2W47A

Clostridium thermocellum cbm35 in complex with delta-4,5- anhydrogalacturonic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
135
structure length
135
Chain Sequence
b'ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSANAFQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
molecule tags Hydrolase
source organism Clostridium thermocellum
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
total genus 28
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w47A00
1DP0A 2VO5A 2VQTA 2HYXA 1O8PA 2VMCA 1IQDC 2WAOA 1W99A 1OF3A 4TXWA 1UY4A 2CDOA 3D3AA 4LHSA 1JYVA 4CU8A 4GWJA 3T0DA 3GXUA 4UI9L 4QB2A 5DN2A 3I2HA 2XHNA 3WF3A 2XONA 1XNAA 3MV11 3WF2A 5G05L 3ABZA 4PQQA 1W8OA 2C4XA 1HN1A 2C9KA 5J1XA 3SKVA 4DXSA 3HN3A 4L0PA 2ZEXA 1ULPA 5C70A 5JXIA 2Y8KA 3OGVA 1CX1A 3WNOA 2J7MA 1K45A 1JU4A 4A4AA 2BBAA 4CUAA 4OMCA 2Y6HA 3T08A 3HNYM 3MUZ1 3UETA 4DEQA 2VZSA 4OYUA 1CIYA 3CZUA 3P6BA 5IFPA 3ACGA 4IUGA 5F7UA 3MUY1 2VZOA 1I5PA 4PT6A 1JZ4A 2QQJA 3CIHA 4PF1A 1JHJA 5DPNA 1JZ6A 4XURA 5I0DA 4QX3A 4MGSA 4JKKA 5CZKA 4DUVA 2YFZA 3MBWA 1H6XA 2WN2A 5HPOA 2JD9A 4DUWA 2ZXQA 3FL7A 4MADA 1UYYA 4OZOA 1GNYA 4A44A 1W0NA 2W47A 3WNNA 1EUTA 1UY3A 2JE8A 3PUIA 2L9LA 1JZ5A 3I2IA 4BK5A 3WNKA 3I2FA 2VCAA 1OH4A 1P8JA 2J1RA 2LW8A 4MOAA 5EJZB 2Y64A 1F4HA 2WZ8A 2V5DA 2ORZA 2V4VA 5CYYA 2VZPA 2ZEZA 3IIIA 2B9VA 4JKMA 3T2OA 3DYOA 3ETPA 3SKJE 2DCJA 2YB7A 2KD7A 3I2JA 2VZQA 1US2A 4QDSA 2WBKA 4LPLA 2JDAA 2W46A 3LPFA 2EICA 3NQHA 2WQ8A 2B4KA 2W5FA 4ARXA 2Z4FA 2X10A 2W91A 2EIBA 4ARYA 4JX0A 1L7RA 5LA0A 4XUQA 1PMHX 2VTFA 4MO3M 2JKXA 2RJ2A 1UY0A 1JZ3A 1TG7A 2W9XA 2VM9A 3K4ZA 3P1IA 5LA1A 5DQ0A 3E1F1 1SG3A 1D7PM 3C7GA 4QX1A 1UY2A 3T0BA 2QQLA 1NKGA 2X05A 1GQPA 1OD3A 3LEIA 2Y6KA 2WAAA 1BHGA 3K46A 4QX2A 2J1EA 3HEIA 4BDVB 3FHQA 3LEKA 3C7FA 2J1AA 2E31A 4ET7A 1JI6A 2VMEA 1K42A 2VCBA 4FI9A 4JHZA 3OEBA 4CU7A 2DCKA 2QQMA 3K4AA 2WUHA 4M4RA 1O8SA 2WO3A 1JZ7A 3WF0A 4JKLA 2R7EB 3T0AA 2BGOA 4P02B 3HOBA 4E8CA 1XPWA 3WNLA 4A6OA 3A7QA 1PMJX 3K4DA 2YC2A 4P00B 3VD7A 3BGAA 2VCCA 4OMDA 4BK4A 3I2GA 1R64A 3LPGA 2PQSA 3HPNA 4DEVA 5C71A 2Y6LA 3I3EA 4RYDA 3A22A 4QX0A 4CUCA 3WEZA 4RN5A 4XUPA 4XUOA 4MGQA 5JXHA 1NX9A 3DECA 2WABA 3C7HA 4DXTA 1DLCA 3ACFA 1XNTA 5LA2A 3THDA 4ZY9A 1KEXA 3OB8A 3FHAA 5JMOA 1GOHA 3LQCA 3K75B 3OGSA 4ZZ5A 1DYOA 4D8MA 5IYYA 1GUIA 2WYSA 2XOMA 3C8XA 3VD5A 3DYMA 1W9TA 4GWIA 2VZ3A 3ACIA 3T2PA 1K3IA 2Y6JA 3VD3A 3FN9A 5JXJA 4P5YA 3OEAA 1KGYA 1UMIA 3WNMA 1UMHA 5JR2A 1PX3A 1TVGA 3WF4A 1UZ0A 5IHRA 2ZEYA 1YQ2A 4QB6A 1GU3A 2W1QA 4CU9A 3CQOA 1JU3A 1JZ8A 3UNPA 3VDAA 2LS6A 1JYNA 2VR4A 4XVHA 3MO4A 3I3DA 2EIDA 4QB1A 3OGRA 2VZRA 3PUHA 5LCWL 2WDBA 2Y6GA 1O59A 1RYYA 3U37A 2J1UA 4LKSA 2EIEA 1JZ2A 2CDPA 5A1AA 4A41A 2VC9A 3C7OA 3NJXA 3EB7A 1K12A 3IAPA 1UYXA 3AC0A 1SDDB 2WN3A 2YC4A 2VJXA 4ZZ8A 5B4XA 2W1WA 3A23A 1H6YA 2VZVA 4KMQA 1F4AA 1XC6A 4W4ZA 1JYXA 2VZ1A 2WO2A 3GDBA 4CUBA 4XZUG 5DMYA 4LQRA 4DXRA 2W3JA 3I2KA 2VZTA 4W50A 1WKYA 2ID4A 2BGPA 3NRUA 1UYZA 3K77A 2VQUA 2QBXA 4XUTA 4QPWA 2J22A 1MPXA 3CDZB 3HNBM 1W9WA 3GGLA 1W8NA 3W5MA 1OF4A 3IDAA 2YFUA 4KI5M 2W94A 2RV9A 3WQBA 4W8JA 4DUXA 4A42A 1L7QA 3SEEA 1SHWB 3MV01 3OBAA 3EYPA 3A21A 4A45A 1UWWA 4BJ0A 1UXXX 2E33A 4E8DA 1CZVA 1EUUA 2W87A 3HJRA 1LNSA 1UXZA 2C26A 1UY1A 3WNPA 2WZEA 2BERA 3CMGA 4KWUA 4GZ9A 3VD9A 5FUIA 3T2QA 1PX4A 2E32A 2VL4A 3THCA 1US3A 2W95A 5IJRA 5IFTA 4Z2AA 2WO1A 2J1TA 3WF1A 2XQXA 2YG0A 3ZM8A 1UX7A 5EJ1B 3NJVA 5B4NA 2J1VA 3LE0A 4A3ZA 4AAXA 4BXSV 2QQIA 2W1SA 4M4PA 1CZTA 2VZUA 4P08A 1GOGA 4TTGA 4UAPA 5EIYB 4QDRA 3VDCA 2E26A 3IB3A 3JXSA 2ORXA 1J83A 4CVUA 2W1UA 3T09A 1OT5A 4QDQA 1W9SA 3WSOA 3SEPA 2VOTA 1CZSA 3HNMA 3CZJA 2VMFA 2RVAA 2QQNA 4UOJA 3ECQA 2QQKA 3ACHA 3W5NA 4CU6A 5HXMA 3LEGA 1NAEA 4OUEA 2BZDA 1WCQA 1GMMA 3UESA 1ULOA 4HG6B 2X09A 3I97A 5JXGA 5JUVA 3I3BA 3C7EA 3J7HA 4D0QA 4ZXEA 5G04L 5C7GA 4YPJA 2DDUA 1GOFA 3NNGA 1NUKA 3VDBA 3OG2A 2J1SA 1T2XA 1JYWA 2HLEA 3DYPA 3BN6A 3IAQA 2V72A 2W92A 3VD4A 4AG4A 3CKHA 4XUNA 1J84A 2VMDA 2ZEWA 3F2ZA 2OKXA 3GM8A 4QAWA 2QQOA
chains in the Genus database with same CATH superfamily
3UJQA 1OUSA 1N47A 1RUF1 1VPHA 2VO5A 1QJX2 4I3GA 3HQRA 5EWSA 1S2KA 1OPMA 1WW7A 1DGRN 4LBQD 4LTAA 4TXWA 3FMGA 4LHSA 1POV3 1FOD3 4AK3A 1W6NB 1W3XA 4GWJA 1WGPA 4AQSA 1IPSA 2BDRA 2AYHA 3AFGA 3GXUA 4RHV2 1SDWA 3ZKUA 3ZYPA 4QD2A 1HRV1 5BPXA 2XHNA 3L2YA 3U4SA 3IIAA 1XYPA 4H55A 4U2AA 2EXJA 1Y3TA 2R32A 4XE9A 4M3CF 4YFZA 3ZDVA 1AHSA 4XF0A 5L9RA 4IGPA 5GLTA 4PQQA 1W8OA 2C4XA 4U36A 3VKMA 3I3MA 5D8AB 1LB2A 4GB33 2HWD1 2GC0A 4NMIA 4DXSA 2RMU2 1MS8A 1W6MB 1VJ2A 5DAPA 3AZXA 2OW4A 2YC0A 4I0BA 5JXIA 2WNVC 2RDRA 3DCQA 1QDCA 1PGW2 1JH5A 1V6IA 3O0XA 5KHGA 4LUMA 2BBAA 2HEVF 3FUQA 1LHUA 5GZEA 5CIRA 2JKBA 2GMPA 3MUZ1 2EALA 2ZGTA 1RUI2 4AFCA 4QGMA 5A32B 2VOKA 3ZFGB 1JUIA 1X36A 3LA3A 2JWPA 2WZR3 2BOIA 4AF9A 3CZUA 1O3RA 1WD3A 4B7KA 1YIFA 3P6BA 2FZ1A 4ZU7A 3WW2A 4IUGA 4LEJA 3ZOIA 1CAUB 2PHWA 4LBOA 1XNKA 2XJSA 3NVCA 5DUWA 4KBBA 3AKSA 4LIVA 4IV3A 4HLTA 1QXPA 4HVQA 1Z7S3 4M0HA 5IK4A 4Q2FA 1U5XA 5FJKA 1UOJA 1C4RA 1JHJA 4PF1A 1F2NA 2AENA 2OUHA 3I59B 4RQPC 5CU1A 5DPNA 3TB0A 5FQ0A 2PLV1 4JKKA 4I3PA 4IEYA 1RUF2 3WLUA 3IN9A 4L97A 1BVVA 3ILRA 4GJZA 3N36A 3SH4A 3ZYGA 3U0ZA 3S5QA 3AX4A 1VR3A 1DDLA 1W6QA 2WT1A 1JODA 4QU2A 2NMOA 3MFAA 2ZS6B 1QH6A 2JD9A 4ZHNA 2UU8A 4FOVA 2IXLA 4YW7A 5F8PA 4BHPA 4YFWA 3NWKA 1ND2B 4IE7A 1MZ6A 1ODNA 2W0XA 4NRPA 4ASKA 1GNYA 2P3YA 5ABJA 1RUE1 4FPYA 5BY5A 4UFJA 2R071 1OKOA 1EUTA 1VBE2 1AYM2 2B7YA 4JDNA 1GZTA 5JSRA 3TN93 2JE8A 1XE0A 1QOTA 1GQHA 2AR6A 3K51A 4HBNA 1OLRA 5K0UB 4COZA 2L9LA 4XAAA 3NV2A 3N9LA 4ASLA 1H4GA 1APNA 2FCUA 2ZTNA 4KWJA 4IGOA 3I2FA 5IVBA 5JZGA 3J8F1 1TMF1 4K6BA 4M3CB 3VKLA 4KWLA 5FP8A 3VKNA 1WLDA 4BA6A 4A2UA 2FHRA 1ZA7A 1VAVA 2IFRA 4O61A 5EJZB 3SCGA 4Q0UA 1EV13 4MXWB 4RHV3 5EP9A 4Q1RA 2PFWA 2V4VA 4GH4B 1HB4A 3OTFA 4CZSA 1G9BA 2VZPA 3ZIXA 2FQPA 3LOBA 5GALA 2RR11 1R1A3 2QJVA 3AMHA 4HSJA 4IQPA 4XQDA 3NAPA 5FP4A 3T2OA 1JOBA 1AVBA 1YEWA 1Q3EA 2UWAA 2JDNA 2WS93 3ZXEA 5GZCA 5FPUA 3I2JA 2ZX3A 3BTAA 3K2OA 5L73A 4LPLA 1JBCA 1H0BA 1Q8QA 5FZLA 2NP0A 3NQHA 1QNYA 4WM7C 2VUDA 2C1FA 4H7MA 4AR2A 4A7KA 1U5YA 4ARXA 3I2DA 5FMOL 4AVAA 5BV6A 3JBG1 1JW6A 3MIGA 4OFGA 5FUPA 3KV5A 5CB7A 1POQA 3THPA 2R072 5LA0A 2VXJA 3N7KA 4ZPIA 5LK7B 2ZGQA 2R0HA 3N9OA 2ZX2A 1NQDA 3RDIA 2XPJA 1CAWA 2WQZC 1NCQB 4X6RB 4XJ9A 1NLQA 1TG7A 1NZIA 2XUEA 3QOPA 1YFUA 3QCWA 5KXBA 4WVMB 4LKEA 3P1IA 5LA1A 5FPBA 1NCRB 3ZMNA 4LO4B 3OD4A 1NYWA 2HEWF 2QQLA 5LBBA 2ETEA 2X05A 1VBD1 2BW8A 3I7DA 2QQVA 1D4VB 2RDSA 2Q4SA 5DZGA 1ZA4A 3LEIA 4QHBA 1R093 2Y6KA 3V0AB 1TMF2 3B9CA 4XCAA 1IS6A 4S2FA 1LHOA 2R061 5CNAA 3DN7A 4TN7A 3CF6E 3FJSA 5FYMA 5IVFA 2Q30A 4R4XA 1Q8PA 2J1AA 4CPBD 4EYUA 5DAQA 1RMU2 3ZPOA 1OBNA 4RR3A 5FLIA 3FFZA 3RZKA 3R4DB 2JB4A 3B3QE 2P17A 4NWWA 1V6NA 4OHYA 3LIHA 2DCKA 4LBJA 5JIAA 3PU8A 1NY72 3GCXA 4I0AA 4OI4A 5F2WA 4BXFA 2KA3A 3RMXA 2HWB1 4IE0A 5BNOB 1FT9A 2HBTA 2XH6A 4JKLA 2D97A 2R7EB 3WP6A 4XDOA 3K3OA 2OA2A 5JMCA 4NHKA 1S1AA 2WNUA 5F5CA 5SV8A 4UFLA 4HSLA 3VD7A 3ZSLA 3M3EA 2K2SA 4PHZA 3ZKYA 5FYYA 4BK4A 1DCSA 5EPAA 3I2GA 5K0UA 3USSA 2GN7A 3LPGA 1PO13 2XB6C 4XBQA 3RZJA 2FDFA 2WWJA 4NIHA 3POWA 4DEVA 1QQP3 1HXS2 1GWKA 5C71A 3LA2A 1PGL1 5IK7A 1ND2A 3DF0A 3Q8EA 4QX8A 4AOCA 3WW1A 4C90A 3TEWA 4F7ZA 3L2HA 5FJHA 2OQ6A 1HRI3 1O7FA 4Q4W3 3TEXA 3NNMA 4AQ6A 4MGQA 4S2GA 1C8M1 1NX9A 2F4PA 2ZGPA 3DECA 1W6QB 4NR1A 2O8QA 4QKDA 1O5UA 3RZGA 4W6WA 2D43A 4AEDC 4IW3A 4Q0VA 2P5BA 4AXOA 4X6QB 2P6HA 1UKGA 3BALA 2B46X 3B00A 3ZFFA 4C0BA 5A7PA 5FQ0B 1ZZ7A 3H9AA 5CFDA 3LQCA 1R082 3AYEA 4ZZ5A 2IWGB 2RS33 2RDNA 4FCAA 3QD6A 5AVPA 5IYYA 3AMPA 5LA9A 1ZRIA 1VBC1 3B69A 1GUIA 1QU0A 3KV9A 4YZ1A 5C33A 1EP0A 1KITA 1VMFA 3N9PA 3CJIC 4FXKB 5IVVA 5K0UC 3DYMA 3BU0A 3AKTA 3O0WA 3D5OA 4FPKA 3UYJA 4ATEA 4PLNA 1LTEA 4RS5C 5HBAA 1FPN1 3VBHB 1T6BX 2ZJCA 1LOFC 3ACIA 1IG3A 1WCDJ 3GJBA 4QGNA 3VD3A 4DFSA 2RS11 1GWLA 2Y6FA 4NHYA 2XJPA 1NCQC 1LHVA 2ZMLA 5JXJA 5FYHA 2B9UA 1UN1A 2HWC2 4M01A 4NUBA 3O1VA 1OA2A 3R4UA 2W68A 2P34A 4XJAA 4NPMA 1HIXA 1UZ0A 3USUB 2QNKA 4FQ4A 1D0HA 3JBG3 4N90A 3WP3A 5BNNC 4GAZA 4XFAA 2XWJB 2CV6A 4IEOA 4NHXA 1K5JA 1YQ2A 2HWD2 3CL1A 3N9QA 5D8AA 4AAPA 1JOPA 5I0UA 4FPFA 4YNIA 5FTTC 3VBSC 1UOGA 1CJPA 1JYNA 3BIWE 4FPEA 5GKAC 5DDJ1 3PJQA 4YVSC 4PI0A 5L7OA 4QKNA 2EXIA 3RSJA 4WM7B 5DDJ3 5GZDA 1UAIA 4HKLA 1KJLA 1PVC3 1VBE1 1RUG1 2ARAA 3NJYA 2RR13 1JS9A 1YFXA 3MIEA 3OY8A 4XABA 4RFRB 4XTMA 5FZCA 1RYYA 4HK8A 1HQLA 1DYPA 1QDOA 2RM21 4K7JA 3GBGA 4RL7A 2YBKA 4GIQA 1XB9A 2WFF2 2CDPA 3VN4A 2VMHA 3LB9A 1EV11 5A1AA 4QQHA 5JVVA 5F2SA 2GMMA 2V5YA 1ZYBA 3IAPA 3AKRA 1RMU1 3E97A 4LOSA 4RGAA 1C1FA 2HBUA 5DXDA 1O3TA 5FZ3A 5DAWA 4R9DA 5J7MA 5FOBB 4UFHA 2OX0A 3ZMOA 4XMAA 1J1TA 1RUNA 3AZWA 1GYKA 2H0BA 1JYXA 3N3HA 2DVAA 1N3OA 4FBFA 2WO2A 1RUH2 1XOYA 2ZGUA 3PHMA 4W6XA 1H2LA 1SPPB 1GV9A 5EYXA 2FDJA 1RUH1 2QUOA 2AC1A 4COYA 4MGTA 1X8EA 3POYA 2PHLA 5ERLA 4LIUA 5FZOA 3ZN5A 1OLMA 2DTYA 3NRUA 1W2AX 4YGBA 1ENRA 4FFFA 5FPXA 4GQ7A 1PO12 1W2TA 5T5JA 1V0AA 1MPXA 5JAXA 4LORA 1SFYA 4Q29A 2WSUA 3WR0A 1BK0A 3WD5A 5A6XA 5A3MA 4XFIA 1C57A 4IEXA 1RUE2 4A3XA 4QPGA 4B4RA 1DBNA 4P9GA 1BEV2 2DCTA 4XXPA 5T3NA 3WDUA 3F95A 4DUXA 4IEZA 1Z78A 4MGZE 2AEZA 4A42A 2G9GA 2PQQA 1URXA 3TRSB 5FY8A 3RYPA 3VHNA 5FCCA 5GZFA 1AL0G 1GBGA 1RVF3 5FRAA 5H9SA 1IGOA 1UWWA 3UGHA 5K7PA 2KM2A 1EAH2 2BVVA 4Q4Y1 1AR62 3EJKA 3KV6A 1W28A 3K48A 1EUUA 3NNJA 2OPKA 3FBMA 3GZEA 3R6SA 4JRLA 3C3VA 3WNPA 4AEJA 1O4TA 5I0SA 2ZGKA 1RJ7A 3NKGA 4MHRA 1PVC2 5E89A 5JR7B 5LRRA 4GZ9A 3KGLA 1NA1C 3VD9A 3RS6A 1PX4A 4AHZA 1HB1A 3WP5A 2XUMA 1STMA 3CJXA 1C5HA 2WT0A 1OXCA 4YVWC 5E16A 2J1TA 1AR83 5TSWA 5F5QA 1QKQA 3IWZA 1BK1A 1CN1A 1E5RA 2G9FA 3INAA 3O5SA 3OYWB 2BJSA 5GLZA 5FOJB 3VV1A 5EJ1B 2J1VA 3E5UA 4BXSV 1HXS1 5HXVA 4EZ4A 1POV1 1GZWB 1VBB1 3WDYA 1R091 3H1MA 4UAPA 3SCFA 4EWDA 3VDCA 1NE6A 2WNEA 3M4FA 3JXSA 4HONA 4XDPA 3T09A 2VY0A 3VBUC 1OT5A 3MZHA 2LTNA 1IS3A 2DFCA 2PHTA 3ATGA 1YRZA 3EXUA 1FYUA 1PVXA 5ABJB 4AVSA 2HWF3 3OBTA 3KM5A 3QBQA 3LCPA 4AVTA 3H42B 3P5BA 1C5IA 4HVRA 3CZJA 2A6WA 5GLWA 2RVAA 2X53S 5KXDA 2YGLA 5FBJA 5BNOA 4YW4A 4I02A 4B8EA 4E4ZA 3SISA 4XQWA 3TEYA 5DG1A 4ZONA 3ACHA 5ANNA 2ZZJA 3W5NA 4ZXKA 3GZUC 4IXLA 2VMIA 1B09A 2WFF3 1ASJ1 1NAEA 2ES3A 2RS12 2FMDA 1WCQA 4XMIA 4BMBA 1H1IA 1IKQA 2NZ9A 1GMMA 1WLCA 5FZGA 1CWPA 2NMNA 5FYTA 3VUOA 5KC6A 3HBKA 4MGYE 2GNMA 3ZPYA 1V6JA 3OUIA 5C7GA 1UOFA 2BNNA 4YPJA 5JPNB 1GOFA 4E27A 1Z7S2 2DFBA 4K20A 2GC1A 1JUHA 3VDBA 3M7AA 4GD4A 1BMV1 4UBHA 3WT3A 1MS3A 4ORFA 2VOWA 1WW4A 3DUIA 3OG2A 3PVBB 4O9EA 5FYIA 