2W47A

Clostridium thermocellum cbm35 in complex with delta-4,5- anhydrogalacturonic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
135
structure length
135
Chain Sequence
b'ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSANAFQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 28
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w47A00
4MGQA 4OYUA 1UMIA 2CDPA 2J1EA 4YPJA 4OUEA 4A4AA 3T0DA 1O8SA 5FUIA 4CUBA 1CZVA 3CDZB 4TTGA 2V72A 3FHAA 3K4ZA 4QDSA 4W50A 3OEBA 2EIBA 2VZ1A 3MUY1 3C8XA 4ARYA 3A7QA 4CUAA 3WNPA 1H6XA 3C7OA 3W5MA 3GM8A 5C70A 2EIDA 3HOBA 4DXTA 3UNPA 2X05A 2VZTA 3T08A 4AG4A 4M4RA 2WN3A 2W1QA 2Y6HA 3I97A 2VZQA 1XNAA 3F2ZA 4A45A 2QQIA 1TG7A 3LE0A 5IFTA 3ACIA 1KGYA 3CMGA 3MV11 1JYNA 3CIHA 4ZZ8A 4BK5A 2V4VA 4XZUG 3SKJE 5JXIA 3PUIA 3VD9A 1GOFA 3OBAA 2J22A 5LA2A 1UMHA 2WDBA 1PX4A 2VZOA 2J7MA 4P08A 4CUCA 1CIYA 3LEGA 4A6OA 4A41A 4DEVA 4DEQA 2WUHA 3HN3A 2Y8KA 5G05L 2J1RA 4PQQA 2VZ3A 3BN6A 2JD9A 2VMFA 2ORZA 4XUTA 3CZJA 1UY0A 2HLEA 4CU9A 2DDUA 1US3A 4QDQA 4TXWA 1WKYA 3LEIA 2E32A 3OGVA 4ZZ5A 2W87A 2C9KA 3MV01 3MO4A 1GOGA 3I2JA 3HEIA 3WF0A 3IAQA 1WCQA 2BGPA 3WNKA 4E8DA 3P1IA 3CKHA 3I3EA 5DQ0A 3WF4A 5B4XA 2W3JA 5CYYA 3LPGA 4QB2A 2E26A 3WF3A 4W8JA 3HPNA 4KMQA 3FHQA 2V5DA 3WNLA 2QBXA 4BDVB 2VR4A 2VC9A 4UAPA 4PF1A 1UY1A 4ZXEA 3MUZ1 2YB7A 4BJ0A 1F4AA 4QX1A 1W9WA 2WZ8A 1GQPA 1EUTA 2Y64A 4UI9L 1R64A 2BBAA 3P6BA 2X10A 2QQKA 1W0NA 2W47A 3AC0A 2XONA 4OMDA 1UZ0A 4QB6A 2VMDA 3ETPA 2VL4A 4JX0A 1W9TA 2W95A 2B9VA 2W5FA 2B4KA 1XC6A 2BZDA 5JMOA 5JXJA 2EICA 4MOAA 1CX1A 3SEEA 1K12A 2DCKA 3DYOA 3WEZA 2WO2A 4LPLA 3VDBA 2XHNA 3JXSA 2YFZA 5IFPA 2J1TA 3WNOA 4LQRA 4QAWA 3GDBA 1BHGA 2J1UA 2W9XA 1UY2A 1JU3A 5IHRA 5JUVA 2QQNA 1DYOA 5EJ1B 1UX7A 4JKLA 2LW8A 3T09A 3A21A 1UYXA 4XUQA 3ECQA 3VDAA 1NX9A 1JYXA 1TVGA 4MO3M 2ORXA 3NJVA 3D3AA 3SKVA 2YG0A 3WF2A 3WNNA 3I2IA 3IIIA 3VD5A 4A42A 2WO3A 1JYVA 3T0BA 4OZOA 1OF4A 2ZEZA 4LHSA 3VD7A 5DMYA 1UWWA 3K4DA 1SHWB 2YFUA 4Z2AA 3MBWA 3K77A 1PMJX 5JXGA 3WF1A 4XUPA 3I3BA 2VO5A 1F4HA 1J84A 4CU6A 5LA0A 2WAAA 4A44A 3IB3A 3LQCA 1EUUA 3GXUA 4CU8A 1RYYA 4ARXA 3ACHA 3EYPA 1KEXA 2J1AA 3GGLA 2QQMA 3DYPA 4E8CA 2CDOA 2WBKA 4PT6A 4MADA 4D0QA 5JR2A 2E31A 2BERA 1XPWA 1O59A 2JDAA 3A22A 3UESA 5CZKA 4OMCA 1K3IA 1UXZA 2XOMA 2J1SA 4ET7A 5C7GA 2W94A 2VMEA 4GWJA 3T2OA 2VJXA 3IAPA 3OEAA 1ULPA 4CU7A 3CZUA 3I3DA 2ZXQA 3HNMA 4D8MA 3C7HA 5F7UA 1MPXA 2XQXA 1UYZA 1NAEA 3THCA 1LNSA 1J83A 1GU3A 1JU4A 1D7PM 4A3ZA 2E33A 4MGSA 3I2FA 1GNYA 4QPWA 4DUVA 1JZ7A 1NKGA 1JYWA 3SEPA 4RN5A 1UYYA 2VZSA 2C26A 2VMCA 5DN2A 3U37A 4JKKA 2QQLA 1UXXX 4DUWA 2QQJA 3ABZA 3T2PA 2BGOA 4XUNA 5DPNA 2PQSA 5A1AA 3T2QA 3DYMA 4QB1A 3WSOA 5JXHA 1I5PA 2VZUA 1JZ2A 3J7HA 1H6YA 2ZEXA 1OD3A 2WN2A 2Y6KA 4AAXA 2VTFA 3OGRA 4GZ9A 2RV9A 5IYYA 1OT5A 4P5YA 5B4NA 1SG3A 2VQUA 3VD4A 2W92A 2KD7A 3LEKA 5IJRA 2WYSA 3A23A 2J1VA 1PX3A 5J1XA 3ACGA 1CZTA 2VQTA 3C7EA 2W1UA 4XVHA 4DUXA 1PMHX 3BGAA 4JHZA 2RVAA 2WO1A 3NJXA 5LCWL 5LA1A 4GWIA 1JZ6A 3NRUA 1JHJA 2JE8A 1GOHA 3HNBM 2ZEYA 1DLCA 1W8NA 4KI5M 2VZPA 2YC2A 3K75B 1XNTA 1JZ4A 2W46A 1O8PA 2W91A 5HPOA 3I2HA 4QDRA 2Y6LA 3DECA 1YQ2A 1W8OA 3K4AA 3LPFA 2Z4FA 3FN9A 3OB8A 2Y6JA 3WNMA 4L0PA 4CVUA 2OKXA 5EIYB 1W9SA 2VM9A 1JI6A 3FL7A 4QX0A 5EJZB 1W99A 2EIEA 2L9LA 3I2GA 5I0DA 2ID4A 3ACFA 1L7RA 3VDCA 2DCJA 1IQDC 1CZSA 3C7GA 1JZ5A 4LKSA 4QX3A 3E1F1 3EB7A 3HJRA 2JKXA 2VZVA 1L7QA 4XUOA 3CQOA 3ZM8A 3NNGA 1SDDB 4JKMA 2X09A 4UOJA 1JZ3A 1GMMA 1NUKA 1UY3A 2R7EB 3IDAA 2C4XA 4P00B 4M4PA 4DXRA 3VD3A 3W5NA 2Y6GA 1K42A 3T0AA 1GUIA 2HYXA 1UY4A 3THDA 1P8JA 1T2XA 3PUHA 3NQHA 2QQOA 2RJ2A 3WQBA 4QX2A 3C7FA 3OGSA 1HN1A 2VOTA 1DP0A 1JZ8A 1K45A 1US2A 4W4ZA 1OF3A 2VCBA 3K46A 4BK4A 2WQ8A 2WAOA 2ZEWA 2WZEA 3UETA 2LS6A 5C71A 2WABA 2VZRA 4XURA 2W1SA 4ZY9A 3I2KA 4HG6B 2W1WA 4P02B 3OG2A 3HNYM 2VCCA 4FI9A 5HXMA 4IUGA 4RYDA 1ULOA 2YC4A 4BXSV 5G04L 4DXSA 1OH4A 2VCAA 4KWUA
chains in the Genus database with same CATH superfamily
2PXJA 4AZZA 1AUYA 3I3MA 3O5SA 2RDNA 3ZYRA 4Q26A 5T5LA 3WDYA 4A4AA 5LWBA 3J9SA 1ACCA 1HRV1 1RC6A 3HQRA 1CZVA 3IMNA 4LKFA 2V5YA 5T55A 1OURA 2JDZA 3GZAA 4C1XA 4TTGA 4FOQA 1REDA 1G7YA 2NMOA 2RS32 1LHWA 1BBT2 1O3QA 4QDSA 1N1SA 5K0UB 1ZX5A 4W50A 1RUF2 1E57A 2KXLA 1DU3D 1QWRA 4XIKA 3ZPOA 4JGZB 3E6BA 5FPAA 1MQTB 1W04A 4GJZA 4CUAA 5A6ZA 3WNPA 3DL3A 3FLTA 1LODA 3C7OA 3W5MA 1J3QA 4RS5B 5FPBA 3V65A 4E2GA 3HOBA 2X29A 4DXTA 1Q8SA 4AG4A 3T08A 4A7KA 5FZ9A 1C8M1 2RJKA 1GZWB 4M4RA 3KT1A 3ZFFA 3I97A 5E8AA 5HI0A 2JE7A 1YRZA 5J37A 2IXJA 3LE0A 4FSJA 4LUKA 1O4ZA 3LKJA 3ZLIA 1PGW1 4Y4RA 1KGYA 5FYIA 5JOWA 1F5FA 1JYNA 3JD72 5HCAA 1C5IA 2A7AA 3M2MA 4AHZA 4XXAA 4CPBA 1DYPA 4AFDA 2MPFA 2RS11 2BWAA 1HJFA 1BXHA 3H3LA 1ZZ9A 1RUE1 3N3HA 2J22A 5LA2A 4UXAA 4QPGA 4ASLA 4Q0PA 3KGLA 4FAHA 3PUAA 1CPNA 2PHUA 2ZJCA 4ATEA 1ZZ7A 1IS6A 1ZBE1 1PX4A 5D2AA 1B35B 3R6SA 2ADDA 2J7MA 3RI8A 3TN91 2X8KA 4LT5A 2JXAA 1F8VA 4Y1UA 1CIYA 5LA9A 1SLIA 5IK8A 4D69A 3VZMA 2FQPA 5F5CA 2J1RA 5G05L 1H30A 1W2AX 3IZOA 2NYYA 3NKGA 1WUVA 3WP3A 4H3WA 2JD9A 5FCCA 3B9CA 4K8RB 4KU8A 3CZJA 1LTEA 4I0BA 1PHMA 1YJLA 2VOXA 4IQPA 5FO7B 1UKRA 4OI0A 1XE7A 2GC2A 4CU9A 3SMHA 2B39A 3CEWA 2E9QA 4QDQA 4OZXA 4QKNA 3SCGA 4AVVA 2WZR2 5FZ0A 1WKYA 4CCKA 2QQWA 2HH9A 3O0VA 2X53S 4XILA 3ZIWA 1OKQA 3ITQA 1RUH2 5CKNA 2E32A 2Q1ZB 2ZA9A 3OGVA 4TZDA 3LIHA 1ND2A 2OZJA 4HT1T 4CP0A 3UGGA 2VQAA 1AYN3 1V6KA 3MHZA 1CD3G 1RHI1 4E9KA 3ASIA 3I7DA 1QEXA 3MO4A 5F3IA 5FAXA 3I2JA 2PLV3 3HEIA 3OY8A 4OHXA 4E4DX 4BQWA 1WCQA 2XJTA 3M3IA 1IKPA 3WNKA 3E6DA 4E8DA 3RS6A 3N4MA 1VBA3 3KSCA 4MLOA 4OUSA 2UWCA 2G1MA 4O9EA 1W8UA 3K3OA 5B4XA 3TEWA 2WT1A 3ZFGB 3RWNA 1ST8A 3DEMA 4ZS2A 4LO5B 1WBLA 1MR5A 4QPIB 4K9SA 4OCTA 5EWSA 4M0HA 4FFFA 4C90A 2BYVE 5AVAA 2ZZQA 4ES9A 4BISA 2KA3A 4CDWA 1N1TA 2YBSA 3FHQA 2V5DA 1I1EA 2R1DA 4OQ9A 2WWSA 2W0XA 4DINB 2OPWA 1LRHA 4P9WA 4CTEA 1W2UA 4HETA 1IG0A 2VC9A 1BVVA 2XL9A 4UAPA 4PHZA 4PF1A 1V9U2 4WM7B 4CZSA 5LZ6A 2BNOA 1Q8VA 5L9RA 4CCJA 3AFGA 4BJ0A 2JDKA 4AI1A 1F4AA 4XBNA 2FCUA 2FHRA 2WZ8A 4Z82A 1XOYA 1EUTA 2Y64A 1D0HA 1V00A 2A3XA 5K0UA 2CGNA 2EXHA 4UBGA 2D97A 1W6QB 2E7TA 3T3YA 2FDFA 3P6BA 1ENXA 1JW6A 3ZYFA 1MQTA 1YQ5A 4RFRB 4TLFA 2R062 4BIOA 4CDUB 4YARA 4XFIA 4GH4C 2G4IA 3J7NA 1LU1A 1H8VA 4XPVA 1EV11 4KBZA 4C0HA 2XONA 3V0AB 4OMDA 3F95A 4RS5A 1Y9GA 5FY5A 3MFAA 3H7JA 5FMOS 1COV3 4D7YA 1YJKA 3WHTA 4CEWC 1W9TA 4CA9A 3FBYA 1PGL2 4CCOA 3AMNA 2W5FA 2FMYA 5A70A 5JMOA 4I3GA 4RHV1 4D6SA 2ZGUA 5EQUA 1QMJA 1WCSA 2EICA 2PFWA 5CFCB 3JBG2 3VKMA 1N3QA 1CONA 4PLOA 4B4RA 1GP5A 1XBFA 5BPXA 2DVGA 1K12A 2NQYA 1UOGA 4X8NA 4GB31 4CSWA 3LWCA 1GZ9A 3KGZA 3ZDVA 2TBVA 1H4HA 4MYEA 4BH9A 2XHNA 2RM23 5C4WA 1QQP3 4YG6A 5IFPA 2VUAA 4UFJA 5KHKA 1B35A 3K51A 3WNOA 4LQRA 2WC2A 3ZN5A 2W9XA 1U5YA 4JZRA 2ARXA 3CBNA 1UX7A 4YGBA 5EJ1B 3ZFEA 4WVVA 4MXWB 2AENA 4CDQB 3AP6A 3I59B 1YUDA 3T09A 5EXOA 3VBFB 1OPOA 1C1LA 1YFXA 1NX9A 4KWLA 3AXDA 2H6CA 4IV3B 4D7TA 3SKVA 2YG0A 3AMMA 5F7UA 2DYCA 1NA1C 1RJ7A 5JOYA 1FAYA 2KR2A 1LULA 1W3XA 2YV8A 1EP0A 2VPVA 3ZPYA 5BY5A 3AJYA 2IVJA 1R082 2Q5TA 1PZ7A 3HIFA 3Q8AA 1VIWB 2CYFA 1JXNA 4OZOA 5FDBA 2O8OA 3FX3A 4MGIE 3VD7A 5ACA2 3MZHA 4BYYA 3N7MA 4X8PA 4LMFA 1IS3A 4B29A 4GWNA 2YUEA 2XXZA 4K7JA 5I8SA 4Z2AA 5FZKA 3TEYA 5CG9A 1QXRA 1HRI3 3MBWA 5ISLA 2V09A 1PMJX 2P4EA 5JXGA 1BEV3 4DQAA 3Q8BA 1H2MA 2VO5A 3KHCA 1O6UA 2HWC2 5CKQA 3FZ3A 3P5BA 4QPIA 4A44A 1EAH3 5KXEA 2PHWA 2VNOA 2FZ1A 4QQOA 1PO11 5ANQA 3MF9A 1PK6C 1Q8QA 2Q8DA 3SH4A 3W9AA 4B4QA 1KEXA 5GLWA 2Y0OA 4OUMA 4PIXA 3RZLA 2C1FA 4PQ9A 3NAPC 2DTYA 1Z0HA 1NQJA 3DYPA 4E8CA 2XLFA 5A3MA 2WBKA 4R4ZA 2AREA 4MADA 4RGGA 1LENA 3UK9A 2R32A 4I3PA 1UU4A 3A22A 3BPSA 2A6VA 1S55A 5C9AA 4NIDA 2DVAA 3GZEA 1SLBA 1S0GA 4COWA 1NE4A 4OLLA 2X5IC 4CDUA 4XF1A 5A80A 1RXGA 4AVSA 3JB8A 3R05A 4XZPA 2WS93 2DVDA 4ISRA 3GBFA 4R9DA 3KB5A 4NAOA 2BEOA 3AKRA 3V0AA 3IAPA 1FOD2 1NT0A 2BVVA 4XDQA 2DUPA 2SLIA 3J7MA 4WM8B 2R0FA 1R1A2 3POEA 1OSGA 1YFWA 4CXYA 3HNMA 4QQHA 3ZYGA 3C7HA 3O1RA 3AMQA 5T3NA 4Q4Y2 1JYCA 3N9NA 1OC1A 1UNBA 4FQ4A 3QBQA 2GSYA 3ZYIB 1GSLA 3U78A 5ANNA 1W0PA 2D5HA 4MVTA 2WKKA 4B1LA 4ZU7A 1H1MA 1AYN1 3WNXA 4U36A 1JOBA 1OLMA 3KVBA 4EN6B 3I2FA 1GNYA 1Y4WA 1MZFA 3S6PA 3BB6A 2D3SA 3SLIA 2PLV1 1J1TA 4K1YA 3ZFFC 1RUOA 1MVQA 2F4LA 4HK8A 2UURA 4K3UA 1VBA1 4LIVA 2C26A 3NV2A 3WHUA 2VMGA 2VMCA 3NV1A 4FOVA 4F7ZA 1JOPA 1DIWA 3BALA 4DUWA 3I59A 4HBNA 2QQJA 2AUYA 1LOFA 4UYBA 4K6BA 4W6YA 1FX5A 1AHSA 3GHMA 5A1AA 4QPGC 1ZZ6A 2FMDA 4GXLA 4PLNA 1HB3A 1ND3A 4IV3A 1LOAA 4QB1A 1DLLA 5FZ8A 4Y3OA 4FFHA 2YPDA 1JZ2A 1Z78A 4HANA 3T2TA 4NRMA 1W05A 2PN5A 1DGWX 1VBE2 2XWBB 4IXLA 3KQRA 4YRDA 3M3QA 5F3CA 1PO23 3PURA 4GZ9A 4LBKA 1WMDA 1SBEA 2VNVA 4AVBA 2EF6A 2WNOA 1YQCA 5FKBA 2GMPA 5A1LA 1OA3A 2ZACA 2DVBA 2WFF3 4UFMA 4XF3A 3LEKA 3AYDA 4JCKA 1PZ9A 3RI9A 4Z8BA 1QJX3 1AL0G 1U5IA 2PMWB 3KZ4C 3ZXKA 2FBEA 3PVEA 3RZMA 2A70A 2OT7A 4GALA 2JB8A 3C7EA 3WG4A 1COV1 2MHFA 3IDCB 3ON7A 2RMU3 1ND2C 1RUG2 4YVSB 2P3KA 4XCAA 1OKOA 5JZGB 3BGAA 3KQ4B 4P14A 1QJY3 1IS4A 4AI3A 4GWIA 2O14A 3AMHA 1YXWA 1W2NA 5KXCA 1XJAA 3B93A 1GOHA 4OI1A 3HNBM 4LBQB 2ZEYA 2IWGB 3AP9A 5GM0A 5IVYA 2R30A 2QCSB 2RM21 4C1WA 1QQP1 2A71A 4XAAA 1VBD3 5A3UA 4FOYA 2W46A 2PHXA 4Q5OA 3E5QA 4LK6A 5DAWA 5H9SA 4CDWC 4CDXB 3THTA 1TQ5A 3TNQA 4GMP3 1X8MA 4TSVA 3N9OA 5LB6A 1LHOA 3WNMA 1BYHA 2OZ6A 1AR92 2SBAA 1OFSA 2Y38A 4JQRA 1RVF2 3UJOA 1H2KA 1W9SA 2VM9A 1CJDA 3PHMA 2F6BA 2ZPXA 3D0JA 5CBLA 5K0UC 4DNYA 2VAUA 1W8HA 4Q2FA 4GAZA 3I4IA 3H50A 1AX2A 1QJU3 4HN1A 2P6CA 3T1LA 1MQTC 1RJ8A 1IS5A 4TWTA 1OVPA 3AMPA 3CF6E 2VVFA 2XVGA 3OYWB 4BQXA 4M3CF 4IL7A 1IQDC 2ZHLA 4PI2A 2RR12 1J59A 3C7GA 4RS5C 2OYZA 4FPLA 4QX3A 1QDCA 2PA7A 2RS33 4FPKA 3E1F1 3VBOB 1ULEA 4I30A 1SEFA 1AYM1 2JG8B 1HRI1 2E6VA 1JZ3A 1OPMA 2OVUA 1NUKA 4FTBA 1POV3 4TN7A 4Y26A 3CNAA 4B3NA 4ATFA 4E27A 3IDAA 3LDKA 3HBZA 4DXRA 5JMCA 3VKNA 4JRLA 3VBRB 1EAH1 2XR4A 2CAUA 4IEYA 4B1MA 1GUIA 1YHFA 3RWKX 5FZIA 5AC93 1UY4A 4UW6A 5A7WB 4B7KA 4GMP0 5C4WC 2WWJA 4XTMA 3PUHA 2P1BA 3NQHA 5FZAA 4S2FA 1B35C 1YLLA 4NOTA 2C0ZA 3JD73 4GKXA 3TNPB 3PLQA 2VECA 2W68A 5GZFA 4XIOA 1PZ8A 1IPSA 5LBBA 3UKTA 3WW2A 2VOTA 1DGLA 4QT6A 3ZFEC 3RZJA 1DP0A 3O7OA 1HV0A 3HQXA 1CX4A 1FMD3 2VCBA 3LD8A 4JC1A 4PDWB 4RR3A 3OGGA 2YBPA 3VBSA 2QE3A 3OD0A 3UETA 2DCTA 4LLOA 1ZA7A 1W2OA 2WABA 5FXZA 4G9SB 1D0GA 2RDRA 3GNEA 3JQWA 2WNVB 4IV1A 3O1TA 3NVCA 3T30A 1HXS2 1K5JA 4YZ3A 4LHNA 4AR2A 4HG6B 2D5FA 1C8M3 4YVSA 2GN7A 2DFCA 4OHWA 1LEMA 2W2IA 4BOWA 5F37A 3HN1A 4HOOA 1POV0 4HPKB 5JSOA 1HJGA 1ZRFA 1OBNA 1N3PA 2BP6A 2BGCA 2ZOEB 1AR82 4IGOA 4KWUA 3J8F2 5GJ6A 