2W47A

Clostridium thermocellum cbm35 in complex with delta-4,5- anhydrogalacturonic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
135
structure length
135
Chain Sequence
ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSANAFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 28
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w47A00
2BZDA 2Y6KA 5I0DA 3LPGA 2EICA 2ID4A 2YC2A 2VMDA 3C8XA 1K42A 3MBWA 2HYXA 2EIDA 3C7FA 3WNOA 2VM9A 4JX0A 4OUEA 1JZ3A 5JXIA 4QX3A 3C7HA 3CDZB 5JXGA 2YC4A 2WUHA 4A44A 1UY3A 4MOAA 2QQLA 2Y6LA 1CIYA 3CQOA 4A3ZA 4FI9A 3C7OA 5F7UA 5JXJA 3WF4A 5IJRA 2L9LA 2WO1A 2ZEYA 2WQ8A 4DEVA 3SEEA 3WEZA 1GQPA 4KMQA 2E32A 3FL7A 2LW8A 3I2HA 1D7PM 2V72A 4P02B 5IFPA 2KD7A 2BGPA 4GZ9A 1RYYA 4KWUA 3F2ZA 4UAPA 4QDRA 3ACHA 2WN3A 4ZXEA 1LNSA 3MV01 2VQUA 4OMDA 3LE0A 2V4VA 3NQHA 3SEPA 3OGVA 1UZ0A 2X05A 1XPWA 4LKSA 1GOFA 3NRUA 2W91A 3K4DA 2ZEZA 3A22A 2QQMA 1NUKA 4QAWA 3SKJE 4RYDA 2VMFA 5B4XA 5LA2A 4RN5A 3HNBM 1PMHX 1GMMA 4ZZ5A 4W50A 1K12A 2XONA 5LA0A 4A45A 4QB1A 1O8PA 4Z2AA 2HLEA 1UX7A 4BDVB 3LEKA 1IQDC 1O8SA 1KEXA 3UETA 1R64A 2QBXA 4XUQA 1JHJA 2W1UA 3WSOA 2C4XA 3NNGA 1JI6A 3LEIA 4TTGA 1UMIA 3PUHA 5IHRA 4M4PA 3UESA 2QQOA 2PQSA 3P1IA 2W5FA 4P5YA 3VD9A 1EUUA 4DXSA 1UY1A 1XNAA 3CMGA 5LA1A 1SHWB 3WF2A 2ZEXA 2WYSA 4JKLA 1NKGA 4JKKA 2WO3A 3CIHA 1W8OA 3T2QA 3OG2A 2C9KA 2J1TA 2Y6GA 1OD3A 2W46A 2R7EB 2ZEWA 3MV11 2XQXA 3P6BA 4CU8A 3VD7A 2W87A 2W9XA 2Z4FA 4DXRA 4QB2A 3I2KA 4JKMA 3HNMA 2VZRA 4BJ0A 5DMYA 3T09A 4UI9L 3U37A 3VDBA 2WO2A 4P08A 3I2GA 4W8JA 2WZ8A 2VCAA 1DLCA 3IAPA 2W1SA 4E8CA 3HN3A 3SKVA 3PUIA 3EYPA 3CZUA 2DCKA 4PF1A 2VO5A 3OBAA 2RV9A 1O59A 1PX3A 3BN6A 4M4RA 1YQ2A 4MO3M 2BBAA 1H6YA 3DECA 4P00B 3FHQA 2J1VA 1MPXA 1GNYA 5EIYB 3I2IA 2E26A 5G05L 3CZJA 5G04L 2VCBA 4DUVA 1PX4A 3WF0A 2E31A 3VD3A 3D3AA 4GWIA 4A4AA 2XHNA 3OB8A 5JR2A 1ULOA 5JMOA 3HOBA 4AG4A 4AAXA 5CYYA 2WAAA 3NJXA 3A21A 3HJRA 2EIEA 2JD9A 3MO4A 1UXXX 2EIBA 4XUPA 5EJZB 3WNLA 1OF4A 3I2JA 1W9WA 4QPWA 3T0DA 1H6XA 3BGAA 4ZZ8A 2VZVA 1WKYA 4DXTA 1W8NA 2CDPA 3GM8A 1UYZA 4YPJA 2ORXA 4QX0A 1US2A 3IAQA 5FUIA 2OKXA 4MGSA 1L7RA 1GUIA 1TG7A 2RVAA 4OYUA 1JZ4A 2VZOA 3LEGA 3IDAA 2J22A 1UY4A 4LPLA 1K3IA 4A42A 3DYMA 5B4NA 2XOMA 3LPFA 2JE8A 1UWWA 3IB3A 2E33A 1JU3A 2W92A 2LS6A 1EUTA 2VL4A 1T2XA 1NX9A 2W47A 3OEAA 4QDQA 4OMCA 2W1WA 1JZ7A 3K77A 2X10A 3HPNA 4E8DA 2JKXA 1PMJX 1TVGA 2CDOA 3ACFA 4BK4A 2WAOA 1KGYA 3WNMA 1JZ6A 1US3A 3VD4A 5IFTA 1UY2A 3ETPA 2DDUA 3UNPA 1UY0A 4A41A 3I3DA 3ECQA 2ZXQA 3GXUA 2Y8KA 2ORZA 3C7GA 3GGLA 1DYOA 1F4HA 1CZTA 4CUCA 2VZ1A 1ULPA 3THDA 1CZVA 2VZUA 3DYOA 5EJ1B 4XUNA 2W95A 5DPNA 3GDBA 3K4AA 3WF1A 4CUBA 1W0NA 1GOGA 3K75B 5HXMA 1W9TA 1W99A 2Y6HA 4D8MA 3VDCA 5C7GA 1GU3A 1UMHA 4PT6A 4MGQA 3ZM8A 3EB7A 2C26A 1JU4A 4ET7A 1CZSA 5JXHA 2RJ2A 1XC6A 4QB6A 1DP0A 2B9VA 1HN1A 2YG0A 1OT5A 5CZKA 2WBKA 4JHZA 1J83A 3WNKA 4A6OA 5HPOA 3T0BA 2VZTA 4KI5M 3VDAA 4XZUG 3T2PA 2W94A 2W3JA 4QX1A 2WABA 4L0PA 1P8JA 3T2OA 4DUWA 2W1QA 4OZOA 4DEQA 1L7QA 4PQQA 2Y6JA 3WNPA 1UYXA 3AC0A 2V5DA 5C70A 3OGRA 4QX2A 1JYXA 2J1SA 3MUY1 2VOTA 2VR4A 5J1XA 1XNTA 4TXWA 3MUZ1 3FN9A 4CU6A 2WZEA 1JYWA 2VMCA 4ZY9A 1SG3A 2DCJA 2J1EA 3C7EA 2VTFA 3NJVA 2VZQA 3T08A 1J84A 3I2FA 3W5NA 1NAEA 4LHSA 3WQBA 1K45A 4CU9A 4HG6B 2Y64A 4IUGA 4XVHA 3E1F1 2VZSA 3ACGA 3K46A 3A7QA 4GWJA 3THCA 1SDDB 2WDBA 2VMEA 1F4AA 4ARYA 1GOHA 3ACIA 1OF3A 1CX1A 4DUXA 2QQIA 3A23A 3LQCA 5IYYA 4XUTA 1JYNA 3JXSA 3I3BA 2YFUA 2QQKA 5DQ0A 2YB7A 3WF3A 4D0QA 2J1UA 2VCCA 5DN2A 1I5PA 1WCQA 2QQJA 2VZPA 2X09A 3DYPA 5C71A 1JZ2A 1JYVA 4QDSA 3J7HA 3FHAA 3W5MA 2WN2A 4W4ZA 2VZ3A 5A1AA 2J1AA 2VQTA 4XUOA 1UYYA 3OEBA 2JDAA 3HNYM 2QQNA 1JZ8A 3ABZA 4UOJA 3HEIA 4CVUA 3I97A 4BK5A 2YFZA 4LQRA 1W9SA 3K4ZA 2VC9A 1UXZA 2B4KA 4CU7A 2VJXA 3IIIA 4XURA 2BGOA 3I3EA 4CUAA 3CKHA 5LCWL 3VD5A 5JUVA 1OH4A 4BXSV 1BHGA 2J7MA 3T0AA 3WNNA 4ARXA 2BERA 1JZ5A 3OGSA 4MADA 2J1RA
chains in the Genus database with same CATH superfamily
2N7GA 4LIVA 1ZBA1 4YW5A 5I0DA 3AKQA 4FAGA 5L7OC 4XJZA 4KG8A 4CCDA 5JOWA 3RZKA 2ID4A 3C8XA 1K42A 2XG3A 1H8TC 1WW6A 3MBWA 4QU2A 3SC7X 3PU3A 3ZN6A 1SPPA 3WNOA 5FPXA 1YIPA 1REEA 4AF9A 3GZAA 3C7HA 3CDZB 3ZR5A 2VXJA 4FPOB 4N9IA 2A5ZA 4A44A 1UY3A 3WXPA 5K8SA 3U1XA 3V56A 2R30A 4AEKA 1ZRCA 2QQLA 1CIYA 2YXSA 3CQOA 4QPYA 5H9QA 4FI9A 1NOVA 2BQPA 2ZGSA 2WNEA 4Q4W3 4A7ZA 5A70A 4AAPA 5L7OB 1CAXB 3VUOA 1HRV3 4EZHA 4UW4A 1I5ZA 2AYHA 1RUG3 3AMMA 3RQ0A 3NKGA 1BKZA 1H8TB 1RUC1 2B46X 4MGYE 2BYVE 2GNTA 3WEZA 2E9QA 4UFLA 5FZCA 4PDWA 1H2LA 5L36A 1IPSA 1D7PM 2V72A 1H30A 1HRI2 2UWBA 1X7NA 5A1LA 2ZGNA 4XF0A 2ZX4A 4HMZA 1VB4A 5C3PA 2PFWA 2ES3A 2HEWF 1LHVA 2XKOA 5C33A 2HWD1 1RUD1 3TN92 1H9WA 3KB5A 5I0RA 1Q8VA 4QU1A 5FY8A 1YJLA 3BPZA 4XXPA 5IK7A 4QQ2A 1G7YA 5J48A 3R0RA 2WN3A 3GALA 4NVPA 4ZXEA 2R072 5C5UA 5C8WA 3LE0A 3SEPA 4BYYA 1RINA 3EBRA 1XPWA 2UY8A 1W8WA 1GICA 2AR6A 4QX5A 4LR4A 2VNOA 3IKWA 4G3YC 5FYCA 1JBCA 2PQQA 4ISQA 4UW3A 1SLTA 1YC61 2QQMA 1NUKA 5SV5A 3H1WA 1SFNA 4QAWA 2DUOA 2C5DA 4XAEA 1HXS1 2XLFA 5B4XA 4K6BA 4XF4A 1GMMA 1HDKA 1OLQA 2VPVA 1QQP3 5A3NA 1BLZA 4LBLA 1NQJA 1C3HA 1O8PA 1ULCA 4HVOA 5FQ0A 3Q8FA 3AJYA 4I3GA 5KXCA 2VU9A 4GA9A 5FY4A 4R9BA 3JD71 1X82A 1LOGA 1VBA2 3KT1A 4K20A 1AYM2 4GJZA 4BHPA 4NE9A 2XVKA 4XUQA 3SMHA 1KS5A 2WT1A 4EN8B 4EN6B 4F83A 1JHJA 1JHNA 4AQTA 3RZHA 3WSOA 3KCYA 1JI6A 4TTGA 2BNNA 3ZMNA 1UMIA 4WVMA 1BVP1 4QQHA 5A3TA 2R043 2XB6C 5K0UC 2Y0IA 2C0ZA 1F2NA 1MS0A 4M4PA 4O9EA 4I2OA 4OI0A 2ZMKA 1WUVA 2PQSA 3P1IA 1NA1C 4I3PA 4B4QA 3ORJA 4NRQA 4NWWA 3ZSEA 2OUJA 4BXFA 3APBA 4DXSA 1RHI2 1DQ0A 5JMCA 2HWC1 4KBBA 5KWRA 2F4PA 3UJQA 2MEV3 1ZRFA 3N9PA 4XJUA 5DDJ2 2YC0A 1JMUB 1HJFA 1OXCA 4M3CE 4YVWC 3LOIA 2EXHA 4YVSC 1O5UA 4XMIA 5FZIA 1QOTA 3GZEA 2HWF1 3KHCA 1L7LA 2XWBB 3DN7A 4X8PA 4GH4C 5EXOA 4AXOA 2ZEWA 3AL6A 3MIDA 4RHV2 2QFEA 5K0UB 5M0TA 4URTA 1OC1A 2Z4FA 5CG9A 3R4DB 3VKMA 2Q8CA 1NA1B 2TNFA 4DXRA 1DGRA 2G19A 4XDPA 4JKMA 3T1MA 2DCTA 2VZRA 2WL1A 4HONA 4UI9L 1IKQA 3U37A 2O8OA 3NV3A 1OLRA 4XTMA 4JGZA 2WZ8A 5EZWA 4RFT0 4YVWB 5HCFA 4BE3A 2P3IA 4YVSB 5DAWA 1H2MA 3N9MA 4P9JA 3V0BB 1DQ5A 4LOSA 2GC0A 4GH4B 1LHUA 3AP6A 1SZBA 4HKWA 3IDCB 5FMCA 3AK0A 4XBNA 5F5AA 1OOPA 1G86A 1Q8QA 2Z5WA 2CTVA 3AP4A 4I0AA 4XCBA 2RMU1 4Y1YA 4K8FA 3OGGA 2ZKLA 1C4RA 4HPKA 3AYAA 3I2OA 5ERLA 1UX6A 2BBAA 4P00B 4FOVA 3FHQA 4LORA 1RUF1 2WZPP 2ENRA 3I2IA 5SV8A 2HYKA 1ZYBA 1IQAA 1H4GA 3SISA 4AI8A 3FFZA 4BIFA 4DUVA 1PX4A 1TE1B 1IS6A 2E31A 3PVBB 2NLRA 4LBMA 4OZXA 3WF0A 2DVFA 3D3AA 4GWIA 4A4AA 3ZXDA 3BTAA 1V9U3 3ZXKA 4NMIA 2PHFA 1O4TA 2XVGA 3E5XA 1W39A 3PIJA 3NJXA 5E6HA 3HJRA 1GSLA 4OQ9A 2C6SA 2JJ6A 4XFAA 2EIBA 1HRI3 4XUPA 5EJZB 1PMIA 4Q5OA 3WP3A 3I2JA 3WNLA 3BGAA 5F3EA 4L97A 5AC92 4ZZ8A 5I8TA 1LCLA 4ES9A 2PLV3 3TN93 1HV0A 4LHNA 2JD4A 4AHXA 4YARA 5T3NA 1DZTA 1N3PA 1S0EA 1US2A 1VBD1 2EAKA 1QNWA 3LA7A 5FUIA 5CIRA 2ZHKA 5IVJA 4MGSA 1W6QA 3SH3A 1D4M3 1XB9A 4KH9A 2R073 1Z7S1 2O8QA 3MF6A 1KITA 3PNAA 4OYUA 3OUIA 4YFWA 2VBPA 5F3GA 5CVRA 2J22A 3I59A 2BVVA 1I1EA 2PN5A 2WNVA 2YMZA 2ZGLA 3GNEA 5FZOB 2XL9A 2QQUA 5JR7B 2WR9A 