VA 4N43B 2YMZA 4CP0A 1HRV2 1I1EA 5TSWA 5JOYA 1W0PA 4Q4W3 1SCSA 1QJU1 3TRSB 3URFA 1O4YA 1RUC2 4MZUA 5IVFA 2ZGNA 5JR2A 3ON7A 4HL0A 3CL1A 5LA0A 3BIEA 4GKYA 2OPKA 5CFCA 5CFDC 5IATA 3O0WA 4Z92B 1ZBE1 2E26A 1WD3A 1F5FA 4TYSA 5BNOB 4AHWA 1V9U2 4COUA 1FOD1 1NE4A 5LWBA 2VUJA 2VR4A 2Z69A 3BTXA 3KV6A 4AI8A 4B8EA 3W59A 1ULOA 1H1AA 3JBG1 2RS12 2PAMA 2XONA 4WVWA 1ASJ3 3WCRA 4XQDA 1WA6X 2B39A 1TMF3 2UWBA 3RGBA 2PXJA 4K3UA 5KC6A 4LO8A 5DXDA 1VBB1 2D5HA 4LUMA 4OI0A 2VQUA 5K0UC 3AMQA 4FOQA 1VAMA 1ND2C 3RI8A 1RUH2 1QDCA 3ILRA 2QBXA 3VD9A 5DG2A 2CGPA 1Z0HA 2HWF2 3RZMA 3DXTA 1BQPA 5BNQA 3VBOC 2O1QA 2GMPA 5FZLA 3IAQA 2UURA 3HBKA 3RJ2X 2JDNA 2D7FA 4OLLA 4K1YA 5C8WA 2C4XA 2Z5WA 3T3YA 3ZXEA 5KXCA 1SPPB 2YPDA 1CX4A 2VOXA 1E5IA 5ERLA 2BNNA 2A1XA 4XF3A 3VHPA 5FQ0A 1DDLA 1YFWA 4IGPA 4I09A 3I2FA 5C7GA 2RS33 3WNXA 4YLZA 3THPA 4AI9A 2DCZA 2XB6C 3P5BA 3HD8B 3TEXA 4QQ2A 1XNBA 2D43A 5JZGA 1GP6A 1Y4WA 4LLFA 4XUQA 3BOWA 3FUOA 1KQRA 5ABJB 1H8TB 4FSJA 2VZSA 3IDEA 5T52A 4CXYA 1C8M1 4DEVA 1LHWA 3VBFB 1VRH3 5FXWA 5DG1A 4YW6A 4GULA 2XH6A 1ND3C 3J7NA 4CRQA 3SMHA 1O4TA 1W06A 4CP2A 1UIKA 1QJU2 2E7TA 1MS3A 3DXUA 3VBSB 1SCRA 3ZSJA 4QX8A 2K9ZA 1A8DA 4GWJA 5FAXA 3VD5A 4Z2AA 3ACLA 5DMYA 1N1YA 1W6PA 4LBLA 4TTGA 4J1WA 1LNSA 1IPJA 1JMUB 2O8QA 4H14A 5GZEA 4CCMA 4CCKA 1QOTA 1ZBE2 3MUZ1 4CVUA 4YARA 4FPGA 4R9CA 4BK4A 1FNYA 3KF3A 3NO8A 1FOD2 4Y1UA 1DGWX 1S0JA 5CEHA 2JG8C 1G7YA 3JBG2 4RQPB 2ZACA 3O0VA 4PDWB 3NL1A 2PN5A 4Z1VA 1R083 3JUUA 3PMSA 1HN0A 5GLUA 3RYPA 1ZRCA 2VD7A 4NHMA 4IEWA 4DFSA 1TG7A 4YGEA 1OOPC 1NA1B 1VBB2 2Y60A 2CV6A 2DUOA 5IK4A 5LA9A 4GIQA 5L7OC 1AUYA 1IQDC 4JDNA 4LORA 2FDJA 3T1LA 1CZSA 2HWD3 1PO21 4P00B 4PLNA 3H8XA 4JGZC 3CQOA 1J3RA 2P37A 1E57A 1UOGA 4JCKA 5GALA 1D4VB 3IT8A 5E6HA 5C9AC 5F1RA 4AFMA 1G6NA 3M3EA 3O0XA 3T09A 1Q56A 4SLIA 2YB7A 2VZTA 3MPBA 2WZR3 3W5MA 4A45A 1W28A 3PHMA 4FPCA 4XTMA 1W2NA 4AK3A 4QPGC 1YQCA 5FP7A 4P9IA 1YQ5A 2X5IB 3TOJA 1RUNA 1KFUL 3OD4A 2HWC1 2WQZC 1H6YA 4BQ1A 3POFA 1PMJX 4IEXA 3EHKA 4LO5B 4W4ZA 4EZ4A 1N3PA 1GWKA 4RHV3 2E7QA 2TEPA 2ZPXA 1YI7A 3B01A 4L99A 1BMV1 3POSA 1US2A 1F2NA 1LODA 1C8M2 2VUAA 2W9XA 3IAPA 3NV2A 4JGYC 2B42B 1W8FA 2HYXA 4KNCA 1RTVA 2ET1A 1A8MA 1WBFA 5F39A 3PMEA 5L9VA 3HT1A 2DVGA 1BK1A 1OUSA 3B69A 4JKMA 2XL9A 2EXKA 2NM1A 5FXZA 1ALYA 3JU9A 1COV1 4O65A 1D2QA 1DFQA 1UY4A 2OQ6A 1W8TA 3AMMA 3NJVA 1V6JA 2GALA 4LO7A 5BY5A 4WV8A 1UU6A 2XJSA 3TBDA 3WW3A 3NWKA 2CAUA 2VOWA 3FX3A 3S7EA 4CUGA 5A6QA 5C4WC 5ISLA 1ENSA 1ZVFA 3HEIA 3O1VA 5KXDA 4ASMB 3K4AA 3MPPG 3MI8A 1NZIA 2D44A 1RUF1 2YV8A 4QT6A 3CBNA 4CEYC 4YGBA 5C3PA 3VBHB 3FC0A 5LCWL 2FDKA 3PL0A 4IV1A 1ACCA 3S0MA 5GM0A 3WF1A 2GC2A 1CR7A 1JS9A 4RFT0 1RHI3 1UL9A 1EY2A 5DAVA 2RM21 1ZZ7A 4K8RB 1D4M3 1W6MB 2KA3A 2YGMA 4CDWC 3C2UA 4L92A 1MZ5A 2R32A 1DIWA 3VDDB 4DIQA 4RR3A 2PHUA 4U36A 3WF4A 1IZ3A 1MVQA 2G1MA 2ZMLA 3MDPA 4BJ0A 1SLLA 1JBCA 3G6JB 2VOVA 4M3CE 1PO22 2BFUL 3LEGA 4DQAA 1RUC3 2ZHLA 3OBZA 3J8F1 4HK9A 4XMAA 2ZGUA 4NIHA 1ULGA 4NN0A 4AEDC 1FX5A 2BTVC 3K3NA 4GB32 3AMPA 5FBJA 2ADDA 4CDXA 5FZ9A 4DUXA 2XPJA 4XC9A 3O14A 4IV3A 3ACHA 4R8HA 2RV9A 1VMHA 1V9U3 3KSCA 2N7GA 4NAMA 2AACA 2ZOEB 2WWJA 1UMZA 2HWC2 2WUHA 2HH9A 3AZZA 3MIEA 3N9NA 3NNFA 1DBNA 3OEAA 3PJQA 3PTYA 4LK6A 2AEZA 3HQRA 2RS13 1XNDA 1UZ0A 5GLWA 3R4UA 4XFAA 2QFEA 4MGZE 2WZPP 2J1EA 4PIXA 3R4SA 2DYCA 2DU1A 1WLDA 4FPKA 4LBQB 2WFPA 4XJ8A 1YYNA 2RJ2A 3UJQA 1G9BA 1BMV2 3IPVB 1ZBA3 5A7QA 4YYOA 2R16A 4JKKA 2HEYF 1UCXA 1GZCA 2WLQA 1W8OA 1X36A 3WP6A 2LUWA 4DRRA 3RZZA 3ZIWA 1DG6A 4DXSA 1O59A 4WVMA 2J1UA 3AVRA 1VIWB 4XUPA 2VMDA 1COV2 4YW7A 4XF9A 4CDUC 3GXUA 4R52A 1YIFA 5CFCB 1EV11 2VC9A 2E6VA 2PHLA 1F4AA 2PHDA 3VD4A 4LHSA 2L9LA 4GQ7A 1HB2A 1W6NA 4AVCA 4QXKA 2W1QA 3PLQA 4OFGA 3O1OA 5I93A 2BBAA 2Q5TA 2WAAA 1QKQA 1UYPA 3MICA 2WNEA 4RR3C 3ZX7A 5A80A 4XF4A 1RUF2 2V4VA 5HV4A 4CXXA 2NMOA 2WN2A 3AYDA 3BTZA 4XJAA 2AH2A 4P02B 4HN1A 1Q8OA 4HKWA 3WLUA 4X8NA 3WSOA 4QU1A 3B5LB 1UO9A 2VW1A 4Q27A 1V6LA 5FZAA 2RM22 5A70A 5KHIA 2WS93 2A6VA 1OLME 1GOGA 3M1HA 4MGQA 3WUDA 4AFDA 1JOBA 2ET7A 2Z79A 1PM7A 2BNMA 5HXMA 1IKPA 4ATEA 2KR2A 3KF5A 3UGFA 3IWZA 5GZDA 3J4UH 3AZYA 1URXA 3WDYA 5C3OA 3AKSA 2R49A 3VGIA 3H8UA 1QJU3 2XVGA 4OHWA 3QH6A 5L73A 3J8F2 2Q8EA 2B5HA 2O14A 2C24A 3MW4A 3U75A 3B93A 5IVYA 1UU5A 4PT6A 1QOSA 2ATFA 4AEJA 4UT5A 4KWKA 5FQ0B 2ZZJA 3HJRA 1HIXA 3UKVA 3AXDA 4F3JA 4FPFA 4DUVA 4KU8A 4JAAA 1W9YA 2ZTNA 1RC6A 3HMYA 3JBG3 3LAGA 1U12A 2ZMNA 5JZGB 5K9YA 1XE0A 3U4XA 2EICA 4XBLA 1CX1A 5FJKA 2YDEA 3N9LA 2H0VA 4DNYA 1FAYA 4B7EA 4S2GA 1SDDB 3UESA 2SBAA 1V6NA 1VBB3 2YBPA 1SMVA 2F17A 1AX1A 4MGTA 3M2MA 2XJPA 1GP4A 2ZAAA 1HXS1 1SEFA 2BOJA 1RVF1 3CKHA 4CCNA 1HB3A 2ZX1A 2ZGPA 4H55A 1LGNA 4FPLA 1J1LA 1SLIA 5JLVA 1ZZ8A 5A32A 3Q9OA 4LBQD 2IXKA 1SLTA 3AMNA 3E6DA 4N7IA 3GCWA 4TXWA 2ZEWA 1Q43A 5B4NA 4Q4W1 4AAPA 3OEBA 2RDRA 2ZX0A 4Y1VA 4UBHA 1LHOA 1YHFA 3IZOA 2D6OX 5A3WA 4HANA 2I45A 1LESA 4YVSA 1GICA 5JPMB 1K5MB 2VZOA 3I2JA 4AGVA 1GU3A 5JUVA 2E33A 1OLQA 2EA7A 2HKXA 3I3DA 3MV01 3NV4A 2YPJA 4FFHA 1NYWA 3DL3A 4WM8C 4XHXA 3V0AA 2R043 4PF5A 1NCQA 1LCLA 1BJQA 4RS5A 1REDA 3M4FA 1TMF1 2K2SA 1QJEA 2XR4A 2XXZA 4MOAA 4QKBA 5FYSA 3K51A 3TYJA
chains in the Genus database with same CATH topology
1JU3A 2VL4A 4M4RA 2J1AA 1CZTA 1OH4A 2VZUA 2R7EB 3T0BA 4LQRA 4P5YA 3A22A 1UX7A 3MO4A 1D7PM 1ULPA 3C7FA 3OGVA 2VO5A 2CDPA 4BK5A 1PMHX 3WQBA 4E8DA 2WAOA 4QB2A 3THDA 2J7MA 2WBKA 2RVAA 4DXTA 2E31A 4A41A 2Y6KA 3HNMA 3HNYM 3DECA 5LA2A 3SKVA 3NNGA 1EUUA 2J1TA 2YC4A 4E8CA 5IFPA 2VCCA 3I3EA 2J22A 1P8JA 1JZ6A 2PQSA 4DXRA 2JDAA 3HPNA 1US3A 3NRUA 4M4PA 3K77A 2YC2A 2BERA 3WNLA 3F2ZA 3THCA 4GWIA 2ZEYA 2VZVA 5EJ1B 2X10A 3I2IA 3P6BA 3OB8A 2YFUA 3K4ZA 2VCAA 3HNBM 2J1VA 4DUWA 2W5FA 3OGSA 2WO1A 4ARYA 5C71A 1O8SA 3WNPA 3PUHA 1DP0A 2CDOA 3K46A 2JKXA 2W1SA 2XOMA 3A23A 1R64A 2ORXA 4QX2A 1JZ4A 3I97A 4FI9A 4CU6A 2WZEA 3T2QA 2VJXA 2QQNA 4A6OA 4XUTA 3IDAA 2ORZA 5J1XA 1TVGA 4D0QA 3T0DA 3UETA 2KD7A 1W99A 1JYWA 2X05A 3ETPA 2VMCA 5HPOA 2WABA 2QQOA 2WDBA 3VDBA 2WO2A 5JR2A 4A42A 3T2OA 5LA0A 2VM9A 2BGPA 3LEIA 2E26A 4A44A 3LE0A 3LPGA 2VR4A 3I3BA 3NJXA 3GDBA 1ULOA 1KEXA 3LEKA 1UXXX 2XONA 3C7OA 1GOFA 2ZXQA 4W50A 2W47A 1EUTA 5EIYB 1I5PA 3WF3A 1W8NA 2WZ8A 4CUCA 1JU4A 2VTFA 3J7HA 1K3IA 4ARXA 3FHAA 2VQUA 2BGOA 4L0PA 3ACFA 2QBXA 3VD9A 4LKSA 3VD7A 1RYYA 3SEEA 4XUNA 1SHWB 3OGRA 1MPXA 3IAQA 2DDUA 2Z4FA 1GQPA 4QDSA 2C4XA 2QQJA 1YQ2A 4UAPA 1UMHA 2B9VA 4IUGA 2DCKA 1JZ5A 4AG4A 4KWUA 3I2FA 5C7GA 3T08A 3IB3A 4JKLA 4P08A 5DN2A 3I2GA 2EIEA 4XUQA 5CZKA 2VZSA 3EB7A 2W46A 4DEVA 5JXHA 4RYDA 1UY0A 5JMOA 1JZ2A 2WYSA 4ZZ8A 5EJZB 2DCJA 1NKGA 3WNMA 1UYXA 3T2PA 3ACGA 3GGLA 4GWJA 4OYUA 1W9SA 5IJRA 3VD5A 4Z2AA 5DMYA 2XHNA 2VZRA 4TTGA 4JHZA 1LNSA 4CVUA 3MUZ1 1UYZA 2VCBA 3AC0A 3MUY1 4XZUG 4BK4A 1K45A 2ZEXA 3VDCA 4W8JA 1NX9A 4OMDA 3MV11 1XC6A 1L7RA 3HN3A 2WO3A 2QQMA 1TG7A 4GZ9A 2EIBA 2W91A 2W3JA 1CIYA 1IQDC 4KI5M 1CZSA 3NQHA 4P00B 4QAWA 3FL7A 2HLEA 3CQOA 2W87A 4HG6B 1J84A 5IHRA 2QQKA 3T09A 4OUEA 2YG0A 1F4HA 1XNTA 2YB7A 2VZTA 4OZOA 3PUIA 3W5MA 4A45A 1T2XA 4A4AA 2C26A 2LW8A 3EYPA 1WCQA 3CIHA 4ET7A 1PX3A 2QQLA 2YFZA 3BN6A 2Y6GA 4QX1A 1H6YA 1PMJX 3GM8A 4W4ZA 4ZY9A 3DYMA 3FN9A 2Y6HA 1OT5A 3W5NA 1US2A 2W9XA 3C7HA 3IAPA 3A7QA 2HYXA 5LA1A 1GOHA 4PF1A 4JKMA 1HN1A 3CZUA 3C7GA 3K4DA 2OKXA 1UY4A 2VZ1A 3NJVA 2W95A 4QDQA 1JHJA 3K75B 3HEIA 2W1UA 1J83A 3I2HA 3K4AA 1JZ8A 4CU9A 2VZ3A 3WF1A 3WNNA 