4ORFA 5A3LA 1UMIA 5LW9A 2CDPA 2UWAA 4CEYB 4LBQA 1GWKA 1GWMA 2R0HA 3T0DA 2ET7A 4Z92B 1O8SA 1RUE3 3GBWA 4CUBA 2I2SA 4BE3A 1QJFA 1QNYA 1ZBA2 1YIPA 2HEYF 4QPIC 3O1UA 3WLUA 3FHAA 3OUJA 5D1IA 1QH6A 1SCSA 1UPIA 2LROA 4Q8KA 3OEBA 4YW2A 2HWD2 1LGNA 2D6LX 4F3JA 1ZYBA 2K2SA 2OIIA 5DUVA 4YW6A 4HFSA 4V2WA 4ARYA 2YU1A 5FY4A 1OLRA 2ARAA 5T5JA 4FBFA 4X6QB 3ZDSA 1GFF2 2LALA 2YROA 5ABJA 3HMYA 3GM8A 3K48A 4B7EA 3UNPA 1C8NA 2VZTA 2XGXA 3Q8CA 4HMZA 5C9AC 3F2ZA 2VZQA 3N9QA 4LNVA 4UBHA 2OS2A 1TMF2 5IFTA 2GH8A 4CDUC 1RXFA 2XUEA 5FZCA 3U4SA 3MV11 4KWKA 4BQ2A 1LGCA 1NXMA 3CIHA 4W6WA 5DAVA 4XZUG 4ZZ8A 2WFF1 4N9HA 5EHDA 2LTNA 4P9IA 1RHI3 1GOFA 2RS52 3VBOA 5CVRA 4Y5SA 1QJX1 1APNA 1BJQA 1NCRA 5J3UA 1AJOA 1OA2A 1S2EA 3M4FA 5LBCA 1GQHA 2R063 2VZOA 2VMIA 3BTAA 4N53B 5CFCC 1DGRA 2P37A 4CUCA 2R042 2C24A 3IWZA 1KJRA 1FYUA 5FO8B 1ULGA 2RMU1 3LEGA 4DEVA 2VUJA 2WUHA 3HN3A 2Y8KA 3HAGA 1AF9A 5FMCA 3VBRA 3X29B 1QJZA 1Y43B 4PQQA 1U5ZA 3BN6A 2Y33A 4L92A 5LK7B 1HLCA 2XJSA 1WMXA 2WYFA 5DUUA 5FY0A 3ES1A 3WG2A 4EROA 3O1VA 2HLEA 4XJWA 1Z7S2 3J7LA 4QU1A 1US3A 4HVRA 5CISA 1Y3TA 4XMIA 1CIWA 1BMV2 4NROA 5C6CA 4XQDA 1KQRA 1LOBA 1ENRA 5JOXA 1LOFC 3PUSA 4O7XA 3VBFC 4NVPA 3D8CA 4PDWA 1C3HA 3KT4A 4RGAA 1REFA 4YZ2A 3UYJA 1YFUA 2C9KA 2VW1A 1ND3C 4IV3C 4GMP1 3OJBA 1PVXA 1LAJA 4N90A 1UMZA 3AJZA 1PIV2 1OOPA 2PHRA 4LULA 2NLRA 2RJLA 2VH9A 2WNVA 3NWKA 1NLQA 4YG0A 4L2NA 1SFNA 2I45A 3RVHA 5JPNB 4Y1XA 2WNUA 3MEPA 4GULA 3PIJA 2GP5A 1G9FA 3N9LA 5DQ0A 1RUI2 2D98A 4RA0A 1BKZA 5CYYA 3Q8EA 4FPFA 4QB2A 5FJKA 5JSRA 1S0CA 1QJU1 1MS5A 4FCAA 3ZR6A 5FV3A 2DCZA 3UKNA 5LRRA 3ZXEA 3ZXDA 3K2OA 1VJ2A 4ZS3A 1GBGA 2BNMA 3OUIA 3VBUB 1I9RA 3AXEA 3KVAA 3ZYJB 5IATA 4JQTA 1PGSA 3N7LA 2RS31 4NN0A 1UOJA 3D6EA 5BYNA 1ZZ8A 4LE3A 1IHMA 5FYTA 5C8CB 1GQPA 2VVDA 2WJSA 5FZGA 3ZIXA 5A33A 1MEC2 1POV1 2VVEA 4LO8A 3AP7A 1VRH3 5JR7B 1R64A 1R092 1SLLA 3LAGA 2CTVA 2OA2A 2BPA2 4KQ7A 2JENA 4MH0E 2BRTA 1H8TA 4JAAA 4FPYA 1JHNA 3NW4A 4N8MA 1JYTA 4BM8A 3AC0A 5AC91 1O4TA 3C2UA 4XF0A 1LGBA 1NY71 4FPCA 4LHLA 2B8MA 4EWDA 3WD5A 1UZ0A 2Z42A 2FDIA 1DQ0A 2MEV2 3ETPA 4ASKA 3WUDA 4XJAA 5CIRA 2VL4A 4JX0A 1RGSA 3JD71 2B9VA 3BKZA 3BODA 4DY3A 5A7QA 2QTWB 4OI4A 3HT2A 4ZONA 2ZHMA 5FYUA 4CRQA 5L9VA 4Q4W2 3VBHB 4EYUA 5BUVA 1ASJ3 2JEMA 3L2HA 3VDDB 2VD7A 2ETEA 4F8AA 3SEEA 5L73A 3LOIA 1FMD1 3NJYA 1HN0A 4FPJA 5GZDA 2DCKA 3DYOA 2G9ZA 4M3CE 2JIGA 4JTNA 4LPLA 1HX6A 5FWJA 5I8TA 3M3OA 2ZGOA 3TEZA 2HWB2 3ZSLA 2DV9A 4OVEA 3MI8A 1ZRRA 4XDOA 3DKWA 4N53A 3RJ2X 1KRIA 3GDBA 1BHGA 2J1UA 4OFGA 3APBA 3BTZA 5IHRA 1G8WA 2QQNA 3U11A 1VRBA 4Q1RA 2WT0A 5JI7A 3OSDA 3GBGA 3A21A 1VBB3 1TME2 2VW2A 4XUQA 3PU3A 4Q4Y3 5FZLA 1VAMA 5DDJ2 1PO13 3VDAA 1LHUA 2F4PA 5FXWA 2UU8A 4IDZA 3DPRA 2ORXA 2R072 4V1PA 5T5PA 3CU7A 3R0RA 5IVVA 2MNGA 4YM2A 3M1HA 3LB9A 3LSEA 3WNNA 4UWDA 3I2IA 3RSJA 3IIIA 4KH9A 5BNOB 4M0NA 5FZ7A 4CEYA 4EZ4A 4P9GA 2VU9A 4A42A 3LGRA 4RQPB 4PBOA 2BFUL 5BXXA 3RYKA 3T0BA 4AI0A 1WWYA 2XL7A 3UGHA 1OF4A 4CP9B 5LY2A 4IERA 1BLZA 1A6CA 3S7EA 1H9WA 4ZU5A 1UWWA 3GJBA 4LORA 3O1MA 3PTYA 2ZGSA 4IGPA 3EMRA 1YIFA 1UPSA 4YGCA 1HRV2 1G6NA 1N1VA 2JB4A 5DZFA 4Y20B 4XUPA 1NYWA 2PHLA 1KITA 1TNFA 1J84A 2ZGQA 1WBFA 5APAA 2IFWA 1VLNA 4RR3C 5D8AB 2XH6A 5E88A 2BJSA 5K4LA 4AHXA 3IB3A 3LQCA 3H1YA 1EUUA 2A6YA 3VBSC 5J48A 1RYYA 4J25A 1RUJ3 5JIUA 4K1ZA 3EYPA 4YZ5A 4OI2A 2JG9A 1UZZA 4QHZA 2QQMA 4GD4A 4BA6A 4IV1C 2CDOA 3LZZA 1LOEA 4PT6A 2HKXA 4D0QA 5FP9A 4E4SA 5HV0A 5GZCA 1V6LA 2GNDA 2BERA 1RUD3 1XPWA 4ZPIA 4BMBA 4CXXA 4YVSC 5C8CA 4QM8A 3U1XA 2R061 5CZKA 2D44A 3FLPA 5C3RA 1PGW2 2V4AA 2ENRA 2J1SA 2XOMA 4Q4V2 4NIHA 3AFKA 3POJA 1PNFA 3NKTA 1D4M3 3KV6A 1FT9A 1RMU3 3MIBA 2RS12 1BK0A 2C5DA 4IEVA 4O65A 5FYZA 3KV4A 4ZKTB 4GWJA 4XQ4A 2ZKLA 2VJXA 3M3CA 5GLTA 5BNNB 4NWVA 3AYAA 5AVPA 5FZFA 1PGL1 4NHXA 3CZUA 4CU7A 3H8UA 5JI9A 4WVMB 1GR3A 5I93A 3TRSB 3LSDA 3I49A 1ZBE2 1F2NA 1MPXA 3IM0A 3ST7A 1S0FA 2WFPA 2I74A 3TN92 5GKAC 1NAEA 4IW3A 1XNBA 3A0NA 1YQ8A 5FY7A 5K7PA 5F6KA 3M7AA 1JU4A 1UN1A 4GKYA 5C3QA 3ZOIA 5FREA 4BZ4A 2E33A 4MGSA 4MXVA 1OI6A 5ABJC 1UD1A 4QPWA 4DUVA 3QOPA 4JGZA 5FLHA 1JZ7A 1NKGA 4COYA 1KD7A 2IUWA 4Q1PA 1S4CA 1VE0A 4RN5A 3SEPA 4AQ2A 2AH2A 2VZSA 4QKBA 1AR62 3EBRA 2D6PA 3I2OA 1AR72 3KHBA 2JIJA 1GZWA 4N7IA 2QQLA 1V0AA 4LBMA 4AOCA 3KWVA 1UXXX 4F83A 3O1PA 1W90A 3T2PA 4AF9A 3RZHA 4M00A 1GZTA 2HWF3 2PQQA 4LA3A 1V6OA 2DTWA 3T2QA 5DAQA 3VBOC 1LOCA 2AEZA 5LY1A 4QPYA 5BNPB 2ZMNA 1IKQA 4JDNA 1NCRC 1NZCA 1UO9A 1MS0A 2WZPP 3AYEA 3B69A 4NWWA 3W58A 1LR5A 1W3VA 1OD3A 2LM3A 1YQ6A 2VTFA 3UL2A 2CV6A 4BQ4A 3M8LA 2RR13 5FP3A 5IYYA 1AL23 2TNFA 3VBRC 4P5YA 2XHKA 4RQPA 4YW5A 5ACA1 4L99A 1WCUA 1VRH1 2Z2SB 2W92A 4WV8A 1LHNA 4OQ8A 2PAKA 1RUC3 5A3NA 1MACA 2VMHA 4FXGB 3ZMNA 4KNCA 4KU7A 2BWCA 1IG3A 3A23A 3MPBA 3SCFA 3N7KA 1O3SA 1IGOA 4QD2A 3M3EA 2XJQA 4Y20A 1X8EA 2DU0A 2JECA 3VL9A 5FR3A 3PU8A 1NCQB 4URTA 2EAKA 2W1UA 3I8TA 4H55A 4PDWC 4XVHA 4CXWA 4DUXA 3OF1A 5JDBA 1TZOA 3USUB 2YY1A 1ASJ1 1C28A 2RVAA 2WO1A 3NJXA 4YVWB 3SQOA 3ZXGA 4C8DA 5KHGA 5LCWL 1OOPC 2VQ0A 2HEVF 1JHJA 2WNVC 1EV12 2ZS6B 4AQ6A 3W20A 2WNUC 2GDFA 5J98B 1DLCA 2AC1A 4X6RB 1W8NA 1XRUA 2YHJA 5T54A 1KJLA 4KI5M 2YC2A 3D82A 5FMOL 1AYM3 4Q4X3 5CADA 2W91A 1S0BA 2VCMA 4Q27A 4RHV2 4AEDB 3H1MA 1XQNA 4LBQD 2Y6LA 1IQAA 4W6XA 5A7OA 1YQ2A 3S7IA 2EXKA 2ZX2A 1FOD1 3AP5A 2QZ3A 4QX7A 4IEZA 3ZFGA 1Y9QA 4AE2A 2XVKA 2ZAAA 3LPFA 4HN0A 2Z4FA 1R1A1 3QH6A 4CUGA 2Y6JA 2GN3A 3AYCA 3H42B 1CAWB 1VBB1 2BW8A 4GB32 2I07B 5DAXA 2CGPA 4Q4Y1 4IEQA 1G9BA 4WVMA 4QXKA 5F9TA 1BQPA 2Q1FA 4XBLA 2ZHKA 1W99A 5CKMA 3FWEA 4WM7A 3WZ1A 5FBJA 5FP8A 1YYNA 4META 1Y9MA 2LUWA 2QUOA 2ID4A 3ACFA 1L7RA 3OBRA 4XJ8A 1CGPA 5L36A 1I5ZA 4DO0A 1H8TC 1A78A 1BVP1 3SH3A 2Q8EA 2GMMA 1CZSA 1FV2A 2JKBA 4NO4A 1ZBA3 4YM3A 1W6QA 5CFDB 4QKDA 5FOJB 5IVFA 1JZ5A 3ROUA 3BU7A 1C1FA 1MS9A 2JKXA 2XLGA 2VZVA 3RYPA 2PTMA 4QX5A 3NNGA 1SDDB 1E5RA 3OPWA 1DZRA 4RL7A 4JKMA 5J36A 4UOJA 4IEWA 1GMMA 4WVWA 3POBA 4PJYA 1OHFA 4COZA 1DHKB 2ZGMA 1J1LA 5FQ0B 5HCHA 4CCNA 4N43B 5DG2A 2R7EB 2ATFA 4NHMA 2V73A 4P00B 4M4PA 4FXKB 1JYIA 4EQVA 3VD3A 3D4KA 3W5NA 3FUOA 4R52A 5FXXA 5CFCA 1RUJ1 3T0AA 2Y60A 1TMF3 3LOBA 2ZGNA 4N9IA 5FYMA 5HCBA 1P8JA 4DPNA 3OD4A 3H8XA 1O5LA 2QQOA 2RJ2A 4LKDA 5F32A 2WQZC 4N53C 3B01A 5EYYA 3OGSA 5FIXA 1W6OB 2Q8CA 2WR9A 2QFEA 1BK1A 1RUD1 2VXJA 4COUA 4Y24A 1LESA 4O61A 5IK5A 2B42B 2XKOA 3CLPA 1K45A 1US2A 1KS4A 2IFRA 1W28A 4FPHA 3ZO0B 3V64A 2B5HA 2ZEWA 4JHTA 4BWOA 4A3XA 4FAGA 1D4M1 3DPRC 4MXWA 1RMU1 4CDQA 3OCPA 5C3SA 3FC0A 3ALQA 4Y4YA 3TOJA 3VBFA 1UCXA 1SACA 2GZWA 4KBBA 5LRSA 1QJEA 4YGEA 3FMGA 2BVBA 4FPGA 3BI3A 2W1WA 4ES8A 1YNAA 3SISA 3LDRA 2VCCA 1NCQA 4AQSA 3HVDA 4NHKA 5JCTA 3VUOA 1PVC3 4D7SA 4XFBA 1ULOA 5KR7A 4CDWB 2YC4A 4AI9A 4FP2A 1X36A 2CY6A 3ORJA 4YVWA 1KS5A 2VUCA 1G9DA 4AGGA 5FK7A 3T4VA 4OYUA 4XAEA 5FPXA 2IXLA 3T1MA 4YPJA 4UFKA 1MZEA 3ZSJA 4OUEA 3SH5A 5FFOC 5IVEA 4CP1A 3RGBA 1SFYA 4SLIA 1EPZA 5FUPA 4XF9A 4AGVA 4NRPA 3LFIA 4AEDA 3AL6A 2OUJA 3RZGA 3KCYA 3THPA 1E5IA 4JV4A 1DQ6A 5FLJA 5FYYA 1UOFA 3H8RA 4LXLA 2WINB 2JG9C 3LIGA 2VZ1A 3MUY1 1I3HA 3C8XA 3PJYA 1AYN2 4NPMA 1QGLA 2HWF1 5L9BA 4Z1VA 2CWMA 3SHRA 1V6NA 2GH2A 4MGTA 2PLV2 3PL0A 4DRVA 1RB8G 2EIDA 3OGJA 2X05A 2PHDA 5C8CC 2DBNA 4UFIA 2WN3A 2W1QA 3FE5A 1XNAA 1VBA2 4PCRA 4TLGA 3WT3A 4A45A 2WSVA 4XMAA 3U75A 2HWE3 2RR11 1YCIA 3QACA 2YMZA 1AL21 5EZWA 4JDMA 4NJ4A 2Y34A 5A3TA 1FI2A 4B8EA 1MS1A 1H2LA 5CFDA 5JXIA 3PUIA 3VD9A 3OBAA 1DQ2A 1UIJA 1OH3A 1RUC1 2GALA 2UY9A 5FYCA 1W03A 1GP4A 3PJQA 3PVOA 5FP4A 2G9FA 3RFRA 4AEMA 2FDHA 2OXBA 4O9GA 2WDBA 4AVCA 4WM8A 2O8QA 4ITCA 4LO7A 1V6MA 5FQ0A 1VAVA 1D4VB 1YEWA 4CP2A 1W9FA 1WGPA 4A6OA 4DEQA 2OQ7A 1DDLA 1GICA 1YI7A 3OTFA 2VZ3A 2VUDA 4LLFA 4JGZC 3POSA 2GP3A 2Y6FA 2ORZA 1HB1A 2VOVA 4WZCA 5I8YA 4XUTA 4OHVA 4AQTA 1I6XA 2PYTA 2QKDA 3N35A 1UY0A 3Q9OA 5FMDA 4OHYA 3CJIB 5A3PA 5F3GA 5FYBA 1ZRIA 3RNSA 4TXWA 1COV2 1BBT3 1Q5OA 2E7AA 3KLSA 3RMYA 2P3YA 5FK8A 5L7OB 4J1WA 1RUF3 3MDPA 4LEJA 4Q4X1 4YG3A 4ZZ5A 3POGA 4I0WB 1O7FA 4IGQA 3MV01 1N47A 2DFBA 3IKWA 4PBPA 1GOGA 3FFZA 5C5UA 1W8TA 2QDNA 2UYAA 5FZOB 4KG0A 1D2SA 3WF0A 3IAQA 4MZUA 4XFCA 5FRAA 4XTPA 5K8SA 5HBAA 5EV7A 4BPZA 3CKHA 3I3EA 2RM22 3L2YA 1LHVA 1QQP2 1OQ1A 3WF4A 3UJQA 2ZBJA 2W3JA 1MS4A 3LPGA 4RQPC 3GZTB 4K40A 2H0VA 1WCDJ 4IEPA 2E26A 1SPPB 3ES4A 4KGGA 5DUXA 4W8JA 1O4YA 1HQNA 4FP3A 5FMBA 4KMQA 5FZ3A 1Q3EA 4IE4A 4MX3A 2VR4A 1ZBA1 2JJ6A 3HT1A 4K8FA 5KHJA 2XJUA 4PLMA 4QX8A 3I54A 3ZYBA 4INDA 4ZXEA 1W0OA 3VKOA 4M3CB 4DMIA 2HWD1 4QX1A 5IW0A 3RMXA 4JGYB 1T6GC 5DG1A 3WCSA 4UF0B 3FLRA 1SBDA 2YYOA 4MGZE 4UI9L 3H0OA 3WY6A 1QNWA 4MGYE 2IXKA 1JBCA 2X10A 3VHPA 2DURA 5F5QA 1UF2C 5JZGA 1WD4A 1WW7A 1POQA 2QQKA 3N7JA 2AYHA 4EWEA 1W0NA 2P3IA 2XDVA 3JZVA 5GLUA 1TMF1 4YLZA 2BOIA 3NL1A 5J7MA 2WZR3 4I2OA 5A32B 1HRI2 5FZDA 1Q56A 1RUH3 1CAVB 2W95A 3PMEA 1XSRA 1BEV2 1RINA 3FFQA 3WUCA 2BZDA 3KMHA 3ZFGC 5JXJA 3DV8A 3KT7A 2RS51 1UU6A 3MW2A 3EXUA 1CX1A 3TBDA 1EAH2 4I02A 3OPTA 1DZQA 4Y33A 5IVJA 1U12A 1D2QA 3PVBB 4AFBA 2BDRA 2H0BA 4CDXA 3MPPG 4NUBA 4HL0A 3WEZA 2WO2A 4YYOA 1KXGA 3VDBA 2EIGA 2R041 3JXSA 1GZCA 2D6OX 5IVBA 1BCXA 4Q4V3 2X5IA 4WM7C 2EAAA 1Q8PA 2YPJA 3J26N 3TB0A 3PDQA 3UT0A 3G6JB 3H8OA 4I09A 2J1TA 4QAWA 4NHYA 2IVIB 5F6LB 1AX1A 4XHBA 5JUVA 2AR6A 1NG0A 1VBC2 1YFYA 3EJKA 4JKLA 1PVC1 2QQUA 1W6PB 2LRPA 4KL1A 3RQ0A 3AZYA 1UYXA 1STMA 3WR0A 3NAPB 4YZ4A 1SFPA 3ECQA 4D94A 4AVAA 5B2GB 4XQWA 5C7GA 1IZ3A 2WS92 1V9U3 4URAA 3OYWA 1TVGA 3MIGA 4MO3M 3MF6A 3CJIA 3Q8FA 5AFEA 3D3AA 3KV5A 2QNKA 4FQZA 2QZ2A 2D43A 3GJAA 3AB0A 3WF2A 3ZN4A 2JDUA 3IPVB 1NOVA 1OXCA 2CU5A 5L7OA 3DXUA 2JG8A 2B7YA 2WWUA 3ZMOA 4YSFA 1DQ4A 4Z2WA 1PNGA 3MIDA 1FNZA 4GWMA 4I0AA 2WO3A 1JYVA 5IAVA 2N7GA 4L8QA 1AR63 1DG6A 2ZEZA 4LHSA 4AI8A 1ZREA 1JN2P 2A6WA 5FZOA 5DMYA 4AEJA 3O12A 2WNEA 4CCDA 1AXZA 1RUI1 3BOPA 3FHIB 3K4DA 1LU2A 1NQDA 2DVFA 3JU9A 3IDBB 5A7WA 3O14A 2JX9A 1CWPA 1ZRDA 2VY0A 1F4HA 3KD4A 1VB4A 4XFGA 2K46A 3U07A 3JBG3 2FD8A 1CESA 4CU6A 3CO2A 3VKFC 5LA0A 2PAMA 4A6SA 1WA6X 3QH7A 1Q8OA 5A7NA 1VMFA 1XNCA 2HWE1 3GXUA 2Q8OA 4OHZA 4ARXA 5ERLA 1REEA 5SV5A 2IXIA 3RRDA 3GCXA 4MV2A 4CDQC 3GF6A 4Y22B 1CQ9A 1ZZCA 3JB4C 3GGLA 3MIEA 3LA7A 1DYKA 3S5AA 4IETA 3AKSA 3AKQA 4YW1A 2QJVA 1DF0A 2E31A 1H4GA 1W6NB 1NCQC 1O91A 1JTZX 1O59A 2JDAA 4HVOA 1CR7A 4M3CA 3UESA 1K5MB 5TSWA 3RYRA 5FP7A 5FOBB 3B02A 1G9CA 5E89A 2IC1A 3TAYA 1PO22 4OMCA 1VALA 4YVWC 4EN9B 1UXZA 3U14A 2D6KA 5IT6A 1ONAA 5I0UA 3IIAA 4G4FA 4Q0QA 2W39A 2W94A 4QPGB 2VMEA 3ILNA 2GC0A 3LF7A 1ZVFA 4HPKA 1ULPA 3KV9A 1QJX2 3I3DA 3ZXAC 1UKGA 1W06A 4D8MA 5A32A 2C9AA 1ZZBA 