1RMU3 2Q1FA 1HJGA 4ZPIA 3VBFB 5IK4A 2Y38A 4DMIA 1AR62 2FD8A 1U5YA 3ON7A 4E9KA 5C3SA 5FDBA 1LU1A 2BWCA 4TN7A 2ZBJA 3H7JA 4QGLA 3H1YA 1QJY1 1WBLA 4QPIA 4O61A 3W58A 2JDNA 3J7MA 4V2WA 2XWJB 4SLIA 5A7WB 4Z8BA 2OZJA 3MIEA 2WINB 5E88A 4IDZA 5BV6A 2YU1A 4Y4RA 3IM0A 1POV0 3K77A 2Q1ZB 1UNBA 3HPNA 1LJ7A 4BQWA 5FY1A 3S5AA 4MG2A 1ND3A 4Q8LA 4PLOA 1PMJX 5IWFA 4AI0A 2WYFA 5EHDA 2AEYA 1B35C 1VBA3 3ACFA 4BK4A 1NYWA 2Q1MA 1GQGA 4RGGA 2X29A 5FZ0A 1H2KA 5TSWA 1S0DA 1VBC2 4UFHA 3RYRA 2ZAHA 5ABJA 3VD4A 2VUCA 4AEJA 3N9QA 3MPBA 5DXDA 4WM8A 1UY0A 1W05A 1GP6A 2VOXA 2VXRA 3ZFEB 4AFDA 1UKRA 2LM3A 2W52A 4LKFA 3ZVXA 3SITA 3U0ZA 1RHI3 2FDKA 3NNJA 3AVSA 4BPZA 3D0JA 3NAPC 3ELNA 3NNMA 1YQCA 1IGOA 1LOAA 4YW6A 3MHZA 2JDUA 2XJVA 3EXUA 1DYOA 3GJAA 5DDJ3 4LO7A 3S57A 1ULPA 2EXIA 4FSJA 2GAUA 5FWJA 4Y33A 2CV6A 2YGMA 2AGSA 1C5HA 4M3CA 1PNFA 3VKNA 2D7FA 5LATA 1W9FA 4DIQA 3GDBA 3SLIA 2WFF2 4RHV3 3DKWA 1RUJ1 4MXWB 1LOEA 4GKYA 4CCNA 1DQ4A 4YGDA 3RRDA 1E5IA 5FXVA 3I3QA 4AI9A 2JE7A 2BFUL 2A6XA 1GOGA 1VBB2 1W90A 2UYBA 3NAPB 2TUNA 2QCSB 5A6XA 3MF9A 4Q4W1 1JW6A 4XBQA 1FYUA 4MUVA 4JGYC 1W9TA 3PJYA 1HRV1 1OH3A 1AL21 3MIBA 3VDCA 1RUG1 1YCIA 1VR3A 5FK7A 2JG8C 4MGQA 5IUQA 3J9SA 3AMPA 4PHZA 3N9NA 2JENA 2RG4A 5C8CA 1QGLA 4IEWA 4XF9A 5C9AC 3ZKYA 1W8ZA 5T55A 3BI3A 2G9FA 3INAA 4LKEA 3H3LA 1DU3D 1UO9A 2AACA 5GKAC 1VE0A 3RDIA 1CVNA 2CNAA 5C4WA 1DP0A 5CNAA 2YG0A 1OT5A 1QJX2 1RVF2 4JGYB 4JTOA 4JHZA 3BPSA 3WNKA 1ZRDA 5HPOA 2WZR2 2LRPA 3NWKA 4XJ8A 3BU0A 5HXVA 1WCKA 2JG8B 2D3PA 1HN0A 2OT7A 3VDAA 1PO22 2DCYA 3AFGA 3PHMA 4GULA 3T2PA 5ACA2 3VBSC 3RS6A 3H3UA 5C9AB 2R16A 4HN0A 1TNFA 4YFZA 3TOJA 1RC6A 5KC6A 2GC3A 4DUWA 4DB5A 2WS92 1RB8G 3AYCA 4DEQA 5GLVA 3WNPA 2Y6JA 1GP4A 1NXD1 3R6SA 5I8SA 1YUDA 1MQTC 4AFBA 1PM4A 1UYXA 4WM7C 1VBE2 2J1SA 2JB8A 4F7ZA 4FOYA 1XNTA 3OOXA 2ZHLA 1H1IA 2VH9A 4YM3A 1UOJA 5GJ6A 4WVZA 1QQP1 5FLHA 2IXHA 1E5SA 3WNXA 4ZS2A 2ZX0A 1QWRA 3RYPA 1NQDA 2ZTNA 1HQNA 2Y26A 3TYJA 2QZ2A 3T08A 1ONAA 3VBSB 3WDXA 1J84A 2WC2A 3UT0A 5A3UA 2WJSA 1PM7A 3F95A 3RZZA 5FK8A 4BQ1A 3W5NA 4J1WA 3WY6A 4HG6B 2OVUA 5CEHA 1Q43A 3B5LB 4XVHA 1MQTB 3E1F1 2VZSA 4IEYA 4WM7B 5IVEA 3ACGA 3NL1A 1OURA 4OLLA 2V09A 4QXHA 1SDDB 1HV1A 4ITCA 3LIGA 1AR63 5DUWA 2R041 3UJOA 3ZYJB 4LOTA 2B45X 3AKTA 1PK6C 2IXJA 1LECA 4FBFA 1LEMA 1RUH2 4CRQA 3BOPA 3B01A 4ARYA 3VBUC 4B4RA 4LO8A 1W8UA 1O3SA 5JI7A 3ILNA 4R9CA 3UL2A 1FXZA 4QM8A 3ALQA 2MEV1 3LQCA 3FLPA 2B9UA 3POSA 4Z2WA 5IYYA 1JYNA 3VB9A 3NJZA 4IETA 1R082 2YFUA 4XC9A 4NOTA 4ASKA 1VB2A 1W6MA 2QQKA 4UF0B 3WF3A 2XH6A 4PIXA 4CCOA 1E5RA 1Y3TA 2VCCA 4IE0A 2PAEA 2WSUA 1I5PA 1WLWA 1F31A 3N9LA 1PK6B 3ZSKA 2VZPA 4UFIA 3J7HA 3JD73 3VBUB 2Z42A 1UD1A 3OY8A 4GWMA 1XE8A 4XAAA 4IEOA 5LZ6A 3K51A 4OHYA 5A1AA 3RVHA 1D2SA 1UPIA 3K3OA 2VQTA 3IDBB 4QXKA 4I30A 4Y20B 2WQZC 1N1VA 4Y22A 4YZ1A 3FC0A 1C8M2 2JDAA 4IE5A 1V70A 4FTEA 4D94A 1J59A 1PVXA 2NYYA 3O1UA 4N43C 2ARBA 4MVTA 3ZSJA 2YFZA 3EMRA 1W9SA 3K4ZA 2DBNA 1A6CA 1LOFC 1TMF2 2B4KA 2HWC3 3GCXA 4RQPA 1LODA 2NPIA 3U75A 1S0GA 1WMDA 3IIIA 4IEUA 2PYTA 4D6SA 4CU7A 2IXKA 3I3EA 2O1QA 4D6RA 3LDRA 5J36A 2WFF3 3VD5A 5JOZA 4Q29A 5LCWL 2VOKA 5IATA 4CEYA 2R0FA 4BXSV 3WNNA 4ARXA 4CP9A 4JZRA 1BK0A 3J8F2 2RS12 4LMFA 4UW6A 2DVGA 3ZYIB 1ZZ9A 4IGQA 5L9RA 2JDKA 4MGZE 2B39A 1VBB3 4W6XA 2VTXJ 4IV3A 4PIZA 5FMDA 5IAXA 4M3CF 4EROA 3S7EA 4ZU7A 1DDLA 4N43B 2YC2A 2VMDA 3MPPG 3WW1A 3HN1A 2HYXA 2PHUA 2R49A 3GBGA 5FZ9A 4EYUA 3WW4A 1V9U1 1JUIA 1JZ3A 5FZGA 4ZONA 2OW4A 5KC5A 1G9AA 5JXGA 2XJRA 1YNAA 2XLGA 3HVDA 4DRRA 3O12A 5FY7A 5FZKA 3NO8A 3PTYA 5FZ8A 1HRI1 1NE6A 2Y6LA 4QT6A 5GZFA 5F5QA 1DCSA 1DBNA 3C7OA 4XE9A 1OVSA 3DPRA 5DUVA 4E2SA 2GU9A 1NLRA 2PLV1 3TN91 2YYOA 1QJX3 1RVF3 4GJYA 4OHWA 5IVFA 3VZLA 5FZ3A 4FFFA 3J26N 2G1MA 3KSCA 2JKBA 3AP9A 3CJIA 1UU6A 2WQ8A 2WZR3 4MGTA 3M3CA 3WINE 4LBJA 2BEOA 5LY2A 1MS3A 2R071 3FL7A 3URFA 1OQDA 1AX2A 1PO23 3O14A 1H8VA 1RUF3 5IFPA 4D3WA 4O7XA 1OLME 1IG0A 2KD7A 4GB32 3BUCA 4LLFA 4GZ9A 3ZKUA 3NV4A 3AP7A 1J58A 3NV2A 3QOPA 3ZFGC 4KWUA 3F2ZA 4CPBD 1OQEA 4AGRA 2RHPA 1BJQA 1VBE3 3BYWA 2OX0A 1ST8A 4TLFA 4XDOA 1OA2A 3RMYA 2VECA 3MV01 4OMDA 1MS4A 2LUWA 1XRUA 3NQHA 3OGVA 5DZEA 3ASIA 2BGCA 4B29A 5FQ0B 5FYYA 3BU7A 3WG2A 2W91A 1W6NA 2ZEZA 3GF6A 2ZJCA 1XYNA 4Z82A 4CEWC 3SKJE 5F9TA 1XU2A 5LA2A 1ULDA 4RN5A 1PMHX 1VBA1 1MEC2 2VW2A 5D21A 3ZFGB 1VBD3 3UGGA 4XILA 4AI3A 2JG9A 5LEJA 3PMSA 5JSOA 4TWTA 1C1FA 1N1YA 4W50A 2V4AA 1Z7S3 1MVQA 4PIYA 4A45A 4AE2A 4S2FA 1VAMA 2P6HA 1RJ7A 4YM2A 1SMVA 5FUNA 4U36A 2ZGTA 4BQYA 1X8MA 1IS5A 3UYJA 4KGQA 1IS3A 3N35A 4LBQA 2C9AA 5FMBA 1RHI1 4JDNA 4CEWB 4COVA 4XMAA 1R64A 1YRZA 2QBXA 3VGIA 4XIKA 1O5LA 3WG4A 1PGSA 2W1UA 3MLKA 5DDJ1 3VLBB 1QJY3 4N53A 1R083 2FHRA 4MYEA 4BM8A 4RR3C 5GM0A 2WQ4A 2VVDA 2F6BA 1V6KA 3CNAA 4CDQC 3VKFC 3WDWA 1GP5A 2Q5TA 4RHV1 4Q1PA 1UOFA 4P5YA 1OFSA 2BJSA 3GYDA 3W21A 2Z79A 1XNAA 3NW4A 3UKTA 4HBNA 2ZEXA 1W0PA 1O3RA 2FZ2A 2WYSA 3KGZA 4JKLA 4LK7A 4AWDA 3A0KA 4AVSA 4L11A 3KV5A 4H2AA 4AGGA 4XHXA 2QQPA 1W8OA 3T2QA 1MS9A 1KRIA 4CP0A 4JGZB 3ZFFC 2W46A 4RR3B 1YHFA 4URAA 5HCBA 2QNKA 3RSJA 3VBOC 4CU8A 3ITQA 1FAYA 2W87A 4CDQB 4R9AA 4J1XA 4BB3A 3G7DA 1T6BX 2VBDA 5A7SA 1SDWA 4MH0E 4CDUC 3E6CC 3MIFA 5IK5A 1OOPB 4IERA 4OHZA 4XOGA 3USUB 4IEQA 3VDBA 4LA3A 4DQAA 4D7YA 1GR3A 4XCAA 5DG1A 3QH7A 4N8MA 3CL1A 3J8F3 2RS13 3POIA 3IWZA 4P9GA 3JU9A 1UZZA 2RE9A 2GNDA 1DLCA 2X5IA 4NWVA 5FRAA 3ZLIA 3BOWA 3O0XA 4XYXA 3FUOA 1RUJ3 3THPA 3ZFFB 2W1SA 4YYOA 3FMGA 4NIGA 4J6GA 1WCDJ 3VBOB 3AX4A 3CZUA 4DOUA 4JVAA 2E51A 2NQYA 2VO5A 1ENRA 1W0OA 3MLJA 3R05A 1VRBA 3BN6A 4CDUB 5C3QA 4EE2A 1YQ2A 5EV7A 4MO3M 5F6KA 1AL23 1VAVA 1OKQA 4Q0SA 2PHTA 1MPXA 4C1XA 1JOJA 1GNYA 3GCWA 3B02A 2XJSA 5G05L 1Q3EA 4AEDA 4N7UA 5AC91 3ZR6A 2VCBA 3OPZA 4XABA 2CY6A 3PVOA 3VD3A 2XGXA 1DYKA 2XHNA 3AZYA 2PHWA 2WLPA 2XR4A 5JPMB 1KQRA 5JMOA 5DAQA 4KWKA 4HK9A 4MHRA 5AVPA 5JDBA 4CXYA 3WD5A 2G9ZA 1IHMA 4YM1A 1W6QB 1ULEA 1DGLA 5FYZA 2BOJA 1ENQA 3QLQA 5T5JA 5BNNC 2AC1A 4Y1UA 1APNA 1XJAA 2JD9A 3HQUA 3MO4A 4LNVA 1WGPA 5H9RA 4AVTA 5IVVA 3K48A 2A1XA 3D8CA 4KBZA 4ZXKA 1OLMA 1W9WA 4IV1C 5L9VA 1H6XA 3I59B 1H9PA 4CDWC 1CGPA 1WBFA 4PI0A 1AVBA 4AQSA 3PDQA 2WNVB 4PLMA 3AP5A 4FPCA 2GALA 3RNSA 3JQWA 4DNYA 5BNPA 1W8NA 3SCGA 4Z92B 1ZREA 1AR61 2YPDA 3O7OA 4OI2A 2XJTA 3JQXA 1LULA 2ORXA 2JWPA 5CFDC 4EWDA 1T6GC 4EWEA 2X8KA 2XBO2 2RVAA 3MW4A 4FPLA 5EFUA 1QJU2 3V0AA 3WP5A 2ERFA 2R32A 4GMP0 4YZ5A 5BNNB 1DQ2A 1BYHA 4Q8KA 2ZABA 4AFAA 1OMIA 1K3IA 1YJKA 5KBFA 5B4NA 4IV1B 1ND3B 2ZGPA 3LPFA 3UKVA 4CDWB 3O1RA 5E8AA 5FY9A 1OA3A 3LSDA 4KU8A 3T4VA 3IB3A 2E33A 1JU3A 5LBBA 1ODMA 2W92A 1RUNA 2PHXA 4YW4A 4RD7A 1VBC1 4L8QA 4BQ3A 5ABJB 2YZ4A 1O3TA 2JE9A 5CFDB 4G4FA 2ZPXA 2HWE2 5FZAA 3PVEA 3OEAA 3WX5A 4C91A 2ZGUA 2DU0A 4QDQA 1U5IA 3LWCA 4OMCA 2A6WA 2CGNA 2W1WA 2VULA 1JZ7A 1UCXA 2WNUA 1PGW2 2X10A 2ZHMA 3WW2A 1QDOA 1D0HA 5A33A 1AL0G 4GD4A 4NUBA 4HXCA 1M4WA 1LENA 2JIGA 1TVGA 2OUHA 3VDDC 2D6LX 5JZGC 2CDOA 1MZEA 4YGCA 1JYTA 1KGYA 1H2NA 3TEZA 4XEZA 1ZNPA 4YG0A 4ZS3A 5JI9A 1UU4A 1US3A 1V0AA 1LR5A 2RR12 3BIWE 4BZ4A 5IFTA 5BNOA 4IGPA 4Y5Z0 