1KGYA 4BXSV 5F7UA 3CMGA 1JYVA 2Y6LA 1JYNA 3WF4A 5JXIA 4BJ0A 1UY3A 3LEGA 2ZEZA 4YPJA 4QX0A 4PQQA 1W0NA 2VMEA 3T0AA 3FHQA 3CDZB 1UXZA 3C7EA 4DUXA 1L7QA 5JXJA 3ACHA 2C9KA 2RV9A 3SEPA 3A21A 3DYOA 3IIIA 2VQTA 1GMMA 2JD9A 2WUHA 3OEAA 5LCWL 1JZ7A 2QQIA 4MADA 1UZ0A 1SG3A 4OMCA 1O8PA 2J1EA 5DPNA 3UNPA 2EIDA 5G04L 2RJ2A 2V72A 4RN5A 4QDRA 4JKKA 1OF3A 1XPWA 1W8OA 2B4KA 1XNAA 4CU8A 4DXSA 1O59A 2J1UA 4UI9L 4XUPA 2VMDA 1DLCA 3LQCA 2LS6A 3GXUA 2VC9A 1JI6A 1F4AA 2WQ8A 1OD3A 1CZVA 2Y6JA 3VD4A 4LHSA 2L9LA 2W1QA 4UOJA 3DYPA 3WNOA 2BBAA 2WAAA 3WF2A 5B4XA 3E1F1 3ABZA 3OBAA 4AAXA 4QPWA 1K42A 1GNYA 2V4VA 2WN2A 3P1IA 5C70A 4XUOA 3OG2A 2XQXA 4P02B 2J1RA 1BHGA 2ID4A 3WSOA 5IFTA 1UY2A 4LPLA 4JX0A 1W9WA 3VDAA 3BGAA 2VZQA 3ECQA 2W94A 1GOGA 4MGQA 2X09A 1H6XA 5HXMA 5G05L 3HOBA 2Y8KA 5JXGA 1NAEA 5CYYA 5DQ0A 1UYYA 4CUBA 4MGSA 4PT6A 2WN3A 3MBWA 1DYOA 3HJRA 1NUKA 4CUAA 4QB6A 1UY1A 4A3ZA 3C8XA 4DEQA 4DUVA 3VD3A 5FUIA 2VMFA 2EICA 1CX1A 2V5DA 1SDDB 3UESA 1W9TA 1JYXA 3CZJA 3CKHA 4ZZ5A 2W92A 2Y64A 3U37A 3I2KA 3SKJE 4BDVB 5I0DA 3JXSA 1UMIA 1K12A 2E32A 1JZ3A 2BZDA 3D3AA 3LPFA 4TXWA 5B4NA 2VOTA 2ZEWA 5IYYA 4XVHA 3WNKA 3OEBA 1UWWA 4QB1A 4CU7A 4KMQA 4XURA 1PX4A 4QX3A 3WF0A 2VZPA 3WEZA 3ZM8A 2J1SA 3I2JA 2VZOA 1GU3A 1OF4A 2E33A 3MV01 3I3DA 5JUVA 4D8MA 2JE8A 5A1AA 4MO3M 1WKYA 4ZXEA 3ACIA 1GUIA 2W1WA 4MOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU3 A;  2VL4 A;  4M4R A;  2J1A A;  1CZT A;  1OH4 A;  2VZU A;  2R7E B;  3T0B A;  4LQR A;  4P5Y A;  3A22 A;  1UX7 A;  3MO4 A;  1D7P M;  1ULP A;  3C7F A;  3OGV A;  2VO5 A;  2CDP A;  4BK5 A;  1PMH X;  3WQB A;  4E8D A;  2WAO A;  4QB2 A;  3THD A;  2J7M A;  2WBK A;  2RVA A;  4DXT A;  2E31 A;  4A41 A;  2Y6K A;  3HNM A;  3HNY M;  3DEC A;  5LA2 A;  3SKV A;  3NNG A;  1EUU A;  2J1T A;  2YC4 A;  4E8C A;  5IFP A;  2VCC A;  3I3E A;  2J22 A;  1P8J A;  1JZ6 A;  2PQS A;  4DXR A;  2JDA A;  3HPN A;  1US3 A;  3NRU A;  4M4P A;  3K77 A;  2YC2 A;  2BER A;  3WNL A;  3F2Z A;  3THC A;  4GWI A;  2ZEY A;  2VZV A;  5EJ1 B;  2X10 A;  3I2I A;  3P6B A;  3OB8 A;  2YFU A;  3K4Z A;  2VCA A;  3HNB M;  2J1V A;  4DUW A;  2W5F A;  3OGS A;  2WO1 A;  4ARY A;  5C71 A;  1O8S A;  3WNP A;  3PUH A;  1DP0 A;  2CDO A;  3K46 A;  2JKX A;  2W1S A;  2XOM A;  3A23 A;  1R64 A;  2ORX A;  4QX2 A;  1JZ4 A;  3I97 A;  4FI9 A;  4CU6 A;  2WZE A;  3T2Q A;  2VJX A;  2QQN A;  4A6O A;  4XUT A;  3IDA A;  2ORZ A;  5J1X A;  1TVG A;  4D0Q A;  3T0D A;  3UET A;  2KD7 A;  1W99 A;  1JYW A;  2X05 A;  3ETP A;  2VMC A;  5HPO A;  2WAB A;  2QQO A;  2WDB A;  3VDB A;  2WO2 A;  5JR2 A;  4A42 A;  3T2O A;  5LA0 A;  2VM9 A;  2BGP A;  3LEI A;  2E26 A;  4A44 A;  3LE0 A;  3LPG A;  2VR4 A;  3I3B A;  3NJX A;  3GDB A;  1ULO A;  1KEX A;  3LEK A;  1UXX X;  2XON A;  3C7O A;  1GOF A;  2ZXQ A;  4W50 A;  2W47 A;  1EUT A;  5EIY B;  1I5P A;  3WF3 A;  1W8N A;  2WZ8 A;  4CUC A;  1JU4 A;  2VTF A;  3J7H A;  1K3I A;  4ARX A;  3FHA A;  2VQU A;  2BGO A;  4L0P A;  3ACF A;  2QBX A;  3VD9 A;  4LKS A;  3VD7 A;  1RYY A;  3SEE A;  4XUN A;  1SHW B;  3OGR A;  1MPX A;  3IAQ A;  2DDU A;  2Z4F A;  1GQP A;  4QDS A;  2C4X A;  2QQJ A;  1YQ2 A;  4UAP A;  1UMH A;  2B9V A;  4IUG A;  2DCK A;  1JZ5 A;  4AG4 A;  4KWU A;  3I2F A;  5C7G A;  3T08 A;  3IB3 A;  4JKL A;  4P08 A;  5DN2 A;  3I2G A;  2EIE A;  4XUQ A;  5CZK A;  2VZS A;  3EB7 A;  2W46 A;  4DEV A;  5JXH A;  4RYD A;  1UY0 A;  5JMO A;  1JZ2 A;  2WYS A;  4ZZ8 A;  5EJZ B;  2DCJ A;  1NKG A;  3WNM A;  1UYX A;  3T2P A;  3ACG A;  3GGL A;  4GWJ A;  4OYU A;  1W9S A;  5IJR A;  3VD5 A;  4Z2A A;  5DMY A;  2XHN A;  2VZR A;  4TTG A;  4JHZ A;  1LNS A;  4CVU A;  3MUZ 1;  1UYZ A;  2VCB A;  3AC0 A;  3MUY 1;  4XZU G;  4BK4 A;  1K45 A;  2ZEX A;  3VDC A;  4W8J A;  1NX9 A;  4OMD A;  3MV1 1;  1XC6 A;  1L7R A;  3HN3 A;  2WO3 A;  2QQM A;  1TG7 A;  4GZ9 A;  2EIB A;  2W91 A;  2W3J A;  1CIY A;  1IQD C;  4KI5 M;  1CZS A;  3NQH A;  4P00 B;  4QAW A;  3FL7 A;  2HLE A;  3CQO A;  2W87 A;  4HG6 B;  1J84 A;  5IHR A;  2QQK A;  3T09 A;  4OUE A;  2YG0 A;  1F4H A;  1XNT A;  2YB7 A;  2VZT A;  4OZO A;  3PUI A;  3W5M A;  4A45 A;  1T2X A;  4A4A A;  2C26 A;  2LW8 A;  3EYP A;  1WCQ A;  3CIH A;  4ET7 A;  1PX3 A;  2QQL A;  2YFZ A;  3BN6 A;  2Y6G A;  4QX1 A;  1H6Y A;  1PMJ X;  3GM8 A;  4W4Z A;  4ZY9 A;  3DYM A;  3FN9 A;  2Y6H A;  1OT5 A;  3W5N A;  1US2 A;  2W9X A;  3C7H A;  3IAP A;  3A7Q A;  2HYX A;  5LA1 A;  1GOH A;  4PF1 A;  4JKM A;  1HN1 A;  3CZU A;  3C7G A;  3K4D A;  2OKX A;  1UY4 A;  2VZ1 A;  3NJV A;  2W95 A;  4QDQ A;  1JHJ A;  3K75 B;  3HEI A;  2W1U A;  1J83 A;  3I2H A;  3K4A A;  1JZ8 A;  4CU9 A;  2VZ3 A;  3WF1 A;  3WNN A;  1KGY A;  4BXS V;  5F7U A;  3CMG A;  1JYV A;  2Y6L A;  1JYN A;  3WF4 A;  5JXI A;  4BJ0 A;  1UY3 A;  3LEG A;  2ZEZ A;  4YPJ A;  4QX0 A;  4PQQ A;  1W0N A;  2VME A;  3T0A A;  3FHQ A;  3CDZ B;  1UXZ A;  3C7E A;  4DUX A;  1L7Q A;  5JXJ A;  3ACH A;  2C9K A;  2RV9 A;  3SEP A;  3A21 A;  3DYO A;  3III A;  2VQT A;  1GMM A;  2JD9 A;  2WUH A;  3OEA A;  5LCW L;  1JZ7 A;  2QQI A;  4MAD A;  1UZ0 A;  1SG3 A;  4OMC A;  1O8P A;  2J1E A;  5DPN A;  3UNP A;  2EID A;  5G04 L;  2RJ2 A;  2V72 A;  4RN5 A;  4QDR A;  4JKK A;  1OF3 A;  1XPW A;  1W8O A;  2B4K A;  1XNA A;  4CU8 A;  4DXS A;  1O59 A;  2J1U A;  4UI9 L;  4XUP A;  2VMD A;  1DLC A;  3LQC A;  2LS6 A;  3GXU A;  2VC9 A;  1JI6 A;  1F4A A;  2WQ8 A;  1OD3 A;  1CZV A;  2Y6J A;  3VD4 A;  4LHS A;  2L9L A;  2W1Q A;  4UOJ A;  3DYP A;  3WNO A;  2BBA A;  2WAA A;  3WF2 A;  5B4X A;  3E1F 1;  3ABZ A;  3OBA A;  4AAX A;  4QPW A;  1K42 A;  1GNY A;  2V4V A;  2WN2 A;  3P1I A;  5C70 A;  4XUO A;  3OG2 A;  2XQX A;  4P02 B;  2J1R A;  1BHG A;  2ID4 A;  3WSO A;  5IFT A;  1UY2 A;  4LPL A;  4JX0 A;  1W9W A;  3VDA A;  3BGA A;  2VZQ A;  3ECQ A;  2W94 A;  1GOG A;  4MGQ A;  2X09 A;  1H6X A;  5HXM A;  5G05 L;  3HOB A;  2Y8K A;  5JXG A;  1NAE A;  5CYY A;  5DQ0 A;  1UYY A;  4CUB A;  4MGS A;  4PT6 A;  2WN3 A;  3MBW A;  1DYO A;  3HJR A;  1NUK A;  4CUA A;  4QB6 A;  1UY1 A;  4A3Z A;  3C8X A;  4DEQ A;  4DUV A;  3VD3 A;  5FUI A;  2VMF A;  2EIC A;  1CX1 A;  2V5D A;  1SDD B;  3UES A;  1W9T A;  1JYX A;  3CZJ A;  3CKH A;  4ZZ5 A;  2W92 A;  2Y64 A;  3U37 A;  3I2K A;  3SKJ E;  4BDV B;  5I0D A;  3JXS A;  1UMI A;  1K12 A;  2E32 A;  1JZ3 A;  2BZD A;  3D3A A;  3LPF A;  4TXW A;  5B4N A;  2VOT A;  2ZEW A;  5IYY A;  4XVH A;  3WNK A;  3OEB A;  1UWW A;  4QB1 A;  4CU7 A;  4KMQ A;  4XUR A;  1PX4 A;  4QX3 A;  3WF0 A;  2VZP A;  3WEZ A;  3ZM8 A;  2J1S A;  3I2J A;  2VZO A;  1GU3 A;  1OF4 A;  2E33 A;  3MV0 1;  3I3D A;  5JUV A;  4D8M A;  2JE8 A;  5A1A A;  4MO3 M;  1WKY A;  4ZXE A;  3ACI A;  1GUI A;  2W1W A;  4MOA A; 
#chains in the Genus database with same CATH topology