1X50A 1RL3A 2WO7A 4B4PA 1GKBA 2JD4A 1CAVA 4H14A 1FPN2 2DCYA 4L11A 4AEDC 2BNNA 4FPEA 1GANA 5FPUA 1X9PA 4LIUA 5FPLA 5FJHA 1F15A 1BBT1 1UZWA 2GNBA 1MS8A 2RMU2 1GU3A 5FZHA 1R083 1LCLA 5JLVA 1RUF1 1T6BX 4S2HA 5A7PA 4UW5A 2ZABA 4XE9A 2ES3A 2GAUA 2AGSA 3PNAA 4U2AA 1LJ7A 2VTXA 1HB4A 3EO6A 3ZN6B 4A3ZA 5ACA3 4LBLA 1A8DA 1QJY2 4KG8A 4P9XA 1KDKA 1TE1B 2WL1A 3MIHA 5IK7A 4ONUA 1JYWA 2ZGPA 4CCCA 3E6CC 2E63A 4QWNA 1YI9A 5BNQA 5T52A 1ZRCA 1L7LA 2YDEA 1UYYA 5LEKA 3NMBA 2HWC3 2OW4A 4Q29A 1ND2B 1U5XA 2XJRA 4BHPA 1LEDA 3U37A 1VBD2 3VZNA 4XETA 1FXZA 1PM4A 4JKKA 4NHLA 5CG8A 5EFUA 4AL9A 5CFDC 1NXD1 3ABZA 3WG1A 5LBFA 2A5ZA 1HW5A 2D3RA 2PQSA 4XUNA 5DPNA 2YC0A 2JWPA 5JOZA 1LB2A 3POIA 4YGDA 3WSOA 1OFNA 1I5PA 2UYBA 3KCCA 4WM8C 2ZEXA 2OX0A 4QM9A 2WLQA 2BFUS 2WN2A 4YW3A 5JVVA 3WOGA 2Y6KA 4XF4A 3U0ZA 1SLAA 4C91A 3QCWA 5FZ1A 3PMSA 1F9KA 2ARBA 2XUMA 3ZXLA 1ENQA 5B4NA 3WXPA 4HVQA 1QJU2 1IPKA 1VMJA 3V0BB 3VD4A 1X9TA 4AFAA 5A1FA 1UAIA 1KFXL 1XU1A 1XU2A 2KD7A 1KDMA 1QH7A 1FOD3 4NPRA 4QXHA 2OQ6A 4BQ1A 4NE9A 4JTOA 2WYSA 5F3EA 4DY5A 1R1A3 3ILFA 3GYDA 3GZUC 4MSVA 4FFIA 1PX3A 5J1XA 3ACGA 2IXHA 1CN1A 2WZR1 3J4UH 1J3RA 3DGTA 4DB5A 1A3KA 4HONA 1QOTA 4XOGA 4AFCA 1RUH1 1CAXB 1DZTA 1UZYA 1AXKA 3LFMA 1PMHX 3MLLA 5DAPA 4D3WA 5KHIA 4JHZA 3O0XA 1UX6A 4CCEA 5I0SA 4Y22A 3W59A 5JSPA 1JZ6A 3NRUA 2GNMA 4P9JA 4IE7A 4QGNA 1S0JA 3O0WA 5F5IA 4E4ZA 4H7MA 2XBO2 2JE8A 5AC92 1VAKA 1NY72 2D6MA 1ZA4A 3SNMA 3ZSEA 5KC6A 3MLKA 2VNRA 3PIGA 2AEYA 1W6NA 3AKTA 1K5MA 4Q4V1 1H1IA 2VZPA 2ARCA 1JZ4A 2A3WA 4Q0UA 1AZDA 1HQWA 1WMEA 4QDRA 4IE5A 1VMHA 5CAZA 2CHHA 3DECA 4H7LA 5FZEA 1W8OA 2BQPA 3GCWA 3ZYPA 2BUKA 1OA4A 3ATGA 2HYKA 4ZU4A 1FMD2 3FN9A 3NSTA 3OB8A 4AK3A 2D6NA 1AXYA 4L0PA 5C4WB 3RDIA 4QGMA 2P6HA 3POYA 1DQ5A 2OKXA 3IBMA 5EIYB 5KXDA 1JI6A 3FL7A 3B9IA 2CL2A 1V9U1 5EJZB 1VBE3 4Y1YA 3VBUA 1M06G 4BLJA 1ENSA 2EIEA 3ZX7A 2XWJB 4XFHA 3ZFEB 3IN9A 5F5AA 4E2SA 3VHNA 2JDPA 1XYNA 2TEPA 4XFAA 5DZGA 5F8PA 4N7UA 5I0DA 1C8M2 2YGMA 5CNAA 3VDCA 2QQPA 4FTEA 2D7FA 3LEMA 5JZGC 1WLWA 2W52A 1ULDA 4NIIA 3ZN6A 3H3UA 3USSA 3H3ZA 1UOBA 3NNMA 4LKSA 1AR61 1O5UA 3ZXJA 3CL1A 2ET1A 5FZ4A 1AR71 5F39A 3QD6A 2D40A 3CQOA 4XUOA 5FPVA 3WDTA 2FDKA 4R9BA 3BIWE 3BYWA 4FOWA 2ZAHA 1RUE2 4YW7A 5F1RA 1RUG3 5GZEA 5I0TA 1DGRN 1UY3A 3P3NA 2WSUA 1QXPA 3HWJA 1S2BA 3FJSA 3KM5A 2CWSA 1JS9A 3JBG1 1QIQA 4PF5A 5GLZA 1XE0A 2WRAA 3GALA 4D6RA 3C3VA 4CDXC 3B7MA 1ULFA 3VBHA 4S2GA 5FWEA 1GWLA 4YM0A 3VDDA 3THDA 4QMAA 3PTRB 2KM2A 5KBFA 3ELNA 1SDWA 3UGFA 3WQBA 4QX2A 3C7FA 1WMFA 4C0BA 4YFZA 1MVEA 1HN1A 1UW8A 1JMUB 4XJUA 2WT2A 4CYDA 5FO9B 3BUCA 1HDKA 4W4ZA 3V0BA 2O0OA 2VBDA 2XB6C 1X7NA 3K46A 4IE0A 1GP6A 1AR93 2WQ8A 2WAOA 1RVF3 2JDHA 3BOWA 2DF7A 4QKFA 5C71A 3CJIC 3KS7A 5IVCA 4XURA 1VR3A 3DUIA 1RHI2 3R4DB 5D21A 3WX5A 4AXOA 5C9AB 4NIAA 1OVSA 4UW3A 5T50A 5L7OC 4P02B 3A4UA 2Q0AA 3A0KA 4LJHA 2JG8C 4QQ2A 5C8WA 3OG2A 3HNYM 4QHOA 4Y5Z0 4FI9A 5HXMA 1CAXA 2Q30A 3POFA 5FPZA 1H1AA 2VG9A 3AP4A 1DFQA 1QKQA 5FY8A 1R081 5G04L 1RTVA 3ETQA 3WQ7A 4DXSA 5BNOA 2VCAA 4A2UA 2HBTA 5FTTC 3AM2A 4BQYA 1O3TA 4MGQA 1O3RA 1HIXA 2J1EA 4KGQA 4R9AA 5HV4A 2F17A 3CHXA 4H2AA 3ZKYA 3D5OA 4CP9A 2NZ9A 5FUIA 4NR1A 3CDZB 4LHKA 4AVTA 5HCFA 2HWC1 1ULCA 2V72A 3H1WA 4UT5A 3JUUA 1HB2A 3K4ZA 1W8WA 3BIEA 3FBMA 3ZSKA 3MICA 4LBOA 5BV6A 2EIBA 1OUXA 4HLTA 5DXDA 4AEKA 5A6QA 5D8AA 2PHFA 5SV8A 4JDOA 4RSUA 3A7QA 3MLJA 4P9YA 2D3PA 1H6XA 2BOJA 3ENRA 3WDXA 3NJZA 5FZMA 4DZGA 2CGOA 4ZHNA 2A6XA 4XFFA 2BTVC 5IWFA 5C70A 1SCRA 4JGYC 2PHTA 2Y6HA 2E51A 2QQIA 4S2DA 1DCSA 4R8HA 1TG7A 3AX4A 5FYSA 5LATA 5I91A 3U4XA 4Y1VA 3ACIA 4Q8LA 3HQUA 4FT8A 4IESA 2XMLA 3ILRA 1AJKA 3CMGA 1QXJA 3MYXA 3VGIA 5DUWA 1ND3B 2E53A 3DCQA 2V4VA 4BK5A 2VOWA 3SKJE 4IE6A 2O1QA 1CPMA 1DQ1A 2P17A 1GYKA 4E2QA 1TEIA 1HXS3 1UMHA 2UY8A 4P9LA 3VZJA 4CEYC 4DIQA 1JOJA 5BNNA 4XABA 5DABA 5H9QA 5KHHA 2R49A 1ALYA 1QOOA 4YM1A 4P08A 4PI0A 3NV3A 1N1YA 4Y5TA 1W6MB 3WQ1A 4A41A 4WVZA 3DXTA 1J58A 5EPAA 1AR83 1IPJA 3J8F3 1VRH2 2D93A 1SMVA 5FLIA 5F2SA 1VP6A 2VMFA 3E97A 3QLQA 3HR9A 2AACA 4RGKA 2B46X 1WW4A 4K21A 4EN0A 4AGRA 4LUMA 2DDUA 4DS0A 1SLTA 4XW3A 4E4HA 3LEIA 3NNJA 1JODA 4AW7A 2P34A 2HWD3 3FUQA 5F2WA 2VGDA 5KC5A 4AAPA 1X82A 2W87A 4XCBA 3SITA 1ASJ2 1F31A 1YWKA 2XKPA 2AZ5A 1GNZA 2RHPA 4IEXA 3IMMA 3B94A 5EJ3A 2A75A 2R16A 2BGPA 3NO8A 1VBC3 2ZMLA 4GA9A 1W8FA 3P1IA 5BNPA 1VBE1 3OUHA 4P5HA 5GZGA 4BMEA 4A7ZA 3BPZA 3B00A 4LOTA 2ZMKA 4JVAA 5IAXA 4FPOB 4NPLA 5E6HA 1S2KA 3WF3A 5I0RA 4LO4B 3W21A 4A7YA 1CVNA 5EYXA 3HPNA 3WNLA 3WQ0A 2RS53 1WW5A 1H2NA 2QBXA 4BDVB 1VBB2 4MHRA 3WP4A 4RFT0 2ZX4A 1PO12 2ILMA 1XB9A 1WD3A 2R1BA 2ZX3A 5KXBA 3JCIA 1WZXA 1UY1A 3B3QE 3MUZ1 2YB7A 3KF3A 3V56A 2R043 5A3WA 4BU2A 3RZKA 1W9WA 2ZGKA 1RUG1 1OMIA 4V2VA 2BV4A 4R4XA 5A3OA 4AHYA 2BBAA 3ME2A 1LECA 1NLRA 4MHUA 1VB2A 2WLPA 5A7SA 4LBJA 2YXSA 3USUA 3IT8A 1MZ5A 2W47A 1Z7S3 2JDMA 4UW4A 1GQGA 1EPWA 3H9AA 5FY1A 3VHOA 2P3JA 1K5MC 2VTXJ 4QB6A 2VMDA 3VZKA 3BTYA 2DWRA 2E7QA 4LOSA 3U10A 3CJXA 3VN4A 2B4KA 1XC6A 4XXPA 1XNDA 1KFUL 4QU2A 1C4RA 2WIIB 2ZX1A 1FATA 4MOAA 4R9CA 5T5OA 1XNKA 2ZGTA 1CJPA 3E5XA 5LEJA 1PIV3 1QHDA 1QY4A 1RUJ2 2JDYA 1AR91 3AZXA 3G7DA 4I01A 1RVF1 2K9ZA 4HSLA 4HXCA 5DZEA 3VBUC 3WCRA 4ZXKA 2RE9A 1CAWA 4GQ7A 2YFZA 3R4SA 1RUI3 3AL5A 4EV0A 1URXA 4EN7B 4QQLA 1RUD2 3BVCA 2VXRA 1OQEA 4RR3B 5FYVA 1W6MA 5L19A 1JUHA 1UY2A 4ASMB 1JU3A 5FUNA 2GC3A 3VBSB 1DYOA 3WW3A 1YO8A 5LBEA 1M4WA 3LCPA 2LW8A 2QDRA 4RD7A 1QOSA 1VPHA 4XEZA 1G9AA 1FPN3 4IV1B 1D4M2 1RMU2 3O1SA 1JYXA 5FBZA 4IEUA 2Z79A 4HSJA 3NJVA 1A8MA 4MG2A 2B9UA 2DU1A 3MIFA 4Q0VA 2TUNA 1BZWA 4XJ9A 1NZIA 4XACA 3WW1A 4DRRA 3S0MA 1UIKA 3HBKA 1MEC3 1OD5A 3UV9A 2GNTA 2VOKA 1R093 2Q4SA 1MZ6A 3VD5A 3VKLA 1OLME 1Q43A 5GALA 1XYPA 3PVNA 3L9JT 3VBHC 4QXCA 5JAXA 2XJVA 4GJYA 3VDDC 4N43A 5JPMB 1GNHA 4HK9A 3AZWA 2YBKA 1FNYA 3N9PA 1UU5A 1B09A 1SHWB 5K9YA 2MEV3 2YFUA 3K3NA 4LR4A 5CA6A 2HJIA 2GC1A 1WCKA 3K77A 3RPQA 5C5TA 1XE8A 3WF1A 2H6BA 4DXZA 1XXNA 3S57A 3I3BA 1S0DA 1RUNA 4Q4W3 1C5HA 4AFMA 3AZVA 2B45X 1PM7A 1Y7BA 2WAAA 3I2DA 1W6OA 2ZGLA 2Z69A 4CU8A 2HBUA 3ACHA 3OPZA 3TYJA 2J1AA 4NMIA 5ABJB 3B5LB 2VE1A 2HWF2 1GLHA 2QQVA 3KCXA 4Y1ZA 1NLSA 2HWB3 4BQ3A 4GH4B 4LO6B 4SBVA 2NPIA 1ZNPA 4QGLA 5JR2A 1HXS1 4XYXA 3UKVA 4J6GA 2JDNA 2G9GA 4XJZA 4QXBA 5H9RA 4CEWB 1K3IA 5A6XA 5AFBA 5BNOC 4LA2A 1TME3 1AL22 3WP5A 4ET7A 2IZWA 2VULA 5DDJ3 3RG0A 3RJRA 3S5QA 1AR81 2FCTA 3J8F1 5C3OA 1NCRB 1SLCA 3T2OA 2R073 1LKNA 4CPBD 2ERFA 3OEAA 2HEWF 1RUC2 1OUSA 4M01A 1BEV1 3ZKUA 3BTXA 2EALA 4EJRA 2ZXQA 1J3PA 4FVVA 1SQ4A 3INAA 2XQXA 1UYZA 3MW4A 4FTSA 2PELA 3THCA 1LNSA 2WA4A 2XBO3 4EZHA 1J83A 2Y26A 1UZVA 1AVBA 4LKEA 3DN7A 5D8AC 2J42A 4NAMA 3P3PA 3OBZA 3MW3A 1W8ZA 1D7PM 4KWJA 3WDUA 4CCLA 2OUHA 3HD8B 3WINE 1UQXA 1DGWA 5JIAA 4HKOA 2FCVA 4HKLA 3BCWA 1HRV3 4EN8B 3WW4A 1VBC1 2CNAA 2IXCA 5HXVA 4HKWA 3LA2A 3AVRA 4LK7A 3AZZA 5H9PA 5DN2A 5KWRA 3VZOA 1AYM2 4Q4X2 2FDJA 1NA1B 3ZXFA 1YC61 3AKPA 3OOXA 2WS91 1QF3A 1WA4A 3ZR5A 2A3YA 1OOPB 2BGOA 5CEHA 1HV1A 2DUOA 3BU0A 3AK0A 4OULA 1CAUB 2P2KA 4FFGA 3JQXA 5J09A 1OQDA 2WNUB 2ZHNA 3DYMA 4BQ5A 5JXHA 2VZUA 1V6JA 5BNNC 5E1RA 4NIGA 2ZGRA 3J7HA 4AHWA 1H6YA 4WBBA 5CU1A 1HKDA 3DKQA 1EYBA 4AAXA 1V70A 5FXVA 3WP6A 2R6QA 3OGRA 2A1XA 2RV9A 1HQLA 2VW0A 3VHRA 5M0TA 3N9MA 1OT5A 2ZX0A 1SG3A 1W39A 2RS13 2VQUA 1L3JA 2VBBA 3OBTA 5IJRA 4BCUA 4XHXA 4GIQA 1WW6A 2RG4A 1PK6B 2UWBA 1H0BA 1DBNA 1QU0A 3WVJA 1ODNA 1ZBE3 1Z7S1 2J1VA 3TN93 1CZTA 1G86A 2VQTA 5A33B 4LE4A 1BMV1 4BB3A 3MGUA 1TNRA 4NRQA 1W2TA 4XC9A 2BU9A 4K20A 3S30A 3R4UA 1H8TB 5FZBA 5FKCA 5CB7A 5LA1A 2CAVA 4PIYA 2X5IB 2Y0IA 4XDPA 3SC7X 1PIV1 4LITA 4GH4A 4QQPA 3ACLA 5FYHA 4YWAA 1E5HA 2CSGA 5BNPC 2XLAA 4CCMA 5C3PA 4XBQA 1PO21 1MS3A 1ZM1A 3VZLA 1E5SA 1AR73 1S0EA 2YU2A 1QDOA 3VLBB 4DFSA 2EXIA 2XJPA 5C33A 2A73B 3K75B 4AYUA 1XNTA 2DUQA 2Q1MA 1SZBA 3E5UA 3T4HB 1O8PA 3VV1A 4CEWA 5HPOA 3I2HA 4LBNA 3URFA 2OPKA 3NNLA 4D6QA 2ADEA 3M70A 4QHBA 2YZ4A 3K4AA 3AVSA 5FY9A 1WLCA 3TEXA 3D0SA 1SPPA 2EXJA 2XQRA 4CVUA 1FPN1 5LK5A 4BLIA 4BXFA 4BIFA 5E16A 3NV4A 4QX0A 3WDVA 1AX0A 3ZVXA 3WDWA 1WLDA 2L9LA 2ZCWA 1EY2A 3H7YA 4YW4A 3VL8A 3ZFFB 1RIRA 3EQEA 4JRAA 4EWAA 1A34A 5FZ6A 3VB9A 3I2GA 1MEC1 4HZFA 1QJY1 1PVC2 1C57A 2DBIA 1F5JA 1R091 2YGLA 3MFCA 1ODMA 2DCJA 4JGYA 4Z07A 4UF0A 1WLTA 3DPRB 1OLQA 3RZZA 2XG3A 2GU9A 1R1ZA 2W08A 1H9PA 4YZ1A 3KF5A 2XPJA 4UFHA 4W65A 3WG3A 3EB7A 3HJRA 2NP0A 2EA7A 1L7QA 2WA3A 1IOAA 3ZM8A 1VBD1 2C6SA 2WFF2 2MEV1 4ISQA 4YNIA 3ZSMA 3TWIA 4TYSA 2X09A 2FZ2A 1XYOA 2VBPA 4UFLA 3O1OA 5J96B 1NA1A 2PAEA 3DF0A 4Q4W1 4Q0SA 1JH5A 1S1AA 2C4XA 1F35A 4L9BA 1UL9A 3IDEA 2Y6GA 1RITA 2XVLA 2P5BA 3PUQA 1CAUA 2JICA 3SCHA 1UYPA 1EV13 4COVA 5EP9A 5IK4A 1K42A 2HYXA 4IEOA 1XSQA 2A6ZA 4J1XA 1T2XA 3N36A 3SXWA 4YFWA 3POWA 5A6YA 2JE9A 2HWB1 1W9YA 4L97A 1LOGA 4MGKE 1GV9A 4MUVA 2NM1A 4AWDA 3WV6A 2RDSA 4PIZA 4RHV3 4WZFA 4CE8A 2RDQA 3NNFA 5LASA 1S0IA 5JWPA 5GLVA 1JZ8A 2G19A 2JG9B 1OF3A 2ZTNA 3ZYHA 2HWE2 4AI2A 4BK4A 3EHKA 1U0AA 3LA3A 1TME1 3LDBA 2QVSB 4GB33 2WZEA 5DDJ1 1PK6A 1PMIA 1SBFA 2LS6A 1W6PA 4FO9A 3OY8B 4DOUA 2VZRA 2R071 3NAPA 1V6IA 2W1SA 2BBVA 2FDGA 4ZY9A 1N3OA 2NN8A 3I3QA 3I2KA 1FV3A 4G3YC 2WQ4A 1JUIA 4IUGA 1NE6A 4RYDA 2Z5WA 3IPVA 1X33A 2GMEA 4N43C 2K0GA 2NMNA 2XBO1 2ZZJA 4BXSV 2ZKNA 4EE2A 3GHNA 1OH4A 4LTAA 5IUQA 2VNGA 2EVXA
chains in the Genus database with same CATH topology