4O9GA 1XNCA 4AQ2A 1PK6B 4J25A 3OYWA 4IE6A 4FFGA 2FDGA 3THTA 1T6GC 4YM0A 3S30A 4AI0A 3VD4A 4QXKA 4RA0A 3WDTA 2EAKA 3ZSEA 1W6OA 2YXSA 3RGBA 3CKHA 2XKOA 2AREA 4G3YC 3F2ZA 4RQPA 2YV8A 3A0NA 2ET1A 2VMFA 1YC61 1FAYA 3D0JA 4IV1C 5T5PA 2QQOA 1QXRA 1UW8A 4R9AA 5DAVA 4CDUC 2VQTA 1QJU1 2HYXA 5FZ9A 5IW0A 1IQDC 2BUKA 4L11A 4BQ4A 1W99A 4R52A 5T52A 4Z07A 1CPMA 1PO23 3ITQA 5A7WB 5F1RA 1JYVA 2R073 2XQRA 1ACCA 2Q0AA 3LFMA 4YGEA 5J96B 5DN2A 4KG8A 2VBDA 5A7NA 3JD73 3WDXA 2OVUA 3WF3A 2RR12 2B5HA 1LOAA 1ASJ2 1XNAA 5J48A 3WF2A 5G05L 3ABZA 4YZ4A 1HJGA 1Z0HA 1UYPA 2WFF1 3O12A 4N53B 2R042 1S0IA 3CEWA 3MLKA 4RSUA 1D2SA 1CVNA 1KQRA 3RPQA 1CJDA 4CUGA 4P5HA 2JG9B 2GAUA 1OA4A 2ZEXA 4L0PA 4Q4V2 3IZOA 4NIDA 3OGVA 4PLMA 2VUAA 1CX1A 4ISQA 4ZS2A 4YW1A 2XXZA 2G4IA 4S2HA 4EQVA 2P1BA 4G9SB 3AZVA 5FFOC 4CUAA 5JZGB 1VBC3 2NPIA 2MEV1 2PAMA 5F5AA 2ZGLA 3E6DA 4P9JA 3ZDSA 5CEHA 2WWSA 4CDWC 1I3HA 3ZXAC 2R063 1TME3 1AXKA 3BKZA 1CIYA 3V0BA 2QDNA 4WM7A 1O91A 5EYYA 3MUY1 3VBRA 1TME2 1FI2A 3O0VA 1YLLA 1FNZA 4PT6A 3SCHA 1LOCA 3RWNA 1QF3A 2R30A 2I74A 2ARXA 3HBZA 4JGYA 4PIZA 4XURA 4CDQB 5AVAA 1A8MA 4YLZA 2GC2A 4YG6A 1COV2 2YU2A 5CZKA 1Q8VA 3DV8A 3GALA 1ENSA 3FLRA 3MBWA 3USUA 2HWD3 1AR92 4MX3A 2PXJA 1H6XA 2Q8EA 4XYXA 1LKNA 5HPOA 2GH8A 4QPIB 1M4WA 1NA1A 4DUWA 1FXZA 2ZXQA 1UYYA 2UWBA 1RUC1 3U4XA 1QJX1 4A7YA 1KS4A 1Q8SA 4CE8A 4YVWA 1QJX3 1W0NA 1X9PA 2W47A 2Z69A 1CQ9A 4UWDA 5EV7A 2CGNA 4IETA 3WNNA 3MPPG 3PUIA 4OQ8A 2VULA 1QH7A 5EQUA 3KZ4C 3KCYA 3I2IA 1C28A 3MF9A 1BBT2 4CCKA 2XVLA 1OH4A 1W6PB 1W8ZA 2Q8CA 4D7TA 4K40A 1G9FA 5JCTA 1SLTA 5HCHA 2LW8A 3OY8B 3GZAA 3OBRA 3IM0A 4RS5A 2JE7A 1F4HA 3OPTA 3ZFEB 4EWEA 1KRIA 2DVFA 2V5DA 3WX5A 4F8AA 4GULA 3H1WA 1F9KA 1RGSA 3JU9A 1VRH1 2ARCA 2K9ZA 4LBQA 1OFNA 2ZEZA 4LO6B 2VVEA 4NOTA 1S0GA 2O1QA 5CYYA 5IT6A 3O1MA 1J59A 2UY9A 2RMU3 3HVDA 5EFUA 3DYOA 2F4LA 4V2VA 5FZMA 2XBO2 1DLLA 3ETPA 4CDXA 2BRTA 4FT8A 2BFUL 2DCJA 2YB7A 4YGCA 2CGPA 4ATFA 2VZQA 1US2A 4QDSA 2KXLA 4L2NA 1AX2A 2JDPA 1RUH3 3ZXFA 1RINA 4EV0A 4IE4A 2XLAA 3WHUA 4YM3A 1Y9GA 3ORJA 2B4KA 2ZHMA 2Z4FA 5FZ4A 1DIWA 3PVEA 1HLCA 3DXUA 1NZCA 2W91A 1ZZ8A 1PK6C 2EIBA 4JV4A 4QPIA 4ARYA 1QJZA 4JX0A 4JGZC 1GLHA 4XPVA 2V73A 3JUUA 4PDWA 5ACA1 2DYCA 5LBEA 2VTFA 2A1XA 3OUHA 4D6RA 2G1MA 1RXGA 2CAUA 1B35C 3D6EA 3NW4A 3BTXA 3BTZA 3ST7A 3PMSA 2WJSA 4ZKTB 2K46A 3MICA 3NSTA 1X82A 3B01A 3X29B 2DVDA 2FMYA 3UT0A 4NPLA 3OF1A 5DQ0A 2OZJA 2C24A 4XOGA 5FXXA 5GM0A 4QGLA 1DU3D 2O8OA 3C7GA 3WQ7A 4H2AA 1GP5A 4CCMA 5FWJA 1NKGA 4JDOA 5DZEA 3ENRA 1D4M2 1EY2A 3MLLA 2TNFA 1UF2C 1ZM1A 1FNYA 4HOOA 4D6QA 1F8VA 2EAAA 1ULCA 4QXBA 1BHGA 2BFUS 4LBNA 2J1EA 4LJHA 1CAVA 3FHQA 5J98B 2A73B 3LEKA 5FY5A 4FOQA 1WA6X 5FYSA 4HZFA 1JI6A 3N7JA 4IGQA 1ZBE1 3OEBA 4IV1A 1ODMA 4CU7A 4Q8LA 5FDBA 2ATFA 4XBNA 1W0PA 1L7LA 2EA7A 4I0WB 3PDQA 2A6XA 2QQMA 3SH3A 4FPLA 1WUVA 4GB31 4V1PA 1G6NA 5C3QA 3PTRB 1IS5A 4CP2A 4AFBA 4Q4X1 4A6SA 1K5MB 5ACA3 3B02A 4UXAA 1RUG2 1G8WA 2J42A 4LO8A 4Y3OA 3WF0A 5AFEA 4CEYA 2JICA 2BGOA 3RVHA 3LSEA 3CHXA 4P02B 3HOBA 3RYKA 1I5ZA 3VDDC 4D94A 5FPAA 4P00B 1EV12 2XBO3 1HW5A 3BGAA 2VCCA 1DGLA 2JG8A 1DQ4A 1R64A 1RUD3 2HWF2 2PQSA 1SCSA 2WQ4A 5A3TA 2OPWA 4META 3QH7A 4C91A 2P3IA 2LRPA 2C0ZA 3UKVA 5L7OC 1TNFA 1QJFA 1ASJ3 1NCRA 1H8TA 3I3EA 5F6LB 4DZGA 5LEKA 2GALA 4WVMA 2JE9A 5SV5A 2X29A 4XUOA 1YQCA 1E5HA 1ONAA 2A6YA 3KLSA 2MEV2 5JXHA 2D3RA 2FZ2A 1V00A 5DG2A 1XSQA 3V0AA 1JXNA 3MIFA 2B42B 2WABA 3H8UA 2JDKA 4F3JA 3ZXDA 1LOEA 3THDA 2CYFA 4UT5A 2WLPA 1SLIA 1KEXA 4OHXA 1GP4A 4JGYC 4AFMA 1RUI3 1N1VA 3BCWA 3B9IA 1CAVB 1GOHA 1LU2A 3ASIA 3K75B 2GP3A 3IMNA 1UZVA 4EN0A 1REEA 2VCMA 4PF5A 4IL7A 3D0SA 2MEV3 2WYSA 5AFBA 5C8CB 2WS92 3VBFA 3RNSA 5CA6A 5FXWA 1N3QA 4I30A 1SCRA 1QMJA 1UQXA 1OKQA 1VBA3 3U10A 3VBUB 2WIIB 2TBVA 4GWIA 3AYCA 4FP3A 3WQ0A 3T2PA 1K3IA 2Y6JA 3FN9A 4DIQA 4CCEA 4P5YA 1GNZA 4ZU4A 3OEAA 4XFCA 1KGYA 2DURA 1UMIA 2GH2A 4RGKA 5KC5A 4IDZA 1MQTC 1UMHA 2YROA 1UIKA 4NAMA 1MS5A 4KBZA 3O1PA 4FPGA 3WF4A 3WW3A 2I07B 3AM2A 2ZEYA 4G4FA 4WBBA 3MPBA 3RQ0A 3UL2A 4MSVA 1GU3A 2E51A 3NV4A 3CQOA 1K5MA 3KV4A 3ME2A 4BM8A 3H8XA 2FDHA 3UNPA 2JJ6A 3VDAA 1OOPA 2VBBA 2BWAA 1LCLA 3W9AA 2VR4A 4HMZA 1QIQA 2JENA 1RUG3 1SQ4A 3JCIA 4Y5Z0 4Y5SA 5KWRA 4R9BA 4XVHA 3J26N 2BP6A 4QPGB 3U11A 4H14A 4JRAA 3I3DA 2EIDA 2CTVA 4MXWA 3N7MA 1TQ5A 5C3SA 4MVTA 5LBFA 5C3PA 3ZN4A 1N1YA 2Y6GA 3CU7A 1O59A 1RUJ2 3JBG2 1S0CA 2J1UA 4LKSA 1OLME 1UL9A 3PUQA 1F5JA 3QLQA 3H50A 5JOXA 2WL1A 3IKWA 4Q0SA 5HI0A 5LY2A 4Z2WA 4MHUA 3C7OA 1CR7A 5CFCB 1NQJA 1DZQA 1K12A 3EB7A 3GYDA 3BU7A 1K5MC 2N7GA 3MF6A 1SDDB 3EHKA 4JQRA 4XTPA 3WG3A 2VJXA 5FMBA 3SNMA 4COVA 5KXCA 5B4XA 2W1WA 3I59A 5IUQA 3UGGA 4B3NA 5LATA 2VZVA 4E4DX 2D6MA 5LW9A 3I8TA 1NY71 2A6ZA 3ZXKA 3POBA 4CP9B 1QOSA 4O7XA 3ZO0B 5A1FA 4XZUG 1N1TA 3VZJA 4NWVA 2W3JA 1QHDA 2NYYA 3GHNA 4QX7A 1X33A 1HB2A 1J58A 2UWCA 2D44A 2D6KA 1WW5A 2VZTA 3W59A 1JTZX 1WKYA 1GWMA 1LENA 2BGPA 5FZFA 4AL9A 2WNVA 3K77A 1JOJA 2VQUA 4XUTA 4UW6A 2HWE3 4XACA 1RMU3 3CDZB 4B4QA 5GJ6A 1SBEA 2FD8A 1JHNA 5IVJA 1W9WA 4MUVA 3VHPA 1WW6A 3IDEA 1S0DA 3DKQA 5FY7A 4KI5M 4XDQA 2W94A 5FZ0A 4TWTA 2RV9A 4Q4W1 5CAZA 2HWB2 2BQPA 3J4UH 1AZDA 4W8JA 4JGYB 3EBRA 3IPVA 4QU1A 5I93A 3SQOA 1DGRA 2A6VA 3IPVB 1ZRRA 4NRMA 5FBZA 1MR5A 3OBAA 3V64A 2B39A 1IG0A 1HV0A 1SBFA 3A21A 1DHKB 4A45A 2HWE2 4J1WA 1RXFA 3ZN6A 3VKFC 4FAHA 1UXXX 2A3YA 1B35B 1ULEA 3NJZA 3AK0A 1W6NA 2VQ0A 3LF7A 1W9YA 1LNSA 1UXZA 1XYNA 2C26A 4XJZA 5D1IA 4C1WA 1G9CA 1S0BA 1VRH2 1RUC3 5H9QA 1CX4A 4BCUA 4BLJA 5EHDA 3VBOC 3WVJA 2WZEA 4KWUA 5K4LA 1FATA 4RFT0 5J36A 5A6QA 4RGGA 2WKKA 2RS53 1OQ1A 3B7MA 3LZZA 1V6LA 4L9BA 1H2MA 5ANQA 3THCA 4C8DA 1VBA2 4CEWB 4R9CA 4WZCA 4YYOA 3ZFFC 5IJRA 2VE1A 5IFTA 3HT2A 5A7SA 4IESA 3B93A 4BQ3A 5IAVA 2YG0A 4K3UA 3NJVA 3NNLA 4WZFA 3KS7A 2QQIA 2W1SA 2C5DA 2PLV2 2VZUA 1PGL2 4Z1VA 5FUNA 3KT4A 2QZ3A 1PMIA 2ZCWA 4OUSA 1H8TC 4CEWC 2WSVA 4Q1PA 1RUI1 3SXWA 1QQP2 2RG4A 2E26A 1YQ5A 4IEUA 2ORXA 3MDPA 4QDQA 1W9SA 1UKRA 2Z5WA 1Q8OA 2F17A 2TEPA 3DPRC 4XF9A 3WSOA 3HR9A 1CZSA 4QKBA 2QQNA 5IVYA 4ES9A 1SLCA 4CPBA 5D8AC 1OMIA 3ECQA 2IXCA 3TWIA 3W58A 2VUCA 3ZR5A 4AI1A 5HXMA 1PGW1 2Y0IA 4OUEA 4D7SA 2D6LX 1S4CA 2UY8A 4XIOA 5CVRA 5DAXA 3VBHA 4N43B 1FMD1 1ULOA 5A3UA 3BOWA 5FLJA 3VBFC 3DL3A 2O0OA 3I97A 4OI0A 1LULA 2ZHNA 2A3XA 3J7HA 5F3IA 4D0QA 1C8M2 5FYVA 3OCPA 1WCUA 3SLIA 5A3PA 1MVEA 1KJRA 1RVF2 2X5IA 2XHKA 4LBMA 4N53A 5BNNB 1S2BA 4BIFA 2DDUA 1UMZA 3NNGA 1YFWA 4JAAA 4CDXC 1H1MA 1NUKA 4LHLA 4AEDB 3VBSB 3ZFFB 4RR3B 3WP4A 3O1RA 2CL2A 3AFKA 2BNMA 5FPVA 3PURA 4DRRA 3DEMA 1R1A1 3ZYRA 3DPRA 4LBKA 2HLEA 3ELNA 1W8TA 3MEPA 4NPRA 4DY3A 1ZRCA 3IAQA 1OOPC 5C4WB 4BQXA 3AP4A 4NJ4A 4AG4A 5IVCA 2CAVA 2PHRA 4CXWA 4Q5OA 5KR7A 3RWKX 2RS52 4PDWC 5FZEA 3ES1A 3WQ1A 2OKXA 1Y9QA 2HYKA 4ISRA 1RTVA 4QAWA 4RR3C 3VBHC 3MFCA 3WNLA 4AVVA 1MS4A 1O8PA 2Y34A 3ILFA 2XMLA 4NIIA 1NT0A 2NLRA 2WAOA 5EXOA 2NN8A 4DO0A 5A3WA 1UY4A 2VVFA 3D3AA 4AFAA 2QFEA 1YI7A 4K9SA 1LJ7A 1OOPB 1RUOA 3TBDA 1VBD3 4CU8A 3FX3A 1PM7A 2C9AA 2ZBJA 5EJ3A 4UI9L 3T0DA 2WNUB 5C9AA 4AVBA 4Q0PA 1REFA 2Z79A 3NNFA 4MZUA 2I2SA 1Y9MA 5FY9A 4YZ5A 3ZXJA 2WO7A 3OOXA 2QQPA 2PAKA 2PHDA 5BNPB 4Q4Y2 1G9DA 2GDFA 5K9YA 3MYXA 3OGJA 3VL8A 2XONA 5FWEA 1ULGA 1UU5A 1U12A 2QDRA 4COUA 4AYUA 5BYNA 3POJA 4P9WA 4NRQA 2G9ZA 4FQZA 1TE1B 4KH9A 3JD72 1LEMA 1DGWX 2GP5A 4L8QA 3A0KA 4YWAA 2XJUA 4QPYA 5I0TA 4CEYB 1BEV1 5J1XA 2DBIA 5FAXA 3ZXGA 1ULPA 3ZYJB 2VNGA 4XF1A 5HCBA 4AGVA 1K45A 3AKPA 2HWF1 4FTBA 2BYVE 3JB4C 3KWVA 3WV6A 4OMCA 4HN0A 2Y6HA 2V4AA 1F15A 3BB6A 3T08A 4BQYA 5HCAA 1S0FA 4JVAA 4K1ZA 4B7EA 2DUPA 4DEQA 4C0HA 2E9QA 4HANA 2ZMKA 2PTMA 2YPDA 4NHMA 3OJBA 1PIV3 5J37A 2YBPA 4CEYC 5C9AC 3ACGA 1IQAA 4N43A 4EE2A 2WRAA 3MIHA 3UJOA 2XDVA 3RZMA 5JDBA 4BOWA 1VRH3 1DQ5A 5CFDC 2NM1A 1VIWB 5FYZA 2QQJA 3W21A 2ZOEB 5FZ7A 3IBMA 2PHFA 4TLFA 3RG0A 5I0DA 2DF7A 3ON7A 1BZWA 4HK9A 4Y1UA 1NLSA 1CESA 3PLQA 4QHZA 4CCNA 4YARA 2YFZA 5IVEA 1C8NA 2GZWA 2HWE1 4LKFA 1TMF3 3T30A 4JGZA 4JDMA 3KD4A 4GWNA 2VPVA 2IVJA 4N8MA 3CJIB 2RE9A 1OC1A 2OXBA 4KQ7A 3POIA 1FPN3 1VBA1 4MADA 3RJRA 4CCJA 4CDQC 4X8PA 5IATA 1AL22 1PHMA 2D6OX 2JIJA 4FTSA 3VZOA 3PVNA 3ZYFA 5FO9B 4E4SA 3GF6A 4YM2A 4AHWA 3VLBB 4DB5A 4B4PA 3VBSA 2HEYF 2V09A 1U5ZA 3FLPA 5E1RA 1FMD3 3NAPB 4AGGA 1AL23 3ZYHA 2TUNA 5BNNA 4ZU5A 5FKCA 5GLUA 4TLGA 3QACA 4YG0A 2J1RA 4GA9A 5F5IA 4XFHA 1FX5A 4MOAA 1I9RA 1OFSA 2E7QA 4Y24A 2WZ8A 5DUVA 1C3HA 2GMEA 3AYAA 4FVVA 2ORZA 4JTNA 1YJKA 4CDUB 2DU1A 1Z7S1 4B29A 4SLIA 1O5LA 2RS32 4FPOB 2LM3A 4LBQB 4FOWA 3CLPA 4DXZA 4Y22B 1Y4WA 1EYBA 2YHJA 4XFBA 5FYBA 3WCSA 3IT8A 2KD7A 4BU2A 4HPKB 3VDDB 5JOYA 4YZ2A 3P3NA 3WZ1A 1RUD1 3E6CC 3E5QA 3RZZA 4A7ZA 2ENRA 1OPOA 2EICA 5KHJA 4CDXB 4QM9A 4Q4V3 2WQ8A 3LSDA 5I8SA 3AL6A 4UFIA 1UO9A 5A33A 2W39A 2D93A 1CONA 3U1XA 1U0AA 1AF9A 2BWCA 3E5XA 3PNAA 1DF0A 1W05A 4Q26A 1HB3A 4HN1A 2Q8OA 3FZ3A 2R6QA 2RM22 5FV3A 2BOJA 2QE3A 2BU9A 1O6UA 1BLZA 1PNFA 1PMHX 2ERFA 2EXHA 2VW1A 4F83A 4MO3M 3MW4A 3O1SA 4PI2A 3O7OA 4Q4X3 2KR2A 1F5FA 1YQ6A 2VH9A 1WA4A 2WZPP 2WFPA 1RIRA 3PJYA 1LRHA 2W9XA 3Q8BA 1X7NA 3PL0A 3GHMA 4XFGA 4HFSA 4KGQA 1HRV3 1ZBE3 2JG9C 4GXLA 3TNQA 1AR63 1EAH3 1Q5OA 2OIIA 4UFKA 2RM23 1AX1A 4NO4A 4DQAA 3LA7A 4MV2A 1ND3A 1OA3A 1V9U2 1LEDA 4PIXA 4JC1A 1RUC2 1V6KA 1GQPA 4LK7A 4S2DA 5FIXA 3ZFGA 5A32A 1UCXA 1W04A 2WAAA 2ZX0A 1LODA 2VGDA 2QQWA 1OLQA 1NLRA 1UU6A 3HEIA 4QX2A 4BDVB 3ZYIB 5CFDB 5A7QA 2E31A 3M3IA 2JDMA 1RITA 1SLLA 1Q56A 2GC3A 2VCBA 3SITA 4JHZA 2AACA 3ZN6B 4QXHA 4B1LA 2A75A 4EWAA 1G9AA 3FE5A 1YUDA 1DQ1A 3BPZA 1LR5A 3LOIA 1BEV3 3O1OA 1OVSA 4P9XA 5FXZA 2ZX1A 2D6NA 4KGGA 1R092 5LY1A 5HCFA 1RC6A 1QY4A 3J7LA 1O8SA 1SBDA 1W03A 2WO3A 1VLNA 1EPWA 1RUJ3 3BI3A 2JG9A 3RMYA 1MQTA 4MXVA 4H3WA 1WMDA 2ZHKA 2VNVA 1LOGA 3RI9A 3T0AA 3M1HA 4FPHA 4E8CA 1XPWA 3NMBA 1PMJX 2ZACA 4JZRA 4PBPA 1NA1B 2WNVB 4OMDA 1H8VA 2CSGA 1UPIA 2R062 3K3NA 4QHOA 1MEC2 5APAA 3HPNA 2OQ7A 1QJU2 2VU9A 2AH2A 3N9NA 4LA2A 4XF3A 4I09A 2E7TA 5AC92 1W8HA 5C6CA 4NAOA 1AX0A 2YY1A 3HQUA 3AP9A 4FOYA 3EQEA 2P2KA 4RYDA 1M06G 1LAJA 4N7IA 4QX0A 4CUCA 1VMJA 4TSVA 4CP9A 2W52A 4DOUA 4J6GA 1WMFA 1H4HA 4LK6A 4OLLA 2Z42A 1AR91 2ZKLA 4NN0A 3C7HA 4WM8A 3VBUA 4DXTA 4YW6A 3ACFA 1R083 1XNTA 5LA2A 1W2OA 2ET7A 4RQPB 2QTWB 1JYTA 3J8F3 3V0BB 3OB8A 1PVC1 1QWRA 3Q8AA 5JMOA 1GANA 4CP0A 3AP7A 1DQ2A 2UURA 3OGSA 4H7LA 2XJRA 4D8MA 5C5UA 3D8CA 3MHZA 4P9IA 3R05A 4WVZA 1AR71 3I49A 3BTYA 1QNWA 3C8XA 4JTOA 1BJQA 1AR61 1EAH1 1WCSA 3PTYA 2NQYA 3VD5A 1W9TA 2ZKNA 1H9PA 4JGZB 3WINE 5FZ1A 5LEJA 2C6SA 2VZ3A 1ND2C 3J8F2 3VZNA 3BPSA 1XU2A 5HV0A 1NOVA 2Q5TA 5FKBA 3KQ4B 4ES8A 3AZYA 5A80A 4Y1VA 