 2XHK A;  3BTY A;  3O1S A;  2ZKN A;  3RFR A;  1B09 A;  4XHB A;  5FZB A;  1OH4 A;  1Z7S 3;  5AC9 3;  2XLA A;  2VGD A;  3T0B A;  4LQR A;  1UX7 A;  1S0C A;  2WNU A;  5J7M A;  2RG4 A;  1ULP A;  1W8Z A;  2WJS A;  3RZG A;  4PBO A;  4JRL A;  1IHM A;  3I54 A;  3OGV A;  3VBU A;  1QNY A;  1RJ7 A;  2CDP A;  5FPX A;  1PMH X;  5KXB A;  2BJS A;  4A2U A;  4QB2 A;  3VUO A;  4AQ2 A;  4YVW C;  2WIN B;  2XVK A;  2A75 A;  2WBK A;  4IE4 A;  1WMX A;  4MH0 E;  4DXT A;  3Q8F A;  5FMO S;  4EQV A;  5BNO A;  1XSR A;  3APB A;  1BVV A;  1WCU A;  3ZYR A;  2J1T A;  4E9K A;  1E5S A;  2GC1 A;  3I3E A;  4KBZ A;  5T5J A;  3WT3 A;  2J22 A;  3LDB A;  1YI9 A;  3NJY A;  1HXS 2;  3LA3 A;  3VZO A;  3PVB B;  1POQ A;  1RVF 2;  3HPN A;  5LEJ A;  4MX3 A;  3L2Y A;  3NRU A;  5E16 A;  3KV5 A;  5FZ8 A;  1UPS A;  5C33 A;  5CU1 A;  3LDK A;  1HW5 A;  1VRH 1;  2B45 X;  4XJ9 A;  1WGP A;  2WYF A;  2JDU A;  2W68 A;  1UOJ A;  3F2Z A;  3PTR B;  5FKC A;  4GWI A;  1SBF A;  1UIJ A;  4NUB A;  1FAT A;  5KHG A;  5F2W A;  2A3W A;  2SLI A;  1H1M A;  1LOB A;  1DF0 A;  4Q4W 2;  4FOY A;  3H3L A;  3JB4 C;  5DZF A;  4GB3 3;  4YZ4 A;  4AQS A;  2GAU A;  2JIG A;  2X10 A;  4NVP A;  1CQ9 A;  4S2F A;  3O12 A;  3OB8 A;  4QHB A;  1XYO A;  2D6L X;  1NXD 1;  4UBG A;  2J1V A;  4IV1 B;  2JXA A;  1DYP A;  2ZGT A;  2W5F A;  2OA2 A;  4YRD A;  5H9Q A;  1FMD 1;  2VH9 A;  1DCS A;  1GWM A;  4NHX A;  2HEV F;  2PHW A;  5FYC A;  1EP0 A;  3MFC A;  5KR7 A;  5DZE A;  3NV1 A;  1GFF 2;  4YM0 A;  5CA6 A;  1DP0 A;  3HAG A;  3K46 A;  2RS5 1;  1ENX A;  2W1S A;  3A23 A;  2ORX A;  3FHI B;  4N43 C;  3INA A;  4Q0Q A;  1FNZ A;  2JDH A;  2G4I A;  1TMF 2;  3AP4 A;  4IGO A;  4R9B A;  5FWJ A;  2P34 A;  3ZFF A;  3ST7 A;  4NWW A;  3RG0 A;  4UFM A;  4AGG A;  4Q0P A;  4QGL A;  3WHT A;  1LHU A;  4NHY A;  2VJX A;  3T4H B;  2WO7 A;  4ZS3 A;  4A6O A;  3AX4 A;  3LOB A;  4YW2 A;  5LY2 A;  1OQE A;  1C4R A;  5EWS A;  5DAQ A;  1XE8 A;  4GMP 0;  1FXZ A;  2ORZ A;  2HWD 1;  4CDX B;  2HYK A;  5IK5 A;  5BNO C;  1QQP 3;  1TVG A;  2RMU 1;  4AWD A;  2E63 A;  4B7K A;  1FPN 3;  4IV3 B;  1OA2 A;  1LJ7 A;  4AYU A;  4H2A A;  4MGY E;  1QXR A;  3CO2 A;  1Q8Q A;  2IFW A;  1XBF A;  2KD7 A;  3VBS A;  1W99 A;  2WZR 1;  5FCC A;  1S2K A;  4EN6 B;  2X05 A;  1D0H A;  1AYN 1;  1VBD 3;  2D97 A;  2VMC A;  3ETP A;  3NVC A;  3MFA A;  4I0B A;  1LOF A;  4QXH A;  1GAN A;  4DY5 A;  1AL2 3;  4XAA A;  4LLO A;  2VCM A;  5FK8 A;  5F3C A;  4LA2 A;  3I49 A;  3LKJ A;  2DWR A;  2ZGK A;  4I2O A;  1RIT A;  4ZU4 A;  3ATG A;  3NNM A;  4AW7 A;  1UZV A;  1NQD A;  2VM9 A;  4OZX A;  5IT6 A;  4GWM A;  4GJZ A;  4UFJ A;  4Y4Y A;  3KV4 A;  5A6Z A;  3M8L A;  1W03 A;  4WVM B;  2E9Q A;  3PUS A;  4PI0 A;  1C1F A;  3I3B A;  4ORF A;  1G8W A;  3RDI A;  3GDB A;  1VRH 2;  3SCF A;  1W6O A;  1D2S A;  1KEX A;  3LEK A;  1W6N B;  4KWJ A;  2ENR A;  3J8F 3;  2IFR A;  2W2I A;  2BWA A;  4K7J A;  5KHJ A;  1EUT A;  2XKP A;  5EIY B;  4QHO A;  4XYX A;  3UV9 A;  3I59 A;  4G9S B;  2Y33 A;  2VTF A;  3KT1 A;  4MLO A;  4ARX A;  3FHA A;  4IDZ A;  4JQR A;  2GN7 A;  3I3M A;  3ZR5 A;  1F8V A;  2R0H A;  4UW3 A;  3RMX A;  4UFK A;  4FBF A;  4P9Y A;  1D0G A;  1FMD 2;  4PQ9 A;  3N9M A;  3AFK A;  5ABJ C;  1H8T C;  3GCX A;  3L2H A;  4TSV A;  2JIJ A;  5DAB A;  3VBF C;  3WXP A;  1MPX A;  3DPR A;  2RS5 2;  3PVN A;  2DDU A;  2TNF A;  3WV6 A;  4YSF A;  4HMZ A;  1HQN A;  2BUK A;  3D82 A;  1D4M 1;  2Q8D A;  5H9P A;  1PVC 3;  4P14 A;  3VBS C;  4A3X A;  2WT2 A;  2EXH A;  2BYV E;  1OA3 A;  2AR6 A;  2HWB 3;  3K48 A;  4HK8 A;  4AG4 A;  3ETQ A;  4WVV A;  2VNR A;  4YGD A;  4K20 A;  2VOK A;  5IWF A;  2YHJ A;  1TEI A;  1H4H A;  4FT8 A;  1KS4 A;  2HWD 2;  1GQH A;  3H50 A;  2EIE A;  2RMU 2;  1ZRR A;  2P2K A;  2ES3 A;  3EB7 A;  5FKB A;  3AFG A;  2UYA A;  4RQP C;  2WZR 2;  4PDW C;  1NLQ A;  4CEW A;  4R4X A;  1AYN 2;  4QD2 A;  2OW4 A;  3OGG A;  4N9I A;  4Q4X 3;  1JZ2 A;  4OUL A;  3MIB A;  1NA1 C;  3ZYJ B;  5FZ7 A;  1AHS A;  2C1F A;  2DCJ A;  1NKG A;  1S55 A;  1UKG A;  2F6B A;  2VUC A;  1GYK A;  1LED A;  5IJR A;  1W9S A;  2LM3 A;  5AFB A;  3OPW A;  2VZR A;  4CCC A;  5I91 A;  4TWT A;  3ZKU A;  1WUV A;  3POG A;  4RD7 A;  4YM2 A;  1KIT A;  3RZH A;  1UYZ A;  1SFN A;  3MUY 1;  2PTM A;  1K45 A;  1ZBA 1;  3BAL A;  1YWK A;  2ZEX A;  2CWS A;  4Y1Y A;  5A32 B;  3OCP A;  1W6M A;  2DVA A;  5FYY A;  4AEM A;  3WVJ A;  3ZFG A;  3IDB B;  1MS4 A;  4BIF A;  3MV1 1;  5LAS A;  4W6X A;  4NRO A;  3PVO A;  3HN3 A;  2FBE A;  4NMI A;  4RGK A;  4WZC A;  2ERF A;  2XJR A;  1MS8 A;  3VZL A;  5FDB A;  1QHD A;  2X5I C;  3ILN A;  4Y33 A;  4XZP A;  1ULD A;  1OA4 A;  4GZ9 A;  2JB8 A;  1XJA A;  3BPZ A;  4A7Z A;  4YVS B;  1CIY A;  4LJH A;  5JCT A;  2WFF 3;  3N7J A;  3JD7 3;  1YFU A;  1HV0 A;  2ZGO A;  5FMD A;  4YZ2 A;  4H7L A;  1FYU A;  2W87 A;  4M00 A;  1YCI A;  3NNL A;  2C0Z A;  4HG6 B;  3V0A B;  1NCQ B;  5IHR A;  4OUE A;  2YG0 A;  1XNT A;  4RS5 B;  1HQW A;  2D6N A;  5FV3 A;  5LRR A;  4E27 A;  2CU5 A;  1VBE 1;  3WCS A;  2LW8 A;  4MGI E;  3LF7 A;  4CCD A;  1D4M 2;  2WS9 1;  3ZMN A;  1WCQ A;  1O3S A;  1VJ2 A;  4IEZ A;  4XCB A;  3CIH A;  4AI2 A;  5ANN A;  1PX3 A;  3BN6 A;  4ET7 A;  5JPN B;  2Y6G A;  1LEC A;  3AKR A;  3SCH A;  1QH7 A;  3ME2 A;  3M3Q A;  5EFU A;  1JN2 P;  2ZHK A;  2WNU B;  1O91 A;  3DYM A;  5FUP A;  1RUG 3;  4EV0 A;  1ZZC A;  4HET A;  4Y24 A;  4L9B A;  1OT5 A;  4B1M A;  3VBU B;  5IW0 A;  1DGW A;  4KU7 A;  4V2W A;  5FZC A;  3VBH C;  1QH6 A;  3OF1 A;  4R4Z A;  4GAL A;  1W2O A;  2A7A A;  1BK0 A;  1IKQ A;  1SBD A;  1HJF A;  1H30 A;  2P3K A;  3A7Q A;  4UF0 A;  2MPF A;  4YGC A;  2YU1 A;  4R9D A;  1MZE A;  1U5Z A;  1VP6 A;  4YW3 A;  2OKX A;  5LB6 A;  3VDD C;  2W52 A;  1NOV A;  2DUQ A;  5FO7 B;  4Z8B A;  1FV2 A;  5FIX A;  4XQW A;  4NR1 A;  2P6H A;  1JHJ A;  3RZJ A;  1VR3 A;  2XLG A;  5FXV A;  5I0R A;  4Y20 A;  4KBB A;  3B3Q E;  3ZXK A;  3H3U A;  4QX5 A;  1KDM A;  5H9S A;  2O0O A;  3M3I A;  1WCS A;  1ZBA 2;  4YM1 A;  4AI3 A;  5F5Q A;  3T30 A;  4MXV A;  5I0T A;  1JZ8 A;  3JQX A;  1BZW A;  4CU9 A;  4DPN A;  1VMF A;  4OQ9 A;  3IMM A;  1H2K A;  1CIW A;  1KGY A;  4I30 A;  5A3P A;  3VZN A;  4CSW A;  2VPV A;  3ES4 A;  4LO6 B;  4Q0U A;  3PVE A;  1AXY A;  1OKQ A;  2XL7 A;  3FWE A;  3SHR A;  3A4U A;  2LAL A;  1AL0 G;  3LA7 A;  2EXJ A;  2H6B A;  2QVS B;  1GQG A;  2XJQ A;  1DQ0 A;  2PHX A;  5FY5 A;  5KHH A;  4FPJ A;  5I8Y A;  3KD4 A;  5AVP A;  1AR6 1;  4X8P A;  4AQ6 A;  1VB2 A;  2ZX3 A;  4Q0S A;  3O5S A;  4HVQ A;  5FZG A;  3ORJ A;  2BVV A;  4PQQ A;  3WP3 A;  1PGW 1;  1W0N A;  4CCJ A;  2QQV A;  5F2S A;  2JEM A;  1VBE 2;  4FP2 A;  1CN1 A;  3ZFF B;  1UXZ A;  4LHL A;  2WS9 2;  3GZU C;  2R04 1;  5BNP A;  1HJG A;  5CFC C;  3A0K A;  3DYO A;  3III A;  3WG4 A;  3RVH A;  5FPA A;  3WDV A;  1JZ7 A;  5AVA A;  5JOW A;  2RR1 1;  4BWO A;  5JMC A;  1QIQ A;  1L3J A;  2AUY A;  4GXL A;  2IVI B;  2KM2 A;  1XB9 A;  2CY6 A;  3TN9 3;  4BQY A;  3RZK A;  4UXA A;  1CAW A;  3SH4 A;  5DPN A;  3UNP A;  2QQW A;  5G04 L;  4D7T A;  2V72 A;  1Z7S 1;  4RN5 A;  5AC9 1;  3HIF A;  3ZKY A;  4Y3O A;  1MZF A;  1WW4 A;  1O3Q A;  1H8V A;  1XPW A;  1ZM1 A;  2A6Z A;  1OD5 A;  2FCV A;  3D8C A;  1NCR A;  5GZC A;  3DV8 A;  1FMD 3;  4CU8 A;  2VMH A;  2OZ6 A;  2ARB A;  3NV3 A;  4QHZ A;  2QDR A;  1WLC A;  3LQC A;  3LFI A;  1OMI A;  1UKR A;  1CZV A;  2RS5 3;  2Y6J A;  3JCI A;  2AEY A;  2DBN A;  5FRE A;  1PIV 3;  1J3P A;  1T6G C;  2QCS B;  4GAZ A;  4A7K A;  1K5M A;  5FUN A;  2I07 B;  4OHY A;  4Y1X A;  5B4X A;  3MW2 A;  4AAX A;  3RJR A;  1K42 A;  1W6O B;  1A78 A;  5FPL A;  1VBC 3;  1UNB A;  1PO1 3;  2C5D A;  2GNM A;  2PAE A;  3H7Y A;  4FOV A;  2XQX A;  4XUO A;  1LU1 A;  5D21 A;  5FZ4 A;  3ZN5 A;  3O1U A;  3KHB A;  3WUC A;  1UY2 A;  3I59 B;  1W9W A;  3TEZ A;  3BGA A;  2VZQ A;  2XJU A;  1Y7B A;  2RMU 3;  3LB9 A;  3LFM A;  4IW3 A;  3OY8 A;  1KJL A;  5FPB A;  5GZG A;  2JEC A;  1H6X A;  2FD8 A;  4IQP A;  5JOX A;  1VLN A;  3AB0 