4MGQA 4OYUA 1UMIA 2CDPA 2J1EA 4YPJA 4OUEA 4A4AA 3T0DA 1O8SA 5FUIA 4CUBA 1CZVA 3CDZB 4TTGA 2V72A 3FHAA 3K4ZA 4QDSA 4W50A 3OEBA 2EIBA 2VZ1A 3MUY1 3C8XA 4ARYA 3A7QA 4CUAA 3WNPA 1H6XA 3C7OA 3W5MA 3GM8A 5C70A 2EIDA 3HOBA 4DXTA 3UNPA 2X05A 2VZTA 3T08A 4AG4A 4M4RA 2WN3A 2W1QA 2Y6HA 3I97A 2VZQA 1XNAA 3F2ZA 4A45A 2QQIA 1TG7A 3LE0A 5IFTA 3ACIA 1KGYA 3CMGA 3MV11 1JYNA 3CIHA 4ZZ8A 4BK5A 2V4VA 4XZUG 3SKJE 5JXIA 3PUIA 3VD9A 1GOFA 3OBAA 2J22A 5LA2A 1UMHA 2WDBA 1PX4A 2VZOA 2J7MA 4P08A 4CUCA 1CIYA 3LEGA 4A6OA 4A41A 4DEVA 4DEQA 2WUHA 3HN3A 2Y8KA 5G05L 2J1RA 4PQQA 2VZ3A 3BN6A 2JD9A 2VMFA 2ORZA 4XUTA 3CZJA 1UY0A 2HLEA 4CU9A 2DDUA 1US3A 4QDQA 4TXWA 1WKYA 3LEIA 2E32A 3OGVA 4ZZ5A 2W87A 2C9KA 3MV01 3MO4A 1GOGA 3I2JA 3HEIA 3WF0A 3IAQA 1WCQA 2BGPA 3WNKA 4E8DA 3P1IA 3CKHA 3I3EA 5DQ0A 3WF4A 5B4XA 2W3JA 5CYYA 3LPGA 4QB2A 2E26A 3WF3A 4W8JA 3HPNA 4KMQA 3FHQA 2V5DA 3WNLA 2QBXA 4BDVB 2VR4A 2VC9A 4UAPA 4PF1A 1UY1A 4ZXEA 3MUZ1 2YB7A 4BJ0A 1F4AA 4QX1A 1W9WA 2WZ8A 1GQPA 1EUTA 2Y64A 4UI9L 1R64A 2BBAA 3P6BA 2X10A 2QQKA 1W0NA 2W47A 3AC0A 2XONA 4OMDA 1UZ0A 4QB6A 2VMDA 3ETPA 2VL4A 4JX0A 1W9TA 2W95A 2B9VA 2W5FA 2B4KA 1XC6A 2BZDA 5JMOA 5JXJA 2EICA 4MOAA 1CX1A 3SEEA 1K12A 2DCKA 3DYOA 3WEZA 2WO2A 4LPLA 3VDBA 2XHNA 3JXSA 2YFZA 5IFPA 2J1TA 3WNOA 4LQRA 4QAWA 3GDBA 1BHGA 2J1UA 2W9XA 1UY2A 1JU3A 5IHRA 5JUVA 2QQNA 1DYOA 5EJ1B 1UX7A 4JKLA 2LW8A 3T09A 3A21A 1UYXA 4XUQA 3ECQA 3VDAA 1NX9A 1JYXA 1TVGA 4MO3M 2ORXA 3NJVA 3D3AA 3SKVA 2YG0A 3WF2A 3WNNA 3I2IA 3IIIA 3VD5A 4A42A 2WO3A 1JYVA 3T0BA 4OZOA 1OF4A 2ZEZA 4LHSA 3VD7A 5DMYA 1UWWA 3K4DA 1SHWB 2YFUA 4Z2AA 3MBWA 3K77A 1PMJX 5JXGA 3WF1A 4XUPA 3I3BA 2VO5A 1F4HA 1J84A 4CU6A 5LA0A 2WAAA 4A44A 3IB3A 3LQCA 1EUUA 3GXUA 4CU8A 1RYYA 4ARXA 3ACHA 3EYPA 1KEXA 2J1AA 3GGLA 2QQMA 3DYPA 4E8CA 2CDOA 2WBKA 4PT6A 4MADA 4D0QA 5JR2A 2E31A 2BERA 1XPWA 1O59A 2JDAA 3A22A 3UESA 5CZKA 4OMCA 1K3IA 1UXZA 2XOMA 2J1SA 4ET7A 5C7GA 2W94A 2VMEA 4GWJA 3T2OA 2VJXA 3IAPA 3OEAA 1ULPA 4CU7A 3CZUA 3I3DA 2ZXQA 3HNMA 4D8MA 3C7HA 5F7UA 1MPXA 2XQXA 1UYZA 1NAEA 3THCA 1LNSA 1J83A 1GU3A 1JU4A 1D7PM 4A3ZA 2E33A 4MGSA 3I2FA 1GNYA 4QPWA 4DUVA 1JZ7A 1NKGA 1JYWA 3SEPA 4RN5A 1UYYA 2VZSA 2C26A 2VMCA 5DN2A 3U37A 4JKKA 2QQLA 1UXXX 4DUWA 2QQJA 3ABZA 3T2PA 2BGOA 4XUNA 5DPNA 2PQSA 5A1AA 3T2QA 3DYMA 4QB1A 3WSOA 5JXHA 1I5PA 2VZUA 1JZ2A 3J7HA 1H6YA 2ZEXA 1OD3A 2WN2A 2Y6KA 4AAXA 2VTFA 3OGRA 4GZ9A 2RV9A 5IYYA 1OT5A 4P5YA 5B4NA 1SG3A 2VQUA 3VD4A 2W92A 2KD7A 3LEKA 5IJRA 2WYSA 3A23A 2J1VA 1PX3A 5J1XA 3ACGA 1CZTA 2VQTA 3C7EA 2W1UA 4XVHA 4DUXA 1PMHX 3BGAA 4JHZA 2RVAA 2WO1A 3NJXA 5LCWL 5LA1A 4GWIA 1JZ6A 3NRUA 1JHJA 2JE8A 1GOHA 3HNBM 2ZEYA 1DLCA 1W8NA 4KI5M 2VZPA 2YC2A 3K75B 1XNTA 1JZ4A 2W46A 1O8PA 2W91A 5HPOA 3I2HA 4QDRA 2Y6LA 3DECA 1YQ2A 1W8OA 3K4AA 3LPFA 2Z4FA 3FN9A 3OB8A 2Y6JA 3WNMA 4L0PA 4CVUA 2OKXA 5EIYB 1W9SA 2VM9A 1JI6A 3FL7A 4QX0A 5EJZB 1W99A 2EIEA 2L9LA 3I2GA 5I0DA 2ID4A 3ACFA 1L7RA 3VDCA 2DCJA 1IQDC 1CZSA 3C7GA 1JZ5A 4LKSA 4QX3A 3E1F1 3EB7A 3HJRA 2JKXA 2VZVA 1L7QA 4XUOA 3CQOA 3ZM8A 3NNGA 1SDDB 4JKMA 2X09A 4UOJA 1JZ3A 1GMMA 1NUKA 1UY3A 2R7EB 3IDAA 2C4XA 4P00B 4M4PA 4DXRA 3VD3A 3W5NA 2Y6GA 1K42A 3T0AA 1GUIA 2HYXA 1UY4A 3THDA 1P8JA 1T2XA 3PUHA 3NQHA 2QQOA 2RJ2A 3WQBA 4QX2A 3C7FA 3OGSA 1HN1A 2VOTA 1DP0A 1JZ8A 1K45A 1US2A 4W4ZA 1OF3A 2VCBA 3K46A 4BK4A 2WQ8A 2WAOA 2ZEWA 2WZEA 3UETA 2LS6A 5C71A 2WABA 2VZRA 4XURA 2W1SA 4ZY9A 3I2KA 4HG6B 2W1WA 4P02B 3OG2A 3HNYM 2VCCA 4FI9A 5HXMA 4IUGA 4RYDA 1ULOA 2YC4A 4BXSV 5G04L 4DXSA 1OH4A 2VCAA 4KWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGQ A;  4OYU A;  1UMI A;  2CDP A;  2J1E A;  4YPJ A;  4OUE A;  4A4A A;  3T0D A;  1O8S A;  5FUI A;  4CUB A;  1CZV A;  3CDZ B;  4TTG A;  2V72 A;  3FHA A;  3K4Z A;  4QDS A;  4W50 A;  3OEB A;  2EIB A;  2VZ1 A;  3MUY 1;  3C8X A;  4ARY A;  3A7Q A;  4CUA A;  3WNP A;  1H6X A;  3C7O A;  3W5M A;  3GM8 A;  5C70 A;  2EID A;  3HOB A;  4DXT A;  3UNP A;  2X05 A;  2VZT A;  3T08 A;  4AG4 A;  4M4R A;  2WN3 A;  2W1Q A;  2Y6H A;  3I97 A;  2VZQ A;  1XNA A;  3F2Z A;  4A45 A;  2QQI A;  1TG7 A;  3LE0 A;  5IFT A;  3ACI A;  1KGY A;  3CMG A;  3MV1 1;  1JYN A;  3CIH A;  4ZZ8 A;  4BK5 A;  2V4V A;  4XZU G;  3SKJ E;  5JXI A;  3PUI A;  3VD9 A;  1GOF A;  3OBA A;  2J22 A;  5LA2 A;  1UMH A;  2WDB A;  1PX4 A;  2VZO A;  2J7M A;  4P08 A;  4CUC A;  1CIY A;  3LEG A;  4A6O A;  4A41 A;  4DEV A;  4DEQ A;  2WUH A;  3HN3 A;  2Y8K A;  5G05 L;  2J1R A;  4PQQ A;  2VZ3 A;  3BN6 A;  2JD9 A;  2VMF A;  2ORZ A;  4XUT A;  3CZJ A;  1UY0 A;  2HLE A;  4CU9 A;  2DDU A;  1US3 A;  4QDQ A;  4TXW A;  1WKY A;  3LEI A;  2E32 A;  3OGV A;  4ZZ5 A;  2W87 A;  2C9K A;  3MV0 1;  3MO4 A;  1GOG A;  3I2J A;  3HEI A;  3WF0 A;  3IAQ A;  1WCQ A;  2BGP A;  3WNK A;  4E8D A;  3P1I A;  3CKH A;  3I3E A;  5DQ0 A;  3WF4 A;  5B4X A;  2W3J A;  5CYY A;  3LPG A;  4QB2 A;  2E26 A;  3WF3 A;  4W8J A;  3HPN A;  4KMQ A;  3FHQ A;  2V5D A;  3WNL A;  2QBX A;  4BDV B;  2VR4 A;  2VC9 A;  4UAP A;  4PF1 A;  1UY1 A;  4ZXE A;  3MUZ 1;  2YB7 A;  4BJ0 A;  1F4A A;  4QX1 A;  1W9W A;  2WZ8 A;  1GQP A;  1EUT A;  2Y64 A;  4UI9 L;  1R64 A;  2BBA A;  3P6B A;  2X10 A;  2QQK A;  1W0N A;  2W47 A;  3AC0 A;  2XON A;  4OMD A;  1UZ0 A;  4QB6 A;  2VMD A;  3ETP A;  2VL4 A;  4JX0 A;  1W9T A;  2W95 A;  2B9V A;  2W5F A;  2B4K A;  1XC6 A;  2BZD A;  5JMO A;  5JXJ A;  2EIC A;  4MOA A;  1CX1 A;  3SEE A;  1K12 A;  2DCK A;  3DYO A;  3WEZ A;  2WO2 A;  4LPL A;  3VDB A;  2XHN A;  3JXS A;  2YFZ A;  5IFP A;  2J1T A;  3WNO A;  4LQR A;  4QAW A;  3GDB A;  1BHG A;  2J1U A;  2W9X A;  1UY2 A;  1JU3 A;  5IHR A;  5JUV A;  2QQN A;  1DYO A;  5EJ1 B;  1UX7 A;  4JKL A;  2LW8 A;  3T09 A;  3A21 A;  1UYX A;  4XUQ A;  3ECQ A;  3VDA A;  1NX9 A;  1JYX A;  1TVG A;  4MO3 M;  2ORX A;  3NJV A;  3D3A A;  3SKV A;  2YG0 A;  3WF2 A;  3WNN A;  3I2I A;  3III A;  3VD5 A;  4A42 A;  2WO3 A;  1JYV A;  3T0B A;  4OZO A;  1OF4 A;  2ZEZ A;  4LHS A;  3VD7 A;  5DMY A;  1UWW A;  3K4D A;  1SHW B;  2YFU A;  4Z2A A;  3MBW A;  3K77 A;  1PMJ X;  5JXG A;  3WF1 A;  4XUP A;  3I3B A;  2VO5 A;  1F4H A;  1J84 A;  4CU6 A;  5LA0 A;  2WAA A;  4A44 A;  3IB3 A;  3LQC A;  1EUU A;  3GXU A;  4CU8 A;  1RYY A;  4ARX A;  3ACH A;  3EYP A;  1KEX A;  2J1A A;  3GGL A;  2QQM A;  3DYP A;  4E8C A;  2CDO A;  2WBK A;  4PT6 A;  4MAD A;  4D0Q A;  5JR2 A;  2E31 A;  2BER A;  1XPW A;  1O59 A;  2JDA A;  3A22 A;  3UES A;  5CZK A;  4OMC A;  1K3I A;  1UXZ A;  2XOM A;  2J1S A;  4ET7 A;  5C7G A;  2W94 A;  2VME A;  4GWJ A;  3T2O A;  2VJX A;  3IAP A;  3OEA A;  1ULP A;  4CU7 A;  3CZU A;  3I3D A;  2ZXQ A;  3HNM A;  4D8M A;  3C7H A;  5F7U A;  1MPX A;  2XQX A;  1UYZ A;  1NAE A;  3THC A;  1LNS A;  1J83 A;  1GU3 A;  1JU4 A;  1D7P M;  4A3Z A;  2E33 A;  4MGS A;  3I2F A;  1GNY A;  4QPW A;  4DUV A;  1JZ7 A;  1NKG A;  1JYW A;  3SEP A;  4RN5 A;  1UYY A;  2VZS A;  2C26 A;  2VMC A;  5DN2 A;  3U37 A;  4JKK A;  2QQL A;  1UXX X;  4DUW A;  2QQJ A;  3ABZ A;  3T2P A;  2BGO A;  4XUN A;  5DPN A;  2PQS A;  5A1A A;  3T2Q A;  3DYM A;  4QB1 A;  3WSO A;  5JXH A;  1I5P A;  2VZU A;  1JZ2 A;  3J7H A;  1H6Y A;  2ZEX A;  1OD3 A;  2WN2 A;  2Y6K A;  4AAX A;  2VTF A;  3OGR A;  4GZ9 A;  2RV9 A;  5IYY A;  1OT5 A;  4P5Y A;  5B4N A;  1SG3 A;  2VQU A;  3VD4 A;  2W92 A;  2KD7 A;  3LEK A;  5IJR A;  2WYS A;  3A23 A;  2J1V A;  1PX3 A;  5J1X A;  3ACG A;  1CZT A;  2VQT A;  3C7E A;  2W1U A;  4XVH A;  4DUX A;  1PMH X;  3BGA A;  4JHZ A;  2RVA A;  2WO1 A;  3NJX A;  5LCW L;  5LA1 A;  4GWI A;  1JZ6 A;  3NRU A;  1JHJ A;  2JE8 A;  1GOH A;  3HNB M;  2ZEY A;  1DLC A;  1W8N A;  4KI5 M;  2VZP A;  2YC2 A;  3K75 B;  1XNT A;  1JZ4 A;  2W46 A;  1O8P A;  2W91 A;  5HPO A;  3I2H A;  4QDR A;  2Y6L A;  3DEC A;  1YQ2 A;  1W8O A;  3K4A A;  3LPF A;  2Z4F A;  3FN9 A;  3OB8 A;  2Y6J A;  3WNM A;  4L0P A;  4CVU A;  2OKX A;  5EIY B;  1W9S A;  2VM9 A;  1JI6 A;  3FL7 A;  4QX0 A;  5EJZ B;  1W99 A;  2EIE A;  2L9L A;  3I2G A;  5I0D A;  2ID4 A;  3ACF A;  1L7R A;  3VDC A;  2DCJ A;  1IQD C;  1CZS A;  3C7G A;  1JZ5 A;  4LKS A;  4QX3 A;  3E1F 1;  3EB7 A;  3HJR A;  2JKX A;  2VZV A;  1L7Q A;  4XUO A;  3CQO A;  3ZM8 A;  3NNG A;  1SDD B;  4JKM A;  2X09 A;  4UOJ A;  1JZ3 A;  1GMM A;  1NUK A;  1UY3 A;  2R7E B;  3IDA A;  2C4X A;  4P00 B;  4M4P A;  4DXR A;  3VD3 A;  3W5N A;  2Y6G A;  1K42 A;  3T0A A;  1GUI A;  2HYX A;  1UY4 A;  3THD A;  1P8J A;  1T2X A;  3PUH A;  3NQH A;  2QQO A;  2RJ2 A;  3WQB A;  4QX2 A;  3C7F A;  3OGS A;  1HN1 A;  2VOT A;  1DP0 A;  1JZ8 A;  1K45 A;  1US2 A;  4W4Z A;  1OF3 A;  2VCB A;  3K46 A;  4BK4 A;  2WQ8 A;  2WAO A;  2ZEW A;  2WZE A;  3UET A;  2LS6 A;  5C71 A;  2WAB A;  2VZR A;  4XUR A;  2W1S A;  4ZY9 A;  3I2K A;  4HG6 B;  2W1W A;  4P02 B;  3OG2 A;  3HNY M;  2VCC A;  4FI9 A;  5HXM A;  4IUG A;  4RYD A;  1ULO A;  2YC4 A;  4BXS V;  5G04 L;  4DXS A;  1OH4 A;  2VCA A;  4KWU A; 
#chains in the Genus database with same CATH topology
 2PXJ A;  4AZZ A;  1AUY A;  3I3M A;  3O5S A;  2RDN A;  3ZYR A;  4Q26 A;  5T5L A;  3WDY A;  4A4A A;  5LWB A;  3J9S A;  1ACC A;  1HRV 1;  1RC6 A;  3HQR A;  1CZV A;  3IMN A;  4LKF A;  2V5Y A;  5T55 A;  1OUR A;  2JDZ A;  3GZA A;  4C1X A;  4TTG A;  4FOQ A;  1RED A;  1G7Y A;  2NMO A;  2RS3 2;  1LHW A;  1BBT 2;  1O3Q A;  4QDS A;  1N1S A;  5K0U B;  1ZX5 A;  4W50 A;  1RUF 2;  1E57 A;  2KXL A;  1DU3 D;  1QWR A;  4XIK A;  3ZPO A;  4JGZ B;  3E6B A;  5FPA A;  1MQT B;  1W04 A;  4GJZ A;  4CUA A;  5A6Z A;  3WNP A;  3DL3 A;  3FLT A;  1LOD A;  3C7O A;  3W5M A;  1J3Q A;  4RS5 B;  5FPB A;  3V65 A;  4E2G A;  3HOB A;  2X29 A;  4DXT A;  1Q8S A;  4AG4 A;  3T08 A;  4A7K A;  5FZ9 A;  1C8M 1;  2RJK A;  1GZW B;  4M4R A;  3KT1 A;  3ZFF A;  3I97 A;  5E8A A;  5HI0 A;  2JE7 A;  1YRZ A;  5J37 A;  2IXJ A;  3LE0 A;  4FSJ A;  4LUK A;  1O4Z A;  3LKJ A;  3ZLI A;  1PGW 1;  4Y4R A;  1KGY A;  5FYI A;  5JOW A;  1F5F A;  1JYN A;  3JD7 2;  5HCA A;  1C5I A;  2A7A A;  3M2M A;  4AHZ A;  4XXA A;  4CPB A;  1DYP A;  4AFD A;  2MPF A;  2RS1 1;  2BWA A;  1HJF A;  1BXH A;  3H3L A;  1ZZ9 A;  1RUE 1;  3N3H A;  2J22 A;  5LA2 A;  4UXA A;  4QPG A;  4ASL A;  4Q0P A;  3KGL A;  4FAH A;  3PUA A;  1CPN A;  2PHU A;  2ZJC A;  4ATE A;  1ZZ7 A;  1IS6 A;  1ZBE 1;  1PX4 A;  5D2A A;  1B35 B;  3R6S A;  2ADD A;  2J7M A;  3RI8 A;  3TN9 1;  2X8K A;  4LT5 A;  2JXA A;  1F8V A;  4Y1U A;  1CIY A;  5LA9 A;  1SLI A;  5IK8 A;  4D69 A;  3VZM A;  2FQP A;  5F5C A;  2J1R A;  5G05 L;  1H30 A;  1W2A X;  3IZO A;  2NYY A;  3NKG A;  1WUV A;  3WP3 A;  4H3W A;  2JD9 A;  5FCC A;  3B9C A;  4K8R B;  4KU8 A;  3CZJ A;  1LTE A;  4I0B A;  1PHM A;  1YJL A;  2VOX A;  4IQP A;  5FO7 B;  1UKR A;  4OI0 A;  1XE7 A;  2GC2 A;  4CU9 A;  3SMH A;  2B39 A;  3CEW A;  2E9Q A;  4QDQ A;  4OZX A;  4QKN A;  3SCG A;  4AVV A;  2WZR 2;  5FZ0 A;  1WKY A;  4CCK A;  2QQW A;  2HH9 A;  3O0V A;  2X53 S;  4XIL A;  3ZIW A;  1OKQ A;  3ITQ A;  1RUH 2;  5CKN A;  2E32 A;  2Q1Z B;  2ZA9 A;  3OGV A;  4TZD A;  3LIH A;  1ND2 A;  2OZJ A;  4HT1 T;  4CP0 A;  3UGG A;  2VQA A;  1AYN 3;  1V6K A;  3MHZ A;  1CD3 G;  1RHI 1;  4E9K A;  3ASI A;  3I7D A;  1QEX A;  3MO4 A;  5F3I A;  5FAX A;  3I2J A;  2PLV 3;  3HEI A;  3OY8 A;  4OHX A;  4E4D X;  4BQW A;  1WCQ A;  2XJT A;  3M3I A;  1IKP A;  3WNK A;  3E6D A;  4E8D A;  3RS6 A;  3N4M A;  1VBA 3;  3KSC A;  4MLO A;  4OUS A;  2UWC A;  2G1M A;  4O9E A;  1W8U A;  3K3O A;  5B4X A;  3TEW A;  2WT1 A;  3ZFG B;  3RWN A;  1ST8 A;  3DEM A;  4ZS2 A;  4LO5 B;  1WBL A;  1MR5 A;  4QPI B;  4K9S A;  4OCT A;  5EWS A;  4M0H A;  4FFF A;  4C90 A;  2BYV E;  5AVA A;  2ZZQ A;  4ES9 A;  4BIS A;  2KA3 A;  4CDW A;  1N1T A;  2YBS A;  3FHQ A;  2V5D A;  1I1E A;  2R1D A;  4OQ9 A;  2WWS A;  2W0X A;  4DIN B;  2OPW A;  1LRH A;  4P9W A;  