5JR2A 1X9TA 2WNOA 1PX3A 2XJQA 2RS13 2HH9A 1ZZ6A 3NO8A 3MGUA 2XLGA 2HWC3 4HL0A 5E6HA 1V70A 2W1QA 2JG8B 1IS4A 1OH3A 3J7MA 5DUXA 3WUDA 2LS6A 3KF3A 3KVBA 1TEIA 3UKTA 3DXTA 4CXXA 2CU5A 1XNBA 3W20A 1A8DA 2D3SA 3MO4A 4CYDA 2RJKA 1UZWA 4QB1A 4HT1T 2GNBA 3OGRA 3GJAA 4LXLA 2VZRA 3PUHA 5LCWL 4LBLA 5C3OA 2WDBA 4Y1ZA 2ZAAA 3PUSA 2BBVA 3U37A 4FPJA 2EIEA 1W6OB 3TN92 1GZCA 3D4KA 4FXGB 3N7LA 4BLIA 1LU1A 3H8OA 4GKYA 4B1MA 4A41A 5T54A 4TZDA 3NJXA 3LFIA 2A71A 1UYXA 4QPGC 3JQWA 3VBOA 4BQ5A 1IHMA 5F37A 3VBOB 3S0MA 5ISLA 4XETA 2P6CA 1I6XA 3A23A 5LRSA 1QQP1 1AL21 4LA3A 4E9KA 4CCOA 4KMQA 1QOOA 2CNAA 4AWDA 2IZWA 1Y7BA 5FYUA 3KHBA 5FMCA 1VBD2 3V56A 3GDBA 1VALA 2DCYA 1PZ7A 4BYYA 4CUBA 4Q8KA 1ZRFA 1CAWB 3BYWA 4LQRA 5DMYA 1H8TB 3BODA 4CXYA 3FFQA 3GZTB 1FOD1 1WBFA 3EMRA 3TYJA 1UU4A 1W06A 4W50A 1VP6A 4XAEA 5FZ8A 2ID4A 2WA4A 1X8MA 4IERA 3UKNA 2X5IB 2EVXA 1UYZA 4XIKA 1CPNA 2HJIA 1RUF3 2QBXA 1AXZA 2WLQA 1MEC3 4QWNA 2J22A 4IE5A 4CDWA 5L7OB 3HNBM 3POFA 4XJWA 1O3SA 4QQLA 5AC91 1W8NA 2D7FA 3VHOA 3W5MA 3DKWA 4RHV1 3IDAA 4EN8B 5LBCA 1IOAA 2PA7A 2Y33A 3B5LB 4Q4X2 3WQBA 1YNAA 1ENXA 2RJLA 3LIGA 3NL1A 3O14A 4R4ZA 3SEEA 1O3QA 1MVQA 1BMV2 1BBT1 1SMVA 1W8WA 4GMP3 3RZHA 3HAGA 3EYPA 2ARBA 3POEA 5FO8B 3AVSA 4BJ0A 4LLOA 4YW5A 3LD8A 1OQDA 3AVRA 2Y26A 4K21A 3HJRA 2W87A 4CTEA 3Q9OA 3FLTA 3VZMA 3AMNA 4XJUA 2DU0A 2IC1A 3KT1A 4XEZA 3GCWA 3T1LA 5D2AA 5GLVA 5CG9A 4D69A 2BERA 4N53C 3ZR6A 4AI3A 2H6CA 1D4M1 2WA3A 3AXDA 4UF0A 5JWPA 4RS5B 4Y4YA 1YQ8A 1RHI2 5FUIA 3T2QA 3AYDA 2E32A 2ILMA 4WM8B 1UZYA 1W6PA 1PNGA 3H3ZA 4MYEA 1ALYA 1WMXA 2W95A 3AMQA 5DABA 1VBC2 2MPFA 3LDRA 4DNYA 4Z2AA 2WO1A 3I54A 2GN3A 1UZZA 4PCRA 3BUCA 3H0OA 1OHFA 3VGIA 1XE7A 1UX7A 2R1DA 1PIV2 1WCKA 1FOD2 1Y43B 2ZABA 5JLVA 4PQ9A 4M4PA 3WG1A 2BGCA 5ACA2 5T50A 4P08A 4PDWB 1GOGA 5FPZA 4TTGA 5E8AA 1CAXB 4WM8C 2IFWA 2IXKA 2WZR1 1VAKA 4RD7A 3U78A 5KXEA 4NHLA 5EIYB 4QDRA 4Z92B 4Q0QA 4NIAA 3N4MA 4M3CE 4YVSB 1J83A 1XYOA 2W1UA 4IV3B 4IEPA 4CRQA 4FPCA 2P4EA 2E53A 4LKDA 4BQ2A 5JOZA 3SEPA 4AHXA 4J1XA 2VOTA 5FY0A 3HNMA 1C8M3 3GBWA 5FZIA 3QH6A 1ST8A 4MH0E 1HRI1 1WBLA 1YCIA 3PIJA 4KG0A 2BEOA 2ZPXA 2QQKA 4QPIC 4DS0A 3LEGA 5F32A 5JPMB 1DFQA 1VRBA 1HRI2 4L92A 4GALA 3P3PA 4SBVA 1ZZ9A 2JECA 2VOVA 2BZDA 3UESA 4HG6B 4DMIA 1SPPA 2X09A 1B35A 3HIFA 4LLFA 5JXGA 5JUVA 3I3BA 1LOFA 1XU1A 4Y22A 2ADEA 3AKQA 2ZX4A 3LEMA 3TAYA 2PMWB 1QJY3 5FO7B 4FAGA 1YYNA 1AYN2 5G04L 2XR4A 2R1BA 4OQ9A 1IKPA 1GKBA 1I1EA 5F9TA 2J1SA 2YPJA 3WW4A 2WT2A 1NG0A 4NE9A 1YHFA 5J09A 4XZPA 3H7YA 1O4YA 3LWCA 1CIWA 3M3CA 5HV4A 3BN6A 1G86A 2V72A 4YVSA 5CKMA 4OHZA 2W92A 4GH4C 1EPZA 1GZ9A 5JSPA 4IEQA 4LHKA 2W08A 1W90A 1A6CA 2MHFA 2PAEA 3AL5A 1CAXA 4XUNA 1X50A 3CO2A 2VMDA 3ZLIA 3BIEA 3T4VA 1FPN2 2H0VA 1PO22 3GM8A 4UF0B 2FCTA 2P3JA 2XVKA 4LHNA 1DP0A 1GR3A 1ZBA2 3FBYA 2VMCA 4WVWA 1AR72 4Q27A 3OGGA 4D6SA 1OF3A 5A7WA 4CDQA 2CDOA 4LO7A 4ASMB 1GP6A 2X8KA 3SH5A 4BPZA 1HXS3 2D6PA 3RFRA 4QB2A 1ZX5A 3AJYA 1QJEA 1QJY1 1POV0 4XHXA 3I2HA 3HD8B 1VMHA 4Y1YA 1LESA 1N3PA 3VDDA 3AMMA 5BUVA 4MGIE 2GNDA 2DUQA 2WC2A 3H3UA 3MW3A 4E2SA 3MV11 3SC7X 5GZGA 1WZXA 3S6PA 1VBB2 2QQUA 4C1XA 1V6OA 4GKXA 1HN1A 4X8NA 3TOJA 2VMGA 4CDUA 2W2IA 3EO6A 2C9KA 2IXHA 4Q4W2 3SKVA 2AEYA 1A3KA 5I0RA 1NCRC 3HN3A 5FZBA 5FZAA 5FY1A 1V9U3 5C70A 1OQEA 3JD71 4CSWA 1MACA 1WLTA 2QKDA 2JD4A 2Y38A 2Y8KA 4JHTA 4K1YA 4AFDA 3O1TA 3WNOA 1HX6A 2J7MA 1JU4A 3I4IA 4M00A 5FZ6A 4A4AA 2CWMA 4PLOA 2B45X 2QCSB 4O65A 4W65A 4LT5A 3HNYM 4CCLA 3UETA 5FPLA 3PIGA 2VZSA 3UV9A 4AQTA 4OYUA 1PZ8A 2R043 3LAGA 3KMHA 1H30A 4BQ1A 5IFPA 4EROA 1W2UA 1XNDA 4R8HA 5F7UA 2VXRA 2VZOA 2ZGNA 1IPKA 1R081 4XHBA 2WZR2 1I5PA 1JZ4A 3CIHA 4XW3A 1AR93 2ZA9A 1H9WA 3APBA 1JZ6A 1A34A 2XL7A 1E5SA 3LKJA 1SZBA 4QX3A 4I2OA 4MGSA 1ZBA1 4DUVA 1UIJA 2UYAA 2WR9A 4BB3A 2ZZQA 5LZ6A 1ZREA 5DUUA 4COWA 5KBFA 1W2NA 4QXCA 2YBSA 5C9AB 2YGMA 4OCTA 3VBFB 1XRUA 4JCKA 2WN2A 3RZLA 3N9MA 2JIGA 5LWBA 1D4M3 4IEWA 4OHWA 1UNBA 4FO9A 4LNVA 1XSRA 5A7OA 2DWRA 3FL7A 4OZOA 1DZTA 4AI8A 1VB2A 4FFHA 2VNOA 3RYRA 1SEFA 4A44A 1KDMA 3JQXA 1UY3A 3OPZA 5FP7A 5I8TA 4DPNA 2WWUA 1C1LA 1JZ5A 2SLIA 4Y20A 5F3EA 3VKOA 4BQWA 4N9IA 4BK5A 1AYN1 3WNKA 4MLOA 1QXJA 5BXXA 1MS0A 2PELA 2VCAA 5JIUA 2PN5A 2XJTA 3SMHA 1P8JA 4XC9A 4BIOA 1J3RA 2Y64A 3CBNA 3MIDA 2E63A 3T2TA 1F31A 2Y60A 1KD7A 1MZEA 1BYHA 4K8FA 1DGWA 2EIGA 1SACA 3IIIA 2A3WA 3A4UA 1MEC1 1MZ5A 2RDQA 4HKOA 3ROUA 2B9VA 4JKMA 2FBEA 2JEMA 2QVSB 4Y20B 4I01A 1J3PA 1YXWA 1CD3G 2JB8A 3KVAA 4GWMA 4IV1B 3SKJE 1VBB3 2VAUA 1UPSA 2JDUA 2WNUC 5C8CC 4E2GA 4LULA 1PO11 4YW2A 2LUWA 2WBKA 4FSJA 2JDAA 4EN6B 2W46A 2IXIA 3LPFA 3MIBA 1XE8A 3N35A 3WNXA 2DV9A 3U75A 5CFCC 3I2OA 3S7EA 2Y0OA 1NXMA 2W5FA 5CG8A 3WUCA 3RJ2X 2X10A 4P14A 2VOXA 5L19A 1YO8A 2OZ6A 3PUAA 4CP1A 1R1A2 1L7RA 4AHYA 1A78A 4XUQA 4PJYA 1MQTB 3GNEA 3O1UA 4KU8A 3OUJA 1AJKA 2GU9A 1E57A 2IUWA 2HWB3 2JKXA 2RJ2A 4YW3A 3S5AA 1UY0A 2HKXA 3PU3A 4OI2A 1JZ3A 4XBLA 5A3OA 1LOBA 2BVBA 5T5OA 2VM9A 3K4ZA 1JYIA 3D82A 2VUJA 2D3PA 1PM4A 3E1F1 4UW3A 1SG3A 3WDWA 2QZ2A 1D7PM 3DPRB 4QX1A 1UY2A 4WV8A 5K8SA 3T0BA 1LGNA 3GBFA 4BMEA 1VE0A 2Q1FA 2R0FA 3MI8A 4AEDA 1TNRA 1D2QA 5JZGC 1OD3A 1HDKA 1PIV1 3G6JB 3ACLA 1CGPA 3K46A 1W3VA 1TME1 1RVF1 1DYKA 4EZHA 2BPA2 3C7FA 4GH4A 2BV4A 3AXEA 1OUXA 1SLBA 4ET7A 1OD5A 4EN9B 4MGKE 3V65A 1ZVFA 2VMEA 1L3JA 4LOTA 1COV1 5CKNA 1K42A 4FI9A 3T3YA 4NVPA 4OVEA 1HQNA 5T55A 5FYCA 1HKDA 3TEZA 2Z2SB 3UK9A 1RHI3 5M0TA 3K4AA 3AZZA 3ZFEC 3FHIB 2WUHA 4M4RA 4YRDA 4PBOA 4FP2A 2FDIA 3AB0A 2G19A 2BNOA 2A7AA 4AI2A 1JZ7A 3ZSKA 1W6MA 1JMUB 1RB8G 4HETA 3NV3A 3S7IA 3LDKA 4N9HA 5DDJ2 2XBO1 5FP9A 2CWSA 5C4WC 5I8YA 5L36A 4A6OA 1BQPA 3A7QA 3K4DA 4HXCA 2YC2A 4OI1A 1AR73 5FZDA 5FK7A 3ZYBA 4DINB 2JDYA 5FZOB 4CCCA 3AP6A 1S2EA 2R49A 4WVVA 2DVBA 1GNHA 1TZOA 2MNGA 1D0GA 4YVWB 5FP3A 1ZZBA 1ULDA 3ZFEA 4HPKA 2Y6LA 3HWJA 2FCVA 4YGDA 5A6YA 2A5ZA 3A22A 3AP5A 3ETQA 3R4SA 3WEZA 4RN5A 4XUPA 5A70A 4LE4A 5J3UA 2EF6A 2I45A 2GSYA 3OBZA 4JQTA 1J1LA 4KWKA 4XJ8A 4CEWA 1CAUA 1DLCA 1WLWA 2CHHA 5CBLA 4NROA 5FY4A 1ND3B 4ZY9A 4YSFA 3WY6A 5A3NA 4Y33A 3SHRA 1G7YA 3FHAA 3Q8FA 5FK8A 5T5LA 4LE3A 1AYN3 1J3QA 1PGSA 2R041 1LHNA 5A33B 2VQAA 2XGXA 1DYOA 1ULFA 4W6YA 3J9SA 5JI7A 3M8LA 1BKZA 1LGBA 3TN91 2A70A 3AJZA 3FC0A 4AGRA 3VBRB 2P37A 3B94A 2YZ4A 1RUE3 1HN0A 2VECA 2XOMA 2DUOA 3PMEA 1BVP1 1GSLA 1S0EA 1H2KA 2Q1ZB 4QT6A 3ILNA 2XVGA 5F3GA 3VZKA 1E5IA 2PHUA 3ZVXA 3KF5A 4QX5A 1DQ6A 1R1ZA 4TYSA 3OD0A 3ALQA 3URFA 4LR4A 1RL3A 1XQNA 4CA9A 3WNMA 4BISA 2ZMNA 3NAPC 3IDBB 3M2MA 2X5IC 5FMDA 1TVGA 1S0JA 2PLV3 5IHRA 5F39A 5H9RA 3U07A 1GFF2 1XBFA 4LMFA 3PVOA 4QMAA 5KHHA 5BNOC 1YIPA 4QB6A 5I91A 1LHWA 4KU7A 2JDZA 4CU9A 2R16A 3KGZA 1JU3A 1W0OA 1JZ8A 1KS5A 4BWOA 2D40A 4UW4A 1RJ8A 1UD1A 4AEMA 1AYM3 4YM1A 4BH9A 2XLFA 2AUYA 1AXYA 1HQWA 3H7JA 4XXAA 2WS91 3LGRA 1W8FA 4OZXA 2GNTA 3HN1A 4AW7A 2VNRA 4URAA 5LASA 1YWKA 5CISA 1AR82 1H1AA 4LITA 5LK5A 4QQOA 1SFNA 3OPWA 4IEVA 2D98A 3POGA 1S55A 1JZ2A 2AZ5A 4UW5A 2LROA 1AR81 1DZRA 1ZZCA 2HWC1 2AGSA 2YU1A 2VC9A 1V9U1 5AC93 3WG4A 1F35A 2JXAA 2K0GA 3NKTA 3AC0A 4QQPA 4ONUA 3ZSJA 2WN3A 2YC4A 3WHTA 1H2NA 4ZZ8A 5C8CA 5A1LA 5CFCA 3MW2A 4EN7B 2F6BA 1H6YA 1KFUL 1F4AA 1BCXA 1XC6A 4W4ZA 1PZ9A 3CJIA 2DVGA 4GMP0 4INDA 5LB6A 2VZ1A 1OURA 2VBPA 1W8UA 2UYBA 4XILA 1PK6A 3MLJA 5C3RA 4QQ2A 4Q4V1 1XXNA 1DG6A 2VW2A 2YYOA 1U5IA 2XWBB 5EZWA 4DXRA 3R0RA 4UYBA 1W39A 4Q4Y3 4MG2A 3HMYA 3JZVA 3I2KA 1JN2P 4KL1A 1V6MA 1UOBA 2LALA 2ZGOA 4Y4RA 2ZAHA 3VZLA 1IZ3A 5E88A 2E6VA 5KHKA 1WMEA 1NCQA 4LUKA 4QPWA 1WD4A 1RUD2 3M3OA 3T4HB 4E4HA 4UFMA 5B2GB 1YI9A 1RHI1 4AI9A 5F3CA 3M3QA 4P9LA 3GGLA 1OSGA 4AE2A 1OF4A 3H8RA 3H3LA 2YFUA 4IV3C 4Y26A 4YG3A 5FLHA 1COV3 1W9FA 5A3LA 4CDWB 3OSDA 4ITCA 2ZGRA 4Z8BA 3RRDA 1L7QA 4N43C 1ENQA 2YMZA 2IVIB 1SHWB 2D5FA 1QGLA 3MV01 4XQ4A 4NIGA 2DCZA 4OHVA 2VVDA 3TNPB 3JB8A 3VHRA 3ZSMA 4LO5B 1HRV2 1KFXL 3BOPA 1AYM1 2VW0A 2E33A 4AEKA 4E8DA 3KSCA 3CNAA 5H9PA 1GQGA 2ZGMA 1CZVA 1FV2A 1HV1A 2VG9A 2VTXA 5C5TA 3FWEA 4FTEA 2Q1MA 5DZFA 2OS2A 2PYTA 1UY1A 2DBNA 2DTWA 5L9BA 3I3QA 4PIYA 2Q8DA 4AZZA 4ZS3A 1HJFA 3Q8CA 3CMGA 4URTA 1RUJ1 3RI8A 2BTVC 1MS9A 5ABJC 1VAMA 5BNPA 3BVCA 4YZ3A 1O4ZA 2VL4A 3ZIWA 2RS51 4M3CA 1US3A 1VB4A 2XG3A 3E6BA 1ZBA3 4D7YA 3WXPA 5C4WA 4FFIA 2JG8C 5BNQA 5A6ZA 4KNCA 4BE3A 1AUYA 3WF1A 1MS1A 5FZKA 1JYCA 2XL9A 2XQXA 5IK5A 3ZM8A 1GZWA 5JI9A 2OYZA 1ZNPA 4AVCA 4DY5A 5B4NA 2YUEA 3LE0A 4A3ZA 4AAXA 3U14A 5L9VA 1UX6A 5FMOS 1NE4A 3C2UA 1CZTA 1VBE3 1PO21 2ZHLA 2CGOA 2FDKA 3LDBA 4GB32 2IXJA 1DQ0A 1OVPA 2B8MA 1NXD1 2XKPA 3WCRA 1QJU3 2H6BA 3IB3A 5C8WA 5JSOA 1BBT3 3NV1A 5BNPC 4CVUA 1N1SA 2P3KA 5CADA 2RHPA 3FUOA 3WOGA 1KXGA 1WWYA 4L99A 2D5HA 3VB9A 5IK8A 1XJAA 4UBGA 1QJY2 4UOJA 4K8RB 4XF4A 3ZX7A 2O14A 4CCDA 3WDVA 4XFFA 3ZXLA 5FXVA 2EXKA 5F6KA 4CU6A 4P9YA 2OT7A 3KHCA 4BZ4A 4D3WA 3J7NA 2JDHA 3WG2A 3KT7A 1REDA 2E7AA 2VD7A 3KB5A 2OUJA 3POSA 2VTXJ 2ZGSA 5FREA 1Q43A 4EJRA 3HQXA 1MZFA 3UGFA 5FR3A 1YJLA 2WYFA 3C7EA 4M0NA 3KQRA 4GJYA 4OUMA 4ZXEA 2XJVA 5JOWA 2CY6A 5IWFA 1QEXA 1ZRDA 1LGCA 1KDKA 2SBAA 3KCXA 1LECA 3IMMA 2RS31 4QKFA 2WINB 1ND3C 4DRVA 1IPJA 5D21A 4E2QA 5IAXA 1T2XA 4Z82A 1BXHA 3DGTA 1JYWA 3ES4A 3H1YA 4GMP1 5FZHA 3G7DA 2RMU1 1YFYA 3ZFGC 3KCCA 4V2WA 2ADDA 2JX9A 3HT1A 3VL9A 3L9JT 3DYPA 4HVOA 4OULA 3S57A 1OI6A 2YDEA 4Y1XA 1FV3A 4HKWA 2PHXA 3VBRC 3IDCB 5KHIA 1GICA 4Y5TA 4N7UA 1J84A 2ZEWA 3M70A 1ZBE2 5CKQA 3T1MA 1SLAA 4QM8A 1SFPA 1FMD2 1AJOA 4XCBA
chains in the Genus database with same CATH topology