3LD8A 2BV4A 3LA3A 1GQHA 2DDUA 3WOGA 3UNPA 4K1ZA 2ARAA 3L9JT 2FDFA 3H50A 1QY4A 4QKDA 2WFF1 5FYVA 1KJRA 4HFSA 1HB1A 1GBGA 3G6JB 3ZPYA 5CFCC 4Z07A 3HIFA 1DIWA 1CN1A 3GHMA 5JVVA 2WA3A 1XSQA 3KF3A 4MGKE 4LHLA 1VBB1 4YZ4A 5F39A 3VDDB 1F4HA 5JZGB 5FPAA 1BBT2 2GMPA 3THDA 1QU0A 2O14A 4AZZA 2P5BA 4QPGA 4COWA 5FP8A 1O3QA 2H0BA 1S0JA 5F2SA 1ZX5A 3U4XA 4NJ4A 1YFWA 5DPNA 3RYKA 4E2QA 5FMOS 3CO2A 2NMOA 4Z1VA 2Y33A 5FZ1A 5CKMA 5DAXA 4IE4A 4ZU5A 3WF1A 5CFCB 5I93A 4K8RB 1FT9A 3DUIA 1JS9A 1FOD2 2H6CA 3LKJA 1AR92 4CUBA 2CAUA 1W6OB 3K75B 4XQDA 2E7AA 2IWGB 2RS52 3LIHA 3OBRA 2MPFA 2ET7A 5DAVA 4BWOA 1EPWA 3D82A 5EWSA 1QJX1 1RVF1 5IVYA 4DRVA 5FO9B 3N4MA 4Q26A 4JQTA 4Q0PA 1G9CA 2WZR1 2ZMLA 2FCUA 1FV2A 1GNZA 5FZMA 3VV1A 1WA4A 2VY0A 2HJIA 1PO21 3EB7A 3OGJA 4JQRA 3POYA 4LA2A 3PVNA 5ACA1 2V5YA 2RM22 2VD7A 3WG1A 2FQPA 2FBEA 1OUXA 3VHPA 4ET7A 5I0TA 2WWJA 4FPGA 4K1YA 2RJ2A 5FOJB 2WS91 1NCQC 3ILRA 2XHKA 4J25A 3ME2A 3ZYBA 5HV4A 1ND2A 4HN1A 2ZZQA 4COUA 1GNHA 1A3KA 4RS5C 4YW1A 1VBE1 5GLZA 2WBKA 5CISA 2NMNA 5CBLA 3RI8A 2GMMA 3DXTA 4CCMA 1V6LA 5K4LA 1R1ZA 1XQNA 2PELA 1RJ8A 3M7AA 5D8AA 3WLUA 2DU1A 3Q8AA 2AUYA 4Y4YA 3ZXGA 4MGIE 4UW5A 1Q56A 1WZXA 4LBOA 2W3JA 2E63A 2GNBA 4QX1A 3VBFC 1P8JA 5KHHA 1NE4A 4DINB 1F8VA 2W1QA 1H4HA 1J3PA 4OZOA 4PQQA 3M4FA 1JOPA 5FP3A 5T54A 1KFUL 5FPLA 4CE8A 3OGRA 1NCQB 4QX2A 1WCUA 1JYXA 2MHFA 3MUY1 2VOTA 3I2DA 3TAYA 3TEWA 2D3SA 1DGRN 1LRHA 4HL0A 1A34A 4RS5B 5L7OA 1CAXA 2HEYF 1JYWA 4XFIA 4Q4X2 4IE7A 2DCZA 2EIGA 4ZY9A 3ETQA 3OCPA 1H8TA 4UWDA 3C7EA 3N7KA 2VUDA 1RUH1 5I91A 2ZS6B 4D7SA 3AXDA 3I2FA 2XBO3 1XNKA 3B9CA 4I0BA 2HWB2 2VVFA 3ZX7A 1GZWB 3FLTA 4E4DX 2P4EA 4JCKA 2ZOEB 4IUGA 3JCIA 4ZU4A 1K5MC 3K46A 4KGGA 3BTXA 2BNMA 2PTMA 1R081 2OS2A 2WDBA 5FXXA 3I7DA 3OPTA 2BWAA 1W6MB 3CJXA 3WW3A 4ASMB 4BCUA 3N3HA 3M70A 5JSRA 5IAVA 3ZFEC 2R062 2XQRA 1EYBA 4AVCA 1F4AA 2ZCWA 3QBQA 3HBKA 4XF1A 4Y1XA 5DZGA 3ACIA 3ATGA 1OF3A 3VZMA 2HWE3 1XOYA 1AYM3 5AFEA 3VBRC 5F3CA 2ZGQA 4XETA 3N9OA 2UURA 3WDUA 5L19A 3JXSA 3I3BA 4P14A 4COYA 3VZKA 4CXWA 3V64A 2VOVA 1C8M1 1K5MB 2R1BA 3KZ4C 4N7IA 5DQ0A 5FYUA 1AF9A 5FR3A 4QKFA 1UU5A 1UZYA 3X29B 4D0QA 1DHKB 4BQXA 1JN2P 1PHMA 5BY5A 3EJKA 5FWEA 2QQVA 1JYIA 4GWNA 4XJ9A 4IQPA 1WCQA 1SACA 2QQJA 1NCRC 4YGBA 1W2NA 2RR13 1QXPA 1TMF1 4JTNA 2QE3A 2Z69A 3KV9A 3KV6A 2WN2A 1AR82 2GN7A 1HB4A 2VZ3A 3CEWA 4XUOA 4NHKA 2I07B 2WO7A 5T5OA 4K40A 1W2TA 4RSUA 1UYYA 3OEBA 3VBRB 4QMAA 2BTVC 1IPJA 4CCEA 2FDHA 4M01A 4HANA 1DQ1A 3ABZA 3J8F1 2RS11 4UOJA 4RFRB 5FPUA 3GJBA 3HEIA 1KDKA 3NSTA 4HETA 4XBLA 4CVUA 3OD0A 4NPLA 2OIIA 3D6EA 4LQRA 2FDGA 3S0MA 5I0UA 5J7MA 3GBWA 1CAWB 3WP6A 4NRMA 1GV9A 1YO8A 3AMQA 5F1RA 1CAUB 4JC1A 1NCRB 2FCTA 2BGOA 2IC1A 2VQ0A 4NHYA 4C8DA 1PZ8A 1RUI2 4XPVA 4CDXC 1VRH2 4Y5TA 2VAUA 2RJKA 3T4HB 4ASLA 5JUVA 3WQ7A 4KQ7A 1RXFA 4H55A 3AB0A 3O1VA 5FZ7A 1OKOA 4F3JA 2NZ9A 5FXZA 3OTFA 5A7OA 1JZ5A 4GALA 4FVVA 2J1RA 1FOD3 5HV0A 1AR93 3AMNA 3N7JA 1UOBA 5L73A 2HBUA 1SCRA 3VL9A 5FV3A 4AFCA 2HBTA 4F8AA 3VBHC 1QF3A 3WT3A 4QWNA 5EYXA 4ZHNA 2EIDA 4YM0A 1GYKA 2G4IA 5A7PA 1O6UA 1WW7A 4JX0A 5K0UA 4OUEA 2WLQA 3MICA 2PHLA 3CJIB 5FP9A 5FPVA 3S5QA 4CDXB 1FMD2 5FYBA 1R1A2 1IZ3A 5JXIA 2XUMA 1NA1A 4XFFA 1FNYA 3SXWA 4LXLA 2WUHA 3IPVB 3WVJA 2NN8A 4MOAA 1PIV2 3HT2A 2DUQA 3FE5A 4GB31 4A3ZA 1F5FA 4IE6A 5KR7A 1S2KA 1QJZA 1YFXA 5FCCA 5IJRA 2CYFA 1WA6X 3FBYA 4YVWA 2WO1A 4INDA 3VBHB 5JPNB 1VPHA 4YGEA 4YVSA 3V0BA 1RXGA 4FFGA 1PGL2 5LBEA 4DEVA 1WLCA 3SEEA 4GH4A 2UY9A 1GQPA 4XFGA 4ISRA 3EO6A 3SNMA 2E32A 4JDMA 3BTZA 4E4HA 4LK6A 1QOOA 2LW8A 1VMJA 3WDTA 4P02B 2V73A 1QIQA 5KXBA 3RZJA 2RDNA 2P17A 4LEJA 4LBNA 1ODNA 2CL2A 4Q2FA 5AC93 2BNOA 2OQ7A 2CWSA 2JDMA 1UZVA 3PIGA 3JZVA 3NJYA 4UAPA 3W59A 1SLLA 2UWCA 2B42B 1Q5OA 1MEC1 2LTNA 4DXZA 2DVAA 3J7NA 1V6MA 4QQLA 5A3OA 2RJLA 4Y1ZA 3KVAA 1QJFA 4Q4X3 2PXJA 2DV9A 2CGOA 3H7YA 5JSPA 1UZ0A 2A73B 2EVXA 3MGUA 5EP9A 2X05A 4LKSA 4BISA 1GOFA 3NRUA 1WD3A 4NPRA 3J7LA 4YW3A 4RYDA 4E4SA 4QGMA 4RGKA 2HWB3 3A0NA 4CSWA 4QHOA 2A7AA 2FDIA 4K7JA 3POJA 1GKBA 1PO12 4AHWA 5CU1A 1CJDA 2VUJA 3VHRA 5T50A 1K12A 2XONA 5LA0A 4QM9A 2H6BA 1VMFA 2JXAA 3KMHA 4OI4A 1RITA 1O4ZA 5BUVA 2HLEA 3AJZA 2E53A 3A4UA 3IZOA 2R0HA 5LB6A 1LGBA 1LGNA 1EPZA 5KXEA 4XHBA 2ILMA 3WCRA 4BDVB 5I8YA 5K7PA 3LEKA 3LSEA 4HKOA 2JECA 5FTTC 1F15A 1O8SA 2YV8A 1WCSA 5T5PA 1SFYA 3UETA 3ZIXA 4YZ2A 1W6PB 3PURA 4Q4V2 2SBAA 1W28A 3NNGA 5A32B 1VBC3 3LEIA 3JB4C 3KT7A 2D3RA 4K3UA 1JXNA 2VVEA 5FZDA 3ZXLA 4BMBA 1XYPA 5IHRA 1X9TA 2H0VA 1STMA 1CAVB 1AXZA 1CPNA 2QQOA 3UESA 4A6SA 5A7QA 5J96B 1R092 4MLOA 3WDYA 2W5FA 1NG0A 1EUUA 3B93A 1AX1A 1ASJ2 2BDRA 4L9BA 5CA6A 2DBIA 3LDKA 3RFRA 3WF2A 5A7WA 4M0NA 1PZ9A 5EQUA 3WHTA 4JKKA 4M0HA 1C1LA 3CIHA 3B94A 1W2AX 3RGBA 2GC2A 4CUGA 1H1MA 3OG2A 2D43A 3ZN6B 4NR1A 1OD3A 4D6QA 1SPPB 1UOGA 2IXLA 5FYIA 3ZSLA 1CWPA 2X5IB 2XQXA 2YDEA 2IXIA 5BXXA 4PDWC 3CBNA 2W9XA 1XSRA 1C5IA 2ZX1A 2IXCA 1UIJA 1POV3 2WNOA 3L2YA 3OYWA 4QX8A 3HD8B 2ZGRA 2E7QA 2WA4A 3HNMA 3JB8A 4UT5A 4CP1A 1RUI3 4BJ0A 5DMYA 3T09A 1Q8OA 1VRH3 2XPJA 3TBDA 4UBHA 1SEFA 4H7LA 4PQ9A 3O0WA 3ES4A 5J09A 1Y43B 2EALA 1C57A 3ZYGA 1S0FA 1UW8A 3SCFA 5F32A 1ULFA 3I54A 4A2UA 1QDCA 2ADEA 3JUUA 4FP2A 4O65A 4AI1A 1B35A 2Y34A 3IAPA 3POEA 4E8CA 2VBBA 4IW3A 3RG0A 1HKDA 1UIKA 2C1FA 2GC1A 1LEDA 1YQ6A 2DCKA 4PDWB 4PF1A 2Q8EA 5FZBA 4C0HA 3AMHA 1QH7A 4XJWA 1SCSA 3QCWA 1MZ5A 1O59A 1AXKA 3U07A 1PX3A 3E97A 4MXWA 2OPKA 1FMD3 4M4RA 3FFQA 1N1SA 3MW2A 4ATEA 3ILFA 2GSYA 1WWYA 4L99A 1PIV3 4S2GA 1WLTA 1O4YA 5EIYB 3NAPA 1GFF2 3AZVA 1ACCA 1NXMA 2E6VA 1X50A 2F17A 5BNPB 4IGOA 4K21A 4HSLA 4IEPA 1UF2C 2JICA 2YY1A 3HQRA 2A75A 5FZEA 4LUKA 3ZOIA 1FNZA 3RZMA 5ACA3 4PJYA 3KGLA 2P2KA 4JAAA 3C2UA 3N7LA 4BH9A 1ULOA 5FZ4A 5L9BA 2ADDA 4AG4A 2WS93 2JB4A 2JDPA 4Q0QA 4PBOA 5CYYA 3VZOA 4C1WA 2K9ZA 2XBO1 5D2AA 4RA0A 1ENXA 3A21A 4MX3A 1QJU1 2EIEA 3VHNA 1UXXX 5JIAA 4CYDA 1J1LA 3PUQA 3T0DA 4QPWA 3MIHA 5JCTA 2VZVA 4MSVA 1WKYA 3ZYRA 2TBVA 2BFUS 4LULA 3GM8A 4JGYA 5FFOC 4JDOA 4Q4Y2 4EQVA 1E5HA 1SLAA 3AXEA 4NROA 4QX0A 4YZ3A 1QXJA 1XNCA 2O0OA 3BIEA 1XXNA 1UZWA 2ARXA 2OKXA 4C90A 3P5BA 5E16A 2JG8A 1SBEA 3PLQA 1J3QA 1NLQA 2GNMA 2VOWA 2HH9A 2HWE1 1AYM1 1YI9A 2VZOA 3LEGA 4FOWA 4G9SB 3ZYPA 5C9AA 1RUOA 3ZXFA 3KCXA 1PGW1 3AM2A 4I02A 3DYMA 1AR72 5A33B 4WVMB 3ACLA 4LUMA 4OHVA 1RTVA 2BRTA 3M3EA 2ZACA 4P9IA 4YSFA 1G8WA 1RUH3 5H9PA 2BBVA 2D5FA 1EUTA 4COZA 2CGPA 5CKQA 1GWMA 2X53S 4LLOA 4U2AA 3RJ2X 5HBAA 3DL3A 2XL7A 2RR11 1REDA 2FMYA 1NZIA 1ZM1A 1PZ7A 3P3PA 1AJOA 2KR2A 1OFNA 5FIXA 3DF0A 1B09A 5E1RA 4AK3A 2DURA 2A6VA 4FPKA 4JGZC 3VBSA 1HB2A 1YFUA 4E8DA 3E6DA 2JKXA 4KWLA 2ET1A 1V00A 2ZZJA 1QXRA 1NT0A 1ZZ6A 2XJUA 4IL7A 1U0AA 4OHXA 1MQTA 2WAOA 1W3VA 3EHKA 3PJQA 4HK8A 4KG0A 4WM7A 3ZSMA 4LO6B 4Q4V3 1TEIA 5IK8A 1BBT1 1KXGA 1W2UA 3WNMA 1G9DA 5LW9A 3U14A 1OOPC 1UY2A 2A3YA 1V6JA 3ETPA 1UQXA 5A3PA 4FP3A 4A41A 1REFA 3LAGA 4V2VA 5DUXA 1R093 5GLTA 5HCAA 2D6NA 4S2DA 5CKNA 1LHNA 1BXHA 1C8M3 3RZGA 2ZXQA 1ASJ3 3GXUA 5B2GB 3ZYHA 2Y8KA 2ETEA 2JIJA 2ORZA 3C7GA 3SH4A 1Z0HA 1IPKA 1FOD1 2B5HA 3N36A 1AR91 5APAA 2RDRA 1CZTA 