4CTE A;  1W2U A;  4HET A;  1IG0 A;  2VC9 A;  1BVV A;  2XL9 A;  4UAP A;  4PHZ A;  4PF1 A;  1V9U 2;  4WM7 B;  4CZS A;  5LZ6 A;  2BNO A;  1Q8V A;  5L9R A;  4CCJ A;  3AFG A;  4BJ0 A;  2JDK A;  4AI1 A;  1F4A A;  4XBN A;  2FCU A;  2FHR A;  2WZ8 A;  4Z82 A;  1XOY A;  1EUT A;  2Y64 A;  1D0H A;  1V00 A;  2A3X A;  5K0U A;  2CGN A;  2EXH A;  4UBG A;  2D97 A;  1W6Q B;  2E7T A;  3T3Y A;  2FDF A;  3P6B A;  1ENX A;  1JW6 A;  3ZYF A;  1MQT A;  1YQ5 A;  4RFR B;  4TLF A;  2R06 2;  4BIO A;  4CDU B;  4YAR A;  4XFI A;  4GH4 C;  2G4I A;  3J7N A;  1LU1 A;  1H8V A;  4XPV A;  1EV1 1;  4KBZ A;  4C0H A;  2XON A;  3V0A B;  4OMD A;  3F95 A;  4RS5 A;  1Y9G A;  5FY5 A;  3MFA A;  3H7J A;  5FMO S;  1COV 3;  4D7Y A;  1YJK A;  3WHT A;  4CEW C;  1W9T A;  4CA9 A;  3FBY A;  1PGL 2;  4CCO A;  3AMN A;  2W5F A;  2FMY A;  5A70 A;  5JMO A;  4I3G A;  4RHV 1;  4D6S A;  2ZGU A;  5EQU A;  1QMJ A;  1WCS A;  2EIC A;  2PFW A;  5CFC B;  3JBG 2;  3VKM A;  1N3Q A;  1CON A;  4PLO A;  4B4R A;  1GP5 A;  1XBF A;  5BPX A;  2DVG A;  1K12 A;  2NQY A;  1UOG A;  4X8N A;  4GB3 1;  4CSW A;  3LWC A;  1GZ9 A;  3KGZ A;  3ZDV A;  2TBV A;  1H4H A;  4MYE A;  4BH9 A;  2XHN A;  2RM2 3;  5C4W A;  1QQP 3;  4YG6 A;  5IFP A;  2VUA A;  4UFJ A;  5KHK A;  1B35 A;  3K51 A;  3WNO A;  4LQR A;  2WC2 A;  3ZN5 A;  2W9X A;  1U5Y A;  4JZR A;  2ARX A;  3CBN A;  1UX7 A;  4YGB A;  5EJ1 B;  3ZFE A;  4WVV A;  4MXW B;  2AEN A;  4CDQ B;  3AP6 A;  3I59 B;  1YUD A;  3T09 A;  5EXO A;  3VBF B;  1OPO A;  1C1L A;  1YFX A;  1NX9 A;  4KWL A;  3AXD A;  2H6C A;  4IV3 B;  4D7T A;  3SKV A;  2YG0 A;  3AMM A;  5F7U A;  2DYC A;  1NA1 C;  1RJ7 A;  5JOY A;  1FAY A;  2KR2 A;  1LUL A;  1W3X A;  2YV8 A;  1EP0 A;  2VPV A;  3ZPY A;  5BY5 A;  3AJY A;  2IVJ A;  1R08 2;  2Q5T A;  1PZ7 A;  3HIF A;  3Q8A A;  1VIW B;  2CYF A;  1JXN A;  4OZO A;  5FDB A;  2O8O A;  3FX3 A;  4MGI E;  3VD7 A;  5ACA 2;  3MZH A;  4BYY A;  3N7M A;  4X8P A;  4LMF A;  1IS3 A;  4B29 A;  4GWN A;  2YUE A;  2XXZ A;  4K7J A;  5I8S A;  4Z2A A;  5FZK A;  3TEY A;  5CG9 A;  1QXR A;  1HRI 3;  3MBW A;  5ISL A;  2V09 A;  1PMJ X;  2P4E A;  5JXG A;  1BEV 3;  4DQA A;  3Q8B A;  1H2M A;  2VO5 A;  3KHC A;  1O6U A;  2HWC 2;  5CKQ A;  3FZ3 A;  3P5B A;  4QPI A;  4A44 A;  1EAH 3;  5KXE A;  2PHW A;  2VNO A;  2FZ1 A;  4QQO A;  1PO1 1;  5ANQ A;  3MF9 A;  1PK6 C;  1Q8Q A;  2Q8D A;  3SH4 A;  3W9A A;  4B4Q A;  1KEX A;  5GLW A;  2Y0O A;  4OUM A;  4PIX A;  3RZL A;  2C1F A;  4PQ9 A;  3NAP C;  2DTY A;  1Z0H A;  1NQJ A;  3DYP A;  4E8C A;  2XLF A;  5A3M A;  2WBK A;  4R4Z A;  2ARE A;  4MAD A;  4RGG A;  1LEN A;  3UK9 A;  2R32 A;  4I3P A;  1UU4 A;  3A22 A;  3BPS A;  2A6V A;  1S55 A;  5C9A A;  4NID A;  2DVA A;  3GZE A;  1SLB A;  1S0G A;  4COW A;  1NE4 A;  4OLL A;  2X5I C;  4CDU A;  4XF1 A;  5A80 A;  1RXG A;  4AVS A;  3JB8 A;  3R05 A;  4XZP A;  2WS9 3;  2DVD A;  4ISR A;  3GBF A;  4R9D A;  3KB5 A;  4NAO A;  2BEO A;  3AKR A;  3V0A A;  3IAP A;  1FOD 2;  1NT0 A;  2BVV A;  4XDQ A;  2DUP A;  2SLI A;  3J7M A;  4WM8 B;  2R0F A;  1R1A 2;  3POE A;  1OSG A;  1YFW A;  4CXY A;  3HNM A;  4QQH A;  3ZYG A;  3C7H A;  3O1R A;  3AMQ A;  5T3N A;  4Q4Y 2;  1JYC A;  3N9N A;  1OC1 A;  1UNB A;  4FQ4 A;  3QBQ A;  2GSY A;  3ZYI B;  1GSL A;  3U78 A;  5ANN A;  1W0P A;  2D5H A;  4MVT A;  2WKK A;  4B1L A;  4ZU7 A;  1H1M A;  1AYN 1;  3WNX A;  4U36 A;  1JOB A;  1OLM A;  3KVB A;  4EN6 B;  3I2F A;  1GNY A;  1Y4W A;  1MZF A;  3S6P A;  3BB6 A;  2D3S A;  3SLI A;  2PLV 1;  1J1T A;  4K1Y A;  3ZFF C;  1RUO A;  1MVQ A;  2F4L A;  4HK8 A;  2UUR A;  4K3U A;  1VBA 1;  4LIV A;  2C26 A;  3NV2 A;  3WHU A;  2VMG A;  2VMC A;  3NV1 A;  4FOV A;  4F7Z A;  1JOP A;  1DIW A;  3BAL A;  4DUW A;  3I59 A;  4HBN A;  2QQJ A;  2AUY A;  1LOF A;  4UYB A;  4K6B A;  4W6Y A;  1FX5 A;  1AHS A;  3GHM A;  5A1A A;  4QPG C;  1ZZ6 A;  2FMD A;  4GXL A;  4PLN A;  1HB3 A;  1ND3 A;  4IV3 A;  1LOA A;  4QB1 A;  1DLL A;  5FZ8 A;  4Y3O A;  4FFH A;  2YPD A;  1JZ2 A;  1Z78 A;  4HAN A;  3T2T A;  4NRM A;  1W05 A;  2PN5 A;  1DGW X;  1VBE 2;  2XWB B;  4IXL A;  3KQR A;  4YRD A;  3M3Q A;  5F3C A;  1PO2 3;  3PUR A;  4GZ9 A;  4LBK A;  1WMD A;  1SBE A;  2VNV A;  4AVB A;  2EF6 A;  2WNO A;  1YQC A;  5FKB A;  2GMP A;  5A1L A;  1OA3 A;  2ZAC A;  2DVB A;  2WFF 3;  4UFM A;  4XF3 A;  3LEK A;  3AYD A;  4JCK A;  1PZ9 A;  3RI9 A;  4Z8B A;  1QJX 3;  1AL0 G;  1U5I A;  2PMW B;  3KZ4 C;  3ZXK A;  2FBE A;  3PVE A;  3RZM A;  2A70 A;  2OT7 A;  4GAL A;  2JB8 A;  3C7E A;  3WG4 A;  1COV 1;  2MHF A;  3IDC B;  3ON7 A;  2RMU 3;  1ND2 C;  1RUG 2;  4YVS B;  2P3K A;  4XCA A;  1OKO A;  5JZG B;  3BGA A;  3KQ4 B;  4P14 A;  1QJY 3;  1IS4 A;  4AI3 A;  4GWI A;  2O14 A;  3AMH A;  1YXW A;  1W2N A;  5KXC A;  1XJA A;  3B93 A;  1GOH A;  4OI1 A;  3HNB M;  4LBQ B;  2ZEY A;  2IWG B;  3AP9 A;  5GM0 A;  5IVY A;  2R30 A;  2QCS B;  2RM2 1;  4C1W A;  1QQP 1;  2A71 A;  4XAA A;  1VBD 3;  5A3U A;  4FOY A;  2W46 A;  2PHX A;  4Q5O A;  3E5Q A;  4LK6 A;  5DAW A;  5H9S A;  4CDW C;  4CDX B;  3THT A;  1TQ5 A;  3TNQ A;  4GMP 3;  1X8M A;  4TSV A;  3N9O A;  5LB6 A;  1LHO A;  3WNM A;  1BYH A;  2OZ6 A;  1AR9 2;  2SBA A;  1OFS A;  2Y38 A;  4JQR A;  1RVF 2;  3UJO A;  1H2K A;  1W9S A;  2VM9 A;  1CJD A;  3PHM A;  2F6B A;  2ZPX A;  3D0J A;  5CBL A;  5K0U C;  4DNY A;  2VAU A;  1W8H A;  4Q2F A;  4GAZ A;  3I4I A;  3H50 A;  1AX2 A;  1QJU 3;  4HN1 A;  2P6C A;  3T1L A;  1MQT C;  1RJ8 A;  1IS5 A;  4TWT A;  1OVP A;  3AMP A;  3CF6 E;  2VVF A;  2XVG A;  3OYW B;  4BQX A;  4M3C F;  4IL7 A;  1IQD C;  2ZHL A;  4PI2 A;  2RR1 2;  1J59 A;  3C7G A;  4RS5 C;  2OYZ A;  4FPL A;  4QX3 A;  1QDC A;  2PA7 A;  2RS3 3;  4FPK A;  3E1F 1;  3VBO B;  1ULE A;  4I30 A;  1SEF A;  1AYM 1;  2JG8 B;  1HRI 1;  2E6V A;  1JZ3 A;  1OPM A;  2OVU A;  1NUK A;  4FTB A;  1POV 3;  4TN7 A;  4Y26 A;  3CNA A;  4B3N A;  4ATF A;  4E27 A;  3IDA A;  3LDK A;  3HBZ A;  4DXR A;  5JMC A;  3VKN A;  4JRL A;  3VBR B;  1EAH 1;  2XR4 A;  2CAU A;  4IEY A;  4B1M A;  1GUI A;  1YHF A;  3RWK X;  5FZI A;  5AC9 3;  1UY4 A;  4UW6 A;  5A7W B;  4B7K A;  4GMP 0;  5C4W C;  2WWJ A;  4XTM A;  3PUH A;  2P1B A;  3NQH A;  5FZA A;  4S2F A;  1B35 C;  1YLL A;  4NOT A;  2C0Z A;  3JD7 3;  4GKX A;  3TNP B;  3PLQ A;  2VEC A;  2W68 A;  5GZF A;  4XIO A;  1PZ8 A;  1IPS A;  5LBB A;  3UKT A;  3WW2 A;  2VOT A;  1DGL A;  4QT6 A;  3ZFE C;  3RZJ A;  1DP0 A;  3O7O A;  1HV0 A;  3HQX A;  1CX4 A;  1FMD 3;  2VCB A;  3LD8 A;  4JC1 A;  4PDW B;  4RR3 A;  3OGG A;  2YBP A;  3VBS A;  2QE3 A;  3OD0 A;  3UET A;  2DCT A;  4LLO A;  1ZA7 A;  1W2O A;  2WAB A;  5FXZ A;  4G9S B;  1D0G A;  2RDR A;  3GNE A;  3JQW A;  2WNV B;  4IV1 A;  3O1T A;  3NVC A;  3T30 A;  1HXS 2;  1K5J A;  4YZ3 A;  4LHN A;  4AR2 A;  4HG6 B;  2D5F A;  1C8M 3;  4YVS A;  2GN7 A;  2DFC A;  4OHW A;  1LEM A;  2W2I A;  4BOW A;  5F37 A;  3HN1 A;  4HOO A;  1POV 0;  4HPK B;  5JSO A;  1HJG A;  1ZRF A;  1OBN A;  1N3P A;  2BP6 A;  2BGC A;  2ZOE B;  1AR8 2;  4IGO A;  4KWU A;  3J8F 2;  5GJ6 A;  4ORF A;  5A3L A;  1UMI A;  5LW9 A;  2CDP A;  2UWA A;  4CEY B;  4LBQ A;  1GWK A;  1GWM A;  2R0H A;  3T0D A;  2ET7 A;  4Z92 B;  1O8S A;  1RUE 3;  3GBW A;  4CUB A;  2I2S A;  4BE3 A;  1QJF A;  1QNY A;  1ZBA 2;  1YIP A;  2HEY F;  4QPI C;  3O1U A;  3WLU A;  3FHA A;  3OUJ A;  5D1I A;  1QH6 A;  1SCS A;  1UPI A;  2LRO A;  4Q8K A;  3OEB A;  4YW2 A;  2HWD 2;  1LGN A;  2D6L X;  4F3J A;  1ZYB A;  2K2S A;  2OII A;  5DUV A;  4YW6 A;  4HFS A;  4V2W A;  4ARY A;  2YU1 A;  5FY4 A;  1OLR A;  2ARA A;  5T5J A;  4FBF A;  4X6Q B;  3ZDS A;  1GFF 2;  2LAL A;  2YRO A;  5ABJ A;  3HMY A;  3GM8 A;  3K48 A;  4B7E A;  3UNP A;  1C8N A;  2VZT A;  2XGX A;  3Q8C A;  4HMZ A;  5C9A C;  3F2Z A;  2VZQ A;  3N9Q A;  4LNV A;  4UBH A;  2OS2 A;  1TMF 2;  5IFT A;  2GH8 A;  4CDU C;  1RXF A;  2XUE A;  5FZC A;  3U4S A;  3MV1 1;  4KWK A;  4BQ2 A;  1LGC A;  1NXM A;  3CIH A;  4W6W A;  5DAV A;  4XZU G;  4ZZ8 A;  2WFF 1;  4N9H A;  5EHD A;  2LTN A;  4P9I A;  1RHI 3;  1GOF A;  2RS5 2;  3VBO A;  5CVR A;  4Y5S A;  1QJX 1;  1APN A;  1BJQ A;  1NCR A;  5J3U A;  1AJO A;  1OA2 A;  1S2E A;  3M4F A;  5LBC A;  1GQH A;  2R06 3;  2VZO A;  2VMI A;  3BTA A;  4N53 B;  5CFC C;  1DGR A;  2P37 A;  4CUC A;  2R04 2;  2C24 A;  3IWZ A;  1KJR A;  1FYU A;  5FO8 B;  1ULG A;  2RMU 1;  3LEG A;  4DEV A;  2VUJ A;  2WUH A;  3HN3 A;  2Y8K A;  3HAG A;  1AF9 A;  5FMC A;  3VBR A;  3X29 B;  1QJZ A;  1Y43 B;  4PQQ A;  1U5Z A;  3BN6 A;  2Y33 A;  4L92 A;  5LK7 B;  1HLC A;  2XJS A;  1WMX A;  2WYF A;  5DUU A;  5FY0 A;  3ES1 A;  3WG2 A;  4ERO A;  3O1V A;  2HLE A;  4XJW A;  1Z7S 2;  3J7L A;  4QU1 A;  1US3 A;  4HVR A;  5CIS A;  1Y3T A;  4XMI A;  1CIW A;  1BMV 2;  4NRO A;  5C6C A;  4XQD A;  1KQR A;  1LOB A;  1ENR A;  5JOX A;  1LOF C;  3PUS A;  4O7X A;  3VBF C;  4NVP A;  3D8C A;  4PDW A;  1C3H A;  3KT4 A;  4RGA A;  1REF A;  4YZ2 A;  3UYJ A;  1YFU A;  2C9K A;  2VW1 A;  1ND3 C;  4IV3 C;  4GMP 1;  3OJB A;  1PVX A;  1LAJ A;  4N90 A;  1UMZ A;  3AJZ A;  1PIV 2;  1OOP A;  2PHR A;  4LUL A;  2NLR A;  2RJL A;  2VH9 A;  2WNV A;  3NWK A;  1NLQ A;  4YG0 A;  4L2N A;  1SFN A;  2I45 A;  3RVH A;  5JPN B;  4Y1X A;  2WNU A;  3MEP A;  4GUL A;  3PIJ A;  2GP5 A;  1G9F A;  3N9L A;  5DQ0 A;  1RUI 2;  2D98 A;  4RA0 A;  1BKZ A;  5CYY A;  3Q8E A;  4FPF A;  4QB2 A;  5FJK A;  5JSR A;  1S0C A;  1QJU 1;  1MS5 A;  4FCA A;  3ZR6 A;  5FV3 A;  2DCZ A;  3UKN A;  5LRR A;  3ZXE A;  3ZXD A;  3K2O A;  1VJ2 A;  4ZS3 A;  1GBG A;  2BNM A;  3OUI A;  3VBU B;  1I9R A;  3AXE A;  3KVA A;  3ZYJ B;  5IAT A;  4JQT A;  1PGS A;  3N7L A;  2RS3 1;  4NN0 A;  1UOJ A;  3D6E A;  5BYN A;  1ZZ8 A;  4LE3 A;  1IHM A;  5FYT A;  5C8C B;  1GQP A;  2VVD A;  2WJS A;  5FZG A;  3ZIX A;  5A33 A;  1MEC 2;  1POV 1;  2VVE A;  4LO8 A;  3AP7 A;  1VRH 3;  5JR7 B;  1R64 A;  1R09 2;  1SLL A;  3LAG A;  2CTV A;  2OA2 A;  2BPA 2;  4KQ7 A;  2JEN A;  4MH0 E;  2BRT A;  1H8T A;  4JAA A;  4FPY A;  1JHN A;  3NW4 A;  4N8M A;  1JYT A;  4BM8 A;  3AC0 A;  5AC9 1;  1O4T A;  3C2U A;  4XF0 A;  1LGB A;  1NY7 1;  4FPC A;  4LHL A;  2B8M A;  4EWD A;  3WD5 A;  1UZ0 A;  2Z42 A;  2FDI A;  1DQ0 A;  2MEV 2;  3ETP A;  4ASK A;  3WUD A;  4XJA A;  5CIR A;  2VL4 A;  4JX0 A;  1RGS A;  3JD7 1;  2B9V A;  3BKZ A;  3BOD A;  4DY3 A;  5A7Q A;  2QTW B;  4OI4 A;  3HT2 A;  4ZON A;  2ZHM A;  5FYU A;  4CRQ A;  5L9V A;  4Q4W 2;  3VBH B;  4EYU A;  5BUV A;  1ASJ 3;  2JEM A;  3L2H A;  3VDD B;  2VD7 A;  2ETE A;  4F8A A;  3SEE A;  5L73 A;  3LOI A;  1FMD 