A;  3WDU A;  5JZG C;  5JI7 A;  4GB3 1;  1AYN 3;  2DTY A;  3KM5 A;  4HKO A;  3LGR A;  1VBA 3;  1NAE A;  3KZ4 C;  4AVB A;  3DPR B;  5CYY A;  5F37 A;  1AR6 2;  2RDQ A;  4GMP 3;  1UYY A;  3MIF A;  4K1Z A;  3AKT A;  2AZ5 A;  4NO4 A;  5A3N A;  1PGW 2;  3OUJ A;  5DUU A;  5KWR A;  2Q30 A;  2WN3 A;  2A70 A;  2DU0 A;  5H9R A;  4M01 A;  4UFI A;  2BBV A;  4LKE A;  5E1R A;  1DYO A;  1LHN A;  1UX6 A;  2IXI A;  4UFH A;  5F9T A;  1NUK A;  2VTX J;  1RXG A;  2R04 2;  2WT0 A;  3NMB A;  4CUA A;  1I5Z A;  2BQP A;  4A3Z A;  1LGB A;  2P5B A;  3C8X A;  3I3Q A;  5GLV A;  4DEQ A;  4ISR A;  2RR1 2;  4OUS A;  2MHF A;  3WHU A;  3EBR A;  4IER A;  1HB4 A;  4ASK A;  2VMF A;  3RWN A;  2VNG A;  3BUC A;  2V5D A;  3DN7 A;  3PUQ A;  5C8C A;  4OUM A;  3S5A A;  4BIO A;  1AZD A;  1Z7S 2;  1SBE A;  2P17 A;  4CEW B;  5AC9 2;  3EXU A;  4B1L A;  2RE9 A;  5FYH A;  4CP9 A;  1K5M C;  1QQP 1;  1JYX A;  5L19 A;  1QXJ A;  3AP9 A;  4FAG A;  1FPN 1;  2BEO A;  4WBB A;  3UYJ A;  3WG1 A;  4MG2 A;  1WMD A;  1WME A;  2EAL A;  2VXJ A;  4OHZ A;  4YFZ A;  2NQY A;  4UW4 A;  4XAB A;  1UMI A;  1K12 A;  2DFC A;  2E32 A;  3TNQ A;  1VBD 1;  1CJP A;  2BZD A;  1XU2 A;  3D3A A;  4Q1P A;  4XW3 A;  1AL2 1;  5F5I A;  3ZYI B;  4DRV A;  2VOT A;  2GDF A;  1RXF A;  5BNN A;  4XVH A;  4QMA A;  4P5H A;  4IE5 A;  3GYD A;  3S5Q A;  5I8T A;  4XXA A;  1DQ4 A;  4O61 A;  5JOZ A;  3ZFG B;  4XUR A;  5F5C A;  1LTE A;  4QX3 A;  1OQD A;  1X8M A;  3D6E A;  3BOD A;  2QDN A;  3HT2 A;  4FFI A;  4DY3 A;  1KS5 A;  3ZFE A;  2Q1F A;  3AYC A;  3MF9 A;  4G4F A;  4IE7 A;  2XG3 A;  5SV5 A;  1OF4 A;  2D5F A;  1AXK A;  1TE1 B;  2YGL A;  1LAJ A;  4Q8K A;  3GZT B;  3LSD A;  3UKN A;  4DIN B;  3KT4 A;  4MO3 M;  1O3R A;  1H9W A;  3VZJ A;  1K5J A;  2JDZ A;  2YBS A;  3GJA A;  4AZZ A;  3Q8E A;  3E6B A;  3WG2 A;  3MLJ A;  5EQU A;  2X53 S;  5C6C A;  3AKP A;  2E51 A;  1CZT A;  1V70 A;  3RNS A;  4NWV A;  3MGU A;  4LR4 A;  2R7E B;  2XUM A;  3A22 A;  1LGC A;  4QGM A;  1D7P M;  3SCG A;  2ADE A;  3VLB B;  2LRP A;  5FYI A;  4COW A;  2B7Y A;  3I4I A;  5DUX A;  2QTW B;  4XFG A;  4CA9 A;  2HJI A;  1WWY A;  4H3W A;  1C5I A;  2VO5 A;  3DUI A;  3VHN A;  3C3V A;  2QZ3 A;  3B00 A;  3WQB A;  1OKO A;  2G9Z A;  4HVR A;  4XJZ A;  5FYV A;  1PVC 1;  3U4S A;  2XUE A;  2RVA A;  1MAC A;  4BHP A;  4A41 A;  1WBL A;  4BMB A;  3HNM A;  2D98 A;  2HWB 1;  2VTX A;  4IEU A;  5HBA A;  3E6C C;  1CAV A;  1W3X A;  2ZAB A;  3CHX A;  4IV1 C;  1EUU A;  2YC4 A;  1ZZB A;  4IET A;  4E8C A;  1CPN A;  4UF0 B;  2VCC A;  1ZNP A;  2YBK A;  1ENQ A;  1RB8 G;  1C28 A;  1QQP 2;  1JZ6 A;  4AHY A;  1FPN 2;  2PQS A;  5FMO L;  1VAV A;  1SDW A;  1IGO A;  3THT A;  3RQ0 A;  5A7W A;  2BER A;  1X33 A;  3WNL A;  3JB8 A;  1XQN A;  1VBD 2;  4EWA A;  2DCT A;  4Q4X 1;  5CG8 A;  1AL2 2;  4Y20 B;  4KL1 A;  1U5I A;  1DZR A;  3N9P A;  1VBE 3;  5EJ1 B;  1QU0 A;  1STM A;  3PNA A;  3I2I A;  3P6B A;  4AI1 A;  4QU2 A;  3W20 A;  3K4Z A;  4CDQ A;  2VCA A;  3HNB M;  1GZW A;  1UZW A;  2ZAH A;  4K40 A;  4CTE A;  4CDX C;  3D4K A;  4FPY A;  4HVO A;  1LEM A;  1JOD A;  5FJH A;  5FZ6 A;  4IV3 C;  1JHN A;  1DYK A;  3K2O A;  5FZF A;  5A33 A;  5C71 A;  4CCO A;  4EZH A;  4GJY A;  2JKX A;  2XOM A;  5C5T A;  4PLM A;  2DVD A;  3UL2 A;  1JZ4 A;  4AE2 A;  2DFB A;  1MQT A;  4DMI A;  2WZE A;  3IDC B;  3PUA A;  2CTV A;  1MR5 A;  3USU A;  1YEW A;  2QQN A;  1TNR A;  1LOE A;  3WQ0 A;  2WFF 1;  2QQP A;  3JD7 1;  4AR2 A;  2JB4 A;  1XNC A;  4BPZ A;  5A1L A;  4ZKT B;  2HEW F;  4LUL A;  1NE6 A;  4OHX A;  5J1X A;  1JXN A;  3GBW A;  3PU8 A;  4EN9 B;  2P3Y A;  1HLC A;  1Y9M A;  4BQX A;  5BNP B;  5GKA C;  5DDJ 3;  3T0D A;  3DKQ A;  1W04 A;  3Q8C A;  3VL9 A;  4BQ2 A;  1POV 0;  3SC7 X;  5FY0 A;  4M3C A;  1CAW B;  2HWE 3;  1PVC 2;  5HCF A;  2WAB A;  2QQO A;  3DF0 A;  1S0E A;  4HT1 T;  2CNA A;  1VPH A;  2VU9 A;  2XBO 3;  2VMI A;  5FTT C;  4B29 A;  2HWB 2;  3HN1 A;  4A42 A;  5CIR A;  4LEJ A;  2IZW A;  4FPE A;  3BU0 A;  5BV6 A;  1RUG 1;  1JUH A;  1ODN A;  1GZ9 A;  3DEM A;  1NCR B;  1CGP A;  3LEI A;  5F6L B;  2F4L A;  2RHP A;  4NHL A;  5KC5 A;  5KHK A;  4KG8 A;  4UYB A;  3KGL A;  5CBL A;  3LPG A;  1R1A 3;  3OBR A;  3POJ A;  2R07 3;  1E5H A;  3RSJ A;  3S57 A;  1DU3 D;  4D6Q A;  3NJX A;  1KDK A;  2GMM A;  1AR6 3;  2ZMK A;  5CAZ A;  3VV1 A;  2WA4 A;  3O1T A;  3VKM A;  3C7O A;  1GOF A;  2ZXQ A;  4W50 A;  4Q4X 2;  2GC0 A;  4OCT A;  5LEK A;  1I5P A;  1W8N A;  2JWP A;  3LD8 A;  4Z2W A;  4CUC A;  2GZW A;  5K8S A;  4TZD A;  1K3I A;  1DLL A;  4N90 A;  1JYC A;  3W21 A;  1PNF A;  2YRO A;  4FXG B;  2NLR A;  4LXL A;  3ACF A;  4ASL A;  5C3Q A;  3RZL A;  4XFH A;  1AYM 3;  1QNW A;  1EYB A;  3BCW A;  5FR3 A;  2RR1 3;  5JIA A;  4HN0 A;  3POW A;  3ALQ A;  4NIG A;  1RYY A;  1M06 G;  3OY8 B;  3LZZ A;  1XYN A;  1N1T A;  2RJK A;  3FLR A;  1AX0 A;  5F3E A;  4BE3 A;  3HQU A;  1GQP A;  2AYH A;  4FTE A;  4Q2F A;  4QQL A;  1GKB A;  5A6X A;  3KGZ A;  2QQJ A;  4UAP A;  1FV3 A;  2VEC A;  5FRA A;  1UMH A;  3H8R A;  2VUD A;  1S0G A;  5FP9 A;  4IE6 A;  2MEV 3;  4AF9 A;  3M7A A;  3MLL A;  5LY1 A;  1AR8 3;  2WFF 2;  2FHR A;  3T08 A;  5JSR A;  3JD7 2;  4BQ5 A;  3H3Z A;  5T5P A;  5A3U A;  3I2G A;  4BQ3 A;  2Z2S B;  5GZF A;  5LRS A;  3FMG A;  1OLM A;  3H42 B;  3CJI A;  1KRI A;  4Q8L A;  3POB A;  5CZK A;  3X29 B;  3KMH A;  2BWC A;  1W9F A;  1SLC A;  2J42 A;  4E2Q A;  3E5U A;  2ZX2 A;  4YWA A;  1ULE A;  1W8U A;  4HON A;  1UZY A;  3FLP A;  4AVA A;  1F31 A;  1X7N A;  2DTW A;  1AVB A;  1EPZ A;  2ZKL A;  5J3U A;  5JMO A;  2ZA9 A;  4ZZ8 A;  5C8C B;  1ENR A;  3LCP A;  4JQT A;  4OI2 A;  5F32 A;  2WWU A;  3OOX A;  5EJZ B;  5C3S A;  4B4Q A;  1UD1 A;  3WNM A;  3JZV A;  4YVS C;  3GGL A;  3QCW A;  4CP9 B;  3TNP B;  3ASI A;  3V64 A;  3TN9 1;  2XHN A;  1IPK A;  1RUG 2;  2BGC A;  2VXR A;  2WNV A;  1V6K A;  1S0F A;  5JDB A;  4UW5 A;  4XZU G;  3AC0 A;  1NCQ C;  3MIH A;  4RS5 C;  3VDC A;  4W8J A;  2FDH A;  4YNI A;  2VQ0 A;  4IES A;  4OMD A;  3U11 A;  5FP8 A;  5BNN B;  4LBO A;  4NJ4 A;  1XC6 A;  1L7R A;  2PHF A;  4ZON A;  5CKN A;  3VKL A;  1JH5 A;  2XJT A;  2GME A;  1W0O A;  2WA3 A;  4MGK E;  5D8A A;  3E5Q A;  4CXW A;  1GWL A;  4BQ4 A;  2EIB A;  1C8N A;  4H7M A;  5FZH A;  3V56 A;  3MZH A;  2WNU C;  3PIG A;  1N47 A;  2WRA A;  4X6Q B;  3ZFE B;  1PIV 1;  3UJO A;  5DZG A;  2C9A A;  3RRD A;  3VBU C;  3NQH A;  4QPI B;  4QAW A;  3BIW E;  2IXH A;  3FL7 A;  3EQE A;  3LOI A;  5B2G B;  4KG0 A;  4XIL A;  5FYZ A;  2EAK A;  3ZYP A;  2ILM A;  1LOG A;  1VBC 1;  4QQH A;  1PO1 1;  2QQK A;  4C1X A;  4BU2 A;  2D3P A;  3D5O A;  4OZO A;  3PUI A;  4DZG A;  2ZGQ A;  2PEL A;  5CAD A;  3OSD A;  4I0A A;  2C26 A;  3AM2 A;  1Q8P A;  1OQ1 A;  1YLL A;  4EN0 A;  1DGL A;  3BU7 A;  4E2G A;  1PZ7 A;  1TME 1;  5CKM A;  2JE9 A;  1AX2 A;  1BCX A;  3EMR A;  1J59 A;  1WW6 A;  1VMJ A;  2A73 B;  3WW2 A;  1OLR A;  5ACA 1;  4NRM A;  1BXH A;  2VNO A;  5E8A A;  1X9T A;  4IE0 A;  1RUJ 3;  1IPS A;  4P9L A;  3WW4 A;  4DB5 A;  5J96 B;  1VBA 1;  4FQZ A;  3W5N A;  3MIG A;  5HCB A;  3ZXD A;  4GMP 1;  3FLT A;  4JV4 A;  1OH3 A;  2D93 A;  5FMB A;  4A6S A;  4D94 A;  4KGG A;  2CSG A;  1AXZ A;  1KXG A;  3R4D B;  1W90 A;  4LHK A;  5EHD A;  1GOH A;  2JDP A;  2QQU A;  4MXW A;  5F6K A;  4Y5T A;  2IVJ A;  1QGL A;  4Q4Y 3;  3BYW A;  1CAV B;  1RMU 3;  3CZU A;  3ZSM A;  