2RS51 4IXLA 3MYXA 2D6KA 2VZ1A 4GKXA 3T1LA 2FDJA 1A8MA 1TMF3 4UF0A 1D0GA 3VKOA 2VZUA 4XDQA 2IVJA 3RZLA 5BNQA 5EJ1B 4QXCA 1N3QA 1FPN2 3AKPA 3K4AA 1PK6A 1O91A 5AFBA 4QKBA 2GH8A 2BOIA 4HPKB 1BEV2 3VBUA 3VZNA 2BVBA 5K9YA 1LHOA 4EZ4A 2WWUA 1W0NA 2R1DA 2RM21 5IW0A 4XF3A 2W08A 5FPZA 1DF0A 4FPJA 3RPQA 4Y20A 5EPAA 5F3IA 4X6RB 4D8MA 1VALA 1S2BA 2DFCA 4FO9A 1ENSA 1GU3A 1ND2B 1WW5A 2VW0A 1SBDA 1W8TA 2ZKNA 1UMHA 4PT6A 2D44A 1Y9GA 2FZ1A 2IZWA 1Q8SA 4FCAA 4BA6A 4DY5A 5D8AB 5GLWA 3T30A 3DEMA 5C6CA 2F4LA 1NY72 5GZEA 3WR0A 2WNVC 1JU4A 1YLLA 1CZSA 4AR2A 4RL7A 4BU2A 5CG8A 1KDMA 2VUAA 4H3WA 1XC6A 2HKXA 2A6YA 4WV8A 3M3QA 2B9VA 4EN7B 1HN1A 1YI7A 5CZKA 5FZHA 1XYOA 4A7KA 4UXAA 3T2TA 4QPIC 4A6OA 1Z78A 5F5CA 5E89A 4V1PA 4N43A 2BW8A 4LJHA 1BQPA 1SLBA 1G9FA 2VZTA 4KI5M 4Q4X1 5ISLA 4HVQA 2DFBA 4XZUG 1AJKA 1LOFA 2W94A 1QEXA 1V9U2 3I8TA 3B7MA 4GB33 3GBFA 4L0PA 5CB7A 1ND3C 1KD7A 4TSVA 5A3WA 1LAJA 2B7YA 5D1IA 4M00A 1JUHA 5GLUA 5HI0A 1L7QA 1IS4A 3FBMA 4S2HA 5FBZA 3W9AA 3AC0A 1S55A 2HWB1 5C70A 5FYHA 3ZXJA 1WD4A 2QDNA 5J1XA 5ABJC 3FN9A 1W03A 4QPIB 1DLLA 1EV12 2A71A 3LGRA 1UN1A 4O9GA 4WM8C 2PLV2 4Q4Y3 2C24A 2R061 1V6OA 2XVLA 1Y4WA 1SG3A 2DCJA 2J1EA 2J42A 3QH6A 4A7YA 3S30A 4GQ7A 3D0SA 3I4IA 3MEPA 1D4M2 1LU2A 1FATA 2UU8A 4P9LA 1H1AA 1SLCA 5LEKA 1NAEA 1GZTA 4LHSA 1EAH2 1K45A 1MEC3 5A6QA 2Y64A 1JYCA 4KWJA 4W6WA 3ZN5A 3UGHA 1KS4A 4GWJA 3A7QA 3LB9A 2CU5A 3POBA 1OPMA 1AR73 3FWEA 3O5SA 3ROUA 1RMU2 4AEMA 2QQWA 2YHJA 1W06A 1DZQA 1HW5A 4WM8B 1BK1A 3WCSA 5JOXA 4CZSA 2WT2A 2VMHA 4UFKA 4CCJA 1N3OA 1WMXA 2A3WA 2CAVA 1GOHA 3FJSA 2VGDA 1WMFA 1X33A 4FFIA 1CX1A 2VTXA 5FY0A 3A23A 4BQ5A 3NKTA 4LBQD 1AR81 3OUHA 1COV2 1EY2A 1ZZ8A 4KU7A 5FZLA 2WSVA 5HCHA 2EXKA 1HQWA 1XBFA 4M3CB 4SBVA 4ES8A 4EWAA 1JH5A 1XE0A 3TEXA 1F35A 1HX6A 3DKQA 3ZFGA 3ZIWA 4NRPA 4AYUA 1VMHA 2J1UA 2ZX3A 5T5LA 5DN2A 4PBPA 4I09A 4FPFA 1TZOA 4CCKA 1S1AA 5C8CC 1JYVA 3DYPA 3E5UA 5C71A 1JZ2A 4TZDA 4QDSA 1POV1 1ZZ7A 3FHAA 3NV1A 1W2OA 1AYN2 3RWNA 5LK5A 3W5MA 1ZBE2 1RUI1 1X9PA 2GN3A 5C4WC 1VRH1 2J1AA 3EQEA 2PAMA 4Q1RA 2RS32 3B9IA 4AL9A 5LA9A 1L3JA 3HNYM 4NPMA 5ANNA 2QQNA 1W8FA 5FO8B 1JZ8A 4FOQA 4NN0A 4AOCA 1CD3G 5LRSA 4CEWA 2AH2A 1U12A 4P9YA 4YNIA 3KQ4B 2OPWA 3I97A 4BK5A 4DFSA 2VNRA 1ZZCA 5FOBB 3IMMA 2D93A 2MNGA 2NP0A 1BMV2 1QH6A 5LBCA 1UXZA 5C8CB 2XUEA 3R4SA 1LB2A 2AENA 3JBG2 5FAXA 2VJXA 3VN4A 4XURA 5KHGA 1LKNA 1RUE2 3WDVA 4CUAA 1I3HA 2PMWB 2YROA 1FPN3 3PTRB 4B3NA 4XXAA 3N7MA 2Z2SB 4YW2A 2FMDA 2YGLA 1OH4A 1FV3A 4OI1A 1FMD1 4ONUA 1R1A1 2J7MA 5C4WB 1CQ9A 2AZ5A 2R6QA 2AREA 2BERA 3CF6E 1BEV3 1CIWA 3OGSA 4MADA 2VC9A 2UYAA 1PIV1 2BZDA 2Y6KA 1SBFA 2PHRA 1W9YA 2P37A 3FLRA 3GHNA 3IIAA 3LPGA 4I0WB 4YLZA 2EICA 2D5HA 3H8XA 5LBFA 1RGSA 3AZXA 5FKCA 4NAMA 4LE4A 1CONA 3C7FA 5A1FA 5EYYA 2VM9A 3KD4A 3U78A 4PF5A 3H42B 4RR3A 4B1LA 5A6YA 1PVC2 1TME2 1PGL1 4CDQA 4D69A 4QX3A 4YWAA 4NAOA 3MDPA 2YC4A 2W2IA 4NHMA 4QD2A 4E4ZA 3WG3A 3RI9A 1ZBA2 4LITA 4ORFA 3USUA 4BLJA 3LOBA 2QZ3A 2ZGKA 5F7UA 5JXJA 4B7KA 2D6PA 3K3NA 4JRAA 4XQWA 3WF4A 1H0BA 1XU1A 4AGVA 4AVAA 1OHFA 2L9LA 2KM2A 4HKLA 2LROA 3MFCA 3TB0A 2KXLA 4XFBA 2ZEYA 2YPJA 3KV4A 1UL9A 3AKRA 3ZFFA 2OZ6A 1VAKA 1ZRRA 3BB6A 1UYPA 1W8HA 4KMQA 2BPA2 3L2HA 3VBOA 3AZZA 3I2HA 4E27A 3AKSA 2OQ6A 4YG6A 5J98B 2DVDA 4XACA 3PMEA 3BKZA 3D5OA 4Y3OA 1W3XA 3WQ1A 2BGPA 5C5TA 4UBGA 3HQXA 4CDUA 2QDRA 3FZ3A 1RYYA 2QKDA 3WQ0A 1UPSA 3ZPOA 1RUC2 5A3MA 1YQ8A 1G9BA 4OVEA 1I9RA 3KCCA 1X36A 1PO11 3ACHA 4QDRA 5FPBA 3RWKX 5IT6A 1GLHA 3H9AA 1LTEA 1LNSA 1ZRIA 2CWMA 2VQUA 5GZDA 3ZN4A 1EV13 1CR7A 1AX0A 1AZDA 1QJU3 2V4VA 4HSJA 1TNRA 3HR9A 1GWKA 2P6CA 2K2SA 1OI6A 4WBBA 3B69A 3H8UA 3K4DA 4Y26A 3A22A 4A3XA 5KHJA 2HWD2 1MS1A 1RUD2 2P3YA 2VMFA 1MS8A 4R52A 1VLNA 3GZTB 1C8NA 3HNBM 1EAH3 2Q8OA 4ZZ5A 4IEZA 2OA2A 1S0BA 4RQPC 4Q4V1 4QKNA 2VMGA 2ARCA 1XE7A 2XJPA 3M3OA 5FXWA 4CXXA 4WVVA 5FYMA 4QB1A 4AHYA 3OY8B 1DGWA 4Z2AA 4CEYC 1LESA 5EJ3A 4JV4A 3H3ZA 4P9WA 1R091 2JDYA 2KA3A 3SH5A 5FJHA 3HMYA 5F6LB 1UX7A 4Y22B 1LHWA 1IQDC 4OQ8A 2RDQA 1HXS2 1ASJ1 3KF5A 4XQ4A 2SLIA 4IV3C 1KEXA 4IEXA 4CCCA 4BIOA 5BNNA 3M3IA 4FXKB 4WZFA 3UK9A 1YFYA 5F2WA 4EN9B 1COV3 3P3NA 1DQ6A 3QACA 2C4XA 2GP3A 2XKPA 4NHXA 4IV1A 3PUHA 4RQPB 4CDWA 2WT0A 4B7EA 5A6ZA 4H7MA 4QGNA 3HBZA 3IN9A 2BP6A 5FYSA 2YBPA 4NIHA 3KWVA 1DGWX 2GZWA 1M06G 2GP5A 4GMP3 3VD9A 4CEYB 4NHLA 4AVBA 1UY1A 4CP9B 2Y6FA 3D4KA 4DY3A 1E57A 1DG6A 3CMGA 5CFDA 1OVPA 3JD72 1UMZA 5LA1A 1SHWB 3OYWB 2K46A 2QTWB 3OBZA 5FP4A 1AYN3 1YQ5A 3TNQA 3ZYFA 1ZBE3 3FUQA 3DPRC 1QHDA 4BMEA 1NKGA 1WLDA 4NIDA 1DFQA 4IV3B 3UKNA 2RS33 1BBT3 1OA4A 2WO3A 3MFAA 4OCTA 3TEYA 1ULGA 4MV2A 3AZWA 2ZGMA 5F5IA 1N47A 2C9KA 2J1TA 4FFHA 3U10A 2Y6GA 3CJIC 1S0IA 5GALA 2R7EB 3MV11 4RGAA 2IVIB 3SCHA 1B35B 2XJQA 3P6BA 5JWPA 4W65A 3VD7A 2HWC2 5JOYA 4QB2A 1SFPA 2DTWA 3BCWA 3JBG3 3I2KA 4PLNA 2OXBA 1RUE3 2BU9A 1GZCA 3MIGA 1CX4A 1A8DA 1DYPA 1VP6A 2RS53 4LIUA 4ZKTB 2WO2A 5FJKA 2VE1A 4P08A 3DPRB 3I2GA 3AYEA 2JEMA 4W8JA 4P5HA 3IMNA 1S0CA 2HWF2 3IDEA 2VCAA 4XTPA 5LASA 2GMEA 5JIUA 3VDDA 5JZGA 1IKPA 3HN3A 4LKDA 3SKVA 4C0BA 4W6YA 3S6PA 3PUIA 1W04A 3EYPA 5FZFA 4R9DA 2D6MA 2ZAAA 1KJLA 5LRRA 2RM23 1C28A 2RV9A 3OBAA 1PVC3 1TME3 2VNGA 1PNGA 2DVBA 2YBKA 3ES1A 4Y1VA 4Q0UA 1IG3A 1AHSA 1H6YA 1XNBA 2W0XA 3DECA 3E6BA 3M1HA 1MACA 2J1VA 3TNPB 5CFCA 1AXYA 4IESA 2JG9C 1URXA 1ZBA3 5IVBA 1W6OA 2WKKA 3MW3A 2ATFA 2E26A 4Y5SA 3CZJA 4Q27A 1UKGA 5G04L 2DYCA 4UYBA 5KXDA 2VMIA 5DABA 2I74A 2A6ZA 3ZDVA 2VG9A 1BZWA 1VJ2A 3C3VA 2PA7A 5A80A 3ST7A 3SQOA 3POWA 4UFMA 1Y7BA 4CA9A 4GAZA 4Q4Y1 4YRDA 5FYTA 3MI8A 3OB8A 3BALA 5JR2A 3HOBA 2RMU2 3MZHA 4AAXA 1W6NB 4KL1A 4WZCA 2WAAA 4EJRA 3VKLA 1HLCA 1RUF2 4CPBA 4NIIA 5A7NA 2DTYA 1OF4A 4N53C 3U4SA 4R8HA 5FY5A 2ZX2A 3VL8A 4TYSA 5IVCA 1JODA 2DWRA 2JG9B 3BODA 2BUKA 3NNFA 4OUSA 1AR71 4DXTA 2CDPA 5GZCA 2YUEA 5CADA 1UYZA 1RUC3 4YPJA 4PCRA 5LY1A 4BOWA 5JAXA 3IAQA 4LBQB 1L7RA 5KHKA 1GUIA 1TG7A 2I2SA 2Y0OA 1JZ4A 3PU8A 3OBTA 4DS0A 3IDAA 3CLPA 3Q8EA 1UY4A 1HQLA 4LPLA 3DGTA 1SQ4A 4GXLA 4N53B 4A42A 2HWD3 2YU2A 1RUD3 4HOOA 2XOMA 1RIRA 3ENRA 5JLVA 1X8EA 2JE8A 3TWIA 3NVCA 1NCQA 1UWWA 2A70A 1MR5A 1IOAA 2R063 4KNCA 1VBD2 2LS6A 1LOBA 4RS5A 4AVVA 2VL4A 4GIQA 4YW7A 4N9HA 1T2XA 2D40A 1NX9A 4NO4A 3O1TA 2W47A 1Z7S2 4CCLA 2D6OX 4XZPA 3OD4A 1CPMA 2VQAA 2PAKA 4OULA 1NLSA 3ZO0B 5I0SA 3NNLA 2LALA 4QXBA 1UAIA 4JHTA 3U11A 3DCQA 3PUSA 2WRAA 5FZOA 2G9GA 2UWAA 3B00A 3V65A 3VBFA 1HXS3 2X5IC 2EXJA 1ZA7A 3O1SA 3WP4A 1GZWA 4ATFA 5GZGA 1HB3A 2WIIB 4MXVA 4FAHA 3ZMOA 2VW1A 4LO5B 5FLIA 5FP7A 2DUPA 1QJY2 1OD5A 2ZHNA 1JZ6A 4LT5A 2ZGOA 3MLLA 2JDZA 2XDVA 5DZFA 4DO0A 2P34A 4FXGB 4JRLA 4BLIA 4I01A 1J3RA 1AR83 4QX7A 1FPN1 1OSGA 1JTZX 1QKQA 3I3DA 5DAPA 1OPOA 1Y9QA 2FCVA 1POQA 3LEMA 2GH2A 3ECQA 3USSA 4N90A 4AHZA 1Y9MA 1AUYA 1BEV1 3ZXAC 3GGLA 2YBSA 4QQOA 4AEDC 4EV0A 1A78A 1N1TA 4EN0A 3Q8CA 1DZRA 1CJPA 4QHBA 3H8OA 2D98A 4CUCA 5FZ6A 5LWBA 5AVAA 3H8RA 5H9SA 1K5MA 1CZVA 3DYOA 2IFWA 3KM5A 3HWJA 4FQZA 4XUNA 2W95A 4B4PA 4LE3A 1OQ1A 3ZFEA 3TRSB 3O1PA 4MHUA 4TLGA 5BYNA 2DF7A 1GWLA 4P9XA 4OFGA 5FO7B 4FPYA 4NIAA 2XMLA 