1DP0A 2VO5A 2VQTA 2HYXA 1O8PA 2VMCA 1IQDC 2WAOA 1W99A 1OF3A 4TXWA 1UY4A 2CDOA 3D3AA 4LHSA 1JYVA 4CU8A 4GWJA 3T0DA 3GXUA 4UI9L 4QB2A 5DN2A 3I2HA 2XHNA 3WF3A 2XONA 1XNAA 3MV11 3WF2A 5G05L 3ABZA 4PQQA 1W8OA 2C4XA 1HN1A 2C9KA 5J1XA 3SKVA 4DXSA 3HN3A 4L0PA 2ZEXA 1ULPA 5C70A 5JXIA 2Y8KA 3OGVA 1CX1A 3WNOA 2J7MA 1K45A 1JU4A 4A4AA 2BBAA 4CUAA 4OMCA 2Y6HA 3T08A 3HNYM 3MUZ1 3UETA 4DEQA 2VZSA 4OYUA 1CIYA 3CZUA 3P6BA 5IFPA 3ACGA 4IUGA 5F7UA 3MUY1 2VZOA 1I5PA 4PT6A 1JZ4A 2QQJA 3CIHA 4PF1A 1JHJA 5DPNA 1JZ6A 4XURA 5I0DA 4QX3A 4MGSA 4JKKA 5CZKA 4DUVA 2YFZA 3MBWA 1H6XA 2WN2A 5HPOA 2JD9A 4DUWA 2ZXQA 3FL7A 4MADA 1UYYA 4OZOA 1GNYA 4A44A 1W0NA 2W47A 3WNNA 1EUTA 1UY3A 2JE8A 3PUIA 2L9LA 1JZ5A 3I2IA 4BK5A 3WNKA 3I2FA 2VCAA 1OH4A 1P8JA 2J1RA 2LW8A 4MOAA 5EJZB 2Y64A 1F4HA 2WZ8A 2V5DA 2ORZA 2V4VA 5CYYA 2VZPA 2ZEZA 3IIIA 2B9VA 4JKMA 3T2OA 3DYOA 3ETPA 3SKJE 2DCJA 2YB7A 2KD7A 3I2JA 2VZQA 1US2A 4QDSA 2WBKA 4LPLA 2JDAA 2W46A 3LPFA 2EICA 3NQHA 2WQ8A 2B4KA 2W5FA 4ARXA 2Z4FA 2X10A 2W91A 2EIBA 4ARYA 4JX0A 1L7RA 5LA0A 4XUQA 1PMHX 2VTFA 4MO3M 2JKXA 2RJ2A 1UY0A 1JZ3A 1TG7A 2W9XA 2VM9A 3K4ZA 3P1IA 5LA1A 5DQ0A 3E1F1 1SG3A 1D7PM 3C7GA 4QX1A 1UY2A 3T0BA 2QQLA 1NKGA 2X05A 1GQPA 1OD3A 3LEIA 2Y6KA 2WAAA 1BHGA 3K46A 4QX2A 2J1EA 3HEIA 4BDVB 3FHQA 3LEKA 3C7FA 2J1AA 2E31A 4ET7A 1JI6A 2VMEA 1K42A 2VCBA 4FI9A 4JHZA 3OEBA 4CU7A 2DCKA 2QQMA 3K4AA 2WUHA 4M4RA 1O8SA 2WO3A 1JZ7A 3WF0A 4JKLA 2R7EB 3T0AA 2BGOA 4P02B 3HOBA 4E8CA 1XPWA 3WNLA 4A6OA 3A7QA 1PMJX 3K4DA 2YC2A 4P00B 3VD7A 3BGAA 2VCCA 4OMDA 4BK4A 3I2GA 1R64A 3LPGA 2PQSA 3HPNA 4DEVA 5C71A 2Y6LA 3I3EA 4RYDA 3A22A 4QX0A 4CUCA 3WEZA 4RN5A 4XUPA 4XUOA 4MGQA 5JXHA 1NX9A 3DECA 2WABA 3C7HA 4DXTA 1DLCA 3ACFA 1XNTA 5LA2A 3THDA 4ZY9A 1KEXA 3OB8A 3FHAA 5JMOA 1GOHA 3LQCA 3K75B 3OGSA 4ZZ5A 1DYOA 4D8MA 5IYYA 1GUIA 2WYSA 2XOMA 3C8XA 3VD5A 3DYMA 1W9TA 4GWIA 2VZ3A 3ACIA 3T2PA 1K3IA 2Y6JA 3VD3A 3FN9A 5JXJA 4P5YA 3OEAA 1KGYA 1UMIA 3WNMA 1UMHA 5JR2A 1PX3A 1TVGA 3WF4A 1UZ0A 5IHRA 2ZEYA 1YQ2A 4QB6A 1GU3A 2W1QA 4CU9A 3CQOA 1JU3A 1JZ8A 3UNPA 3VDAA 2LS6A 1JYNA 2VR4A 4XVHA 3MO4A 3I3DA 2EIDA 4QB1A 3OGRA 2VZRA 3PUHA 5LCWL 2WDBA 2Y6GA 1O59A 1RYYA 3U37A 2J1UA 4LKSA 2EIEA 1JZ2A 2CDPA 5A1AA 4A41A 2VC9A 3C7OA 3NJXA 3EB7A 1K12A 3IAPA 1UYXA 3AC0A 1SDDB 2WN3A 2YC4A 2VJXA 4ZZ8A 5B4XA 2W1WA 3A23A 1H6YA 2VZVA 4KMQA 1F4AA 1XC6A 4W4ZA 1JYXA 2VZ1A 2WO2A 3GDBA 4CUBA 4XZUG 5DMYA 4LQRA 4DXRA 2W3JA 3I2KA 2VZTA 4W50A 1WKYA 2ID4A 2BGPA 3NRUA 1UYZA 3K77A 2VQUA 2QBXA 4XUTA 4QPWA 2J22A 1MPXA 3CDZB 3HNBM 1W9WA 3GGLA 1W8NA 3W5MA 1OF4A 3IDAA 2YFUA 4KI5M 2W94A 2RV9A 3WQBA 4W8JA 4DUXA 4A42A 1L7QA 3SEEA 1SHWB 3MV01 3OBAA 3EYPA 3A21A 4A45A 1UWWA 4BJ0A 1UXXX 2E33A 4E8DA 1CZVA 1EUUA 2W87A 3HJRA 1LNSA 1UXZA 2C26A 1UY1A 3WNPA 2WZEA 2BERA 3CMGA 4KWUA 4GZ9A 3VD9A 5FUIA 3T2QA 1PX4A 2E32A 2VL4A 3THCA 1US3A 2W95A 5IJRA 5IFTA 4Z2AA 2WO1A 2J1TA 3WF1A 2XQXA 2YG0A 3ZM8A 1UX7A 5EJ1B 3NJVA 5B4NA 2J1VA 3LE0A 4A3ZA 4AAXA 4BXSV 2QQIA 2W1SA 4M4PA 1CZTA 2VZUA 4P08A 1GOGA 4TTGA 4UAPA 5EIYB 4QDRA 3VDCA 2E26A 3IB3A 3JXSA 2ORXA 1J83A 4CVUA 2W1UA 3T09A 1OT5A 4QDQA 1W9SA 3WSOA 3SEPA 2VOTA 1CZSA 3HNMA 3CZJA 2VMFA 2RVAA 2QQNA 4UOJA 3ECQA 2QQKA 3ACHA 3W5NA 4CU6A 5HXMA 3LEGA 1NAEA 4OUEA 2BZDA 1WCQA 1GMMA 3UESA 1ULOA 4HG6B 2X09A 3I97A 5JXGA 5JUVA 3I3BA 3C7EA 3J7HA 4D0QA 4ZXEA 5G04L 5C7GA 4YPJA 2DDUA 1GOFA 3NNGA 1NUKA 3VDBA 3OG2A 2J1SA 1T2XA 1JYWA 2HLEA 3DYPA 3BN6A 3IAQA 2V72A 2W92A 3VD4A 4AG4A 3CKHA 4XUNA 1J84A 2VMDA 2ZEWA 3F2ZA 2OKXA 3GM8A 4QAWA 2QQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP0 A;  2VO5 A;  2VQT A;  2HYX A;  1O8P A;  2VMC A;  1IQD C;  2WAO A;  1W99 A;  1OF3 A;  4TXW A;  1UY4 A;  2CDO A;  3D3A A;  4LHS A;  1JYV A;  4CU8 A;  4GWJ A;  3T0D A;  3GXU A;  4UI9 L;  4QB2 A;  5DN2 A;  3I2H A;  2XHN A;  3WF3 A;  2XON A;  1XNA A;  3MV1 1;  3WF2 A;  5G05 L;  3ABZ A;  4PQQ A;  1W8O A;  2C4X A;  1HN1 A;  2C9K A;  5J1X A;  3SKV A;  4DXS A;  3HN3 A;  4L0P A;  2ZEX A;  1ULP A;  5C70 A;  5JXI A;  2Y8K A;  3OGV A;  1CX1 A;  3WNO A;  2J7M A;  1K45 A;  1JU4 A;  4A4A A;  2BBA A;  4CUA A;  4OMC A;  2Y6H A;  3T08 A;  3HNY M;  3MUZ 1;  3UET A;  4DEQ A;  2VZS A;  4OYU A;  1CIY A;  3CZU A;  3P6B A;  5IFP A;  3ACG A;  4IUG A;  5F7U A;  3MUY 1;  2VZO A;  1I5P A;  4PT6 A;  1JZ4 A;  2QQJ A;  3CIH A;  4PF1 A;  1JHJ A;  5DPN A;  1JZ6 A;  4XUR A;  5I0D A;  4QX3 A;  4MGS A;  4JKK A;  5CZK A;  4DUV A;  2YFZ A;  3MBW A;  1H6X A;  2WN2 A;  5HPO A;  2JD9 A;  4DUW A;  2ZXQ A;  3FL7 A;  4MAD A;  1UYY A;  4OZO A;  1GNY A;  4A44 A;  1W0N A;  2W47 A;  3WNN A;  1EUT A;  1UY3 A;  2JE8 A;  3PUI A;  2L9L A;  1JZ5 A;  3I2I A;  4BK5 A;  3WNK A;  3I2F A;  2VCA A;  1OH4 A;  1P8J A;  2J1R A;  2LW8 A;  4MOA A;  5EJZ B;  2Y64 A;  1F4H A;  2WZ8 A;  2V5D A;  2ORZ A;  2V4V A;  5CYY A;  2VZP A;  2ZEZ A;  3III A;  2B9V A;  4JKM A;  3T2O A;  3DYO A;  3ETP A;  3SKJ E;  2DCJ A;  2YB7 A;  2KD7 A;  3I2J A;  2VZQ A;  1US2 A;  4QDS A;  2WBK A;  4LPL A;  2JDA A;  2W46 A;  3LPF A;  2EIC A;  3NQH A;  2WQ8 A;  2B4K A;  2W5F A;  4ARX A;  2Z4F A;  2X10 A;  2W91 A;  2EIB A;  4ARY A;  4JX0 A;  1L7R A;  5LA0 A;  4XUQ A;  1PMH X;  2VTF A;  4MO3 M;  2JKX A;  2RJ2 A;  1UY0 A;  1JZ3 A;  1TG7 A;  2W9X A;  2VM9 A;  3K4Z A;  3P1I A;  5LA1 A;  5DQ0 A;  3E1F 1;  1SG3 A;  1D7P M;  3C7G A;  4QX1 A;  1UY2 A;  3T0B A;  2QQL A;  1NKG A;  2X05 A;  1GQP A;  1OD3 A;  3LEI A;  2Y6K A;  2WAA A;  1BHG A;  3K46 A;  4QX2 A;  2J1E A;  3HEI A;  4BDV B;  3FHQ A;  3LEK A;  3C7F A;  2J1A A;  2E31 A;  4ET7 A;  1JI6 A;  2VME A;  1K42 A;  2VCB A;  4FI9 A;  4JHZ A;  3OEB A;  4CU7 A;  2DCK A;  2QQM A;  3K4A A;  2WUH A;  4M4R A;  1O8S A;  2WO3 A;  1JZ7 A;  3WF0 A;  4JKL A;  2R7E B;  3T0A A;  2BGO A;  4P02 B;  3HOB A;  4E8C A;  1XPW A;  3WNL A;  4A6O A;  3A7Q A;  1PMJ X;  3K4D A;  2YC2 A;  4P00 B;  3VD7 A;  3BGA A;  2VCC A;  4OMD A;  4BK4 A;  3I2G A;  1R64 A;  3LPG A;  2PQS A;  3HPN A;  4DEV A;  5C71 A;  2Y6L A;  3I3E A;  4RYD A;  3A22 A;  4QX0 A;  4CUC A;  3WEZ A;  4RN5 A;  4XUP A;  4XUO A;  4MGQ A;  5JXH A;  1NX9 A;  3DEC A;  2WAB A;  3C7H A;  4DXT A;  1DLC A;  3ACF A;  1XNT A;  5LA2 A;  3THD A;  4ZY9 A;  1KEX A;  3OB8 A;  3FHA A;  5JMO A;  1GOH A;  3LQC A;  3K75 B;  3OGS A;  4ZZ5 A;  1DYO A;  4D8M A;  5IYY A;  1GUI A;  2WYS A;  2XOM A;  3C8X A;  3VD5 A;  3DYM A;  1W9T A;  4GWI A;  2VZ3 A;  3ACI A;  3T2P A;  1K3I A;  2Y6J A;  3VD3 A;  3FN9 A;  5JXJ A;  4P5Y A;  3OEA A;  1KGY A;  1UMI A;  3WNM A;  1UMH A;  5JR2 A;  1PX3 A;  1TVG A;  3WF4 A;  1UZ0 A;  5IHR A;  2ZEY A;  1YQ2 A;  4QB6 A;  1GU3 A;  2W1Q A;  4CU9 A;  3CQO A;  1JU3 A;  1JZ8 A;  3UNP A;  3VDA A;  2LS6 A;  1JYN A;  2VR4 A;  4XVH A;  3MO4 A;  3I3D A;  2EID A;  4QB1 A;  3OGR A;  2VZR A;  3PUH A;  5LCW L;  2WDB A;  2Y6G A;  1O59 A;  1RYY A;  3U37 A;  2J1U A;  4LKS A;  2EIE A;  1JZ2 A;  2CDP A;  5A1A A;  4A41 A;  2VC9 A;  3C7O A;  3NJX A;  3EB7 A;  1K12 A;  3IAP A;  1UYX A;  3AC0 A;  1SDD B;  2WN3 A;  2YC4 A;  2VJX A;  4ZZ8 A;  5B4X A;  2W1W A;  3A23 A;  1H6Y A;  2VZV A;  4KMQ A;  1F4A A;  1XC6 A;  4W4Z A;  1JYX A;  2VZ1 A;  2WO2 A;  3GDB A;  4CUB A;  4XZU G;  5DMY A;  4LQR A;  4DXR A;  2W3J A;  3I2K A;  2VZT A;  4W50 A;  1WKY A;  2ID4 A;  2BGP A;  3NRU A;  1UYZ A;  3K77 A;  2VQU A;  2QBX A;  4XUT A;  4QPW A;  2J22 A;  1MPX A;  3CDZ B;  3HNB M;  1W9W A;  3GGL A;  1W8N A;  3W5M A;  1OF4 A;  3IDA A;  2YFU A;  4KI5 M;  2W94 A;  2RV9 A;  3WQB A;  4W8J A;  4DUX A;  4A42 A;  1L7Q A;  3SEE A;  1SHW B;  3MV0 1;  3OBA A;  3EYP A;  3A21 A;  4A45 A;  1UWW A;  4BJ0 A;  1UXX X;  2E33 A;  4E8D A;  1CZV A;  1EUU A;  2W87 A;  3HJR A;  1LNS A;  1UXZ A;  2C26 A;  1UY1 A;  3WNP A;  2WZE A;  2BER A;  3CMG A;  4KWU A;  4GZ9 A;  3VD9 A;  5FUI A;  3T2Q A;  1PX4 A;  2E32 A;  2VL4 A;  3THC A;  1US3 A;  2W95 A;  5IJR A;  5IFT A;  4Z2A A;  2WO1 A;  2J1T A;  3WF1 A;  2XQX A;  2YG0 A;  3ZM8 A;  1UX7 A;  5EJ1 B;  3NJV A;  5B4N A;  2J1V A;  3LE0 A;  4A3Z A;  4AAX A;  4BXS V;  2QQI A;  2W1S A;  4M4P A;  1CZT A;  2VZU A;  4P08 A;  1GOG A;  4TTG A;  4UAP A;  5EIY B;  4QDR A;  3VDC A;  2E26 A;  3IB3 A;  3JXS A;  2ORX A;  1J83 A;  4CVU A;  2W1U A;  3T09 A;  1OT5 A;  4QDQ A;  1W9S A;  3WSO A;  3SEP A;  2VOT A;  1CZS A;  3HNM A;  3CZJ A;  2VMF A;  2RVA A;  2QQN A;  4UOJ A;  3ECQ A;  2QQK A;  3ACH A;  3W5N A;  4CU6 A;  5HXM A;  3LEG A;  1NAE A;  4OUE A;  2BZD A;  1WCQ A;  1GMM A;  3UES A;  1ULO A;  4HG6 B;  2X09 A;  3I97 A;  5JXG A;  5JUV A;  3I3B A;  3C7E A;  3J7H A;  4D0Q A;  4ZXE A;  5G04 L;  5C7G A;  4YPJ A;  2DDU A;  1GOF A;  3NNG A;  1NUK A;  3VDB A;  3OG2 A;  2J1S A;  1T2X A;  1JYW A;  2HLE A;  3DYP A;  3BN6 A;  3IAQ A;  2V72 A;  2W92 A;  3VD4 A;  4AG4 A;  3CKH A;  4XUN A;  1J84 A;  2VMD A;  2ZEW A;  3F2Z A;  2OKX A;  3GM8 A;  4QAW A;  2QQO A; 
#chains in the Genus database with same CATH topology
 3UJQ A;  1OUS A;  1N47 A;  1RUF 1;  1VPH A;  2VO5 A;  1QJX 2;  4I3G A;  3HQR A;  5EWS A;  1S2K A;  1OPM A;  1WW7 A;  1DGR N;  4LBQ D;  4LTA A;  4TXW A;  3FMG A;  4LHS A;  1POV 3;  1FOD 3;  4AK3 A;  1W6N B;  1W3X A;  4GWJ A;  1WGP A;  4AQS A;  1IPS A;  2BDR A;  2AYH A;  3AFG A;  3GXU A;  4RHV 2;  1SDW A;  3ZKU A;  3ZYP A;  4QD2 A;  1HRV 1;  5BPX A;  2XHN A;  3L2Y A;  3U4S A;  3IIA A;  1XYP A;  4H55 A;  4U2A A;  2EXJ A;  1Y3T A;  2R32 A;  4XE9 A;  4M3C F;  4YFZ A;  3ZDV A;  1AHS A;  4XF0 A;  5L9R A;  4IGP A;  5GLT A;  4PQQ A;  1W8O A;  2C4X A;  4U36 A;  3VKM A;  3I3M A;  5D8A B;  1LB2 A;  4GB3 3;  2HWD 1;  2GC0 A;  4NMI A;  4DXS A;  2RMU 2;  1MS8 A;  1W6M B;  1VJ2 A;  5DAP A;  3AZX A;  2OW4 A;  2YC0 A;  4I0B A;  5JXI A;  2WNV C;  2RDR A;  3DCQ A;  1QDC A;  1PGW 2;  1JH5 A;  1V6I A;  3O0X A;  5KHG A;  4LUM A;  2BBA A;  2HEV F;  3FUQ A;  1LHU A;  5GZE A;  5CIR A;  2JKB A;  2GMP A;  3MUZ 1;  2EAL A;  2ZGT A;  1RUI 2;  4AFC A;  4QGM A;  5A32 B;  2VOK A;  3ZFG B;  1JUI A;  1X36 A;  3LA3 A;  2JWP A;  2WZR 3;  2BOI A;  4AF9 A;  3CZU A;  1O3R A;  1WD3 A;  4B7K A;  1YIF A;  3P6B A;  2FZ1 A;  4ZU7 A;  3WW2 A;  4IUG A;  4LEJ A;  3ZOI A;  1CAU B;  2PHW A;  4LBO A;  1XNK A;  2XJS A;  3NVC A;  5DUW A;  4KBB A;  3AKS A;  4LIV A;  4IV3 A;  4HLT A;  1QXP A;  4HVQ A;  1Z7S 3;  4M0H A;  5IK4 A;  4Q2F A;  1U5X A;  5FJK A;  1UOJ A;  1C4R A;  1JHJ A;  4PF1 A;  1F2N A;  2AEN A;  2OUH A;  3I59 B;  4RQP C;  5CU1 A;  5DPN A;  3TB0 A;  5FQ0 A;  2PLV 1;  4JKK A;  4I3P A;  4IEY A;  1RUF 2;  3WLU A;  3IN9 A;  4L97 A;  1BVV A;  3ILR A;  4GJZ A;  3N36 A;  3SH4 A;  3ZYG A;  3U0Z A;  3S5Q A;  3AX4 A;  1VR3 A;  1DDL A;  1W6Q A;  2WT1 A;  1JOD A;  4QU2 A;  2NMO A;  3MFA A;  2ZS6 B;  1QH6 A;  2JD9 A;  4ZHN A;  2UU8 A;  4FOV A;  2IXL A;  4YW7 A;  5F8P A;  4BHP A;  4YFW A;  3NWK A;  1ND2 B;  4IE7 A;  1MZ6 A;  1ODN A;  2W0X A;  4NRP A;  4ASK A;  1GNY A;  2P3Y A;  5ABJ A;  1RUE 1;  4FPY A;  5BY5 A;  4UFJ A;  2R07 1;  1OKO A;  1EUT A;  1VBE 2;  1AYM 2;  2B7Y A;  4JDN A;  1GZT A;  5JSR A;  3TN9 3;  2JE8 A;  1XE0 A;  1QOT A;  1GQH A;  2AR6 A;  3K51 A;  4HBN A;  1OLR A;  5K0U B;  4COZ A;  2L9L A;  4XAA A;  3NV2 A;  3N9L A;  4ASL A;  1H4G A;  1APN A;  2FCU A;  2ZTN A;  4KWJ A;  4IGO A;  3I2F A;  5IVB A;  5JZG A;  3J8F 1;  1TMF 1;  4K6B A;  4M3C B;  3VKL A;  4KWL A;  5FP8 A;  3VKN A;  1WLD A;  4BA6 A;  4A2U A;  2FHR A;  1ZA7 A;  1VAV A;  2IFR A;  4O61 A;  5EJZ B;  3SCG A;  4Q0U A;  1EV1 3;  4MXW B;  4RHV 3;  5EP9 A;  4Q1R A;  2PFW A;  2V4V A;  4GH4 B;  1HB4 A;  3OTF A;  4CZS A;  1G9B A;  2VZP A;  3ZIX A;  2FQP A;  3LOB A;  5GAL A;  2RR1 1;  1R1A 3;  2QJV A;  3AMH A;  4HSJ A;  4IQP A;  