3K4D A;  1QEX A;  2PYT A;  2R1B A;  3WY6 A;  2UWC A;  3ZOI A;  1H2L A;  2V5Y A;  2W95 A;  4QDQ A;  1LKN A;  1IQA A;  3N9O A;  3TN9 2;  4Q29 A;  5GLZ A;  2ZHN A;  5CNA A;  1OVP A;  4JC1 A;  2AC1 A;  3AXE A;  5HI0 A;  2R6Q A;  5A7W B;  1G9F A;  2W1U A;  1J83 A;  3SXW A;  3W9A A;  3UKT A;  1LB2 A;  4L11 A;  1REF A;  4FXK B;  4MYE A;  3I2O A;  1I9R A;  3LIG A;  2G9G A;  1JYT A;  3ZFF C;  1AR7 3;  2H6C A;  2VZ3 A;  3WP5 A;  3WNN A;  1UQX A;  3OGJ A;  1SFY A;  1CAX A;  2A6Y A;  4XFC A;  4E4D X;  2EVX A;  5JWP A;  3UGH A;  3QBQ A;  4CDQ B;  2D40 A;  3U78 A;  1GZW B;  3CMG A;  1CPM A;  2R30 A;  4WM7 A;  5GJ6 A;  3LDR A;  3D0J A;  2Y6L A;  5FLH A;  3LSE A;  1OUR A;  1PIV 2;  3KB5 A;  3OPZ A;  5A7S A;  5A33 B;  3G7D A;  1GSL A;  2WKK A;  2JG9 A;  1NQJ A;  1UY3 A;  3UT0 A;  1LOA A;  1QY4 A;  3MF6 A;  2OVU A;  4YPJ A;  1C3H A;  3H1W A;  5JSO A;  2RJL A;  1VBC 2;  4QX0 A;  2OYZ A;  4HFS A;  1B35 A;  1LOF C;  1PO1 2;  2PAK A;  3CNA A;  2JDY A;  2VME A;  4N8M A;  3WDT A;  5A3L A;  3FHQ A;  2TBV A;  4FCA A;  1F35 A;  4R9A A;  2PLV 3;  2WII B;  1MQT B;  2P3I A;  3KCY A;  1EAH 1;  3NNJ A;  2NN8 A;  4I3P A;  4N53 A;  3N7L A;  4QX7 A;  2G9F A;  3ZYF A;  4CCE A;  3USU B;  4COV A;  1H2M A;  1TME 2;  3WP4 A;  3A21 A;  1MS1 A;  4ZXK A;  2VQT A;  5IVB A;  1GMM A;  5FK7 A;  2GND A;  1DGR A;  3S7I A;  4MAD A;  5ACA 2;  3FJS A;  5E89 A;  5JI9 A;  1BEV 3;  5EYY A;  4JVA A;  2ARX A;  1SG3 A;  3MEP A;  4ES9 A;  1VBA 2;  1LRH A;  1QJX 3;  3MYX A;  2ARC A;  4QDR A;  1Q3E A;  4HBN A;  4C1W A;  1YQ8 A;  1OXC A;  4O7X A;  4URA A;  5LK7 B;  4M3C B;  4C90 A;  1WD4 A;  2B9U A;  4BH9 A;  3GAL A;  3FUQ A;  5L9B A;  1X9P A;  2B46 X;  4K9S A;  1NLR A;  5T5L A;  4OI1 A;  3VBR A;  2RDN A;  3IBM A;  2GH2 A;  4XJW A;  2LS6 A;  3M3O A;  4IEP A;  4X6R B;  3ZLI A;  4PIZ A;  4AVT A;  1GNH A;  3QAC A;  1SLA A;  1JI6 A;  2WQ8 A;  4IEV A;  1OD3 A;  3NAP A;  2BNO A;  5DAX A;  1UOF A;  1KFX L;  5T55 A;  3ZSK A;  3ROU A;  1APN A;  4UOJ A;  3DYP A;  3WNO A;  2A6W A;  3DPR C;  3MW3 A;  5J98 B;  1LOC A;  1S2E A;  3FE5 A;  3WF2 A;  3ZR6 A;  1ZRF A;  1GNY A;  3N35 A;  5A7O A;  2VVF A;  3VHO A;  1CES A;  4BXF A;  4IEQ A;  3SLI A;  1VB4 A;  5C70 A;  3NKG A;  1UU4 A;  3D0S A;  3OG2 A;  4KH9 A;  2ID4 A;  5M0T A;  4FPH A;  3ZMO A;  4LPL A;  4JX0 A;  1UPI A;  5CFD A;  5L9R A;  2DVF A;  3CU7 A;  1PVX A;  3NJZ A;  4AVS A;  1W2T A;  3ECQ A;  2UY8 A;  3POE A;  4LHN A;  4LA3 A;  1HDK A;  2X09 A;  3QLQ A;  4IND A;  1W6Q A;  1WCK A;  1ST8 A;  1H0B A;  2P4E A;  4JZR A;  1QOO A;  2CL2 A;  3AJY A;  5FLJ A;  2OQ7 A;  3KV9 A;  4NPM A;  2DBI A;  2NYY A;  4BB3 A;  2D3R A;  5JXG A;  2PHR A;  3U07 A;  3KHC A;  4G3Y C;  5C5U A;  4J25 A;  3Q8B A;  4IXL A;  5DQ0 A;  4CEW C;  1IG0 A;  2JDM A;  1RUE 1;  1NG0 A;  1O6U A;  3N7M A;  4LTA A;  3E97 A;  1OVS A;  4CUB A;  4MGS A;  5HCH A;  3EJK A;  1UAI A;  1VAK A;  5K0U A;  1NLS A;  2QJV A;  1ND2 A;  1EAH 2;  1QDO A;  4K21 A;  4V1P A;  1PM4 A;  5J48 A;  1POV 3;  1YIP A;  3CJX A;  1UY1 A;  3VBO A;  3IM0 A;  2ZCW A;  4RGG A;  1GP5 A;  2OT7 A;  5T5O A;  1C5H A;  1WA4 A;  2Y0I A;  4D3W A;  1FI2 A;  2I2S A;  3AYE A;  3CJI B;  4XET A;  5D2A A;  5HV0 A;  1R09 3;  3ZFG C;  4LIT A;  1WW7 A;  4AQT A;  1J3Q A;  3AZV A;  3H7J A;  3JQW A;  3KCX A;  2W0X A;  3AL5 A;  1QJZ A;  2OPW A;  2ZGL A;  3AK0 A;  5EXO A;  4XAE A;  3WZ1 A;  3O1R A;  2FCT A;  2W92 A;  1RUD 1;  1S1A A;  2Y64 A;  5DDJ 1;  3U37 A;  3SKJ E;  4BDV B;  2ZGM A;  3B9I A;  3N36 A;  1W2U A;  2TUN A;  5I0D A;  5FWE A;  2YZ4 A;  4EYU A;  1JOJ A;  5J09 A;  3AL6 A;  4LIV A;  2WNV B;  2HWE 1;  1PZ8 A;  3LPF A;  4KGQ A;  1QXP A;  3ZO0 B;  2G19 A;  5J37 A;  4YG3 A;  2X29 A;  2XBO 1;  5IYY A;  2VUL A;  3HQX A;  3WNK A;  3UK9 A;  4D7Y A;  4QB1 A;  1CJD A;  2DUR A;  4CU7 A;  1ND3 A;  5BUV A;  4QXC A;  1V0A A;  3WX5 A;  2NMN A;  2CGO A;  3DGT A;  4Q26 A;  1H9P A;  2GSY A;  3WF0 A;  5LBF A;  3EO6 A;  1O5U A;  2VZP A;  3FBY A;  4NID A;  3WEZ A;  2ZBJ A;  3ZM8 A;  2J1S A;  1R1A 1;  2ZGR A;  4FFG A;  4ONU A;  2R07 1;  2YU2 A;  4L2N A;  1I6X A;  5D8A B;  1QJY 3;  5DUV A;  1HKD A;  2JD4 A;  3WIN E;  2OUJ A;  4FVV A;  1XYP A;  4XFB A;  5JIU A;  2JE8 A;  5FOB B;  4GH4 B;  2BOI A;  4ZS2 A;  3QOP A;  3U1X A;  3ZDS A;  1WKY A;  4PIY A;  3ACI A;  3J7M A;  1DQ1 A;  4ES8 A;  5BYN A;  2JG8 A;  3FFQ A;  5FYT A;  4ISQ A;  3T1M A;  1AR9 1;  4Y22 A;  4PI2 A;  4COZ A;  1DZQ A;  3GBG A;  4EN7 B;  1JU3 A;  3RPQ A;  4M4R A;  3O7O A;  2R06 3;  4Q5O A;  4BLJ A;  2UYB A;  1AYM 1;  1I3H A;  1RUE 2;  1YC6 1;  1OOP A;  2C6S A;  4IEY A;  3KS7 A;  2WLP A;  3V0B A;  2NPI A;  4C0H A;  4D6R A;  5L7O A;  4E4Z A;  3C7F A;  5I0U A;  4Y5Z 0;  4AL9 A;  5KXE A;  5IUQ A;  3IN9 A;  5FZ3 A;  4N9H A;  1W8H A;  4JGZ A;  1IOA A;  2WAO A;  4S2H A;  4Y4R A;  5T50 A;  1X82 A;  2Q8C A;  5C9A A;  4LMF A;  4XFI A;  4CZS A;  2WR9 A;  2J7M A;  4P9J A;  1IS5 A;  5JVV A;  4C91 A;  1DGR N;  2E31 A;  2MEV 1;  4O9G A;  4LBM A;  2Y6K A;  5JSP A;  5CKQ A;  1AR8 1;  5CG9 A;  1JUI A;  4QPG A;  5LBC A;  3SKV A;  3KQR A;  4MXW B;  3N3H A;  4LOS A;  5DAP A;  2O8O A;  4OQ8 A;  1P8J A;  4SBV A;  4DXR A;  1BBT 1;  2Y6F A;  4AXO A;  1RUD 2;  1US3 A;  2A71 A;  1W2A X;  3K77 A;  5DDJ 2;  5A7P A;  4AHZ A;  2A6X A;  3THC A;  3I8T A;  1PK6 B;  1ONA A;  2HWE 2;  3BPS A;  3TEY A;  4M0N A;  4DXZ A;  4JGY A;  4P9G A;  2XBO 2;  1N1V A;  2GNT A;  4URT A;  4LE4 A;  1O3T A;  5FPZ A;  4EWE A;  4YZ3 A;  1SAC A;  2GC3 A;  4BZ4 A;  2XVL A;  3VKO A;  3H1Y A;  1YFY A;  1TME 3;  5FXX A;  5FZ1 A;  4LKF A;  4QQP A;  1RL3 A;  3DKW A;  1CAX B;  2WO1 A;  4YW1 A;  3ZIX A;  5ACA 3;  5BNP C;  1O8S A;  1R1A 2;  2P1B A;  2XGX A;  2ARE A;  2R07 2;  4LIU A;  3PUH A;  2JEN A;  3R0R A;  4HSL A;  3ENR A;  4WM7 B;  5C4W A;  1R64 A;  2CGN A;  1HRI 3;  2CWM A;  4M0H A;  3I97 A;  2FQP A;  5FY1 A;  4CEY A;  1NZC A;  3OTF A;  1Q5O A;  3POY A;  2QE3 A;  2YC0 A;  5FZM A;  2JG9 B;  2Y0O A;  2ZHM A;  5FPU A;  1AR9 2;  1MS5 A;  4HOO A;  1B35 B;  3PIJ A;  2DCY A;  5C3R A;  3AP6 A;  1NCR C;  1AYM 2;  4XUT A;  4E2S A;  4CDW A;  2OZJ A;  3NW4 A;  5J36 A;  4J6G A;  4N53 B;  1BVP 1;  4MET A;  3VZM A;  3OUI A;  4D0Q A;  1OUX A;  3M70 A;  4K8F A;  1F15 A;  3UET A;  3WD5 A;  1QJF A;  2JE7 A;  4FFF A;  1MEC 1;  2BV4 A;  2A3Y A;  3CF6 E;  1H2N A;  4TLF A;  3T4V A;  3U10 A;  4MUV A;  4B3N A;  2WT1 A;  4LBK A;  5HPO A;  2QNK A;  4AED A;  5L36 A;  4QXB A;  4AI0 A;  1QWR A;  2MEV 2;  2WDB A;  2WNO A;  3ZSE A;  3VDB A;  2WO2 A;  1UZZ A;  3SNM A;  1AR8 2;  4NHK A;  4BME A;  3T2O A;  2F4P A;  3ZYG A;  4CPB A;  2BGP A;  4LK7 A;  1RUJ 1;  1NY7 1;  1DQ2 A;  3ES1 A;  3ZXG A;  1MVE A;  2AGS A;  3ZXF A;  2V09 A;  4S2D A;  4NIA A;  2VVD A;  3VBR B;  1BBT 2;  4XFF A;  4A44 A;  2IXJ A;  3J26 N;  3FBM A;  3LE0 A;  2D6P A;  4EE2 A;  4C8D A;  3WQ7 A;  2DUP A;  3NAP B;  4NAO A;  1M4W A;  2IUW A;  3CLP A;  4JDO A;  1UXX X;  3N4M A;  4JTN A;  4Q4Y 1;  1RUI 1;  2W47 A;  1XOY A;  1RMU 1;  3WF3 A;  4YG6 A;  2WZ8 A;  1IS4 A;  1GR3 A;  2K0G A;  3LIH A;  3CEW A;  1EAH 3;  4KWL A;  4MHU A;  4QPI A;  1JU4 A;  3J7H A;  4LE3 A;  1YQ6 A;  3AYA A;  2OII A;  2BGO A;  3Q8A A;  4L0P A;  5FPV A;  3TB0 A;  1DQ5 A;  1AJK A;  4QKN A;  4CDU A;  4GWN A;  4LKS A;  4PLO A;  4W65 A;  3VD7 A;  4C0B A;  