1;  3NJY A;  1HN0 A;  4FPJ A;  5GZD A;  2DCK A;  3DYO A;  2G9Z A;  4M3C E;  2JIG A;  4JTN A;  4LPL A;  1HX6 A;  5FWJ A;  5I8T A;  3M3O A;  2ZGO A;  3TEZ A;  2HWB 2;  3ZSL A;  2DV9 A;  4OVE A;  3MI8 A;  1ZRR A;  4XDO A;  3DKW A;  4N53 A;  3RJ2 X;  1KRI A;  3GDB A;  1BHG A;  2J1U A;  4OFG A;  3APB A;  3BTZ A;  5IHR A;  1G8W A;  2QQN A;  3U11 A;  1VRB A;  4Q1R A;  2WT0 A;  5JI7 A;  3OSD A;  3GBG A;  3A21 A;  1VBB 3;  1TME 2;  2VW2 A;  4XUQ A;  3PU3 A;  4Q4Y 3;  5FZL A;  1VAM A;  5DDJ 2;  1PO1 3;  3VDA A;  1LHU A;  2F4P A;  5FXW A;  2UU8 A;  4IDZ A;  3DPR A;  2ORX A;  2R07 2;  4V1P A;  5T5P A;  3CU7 A;  3R0R A;  5IVV A;  2MNG A;  4YM2 A;  3M1H A;  3LB9 A;  3LSE A;  3WNN A;  4UWD A;  3I2I A;  3RSJ A;  3III A;  4KH9 A;  5BNO B;  4M0N A;  5FZ7 A;  4CEY A;  4EZ4 A;  4P9G A;  2VU9 A;  4A42 A;  3LGR A;  4RQP B;  4PBO A;  2BFU L;  5BXX A;  3RYK A;  3T0B A;  4AI0 A;  1WWY A;  2XL7 A;  3UGH A;  1OF4 A;  4CP9 B;  5LY2 A;  4IER A;  1BLZ A;  1A6C A;  3S7E A;  1H9W A;  4ZU5 A;  1UWW A;  3GJB A;  4LOR A;  3O1M A;  3PTY A;  2ZGS A;  4IGP A;  3EMR A;  1YIF A;  1UPS A;  4YGC A;  1HRV 2;  1G6N A;  1N1V A;  2JB4 A;  5DZF A;  4Y20 B;  4XUP A;  1NYW A;  2PHL A;  1KIT A;  1TNF A;  1J84 A;  2ZGQ A;  1WBF A;  5APA A;  2IFW A;  1VLN A;  4RR3 C;  5D8A B;  2XH6 A;  5E88 A;  2BJS A;  5K4L A;  4AHX A;  3IB3 A;  3LQC A;  3H1Y A;  1EUU A;  2A6Y A;  3VBS C;  5J48 A;  1RYY A;  4J25 A;  1RUJ 3;  5JIU A;  4K1Z A;  3EYP A;  4YZ5 A;  4OI2 A;  2JG9 A;  1UZZ A;  4QHZ A;  2QQM A;  4GD4 A;  4BA6 A;  4IV1 C;  2CDO A;  3LZZ A;  1LOE A;  4PT6 A;  2HKX A;  4D0Q A;  5FP9 A;  4E4S A;  5HV0 A;  5GZC A;  1V6L A;  2GND A;  2BER A;  1RUD 3;  1XPW A;  4ZPI A;  4BMB A;  4CXX A;  4YVS C;  5C8C A;  4QM8 A;  3U1X A;  2R06 1;  5CZK A;  2D44 A;  3FLP A;  5C3R A;  1PGW 2;  2V4A A;  2ENR A;  2J1S A;  2XOM A;  4Q4V 2;  4NIH A;  3AFK A;  3POJ A;  1PNF A;  3NKT A;  1D4M 3;  3KV6 A;  1FT9 A;  1RMU 3;  3MIB A;  2RS1 2;  1BK0 A;  2C5D A;  4IEV A;  4O65 A;  5FYZ A;  3KV4 A;  4ZKT B;  4GWJ A;  4XQ4 A;  2ZKL A;  2VJX A;  3M3C A;  5GLT A;  5BNN B;  4NWV A;  3AYA A;  5AVP A;  5FZF A;  1PGL 1;  4NHX A;  3CZU A;  4CU7 A;  3H8U A;  5JI9 A;  4WVM B;  1GR3 A;  5I93 A;  3TRS B;  3LSD A;  3I49 A;  1ZBE 2;  1F2N A;  1MPX A;  3IM0 A;  3ST7 A;  1S0F A;  2WFP A;  2I74 A;  3TN9 2;  5GKA C;  1NAE A;  4IW3 A;  1XNB A;  3A0N A;  1YQ8 A;  5FY7 A;  5K7P A;  5F6K A;  3M7A A;  1JU4 A;  1UN1 A;  4GKY A;  5C3Q A;  3ZOI A;  5FRE A;  4BZ4 A;  2E33 A;  4MGS A;  4MXV A;  1OI6 A;  5ABJ C;  1UD1 A;  4QPW A;  4DUV A;  3QOP A;  4JGZ A;  5FLH A;  1JZ7 A;  1NKG A;  4COY A;  1KD7 A;  2IUW A;  4Q1P A;  1S4C A;  1VE0 A;  4RN5 A;  3SEP A;  4AQ2 A;  2AH2 A;  2VZS A;  4QKB A;  1AR6 2;  3EBR A;  2D6P A;  3I2O A;  1AR7 2;  3KHB A;  2JIJ A;  1GZW A;  4N7I A;  2QQL A;  1V0A A;  4LBM A;  4AOC A;  3KWV A;  1UXX X;  4F83 A;  3O1P A;  1W90 A;  3T2P A;  4AF9 A;  3RZH A;  4M00 A;  1GZT A;  2HWF 3;  2PQQ A;  4LA3 A;  1V6O A;  2DTW A;  3T2Q A;  5DAQ A;  3VBO C;  1LOC A;  2AEZ A;  5LY1 A;  4QPY A;  5BNP B;  2ZMN A;  1IKQ A;  4JDN A;  1NCR C;  1NZC A;  1UO9 A;  1MS0 A;  2WZP P;  3AYE A;  3B69 A;  4NWW A;  3W58 A;  1LR5 A;  1W3V A;  1OD3 A;  2LM3 A;  1YQ6 A;  2VTF A;  3UL2 A;  2CV6 A;  4BQ4 A;  3M8L A;  2RR1 3;  5FP3 A;  5IYY A;  1AL2 3;  2TNF A;  3VBR C;  4P5Y A;  2XHK A;  4RQP A;  4YW5 A;  5ACA 1;  4L99 A;  1WCU A;  1VRH 1;  2Z2S B;  2W92 A;  4WV8 A;  1LHN A;  4OQ8 A;  2PAK A;  1RUC 3;  5A3N A;  1MAC A;  2VMH A;  4FXG B;  3ZMN A;  4KNC A;  4KU7 A;  2BWC A;  1IG3 A;  3A23 A;  3MPB A;  3SCF A;  3N7K A;  1O3S A;  1IGO A;  4QD2 A;  3M3E A;  2XJQ A;  4Y20 A;  1X8E A;  2DU0 A;  2JEC A;  3VL9 A;  5FR3 A;  3PU8 A;  1NCQ B;  4URT A;  2EAK A;  2W1U A;  3I8T A;  4H55 A;  4PDW C;  4XVH A;  4CXW A;  4DUX A;  3OF1 A;  5JDB A;  1TZO A;  3USU B;  2YY1 A;  1ASJ 1;  1C28 A;  2RVA A;  2WO1 A;  3NJX A;  4YVW B;  3SQO A;  3ZXG A;  4C8D A;  5KHG A;  5LCW L;  1OOP C;  2VQ0 A;  2HEV F;  1JHJ A;  2WNV C;  1EV1 2;  2ZS6 B;  4AQ6 A;  3W20 A;  2WNU C;  2GDF A;  5J98 B;  1DLC A;  2AC1 A;  4X6R B;  1W8N A;  1XRU A;  2YHJ A;  5T54 A;  1KJL A;  4KI5 M;  2YC2 A;  3D82 A;  5FMO L;  1AYM 3;  4Q4X 3;  5CAD A;  2W91 A;  1S0B A;  2VCM A;  4Q27 A;  4RHV 2;  4AED B;  3H1M A;  1XQN A;  4LBQ D;  2Y6L A;  1IQA A;  4W6X A;  5A7O A;  1YQ2 A;  3S7I A;  2EXK A;  2ZX2 A;  1FOD 1;  3AP5 A;  2QZ3 A;  4QX7 A;  4IEZ A;  3ZFG A;  1Y9Q A;  4AE2 A;  2XVK A;  2ZAA A;  3LPF A;  4HN0 A;  2Z4F A;  1R1A 1;  3QH6 A;  4CUG A;  2Y6J A;  2GN3 A;  3AYC A;  3H42 B;  1CAW B;  1VBB 1;  2BW8 A;  4GB3 2;  2I07 B;  5DAX A;  2CGP A;  4Q4Y 1;  4IEQ A;  1G9B A;  4WVM A;  4QXK A;  5F9T A;  1BQP A;  2Q1F A;  4XBL A;  2ZHK A;  1W99 A;  5CKM A;  3FWE A;  4WM7 A;  3WZ1 A;  5FBJ A;  5FP8 A;  1YYN A;  4MET A;  1Y9M A;  2LUW A;  2QUO A;  2ID4 A;  3ACF A;  1L7R A;  3OBR A;  4XJ8 A;  1CGP A;  5L36 A;  1I5Z A;  4DO0 A;  1H8T C;  1A78 A;  1BVP 1;  3SH3 A;  2Q8E A;  2GMM A;  1CZS A;  1FV2 A;  2JKB A;  4NO4 A;  1ZBA 3;  4YM3 A;  1W6Q A;  5CFD B;  4QKD A;  5FOJ B;  5IVF A;  1JZ5 A;  3ROU A;  3BU7 A;  1C1F A;  1MS9 A;  2JKX A;  2XLG A;  2VZV A;  3RYP A;  2PTM A;  4QX5 A;  3NNG A;  1SDD B;  1E5R A;  3OPW A;  1DZR A;  4RL7 A;  4JKM A;  5J36 A;  4UOJ A;  4IEW A;  1GMM A;  4WVW A;  3POB A;  4PJY A;  1OHF A;  4COZ A;  1DHK B;  2ZGM A;  1J1L A;  5FQ0 B;  5HCH A;  4CCN A;  4N43 B;  5DG2 A;  2R7E B;  2ATF A;  4NHM A;  2V73 A;  4P00 B;  4M4P A;  4FXK B;  1JYI A;  4EQV A;  3VD3 A;  3D4K A;  3W5N A;  3FUO A;  4R52 A;  5FXX A;  5CFC A;  1RUJ 1;  3T0A A;  2Y60 A;  1TMF 3;  3LOB A;  2ZGN A;  4N9I A;  5FYM A;  5HCB A;  1P8J A;  4DPN A;  3OD4 A;  3H8X A;  1O5L A;  2QQO A;  2RJ2 A;  4LKD A;  5F32 A;  2WQZ C;  4N53 C;  3B01 A;  5EYY A;  3OGS A;  5FIX A;  1W6O B;  2Q8C A;  2WR9 A;  2QFE A;  1BK1 A;  1RUD 1;  2VXJ A;  4COU A;  4Y24 A;  1LES A;  4O61 A;  5IK5 A;  2B42 B;  2XKO A;  3CLP A;  1K45 A;  1US2 A;  1KS4 A;  2IFR A;  1W28 A;  4FPH A;  3ZO0 B;  3V64 A;  2B5H A;  2ZEW A;  4JHT A;  4BWO A;  4A3X A;  4FAG A;  1D4M 1;  3DPR C;  4MXW A;  1RMU 1;  4CDQ A;  3OCP A;  5C3S A;  3FC0 A;  3ALQ A;  4Y4Y A;  3TOJ A;  3VBF A;  1UCX A;  1SAC A;  2GZW A;  4KBB A;  5LRS A;  1QJE A;  4YGE A;  3FMG A;  2BVB A;  4FPG A;  3BI3 A;  2W1W A;  4ES8 A;  1YNA A;  3SIS A;  3LDR A;  2VCC A;  1NCQ A;  4AQS A;  3HVD A;  4NHK A;  5JCT A;  3VUO A;  1PVC 3;  4D7S A;  4XFB A;  1ULO A;  5KR7 A;  4CDW B;  2YC4 A;  4AI9 A;  4FP2 A;  1X36 A;  2CY6 A;  3ORJ A;  4YVW A;  1KS5 A;  2VUC A;  1G9D A;  4AGG A;  5FK7 A;  3T4V A;  4OYU A;  4XAE A;  5FPX A;  2IXL A;  3T1M A;  4YPJ A;  4UFK A;  1MZE A;  3ZSJ A;  4OUE A;  3SH5 A;  5FFO C;  5IVE A;  4CP1 A;  3RGB A;  1SFY A;  4SLI A;  1EPZ A;  5FUP A;  4XF9 A;  4AGV A;  4NRP A;  3LFI A;  4AED A;  3AL6 A;  2OUJ A;  3RZG A;  3KCY A;  3THP A;  1E5I A;  4JV4 A;  1DQ6 A;  5FLJ A;  5FYY A;  1UOF A;  3H8R A;  4LXL A;  2WIN B;  2JG9 C;  3LIG A;  2VZ1 A;  3MUY 1;  1I3H A;  3C8X A;  3PJY A;  1AYN 2;  4NPM A;  1QGL A;  2HWF 1;  5L9B A;  4Z1V A;  2CWM A;  3SHR A;  1V6N A;  2GH2 A;  4MGT A;  2PLV 2;  3PL0 A;  4DRV A;  1RB8 G;  2EID A;  3OGJ A;  2X05 A;  2PHD A;  5C8C C;  2DBN A;  4UFI A;  2WN3 A;  2W1Q A;  3FE5 A;  1XNA A;  1VBA 2;  4PCR A;  4TLG A;  3WT3 A;  4A45 A;  2WSV A;  4XMA A;  3U75 A;  2HWE 3;  2RR1 1;  1YCI A;  3QAC A;  2YMZ A;  1AL2 1;  5EZW A;  4JDM A;  4NJ4 A;  2Y34 A;  5A3T A;  1FI2 A;  4B8E A;  1MS1 A;  1H2L A;  5CFD A;  5JXI A;  3PUI A;  3VD9 A;  3OBA A;  1DQ2 A;  1UIJ A;  1OH3 A;  1RUC 1;  2GAL A;  2UY9 A;  5FYC A;  1W03 A;  1GP4 A;  3PJQ A;  3PVO A;  5FP4 A;  2G9F A;  3RFR A;  4AEM A;  2FDH A;  2OXB A;  4O9G A;  2WDB A;  4AVC A;  4WM8 A;  2O8Q A;  4ITC A;  4LO7 A;  1V6M A;  5FQ0 A;  1VAV A;  1D4V B;  1YEW A;  4CP2 A;  1W9F A;  1WGP A;  4A6O A;  4DEQ A;  2OQ7 A;  1DDL A;  1GIC A;  1YI7 A;  3OTF A;  2VZ3 A;  2VUD A;  4LLF A;  4JGZ C;  3POS A;  2GP3 A;  2Y6F A;  2ORZ A;  1HB1 A;  2VOV A;  4WZC A;  5I8Y A;  4XUT A;  4OHV A;  4AQT A;  1I6X A;  2PYT A;  2QKD A;  3N35 A;  1UY0 A;  3Q9O A;  5FMD A;  4OHY A;  3CJI B;  5A3P A;  5F3G A;  5FYB A;  1ZRI A;  3RNS A;  4TXW A;  1COV 2;  1BBT 3;  1Q5O A;  2E7A A;  3KLS A;  3RMY A;  2P3Y A;  5FK8 A;  5L7O B;  4J1W A;  1RUF 3;  3MDP A;  4LEJ A;  4Q4X 1;  4YG3 A;  4ZZ5 A;  3POG A;  4I0W B;  1O7F A;  4IGQ A;  3MV0 1;  1N47 A;  2DFB A;  3IKW A;  4PBP A;  1GOG A;  3FFZ A;  5C5U A;  1W8T A;  2QDN A;  2UYA A;  5FZO B;  4KG0 A;  1D2S A;  3WF0 A;  3IAQ A;  4MZU A;  4XFC A;  5FRA A;  4XTP A;  5K8S A;  5HBA A;  5EV7 A;  4BPZ A;  3CKH A;  3I3E A;  2RM2 2;  3L2Y A;  1LHV A;  1QQP 2;  1OQ1 A;  3WF4 A;  3UJQ A;  2ZBJ A;  2W3J A;  1MS4 A;  3LPG A;  4RQP C;  3GZT B;  4K40 A;  2H0V A;  1WCD J;  4IEP A;  2E26 A;  1SPP B;  3ES4 A;  4KGG A;  5DUX A;  4W8J A;  1O4Y A;  1HQN A;  4FP3 A;  5FMB A;  4KMQ A;  5FZ3 A;  1Q3E A;  4IE4 A;  4MX3 A;  2VR4 A;  1ZBA 1;  2JJ6 A;  3HT1 A;  4K8F A;  5KHJ A;  2XJU A;  4PLM A;  4QX8 A;  3I54 A;  3ZYB A;  4IND A;  4ZXE A;  1W0O A;  3VKO A;  4M3C B;  4DMI A;  2HWD 1;  4QX1 A;  5IW0 A;  3RMX A;  4JGY B;  1T6G C;  5DG1 A;  3WCS A;  4UF0 B;  3FLR A;  1SBD A;  2YYO A;  4MGZ E;  4UI9 L;  3H0O A;  3WY6 A;  1QNW A;  4MGY E;  2IXK A;  1JBC A;  2X10 A;  3VHP A;  2DUR A;  5F5Q A;  1UF2 C;  5JZG A;  1WD4 A;  1WW7 A;  1POQ A;  2QQK A;  3N7J A;  2AYH A;  4EWE A;  1W0N A;  2P3I A;  2XDV A;  3JZV A;  5GLU A;  1TMF 1;  4YLZ A;  2BOI A;  3NL1 A;  5J7M A;  2WZR 3;  4I2O A;  5A32 B;  1HRI 2;  5FZD A;  1Q56 A;  1RUH 3;  1CAV B;  2W95 A;  3PME A;  1XSR A;  1BEV 2;  1RIN A;  3FFQ A;  3WUC A;  2BZD A;  3KMH A;  3ZFG C;  5JXJ A;  3DV8 A;  3KT7 A;  2RS5 1;  1UU6 A;  3MW2 A;  3EXU A;  1CX1 A;  3TBD A;  1EAH 2;  4I02 A;  3OPT A;  1DZQ A;  4Y33 A;  5IVJ A;  1U12 A;  1D2Q A;  3PVB B;  4AFB A;  2BDR A;  2H0B A;  4CDX A;  3MPP G;  4NUB A;  4HL0 A;  3WEZ A;  2WO2 A;  4YYO A;  1KXG A;  3VDB A;  2EIG A;  2R04 1;  3JXS A;  1GZC A;  2D6O X;  5IVB A;  1BCX A;  4Q4V 3;  2X5I A;  4WM7 C;  2EAA A;  1Q8P A;  2YPJ A;  3J26 N;  3TB0 A;  3PDQ A;  3UT0 A;  3G6J B;  3H8O A;  4I09 A;  2J1T A;  4QAW A;  4NHY A;  2IVI B;  5F6L B;  1AX1 A;  4XHB A;  5JUV A;  2AR6 A;  1NG0 A;  1VBC 2;  1YFY A;  3EJK A;  4JKL A;  1PVC 1;  2QQU A;  1W6P B;  2LRP A;  4KL1 A;  3RQ0 A;  3AZY A;  1UYX A;  1STM A;  3WR0 A;  3NAP B;  4YZ4 A;  1SFP A;  3ECQ A;  4D94 A;  4AVA A;  5B2G B;  4XQW A;  5C7G A;  1IZ3 A;  2WS9 2;  1V9U 3;  4URA A;  3OYW A;  1TVG A;  3MIG A;  4MO3 M;  3MF6 A;  3CJI A;  3Q8F A;  5AFE A;  3D3A A;  3KV5 A;  2QNK A;  4FQZ A;  2QZ2 A;  2D43 A;  3GJA A;  3AB0 A;  3WF2 A;  3ZN4 A;  2JDU A;  3IPV B;  1NOV A;  1OXC A;  2CU5 A;  5L7O A;  3DXU A;  2JG8 A;  2B7Y A;  2WWU A;  3ZMO A;  4YSF A;  1DQ4 A;  4Z2W A;  1PNG A;  3MID A;  1FNZ A;  4GWM A;  4I0A A;  2WO3 A;  1JYV A;  5IAV A;  2N7G A;  4L8Q A;  1AR6 3;  1DG6 A;  2ZEZ A;  4LHS A;  4AI8 A;  1ZRE A;  1JN2 P;  2A6W A;  5FZO A;  5DMY A;  4AEJ A;  3O12 A;  2WNE A;  4CCD A;  1AXZ A;  1RUI 1;  3BOP A;  3FHI B;  3K4D A;  1LU2 A;  1NQD A;  2DVF A;  3JU9 A;  3IDB B;  5A7W A;  3O14 A;  2JX9 A;  1CWP A;  1ZRD A;  2VY0 A;  1F4H A;  3KD4 A;  1VB4 A;  4XFG A;  2K46 A;  3U07 A;  3JBG 3;  2FD8 A;  1CES A;  4CU6 A;  3CO2 A;  3VKF C;  5LA0 A;  2PAM A;  4A6S A;  1WA6 X;  3QH7 A;  1Q8O A;  5A7N A;  1VMF A;  1XNC A;  2HWE 1;  3GXU A;  2Q8O A;  4OHZ A;  4ARX A;  5ERL A;  1REE A;  5SV5 A;  2IXI A;  3RRD A;  3GCX A;  4MV2 A;  4CDQ C;  3GF6 A;  4Y22 B;  1CQ9 A;  1ZZC A;  3JB4 C;  3GGL A;  3MIE A;  3LA7 A;  1DYK A;  3S5A A;  4IET A;  3AKS A;  3AKQ A;  4YW1 A;  2QJV A;  1DF0 A;  2E31 A;  1H4G A;  1W6N B;  1NCQ C;  1O91 A;  1JTZ X;  1O59 A;  2JDA A;  4HVO A;  1CR7 A;  4M3C A;  3UES A;  1K5M B;  5TSW A;  3RYR A;  5FP7 A;  5FOB B;  3B02 A;  1G9C A;  5E89 A;  2IC1 A;  3TAY A;  1PO2 2;  4OMC A;  1VAL A;  4YVW C;  4EN9 B;  1UXZ A;  3U14 A;  2D6K A;  5IT6 A;  1ONA A;  5I0U A;  3IIA A;  4G4F A;  4Q0Q A;  2W39 A;  2W94 A;  4QPG B;  2VME A;  3ILN A;  2GC0 A;  3LF7 A;  1ZVF A;  4HPK A;  1ULP A;  3KV9 A;  1QJX 2;  3I3D A;  3ZXA C;  1UKG A;  1W06 A;  4D8M A;  5A32 A;  2C9A A;  1ZZB A;  1X50 A;  1RL3 A;  2WO7 A;  4B4P A;  1GKB A;  2JD4 A;  1CAV A;  4H14 A;  1FPN 2;  2DCY A;  4L11 A;  4AED C;  2BNN A;  4FPE A;  1GAN A;  5FPU A;  1X9P A;  4LIU A;  5FPL A;  5FJH A;  1F15 A;  1BBT 1;  1UZW A;  2GNB A;  1MS8 A;  2RMU 2;  1GU3 A;  5FZH A;  1R08 3;  1LCL A;  5JLV A;  1RUF 1;  1T6B X;  4S2H A;  5A7P A;  4UW5 A;  2ZAB A;  4XE9 A;  2ES3 A;  2GAU A;  2AGS A;  3PNA A;  4U2A A;  1LJ7 A;  2VTX A;  1HB4 A;  3EO6 A;  3ZN6 B;  4A3Z A;  5ACA 3;  4LBL A;  1A8D A;  1QJY 2;  4KG8 A;  4P9X A;  1KDK A;  1TE1 B;  2WL1 A;  3MIH A;  5IK7 A;  4ONU A;  1JYW A;  2ZGP A;  4CCC A;  3E6C C;  2E63 A;  4QWN A;  1YI9 A;  5BNQ A;  5T52 A;  1ZRC A;  1L7L A;  2YDE A;  1UYY A;  5LEK A;  3NMB A;  2HWC 3;  2OW4 A;  4Q29 A;  1ND2 B;  1U5X A;  2XJR A;  4BHP A;  1LED A;  3U37 A;  1VBD 2;  3VZN A;  4XET A;  1FXZ A;  1PM4 A;  4JKK A;  4NHL A;  5CG8 A;  5EFU A;  4AL9 A;  5CFD C;  1NXD 1;  3ABZ A;  3WG1 A;  5LBF A;  2A5Z A;  1HW5 A;  2D3R A;  2PQS A;  4XUN A;  5DPN A;  2YC0 A;  2JWP A;  5JOZ A;  1LB2 A;  3POI A;  4YGD A;  3WSO A;  1OFN A;  1I5P A;  2UYB A;  3KCC A;  4WM8 C;  2ZEX A;  2OX0 A;  4QM9 A;  2WLQ A;  2BFU S;  2WN2 A;  4YW3 A;  5JVV A;  3WOG A;  2Y6K A;  4XF4 A;  3U0Z A;  1SLA A;  4C91 A;  3QCW A;  5FZ1 A;  3PMS A;  1F9K A;  2ARB A;  2XUM A;  3ZXL A;  1ENQ A;  5B4N A;  3WXP A;  4HVQ A;  1QJU 2;  1IPK A;  1VMJ A;  3V0B B;  3VD4 A;  1X9T A;  4AFA A;  5A1F A;  1UAI A;  1KFX L;  1XU1 A;  1XU2 A;  2KD7 A;  1KDM A;  1QH7 A;  1FOD 3;  4NPR A;  4QXH A;  2OQ6 A;  4BQ1 A;  4NE9 A;  4JTO A;  2WYS A;  5F3E A;  4DY5 A;  1R1A 3;  3ILF A;  3GYD A;  3GZU C;  4MSV A;  4FFI A;  1PX3 A;  5J1X A;  3ACG A;  2IXH A;  1CN1 A;  2WZR 1;  3J4U H;  1J3R A;  3DGT A;  4DB5 A;  1A3K A;  4HON A;  1QOT A;  4XOG A;  4AFC A;  1RUH 1;  1CAX B;  1DZT A;  1UZY A;  1AXK A;  3LFM A;  1PMH X;  3MLL A;  5DAP A;  4D3W A;  5KHI A;  4JHZ A;  3O0X A;  1UX6 A;  4CCE A;  5I0S A;  4Y22 A;  3W59 A;  5JSP A;  1JZ6 A;  3NRU A;  2GNM A;  4P9J A;  4IE7 A;  4QGN A;  1S0J A;  3O0W A;  5F5I A;  4E4Z A;  4H7M A;  2XBO 2;  2JE8 A;  5AC9 2;  1VAK A;  1NY7 2;  2D6M A;  1ZA4 A;  3SNM A;  3ZSE A;  5KC6 A;  3MLK A;  2VNR A;  3PIG A;  2AEY A;  1W6N A;  3AKT A;  1K5M A;  4Q4V 1;  1H1I A;  2VZP A;  2ARC A;  1JZ4 A;  2A3W A;  4Q0U A;  1AZD A;  1HQW A;  1WME A;  4QDR A;  4IE5 A;  1VMH A;  5CAZ A;  2CHH A;  3DEC A;  4H7L A;  5FZE A;  1W8O A;  2BQP A;  3GCW A;  3ZYP A;  2BUK A;  1OA4 A;  3ATG A;  2HYK A;  4ZU4 A;  1FMD 2;  3FN9 A;  3NST A;  3OB8 A;  4AK3 A;  2D6N A;  1AXY A;  4L0P A;  5C4W B;  3RDI A;  4QGM A;  2P6H A;  3POY A;  1DQ5 A;  2OKX A;  3IBM A;  5EIY B;  5KXD A;  1JI6 A;  3FL7 A;  3B9I A;  2CL2 A;  1V9U 1;  5EJZ B;  1VBE 3;  4Y1Y A;  3VBU A;  1M06 G;  4BLJ A;  1ENS A;  2EIE A;  3ZX7 A;  2XWJ B;  4XFH A;  3ZFE B;  3IN9 A;  5F5A A;  4E2S A;  3VHN A;  2JDP A;  1XYN A;  2TEP A;  4XFA A;  5DZG A;  5F8P A;  4N7U A;  5I0D A;  1C8M 2;  2YGM A;  5CNA A;  3VDC A;  2QQP A;  4FTE A;  2D7F A;  3LEM A;  5JZG C;  1WLW A;  2W52 A;  1ULD A;  4NII A;  3ZN6 A;  3H3U A;  3USS A;  3H3Z A;  1UOB A;  3NNM A;  4LKS A;  1AR6 1;  1O5U A;  3ZXJ A;  3CL1 A;  2ET1 A;  5FZ4 A;  1AR7 1;  5F39 A;  3QD6 A;  2D40 A;  3CQO A;  4XUO A;  5FPV A;  3WDT A;  2FDK A;  4R9B A;  3BIW E;  3BYW A;  4FOW A;  2ZAH A;  1RUE 2;  4YW7 A;  5F1R A;  1RUG 3;  5GZE A;  5I0T A;  1DGR N;  1UY3 A;  3P3N A;  2WSU A;  1QXP A;  3HWJ A;  1S2B A;  3FJS A;  3KM5 A;  2CWS A;  1JS9 A;  3JBG 1;  1QIQ A;  4PF5 A;  5GLZ A;  1XE0 A;  2WRA A;  3GAL A;  4D6R A;  3C3V A;  4CDX C;  3B7M A;  1ULF A;  3VBH A;  4S2G A;  5FWE A;  1GWL A;  4YM0 A;  3VDD A;  3THD A;  4QMA A;  3PTR B;  2KM2 A;  5KBF A;  3ELN A;  1SDW A;  3UGF A;  3WQB A;  4QX2 A;  3C7F A;  1WMF A;  4C0B A;  4YFZ A;  1MVE A;  1HN1 A;  1UW8 A;  1JMU B;  4XJU A;  2WT2 A;  4CYD A;  5FO9 B;  3BUC A;  1HDK A;  4W4Z A;  3V0B A;  2O0O A;  2VBD A;  2XB6 C;  1X7N A;  3K46 A;  4IE0 A;  1GP6 A;  1AR9 3;  2WQ8 A;  2WAO A;  1RVF 3;  2JDH A;  3BOW A;  2DF7 A;  4QKF A;  5C71 A;  3CJI C;  3KS7 A;  5IVC A;  4XUR A;  1VR3 A;  3DUI A;  1RHI 2;  3R4D B;  5D21 A;  3WX5 A;  4AXO A;  5C9A B;  4NIA A;  1OVS A;  4UW3 A;  5T50 A;  5L7O C;  4P02 B;  3A4U A;  2Q0A A;  3A0K A;  4LJH A;  2JG8 C;  4QQ2 A;  5C8W A;  3OG2 A;  3HNY M;  4QHO A;  4Y5Z 0;  4FI9 A;  5HXM A;  1CAX A;  2Q30 A;  3POF A;  5FPZ A;  1H1A A;  2VG9 A;  3AP4 A;  1DFQ A;  1QKQ A;  5FY8 A;  1R08 1;  5G04 L;  1RTV A;  3ETQ A;  3WQ7 A;  4DXS A;  5BNO A;  2VCA A;  4A2U A;  2HBT A;  5FTT C;  3AM2 A;  4BQY A;  1O3T A;  4MGQ A;  1O3R A;  1HIX A;  2J1E A;  4KGQ A;  4R9A A;  5HV4 A;  2F17 A;  3CHX A;  4H2A A;  3ZKY A;  3D5O A;  4CP9 A;  2NZ9 A;  5FUI A;  4NR1 A;  3CDZ B;  4LHK A;  4AVT A;  5HCF A;  2HWC 1;  1ULC A;  2V72 A;  3H1W A;  4UT5 A;  3JUU A;  1HB2 A;  3K4Z A;  1W8W A;  3BIE A;  3FBM A;  3ZSK A;  3MIC A;  4LBO A;  5BV6 A;  2EIB A;  1OUX A;  4HLT A;  5DXD A;  4AEK A;  5A6Q A;  5D8A A;  2PHF A;  5SV8 A;  4JDO A;  4RSU A;  3A7Q A;  3MLJ A;  4P9Y A;  2D3P A;  1H6X A;  2BOJ A;  3ENR A;  3WDX A;  3NJZ A;  5FZM A;  4DZG A;  2CGO A;  4ZHN A;  2A6X A;  4XFF A;  2BTV C;  5IWF A;  5C70 A;  1SCR A;  4JGY C;  2PHT A;  2Y6H A;  2E51 A;  2QQI A;  4S2D A;  1DCS A;  4R8H A;  1TG7 A;  3AX4 A;  5FYS A;  5LAT A;  5I91 A;  3U4X A;  4Y1V A;  3ACI A;  4Q8L A;  3HQU A;  4FT8 A;  4IES A;  2XML A;  3ILR A;  1AJK A;  3CMG A;  1QXJ A;  3MYX A;  3VGI A;  5DUW A;  1ND3 B;  2E53 A;  3DCQ A;  2V4V A;  4BK5 A;  2VOW A;  3SKJ E;  4IE6 A;  2O1Q A;  1CPM A;  1DQ1 A;  2P17 A;  1GYK A;  4E2Q A;  1TEI A;  1HXS 3;  1UMH A;  2UY8 A;  4P9L A;  3VZJ A;  4CEY C;  4DIQ A;  1JOJ A;  5BNN A;  4XAB A;  5DAB A;  5H9Q A;  5KHH A;  2R49 A;  1ALY A;  1QOO A;  4YM1 A;  4P08 A;  4PI0 A;  3NV3 A;  1N1Y A;  4Y5T A;  1W6M B;  3WQ1 A;  4A41 A;  4WVZ A;  3DXT A;  1J58 A;  5EPA A;  1AR8 3;  1IPJ A;  3J8F 3;  1VRH 2;  2D93 A;  1SMV A;  5FLI A;  5F2S A;  1VP6 A;  2VMF A;  3E97 A;  3QLQ A;  3HR9 A;  2AAC A;  4RGK A;  2B46 X;  1WW4 A;  4K21 A;  4EN0 A;  4AGR A;  4LUM A;  2DDU A;  4DS0 A;  1SLT A;  4XW3 A;  4E4H A;  3LEI A;  3NNJ A;  1JOD A;  4AW7 A;  2P34 A;  2HWD 3;  3FUQ A;  5F2W A;  2VGD A;  5KC5 A;  4AAP A;  1X82 A;  2W87 A;  4XCB A;  3SIT A;  1ASJ 2;  1F31 A;  1YWK A;  2XKP A;  2AZ5 A;  1GNZ A;  2RHP A;  4IEX A;  3IMM A;  3B94 A;  5EJ3 A;  2A75 A;  2R16 A;  2BGP A;  3NO8 A;  1VBC 3;  2ZML A;  4GA9 A;  1W8F A;  3P1I A;  5BNP A;  1VBE 1;  3OUH A;  4P5H A;  5GZG A;  4BME A;  4A7Z A;  3BPZ A;  3B00 A;  4LOT A;  2ZMK A;  4JVA A;  5IAX A;  4FPO B;  4NPL A;  5E6H A;  1S2K A;  3WF3 A;  5I0R A;  4LO4 B;  3W21 A;  4A7Y A;  1CVN A;  5EYX A;  3HPN A;  3WNL A;  3WQ0 A;  2RS5 3;  1WW5 A;  1H2N A;  2QBX A;  4BDV B;  1VBB 2;  4MHR A;  3WP4 A;  4RFT 0;  2ZX4 A;  1PO1 2;  2ILM A;  1XB9 A;  1WD3 A;  2R1B A;  2ZX3 A;  5KXB A;  3JCI A;  1WZX A;  1UY1 A;  3B3Q E;  3MUZ 1;  2YB7 A;  3KF3 A;  3V56 A;  2R04 3;  5A3W A;  4BU2 A;  3RZK A;  1W9W A;  2ZGK A;  1RUG 1;  1OMI A;  4V2V A;  2BV4 A;  4R4X A;  5A3O A;  4AHY A;  2BBA A;  3ME2 A;  1LEC A;  1NLR A;  4MHU A;  1VB2 A;  2WLP A;  5A7S A;  4LBJ A;  2YXS A;  3USU A;  3IT8 A;  1MZ5 A;  2W47 A;  1Z7S 3;  2JDM A;  4UW4 A;  1GQG A;  1EPW A;  3H9A A;  5FY1 A;  3VHO A;  2P3J A;  1K5M C;  2VTX J;  4QB6 A;  2VMD A;  3VZK A;  3BTY A;  2DWR A;  2E7Q A;  4LOS A;  3U10 A;  3CJX A;  3VN4 A;  2B4K A;  1XC6 A;  4XXP A;  1XND A;  1KFU L;  4QU2 A;  1C4R A;  2WII B;  2ZX1 A;  1FAT A;  4MOA A;  4R9C A;  5T5O A;  1XNK A;  2ZGT A;  1CJP A;  3E5X A;  5LEJ A;  1PIV 3;  1QHD A;  1QY4 A;  1RUJ 2;  2JDY A;  1AR9 1;  3AZX A;  3G7D A;  4I01 A;  1RVF 1;  2K9Z A;  4HSL A;  4HXC A;  5DZE A;  3VBU C;  3WCR A;  4ZXK A;  2RE9 A;  1CAW A;  4GQ7 A;  2YFZ A;  3R4S A;  1RUI 3;  3AL5 A;  4EV0 A;  1URX A;  4EN7 B;  4QQL A;  1RUD 2;  3BVC A;  2VXR A;  1OQE A;  4RR3 B;  5FYV A;  1W6M A;  5L19 A;  1JUH A;  1UY2 A;  4ASM B;  1JU3 A;  5FUN A;  2GC3 A;  3VBS B;  1DYO A;  3WW3 A;  1YO8 A;  5LBE A;  1M4W A;  3LCP A;  2LW8 A;  2QDR A;  4RD7 A;  1QOS A;  1VPH A;  4XEZ A;  1G9A A;  1FPN 3;  4IV1 B;  1D4M 2;  1RMU 2;  3O1S A;  1JYX A;  5FBZ A;  4IEU A;  2Z79 A;  4HSJ A;  3NJV A;  1A8M A;  4MG2 A;  2B9U A;  2DU1 A;  3MIF A;  4Q0V A;  2TUN A;  1BZW A;  4XJ9 A;  1NZI A;  4XAC A;  3WW1 A;  4DRR A;  3S0M A;  1UIK A;  3HBK A;  1MEC 3;  1OD5 A;  3UV9 A;  2GNT A;  2VOK A;  1R09 3;  2Q4S A;  1MZ6 A;  3VD5 A;  3VKL A;  1OLM E;  1Q43 A;  5GAL A;  1XYP A;  3PVN A;  3L9J T;  3VBH C;  4QXC A;  5JAX A;  2XJV A;  4GJY A;  3VDD C;  4N43 A;  5JPM B;  1GNH A;  4HK9 A;  3AZW A;  2YBK A;  1FNY A;  3N9P A;  1UU5 A;  1B09 A;  1SHW B;  5K9Y A;  2MEV 3;  2YFU A;  