4XQD A;  3NAP A;  5FP4 A;  3T2O A;  1JOB A;  1AVB A;  1YEW A;  1Q3E A;  2UWA A;  2JDN A;  2WS9 3;  3ZXE A;  5GZC A;  5FPU A;  3I2J A;  2ZX3 A;  3BTA A;  3K2O A;  5L73 A;  4LPL A;  1JBC A;  1H0B A;  1Q8Q A;  5FZL A;  2NP0 A;  3NQH A;  1QNY A;  4WM7 C;  2VUD A;  2C1F A;  4H7M A;  4AR2 A;  4A7K A;  1U5Y A;  4ARX A;  3I2D A;  5FMO L;  4AVA A;  5BV6 A;  3JBG 1;  1JW6 A;  3MIG A;  4OFG A;  5FUP A;  3KV5 A;  5CB7 A;  1POQ A;  3THP A;  2R07 2;  5LA0 A;  2VXJ A;  3N7K A;  4ZPI A;  5LK7 B;  2ZGQ A;  2R0H A;  3N9O A;  2ZX2 A;  1NQD A;  3RDI A;  2XPJ A;  1CAW A;  2WQZ C;  1NCQ B;  4X6R B;  4XJ9 A;  1NLQ A;  1TG7 A;  1NZI A;  2XUE A;  3QOP A;  1YFU A;  3QCW A;  5KXB A;  4WVM B;  4LKE A;  3P1I A;  5LA1 A;  5FPB A;  1NCR B;  3ZMN A;  4LO4 B;  3OD4 A;  1NYW A;  2HEW F;  2QQL A;  5LBB A;  2ETE A;  2X05 A;  1VBD 1;  2BW8 A;  3I7D A;  2QQV A;  1D4V B;  2RDS A;  2Q4S A;  5DZG A;  1ZA4 A;  3LEI A;  4QHB A;  1R09 3;  2Y6K A;  3V0A B;  1TMF 2;  3B9C A;  4XCA A;  1IS6 A;  4S2F A;  1LHO A;  2R06 1;  5CNA A;  3DN7 A;  4TN7 A;  3CF6 E;  3FJS A;  5FYM A;  5IVF A;  2Q30 A;  4R4X A;  1Q8P A;  2J1A A;  4CPB D;  4EYU A;  5DAQ A;  1RMU 2;  3ZPO A;  1OBN A;  4RR3 A;  5FLI A;  3FFZ A;  3RZK A;  3R4D B;  2JB4 A;  3B3Q E;  2P17 A;  4NWW A;  1V6N A;  4OHY A;  3LIH A;  2DCK A;  4LBJ A;  5JIA A;  3PU8 A;  1NY7 2;  3GCX A;  4I0A A;  4OI4 A;  5F2W A;  4BXF A;  2KA3 A;  3RMX A;  2HWB 1;  4IE0 A;  5BNO B;  1FT9 A;  2HBT A;  2XH6 A;  4JKL A;  2D97 A;  2R7E B;  3WP6 A;  4XDO A;  3K3O A;  2OA2 A;  5JMC A;  4NHK A;  1S1A A;  2WNU A;  5F5C A;  5SV8 A;  4UFL A;  4HSL A;  3VD7 A;  3ZSL A;  3M3E A;  2K2S A;  4PHZ A;  3ZKY A;  5FYY A;  4BK4 A;  1DCS A;  5EPA A;  3I2G A;  5K0U A;  3USS A;  2GN7 A;  3LPG A;  1PO1 3;  2XB6 C;  4XBQ A;  3RZJ A;  2FDF A;  2WWJ A;  4NIH A;  3POW A;  4DEV A;  1QQP 3;  1HXS 2;  1GWK A;  5C71 A;  3LA2 A;  1PGL 1;  5IK7 A;  1ND2 A;  3DF0 A;  3Q8E A;  4QX8 A;  4AOC A;  3WW1 A;  4C90 A;  3TEW A;  4F7Z A;  3L2H A;  5FJH A;  2OQ6 A;  1HRI 3;  1O7F A;  4Q4W 3;  3TEX A;  3NNM A;  4AQ6 A;  4MGQ A;  4S2G A;  1C8M 1;  1NX9 A;  2F4P A;  2ZGP A;  3DEC A;  1W6Q B;  4NR1 A;  2O8Q A;  4QKD A;  1O5U A;  3RZG A;  4W6W A;  2D43 A;  4AED C;  4IW3 A;  4Q0V A;  2P5B A;  4AXO A;  4X6Q B;  2P6H A;  1UKG A;  3BAL A;  2B46 X;  3B00 A;  3ZFF A;  4C0B A;  5A7P A;  5FQ0 B;  1ZZ7 A;  3H9A A;  5CFD A;  3LQC A;  1R08 2;  3AYE A;  4ZZ5 A;  2IWG B;  2RS3 3;  2RDN A;  4FCA A;  3QD6 A;  5AVP A;  5IYY A;  3AMP A;  5LA9 A;  1ZRI A;  1VBC 1;  3B69 A;  1GUI A;  1QU0 A;  3KV9 A;  4YZ1 A;  5C33 A;  1EP0 A;  1KIT A;  1VMF A;  3N9P A;  3CJI C;  4FXK B;  5IVV A;  5K0U C;  3DYM A;  3BU0 A;  3AKT A;  3O0W A;  3D5O A;  4FPK A;  3UYJ A;  4ATE A;  4PLN A;  1LTE A;  4RS5 C;  5HBA A;  1FPN 1;  3VBH B;  1T6B X;  2ZJC A;  1LOF C;  3ACI A;  1IG3 A;  1WCD J;  3GJB A;  4QGN A;  3VD3 A;  4DFS A;  2RS1 1;  1GWL A;  2Y6F A;  4NHY A;  2XJP A;  1NCQ C;  1LHV A;  2ZML A;  5JXJ A;  5FYH A;  2B9U A;  1UN1 A;  2HWC 2;  4M01 A;  4NUB A;  3O1V A;  1OA2 A;  3R4U A;  2W68 A;  2P34 A;  4XJA A;  4NPM A;  1HIX A;  1UZ0 A;  3USU B;  2QNK A;  4FQ4 A;  1D0H A;  3JBG 3;  4N90 A;  3WP3 A;  5BNN C;  4GAZ A;  4XFA A;  2XWJ B;  2CV6 A;  4IEO A;  4NHX A;  1K5J A;  1YQ2 A;  2HWD 2;  3CL1 A;  3N9Q A;  5D8A A;  4AAP A;  1JOP A;  5I0U A;  4FPF A;  4YNI A;  5FTT C;  3VBS C;  1UOG A;  1CJP A;  1JYN A;  3BIW E;  4FPE A;  5GKA C;  5DDJ 1;  3PJQ A;  4YVS C;  4PI0 A;  5L7O A;  4QKN A;  2EXI A;  3RSJ A;  4WM7 B;  5DDJ 3;  5GZD A;  1UAI A;  4HKL A;  1KJL A;  1PVC 3;  1VBE 1;  1RUG 1;  2ARA A;  3NJY A;  2RR1 3;  1JS9 A;  1YFX A;  3MIE A;  3OY8 A;  4XAB A;  4RFR B;  4XTM A;  5FZC A;  1RYY A;  4HK8 A;  1HQL A;  1DYP A;  1QDO A;  2RM2 1;  4K7J A;  3GBG A;  4RL7 A;  2YBK A;  4GIQ A;  1XB9 A;  2WFF 2;  2CDP A;  3VN4 A;  2VMH A;  3LB9 A;  1EV1 1;  5A1A A;  4QQH A;  5JVV A;  5F2S A;  2GMM A;  2V5Y A;  1ZYB A;  3IAP A;  3AKR A;  1RMU 1;  3E97 A;  4LOS A;  4RGA A;  1C1F A;  2HBU A;  5DXD A;  1O3T A;  5FZ3 A;  5DAW A;  4R9D A;  5J7M A;  5FOB B;  4UFH A;  2OX0 A;  3ZMO A;  4XMA A;  1J1T A;  1RUN A;  3AZW A;  1GYK A;  2H0B A;  1JYX A;  3N3H A;  2DVA A;  1N3O A;  4FBF A;  2WO2 A;  1RUH 2;  1XOY A;  2ZGU A;  3PHM A;  4W6X A;  1H2L A;  1SPP B;  1GV9 A;  5EYX A;  2FDJ A;  1RUH 1;  2QUO A;  2AC1 A;  4COY A;  4MGT A;  1X8E A;  3POY A;  2PHL A;  5ERL A;  4LIU A;  5FZO A;  3ZN5 A;  1OLM A;  2DTY A;  3NRU A;  1W2A X;  4YGB A;  1ENR A;  4FFF A;  5FPX A;  4GQ7 A;  1PO1 2;  1W2T A;  5T5J A;  1V0A A;  1MPX A;  5JAX A;  4LOR A;  1SFY A;  4Q29 A;  2WSU A;  3WR0 A;  1BK0 A;  3WD5 A;  5A6X A;  5A3M A;  4XFI A;  1C57 A;  4IEX A;  1RUE 2;  4A3X A;  4QPG A;  4B4R A;  1DBN A;  4P9G A;  1BEV 2;  2DCT A;  4XXP A;  5T3N A;  3WDU A;  3F95 A;  4DUX A;  4IEZ A;  1Z78 A;  4MGZ E;  2AEZ A;  4A42 A;  2G9G A;  2PQQ A;  1URX A;  3TRS B;  5FY8 A;  3RYP A;  3VHN A;  5FCC A;  5GZF A;  1AL0 G;  1GBG A;  1RVF 3;  5FRA A;  5H9S A;  1IGO A;  1UWW A;  3UGH A;  5K7P A;  2KM2 A;  1EAH 2;  2BVV A;  4Q4Y 1;  1AR6 2;  3EJK A;  3KV6 A;  1W28 A;  3K48 A;  1EUU A;  3NNJ A;  2OPK A;  3FBM A;  3GZE A;  3R6S A;  4JRL A;  3C3V A;  3WNP A;  4AEJ A;  1O4T A;  5I0S A;  2ZGK A;  1RJ7 A;  3NKG A;  4MHR A;  1PVC 2;  5E89 A;  5JR7 B;  5LRR A;  4GZ9 A;  3KGL A;  1NA1 C;  3VD9 A;  3RS6 A;  1PX4 A;  4AHZ A;  1HB1 A;  3WP5 A;  2XUM A;  1STM A;  3CJX A;  1C5H A;  2WT0 A;  1OXC A;  4YVW C;  5E16 A;  2J1T A;  1AR8 3;  5TSW A;  5F5Q A;  1QKQ A;  3IWZ A;  1BK1 A;  1CN1 A;  1E5R A;  2G9F A;  3INA A;  3O5S A;  3OYW B;  2BJS A;  5GLZ A;  5FOJ B;  3VV1 A;  5EJ1 B;  2J1V A;  3E5U A;  4BXS V;  1HXS 1;  5HXV A;  4EZ4 A;  1POV 1;  1GZW B;  1VBB 1;  3WDY A;  1R09 1;  3H1M A;  4UAP A;  3SCF A;  4EWD A;  3VDC A;  1NE6 A;  2WNE A;  3M4F A;  3JXS A;  4HON A;  4XDP A;  3T09 A;  2VY0 A;  3VBU C;  1OT5 A;  3MZH A;  2LTN A;  1IS3 A;  2DFC A;  2PHT A;  3ATG A;  1YRZ A;  3EXU A;  1FYU A;  1PVX A;  5ABJ B;  4AVS A;  2HWF 3;  3OBT A;  3KM5 A;  3QBQ A;  3LCP A;  4AVT A;  3H42 B;  3P5B A;  1C5I A;  4HVR A;  3CZJ A;  2A6W A;  5GLW A;  2RVA A;  2X53 S;  5KXD A;  2YGL A;  5FBJ A;  5BNO A;  4YW4 A;  4I02 A;  4B8E A;  4E4Z A;  3SIS A;  4XQW A;  3TEY A;  5DG1 A;  4ZON A;  3ACH A;  5ANN A;  2ZZJ A;  3W5N A;  4ZXK A;  3GZU C;  4IXL A;  2VMI A;  1B09 A;  2WFF 3;  1ASJ 1;  1NAE A;  2ES3 A;  2RS1 2;  2FMD A;  1WCQ A;  4XMI A;  4BMB A;  1H1I A;  1IKQ A;  2NZ9 A;  1GMM A;  1WLC A;  5FZG A;  1CWP A;  2NMN A;  5FYT A;  3VUO A;  5KC6 A;  3HBK A;  4MGY E;  2GNM A;  3ZPY A;  1V6J A;  3OUI A;  5C7G A;  1UOF A;  2BNN A;  4YPJ A;  5JPN B;  1GOF A;  4E27 A;  1Z7S 2;  2DFB A;  4K20 A;  2GC1 A;  1JUH A;  3VDB A;  3M7A A;  4GD4 A;  1BMV 1;  4UBH A;  3WT3 A;  1MS3 A;  4ORF A;  2VOW A;  1WW4 A;  3DUI A;  3OG2 A;  3PVB B;  4O9E A;  5FYI A;  4O9G A;  1XNC A;  4AQ2 A;  1PK6 B;  4J25 A;  3OYW A;  4IE6 A;  4FFG A;  2FDG A;  3THT A;  1T6G C;  4YM0 A;  3S30 A;  4AI0 A;  3VD4 A;  4QXK A;  4RA0 A;  3WDT A;  2EAK A;  3ZSE A;  1W6O A;  2YXS A;  3RGB A;  3CKH A;  2XKO A;  2ARE A;  4G3Y C;  3F2Z A;  4RQP A;  2YV8 A;  3A0N A;  2ET1 A;  2VMF A;  1YC6 1;  1FAY A;  3D0J A;  4IV1 C;  5T5P A;  2QQO A;  1QXR A;  1UW8 A;  4R9A A;  5DAV A;  4CDU C;  2VQT A;  1QJU 1;  2HYX A;  5FZ9 A;  5IW0 A;  1IQD C;  2BUK A;  4L11 A;  4BQ4 A;  1W99 A;  4R52 A;  5T52 A;  4Z07 A;  1CPM A;  1PO2 3;  3ITQ A;  5A7W B;  5F1R A;  1JYV A;  2R07 3;  2XQR A;  1ACC A;  2Q0A A;  3LFM A;  4YGE A;  5J96 B;  5DN2 A;  4KG8 A;  2VBD A;  5A7N A;  3JD7 3;  3WDX A;  2OVU A;  3WF3 A;  2RR1 2;  2B5H A;  1LOA A;  1ASJ 2;  1XNA A;  5J48 A;  3WF2 A;  5G05 L;  3ABZ A;  4YZ4 A;  1HJG A;  1Z0H A;  1UYP A;  2WFF 1;  3O12 A;  4N53 B;  2R04 2;  1S0I A;  3CEW A;  3MLK A;  4RSU A;  1D2S A;  1CVN A;  1KQR A;  3RPQ A;  1CJD A;  4CUG A;  4P5H A;  2JG9 B;  2GAU A;  1OA4 A;  2ZEX A;  4L0P A;  4Q4V 2;  3IZO A;  4NID A;  3OGV A;  4PLM A;  2VUA A;  1CX1 A;  4ISQ A;  4ZS2 A;  4YW1 A;  2XXZ A;  2G4I A;  4S2H A;  4EQV A;  2P1B A;  4G9S B;  3AZV A;  5FFO C;  4CUA A;  5JZG B;  1VBC 3;  2NPI A;  2MEV 1;  2PAM A;  5F5A A;  2ZGL A;  3E6D A;  4P9J A;  3ZDS A;  5CEH A;  2WWS A;  4CDW C;  1I3H A;  3ZXA C;  2R06 3;  1TME 3;  1AXK A;  3BKZ A;  1CIY A;  3V0B A;  2QDN A;  4WM7 A;  1O91 A;  5EYY A;  3MUY 1;  3VBR A;  1TME 2;  1FI2 A;  3O0V A;  1YLL A;  1FNZ A;  4PT6 A;  3SCH A;  1LOC A;  3RWN A;  1QF3 A;  2R30 A;  2I74 A;  2ARX A;  3HBZ A;  4JGY A;  4PIZ A;  4XUR A;  4CDQ B;  5AVA A;  1A8M A;  4YLZ A;  2GC2 A;  4YG6 A;  1COV 2;  2YU2 A;  5CZK A;  1Q8V A;  3DV8 A;  3GAL A;  1ENS A;  3FLR A;  3MBW A;  3USU A;  2HWD 3;  1AR9 2;  4MX3 A;  2PXJ A;  1H6X A;  2Q8E A;  4XYX A;  1LKN A;  5HPO A;  2GH8 A;  4QPI B;  1M4W A;  1NA1 A;  4DUW A;  1FXZ A;  2ZXQ A;  1UYY A;  2UWB A;  1RUC 1;  3U4X A;  1QJX 1;  4A7Y A;  1KS4 A;  1Q8S A;  4CE8 A;  4YVW A;  1QJX 3;  1W0N A;  1X9P A;  2W47 A;  2Z69 A;  1CQ9 A;  4UWD A;  5EV7 A;  2CGN A;  4IET A;  3WNN A;  3MPP G;  3PUI A;  4OQ8 A;  2VUL A;  1QH7 A;  5EQU A;  3KZ4 C;  3KCY A;  3I2I A;  1C28 A;  3MF9 A;  1BBT 2;  4CCK A;  2XVL A;  1OH4 A;  1W6P B;  1W8Z A;  2Q8C A;  4D7T A;  4K40 A;  1G9F A;  5JCT A;  1SLT A;  5HCH A;  2LW8 A;  3OY8 B;  3GZA A;  3OBR A;  3IM0 A;  4RS5 A;  2JE7 A;  1F4H A;  3OPT A;  3ZFE B;  4EWE A;  1KRI A;  2DVF A;  2V5D A;  3WX5 A;  4F8A A;  4GUL A;  3H1W A;  1F9K A;  1RGS A;  3JU9 A;  1VRH 1;  2ARC A;  2K9Z A;  4LBQ A;  1OFN A;  2ZEZ A;  4LO6 B;  2VVE A;  4NOT A;  1S0G A;  2O1Q A;  5CYY A;  5IT6 A;  3O1M A;  1J59 A;  2UY9 A;  2RMU 3;  3HVD A;  5EFU A;  3DYO A;  2F4L A;  4V2V A;  5FZM A;  2XBO 2;  1DLL A;  3ETP A;  4CDX A;  2BRT A;  4FT8 A;  2BFU L;  2DCJ A;  2YB7 A;  4YGC A;  2CGP A;  4ATF A;  2VZQ A;  1US2 A;  4QDS A;  2KXL A;  4L2N A;  1AX2 A;  2JDP A;  1RUH 3;  3ZXF A;  1RIN A;  4EV0 A;  4IE4 A;  2XLA A;  3WHU A;  4YM3 A;  1Y9G A;  3ORJ A;  2B4K A;  2ZHM A;  2Z4F A;  5FZ4 A;  1DIW A;  3PVE A;  1HLC A;  3DXU A;  1NZC A;  2W91 A;  1ZZ8 A;  1PK6 C;  2EIB A;  4JV4 A;  4QPI A;  4ARY A;  1QJZ A;  4JX0 A;  4JGZ C;  1GLH A;  4XPV A;  2V73 A;  3JUU A;  4PDW A;  5ACA 1;  2DYC A;  5LBE A;  2VTF A;  2A1X A;  3OUH A;  4D6R A;  2G1M A;  1RXG A;  2CAU A;  1B35 C;  3D6E A;  3NW4 A;  3BTX A;  3BTZ A;  3ST7 A;  3PMS A;  2WJS A;  4ZKT B;  2K46 A;  3MIC A;  3NST A;  1X82 A;  3B01 A;  3X29 B;  2DVD A;  2FMY A;  3UT0 A;  4NPL A;  3OF1 A;  5DQ0 A;  2OZJ A;  2C24 A;  4XOG A;  5FXX A;  5GM0 A;  4QGL A;  1DU3 D;  2O8O A;  3C7G A;  3WQ7 A;  4H2A A;  1GP5 A;  4CCM A;  5FWJ A;  1NKG A;  4JDO A;  5DZE A;  3ENR A;  1D4M 2;  1EY2 A;  3MLL A;  2TNF A;  1UF2 C;  1ZM1 A;  1FNY A;  4HOO A;  4D6Q A;  1F8V A;  2EAA A;  1ULC A;  4QXB A;  1BHG A;  2BFU S;  4LBN A;  2J1E A;  4LJH A;  1CAV A;  3FHQ A;  5J98 B;  2A73 B;  3LEK A;  5FY5 A;  4FOQ A;  1WA6 X;  5FYS A;  4HZF A;  1JI6 A;  3N7J A;  4IGQ A;  1ZBE 1;  3OEB A;  4IV1 A;  1ODM A;  4CU7 A;  4Q8L A;  5FDB A;  2ATF A;  4XBN A;  1W0P A;  1L7L A;  2EA7 A;  4I0W B;  3PDQ A;  2A6X A;  2QQM A;  3SH3 A;  4FPL A;  1WUV A;  4GB3 1;  4V1P A;  1G6N A;  5C3Q A;  3PTR B;  1IS5 A;  4CP2 A;  4AFB A;  4Q4X 1;  4A6S A;  1K5M B;  5ACA 3;  3B02 A;  4UXA A;  1RUG 2;  1G8W A;  2J42 A;  4LO8 A;  4Y3O A;  3WF0 A;  5AFE A;  4CEY A;  2JIC A;  2BGO A;  3RVH A;  3LSE A;  3CHX A;  4P02 B;  3HOB A;  3RYK A;  1I5Z A;  3VDD C;  4D94 A;  5FPA A;  4P00 B;  1EV1 2;  2XBO 3;  1HW5 A;  3BGA A;  2VCC A;  1DGL A;  2JG8 A;  1DQ4 A;  1R64 A;  1RUD 3;  2HWF 2;  2PQS A;  1SCS A;  2WQ4 A;  5A3T A;  2OPW A;  4MET A;  3QH7 A;  4C91 A;  2P3I A;  2LRP A;  2C0Z A;  3UKV A;  5L7O C;  1TNF A;  1QJF A;  1ASJ 3;  1NCR A;  1H8T A;  3I3E A;  5F6L B;  4DZG A;  5LEK A;  2GAL A;  4WVM A;  2JE9 A;  5SV5 A;  2X29 A;  4XUO A;  1YQC A;  1E5H A;  1ONA A;  2A6Y A;  3KLS A;  2MEV 2;  5JXH A;  2D3R A;  2FZ2 A;  1V00 A;  5DG2 A;  1XSQ A;  3V0A A;  1JXN A;  3MIF A;  2B42 B;  2WAB A;  3H8U A;  2JDK A;  4F3J A;  3ZXD A;  1LOE A;  3THD A;  2CYF A;  4UT5 A;  2WLP A;  1SLI A;  1KEX A;  4OHX A;  1GP4 A;  4JGY C;  4AFM A;  1RUI 3;  1N1V A;  3BCW A;  3B9I A;  1CAV B;  1GOH A;  1LU2 A;  3ASI A;  3K75 B;  2GP3 A;  3IMN A;  1UZV A;  4EN0 A;  1REE A;  2VCM A;  4PF5 A;  4IL7 A;  3D0S A;  2MEV 3;  2WYS A;  5AFB A;  5C8C B;  2WS9 2;  3VBF A;  3RNS A;  5CA6 A;  5FXW A;  1N3Q A;  4I30 A;  1SCR A;  1QMJ A;  1UQX A;  1OKQ A;  1VBA 3;  3U10 A;  3VBU B;  2WII B;  2TBV A;  4GWI A;  3AYC A;  4FP3 A;  3WQ0 A;  3T2P A;  1K3I A;  2Y6J A;  3FN9 A;  4DIQ A;  4CCE A;  4P5Y A;  1GNZ A;  4ZU4 A;  3OEA A;  4XFC A;  1KGY A;  2DUR A;  1UMI A;  2GH2 A;  4RGK A;  5KC5 A;  4IDZ A;  1MQT C;  1UMH A;  2YRO A;  1UIK A;  4NAM A;  1MS5 A;  4KBZ A;  3O1P A;  4FPG A;  3WF4 A;  3WW3 A;  2I07 B;  3AM2 A;  2ZEY A;  4G4F A;  4WBB A;  3MPB A;  3RQ0 A;  3UL2 A;  4MSV A;  1GU3 A;  2E51 A;  3NV4 A;  3CQO A;  1K5M A;  3KV4 A;  3ME2 A;  4BM8 A;  3H8X A;  2FDH A;  3UNP A;  2JJ6 A;  3VDA A;  1OOP A;  2VBB A;  2BWA A;  1LCL A;  3W9A A;  2VR4 A;  4HMZ A;  1QIQ A;  2JEN A;  1RUG 3;  1SQ4 A;  3JCI A;  4Y5Z 0;  4Y5S A;  5KWR A;  4R9B A;  4XVH A;  3J26 N;  2BP6 A;  4QPG B;  3U11 A;  4H14 A;  4JRA A;  3I3D A;  2EID A;  2CTV A;  4MXW A;  3N7M A;  1TQ5 A;  5C3S A;  4MVT A;  5LBF A;  5C3P A;  3ZN4 A;  1N1Y A;  2Y6G A;  3CU7 A;  1O59 A;  1RUJ 2;  3JBG 2;  1S0C A;  2J1U A;  4LKS A;  1OLM E;  1UL9 A;  3PUQ A;  1F5J A;  3QLQ A;  3H50 A;  5JOX A;  2WL1 A;  3IKW A;  4Q0S A;  5HI0 A;  5LY2 A;  4Z2W A;  4MHU A;  3C7O A;  1CR7 A;  5CFC B;  1NQJ A;  1DZQ A;  1K12 A;  3EB7 A;  3GYD A;  3BU7 A;  1K5M C;  2N7G A;  3MF6 A;  1SDD B;  3EHK A;  4JQR A;  4XTP A;  3WG3 A;  2VJX A;  5FMB A;  3SNM A;  4COV A;  5KXC A;  5B4X A;  2W1W A;  3I59 A;  5IUQ A;  3UGG A;  4B3N A;  5LAT A;  2VZV A;  4E4D X;  2D6M A;  5LW9 A;  3I8T A;  1NY7 1;  2A6Z A;  3ZXK A;  3POB A;  4CP9 B;  1QOS A;  4O7X A;  3ZO0 B;  5A1F A;  4XZU G;  1N1T A;  3VZJ A;  4NWV A;  2W3J A;  1QHD A;  2NYY A;  3GHN A;  4QX7 A;  1X33 A;  1HB2 A;  1J58 A;  2UWC A;  2D44 A;  2D6K A;  1WW5 A;  2VZT A;  3W59 A;  1JTZ X;  1WKY A;  1GWM A;  1LEN A;  2BGP A;  5FZF A;  4AL9 A;  2WNV A;  3K77 A;  1JOJ A;  2VQU A;  4XUT A;  4UW6 A;  2HWE 3;  4XAC A;  1RMU 3;  3CDZ B;  4B4Q A;  5GJ6 A;  1SBE A;  2FD8 A;  1JHN A;  5IVJ A;  1W9W A;  4MUV A;  3VHP A;  1WW6 A;  3IDE A;  1S0D A;  3DKQ A;  5FY7 A;  4KI5 M;  4XDQ A;  2W94 A;  5FZ0 A;  4TWT A;  2RV9 A;  4Q4W 1;  5CAZ A;  2HWB 2;  2BQP A;  3J4U H;  1AZD A;  4W8J A;  4JGY B;  3EBR A;  3IPV A;  4QU1 A;  5I93 A;  3SQO A;  1DGR A;  2A6V A;  3IPV B;  1ZRR A;  4NRM A;  5FBZ A;  1MR5 A;  3OBA A;  3V64 A;  2B39 A;  1IG0 A;  1HV0 A;  1SBF A;  3A21 A;  1DHK B;  4A45 A;  2HWE 2;  4J1W A;  1RXF A;  3ZN6 A;  3VKF C;  4FAH A;  1UXX X;  2A3Y A;  1B35 B;  1ULE A;  3NJZ A;  3AK0 A;  1W6N A;  2VQ0 A;  3LF7 A;  1W9Y A;  1LNS A;  1UXZ A;  1XYN A;  2C26 A;  4XJZ A;  5D1I A;  4C1W A;  1G9C A;  1S0B A;  1VRH 2;  1RUC 3;  5H9Q A;  1CX4 A;  4BCU A;  4BLJ A;  5EHD A;  3VBO C;  3WVJ A;  2WZE A;  4KWU A;  5K4L A;  1FAT A;  4RFT 0;  5J36 A;  5A6Q A;  4RGG A;  2WKK A;  2RS5 3;  1OQ1 A;  3B7M A;  3LZZ A;  1V6L A;  4L9B A;  1H2M A;  5ANQ A;  3THC A;  4C8D A;  1VBA 2;  4CEW B;  4R9C A;  4WZC A;  4YYO A;  3ZFF C;  5IJR A;  2VE1 A;  5IFT A;  3HT2 A;  5A7S A;  4IES A;  3B93 A;  4BQ3 A;  5IAV A;  2YG0 A;  4K3U A;  3NJV A;  3NNL A;  4WZF A;  3KS7 A;  2QQI A;  2W1S A;  2C5D A;  2PLV 2;  2VZU A;  1PGL 2;  4Z1V A;  5FUN A;  3KT4 A;  2QZ3 A;  1PMI A;  2ZCW A;  4OUS A;  1H8T C;  4CEW C;  2WSV A;  4Q1P A;  1RUI 1;  3SXW A;  1QQP 2;  2RG4 A;  2E26 A;  1YQ5 A;  4IEU A;  2ORX A;  3MDP A;  4QDQ A;  1W9S A;  1UKR A;  2Z5W A;  1Q8O A;  2F17 A;  2TEP A;  3DPR C;  4XF9 A;  3WSO A;  3HR9 A;  1CZS A;  4QKB A;  2QQN A;  5IVY A;  4ES9 A;  1SLC A;  4CPB A;  5D8A C;  1OMI A;  3ECQ A;  2IXC A;  3TWI A;  3W58 A;  2VUC A;  3ZR5 A;  4AI1 A;  5HXM A;  1PGW 1;  2Y0I A;  4OUE A;  4D7S A;  2D6L X;  1S4C A;  2UY8 A;  4XIO A;  5CVR A;  5DAX A;  3VBH A;  4N43 B;  1FMD 1;  1ULO A;  5A3U A;  3BOW A;  5FLJ A;  3VBF C;  3DL3 A;  2O0O A;  3I97 A;  4OI0 A;  1LUL A;  2ZHN A;  2A3X A;  3J7H A;  5F3I A;  4D0Q A;  1C8M 2;  5FYV A;  3OCP A;  1WCU A;  3SLI A;  5A3P A;  1MVE A;  1KJR A;  1RVF 2;  2X5I A;  2XHK A;  4LBM A;  4N53 A;  5BNN B;  1S2B A;  4BIF A;  2DDU A;  1UMZ A;  3NNG A;  1YFW A;  4JAA A;  4CDX C;  1H1M A;  1NUK A;  4LHL A;  4AED B;  3VBS B;  3ZFF B;  4RR3 B;  3WP4 A;  3O1R A;  2CL2 A;  3AFK A;  2BNM A;  5FPV A;  3PUR A;  4DRR A;  3DEM A;  1R1A 1;  3ZYR A;  3DPR A;  4LBK A;  2HLE A;  3ELN A;  1W8T A;  3MEP A;  4NPR A;  4DY3 A;  1ZRC A;  3IAQ A;  1OOP C;  5C4W B;  4BQX A;  3AP4 A;  4NJ4 A;  4AG4 A;  5IVC A;  2CAV A;  2PHR A;  4CXW A;  4Q5O A;  5KR7 A;  3RWK X;  2RS5 2;  4PDW C;  5FZE A;  3ES1 A;  3WQ1 A;  2OKX A;  1Y9Q A;  2HYK A;  4ISR A;  1RTV A;  4QAW A;  4RR3 C;  3VBH C;  3MFC A;  3WNL A;  4AVV A;  1MS4 A;  1O8P A;  2Y34 A;  3ILF A;  2XML A;  4NII A;  1NT0 A;  2NLR A;  2WAO A;  5EXO A;  2NN8 A;  4DO0 A;  5A3W A;  1UY4 A;  2VVF A;  3D3A A;  4AFA A;  2QFE A;  1YI7 A;  4K9S A;  1LJ7 A;  1OOP B;  1RUO A;  3TBD A;  1VBD 3;  4CU8 A;  3FX3 A;  1PM7 A;  2C9A A;  2ZBJ A;  5EJ3 A;  4UI9 L;  3T0D A;  2WNU B;  5C9A A;  4AVB A;  4Q0P A;  1REF A;  2Z79 A;  3NNF A;  4MZU A;  2I2S A;  1Y9M A;  5FY9 A;  4YZ5 A;  3ZXJ A;  2WO7 A;  3OOX A;  2QQP A;  2PAK A;  2PHD A;  5BNP B;  4Q4Y 2;  1G9D A;  2GDF A;  5K9Y A;  3MYX A;  3OGJ A;  3VL8 A;  2XON A;  5FWE A;  1ULG A;  1UU5 A;  1U12 A;  2QDR A;  4COU A;  4AYU A;  5BYN A;  3POJ A;  4P9W A;  4NRQ A;  2G9Z A;  4FQZ A;  1TE1 B;  4KH9 A;  3JD7 2;  1LEM A;  1DGW X;  2GP5 A;  4L8Q A;  3A0K A;  4YWA A;  2XJU A;  4QPY A;  5I0T A;  4CEY B;  1BEV 1;  5J1X A;  2DBI A;  5FAX A;  3ZXG A;  1ULP A;  3ZYJ B;  2VNG A;  4XF1 A;  5HCB A;  4AGV A;  1K45 A;  3AKP A;  2HWF 1;  4FTB A;  2BYV E;  3JB4 C;  3KWV A;  3WV6 A;  4OMC A;  4HN0 A;  2Y6H A;  2V4A A;  1F15 A;  3BB6 A;  3T08 A;  4BQY A;  5HCA A;  1S0F A;  4JVA A;  4K1Z A;  4B7E A;  2DUP A;  4DEQ A;  4C0H A;  2E9Q A;  4HAN A;  2ZMK A;  2PTM A;  2YPD A;  4NHM A;  3OJB A;  1PIV 3;  5J37 A;  2YBP A;  4CEY C;  5C9A C;  3ACG A;  1IQA A;  4N43 A;  4EE2 A;  2WRA A;  3MIH A;  3UJO A;  2XDV A;  3RZM A;  5JDB A;  4BOW A;  1VRH 3;  1DQ5 A;  5CFD C;  2NM1 A;  1VIW B;  5FYZ A;  2QQJ A;  3W21 A;  2ZOE B;  5FZ7 A;  3IBM A;  2PHF A;  4TLF A;  3RG0 A;  5I0D A;  2DF7 A;  3ON7 A;  1BZW A;  4HK9 A;  4Y1U A;  1NLS A;  1CES A;  3PLQ A;  4QHZ A;  4CCN A;  4YAR A;  2YFZ A;  5IVE A;  1C8N A;  2GZW A;  2HWE 1;  4LKF A;  1TMF 3;  3T30 A;  4JGZ A;  4JDM A;  3KD4 A;  4GWN A;  2VPV A;  2IVJ A;  4N8M A;  3CJI B;  2RE9 A;  1OC1 A;  2OXB A;  4KQ7 A;  3POI A;  1FPN 3;  1VBA 1;  4MAD A;  3RJR A;  4CCJ A;  4CDQ C;  4X8P A;  5IAT A;  1AL2 2;  1PHM A;  2D6O X;  2JIJ A;  4FTS A;  3VZO A;  3PVN A;  3ZYF A;  5FO9 B;  4E4S A;  3GF6 A;  4YM2 A;  4AHW A;  3VLB B;  4DB5 A;  4B4P A;  3VBS A;  2HEY F;  2V09 A;  1U5Z A;  3FLP A;  5E1R A;  1FMD 3;  3NAP B;  4AGG A;  1AL2 3;  3ZYH A;  2TUN A;  5BNN A;  4ZU5 A;  5FKC A;  5GLU A;  4TLG A;  3QAC A;  4YG0 A;  2J1R A;  4GA9 A;  5F5I A;  4XFH A;  1FX5 A;  4MOA A;  1I9R A;  1OFS A;  2E7Q A;  4Y24 A;  2WZ8 A;  5DUV A;  1C3H A;  2GME A;  3AYA A;  4FVV A;  2ORZ A;  4JTN A;  1YJK A;  4CDU B;  2DU1 A;  1Z7S 1;  4B29 A;  4SLI A;  1O5L A;  2RS3 2;  4FPO B;  2LM3 A;  4LBQ B;  4FOW A;  3CLP A;  4DXZ A;  4Y22 B;  1Y4W A;  1EYB A;  2YHJ A;  4XFB A;  5FYB A;  3WCS A;  3IT8 A;  2KD7 A;  4BU2 A;  4HPK B;  3VDD B;  5JOY A;  4YZ2 A;  3P3N A;  3WZ1 A;  1RUD 1;  3E6C C;  3E5Q A;  3RZZ A;  4A7Z A;  2ENR A;  1OPO A;  2EIC A;  5KHJ A;  4CDX B;  4QM9 A;  4Q4V 3;  2WQ8 A;  3LSD A;  5I8S A;  3AL6 A;  4UFI A;  1UO9 A;  5A33 A;  2W39 A;  2D93 A;  1CON A;  3U1X A;  1U0A A;  1AF9 A;  2BWC A;  3E5X A;  3PNA A;  1DF0 A;  1W05 A;  4Q26 A;  1HB3 A;  4HN1 A;  2Q8O A;  3FZ3 A;  2R6Q A;  2RM2 2;  5FV3 A;  2BOJ A;  2QE3 A;  2BU9 A;  1O6U A;  1BLZ A;  1PNF A;  1PMH X;  2ERF A;  2EXH A;  2VW1 A;  4F83 A;  4MO3 M;  3MW4 A;  3O1S A;  4PI2 A;  3O7O A;  4Q4X 3;  2KR2 A;  1F5F A;  1YQ6 A;  2VH9 A;  1WA4 A;  2WZP P;  2WFP A;  1RIR A;  3PJY A;  1LRH A;  2W9X A;  3Q8B A;  1X7N A;  3PL0 A;  3GHM A;  4XFG A;  4HFS A;  4KGQ A;  1HRV 3;  1ZBE 3;  2JG9 C;  4GXL A;  3TNQ A;  1AR6 3;  1EAH 3;  1Q5O A;  2OII A;  4UFK A;  2RM2 3;  1AX1 A;  4NO4 A;  4DQA A;  3LA7 A;  4MV2 A;  1ND3 A;  1OA3 A;  1V9U 2;  1LED A;  4PIX A;  4JC1 A;  1RUC 2;  1V6K A;  1GQP A;  4LK7 A;  4S2D A;  5FIX A;  3ZFG A;  5A32 A;  1UCX A;  1W04 A;  2WAA A;  2ZX0 A;  1LOD A;  2VGD A;  2QQW A;  1OLQ A;  1NLR A;  1UU6 A;  3HEI A;  4QX2 A;  4BDV B;  3ZYI B;  5CFD B;  5A7Q A;  2E31 A;  3M3I A;  2JDM A;  1RIT A;  1SLL A;  1Q56 A;  2GC3 A;  2VCB A;  3SIT A;  4JHZ A;  2AAC A;  3ZN6 B;  4QXH A;  4B1L A;  2A75 A;  4EWA A;  1G9A