5CFD B;  1ULF A;  4QKD A;  3SEE A;  4XUN A;  1DQ6 A;  1MS9 A;  5EV7 A;  1SHW B;  3OGR A;  1W6Q B;  3LA2 A;  1AR7 1;  3MLK A;  2V4A A;  3ZN6 A;  4ATF A;  2Z4F A;  4QDS A;  4Z07 A;  4UFL A;  5EPA A;  4EJR A;  5C8C C;  1U0A A;  1KD7 A;  4GD4 A;  5GLT A;  5IK8 A;  4YW5 A;  1YQ2 A;  4PJY A;  3SIS A;  1HRV 3;  2B8M A;  2BP6 A;  1W39 A;  4NE9 A;  2B9V A;  2NP0 A;  1U5X A;  2RDS A;  2DCK A;  4IUG A;  1JZ5 A;  5I8S A;  4MHR A;  4KWU A;  2PQQ A;  2CHH A;  1OI6 A;  3IB3 A;  3AMH A;  4JKL A;  5K0U B;  4AOC A;  4P08 A;  5DN2 A;  4DS0 A;  4ERO A;  1C1L A;  5FO9 B;  1ND2 B;  3ZN4 A;  4E4S A;  4BM8 A;  1HB1 A;  1V6I A;  3VBO B;  3ZYH A;  2BU9 A;  4QQO A;  5BNN C;  2W46 A;  1MEC 2;  4KQ7 A;  4BOW A;  1ZYB A;  2PLV 1;  5JXH A;  2VBD A;  4BYY A;  4RYD A;  1UY0 A;  5IAX A;  2UU8 A;  1QMJ A;  4HLT A;  4RA0 A;  3AKQ A;  2WYS A;  4AGR A;  2EF6 A;  4D6S A;  2V73 A;  2BVB A;  3POI A;  3RWK X;  3ZPY A;  3PJY A;  1G9D A;  1UYX A;  3T2P A;  1SLB A;  3ACG A;  4OYU A;  3ZFE C;  1WW5 A;  1BEV 1;  2GU9 A;  4YZ1 A;  1ZRE A;  4WZF A;  3AJZ A;  2D6K A;  1RUJ 2;  1NY7 2;  4QPI C;  4JHZ A;  1RUH 3;  5LBE A;  4D69 A;  2HWF 3;  2NZ9 A;  1QJX 1;  2VCB A;  3AZW A;  4HPK A;  1CAU A;  3BTA A;  4FAH A;  5A3M A;  2I74 A;  2D6M A;  5CB7 A;  1XSQ A;  4BLI A;  1NX9 A;  4ZU7 A;  1N3Q A;  1X50 A;  1YNA A;  3IIA A;  1RUE 3;  4LNV A;  3WDW A;  1ZA4 A;  3GNE A;  3ZXJ A;  2WO3 A;  4EN8 B;  2JDK A;  2QQM A;  4IL7 A;  1RUI 2;  2H0B A;  4Q4Y 2;  1RIN A;  1RMU 2;  1ND3 B;  4NRP A;  1SZB A;  4QKF A;  3J9S A;  5IVE A;  5CVR A;  1PZ9 A;  3O1P A;  2LRO A;  3PU3 A;  1XXN A;  1GBG A;  2W91 A;  3OD0 A;  3OJB A;  3HWJ A;  5T3N A;  4COY A;  2W3J A;  3HR9 A;  1YUD A;  2Q8O A;  4KI5 M;  4LOT A;  4Q1R A;  1YO8 A;  1REE A;  4XQ4 A;  4Y26 A;  3SH5 A;  1BLZ A;  1A6C A;  1JTZ X;  2HLE A;  4I02 A;  5APA A;  3OUH A;  5K7P A;  5FFO C;  4XBQ A;  1J84 A;  4FO9 A;  4Z82 A;  4ZU5 A;  3H0O A;  4GKX A;  4UW6 A;  1F4H A;  1AR7 2;  5LAT A;  4WVZ A;  1YFX A;  4XF0 A;  4I0W B;  3L9J T;  4AFA A;  4TLG A;  1T2X A;  2JG8 B;  4A4A A;  3RYK A;  4Y22 B;  2QZ2 A;  3EYP A;  5BXX A;  1GV9 A;  3IMN A;  1Y9G A;  2VW2 A;  3A0N A;  3KQ4 B;  1RUD 3;  3ILF A;  2QQL A;  2YFZ A;  3P3P A;  4NPR A;  4RL7 A;  5T54 A;  4MSV A;  1OOP B;  4QX1 A;  2ARA A;  3BVC A;  4WM8 A;  4QM9 A;  3GM8 A;  4ZY9 A;  3S6P A;  3V0B B;  5L7O B;  3FN9 A;  2Y6H A;  3QH7 A;  2YY1 A;  5FP4 A;  1ZBE 3;  2X8K A;  3MID A;  4JGZ B;  4MVT A;  3HVD A;  4PBP A;  2P3J A;  4YM3 A;  1F5J A;  1FOD 3;  4LBJ A;  5FZO A;  4XDQ A;  1RJ8 A;  3LWC A;  5C9A B;  3C7H A;  3AP7 A;  5LA1 A;  2PLV 2;  4Q4V 1;  5LBB A;  1TQ5 A;  4PF1 A;  5I0S A;  1UW8 A;  4XDO A;  3FFZ A;  1GZT A;  3KCC A;  4AVV A;  1POV 1;  1HN1 A;  4CDQ C;  4QPY A;  4QPG B;  1BKZ A;  3C7G A;  3NST A;  1V6M A;  4YZ5 A;  2VZ1 A;  1ZZ6 A;  2XJV A;  1PGL 1;  1G86 A;  4IGQ A;  1BEV 2;  1IG3 A;  1L7L A;  3K75 B;  2DV9 A;  2FMY A;  1R09 1;  5FY9 A;  1H4G A;  4YVW A;  1QJX 2;  2EXI A;  3I2H A;  5FYB A;  1WCD J;  1AR9 3;  1J1T A;  3USS A;  4QM8 A;  2GN3 A;  1W6P B;  2PA7 A;  1EV1 2;  2JX9 A;  3N9Q A;  1JW6 A;  4BCU A;  3BKZ A;  1LEN A;  1MQT C;  3GBF A;  4JGY B;  3SIT A;  3VN4 A;  5JAX A;  5KBF A;  1MZ6 A;  4BXS V;  4JDM A;  3WW1 A;  4XIK A;  2FMD A;  4XIO A;  5F7U A;  2BFU S;  1UOB A;  1DZT A;  5FP3 A;  3ZSL A;  1ZRI A;  4QGN A;  1JYV A;  1W3V A;  3R6S A;  2EAA A;  1ZX5 A;  1JYN A;  1W05 A;  4ZHN A;  3KVA A;  4NII A;  5JXI A;  1KJR A;  1H1I A;  3OYW A;  5EYX A;  2Q1M A;  4LUK A;  1S4C A;  4MV2 A;  3VKN A;  2ZEZ A;  5C4W B;  5AFE A;  2D3S A;  4B4P A;  3PDQ A;  5FZE A;  5JR7 B;  1S0D A;  3UGG A;  1ASJ 1;  1N3O A;  3AZX A;  5FZD A;  4BA6 A;  4CEY B;  4YW4 A;  3T0A A;  1C8M 3;  3TWI A;  3ZYB A;  2WC2 A;  3CDZ B;  1QJY 1;  3C7E A;  1AF9 A;  1L7Q A;  5JXJ A;  5F3G A;  3R05 A;  4OHV A;  1BBT 3;  2C9K A;  3SEP A;  2HBU A;  4BQW A;  3BB6 A;  4NRQ A;  4BIS A;  2HBT A;  3B94 A;  4YG0 A;  2JD9 A;  4AFB A;  4CDW B;  5HXV A;  2QQI A;  2K46 A;  1HV1 A;  4N43 A;  4OMC A;  5FY7 A;  1FT9 A;  1VAL A;  1O8P A;  3HBZ A;  2GNB A;  2R06 1;  2VMG A;  2EID A;  2OUH A;  1HQL A;  4FPO B;  1U5Y A;  5FY8 A;  5SV8 A;  5IVV A;  2VAU A;  3KWV A;  5FOJ B;  2FDF A;  3T2T A;  2IXC A;  1CWP A;  4LT5 A;  1X8E A;  1OF3 A;  4XJU A;  2B4K A;  4XF1 A;  1G9C A;  3QD6 A;  3RMY A;  4Q4V 2;  3V65 A;  3GHN A;  4AED B;  3I2D A;  4CP1 A;  2IXL A;  1IS6 A;  5A3O A;  4GA9 A;  1XNA A;  5A1F A;  2VW0 A;  4LO4 B;  2Q0A A;  2Y34 A;  4UI9 L;  1DLC A;  1LUL A;  2RS3 1;  3OBT A;  4RGA A;  5IK7 A;  5E88 A;  1WLT A;  2GH8 A;  1OPO A;  4QWN A;  2R1D A;  2OXB A;  4HZF A;  1PGL 2;  1O7F A;  1ZRD A;  2BW8 A;  4JHT A;  4M3C F;  3M3C A;  1R09 2;  2ZX4 A;  3AP5 A;  3I7D A;  3WQ1 A;  1EPW A;  1Y43 B;  1PO2 3;  1S0I A;  3E1F 1;  3ABZ A;  2CYF A;  3OBA A;  4HKL A;  4QPW A;  4XCA A;  2FDG A;  1GLH A;  1OC1 A;  1V00 A;  2VBP A;  2XWB B;  3P1I A;  4W6W A;  4CCL A;  4GH4 A;  5IFT A;  2J1R A;  1BHG A;  3O1M A;  3DCQ A;  3ZPO A;  3VDA A;  3ZXA C;  1J58 A;  4F8A A;  3H8O A;  3TEW A;  2W94 A;  3ELN A;  2VG9 A;  4XEZ A;  4TN7 A;  1OFN A;  1SFP A;  4CDU B;  2HWC 3;  2W08 A;  1MEC 3;  5G05 L;  2QUO A;  3CJI C;  1MS0 A;  1OFS A;  2WSU A;  2EIG A;  3HOB A;  2Y8K A;  4XPV A;  1SPP A;  4F7Z A;  5IAV A;  1A34 A;  4I3G A;  3ZN6 B;  3P3N A;  4YFW A;  3U0Z A;  4F83 A;  4RR3 B;  1V6O A;  1ASJ 2;  5FYU A;  2YUE A;  1R08 1;  2ZJC A;  5F5A A;  2E53 A;  4LKD A;  2KXL A;  3TAY A;  1JOP A;  4JRA A;  2Z42 A;  1QJY 2;  3MBW A;  3WOG A;  5EZW A;  3WG3 A;  1ZA7 A;  1O5L A;  5ABJ A;  1R1Z A;  1HRI 1;  1H8T A;  1COV 3;  2ZGS A;  3KLS A;  1XU1 A;  2WNV C;  4QB6 A;  3VL8 A;  4RSU A;  3VZK A;  1OPM A;  4LBN A;  1PGS A;  3VBF A;  5ANQ A;  3VD3 A;  4PCR A;  4XDP A;  5FUI A;  3U14 A;  2FZ2 A;  3RYR A;  1DHK B;  1RUI 3;  2A5Z A;  3H9A A;  2R06 2;  5LZ6 A;  3PUR A;  2WWS A;  1LR5 A;  2ETE A;  3MHZ A;  1O4Z A;  1RGS A;  1RUF 3;  3RS6 A;  1W9T A;  4XXP A;  5HCA A;  3CZJ A;  4ZZ5 A;  1PK6 A;  5EJ3 A;  5D8A C;  2UY9 A;  1XNK A;  5K4L A;  2BPA 2;  2LTN A;  3GHM A;  3WR0 A;  1CON A;  3I2K A;  3JXS A;  2RM2 3;  5LW9 A;  4XOG A;  4GH4 C;  2RS3 2;  3LEM A;  1TNF A;  1YRZ A;  1XE7 A;  1T6B X;  3RI9 A;  1A3K A;  4RHV 1;  4AFC A;  1CD3 G;  1JZ3 A;  4HXC A;  1CVN A;  1Z78 A;  2BRT A;  1LU2 A;  4RQP A;  3SH3 A;  4PDW A;  1WLW A;  4HPK B;  1WMF A;  3W58 A;  1CAU B;  1UWW A;  4ZPI A;  2FZ1 A;  4KMQ A;  5FLI A;  1NA1 A;  1PX4 A;  2QKD A;  4N7U A;  3NKT A;  4HSJ A;  3WDX A;  4CPB D;  4FTS A;  3B9C A;  2WQ4 A;  4XTP A;  5D1I A;  3IKW A;  2VVE A;  3VHR A;  1ULC A;  3VKF C;  2XDV A;  1XRU A;  2FCU A;  1WZX A;  2IC1 A;  5DAW A;  4D8M A;  1LHV A;  1Q8S A;  1Y3T A;  1YXW A;  2YXS A;  4NOT A;  2OS2 A;  2PHT A;  2ZZQ A;  4D7S A;  5A1A A;  1OSG A;  1UF2 C;  4ZXE A;  1RUO A;  4XMI A;  4CYD A;  1GUI A;  2W1W A;  2W39 A;  5A6Y A;  3VB9 A;  2WL1 A;  5FBZ A;  2VL4 A;  2ZS6 B;  4FOW A;  2J1A A;  3ITQ A;  2X5I A;  1Y9Q A;  2VZU A;  4W6Y A;  1RHI 1;  4XAC A;  3FZ3 A;  5F8P A;  5FZI A;  1R08 2;  1AJO A;  4P5Y A;  5A7N A;  3MO4 A;  2DVB A;  3F95 A;  1VRB A;  3SQO A;  4E4H A;  1NXM A;  2P6C A;  4BK5 A;  1HRI 2;  1PNG A;  3BOP A;  4WM8 B;  1PK6 C;  4Y5S A;  4E8D A;  2OX0 A;  3THD A;  1OHF A;  1EV1 3;  3B02 A;  4OVE A;  5A3T A;  1HRV 1;  2YYO A;  2XLF A;  1RUC 