2WFPA 1NY71 3VHOA 5C3OA 5BNPC 2D97A 5HXMA 3WV6A 3VBRA 4AEDB 3I3MA 2W68A 1W99A 2PHDA 4LTAA 2Y6HA 4LO4B 1QOSA 2HWF3 1QJEA 5C7GA 1XNDA 5CAZA 1MZ6A 4IEVA 3O0VA 2P3JA 2NM1A 3AVRA 3NMBA 1RUJ2 3W20A 1GANA 4AW7A 2AEZA 1J1TA 1R1A3 3OF1A 1CAWA 4XJAA 3M2MA 4X6QB 3H0OA 1QMJA 2XLAA 3OUJA 5BPXA 1CAUA 3ZM8A 4BQ2A 1NCRA 1ZVFA 4Q0VA 3VZJA 2C26A 3Q9OA 4DPNA 5DG2A 2QVSB 2WWSA 5JXHA 3KLSA 1S4CA 3POFA 4Q4W2 5C3RA 4AQ2A 4QHZA 4QB6A 5DUUA 1HRV2 1AL22 1MZFA 1FI2A 1RUG2 3SHRA 2Y60A 2E7TA 3CHXA 5FBJA 1OBNA 1J83A 1ALYA 1YXWA 3PL0A 1I6XA 3T0BA 4HLTA 2JDHA 4MZUA 1GZ9A 1V6IA 1EV11 4AFMA 4L92A 4CTEA 3DV8A 3V0AB 3WUCA 1LOCA 2WNUC 1O7FA 2WABA 3Q8BA 1RL3A 4CDXA 2RMU3 3T2OA 5J3UA 1D4M1 2EA7A 3FHIB 4OUMA 3IPVA 4LHKA 4FQ4A 5ANQA 4AQ6A 2V5DA 3RJRA 3GZUC 2Q8DA 1EAH1 1NZCA 2CSGA 2VR4A 3CU7A 4TXWA 3AYDA 3B3QE 3MUZ1 1U5XA 3POGA 1YWKA 1FX5A 4B1MA 5BNOC 3H1MA 4HVRA 2WZEA 3E5QA 2IFRA 4CU6A 1F9KA 5A3LA 1K5JA 2VMCA 1RMU1 3VBHA 4X8NA 3KVBA 4XFCA 3WHUA 1V6NA 3RMXA 1F5JA 3OPWA 3HAGA 2Q30A 2VTFA 5FUPA 3NJVA 2VZQA 2WNUB 1Q8PA 3BVCA 4META 1D2QA 4FPHA 3WQBA 4YG3A 4CU9A 2IUWA 1U5ZA 4FPEA 2JX9A 5F37A 1PO13 5FREA 1COV1 3T3YA 5FMOL 1ZZBA 2EF6A 1WW4A 2XXZA 2P3KA 4QPGC 3THCA 4BQ4A 2CHHA 3O1OA 1QQP2 5J37A 4FTBA 1BVVA 5BNOB 4R4ZA 4DZGA 3S7IA 2VMEA 2RDSA 1EP0A 1ZA4A 3I49A 1HIXA 3LCPA 4XIOA 3LDBA 4D7TA 4GMP1 2Q4SA 4K9SA 3WUDA 5FKBA 1JOBA 4HZFA 1QNYA 5KHIA 4Y24A 5LK7B 3O1MA 4DUXA 4B8EA 4PI2A 2GDFA 2QQIA 1AYN1 2VNVA 3KHBA 1ZBE1 4E2GA 1S2EA 3LFIA 1KFXL 4XUTA 1VIWB 3LF7A 2RS31 1CESA 3M8LA 2OYZA 1YEWA 3UV9A 3J4UH 2R042 2YB7A 3UGFA 4LBKA 4QPGB 1YYNA 2P1BA 3LFMA 4UFJA 3OSDA 1OUSA 5F8PA 2VCMA 1MVEA 3PUAA 2B8MA 3AFKA 3R4UA 2QJVA 1BMV1 2X09A 3ZDSA 3THTA 3QD6A 1BCXA 1LGCA 1SLIA 3JBG1 2ZMNA 2MEV2 1RUE1 3KT4A 4W4ZA 4XFHA 5FLJA 1WMEA 2EAAA 1ND2C 1MS5A 3WZ1A 2A3XA 3IT8A 1TQ5A 2QUOA 3KQRA 4CP2A 4WVWA 3HT1A 1W6PA 5D8AC 3ZXEA 3AL5A 5A32A 3KS7A 2TEPA 3DXUA 4R4XA 2HEVF 4HT1T 4QQPA 3FX3A 1CAVA 1YIFA 4FT8A 3IBMA 4XW3A 3LZZA 4FTSA 3BTYA 5T52A 3LA2A 3CKHA 2W39A 1G6NA 3K2OA 1PVC1 1TME1 3OJBA 4AI2A 4L2NA 4H14A 1BHGA 2K0GA 3T0AA 1D4VB 2I45A 2Q0AA 2ZA9A
chains in the Genus database with same CATH topology
2BZDA 2Y6KA 5I0DA 3LPGA 2EICA 2ID4A 2YC2A 2VMDA 3C8XA 1K42A 3MBWA 2HYXA 2EIDA 3C7FA 3WNOA 2VM9A 4JX0A 4OUEA 1JZ3A 5JXIA 4QX3A 3C7HA 3CDZB 5JXGA 2YC4A 2WUHA 4A44A 1UY3A 4MOAA 2QQLA 2Y6LA 1CIYA 3CQOA 4A3ZA 4FI9A 3C7OA 5F7UA 5JXJA 3WF4A 5IJRA 2L9LA 2WO1A 2ZEYA 2WQ8A 4DEVA 3SEEA 3WEZA 1GQPA 4KMQA 2E32A 3FL7A 2LW8A 3I2HA 1D7PM 2V72A 4P02B 5IFPA 2KD7A 2BGPA 4GZ9A 1RYYA 4KWUA 3F2ZA 4UAPA 4QDRA 3ACHA 2WN3A 4ZXEA 1LNSA 3MV01 2VQUA 4OMDA 3LE0A 2V4VA 3NQHA 3SEPA 3OGVA 1UZ0A 2X05A 1XPWA 4LKSA 1GOFA 3NRUA 2W91A 3K4DA 2ZEZA 3A22A 2QQMA 1NUKA 4QAWA 3SKJE 4RYDA 2VMFA 5B4XA 5LA2A 4RN5A 3HNBM 1PMHX 1GMMA 4ZZ5A 4W50A 1K12A 2XONA 5LA0A 4A45A 4QB1A 1O8PA 4Z2AA 2HLEA 1UX7A 4BDVB 3LEKA 1IQDC 1O8SA 1KEXA 3UETA 1R64A 2QBXA 4XUQA 1JHJA 2W1UA 3WSOA 2C4XA 3NNGA 1JI6A 3LEIA 4TTGA 1UMIA 3PUHA 5IHRA 4M4PA 3UESA 2QQOA 2PQSA 3P1IA 2W5FA 4P5YA 3VD9A 1EUUA 4DXSA 1UY1A 1XNAA 3CMGA 5LA1A 1SHWB 3WF2A 2ZEXA 2WYSA 4JKLA 1NKGA 4JKKA 2WO3A 3CIHA 1W8OA 3T2QA 3OG2A 2C9KA 2J1TA 2Y6GA 1OD3A 2W46A 2R7EB 2ZEWA 3MV11 2XQXA 3P6BA 4CU8A 3VD7A 2W87A 2W9XA 2Z4FA 4DXRA 4QB2A 3I2KA 4JKMA 3HNMA 2VZRA 4BJ0A 5DMYA 3T09A 4UI9L 3U37A 3VDBA 2WO2A 4P08A 3I2GA 4W8JA 2WZ8A 2VCAA 1DLCA 3IAPA 2W1SA 4E8CA 3HN3A 3SKVA 3PUIA 3EYPA 3CZUA 2DCKA 4PF1A 2VO5A 3OBAA 2RV9A 1O59A 1PX3A 3BN6A 4M4RA 1YQ2A 4MO3M 2BBAA 1H6YA 3DECA 4P00B 3FHQA 2J1VA 1MPXA 1GNYA 5EIYB 3I2IA 2E26A 5G05L 3CZJA 5G04L 2VCBA 4DUVA 1PX4A 3WF0A 2E31A 3VD3A 3D3AA 4GWIA 4A4AA 2XHNA 3OB8A 5JR2A 1ULOA 5JMOA 3HOBA 4AG4A 4AAXA 5CYYA 2WAAA 3NJXA 3A21A 3HJRA 2EIEA 2JD9A 3MO4A 1UXXX 2EIBA 4XUPA 5EJZB 3WNLA 1OF4A 3I2JA 1W9WA 4QPWA 3T0DA 1H6XA 3BGAA 4ZZ8A 2VZVA 1WKYA 4DXTA 1W8NA 2CDPA 3GM8A 1UYZA 4YPJA 2ORXA 4QX0A 1US2A 3IAQA 5FUIA 2OKXA 4MGSA 1L7RA 1GUIA 1TG7A 2RVAA 4OYUA 1JZ4A 2VZOA 3LEGA 3IDAA 2J22A 1UY4A 4LPLA 1K3IA 4A42A 3DYMA 5B4NA 2XOMA 3LPFA 2JE8A 1UWWA 3IB3A 2E33A 1JU3A 2W92A 2LS6A 1EUTA 2VL4A 1T2XA 1NX9A 2W47A 3OEAA 4QDQA 4OMCA 2W1WA 1JZ7A 3K77A 2X10A 3HPNA 4E8DA 2JKXA 1PMJX 1TVGA 2CDOA 3ACFA 4BK4A 2WAOA 1KGYA 3WNMA 1JZ6A 1US3A 3VD4A 5IFTA 1UY2A 3ETPA 2DDUA 3UNPA 1UY0A 4A41A 3I3DA 3ECQA 2ZXQA 3GXUA 2Y8KA 2ORZA 3C7GA 3GGLA 1DYOA 1F4HA 1CZTA 4CUCA 2VZ1A 1ULPA 3THDA 1CZVA 2VZUA 3DYOA 5EJ1B 4XUNA 2W95A 5DPNA 3GDBA 3K4AA 3WF1A 4CUBA 1W0NA 1GOGA 3K75B 5HXMA 1W9TA 1W99A 2Y6HA 4D8MA 3VDCA 5C7GA 1GU3A 1UMHA 4PT6A 4MGQA 3ZM8A 3EB7A 2C26A 1JU4A 4ET7A 1CZSA 5JXHA 2RJ2A 1XC6A 4QB6A 1DP0A 2B9VA 1HN1A 2YG0A 1OT5A 5CZKA 2WBKA 4JHZA 1J83A 3WNKA 4A6OA 5HPOA 3T0BA 2VZTA 4KI5M 3VDAA 4XZUG 3T2PA 2W94A 2W3JA 4QX1A 2WABA 4L0PA 1P8JA 3T2OA 4DUWA 2W1QA 4OZOA 4DEQA 1L7QA 4PQQA 2Y6JA 3WNPA 1UYXA 3AC0A 2V5DA 5C70A 3OGRA 4QX2A 1JYXA 2J1SA 3MUY1 2VOTA 2VR4A 5J1XA 1XNTA 4TXWA 3MUZ1 3FN9A 4CU6A 2WZEA 1JYWA 2VMCA 4ZY9A 1SG3A 2DCJA 2J1EA 3C7EA 2VTFA 3NJVA 2VZQA 3T08A 1J84A 3I2FA 3W5NA 1NAEA 4LHSA 3WQBA 1K45A 4CU9A 4HG6B 2Y64A 4IUGA 4XVHA 3E1F1 2VZSA 3ACGA 3K46A 3A7QA 4GWJA 3THCA 1SDDB 2WDBA 2VMEA 1F4AA 4ARYA 1GOHA 3ACIA 1OF3A 1CX1A 4DUXA 2QQIA 3A23A 3LQCA 5IYYA 4XUTA 1JYNA 3JXSA 3I3BA 2YFUA 2QQKA 5DQ0A 2YB7A 3WF3A 4D0QA 2J1UA 2VCCA 5DN2A 1I5PA 1WCQA 2QQJA 2VZPA 2X09A 3DYPA 5C71A 1JZ2A 1JYVA 4QDSA 3J7HA 3FHAA 3W5MA 2WN2A 4W4ZA 2VZ3A 5A1AA 2J1AA 2VQTA 4XUOA 1UYYA 3OEBA 2JDAA 3HNYM 2QQNA 1JZ8A 3ABZA 4UOJA 3HEIA 4CVUA 3I97A 4BK5A 2YFZA 4LQRA 1W9SA 3K4ZA 2VC9A 1UXZA 2B4KA 4CU7A 2VJXA 3IIIA 4XURA 2BGOA 3I3EA 4CUAA 3CKHA 5LCWL 3VD5A 5JUVA 1OH4A 4BXSV 1BHGA 2J7MA 3T0AA 3WNNA 4ARXA 2BERA 1JZ5A 3OGSA 4MADA 2J1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZD A;  2Y6K A;  5I0D A;  3LPG A;  2EIC A;  2ID4 A;  2YC2 A;  2VMD A;  3C8X A;  1K42 A;  3MBW A;  2HYX A;  2EID A;  3C7F A;  3WNO A;  2VM9 A;  4JX0 A;  4OUE A;  1JZ3 A;  5JXI A;  4QX3 A;  3C7H A;  3CDZ B;  5JXG A;  2YC4 A;  2WUH A;  4A44 A;  1UY3 A;  4MOA A;  2QQL A;  2Y6L A;  1CIY A;  3CQO A;  4A3Z A;  4FI9 A;  3C7O A;  5F7U A;  5JXJ A;  3WF4 A;  5IJR A;  2L9L A;  2WO1 A;  2ZEY A;  2WQ8 A;  4DEV A;  3SEE A;  3WEZ A;  1GQP A;  4KMQ A;  2E32 A;  3FL7 A;  2LW8 A;  3I2H A;  1D7P M;  2V72 A;  4P02 B;  5IFP A;  2KD7 A;  2BGP A;  4GZ9 A;  1RYY A;  4KWU A;  3F2Z A;  4UAP A;  4QDR A;  3ACH A;  2WN3 A;  4ZXE A;  1LNS A;  3MV0 1;  2VQU A;  4OMD A;  3LE0 A;  2V4V A;  3NQH A;  3SEP A;  3OGV A;  1UZ0 A;  2X05 A;  1XPW A;  4LKS A;  1GOF A;  3NRU A;  2W91 A;  3K4D A;  2ZEZ A;  3A22 A;  2QQM A;  1NUK A;  4QAW A;  3SKJ E;  4RYD A;  2VMF A;  5B4X A;  5LA2 A;  4RN5 A;  3HNB M;  1PMH X;  1GMM A;  4ZZ5 A;  4W50 A;  1K12 A;  2XON A;  5LA0 A;  4A45 A;  4QB1 A;  1O8P A;  4Z2A A;  2HLE A;  1UX7 A;  4BDV B;  3LEK A;  1IQD C;  1O8S A;  1KEX A;  3UET A;  1R64 A;  2QBX A;  4XUQ A;  1JHJ A;  2W1U A;  3WSO A;  2C4X A;  3NNG A;  1JI6 A;  3LEI A;  4TTG A;  1UMI A;  3PUH A;  5IHR A;  4M4P A;  3UES A;  2QQO A;  2PQS A;  3P1I