A;  3FE5 A;  1YUD A;  1DQ1 A;  3BPZ A;  1LR5 A;  3LOI A;  1BEV 3;  3O1O A;  1OVS A;  4P9X A;  5FXZ A;  2ZX1 A;  2D6N A;  4KGG A;  1R09 2;  5LY1 A;  5HCF A;  1RC6 A;  1QY4 A;  3J7L A;  1O8S A;  1SBD A;  1W03 A;  2WO3 A;  1VLN A;  1EPW A;  1RUJ 3;  3BI3 A;  2JG9 A;  3RMY A;  1MQT A;  4MXV A;  4H3W A;  1WMD A;  2ZHK A;  2VNV A;  1LOG A;  3RI9 A;  3T0A A;  3M1H A;  4FPH A;  4E8C A;  1XPW A;  3NMB A;  1PMJ X;  2ZAC A;  4JZR A;  4PBP A;  1NA1 B;  2WNV B;  4OMD A;  1H8V A;  2CSG A;  1UPI A;  2R06 2;  3K3N A;  4QHO A;  1MEC 2;  5APA A;  3HPN A;  2OQ7 A;  1QJU 2;  2VU9 A;  2AH2 A;  3N9N A;  4LA2 A;  4XF3 A;  4I09 A;  2E7T A;  5AC9 2;  1W8H A;  5C6C A;  4NAO A;  1AX0 A;  2YY1 A;  3HQU A;  3AP9 A;  4FOY A;  3EQE A;  2P2K A;  4RYD A;  1M06 G;  1LAJ A;  4N7I A;  4QX0 A;  4CUC A;  1VMJ A;  4TSV A;  4CP9 A;  2W52 A;  4DOU A;  4J6G A;  1WMF A;  1H4H A;  4LK6 A;  4OLL A;  2Z42 A;  1AR9 1;  2ZKL A;  4NN0 A;  3C7H A;  4WM8 A;  3VBU A;  4DXT A;  4YW6 A;  3ACF A;  1R08 3;  1XNT A;  5LA2 A;  1W2O A;  2ET7 A;  4RQP B;  2QTW B;  1JYT A;  3J8F 3;  3V0B B;  3OB8 A;  1PVC 1;  1QWR A;  3Q8A A;  5JMO A;  1GAN A;  4CP0 A;  3AP7 A;  1DQ2 A;  2UUR A;  3OGS A;  4H7L A;  2XJR A;  4D8M A;  5C5U A;  3D8C A;  3MHZ A;  4P9I A;  3R05 A;  4WVZ A;  1AR7 1;  3I49 A;  3BTY A;  1QNW A;  3C8X A;  4JTO A;  1BJQ A;  1AR6 1;  1EAH 1;  1WCS A;  3PTY A;  2NQY A;  3VD5 A;  1W9T A;  2ZKN A;  1H9P A;  4JGZ B;  3WIN E;  5FZ1 A;  5LEJ A;  2C6S A;  2VZ3 A;  1ND2 C;  3J8F 2;  3VZN A;  3BPS A;  1XU2 A;  5HV0 A;  1NOV A;  2Q5T A;  5FKB A;  3KQ4 B;  4ES8 A;  3AZY A;  5A80 A;  4Y1V A;  5JR2 A;  1X9T A;  2WNO A;  1PX3 A;  2XJQ A;  2RS1 3;  2HH9 A;  1ZZ6 A;  3NO8 A;  3MGU A;  2XLG A;  2HWC 3;  4HL0 A;  5E6H A;  1V70 A;  2W1Q A;  2JG8 B;  1IS4 A;  1OH3 A;  3J7M A;  5DUX A;  3WUD A;  2LS6 A;  3KF3 A;  3KVB A;  1TEI A;  3UKT A;  3DXT A;  4CXX A;  2CU5 A;  1XNB A;  3W20 A;  1A8D A;  2D3S A;  3MO4 A;  4CYD A;  2RJK A;  1UZW A;  4QB1 A;  4HT1 T;  2GNB A;  3OGR A;  3GJA A;  4LXL A;  2VZR A;  3PUH A;  5LCW L;  4LBL A;  5C3O A;  2WDB A;  4Y1Z A;  2ZAA A;  3PUS A;  2BBV A;  3U37 A;  4FPJ A;  2EIE A;  1W6O B;  3TN9 2;  1GZC A;  3D4K A;  4FXG B;  3N7L A;  4BLI A;  1LU1 A;  3H8O A;  4GKY A;  4B1M A;  4A41 A;  5T54 A;  4TZD A;  3NJX A;  3LFI A;  2A71 A;  1UYX A;  4QPG C;  3JQW A;  3VBO A;  4BQ5 A;  1IHM A;  5F37 A;  3VBO B;  3S0M A;  5ISL A;  4XET A;  2P6C A;  1I6X A;  3A23 A;  5LRS A;  1QQP 1;  1AL2 1;  4LA3 A;  4E9K A;  4CCO A;  4KMQ A;  1QOO A;  2CNA A;  4AWD A;  2IZW A;  1Y7B A;  5FYU A;  3KHB A;  5FMC A;  1VBD 2;  3V56 A;  3GDB A;  1VAL A;  2DCY A;  1PZ7 A;  4BYY A;  4CUB A;  4Q8K A;  1ZRF A;  1CAW B;  3BYW A;  4LQR A;  5DMY A;  1H8T B;  3BOD A;  4CXY A;  3FFQ A;  3GZT B;  1FOD 1;  1WBF A;  3EMR A;  3TYJ A;  1UU4 A;  1W06 A;  4W50 A;  1VP6 A;  4XAE A;  5FZ8 A;  2ID4 A;  2WA4 A;  1X8M A;  4IER A;  3UKN A;  2X5I B;  2EVX A;  1UYZ A;  4XIK A;  1CPN A;  2HJI A;  1RUF 3;  2QBX A;  1AXZ A;  2WLQ A;  1MEC 3;  4QWN A;  2J22 A;  4IE5 A;  4CDW A;  5L7O B;  3HNB M;  3POF A;  4XJW A;  1O3S A;  4QQL A;  5AC9 1;  1W8N A;  2D7F A;  3VHO A;  3W5M A;  3DKW A;  4RHV 1;  3IDA A;  4EN8 B;  5LBC A;  1IOA A;  2PA7 A;  2Y33 A;  3B5L B;  4Q4X 2;  3WQB A;  1YNA A;  1ENX A;  2RJL A;  3LIG A;  3NL1 A;  3O14 A;  4R4Z A;  3SEE A;  1O3Q A;  1MVQ A;  1BMV 2;  1BBT 1;  1SMV A;  1W8W A;  4GMP 3;  3RZH A;  3HAG A;  3EYP A;  2ARB A;  3POE A;  5FO8 B;  3AVS A;  4BJ0 A;  4LLO A;  4YW5 A;  3LD8 A;  1OQD A;  3AVR A;  2Y26 A;  4K21 A;  3HJR A;  2W87 A;  4CTE A;  3Q9O A;  3FLT A;  3VZM A;  3AMN A;  4XJU A;  2DU0 A;  2IC1 A;  3KT1 A;  4XEZ A;  3GCW A;  3T1L A;  5D2A A;  5GLV A;  5CG9 A;  4D69 A;  2BER A;  4N53 C;  3ZR6 A;  4AI3 A;  2H6C A;  1D4M 1;  2WA3 A;  3AXD A;  4UF0 A;  5JWP A;  4RS5 B;  4Y4Y A;  1YQ8 A;  1RHI 2;  5FUI A;  3T2Q A;  3AYD A;  2E32 A;  2ILM A;  4WM8 B;  1UZY A;  1W6P A;  1PNG A;  3H3Z A;  4MYE A;  1ALY A;  1WMX A;  2W95 A;  3AMQ A;  5DAB A;  1VBC 2;  2MPF A;  3LDR A;  4DNY A;  4Z2A A;  2WO1 A;  3I54 A;  2GN3 A;  1UZZ A;  4PCR A;  3BUC A;  3H0O A;  1OHF A;  3VGI A;  1XE7 A;  1UX7 A;  2R1D A;  1PIV 2;  1WCK A;  1FOD 2;  1Y43 B;  2ZAB A;  5JLV A;  4PQ9 A;  4M4P A;  3WG1 A;  2BGC A;  5ACA 2;  5T50 A;  4P08 A;  4PDW B;  1GOG A;  5FPZ A;  4TTG A;  5E8A A;  1CAX B;  4WM8 C;  2IFW A;  2IXK A;  2WZR 1;  1VAK A;  4RD7 A;  3U78 A;  5KXE A;  4NHL A;  5EIY B;  4QDR A;  4Z92 B;  4Q0Q A;  4NIA A;  3N4M A;  4M3C E;  4YVS B;  1J83 A;  1XYO A;  2W1U A;  4IV3 B;  4IEP A;  4CRQ A;  4FPC A;  2P4E A;  2E53 A;  4LKD A;  4BQ2 A;  5JOZ A;  3SEP A;  4AHX A;  4J1X A;  2VOT A;  5FY0 A;  3HNM A;  1C8M 3;  3GBW A;  5FZI A;  3QH6 A;  1ST8 A;  4MH0 E;  1HRI 1;  1WBL A;  1YCI A;  3PIJ A;  4KG0 A;  2BEO A;  2ZPX A;  2QQK A;  4QPI C;  4DS0 A;  3LEG A;  5F32 A;  5JPM B;  1DFQ A;  1VRB A;  1HRI 2;  4L92 A;  4GAL A;  3P3P A;  4SBV A;  1ZZ9 A;  2JEC A;  2VOV A;  2BZD A;  3UES A;  4HG6 B;  4DMI A;  1SPP A;  2X09 A;  1B35 A;  3HIF A;  4LLF A;  5JXG A;  5JUV A;  3I3B A;  1LOF A;  1XU1 A;  4Y22 A;  2ADE A;  3AKQ A;  2ZX4 A;  3LEM A;  3TAY A;  2PMW B;  1QJY 3;  5FO7 B;  4FAG A;  1YYN A;  1AYN 2;  5G04 L;  2XR4 A;  2R1B A;  4OQ9 A;  1IKP A;  1GKB A;  1I1E A;  5F9T A;  2J1S A;  2YPJ A;  3WW4 A;  2WT2 A;  1NG0 A;  4NE9 A;  1YHF A;  5J09 A;  4XZP A;  3H7Y A;  1O4Y A;  3LWC A;  1CIW A;  3M3C A;  5HV4 A;  3BN6 A;  1G86 A;  2V72 A;  4YVS A;  5CKM A;  4OHZ A;  2W92 A;  4GH4 C;  1EPZ A;  1GZ9 A;  5JSP A;  4IEQ A;  4LHK A;  2W08 A;  1W90 A;  1A6C A;  2MHF A;  2PAE A;  3AL5 A;  1CAX A;  4XUN A;  1X50 A;  3CO2 A;  2VMD A;  3ZLI A;  3BIE A;  3T4V A;  1FPN 2;  2H0V A;  1PO2 2;  3GM8 A;  4UF0 B;  2FCT A;  2P3J A;  2XVK A;  4LHN A;  1DP0 A;  1GR3 A;  1ZBA 2;  3FBY A;  2VMC A;  4WVW A;  1AR7 2;  4Q27 A;  3OGG A;  4D6S A;  1OF3 A;  5A7W A;  4CDQ A;  2CDO A;  4LO7 A;  4ASM B;  1GP6 A;  2X8K A;  3SH5 A;  4BPZ A;  1HXS 3;  2D6P A;  3RFR A;  4QB2 A;  1ZX5 A;  3AJY A;  1QJE A;  1QJY 1;  1POV 0;  4XHX A;  3I2H A;  3HD8 B;  1VMH A;  4Y1Y A;  1LES A;  1N3P A;  3VDD A;  3AMM A;  5BUV A;  4MGI E;  2GND A;  2DUQ A;  2WC2 A;  3H3U A;  3MW3 A;  4E2S A;  3MV1 1;  3SC7 X;  5GZG A;  1WZX A;  3S6P A;  1VBB 2;  2QQU A;  4C1X A;  1V6O A;  4GKX A;  1HN1 A;  4X8N A;  3TOJ A;  2VMG A;  4CDU A;  2W2I A;  3EO6 A;  2C9K A;  2IXH A;  4Q4W 2;  3SKV A;  2AEY A;  1A3K A;  5I0R A;  1NCR C;  3HN3 A;  5FZB A;  5FZA A;  5FY1 A;  1V9U 3;  5C70 A;  1OQE A;  3JD7 1;  4CSW A;  1MAC A;  1WLT A;  2QKD A;  2JD4 A;  2Y38 A;  2Y8K A;  4JHT A;  4K1Y A;  4AFD A;  3O1T A;  3WNO A;  1HX6 A;  2J7M A;  1JU4 A;  3I4I A;  4M00 A;  5FZ6 A;  4A4A A;  2CWM A;  4PLO A;  2B45 X;  2QCS B;  4O65 A;  4W65 A;  4LT5 A;  3HNY M;  4CCL A;  3UET A;  5FPL A;  3PIG A;  2VZS A;  3UV9 A;  4AQT A;  4OYU A;  1PZ8 A;  2R04 3;  3LAG A;  3KMH A;  1H30 A;  4BQ1 A;  5IFP A;  4ERO A;  1W2U A;  1XND A;  4R8H A;  5F7U A;  2VXR A;  2VZO A;  2ZGN A;  1IPK A;  1R08 1;  4XHB A;  2WZR 2;  1I5P A;  1JZ4 A;  3CIH A;  4XW3 A;  1AR9 3;  2ZA9 A;  1H9W A;  3APB A;  1JZ6 A;  1A34 A;  2XL7 A;  1E5S A;  3LKJ A;  1SZB A;  4QX3 A;  4I2O A;  4MGS A;  1ZBA 1;  4DUV A;  1UIJ A;  2UYA A;  2WR9 A;  4BB3 A;  2ZZQ A;  5LZ6 A;  1ZRE A;  5DUU A;  4COW A;  5KBF A;  1W2N A;  4QXC A;  2YBS A;  5C9A B;  2YGM A;  4OCT A;  3VBF B;  1XRU A;  4JCK A;  2WN2 A;  3RZL A;  3N9M A;  2JIG A;  5LWB A;  1D4M 3;  4IEW A;  4OHW A;  1UNB A;  4FO9 A;  4LNV A;  1XSR A;  5A7O A;  2DWR A;  3FL7 A;  4OZO A;  1DZT A;  4AI8 A;  1VB2 A;  4FFH A;  2VNO A;  3RYR A;  1SEF A;  4A44 A;  1KDM A;  3JQX A;  1UY3 A;  3OPZ A;  5FP7 A;  5I8T A;  4DPN A;  2WWU A;  1C1L A;  1JZ5 A;  2SLI A;  4Y20 A;  5F3E A;  3VKO A;  4BQW A;  4N9I A;  4BK5 A;  1AYN 1;  3WNK A;  4MLO A;  1QXJ A;  5BXX A;  1MS0 A;  2PEL A;  2VCA A;  5JIU A;  2PN5 A;  2XJT A;  3SMH A;  1P8J A;  4XC9 A;  4BIO A;  1J3R A;  2Y64 A;  3CBN A;  3MID A;  2E63 A;  3T2T A;  1F31 A;  2Y60 A;  1KD7 A;  1MZE A;  1BYH A;  4K8F A;  1DGW A;  2EIG A;  1SAC A;  3III A;  2A3W A;  3A4U A;  1MEC 1;  1MZ5 A;  2RDQ A;  4HKO A;  3ROU A;  2B9V A;  4JKM A;  2FBE A;  2JEM A;  2QVS B;  4Y20 B;  4I01 A;  1J3P A;  1YXW A;  1CD3 G;  2JB8 A;  3KVA A;  4GWM A;  4IV1 B;  3SKJ E;  1VBB 3;  2VAU A;  1UPS A;  2JDU A;  2WNU C;  5C8C C;  4E2G A;  4LUL A;  1PO1 1;  4YW2 A;  2LUW A;  2WBK A;  4FSJ A;  2JDA A;  4EN6 B;  2W46 A;  2IXI A;  3LPF A;  3MIB A;  1XE8 A;  3N35 A;  3WNX A;  2DV9 A;  3U75 A;  5CFC C;  3I2O A;  3S7E A;  2Y0O A;  1NXM A;  2W5F A;  5CG8 A;  3WUC A;  3RJ2 X;  2X10 A;  4P14 A;  2VOX A;  5L19 A;  1YO8 A;  2OZ6 A;  3PUA A;  4CP1 A;  1R1A 2;  1L7R A;  4AHY A;  1A78 A;  4XUQ A;  4PJY A;  1MQT B;  3GNE A;  3O1U A;  4KU8 A;  3OUJ A;  1AJK A;  2GU9 A;  1E57 A;  2IUW A;  2HWB 3;  2JKX A;  2RJ2 A;  4YW3 A;  3S5A A;  1UY0 A;  2HKX A;  3PU3 A;  4OI2 A;  1JZ3 A;  4XBL A;  5A3O A;  1LOB A;  2BVB A;  5T5O A;  2VM9 A;  3K4Z A;  1JYI A;  3D82 A;  2VUJ A;  2D3P A;  1PM4 A;  3E1F 1;  4UW3 A;  1SG3 A;  3WDW A;  2QZ2 A;  1D7P M;  3DPR B;  4QX1 A;  1UY2 A;  4WV8 A;  5K8S A;  3T0B A;  1LGN A;  3GBF A;  4BME A;  1VE0 A;  2Q1F A;  2R0F A;  3MI8 A;  4AED A;  1TNR A;  1D2Q A;  5JZG C;  1OD3 A;  1HDK A;  1PIV 1;  3G6J B;  3ACL A;  1CGP A;  3K46 A;  1W3V A;  1TME 1;  1RVF 1;  1DYK A;  4EZH A;  2BPA 2;  3C7F A;  4GH4 A;  2BV4 A;  3AXE A;  1OUX A;  1SLB A;  4ET7 A;  1OD5 A;  4EN9 B;  4MGK E;  3V65 A;  1ZVF A;  2VME A;  1L3J A;  4LOT A;  1COV 1;  5CKN A;  1K42 A;  4FI9 A;  3T3Y A;  4NVP A;  4OVE A;  1HQN A;  5T55 A;  5FYC A;  1HKD A;  3TEZ A;  2Z2S B;  3UK9 A;  1RHI 3;  5M0T A;  3K4A A;  3AZZ A;  3ZFE C;  3FHI B;  2WUH A;  4M4R A;  4YRD A;  4PBO A;  4FP2 A;  2FDI A;  3AB0 A;  2G19 A;  2BNO A;  2A7A A;  4AI2 A;  1JZ7 A;  3ZSK A;  1W6M A;  1JMU B;  1RB8 G;  4HET A;  3NV3 A;  3S7I A;  3LDK A;  4N9H A;  5DDJ 2;  2XBO 1;  5FP9 A;  2CWS A;  5C4W C;  5I8Y A;  5L36 A;  4A6O A;  1BQP A;  3A7Q A;  3K4D A;  4HXC A;  2YC2 A;  4OI1 A;  1AR7 3;  5FZD A;  5FK7 A;  3ZYB A;  4DIN B;  2JDY A;  5FZO B;  4CCC A;  3AP6 A;  1S2E A;  2R49 A;  4WVV A;  2DVB A;  1GNH A;  1TZO A;  2MNG A;  1D0G A;  4YVW B;  5FP3 A;  1ZZB A;  1ULD A;  3ZFE A;  4HPK A;  2Y6L A;  3HWJ A;  2FCV A;  4YGD A;  5A6Y A;  2A5Z A;  3A22 A;  3AP5 A;  3ETQ A;  3R4S A;  3WEZ A;  4RN5 A;  4XUP A;  5A70 A;  4LE4 A;  5J3U A;  2EF6 A;  2I45 A;  2GSY A;  3OBZ A;  4JQT A;  1J1L A;  