3K3N A;  4LR4 A;  5CA6 A;  2HJI A;  2GC1 A;  1WCK A;  3K77 A;  3RPQ A;  5C5T A;  1XE8 A;  3WF1 A;  2H6B A;  4DXZ A;  1XXN A;  3S57 A;  3I3B A;  1S0D A;  1RUN A;  4Q4W 3;  1C5H A;  4AFM A;  3AZV A;  2B45 X;  1PM7 A;  1Y7B A;  2WAA A;  3I2D A;  1W6O A;  2ZGL A;  2Z69 A;  4CU8 A;  2HBU A;  3ACH A;  3OPZ A;  3TYJ A;  2J1A A;  4NMI A;  5ABJ B;  3B5L B;  2VE1 A;  2HWF 2;  1GLH A;  2QQV A;  3KCX A;  4Y1Z A;  1NLS A;  2HWB 3;  4BQ3 A;  4GH4 B;  4LO6 B;  4SBV A;  2NPI A;  1ZNP A;  4QGL A;  5JR2 A;  1HXS 1;  4XYX A;  3UKV A;  4J6G A;  2JDN A;  2G9G A;  4XJZ A;  4QXB A;  5H9R A;  4CEW B;  1K3I A;  5A6X A;  5AFB A;  5BNO C;  4LA2 A;  1TME 3;  1AL2 2;  3WP5 A;  4ET7 A;  2IZW A;  2VUL A;  5DDJ 3;  3RG0 A;  3RJR A;  3S5Q A;  1AR8 1;  2FCT A;  3J8F 1;  5C3O A;  1NCR B;  1SLC A;  3T2O A;  2R07 3;  1LKN A;  4CPB D;  2ERF A;  3OEA A;  2HEW F;  1RUC 2;  1OUS A;  4M01 A;  1BEV 1;  3ZKU A;  3BTX A;  2EAL A;  4EJR A;  2ZXQ A;  1J3P A;  4FVV A;  1SQ4 A;  3INA A;  2XQX A;  1UYZ A;  3MW4 A;  4FTS A;  2PEL A;  3THC A;  1LNS A;  2WA4 A;  2XBO 3;  4EZH A;  1J83 A;  2Y26 A;  1UZV A;  1AVB A;  4LKE A;  3DN7 A;  5D8A C;  2J42 A;  4NAM A;  3P3P A;  3OBZ A;  3MW3 A;  1W8Z A;  1D7P M;  4KWJ A;  3WDU A;  4CCL A;  2OUH A;  3HD8 B;  3WIN E;  1UQX A;  1DGW A;  5JIA A;  4HKO A;  2FCV A;  4HKL A;  3BCW A;  1HRV 3;  4EN8 B;  3WW4 A;  1VBC 1;  2CNA A;  2IXC A;  5HXV A;  4HKW A;  3LA2 A;  3AVR A;  4LK7 A;  3AZZ A;  5H9P A;  5DN2 A;  5KWR A;  3VZO A;  1AYM 2;  4Q4X 2;  2FDJ A;  1NA1 B;  3ZXF A;  1YC6 1;  3AKP A;  3OOX A;  2WS9 1;  1QF3 A;  1WA4 A;  3ZR5 A;  2A3Y A;  1OOP B;  2BGO A;  5CEH A;  1HV1 A;  2DUO A;  3BU0 A;  3AK0 A;  4OUL A;  1CAU B;  2P2K A;  4FFG A;  3JQX A;  5J09 A;  1OQD A;  2WNU B;  2ZHN A;  3DYM A;  4BQ5 A;  5JXH A;  2VZU A;  1V6J A;  5BNN C;  5E1R A;  4NIG A;  2ZGR A;  3J7H A;  4AHW A;  1H6Y A;  4WBB A;  5CU1 A;  1HKD A;  3DKQ A;  1EYB A;  4AAX A;  1V70 A;  5FXV A;  3WP6 A;  2R6Q A;  3OGR A;  2A1X A;  2RV9 A;  1HQL A;  2VW0 A;  3VHR A;  5M0T A;  3N9M A;  1OT5 A;  2ZX0 A;  1SG3 A;  1W39 A;  2RS1 3;  2VQU A;  1L3J A;  2VBB A;  3OBT A;  5IJR A;  4BCU A;  4XHX A;  4GIQ A;  1WW6 A;  2RG4 A;  1PK6 B;  2UWB A;  1H0B A;  1DBN A;  1QU0 A;  3WVJ A;  1ODN A;  1ZBE 3;  1Z7S 1;  2J1V A;  3TN9 3;  1CZT A;  1G86 A;  2VQT A;  5A33 B;  4LE4 A;  1BMV 1;  4BB3 A;  3MGU A;  1TNR A;  4NRQ A;  1W2T A;  4XC9 A;  2BU9 A;  4K20 A;  3S30 A;  3R4U A;  1H8T B;  5FZB A;  5FKC A;  5CB7 A;  5LA1 A;  2CAV A;  4PIY A;  2X5I B;  2Y0I A;  4XDP A;  3SC7 X;  1PIV 1;  4LIT A;  4GH4 A;  4QQP A;  3ACL A;  5FYH A;  4YWA A;  1E5H A;  2CSG A;  5BNP C;  2XLA A;  4CCM A;  5C3P A;  4XBQ A;  1PO2 1;  1MS3 A;  1ZM1 A;  3VZL A;  1E5S A;  1AR7 3;  1S0E A;  2YU2 A;  1QDO A;  3VLB B;  4DFS A;  2EXI A;  2XJP A;  5C33 A;  2A73 B;  3K75 B;  4AYU A;  1XNT A;  2DUQ A;  2Q1M A;  1SZB A;  3E5U A;  3T4H B;  1O8P A;  3VV1 A;  4CEW A;  5HPO A;  3I2H A;  4LBN A;  3URF A;  2OPK A;  3NNL A;  4D6Q A;  2ADE A;  3M70 A;  4QHB A;  2YZ4 A;  3K4A A;  3AVS A;  5FY9 A;  1WLC A;  3TEX A;  3D0S A;  1SPP A;  2EXJ A;  2XQR A;  4CVU A;  1FPN 1;  5LK5 A;  4BLI A;  4BXF A;  4BIF A;  5E16 A;  3NV4 A;  4QX0 A;  3WDV A;  1AX0 A;  3ZVX A;  3WDW A;  1WLD A;  2L9L A;  2ZCW A;  1EY2 A;  3H7Y A;  4YW4 A;  3VL8 A;  3ZFF B;  1RIR A;  3EQE A;  4JRA A;  4EWA A;  1A34 A;  5FZ6 A;  3VB9 A;  3I2G A;  1MEC 1;  4HZF A;  1QJY 1;  1PVC 2;  1C57 A;  2DBI A;  1F5J A;  1R09 1;  2YGL A;  3MFC A;  1ODM A;  2DCJ A;  4JGY A;  4Z07 A;  4UF0 A;  1WLT A;  3DPR B;  1OLQ A;  3RZZ A;  2XG3 A;  2GU9 A;  1R1Z A;  2W08 A;  1H9P A;  4YZ1 A;  3KF5 A;  2XPJ A;  4UFH A;  4W65 A;  3WG3 A;  3EB7 A;  3HJR A;  2NP0 A;  2EA7 A;  1L7Q A;  2WA3 A;  1IOA A;  3ZM8 A;  1VBD 1;  2C6S A;  2WFF 2;  2MEV 1;  4ISQ A;  4YNI A;  3ZSM A;  3TWI A;  4TYS A;  2X09 A;  2FZ2 A;  1XYO A;  2VBP A;  4UFL A;  3O1O A;  5J96 B;  1NA1 A;  2PAE A;  3DF0 A;  4Q4W 1;  4Q0S A;  1JH5 A;  1S1A A;  2C4X A;  1F35 A;  4L9B A;  1UL9 A;  3IDE A;  2Y6G A;  1RIT A;  2XVL A;  2P5B A;  3PUQ A;  1CAU A;  2JIC A;  3SCH A;  1UYP A;  1EV1 3;  4COV A;  5EP9 A;  5IK4 A;  1K42 A;  2HYX A;  4IEO A;  1XSQ A;  2A6Z A;  4J1X A;  1T2X A;  3N36 A;  3SXW A;  4YFW A;  3POW A;  5A6Y A;  2JE9 A;  2HWB 1;  1W9Y A;  4L97 A;  1LOG A;  4MGK E;  1GV9 A;  4MUV A;  2NM1 A;  4AWD A;  3WV6 A;  2RDS A;  4PIZ A;  4RHV 3;  4WZF A;  4CE8 A;  2RDQ A;  3NNF A;  5LAS A;  1S0I A;  5JWP A;  5GLV A;  1JZ8 A;  2G19 A;  2JG9 B;  1OF3 A;  2ZTN A;  3ZYH A;  2HWE 2;  4AI2 A;  4BK4 A;  3EHK A;  1U0A A;  3LA3 A;  1TME 1;  3LDB A;  2QVS B;  4GB3 3;  2WZE A;  5DDJ 1;  1PK6 A;  1PMI A;  1SBF A;  2LS6 A;  1W6P A;  4FO9 A;  3OY8 B;  4DOU A;  2VZR A;  2R07 1;  3NAP A;  1V6I A;  2W1S A;  2BBV A;  2FDG A;  4ZY9 A;  1N3O A;  2NN8 A;  3I3Q A;  3I2K A;  1FV3 A;  4G3Y C;  2WQ4 A;  1JUI A;  4IUG A;  1NE6 A;  4RYD A;  2Z5W A;  3IPV A;  1X33 A;  2GME A;  4N43 C;  2K0G A;  2NMN A;  2XBO 1;  2ZZJ A;  4BXS V;  2ZKN A;  4EE2 A;  3GHN A;  1OH4 A;  4LTA A;  5IUQ A;  2VNG A;  2EVX A; 
#chains in the Genus database with same CATH homology
 4MGQ A;  4OYU A;  1UMI A;  2CDP A;  2J1E A;  4YPJ A;  4OUE A;  4A4A A;  3T0D A;  1O8S A;  5FUI A;  4CUB A;  1CZV A;  3CDZ B;  4TTG A;  2V72 A;  3FHA A;  3K4Z A;  4QDS A;  4W50 A;  3OEB A;  2EIB A;  2VZ1 A;  3MUY 1;  3C8X A;  4ARY A;  3A7Q A;  4CUA A;  3WNP A;  1H6X A;  3C7O A;  3W5M A;  3GM8 A;  5C70 A;  2EID A;  3HOB A;  4DXT A;  3UNP A;  2X05 A;  2VZT A;  3T08 A;  4AG4 A;  4M4R A;  2WN3 A;  2W1Q A;  2Y6H A;  3I97 A;  2VZQ A;  1XNA A;  3F2Z A;  4A45 A;  2QQI A;  1TG7 A;  3LE0 A;  5IFT A;  3ACI A;  1KGY A;  3CMG A;  3MV1 1;  1JYN A;  3CIH A;  4ZZ8 A;  4BK5 A;  2V4V A;  4XZU G;  3SKJ E;  5JXI A;  3PUI A;  3VD9 A;  1GOF A;  3OBA A;  2J22 A;  5LA2 A;  1UMH A;  2WDB A;  1PX4 A;  2VZO A;  2J7M A;  4P08 A;  4CUC A;  1CIY A;  3LEG A;  4A6O A;  4A41 A;  4DEV A;  4DEQ A;  2WUH A;  3HN3 A;  2Y8K A;  5G05 L;  2J1R A;  4PQQ A;  2VZ3 A;  3BN6 A;  2JD9 A;  2VMF A;  2ORZ A;  4XUT A;  3CZJ A;  1UY0 A;  2HLE A;  4CU9 A;  2DDU A;  1US3 A;  4QDQ A;  4TXW A;  1WKY A;  3LEI A;  2E32 A;  3OGV A;  4ZZ5 A;  2W87 A;  2C9K A;  3MV0 1;  3MO4 A;  1GOG A;  3I2J A;  3HEI A;  3WF0 A;  3IAQ A;  1WCQ A;  2BGP A;  3WNK A;  4E8D A;  3P1I A;  3CKH A;  3I3E A;  5DQ0 A;  3WF4 A;  5B4X A;  2W3J A;  5CYY A;  3LPG A;  4QB2 A;  2E26 A;  3WF3 A;  4W8J A;  3HPN A;  4KMQ A;  3FHQ A;  2V5D A;  3WNL A;  2QBX A;  4BDV B;  2VR4 A;  2VC9 A;  4UAP A;  4PF1 A;  1UY1 A;  4ZXE A;  3MUZ 1;  2YB7 A;  4BJ0 A;  1F4A A;  4QX1 A;  1W9W A;  2WZ8 A;  1GQP A;  1EUT A;  2Y64 A;  4UI9 L;  1R64 A;  2BBA A;  3P6B A;  2X10 A;  2QQK A;  1W0N A;  2W47 A;  3AC0 A;  2XON A;  4OMD A;  1UZ0 A;  4QB6 A;  2VMD A;  3ETP A;  2VL4 A;  4JX0 A;  1W9T A;  2W95 A;  2B9V A;  2W5F A;  2B4K A;  1XC6 A;  2BZD A;  5JMO A;  5JXJ A;  2EIC A;  4MOA A;  1CX1 A;  3SEE A;  1K12 A;  2DCK A;  3DYO A;  3WEZ A;  2WO2 A;  4LPL A;  3VDB A;  2XHN A;  3JXS A;  2YFZ A;  5IFP A;  2J1T A;  3WNO A;  4LQR A;  4QAW A;  3GDB A;  1BHG A;  2J1U A;  2W9X A;  1UY2 A;  1JU3 A;  5IHR A;  5JUV A;  2QQN A;  1DYO A;  5EJ1 B;  1UX7 A;  4JKL A;  2LW8 A;  3T09 A;  3A21 A;  1UYX A;  4XUQ A;  3ECQ A;  3VDA A;  1NX9 A;  1JYX A;  1TVG A;  4MO3 M;  2ORX A;  3NJV A;  3D3A A;  3SKV A;  2YG0 A;  3WF2 A;  3WNN A;  3I2I A;  3III A;  3VD5 A;  4A42 A;  2WO3 A;  1JYV A;  3T0B A;  4OZO A;  1OF4 A;  2ZEZ A;  4LHS A;  3VD7 A;  5DMY A;  1UWW A;  3K4D A;  1SHW B;  2YFU A;  4Z2A A;  3MBW A;  3K77 A;  1PMJ X;  5JXG A;  3WF1 A;  4XUP A;  3I3B A;  2VO5 A;  1F4H A;  1J84 A;  4CU6 A;  5LA0 A;  2WAA A;  4A44 A;  3IB3 A;  3LQC A;  1EUU A;  3GXU A;  4CU8 A;  1RYY A;  4ARX A;  3ACH A;  3EYP A;  1KEX A;  2J1A A;  3GGL A;  2QQM A;  3DYP A;  4E8C A;  2CDO A;  2WBK A;  4PT6 A;  4MAD A;  4D0Q A;  5JR2 A;  2E31 A;  2BER A;  1XPW A;  1O59 A;  2JDA A;  3A22 A;  3UES A;  5CZK A;  4OMC A;  1K3I A;  1UXZ A;  2XOM A;  2J1S A;  4ET7 A;  5C7G A;  2W94 A;  2VME A;  4GWJ A;  3T2O A;  2VJX A;  3IAP A;  3OEA A;  1ULP A;  4CU7 A;  3CZU A;  3I3D A;  2ZXQ A;  3HNM A;  4D8M A;  3C7H A;  5F7U A;  1MPX A;  2XQX A;  1UYZ A;  1NAE A;  3THC A;  1LNS A;  1J83 A;  1GU3 A;  1JU4 A;  1D7P M;  4A3Z A;  2E33 A;  4MGS A;  3I2F A;  1GNY A;  4QPW A;  4DUV A;  1JZ7 A;  1NKG A;  1JYW A;  3SEP A;  4RN5 A;  1UYY A;  2VZS A;  2C26 A;  2VMC A;  5DN2 A;  3U37 A;  4JKK A;  2QQL A;  1UXX X;  4DUW A;  2QQJ A;  3ABZ A;  3T2P A;  2BGO A;  4XUN A;  5DPN A;  2PQS A;  5A1A A;  3T2Q A;  3DYM A;  4QB1 A;  3WSO A;  5JXH A;  1I5P A;  2VZU A;  1JZ2 A;  3J7H A;  1H6Y A;  2ZEX A;  1OD3 A;  2WN2 A;  2Y6K A;  4AAX A;  2VTF A;  3OGR A;  4GZ9 A;  2RV9 A;  5IYY A;  1OT5 A;  4P5Y A;  5B4N A;  1SG3 A;  2VQU A;  3VD4 A;  2W92 A;  2KD7 A;  3LEK A;  5IJR A;  2WYS A;  3A23 A;  2J1V A;  1PX3 A;  5J1X A;  3ACG A;  1CZT A;  2VQT A;  3C7E A;  2W1U A;  4XVH A;  4DUX A;  1PMH X;  3BGA A;  4JHZ A;  2RVA A;  2WO1 A;  3NJX A;  5LCW L;  5LA1 A;  4GWI A;  1JZ6 A;  3NRU A;  1JHJ A;  2JE8 A;  1GOH A;  3HNB M;  2ZEY A;  1DLC A;  1W8N A;  4KI5 M;  2VZP A;  2YC2 A;  3K75 B;  1XNT A;  1JZ4 A;  2W46 A;  1O8P A;  2W91 A;  5HPO A;  3I2H A;  4QDR A;  2Y6L A;  3DEC A;  1YQ2 A;  1W8O A;  3K4A A;  3LPF A;  2Z4F A;  3FN9 A;  3OB8 A;  2Y6J A;  3WNM A;  4L0P A;  4CVU A;  2OKX A;  5EIY B;  1W9S A;  2VM9 A;  1JI6 A;  3FL7 A;  4QX0 A;  5EJZ B;  1W99 A;  2EIE A;  2L9L A;  3I2G A;  5I0D A;  2ID4 A;  3ACF A;  1L7R A;  3VDC A;  2DCJ A;  1IQD C;  1CZS A;  3C7G A;  1JZ5 A;  4LKS A;  4QX3 A;  3E1F 1;  3EB7 A;  3HJR A;  2JKX A;  2VZV A;  1L7Q A;  4XUO A;  3CQO A;  3ZM8 A;  3NNG A;  1SDD B;  4JKM A;  2X09 A;  4UOJ A;  1JZ3 A;  1GMM A;  1NUK A;  1UY3 A;  2R7E B;  3IDA A;  2C4X A;  4P00 B;  4M4P A;  4DXR A;  3VD3 A;  3W5N A;  2Y6G A;  1K42 A;  3T0A A;  1GUI A;  2HYX A;  1UY4 A;  3THD A;  1P8J A;  1T2X A;  3PUH A;  3NQH A;  2QQO A;  2RJ2 A;  3WQB A;  4QX2 A;  3C7F A;  3OGS A;  1HN1 A;  2VOT A;  1DP0 A;  1JZ8 A;  1K45 A;  1US2 A;  4W4Z A;  1OF3 A;  2VCB A;  3K46 A;  4BK4 A;  2WQ8 A;  2WAO A;  2ZEW A;  2WZE A;  3UET A;  2LS6 A;  5C71 A;  2WAB A;  2VZR A;  4XUR A;  2W1S A;  4ZY9 A;  3I2K A;  4HG6 B;  2W1W A;  4P02 B;  3OG2 A;  3HNY M;  2VCC A;  4FI9 A;  5HXM A;  4IUG A;  4RYD A;  1ULO A;  2YC4 A;  4BXS V;  5G04 L;  4DXS A;  1OH4 A;  2VCA A;  4KWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...