A;  2W5F A;  4P5Y A;  3VD9 A;  1EUU A;  4DXS A;  1UY1 A;  1XNA A;  3CMG A;  5LA1 A;  1SHW B;  3WF2 A;  2ZEX A;  2WYS A;  4JKL A;  1NKG A;  4JKK A;  2WO3 A;  3CIH A;  1W8O A;  3T2Q A;  3OG2 A;  2C9K A;  2J1T A;  2Y6G A;  1OD3 A;  2W46 A;  2R7E B;  2ZEW A;  3MV1 1;  2XQX A;  3P6B A;  4CU8 A;  3VD7 A;  2W87 A;  2W9X A;  2Z4F A;  4DXR A;  4QB2 A;  3I2K A;  4JKM A;  3HNM A;  2VZR A;  4BJ0 A;  5DMY A;  3T09 A;  4UI9 L;  3U37 A;  3VDB A;  2WO2 A;  4P08 A;  3I2G A;  4W8J A;  2WZ8 A;  2VCA A;  1DLC A;  3IAP A;  2W1S A;  4E8C A;  3HN3 A;  3SKV A;  3PUI A;  3EYP A;  3CZU A;  2DCK A;  4PF1 A;  2VO5 A;  3OBA A;  2RV9 A;  1O59 A;  1PX3 A;  3BN6 A;  4M4R A;  1YQ2 A;  4MO3 M;  2BBA A;  1H6Y A;  3DEC A;  4P00 B;  3FHQ A;  2J1V A;  1MPX A;  1GNY A;  5EIY B;  3I2I A;  2E26 A;  5G05 L;  3CZJ A;  5G04 L;  2VCB A;  4DUV A;  1PX4 A;  3WF0 A;  2E31 A;  3VD3 A;  3D3A A;  4GWI A;  4A4A A;  2XHN A;  3OB8 A;  5JR2 A;  1ULO A;  5JMO A;  3HOB A;  4AG4 A;  4AAX A;  5CYY A;  2WAA A;  3NJX A;  3A21 A;  3HJR A;  2EIE A;  2JD9 A;  3MO4 A;  1UXX X;  2EIB A;  4XUP A;  5EJZ B;  3WNL A;  1OF4 A;  3I2J A;  1W9W A;  4QPW A;  3T0D A;  1H6X A;  3BGA A;  4ZZ8 A;  2VZV A;  1WKY A;  4DXT A;  1W8N A;  2CDP A;  3GM8 A;  1UYZ A;  4YPJ A;  2ORX A;  4QX0 A;  1US2 A;  3IAQ A;  5FUI A;  2OKX A;  4MGS A;  1L7R A;  1GUI A;  1TG7 A;  2RVA A;  4OYU A;  1JZ4 A;  2VZO A;  3LEG A;  3IDA A;  2J22 A;  1UY4 A;  4LPL A;  1K3I A;  4A42 A;  3DYM A;  5B4N A;  2XOM A;  3LPF A;  2JE8 A;  1UWW A;  3IB3 A;  2E33 A;  1JU3 A;  2W92 A;  2LS6 A;  1EUT A;  2VL4 A;  1T2X A;  1NX9 A;  2W47 A;  3OEA A;  4QDQ A;  4OMC A;  2W1W A;  1JZ7 A;  3K77 A;  2X10 A;  3HPN A;  4E8D A;  2JKX A;  1PMJ X;  1TVG A;  2CDO A;  3ACF A;  4BK4 A;  2WAO A;  1KGY A;  3WNM A;  1JZ6 A;  1US3 A;  3VD4 A;  5IFT A;  1UY2 A;  3ETP A;  2DDU A;  3UNP A;  1UY0 A;  4A41 A;  3I3D A;  3ECQ A;  2ZXQ A;  3GXU A;  2Y8K A;  2ORZ A;  3C7G A;  3GGL A;  1DYO A;  1F4H A;  1CZT A;  4CUC A;  2VZ1 A;  1ULP A;  3THD A;  1CZV A;  2VZU A;  3DYO A;  5EJ1 B;  4XUN A;  2W95 A;  5DPN A;  3GDB A;  3K4A A;  3WF1 A;  4CUB A;  1W0N A;  1GOG A;  3K75 B;  5HXM A;  1W9T A;  1W99 A;  2Y6H A;  4D8M A;  3VDC A;  5C7G A;  1GU3 A;  1UMH A;  4PT6 A;  4MGQ A;  3ZM8 A;  3EB7 A;  2C26 A;  1JU4 A;  4ET7 A;  1CZS A;  5JXH A;  2RJ2 A;  1XC6 A;  4QB6 A;  1DP0 A;  2B9V A;  1HN1 A;  2YG0 A;  1OT5 A;  5CZK A;  2WBK A;  4JHZ A;  1J83 A;  3WNK A;  4A6O A;  5HPO A;  3T0B A;  2VZT A;  4KI5 M;  3VDA A;  4XZU G;  3T2P A;  2W94 A;  2W3J A;  4QX1 A;  2WAB A;  4L0P A;  1P8J A;  3T2O A;  4DUW A;  2W1Q A;  4OZO A;  4DEQ A;  1L7Q A;  4PQQ A;  2Y6J A;  3WNP A;  1UYX A;  3AC0 A;  2V5D A;  5C70 A;  3OGR A;  4QX2 A;  1JYX A;  2J1S A;  3MUY 1;  2VOT A;  2VR4 A;  5J1X A;  1XNT A;  4TXW A;  3MUZ 1;  3FN9 A;  4CU6 A;  2WZE A;  1JYW A;  2VMC A;  4ZY9 A;  1SG3 A;  2DCJ A;  2J1E A;  3C7E A;  2VTF A;  3NJV A;  2VZQ A;  3T08 A;  1J84 A;  3I2F A;  3W5N A;  1NAE A;  4LHS A;  3WQB A;  1K45 A;  4CU9 A;  4HG6 B;  2Y64 A;  4IUG A;  4XVH A;  3E1F 1;  2VZS A;  3ACG A;  3K46 A;  3A7Q A;  4GWJ A;  3THC A;  1SDD B;  2WDB A;  2VME A;  1F4A A;  4ARY A;  1GOH A;  3ACI A;  1OF3 A;  1CX1 A;  4DUX A;  2QQI A;  3A23 A;  3LQC A;  5IYY A;  4XUT A;  1JYN A;  3JXS A;  3I3B A;  2YFU A;  2QQK A;  5DQ0 A;  2YB7 A;  3WF3 A;  4D0Q A;  2J1U A;  2VCC A;  5DN2 A;  1I5P A;  1WCQ A;  2QQJ A;  2VZP A;  2X09 A;  3DYP A;  5C71 A;  1JZ2 A;  1JYV A;  4QDS A;  3J7H A;  3FHA A;  3W5M A;  2WN2 A;  4W4Z A;  2VZ3 A;  5A1A A;  2J1A A;  2VQT A;  4XUO A;  1UYY A;  3OEB A;  2JDA A;  3HNY M;  2QQN A;  1JZ8 A;  3ABZ A;  4UOJ A;  3HEI A;  4CVU A;  3I97 A;  4BK5 A;  2YFZ A;  4LQR A;  1W9S A;  3K4Z A;  2VC9 A;  1UXZ A;  2B4K A;  4CU7 A;  2VJX A;  3III A;  4XUR A;  2BGO A;  3I3E A;  4CUA A;  3CKH A;  5LCW L;  3VD5 A;  5JUV A;  1OH4 A;  4BXS V;  1BHG A;  2J7M A;  3T0A A;  3WNN A;  4ARX A;  2BER A;  1JZ5 A;  3OGS A;  4MAD A;  2J1R A; 
#chains in the Genus database with same CATH topology
 2N7G A;  4LIV A;  1ZBA 1;  4YW5 A;  5I0D A;  3AKQ A;  4FAG A;  5L7O C;  4XJZ A;  4KG8 A;  4CCD A;  5JOW A;  3RZK A;  2ID4 A;  3C8X A;  1K42 A;  2XG3 A;  1H8T C;  1WW6 A;  3MBW A;  4QU2 A;  3SC7 X;  3PU3 A;  3ZN6 A;  1SPP A;  3WNO A;  5FPX A;  1YIP A;  1REE A;  4AF9 A;  3GZA A;  3C7H A;  3CDZ B;  3ZR5 A;  2VXJ A;  4FPO B;  4N9I A;  2A5Z A;  4A44 A;  1UY3 A;  3WXP A;  5K8S A;  3U1X A;  3V56 A;  2R30 A;  4AEK A;  1ZRC A;  2QQL A;  1CIY A;  2YXS A;  3CQO A;  4QPY A;  5H9Q A;  4FI9 A;  1NOV A;  2BQP A;  2ZGS A;  2WNE A;  4Q4W 3;  4A7Z A;  5A70 A;  4AAP A;  5L7O B;  1CAX B;  3VUO A;  1HRV 3;  4EZH A;  4UW4 A;  1I5Z A;  2AYH A;  1RUG 3;  3AMM A;  3RQ0 A;  3NKG A;  1BKZ A;  1H8T B;  1RUC 1;  2B46 X;  4MGY E;  2BYV E;  2GNT A;  3WEZ A;  2E9Q A;  4UFL A;  5FZC A;  4PDW A;  1H2L A;  5L36 A;  1IPS A;  1D7P M;  2V72 A;  1H30 A;  1HRI 2;  2UWB A;  1X7N A;  5A1L A;  2ZGN A;  4XF0 A;  2ZX4 A;  4HMZ A;  1VB4 A;  5C3P A;  2PFW A;  2ES3 A;  2HEW F;  1LHV A;  2XKO A;  5C33 A;  2HWD 1;  1RUD 1;  3TN9 2;  1H9W A;  3KB5 A;  5I0R A;  1Q8V A;  4QU1 A;  5FY8 A;  1YJL A;  3BPZ A;  4XXP A;  5IK7 A;  4QQ2 A;  1G7Y A;  5J48 A;  3R0R A;  2WN3 A;  3GAL A;  4NVP A;  4ZXE A;  2R07 2;  5C5U A;  5C8W A;  3LE0 A;  3SEP A;  4BYY A;  1RIN A;  3EBR A;  1XPW A;  2UY8 A;  1W8W A;  1GIC A;  2AR6 A;  4QX5 A;  4LR4 A;  2VNO A;  3IKW A;  4G3Y C;  5FYC A;  1JBC A;  2PQQ A;  4ISQ A;  4UW3 A;  1SLT A;  1YC6 1;  2QQM A;  1NUK A;  5SV5 A;  3H1W A;  1SFN A;  4QAW A;  2DUO A;  2C5D A;  4XAE A;  1HXS 1;  2XLF A;  5B4X A;  4K6B A;  4XF4 A;  1GMM A;  1HDK A;  1OLQ A;  2VPV A;  1QQP 3;  5A3N A;  1BLZ A;  4LBL A;  1NQJ A;  1C3H A;  1O8P A;  1ULC A;  4HVO A;  5FQ0 A;  3Q8F A;  3AJY A;  4I3G A;  5KXC A;  2VU9 A;  4GA9 A;  5FY4 A;  4R9B A;  3JD7 1;  1X82 A;  1LOG A;  1VBA 2;  3KT1 A;  4K20 A;  1AYM 2;  4GJZ A;  4BHP A;  4NE9 A;  2XVK A;  4XUQ A;  3SMH A;  1KS5 A;  2WT1 A;  4EN8 B;  4EN6 B;  4F83 A;  1JHJ A;  1JHN A;  4AQT A;  3RZH A;  3WSO A;  3KCY A;  1JI6 A;  4TTG A;  2BNN A;  3ZMN A;  1UMI A;  4WVM A;  1BVP 1;  4QQH A;  5A3T A;  2R04 3;  2XB6 C;  5K0U C;  2Y0I A;  2C0Z A;  1F2N A;  1MS0 A;  4M4P A;  4O9E A;  4I2O A;  4OI0 A;  2ZMK A;  1WUV A;  2PQS A;  3P1I A;  1NA1 C;  4I3P A;  4B4Q A;  3ORJ A;  4NRQ A;  4NWW A;  3ZSE A;  2OUJ A;  4BXF A;  3APB A;  4DXS A;  1RHI 2;  1DQ0 A;  5JMC A;  2HWC 1;  4KBB A;  5KWR A;  2F4P A;  3UJQ A;  2MEV 3;  1ZRF A;  3N9P A;  4XJU A;  5DDJ 2;  2YC0 A;  1JMU B;  1HJF A;  1OXC A;  4M3C E;  4YVW C;  3LOI A;  2EXH A;  4YVS C;  1O5U A;  4XMI A;  5FZI A;  1QOT A;  3GZE A;  2HWF 1;  3KHC A;  1L7L A;  2XWB B;  3DN7 A;  4X8P A;  4GH4 C;  5EXO A;  4AXO A;  2ZEW A;  3AL6 A;  3MID A;  4RHV 2;  2QFE A;  5K0U B;  5M0T A;  4URT A;  1OC1 A;  2Z4F A;  5CG9 A;  3R4D B;  3VKM A;  2Q8C A;  1NA1 B;  2TNF A;  4DXR A;  1DGR A;  2G19 A;  4XDP A;  4JKM A;  3T1M A;  2DCT A;  2VZR A;  2WL1 A;  4HON A;  4UI9 L;  