4KWK A;  4XJ8 A;  4CEW A;  1CAU A;  1DLC A;  1WLW A;  2CHH A;  5CBL A;  4NRO A;  5FY4 A;  1ND3 B;  4ZY9 A;  4YSF A;  3WY6 A;  5A3N A;  4Y33 A;  3SHR A;  1G7Y A;  3FHA A;  3Q8F A;  5FK8 A;  5T5L A;  4LE3 A;  1AYN 3;  1J3Q A;  1PGS A;  2R04 1;  1LHN A;  5A33 B;  2VQA A;  2XGX A;  1DYO A;  1ULF A;  4W6Y A;  3J9S A;  5JI7 A;  3M8L A;  1BKZ A;  1LGB A;  3TN9 1;  2A70 A;  3AJZ A;  3FC0 A;  4AGR A;  3VBR B;  2P37 A;  3B94 A;  2YZ4 A;  1RUE 3;  1HN0 A;  2VEC A;  2XOM A;  2DUO A;  3PME A;  1BVP 1;  1GSL A;  1S0E A;  1H2K A;  2Q1Z B;  4QT6 A;  3ILN A;  2XVG A;  5F3G A;  3VZK A;  1E5I A;  2PHU A;  3ZVX A;  3KF5 A;  4QX5 A;  1DQ6 A;  1R1Z A;  4TYS A;  3OD0 A;  3ALQ A;  3URF A;  4LR4 A;  1RL3 A;  1XQN A;  4CA9 A;  3WNM A;  4BIS A;  2ZMN A;  3NAP C;  3IDB B;  3M2M A;  2X5I C;  5FMD A;  1TVG A;  1S0J A;  2PLV 3;  5IHR A;  5F39 A;  5H9R A;  3U07 A;  1GFF 2;  1XBF A;  4LMF A;  3PVO A;  4QMA A;  5KHH A;  5BNO C;  1YIP A;  4QB6 A;  5I91 A;  1LHW A;  4KU7 A;  2JDZ A;  4CU9 A;  2R16 A;  3KGZ A;  1JU3 A;  1W0O A;  1JZ8 A;  1KS5 A;  4BWO A;  2D40 A;  4UW4 A;  1RJ8 A;  1UD1 A;  4AEM A;  1AYM 3;  4YM1 A;  4BH9 A;  2XLF A;  2AUY A;  1AXY A;  1HQW A;  3H7J A;  4XXA A;  2WS9 1;  3LGR A;  1W8F A;  4OZX A;  2GNT A;  3HN1 A;  4AW7 A;  2VNR A;  4URA A;  5LAS A;  1YWK A;  5CIS A;  1AR8 2;  1H1A A;  4LIT A;  5LK5 A;  4QQO A;  1SFN A;  3OPW A;  4IEV A;  2D98 A;  3POG A;  1S55 A;  1JZ2 A;  2AZ5 A;  4UW5 A;  2LRO A;  1AR8 1;  1DZR A;  1ZZC A;  2HWC 1;  2AGS A;  2YU1 A;  2VC9 A;  1V9U 1;  5AC9 3;  3WG4 A;  1F35 A;  2JXA A;  2K0G A;  3NKT A;  3AC0 A;  4QQP A;  4ONU A;  3ZSJ A;  2WN3 A;  2YC4 A;  3WHT A;  1H2N A;  4ZZ8 A;  5C8C A;  5A1L A;  5CFC A;  3MW2 A;  4EN7 B;  2F6B A;  1H6Y A;  1KFU L;  1F4A A;  1BCX A;  1XC6 A;  4W4Z A;  1PZ9 A;  3CJI A;  2DVG A;  4GMP 0;  4IND A;  5LB6 A;  2VZ1 A;  1OUR A;  2VBP A;  1W8U A;  2UYB A;  4XIL A;  1PK6 A;  3MLJ A;  5C3R A;  4QQ2 A;  4Q4V 1;  1XXN A;  1DG6 A;  2VW2 A;  2YYO A;  1U5I A;  2XWB B;  5EZW A;  4DXR A;  3R0R A;  4UYB A;  1W39 A;  4Q4Y 3;  4MG2 A;  3HMY A;  3JZV A;  3I2K A;  1JN2 P;  4KL1 A;  1V6M A;  1UOB A;  2LAL A;  2ZGO A;  4Y4R A;  2ZAH A;  3VZL A;  1IZ3 A;  5E88 A;  2E6V A;  5KHK A;  1WME A;  1NCQ A;  4LUK A;  4QPW A;  1WD4 A;  1RUD 2;  3M3O A;  3T4H B;  4E4H A;  4UFM A;  5B2G B;  1YI9 A;  1RHI 1;  4AI9 A;  5F3C A;  3M3Q A;  4P9L A;  3GGL A;  1OSG A;  4AE2 A;  1OF4 A;  3H8R A;  3H3L A;  2YFU A;  4IV3 C;  4Y26 A;  4YG3 A;  5FLH A;  1COV 3;  1W9F A;  5A3L A;  4CDW B;  3OSD A;  4ITC A;  2ZGR A;  4Z8B A;  3RRD A;  1L7Q A;  4N43 C;  1ENQ A;  2YMZ A;  2IVI B;  1SHW B;  2D5F A;  1QGL A;  3MV0 1;  4XQ4 A;  4NIG A;  2DCZ A;  4OHV A;  2VVD A;  3TNP B;  3JB8 A;  3VHR A;  3ZSM A;  4LO5 B;  1HRV 2;  1KFX L;  3BOP A;  1AYM 1;  2VW0 A;  2E33 A;  4AEK A;  4E8D A;  3KSC A;  3CNA A;  5H9P A;  1GQG A;  2ZGM A;  1CZV A;  1FV2 A;  1HV1 A;  2VG9 A;  2VTX A;  5C5T A;  3FWE A;  4FTE A;  2Q1M A;  5DZF A;  2OS2 A;  2PYT A;  1UY1 A;  2DBN A;  2DTW A;  5L9B A;  3I3Q A;  4PIY A;  2Q8D A;  4AZZ A;  4ZS3 A;  1HJF A;  3Q8C A;  3CMG A;  4URT A;  1RUJ 1;  3RI8 A;  2BTV C;  1MS9 A;  5ABJ C;  1VAM A;  5BNP A;  3BVC A;  4YZ3 A;  1O4Z A;  2VL4 A;  3ZIW A;  2RS5 1;  4M3C A;  1US3 A;  1VB4 A;  2XG3 A;  3E6B A;  1ZBA 3;  4D7Y A;  3WXP A;  5C4W A;  4FFI A;  2JG8 C;  5BNQ A;  5A6Z A;  4KNC A;  4BE3 A;  1AUY A;  3WF1 A;  1MS1 A;  5FZK A;  1JYC A;  2XL9 A;  2XQX A;  5IK5 A;  3ZM8 A;  1GZW A;  5JI9 A;  2OYZ A;  1ZNP A;  4AVC A;  4DY5 A;  5B4N A;  2YUE A;  3LE0 A;  4A3Z A;  4AAX A;  3U14 A;  5L9V A;  1UX6 A;  5FMO S;  1NE4 A;  3C2U A;  1CZT A;  1VBE 3;  1PO2 1;  2ZHL A;  2CGO A;  2FDK A;  3LDB A;  4GB3 2;  2IXJ A;  1DQ0 A;  1OVP A;  2B8M A;  1NXD 1;  2XKP A;  3WCR A;  1QJU 3;  2H6B A;  3IB3 A;  5C8W A;  5JSO A;  1BBT 3;  3NV1 A;  5BNP C;  4CVU A;  1N1S A;  2P3K A;  5CAD A;  2RHP A;  3FUO A;  3WOG A;  1KXG A;  1WWY A;  4L99 A;  2D5H A;  3VB9 A;  5IK8 A;  1XJA A;  4UBG A;  1QJY 2;  4UOJ A;  4K8R B;  4XF4 A;  3ZX7 A;  2O14 A;  4CCD A;  3WDV A;  4XFF A;  3ZXL A;  5FXV A;  2EXK A;  5F6K A;  4CU6 A;  4P9Y A;  2OT7 A;  3KHC A;  4BZ4 A;  4D3W A;  3J7N A;  2JDH A;  3WG2 A;  3KT7 A;  1RED A;  2E7A A;  2VD7 A;  3KB5 A;  2OUJ A;  3POS A;  2VTX J;  2ZGS A;  5FRE A;  1Q43 A;  4EJR A;  3HQX A;  1MZF A;  3UGF A;  5FR3 A;  1YJL A;  2WYF A;  3C7E A;  4M0N A;  3KQR A;  4GJY A;  4OUM A;  4ZXE A;  2XJV A;  5JOW A;  2CY6 A;  5IWF A;  1QEX A;  1ZRD A;  1LGC A;  1KDK A;  2SBA A;  3KCX A;  1LEC A;  3IMM A;  2RS3 1;  4QKF A;  2WIN B;  1ND3 C;  4DRV A;  1IPJ A;  5D21 A;  4E2Q A;  5IAX A;  1T2X A;  4Z82 A;  1BXH A;  3DGT A;  1JYW A;  3ES4 A;  3H1Y A;  4GMP 1;  5FZH A;  3G7D A;  2RMU 1;  1YFY A;  3ZFG C;  3KCC A;  4V2W A;  2ADD A;  2JX9 A;  3HT1 A;  3VL9 A;  3L9J T;  3DYP A;  4HVO A;  4OUL A;  3S57 A;  1OI6 A;  2YDE A;  4Y1X A;  1FV3 A;  4HKW A;  2PHX A;  3VBR C;  3IDC B;  5KHI A;  1GIC A;  4Y5T A;  4N7U A;  1J84 A;  2ZEW A;  3M70 A;  1ZBE 2;  5CKQ A;  3T1M A;  1SLA A;  4QM8 A;  1SFP A;  1FMD 2;  1AJO A;  4XCB A; 
#chains in the Genus database with same CATH homology
 1DP0 A;  2VO5 A;  2VQT A;  2HYX A;  1O8P A;  2VMC A;  1IQD C;  2WAO A;  1W99 A;  1OF3 A;  4TXW A;  1UY4 A;  2CDO A;  3D3A A;  4LHS A;  1JYV A;  4CU8 A;  4GWJ A;  3T0D A;  3GXU A;  4UI9 L;  4QB2 A;  5DN2 A;  3I2H A;  2XHN A;  3WF3 A;  2XON A;  1XNA A;  3MV1 1;  3WF2 A;  5G05 L;  3ABZ A;  4PQQ A;  1W8O A;  2C4X A;  1HN1 A;  2C9K A;  5J1X A;  3SKV A;  4DXS A;  3HN3 A;  4L0P A;  2ZEX A;  1ULP A;  5C70 A;  5JXI A;  2Y8K A;  3OGV A;  1CX1 A;  3WNO A;  2J7M A;  1K45 A;  1JU4 A;  4A4A A;  2BBA A;  4CUA A;  4OMC A;  2Y6H A;  3T08 A;  3HNY M;  3MUZ 1;  3UET A;  4DEQ A;  2VZS A;  4OYU A;  1CIY A;  3CZU A;  3P6B A;  5IFP A;  3ACG A;  4IUG A;  5F7U A;  3MUY 1;  2VZO A;  1I5P A;  4PT6 A;  1JZ4 A;  2QQJ A;  3CIH A;  4PF1 A;  1JHJ A;  5DPN A;  1JZ6 A;  4XUR A;  5I0D A;  4QX3 A;  4MGS A;  4JKK A;  5CZK A;  4DUV A;  2YFZ A;  3MBW A;  1H6X A;  2WN2 A;  5HPO A;  2JD9 A;  4DUW A;  2ZXQ A;  3FL7 A;  4MAD A;  1UYY A;  4OZO A;  1GNY A;  4A44 A;  1W0N A;  2W47 A;  3WNN A;  1EUT A;  1UY3 A;  2JE8 A;  3PUI A;  2L9L A;  1JZ5 A;  3I2I A;  4BK5 A;  3WNK A;  3I2F A;  2VCA A;  1OH4 A;  1P8J A;  2J1R A;  2LW8 A;  4MOA A;  5EJZ B;  2Y64 A;  1F4H A;  2WZ8 A;  2V5D A;  2ORZ A;  2V4V A;  5CYY A;  2VZP A;  2ZEZ A;  3III A;  2B9V A;  4JKM A;  3T2O A;  3DYO A;  3ETP A;  3SKJ E;  2DCJ A;  2YB7 A;  2KD7 A;  3I2J A;  2VZQ A;  1US2 A;  4QDS A;  2WBK A;  4LPL A;  2JDA A;  2W46 A;  3LPF A;  2EIC A;  3NQH A;  2WQ8 A;  2B4K A;  2W5F A;  4ARX A;  2Z4F A;  2X10 A;  2W91 A;  2EIB A;  4ARY A;  4JX0 A;  1L7R A;  5LA0 A;  4XUQ A;  1PMH X;  2VTF A;  4MO3 M;  2JKX A;  2RJ2 A;  1UY0 A;  1JZ3 A;  1TG7 A;  2W9X A;  2VM9 A;  3K4Z A;  3P1I A;  5LA1 A;  5DQ0 A;  3E1F 1;  1SG3 A;  1D7P M;  3C7G A;  4QX1 A;  1UY2 A;  3T0B A;  2QQL A;  1NKG A;  2X05 A;  1GQP A;  1OD3 A;  3LEI A;  2Y6K A;  2WAA A;  1BHG A;  3K46 A;  4QX2 A;  2J1E A;  3HEI A;  4BDV B;  3FHQ A;  3LEK A;  3C7F A;  2J1A A;  2E31 A;  4ET7 A;  1JI6 A;  2VME A;  1K42 A;  2VCB A;  4FI9 A;  4JHZ A;  3OEB A;  4CU7 A;  2DCK A;  2QQM A;  3K4A A;  2WUH A;  4M4R A;  1O8S A;  2WO3 A;  1JZ7 A;  3WF0 A;  4JKL A;  2R7E B;  3T0A A;  2BGO A;  4P02 B;  3HOB A;  4E8C A;  1XPW A;  3WNL A;  4A6O A;  3A7Q A;  1PMJ X;  3K4D A;  2YC2 A;  4P00 B;  3VD7 A;  3BGA A;  2VCC A;  4OMD A;  4BK4 A;  3I2G A;  1R64 A;  3LPG A;  2PQS A;  3HPN A;  4DEV A;  5C71 A;  2Y6L A;  3I3E A;  4RYD A;  3A22 A;  4QX0 A;  4CUC A;  3WEZ A;  4RN5 A;  4XUP A;  4XUO A;  4MGQ A;  5JXH A;  1NX9 A;  3DEC A;  2WAB A;  3C7H A;  4DXT A;  1DLC A;  3ACF A;  1XNT A;  5LA2 A;  3THD A;  4ZY9 A;  1KEX A;  3OB8 A;  3FHA A;  5JMO A;  1GOH A;  3LQC A;  3K75 B;  3OGS A;  4ZZ5 A;  1DYO A;  4D8M A;  5IYY A;  1GUI A;  2WYS A;  2XOM A;  3C8X A;  3VD5 A;  3DYM A;  1W9T A;  4GWI A;  2VZ3 A;  3ACI A;  3T2P A;  1K3I A;  2Y6J A;  3VD3 A;  3FN9 A;  5JXJ A;  4P5Y A;  3OEA A;  1KGY A;  1UMI A;  3WNM A;  1UMH A;  5JR2 A;  1PX3 A;  1TVG A;  3WF4 A;  1UZ0 A;  5IHR A;  2ZEY A;  1YQ2 A;  4QB6 A;  1GU3 A;  2W1Q A;  4CU9 A;  3CQO A;  1JU3 A;  1JZ8 A;  3UNP A;  3VDA A;  2LS6 A;  1JYN A;  2VR4 A;  4XVH A;  3MO4 A;  3I3D A;  2EID A;  4QB1 A;  3OGR A;  2VZR A;  3PUH A;  5LCW L;  2WDB A;  2Y6G A;  1O59 A;  1RYY A;  3U37 A;  2J1U A;  4LKS A;  2EIE A;  1JZ2 A;  2CDP A;  5A1A A;  4A41 A;  2VC9 A;  3C7O A;  3NJX A;  3EB7 A;  1K12 A;  3IAP A;  1UYX A;  3AC0 A;  1SDD B;  2WN3 A;  2YC4 A;  2VJX A;  4ZZ8 A;  5B4X A;  2W1W A;  3A23 A;  1H6Y A;  2VZV A;  4KMQ A;  1F4A A;  1XC6 A;  4W4Z A;  1JYX A;  2VZ1 A;  2WO2 A;  3GDB A;  4CUB A;  4XZU G;  5DMY A;  4LQR A;  4DXR A;  2W3J A;  3I2K A;  2VZT A;  4W50 A;  1WKY A;  2ID4 A;  2BGP A;  3NRU A;  1UYZ A;  3K77 A;  2VQU A;  2QBX A;  4XUT A;  4QPW A;  2J22 A;  1MPX A;  3CDZ B;  3HNB M;  1W9W A;  3GGL A;  1W8N A;  3W5M A;  1OF4 A;  3IDA A;  2YFU A;  4KI5 M;  2W94 A;  2RV9 A;  3WQB A;  4W8J A;  4DUX A;  4A42 A;  1L7Q A;  3SEE A;  1SHW B;  3MV0 1;  3OBA A;  3EYP A;  3A21 A;  4A45 A;  1UWW A;  4BJ0 A;  1UXX X;  2E33 A;  4E8D A;  1CZV A;  1EUU A;  2W87 A;  3HJR A;  1LNS A;  1UXZ A;  2C26 A;  1UY1 A;  3WNP A;  2WZE A;  2BER A;  3CMG A;  4KWU A;  4GZ9 A;  3VD9 A;  5FUI A;  3T2Q A;  1PX4 A;  2E32 A;  2VL4 A;  3THC A;  1US3 A;  2W95 A;  5IJR A;  5IFT A;  4Z2A A;  2WO1 A;  2J1T A;  3WF1 A;  2XQX A;  2YG0 A;  3ZM8 A;  1UX7 A;  5EJ1 B;  3NJV A;  5B4N A;  2J1V A;  3LE0 A;  4A3Z A;  4AAX A;  4BXS V;  2QQI A;  2W1S A;  4M4P A;  1CZT A;  2VZU A;  4P08 A;  1GOG A;  4TTG A;  4UAP A;  5EIY B;  4QDR A;  3VDC A;  2E26 A;  3IB3 A;  3JXS A;  2ORX A;  1J83 A;  4CVU A;  2W1U A;  3T09 A;  1OT5 A;  4QDQ A;  1W9S A;  3WSO A;  3SEP A;  2VOT A;  1CZS A;  3HNM A;  3CZJ A;  2VMF A;  2RVA A;  2QQN A;  4UOJ A;  3ECQ A;  2QQK A;  3ACH A;  3W5N A;  4CU6 A;  5HXM A;  3LEG A;  1NAE A;  4OUE A;  2BZD A;  1WCQ A;  1GMM A;  3UES A;  1ULO A;  4HG6 B;  2X09 A;  3I97 A;  5JXG A;  5JUV A;  3I3B A;  3C7E A;  3J7H A;  4D0Q A;  4ZXE A;  5G04 L;  5C7G A;  4YPJ A;  2DDU A;  1GOF A;  3NNG A;  1NUK A;  3VDB A;  3OG2 A;  2J1S A;  1T2X A;  1JYW A;  2HLE A;  3DYP A;  3BN6 A;  3IAQ A;  2V72 A;  2W92 A;  3VD4 A;  4AG4 A;  3CKH A;  4XUN A;  1J84 A;  2VMD A;  2ZEW A;  3F2Z A;  2OKX A;  3GM8 A;  4QAW A;  2QQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...