1;  2XQR A;  3HNY M;  1TZO A;  5FZO B;  2FDI A;  2BDR A;  3DEC A;  1OBN A;  5LA2 A;  3NNG A;  5IFP A;  5F3I A;  2XML A;  2VY0 A;  4FTB A;  1G9A A;  3H1M A;  2JDA A;  5BPX A;  1V9U 1;  4WM7 C;  5FYM A;  4M4P A;  5FZK A;  4CE8 A;  2YC2 A;  2JKB A;  1S0B A;  5CIS A;  2DF7 A;  2RS1 1;  1ODM A;  4RHV 2;  3VBH A;  2E7A A;  2JG9 C;  4PHZ A;  2MNG A;  2UWA A;  1YJL A;  2GP5 A;  3GZA A;  4O9E A;  5EP9 A;  1NT0 A;  2ZEY A;  1VE0 A;  2VZV A;  2XWJ B;  4XE9 A;  3KT7 A;  4YVW B;  4DOU A;  1B35 C;  2JJ6 A;  2VNV A;  3GZE A;  2YFU A;  1PMI A;  2A3X A;  4I01 A;  4DO0 A;  4XBN A;  3GJB A;  1ZZ9 A;  2VBB A;  2WSV A;  1UN1 A;  2CAV A;  3OPT A;  4DUW A;  1HX6 A;  1RUH 1;  2R0F A;  3OGS A;  1S2B A;  4N53 C;  3VDD A;  2JIC A;  5FY4 A;  2HWF 1;  2PFW A;  2PMW B;  1GNZ A;  1W8W A;  1SQ4 A;  1N1S A;  3GF6 A;  4L97 A;  5FZ0 A;  4ARY A;  5LK5 A;  1BYH A;  2VQA A;  3WNP A;  2Q4S A;  4Y1Z A;  4A7Y A;  2CDO A;  1F9K A;  4K6B A;  4P9X A;  5DUW A;  4QX2 A;  3B7M A;  4FQ4 A;  1YJK A;  2AEN A;  4B4R A;  3KVB A;  3ZVX A;  4EWD A;  5IVJ A;  2GP3 A;  1E5R A;  3OYW B;  4FI9 A;  4RFR B;  4IEO A;  4CU6 A;  2Y26 A;  1PHM A;  3E5X A;  4Q4V 3;  3J7L A;  3N7K A;  3T2Q A;  4ITC A;  4U2A A;  4AHX A;  3BI3 A;  5IVC A;  2IWG B;  3AVS A;  1IS3 A;  1QF3 A;  2Y38 A;  3K3O A;  4L8Q A;  3IDA A;  5FO8 B;  1RHI 2;  4UWD A;  3S30 A;  3VBR C;  1HXS 3;  2VE1 A;  1JYI A;  1RVF 3;  2Q1Z B;  1RIR A;  4JTO A;  4NPL A;  4OI4 A;  3NAP C;  4AEK A;  3ZDV A;  4LBQ A;  4FP3 A;  4P9W A;  1C57 A;  5FMC A;  1Q8V A;  3IPV A;  4J1X A;  1JYW A;  2XKO A;  4V2V A;  3ZXL A;  4Q0V A;  4N43 B;  2YMZ A;  4CP0 A;  1HRV 2;  1I1E A;  5TSW A;  5JOY A;  1W0P A;  4Q4W 3;  1SCS A;  1QJU 1;  3TRS B;  3URF A;  1O4Y A;  1RUC 2;  4MZU A;  5IVF A;  2ZGN A;  5JR2 A;  3ON7 A;  4HL0 A;  3CL1 A;  5LA0 A;  3BIE A;  4GKY A;  2OPK A;  5CFC A;  5CFD C;  5IAT A;  3O0W A;  4Z92 B;  1ZBE 1;  2E26 A;  1WD3 A;  1F5F A;  4TYS A;  5BNO B;  4AHW A;  1V9U 2;  4COU A;  1FOD 1;  1NE4 A;  5LWB A;  2VUJ A;  2VR4 A;  2Z69 A;  3BTX A;  3KV6 A;  4AI8 A;  4B8E A;  3W59 A;  1ULO A;  1H1A A;  3JBG 1;  2RS1 2;  2PAM A;  2XON A;  4WVW A;  1ASJ 3;  3WCR A;  4XQD A;  1WA6 X;  2B39 A;  1TMF 3;  2UWB A;  3RGB A;  2PXJ A;  4K3U A;  5KC6 A;  4LO8 A;  5DXD A;  1VBB 1;  2D5H A;  4LUM A;  4OI0 A;  2VQU A;  5K0U C;  3AMQ A;  4FOQ A;  1VAM A;  1ND2 C;  3RI8 A;  1RUH 2;  1QDC A;  3ILR A;  2QBX A;  3VD9 A;  5DG2 A;  2CGP A;  1Z0H A;  2HWF 2;  3RZM A;  3DXT A;  1BQP A;  5BNQ A;  3VBO C;  2O1Q A;  2GMP A;  5FZL A;  3IAQ A;  2UUR A;  3HBK A;  3RJ2 X;  2JDN A;  2D7F A;  4OLL A;  4K1Y A;  5C8W A;  2C4X A;  2Z5W A;  3T3Y A;  3ZXE A;  5KXC A;  1SPP B;  2YPD A;  1CX4 A;  2VOX A;  1E5I A;  5ERL A;  2BNN A;  2A1X A;  4XF3 A;  3VHP A;  5FQ0 A;  1DDL A;  1YFW A;  4IGP A;  4I09 A;  3I2F A;  5C7G A;  2RS3 3;  3WNX A;  4YLZ A;  3THP A;  4AI9 A;  2DCZ A;  2XB6 C;  3P5B A;  3HD8 B;  3TEX A;  4QQ2 A;  1XNB A;  2D43 A;  5JZG A;  1GP6 A;  1Y4W A;  4LLF A;  4XUQ A;  3BOW A;  3FUO A;  1KQR A;  5ABJ B;  1H8T B;  4FSJ A;  2VZS A;  3IDE A;  5T52 A;  4CXY A;  1C8M 1;  4DEV A;  1LHW A;  3VBF B;  1VRH 3;  5FXW A;  5DG1 A;  4YW6 A;  4GUL A;  2XH6 A;  1ND3 C;  3J7N A;  4CRQ A;  3SMH A;  1O4T A;  1W06 A;  4CP2 A;  1UIK A;  1QJU 2;  2E7T A;  1MS3 A;  3DXU A;  3VBS B;  1SCR A;  3ZSJ A;  4QX8 A;  2K9Z A;  1A8D A;  4GWJ A;  5FAX A;  3VD5 A;  4Z2A A;  3ACL A;  5DMY A;  1N1Y A;  1W6P A;  4LBL A;  4TTG A;  4J1W A;  1LNS A;  1IPJ A;  1JMU B;  2O8Q A;  4H14 A;  5GZE A;  4CCM A;  4CCK A;  1QOT A;  1ZBE 2;  3MUZ 1;  4CVU A;  4YAR A;  4FPG A;  4R9C A;  4BK4 A;  1FNY A;  3KF3 A;  3NO8 A;  1FOD 2;  4Y1U A;  1DGW X;  1S0J A;  5CEH A;  2JG8 C;  1G7Y A;  3JBG 2;  4RQP B;  2ZAC A;  3O0V A;  4PDW B;  3NL1 A;  2PN5 A;  4Z1V A;  1R08 3;  3JUU A;  3PMS A;  1HN0 A;  5GLU A;  3RYP A;  1ZRC A;  2VD7 A;  4NHM A;  4IEW A;  4DFS A;  1TG7 A;  4YGE A;  1OOP C;  1NA1 B;  1VBB 2;  2Y60 A;  2CV6 A;  2DUO A;  5IK4 A;  5LA9 A;  4GIQ A;  5L7O C;  1AUY A;  1IQD C;  4JDN A;  4LOR A;  2FDJ A;  3T1L A;  1CZS A;  2HWD 3;  1PO2 1;  4P00 B;  4PLN A;  3H8X A;  4JGZ C;  3CQO A;  1J3R A;  2P37 A;  1E57 A;  1UOG A;  4JCK A;  5GAL A;  1D4V B;  3IT8 A;  5E6H A;  5C9A C;  5F1R A;  4AFM A;  1G6N A;  3M3E A;  3O0X A;  3T09 A;  1Q56 A;  4SLI A;  2YB7 A;  2VZT A;  3MPB A;  2WZR 3;  3W5M A;  4A45 A;  1W28 A;  3PHM A;  4FPC A;  4XTM A;  1W2N A;  4AK3 A;  4QPG C;  1YQC A;  5FP7 A;  4P9I A;  1YQ5 A;  2X5I B;  3TOJ A;  1RUN A;  1KFU L;  3OD4 A;  2HWC 1;  2WQZ C;  1H6Y A;  4BQ1 A;  3POF A;  1PMJ X;  4IEX A;  3EHK A;  4LO5 B;  4W4Z A;  4EZ4 A;  1N3P A;  1GWK A;  4RHV 3;  2E7Q A;  2TEP A;  2ZPX A;  1YI7 A;  3B01 A;  4L99 A;  1BMV 1;  3POS A;  1US2 A;  1F2N A;  1LOD A;  1C8M 2;  2VUA A;  2W9X A;  3IAP A;  3NV2 A;  4JGY C;  2B42 B;  1W8F A;  2HYX A;  4KNC A;  1RTV A;  2ET1 A;  1A8M A;  1WBF A;  5F39 A;  3PME A;  5L9V A;  3HT1 A;  2DVG A;  1BK1 A;  1OUS A;  3B69 A;  4JKM A;  2XL9 A;  2EXK A;  2NM1 A;  5FXZ A;  1ALY A;  3JU9 A;  1COV 1;  4O65 A;  1D2Q A;  1DFQ A;  1UY4 A;  2OQ6 A;  1W8T A;  3AMM A;  3NJV A;  1V6J A;  2GAL A;  4LO7 A;  5BY5 A;  4WV8 A;  1UU6 A;  2XJS A;  3TBD A;  3WW3 A;  3NWK A;  2CAU A;  2VOW A;  3FX3 A;  3S7E A;  4CUG A;  5A6Q A;  5C4W C;  5ISL A;  1ENS A;  1ZVF A;  3HEI A;  3O1V A;  5KXD A;  4ASM B;  3K4A A;  3MPP G;  3MI8 A;  1NZI A;  2D44 A;  1RUF 1;  2YV8 A;  4QT6 A;  3CBN A;  4CEY C;  4YGB A;  5C3P A;  3VBH B;  3FC0 A;  5LCW L;  2FDK A;  3PL0 A;  4IV1 A;  1ACC A;  3S0M A;  5GM0 A;  3WF1 A;  2GC2 A;  1CR7 A;  1JS9 A;  4RFT 0;  1RHI 3;  1UL9 A;  1EY2 A;  5DAV A;  2RM2 1;  1ZZ7 A;  4K8R B;  1D4M 3;  1W6M B;  2KA3 A;  2YGM A;  4CDW C;  3C2U A;  4L92 A;  1MZ5 A;  2R32 A;  1DIW A;  3VDD B;  4DIQ A;  4RR3 A;  2PHU A;  4U36 A;  3WF4 A;  1IZ3 A;  1MVQ A;  2G1M A;  2ZML A;  3MDP A;  4BJ0 A;  1SLL A;  1JBC A;  3G6J B;  2VOV A;  4M3C E;  1PO2 2;  2BFU L;  3LEG A;  4DQA A;  1RUC 3;  2ZHL A;  3OBZ A;  3J8F 1;  4HK9 A;  4XMA A;  2ZGU A;  4NIH A;  1ULG A;  4NN0 A;  4AED C;  1FX5 A;  2BTV C;  3K3N A;  4GB3 2;  3AMP A;  5FBJ A;  2ADD A;  4CDX A;  5FZ9 A;  4DUX A;  2XPJ A;  4XC9 A;  3O14 A;  4IV3 A;  3ACH A;  4R8H A;  2RV9 A;  1VMH A;  1V9U 3;  3KSC A;  2N7G A;  4NAM A;  2AAC A;  2ZOE B;  2WWJ A;  1UMZ A;  2HWC 2;  2WUH A;  2HH9 A;  3AZZ A;  3MIE A;  3N9N A;  3NNF A;  1DBN A;  3OEA A;  3PJQ A;  3PTY A;  4LK6 A;  2AEZ A;  3HQR A;  2RS1 3;  1XND A;  1UZ0 A;  5GLW A;  3R4U A;  4XFA A;  2QFE A;  4MGZ E;  2WZP P;  2J1E A;  4PIX A;  3R4S A;  2DYC A;  2DU1 A;  1WLD A;  4FPK A;  4LBQ B;  2WFP A;  4XJ8 A;  1YYN A;  2RJ2 A;  3UJQ A;  1G9B A;  1BMV 2;  3IPV B;  1ZBA 3;  5A7Q A;  4YYO A;  2R16 A;  4JKK A;  2HEY F;  1UCX A;  1GZC A;  2WLQ A;  1W8O A;  1X36 A;  3WP6 A;  2LUW A;  4DRR A;  3RZZ A;  3ZIW A;  1DG6 A;  4DXS A;  1O59 A;  4WVM A;  2J1U A;  3AVR A;  1VIW B;  4XUP A;  2VMD A;  1COV 2;  4YW7 A;  4XF9 A;  4CDU C;  3GXU A;  4R52 A;  1YIF A;  5CFC B;  1EV1 1;  2VC9 A;  2E6V A;  2PHL A;  1F4A A;  2PHD A;  3VD4 A;  4LHS A;  2L9L A;  4GQ7 A;  1HB2 A;  1W6N A;  4AVC A;  4QXK A;  2W1Q A;  3PLQ A;  4OFG A;  3O1O A;  5I93 A;  2BBA A;  2Q5T A;  2WAA A;  1QKQ A;  1UYP A;  3MIC A;  2WNE A;  4RR3 C;  3ZX7 A;  5A80 A;  4XF4 A;  1RUF 2;  2V4V A;  5HV4 A;  4CXX A;  