1IKQ A;  3U37 A;  2O8O A;  3NV3 A;  1OLR A;  4XTM A;  4JGZ A;  2WZ8 A;  5EZW A;  4RFT 0;  4YVW B;  5HCF A;  4BE3 A;  2P3I A;  4YVS B;  5DAW A;  1H2M A;  3N9M A;  4P9J A;  3V0B B;  1DQ5 A;  4LOS A;  2GC0 A;  4GH4 B;  1LHU A;  3AP6 A;  1SZB A;  4HKW A;  3IDC B;  5FMC A;  3AK0 A;  4XBN A;  5F5A A;  1OOP A;  1G86 A;  1Q8Q A;  2Z5W A;  2CTV A;  3AP4 A;  4I0A A;  4XCB A;  2RMU 1;  4Y1Y A;  4K8F A;  3OGG A;  2ZKL A;  1C4R A;  4HPK A;  3AYA A;  3I2O A;  5ERL A;  1UX6 A;  2BBA A;  4P00 B;  4FOV A;  3FHQ A;  4LOR A;  1RUF 1;  2WZP P;  2ENR A;  3I2I A;  5SV8 A;  2HYK A;  1ZYB A;  1IQA A;  1H4G A;  3SIS A;  4AI8 A;  3FFZ A;  4BIF A;  4DUV A;  1PX4 A;  1TE1 B;  1IS6 A;  2E31 A;  3PVB B;  2NLR A;  4LBM A;  4OZX A;  3WF0 A;  2DVF A;  3D3A A;  4GWI A;  4A4A A;  3ZXD A;  3BTA A;  1V9U 3;  3ZXK A;  4NMI A;  2PHF A;  1O4T A;  2XVG A;  3E5X A;  1W39 A;  3PIJ A;  3NJX A;  5E6H A;  3HJR A;  1GSL A;  4OQ9 A;  2C6S A;  2JJ6 A;  4XFA A;  2EIB A;  1HRI 3;  4XUP A;  5EJZ B;  1PMI A;  4Q5O A;  3WP3 A;  3I2J A;  3WNL A;  3BGA A;  5F3E A;  4L97 A;  5AC9 2;  4ZZ8 A;  5I8T A;  1LCL A;  4ES9 A;  2PLV 3;  3TN9 3;  1HV0 A;  4LHN A;  2JD4 A;  4AHX A;  4YAR A;  5T3N A;  1DZT A;  1N3P A;  1S0E A;  1US2 A;  1VBD 1;  2EAK A;  1QNW A;  3LA7 A;  5FUI A;  5CIR A;  2ZHK A;  5IVJ A;  4MGS A;  1W6Q A;  3SH3 A;  1D4M 3;  1XB9 A;  4KH9 A;  2R07 3;  1Z7S 1;  2O8Q A;  3MF6 A;  1KIT A;  3PNA A;  4OYU A;  3OUI A;  4YFW A;  2VBP A;  5F3G A;  5CVR A;  2J22 A;  3I59 A;  2BVV A;  1I1E A;  2PN5 A;  2WNV A;  2YMZ A;  2ZGL A;  3GNE A;  5FZO B;  2XL9 A;  2QQU A;  5JR7 B;  2WR9 A;  1RMU 3;  2Q1F A;  1HJG A;  4ZPI A;  3VBF B;  5IK4 A;  2Y38 A;  4DMI A;  1AR6 2;  2FD8 A;  1U5Y A;  3ON7 A;  4E9K A;  5C3S A;  5FDB A;  1LU1 A;  2BWC A;  4TN7 A;  2ZBJ A;  3H7J A;  4QGL A;  3H1Y A;  1QJY 1;  1WBL A;  4QPI A;  4O61 A;  3W58 A;  2JDN A;  3J7M A;  4V2W A;  2XWJ B;  4SLI A;  5A7W B;  4Z8B A;  2OZJ A;  3MIE A;  2WIN B;  5E88 A;  4IDZ A;  5BV6 A;  2YU1 A;  4Y4R A;  3IM0 A;  1POV 0;  3K77 A;  2Q1Z B;  1UNB A;  3HPN A;  1LJ7 A;  4BQW A;  5FY1 A;  3S5A A;  4MG2 A;  1ND3 A;  4Q8L A;  4PLO A;  1PMJ X;  5IWF A;  4AI0 A;  2WYF A;  5EHD A;  2AEY A;  1B35 C;  1VBA 3;  3ACF A;  4BK4 A;  1NYW A;  2Q1M A;  1GQG A;  4RGG A;  2X29 A;  5FZ0 A;  1H2K A;  5TSW A;  1S0D A;  1VBC 2;  4UFH A;  3RYR A;  2ZAH A;  5ABJ A;  3VD4 A;  2VUC A;  4AEJ A;  3N9Q A;  3MPB A;  5DXD A;  4WM8 A;  1UY0 A;  1W05 A;  1GP6 A;  2VOX A;  2VXR A;  3ZFE B;  4AFD A;  1UKR A;  2LM3 A;  2W52 A;  4LKF A;  3ZVX A;  3SIT A;  3U0Z A;  1RHI 3;  2FDK A;  3NNJ A;  3AVS A;  4BPZ A;  3D0J A;  3NAP C;  3ELN A;  3NNM A;  1YQC A;  1IGO A;  1LOA A;  4YW6 A;  3MHZ A;  2JDU A;  2XJV A;  3EXU A;  1DYO A;  3GJA A;  5DDJ 3;  4LO7 A;  3S57 A;  1ULP A;  2EXI A;  4FSJ A;  2GAU A;  5FWJ A;  4Y33 A;  2CV6 A;  2YGM A;  2AGS A;  1C5H A;  4M3C A;  1PNF A;  3VKN A;  2D7F A;  5LAT A;  1W9F A;  4DIQ A;  3GDB A;  3SLI A;  2WFF 2;  4RHV 3;  3DKW A;  1RUJ 1;  4MXW B;  1LOE A;  4GKY A;  4CCN A;  1DQ4 A;  4YGD A;  3RRD A;  1E5I A;  5FXV A;  3I3Q A;  4AI9 A;  2JE7 A;  2BFU L;  2A6X A;  1GOG A;  1VBB 2;  1W90 A;  2UYB A;  3NAP B;  2TUN A;  2QCS B;  5A6X A;  3MF9 A;  4Q4W 1;  1JW6 A;  4XBQ A;  1FYU A;  4MUV A;  4JGY C;  1W9T A;  3PJY A;  1HRV 1;  1OH3 A;  1AL2 1;  3MIB A;  3VDC A;  1RUG 1;  1YCI A;  1VR3 A;  5FK7 A;  2JG8 C;  4MGQ A;  5IUQ A;  3J9S A;  3AMP A;  4PHZ A;  3N9N A;  2JEN A;  2RG4 A;  5C8C A;  1QGL A;  4IEW A;  4XF9 A;  5C9A C;  3ZKY A;  1W8Z A;  5T55 A;  3BI3 A;  2G9F A;  3INA A;  4LKE A;  3H3L A;  1DU3 D;  1UO9 A;  2AAC A;  5GKA C;  1VE0 A;  3RDI A;  1CVN A;  2CNA A;  5C4W A;  1DP0 A;  5CNA A;  2YG0 A;  1OT5 A;  1QJX 2;  1RVF 2;  4JGY B;  4JTO A;  4JHZ A;  3BPS A;  3WNK A;  1ZRD A;  5HPO A;  2WZR 2;  2LRP A;  3NWK A;  4XJ8 A;  3BU0 A;  5HXV A;  1WCK A;  2JG8 B;  2D3P A;  1HN0 A;  2OT7 A;  3VDA A;  1PO2 2;  2DCY A;  3AFG A;  3PHM A;  4GUL A;  3T2P A;  5ACA 2;  3VBS C;  3RS6 A;  3H3U A;  5C9A B;  2R16 A;  4HN0 A;  1TNF A;  4YFZ A;  3TOJ A;  1RC6 A;  5KC6 A;  2GC3 A;  4DUW A;  4DB5 A;  2WS9 2;  1RB8 G;  3AYC A;  4DEQ A;  5GLV A;  3WNP A;  2Y6J A;  1GP4 A;  1NXD 1;  3R6S A;  5I8S A;  1YUD A;  1MQT C;  4AFB A;  1PM4 A;  1UYX A;  4WM7 C;  1VBE 2;  2J1S A;  2JB8 A;  4F7Z A;  4FOY A;  1XNT A;  3OOX A;  2ZHL A;  1H1I A;  2VH9 A;  4YM3 A;  1UOJ A;  5GJ6 A;  4WVZ A;  1QQP 1;  5FLH A;  2IXH A;  1E5S A;  3WNX A;  4ZS2 A;  2ZX0 A;  1QWR A;  3RYP A;  1NQD A;  2ZTN A;  1HQN A;  2Y26 A;  3TYJ A;  2QZ2 A;  3T08 A;  1ONA A;  3VBS B;  3WDX A;  1J84 A;  2WC2 A;  3UT0 A;  5A3U A;  2WJS A;  1PM7 A;  3F95 A;  3RZZ A;  5FK8 A;  4BQ1 A;  3W5N A;  4J1W A;  3WY6 A;  4HG6 B;  2OVU A;  5CEH A;  1Q43 A;  3B5L B;  4XVH A;  1MQT B;  3E1F 1;  2VZS A;  4IEY A;  4WM7 B;  5IVE A;  3ACG A;  3NL1 A;  1OUR A;  4OLL A;  2V09 A;  4QXH A;  1SDD B;  1HV1 A;  4ITC A;  3LIG A;  1AR6 3;  5DUW A;  2R04 1;  3UJO A;  3ZYJ B;  4LOT A;  2B45 X;  3AKT A;  1PK6 C;  2IXJ A;  1LEC A;  4FBF A;  1LEM A;  1RUH 2;  4CRQ A;  3BOP A;  3B01 A;  4ARY A;  3VBU C;  4B4R A;  4LO8 A;  1W8U A;  1O3S A;  5JI7 A;  3ILN A;  4R9C A;  3UL2 A;  1FXZ A;  4QM8 A;  3ALQ A;  2MEV 1;  3LQC A;  3FLP A;  2B9U A;  3POS A;  4Z2W A;  5IYY A;  1JYN A;  3VB9 A;  3NJZ A;  4IET A;  1R08 2;  2YFU A;  4XC9 A;  4NOT A;  4ASK A;  1VB2 A;  1W6M A;  2QQK A;  4UF0 B;  3WF3 A;  2XH6 A;  4PIX A;  4CCO A;  1E5R A;  1Y3T A;  2VCC A;  4IE0 A;  2PAE A;  2WSU A;  1I5P A;  1WLW A;  1F31 A;  3N9L A;  1PK6 B;  3ZSK A;  2VZP A;  4UFI A;  3J7H A;  3JD7 3;  3VBU B;  2Z42 A;  1UD1 A;  3OY8 A;  4GWM A;  1XE8 A;  4XAA A;  4IEO A;  5LZ6 A;  3K51 A;  4OHY A;  5A1A A;  3RVH A;  1D2S A;  1UPI A;  3K3O A;  2VQT A;  3IDB B;  4QXK A;  4I30 A;  4Y20 B;  2WQZ C;  1N1V A;  4Y22 A;  4YZ1 A;  3FC0 A;  1C8M 2;  2JDA A;  4IE5 A;  1V70 A;  4FTE A;  4D94 A;  1J59 A;  1PVX A;  2NYY A;  3O1U A;  4N43 C;  2ARB A;  4MVT A;  3ZSJ A;  2YFZ A;  3EMR A;  1W9S A;  3K4Z A;  2DBN A;  1A6C A;  1LOF C;  1TMF 2;  2B4K A;  2HWC 3;  3GCX A;  4RQP A;  1LOD A;  2NPI A;  3U75 A;  1S0G A;  1WMD A;  3III A;  4IEU A;  2PYT A;  4D6S A;  4CU7 A;  2IXK A;  3I3E A;  2O1Q A;  4D6R A;  3LDR A;  5J36 A;  2WFF 3;  3VD5 A;  5JOZ A;  4Q29 A;  5LCW L;  2VOK A;  5IAT A;  4CEY A;  2R0F A;  4BXS V;  3WNN A;  4ARX A;  4CP9 A;  4JZR A;  1BK0 A;  3J8F 2;  2RS1 2;  4LMF A;  4UW6 A;  2DVG A;  3ZYI B;  1ZZ9 A;  4IGQ A;  5L9R A;  2JDK A;  4MGZ E;  2B39 A;  1VBB 3;  4W6X A;  2VTX J;  4IV3 A;  4PIZ A;  5FMD A;  5IAX A;  4M3C F;  4ERO A;  3S7E A;  4ZU7 A;  1DDL A;  4N43 B;  2YC2 A;  2VMD A;  3MPP G;  3WW1 A;  3HN1 A;  2HYX A;  2PHU A;  2R49 A;  3GBG A;  5FZ9 A;  4EYU A;  3WW4 A;  1V9U 1;  1JUI A;  1JZ3 A;  5FZG A;  4ZON A;  2OW4 A;  5KC5 A;  1G9A A;  5JXG A;  2XJR A;  1YNA A;  2XLG A;  3HVD A;  4DRR A;  3O12 A;  5FY7 A;  5FZK A;  3NO8 A;  3PTY A;  5FZ8 A;  1HRI 1;  1NE6 A;  2Y6L A;  4QT6 A;  5GZF A;  5F5Q A;  1DCS A;  