2NMO A;  2WN2 A;  3AYD A;  3BTZ A;  4XJA A;  2AH2 A;  4P02 B;  4HN1 A;  1Q8O A;  4HKW A;  3WLU A;  4X8N A;  3WSO A;  4QU1 A;  3B5L B;  1UO9 A;  2VW1 A;  4Q27 A;  1V6L A;  5FZA A;  2RM2 2;  5A70 A;  5KHI A;  2WS9 3;  2A6V A;  1OLM E;  1GOG A;  3M1H A;  4MGQ A;  3WUD A;  4AFD A;  1JOB A;  2ET7 A;  2Z79 A;  1PM7 A;  2BNM A;  5HXM A;  1IKP A;  4ATE A;  2KR2 A;  3KF5 A;  3UGF A;  3IWZ A;  5GZD A;  3J4U H;  3AZY A;  1URX A;  3WDY A;  5C3O A;  3AKS A;  2R49 A;  3VGI A;  3H8U A;  1QJU 3;  2XVG A;  4OHW A;  3QH6 A;  5L73 A;  3J8F 2;  2Q8E A;  2B5H A;  2O14 A;  2C24 A;  3MW4 A;  3U75 A;  3B93 A;  5IVY A;  1UU5 A;  4PT6 A;  1QOS A;  2ATF A;  4AEJ A;  4UT5 A;  4KWK A;  5FQ0 B;  2ZZJ A;  3HJR A;  1HIX A;  3UKV A;  3AXD A;  4F3J A;  4FPF A;  4DUV A;  4KU8 A;  4JAA A;  1W9Y A;  2ZTN A;  1RC6 A;  3HMY A;  3JBG 3;  3LAG A;  1U12 A;  2ZMN A;  5JZG B;  5K9Y A;  1XE0 A;  3U4X A;  2EIC A;  4XBL A;  1CX1 A;  5FJK A;  2YDE A;  3N9L A;  2H0V A;  4DNY A;  1FAY A;  4B7E A;  4S2G A;  1SDD B;  3UES A;  2SBA A;  1V6N A;  1VBB 3;  2YBP A;  1SMV A;  2F17 A;  1AX1 A;  4MGT A;  3M2M A;  2XJP A;  1GP4 A;  2ZAA A;  1HXS 1;  1SEF A;  2BOJ A;  1RVF 1;  3CKH A;  4CCN A;  1HB3 A;  2ZX1 A;  2ZGP A;  4H55 A;  1LGN A;  4FPL A;  1J1L A;  1SLI A;  5JLV A;  1ZZ8 A;  5A32 A;  3Q9O A;  4LBQ D;  2IXK A;  1SLT A;  3AMN A;  3E6D A;  4N7I A;  3GCW A;  4TXW A;  2ZEW A;  1Q43 A;  5B4N A;  4Q4W 1;  4AAP A;  3OEB A;  2RDR A;  2ZX0 A;  4Y1V A;  4UBH A;  1LHO A;  1YHF A;  3IZO A;  2D6O X;  5A3W A;  4HAN A;  2I45 A;  1LES A;  4YVS A;  1GIC A;  5JPM B;  1K5M B;  2VZO A;  3I2J A;  4AGV A;  1GU3 A;  5JUV A;  2E33 A;  1OLQ A;  2EA7 A;  2HKX A;  3I3D A;  3MV0 1;  3NV4 A;  2YPJ A;  4FFH A;  1NYW A;  3DL3 A;  4WM8 C;  4XHX A;  3V0A A;  2R04 3;  4PF5 A;  1NCQ A;  1LCL A;  1BJQ A;  4RS5 A;  1RED A;  3M4F A;  1TMF 1;  2K2S A;  1QJE A;  2XR4 A;  2XXZ A;  4MOA A;  4QKB A;  5FYS A;  3K51 A;  3TYJ A; 
#chains in the Genus database with same CATH homology
 1JU3 A;  2VL4 A;  4M4R A;  2J1A A;  1CZT A;  1OH4 A;  2VZU A;  2R7E B;  3T0B A;  4LQR A;  4P5Y A;  3A22 A;  1UX7 A;  3MO4 A;  1D7P M;  1ULP A;  3C7F A;  3OGV A;  2VO5 A;  2CDP A;  4BK5 A;  1PMH X;  3WQB A;  4E8D A;  2WAO A;  4QB2 A;  3THD A;  2J7M A;  2WBK A;  2RVA A;  4DXT A;  2E31 A;  4A41 A;  2Y6K A;  3HNM A;  3HNY M;  3DEC A;  5LA2 A;  3SKV A;  3NNG A;  1EUU A;  2J1T A;  2YC4 A;  4E8C A;  5IFP A;  2VCC A;  3I3E A;  2J22 A;  1P8J A;  1JZ6 A;  2PQS A;  4DXR A;  2JDA A;  3HPN A;  1US3 A;  3NRU A;  4M4P A;  3K77 A;  2YC2 A;  2BER A;  3WNL A;  3F2Z A;  3THC A;  4GWI A;  2ZEY A;  2VZV A;  5EJ1 B;  2X10 A;  3I2I A;  3P6B A;  3OB8 A;  2YFU A;  3K4Z A;  2VCA A;  3HNB M;  2J1V A;  4DUW A;  2W5F A;  3OGS A;  2WO1 A;  4ARY A;  5C71 A;  1O8S A;  3WNP A;  3PUH A;  1DP0 A;  2CDO A;  3K46 A;  2JKX A;  2W1S A;  2XOM A;  3A23 A;  1R64 A;  2ORX A;  4QX2 A;  1JZ4 A;  3I97 A;  4FI9 A;  4CU6 A;  2WZE A;  3T2Q A;  2VJX A;  2QQN A;  4A6O A;  4XUT A;  3IDA A;  2ORZ A;  5J1X A;  1TVG A;  4D0Q A;  3T0D A;  3UET A;  2KD7 A;  1W99 A;  1JYW A;  2X05 A;  3ETP A;  2VMC A;  5HPO A;  2WAB A;  2QQO A;  2WDB A;  3VDB A;  2WO2 A;  5JR2 A;  4A42 A;  3T2O A;  5LA0 A;  2VM9 A;  2BGP A;  3LEI A;  2E26 A;  4A44 A;  3LE0 A;  3LPG A;  2VR4 A;  3I3B A;  3NJX A;  3GDB A;  1ULO A;  1KEX A;  3LEK A;  1UXX X;  2XON A;  3C7O A;  1GOF A;  2ZXQ A;  4W50 A;  2W47 A;  1EUT A;  5EIY B;  1I5P A;  3WF3 A;  1W8N A;  2WZ8 A;  4CUC A;  1JU4 A;  2VTF A;  3J7H A;  1K3I A;  4ARX A;  3FHA A;  2VQU A;  2BGO A;  4L0P A;  3ACF A;  2QBX A;  3VD9 A;  4LKS A;  3VD7 A;  1RYY A;  3SEE A;  4XUN A;  1SHW B;  3OGR A;  1MPX A;  3IAQ A;  2DDU A;  2Z4F A;  1GQP A;  4QDS A;  2C4X A;  2QQJ A;  1YQ2 A;  4UAP A;  1UMH A;  2B9V A;  4IUG A;  2DCK A;  1JZ5 A;  4AG4 A;  4KWU A;  3I2F A;  5C7G A;  3T08 A;  3IB3 A;  4JKL A;  4P08 A;  5DN2 A;  3I2G A;  2EIE A;  4XUQ A;  5CZK A;  2VZS A;  3EB7 A;  2W46 A;  4DEV A;  5JXH A;  4RYD A;  1UY0 A;  5JMO A;  1JZ2 A;  2WYS A;  4ZZ8 A;  5EJZ B;  2DCJ A;  1NKG A;  3WNM A;  1UYX A;  3T2P A;  3ACG A;  3GGL A;  4GWJ A;  4OYU A;  1W9S A;  5IJR A;  3VD5 A;  4Z2A A;  5DMY A;  2XHN A;  2VZR A;  4TTG A;  4JHZ A;  1LNS A;  4CVU A;  3MUZ 1;  1UYZ A;  2VCB A;  3AC0 A;  3MUY 1;  4XZU G;  4BK4 A;  1K45 A;  2ZEX A;  3VDC A;  4W8J A;  1NX9 A;  4OMD A;  3MV1 1;  1XC6 A;  1L7R A;  3HN3 A;  2WO3 A;  2QQM A;  1TG7 A;  4GZ9 A;  2EIB A;  2W91 A;  2W3J A;  1CIY A;  1IQD C;  4KI5 M;  1CZS A;  3NQH A;  4P00 B;  4QAW A;  3FL7 A;  2HLE A;  3CQO A;  2W87 A;  4HG6 B;  1J84 A;  5IHR A;  2QQK A;  3T09 A;  4OUE A;  2YG0 A;  1F4H A;  1XNT A;  2YB7 A;  2VZT A;  4OZO A;  3PUI A;  3W5M A;  4A45 A;  1T2X A;  4A4A A;  2C26 A;  2LW8 A;  3EYP A;  1WCQ A;  3CIH A;  4ET7 A;  1PX3 A;  2QQL A;  2YFZ A;  3BN6 A;  2Y6G A;  4QX1 A;  1H6Y A;  1PMJ X;  3GM8 A;  4W4Z A;  4ZY9 A;  3DYM A;  3FN9 A;  2Y6H A;  1OT5 A;  3W5N A;  1US2 A;  2W9X A;  3C7H A;  3IAP A;  3A7Q A;  2HYX A;  5LA1 A;  1GOH A;  4PF1 A;  4JKM A;  1HN1 A;  3CZU A;  3C7G A;  3K4D A;  2OKX A;  1UY4 A;  2VZ1 A;  3NJV A;  2W95 A;  4QDQ A;  1JHJ A;  3K75 B;  3HEI A;  2W1U A;  1J83 A;  3I2H A;  3K4A A;  1JZ8 A;  4CU9 A;  2VZ3 A;  3WF1 A;  3WNN A;  1KGY A;  4BXS V;  5F7U A;  3CMG A;  1JYV A;  2Y6L A;  1JYN A;  3WF4 A;  5JXI A;  4BJ0 A;  1UY3 A;  3LEG A;  2ZEZ A;  4YPJ A;  4QX0 A;  4PQQ A;  1W0N A;  2VME A;  3T0A A;  3FHQ A;  3CDZ B;  1UXZ A;  3C7E A;  4DUX A;  1L7Q A;  5JXJ A;  3ACH A;  2C9K A;  2RV9 A;  3SEP A;  3A21 A;  3DYO A;  3III A;  2VQT A;  1GMM A;  2JD9 A;  2WUH A;  3OEA A;  5LCW L;  1JZ7 A;  2QQI A;  4MAD A;  1UZ0 A;  1SG3 A;  4OMC A;  1O8P A;  2J1E A;  5DPN A;  3UNP A;  2EID A;  5G04 L;  2RJ2 A;  2V72 A;  4RN5 A;  4QDR A;  4JKK A;  1OF3 A;  1XPW A;  1W8O A;  2B4K A;  1XNA A;  4CU8 A;  4DXS A;  1O59 A;  2J1U A;  4UI9 L;  4XUP A;  2VMD A;  1DLC A;  3LQC A;  2LS6 A;  3GXU A;  2VC9 A;  1JI6 A;  1F4A A;  2WQ8 A;  1OD3 A;  1CZV A;  2Y6J A;  3VD4 A;  4LHS A;  2L9L A;  2W1Q A;  4UOJ A;  3DYP A;  3WNO A;  2BBA A;  2WAA A;  3WF2 A;  5B4X A;  3E1F 1;  3ABZ A;  3OBA A;  4AAX A;  4QPW A;  1K42 A;  1GNY A;  2V4V A;  2WN2 A;  3P1I A;  5C70 A;  4XUO A;  3OG2 A;  2XQX A;  4P02 B;  2J1R A;  1BHG A;  2ID4 A;  3WSO A;  5IFT A;  1UY2 A;  4LPL A;  4JX0 A;  1W9W A;  3VDA A;  3BGA A;  2VZQ A;  3ECQ A;  2W94 A;  1GOG A;  4MGQ A;  2X09 A;  1H6X A;  5HXM A;  5G05 L;  3HOB A;  2Y8K A;  5JXG A;  1NAE A;  5CYY A;  5DQ0 A;  1UYY A;  4CUB A;  4MGS A;  4PT6 A;  2WN3 A;  3MBW A;  1DYO A;  3HJR A;  1NUK A;  4CUA A;  4QB6 A;  1UY1 A;  4A3Z A;  3C8X A;  4DEQ A;  4DUV A;  3VD3 A;  5FUI A;  2VMF A;  2EIC A;  1CX1 A;  2V5D A;  1SDD B;  3UES A;  1W9T A;  1JYX A;  3CZJ A;  3CKH A;  4ZZ5 A;  2W92 A;  2Y64 A;  3U37 A;  3I2K A;  3SKJ E;  4BDV B;  5I0D A;  3JXS A;  1UMI A;  1K12 A;  2E32 A;  1JZ3 A;  2BZD A;  3D3A A;  3LPF A;  4TXW A;  5B4N A;  2VOT A;  2ZEW A;  5IYY A;  4XVH A;  3WNK A;  3OEB A;  1UWW A;  4QB1 A;  4CU7 A;  4KMQ A;  4XUR A;  1PX4 A;  4QX3 A;  3WF0 A;  2VZP A;  3WEZ A;  3ZM8 A;  2J1S A;  3I2J A;  2VZO A;  1GU3 A;  1OF4 A;  2E33 A;  3MV0 1;  3I3D A;  5JUV A;  4D8M A;  2JE8 A;  5A1A A;  4MO3 M;  1WKY A;  4ZXE A;  3ACI A;  1GUI A;  2W1W A;  4MOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...