1DBN A;  3C7O A;  4XE9 A;  1OVS A;  3DPR A;  5DUV A;  4E2S A;  2GU9 A;  1NLR A;  2PLV 1;  3TN9 1;  2YYO A;  1QJX 3;  1RVF 3;  4GJY A;  4OHW A;  5IVF A;  3VZL A;  5FZ3 A;  4FFF A;  3J26 N;  2G1M A;  3KSC A;  2JKB A;  3AP9 A;  3CJI A;  1UU6 A;  2WQ8 A;  2WZR 3;  4MGT A;  3M3C A;  3WIN E;  4LBJ A;  2BEO A;  5LY2 A;  1MS3 A;  2R07 1;  3FL7 A;  3URF A;  1OQD A;  1AX2 A;  1PO2 3;  3O14 A;  1H8V A;  1RUF 3;  5IFP A;  4D3W A;  4O7X A;  1OLM E;  1IG0 A;  2KD7 A;  4GB3 2;  3BUC A;  4LLF A;  4GZ9 A;  3ZKU A;  3NV4 A;  3AP7 A;  1J58 A;  3NV2 A;  3QOP A;  3ZFG C;  4KWU A;  3F2Z A;  4CPB D;  1OQE A;  4AGR A;  2RHP A;  1BJQ A;  1VBE 3;  3BYW A;  2OX0 A;  1ST8 A;  4TLF A;  4XDO A;  1OA2 A;  3RMY A;  2VEC A;  3MV0 1;  4OMD A;  1MS4 A;  2LUW A;  1XRU A;  3NQH A;  3OGV A;  5DZE A;  3ASI A;  2BGC A;  4B29 A;  5FQ0 B;  5FYY A;  3BU7 A;  3WG2 A;  2W91 A;  1W6N A;  2ZEZ A;  3GF6 A;  2ZJC A;  1XYN A;  4Z82 A;  4CEW C;  3SKJ E;  5F9T A;  1XU2 A;  5LA2 A;  1ULD A;  4RN5 A;  1PMH X;  1VBA 1;  1MEC 2;  2VW2 A;  5D21 A;  3ZFG B;  1VBD 3;  3UGG A;  4XIL A;  4AI3 A;  2JG9 A;  5LEJ A;  3PMS A;  5JSO A;  4TWT A;  1C1F A;  1N1Y A;  4W50 A;  2V4A A;  1Z7S 3;  1MVQ A;  4PIY A;  4A45 A;  4AE2 A;  4S2F A;  1VAM A;  2P6H A;  1RJ7 A;  4YM2 A;  1SMV A;  5FUN A;  4U36 A;  2ZGT A;  4BQY A;  1X8M A;  1IS5 A;  3UYJ A;  4KGQ A;  1IS3 A;  3N35 A;  4LBQ A;  2C9A A;  5FMB A;  1RHI 1;  4JDN A;  4CEW B;  4COV A;  4XMA A;  1R64 A;  1YRZ A;  2QBX A;  3VGI A;  4XIK A;  1O5L A;  3WG4 A;  1PGS A;  2W1U A;  3MLK A;  5DDJ 1;  3VLB B;  1QJY 3;  4N53 A;  1R08 3;  2FHR A;  4MYE A;  4BM8 A;  4RR3 C;  5GM0 A;  2WQ4 A;  2VVD A;  2F6B A;  1V6K A;  3CNA A;  4CDQ C;  3VKF C;  3WDW A;  1GP5 A;  2Q5T A;  4RHV 1;  4Q1P A;  1UOF A;  4P5Y A;  1OFS A;  2BJS A;  3GYD A;  3W21 A;  2Z79 A;  1XNA A;  3NW4 A;  3UKT A;  4HBN A;  2ZEX A;  1W0P A;  1O3R A;  2FZ2 A;  2WYS A;  3KGZ A;  4JKL A;  4LK7 A;  4AWD A;  3A0K A;  4AVS A;  4L11 A;  3KV5 A;  4H2A A;  4AGG A;  4XHX A;  2QQP A;  1W8O A;  3T2Q A;  1MS9 A;  1KRI A;  4CP0 A;  4JGZ B;  3ZFF C;  2W46 A;  4RR3 B;  1YHF A;  4URA A;  5HCB A;  2QNK A;  3RSJ A;  3VBO C;  4CU8 A;  3ITQ A;  1FAY A;  2W87 A;  4CDQ B;  4R9A A;  4J1X A;  4BB3 A;  3G7D A;  1T6B X;  2VBD A;  5A7S A;  1SDW A;  4MH0 E;  4CDU C;  3E6C C;  3MIF A;  5IK5 A;  1OOP B;  4IER A;  4OHZ A;  4XOG A;  3USU B;  4IEQ A;  3VDB A;  4LA3 A;  4DQA A;  4D7Y A;  1GR3 A;  4XCA A;  5DG1 A;  3QH7 A;  4N8M A;  3CL1 A;  3J8F 3;  2RS1 3;  3POI A;  3IWZ A;  4P9G A;  3JU9 A;  1UZZ A;  2RE9 A;  2GND A;  1DLC A;  2X5I A;  4NWV A;  5FRA A;  3ZLI A;  3BOW A;  3O0X A;  4XYX A;  3FUO A;  1RUJ 3;  3THP A;  3ZFF B;  2W1S A;  4YYO A;  3FMG A;  4NIG A;  4J6G A;  1WCD J;  3VBO B;  3AX4 A;  3CZU A;  4DOU A;  4JVA A;  2E51 A;  2NQY A;  2VO5 A;  1ENR A;  1W0O A;  3MLJ A;  3R05 A;  1VRB A;  3BN6 A;  4CDU B;  5C3Q A;  4EE2 A;  1YQ2 A;  5EV7 A;  4MO3 M;  5F6K A;  1AL2 3;  1VAV A;  1OKQ A;  4Q0S A;  2PHT A;  1MPX A;  4C1X A;  1JOJ A;  1GNY A;  3GCW A;  3B02 A;  2XJS A;  5G05 L;  1Q3E A;  4AED A;  4N7U A;  5AC9 1;  3ZR6 A;  2VCB A;  3OPZ A;  4XAB A;  2CY6 A;  3PVO A;  3VD3 A;  2XGX A;  1DYK A;  2XHN A;  3AZY A;  2PHW A;  2WLP A;  2XR4 A;  5JPM B;  1KQR A;  5JMO A;  5DAQ A;  4KWK A;  4HK9 A;  4MHR A;  5AVP A;  5JDB A;  4CXY A;  3WD5 A;  2G9Z A;  1IHM A;  4YM1 A;  1W6Q B;  1ULE A;  1DGL A;  5FYZ A;  2BOJ A;  1ENQ A;  3QLQ A;  5T5J A;  5BNN C;  2AC1 A;  4Y1U A;  1APN A;  1XJA A;  2JD9 A;  3HQU A;  3MO4 A;  4LNV A;  1WGP A;  5H9R A;  4AVT A;  5IVV A;  3K48 A;  2A1X A;  3D8C A;  4KBZ A;  4ZXK A;  1OLM A;  1W9W A;  4IV1 C;  5L9V A;  1H6X A;  3I59 B;  1H9P A;  4CDW C;  1CGP A;  1WBF A;  4PI0 A;  1AVB A;  4AQS A;  3PDQ A;  2WNV B;  4PLM A;  3AP5 A;  4FPC A;  2GAL A;  3RNS A;  3JQW A;  4DNY A;  5BNP A;  1W8N A;  3SCG A;  4Z92 B;  1ZRE A;  1AR6 1;  2YPD A;  3O7O A;  4OI2 A;  2XJT A;  3JQX A;  1LUL A;  2ORX A;  2JWP A;  5CFD C;  4EWD A;  1T6G C;  4EWE A;  2X8K A;  2XBO 2;  2RVA A;  3MW4 A;  4FPL A;  5EFU A;  1QJU 2;  3V0A A;  3WP5 A;  2ERF A;  2R32 A;  4GMP 0;  4YZ5 A;  5BNN B;  1DQ2 A;  1BYH A;  4Q8K A;  2ZAB A;  4AFA A;  1OMI A;  1K3I A;  1YJK A;  5KBF A;  5B4N A;  4IV1 B;  1ND3 B;  2ZGP A;  3LPF A;  3UKV A;  4CDW B;  3O1R A;  5E8A A;  5FY9 A;  1OA3 A;  3LSD A;  4KU8 A;  3T4V A;  3IB3 A;  2E33 A;  1JU3 A;  5LBB A;  1ODM A;  2W92 A;  1RUN A;  2PHX A;  4YW4 A;  4RD7 A;  1VBC 1;  4L8Q A;  4BQ3 A;  5ABJ B;  2YZ4 A;  1O3T A;  2JE9 A;  5CFD B;  4G4F A;  2ZPX A;  2HWE 2;  5FZA A;  3PVE A;  3OEA A;  3WX5 A;  4C91 A;  2ZGU A;  2DU0 A;  4QDQ A;  1U5I A;  3LWC A;  4OMC A;  2A6W A;  2CGN A;  2W1W A;  2VUL A;  1JZ7 A;  1UCX A;  2WNU A;  1PGW 2;  2X10 A;  2ZHM A;  3WW2 A;  1QDO A;  1D0H A;  5A33 A;  1AL0 G;  4GD4 A;  4NUB A;  4HXC A;  1M4W A;  1LEN A;  2JIG A;  1TVG A;  2OUH A;  3VDD C;  2D6L X;  5JZG C;  2CDO A;  1MZE A;  4YGC A;  1JYT A;  1KGY A;  1H2N A;  3TEZ A;  4XEZ A;  1ZNP A;  4YG0 A;  4ZS3 A;  5JI9 A;  1UU4 A;  1US3 A;  1V0A A;  1LR5 A;  2RR1 2;  3BIW E;  4BZ4 A;  5IFT A;  5BNO A;  4IGP A;  4Y5Z 0;  3LD8 A;  2BV4 A;  3LA3 A;  1GQH A;  2DDU A;  3WOG A;  3UNP A;  4K1Z A;  2ARA A;  3L9J T;  2FDF A;  3H50 A;  1QY4 A;  4QKD A;  2WFF 1;  5FYV A;  1KJR A;  4HFS A;  1HB1 A;  1GBG A;  3G6J B;  3ZPY A;  5CFC C;  4Z07 A;  3HIF A;  1DIW A;  1CN1 A;  3GHM A;  5JVV A;  2WA3 A;  1XSQ A;  3KF3 A;  4MGK E;  4LHL A;  1VBB 1;  4YZ4 A;  5F39 A;  3VDD B;  1F4H A;  5JZG B;  5FPA A;  1BBT 2;  2GMP A;  3THD A;  1QU0 A;  2O14 A;  4AZZ A;  2P5B A;  4QPG A;  4COW A;  5FP8 A;  1O3Q A;  2H0B A;  1S0J A;  5F2S A;  1ZX5 A;  3U4X A;  4NJ4 A;  1YFW A;  5DPN A;  3RYK A;  4E2Q A;  5FMO S;  3CO2 A;  2NMO A;  4Z1V A;  2Y33 A;  5FZ1 A;  5CKM A;  5DAX A;  4IE4 A;  4ZU5 A;  3WF1 A;  5CFC B;  5I93 A;  4K8R B;  1FT9 A;  3DUI A;  1JS9 A;  1FOD 2;  2H6C A;  3LKJ A;  1AR9 2;  4CUB A;  2CAU A;  1W6O B;  3K75 B;  4XQD A;  2E7A A;  2IWG B;  2RS5 2;  3LIH A;  3OBR A;  2MPF A;  2ET7 A;  5DAV A;  4BWO A;  1EPW A;  3D82 A;  5EWS A;  1QJX 1;  1RVF 1;  5IVY A;  4DRV A;  5FO9 B;  3N4M A;  4Q26 A;  4JQT A;  4Q0P A;  1G9C A;  2WZR 1;  2ZML A;  2FCU A;  1FV2 A;  1GNZ A;  5FZM A;  3VV1 A;  1WA4 A;  2VY0 A;  2HJI A;  1PO2 1;  3EB7 A;  3OGJ A;  4JQR A;  3POY A;  4LA2 A;  3PVN A;  5ACA 1;  2V5Y A;  2RM2 2;  2VD7 A;  3WG1 A;  2FQP A;  2FBE A;  1OUX A;  3VHP A;  4ET7 A;  5I0T A;  2WWJ A;  4FPG A;  4K1Y A;  2RJ2 A;  5FOJ B;  2WS9 1;  1NCQ C;  3ILR A;  2XHK A;  4J25 A;  3ME2 A;  3ZYB A;  5HV4 A;  1ND2 A;  4HN1 A;  2ZZQ A;  4COU A;  1GNH A;  1A3K A;  4RS5 C;  4YW1 A;  1VBE 1;  5GLZ A;  2WBK A;  5CIS A;  2NMN A;  5CBL A;  3RI8 A;  2GMM A;  3DXT A;  4CCM A;  1V6L A;  5K4L A;  1R1Z A;  1XQN A;  2PEL A;  1RJ8 A;  3M7A A;  5D8A A;  3WLU A;  2DU1 A;  3Q8A A;  2AUY A;  4Y4Y A;  3ZXG A;  4MGI E;  4UW5 A;  1Q56 A;  1WZX A;  4LBO A;  2W3J A;  2E63 A;  2GNB A;  4QX1 A;  3VBF C;  1P8J A;  5KHH A;  1NE4 A;  4DIN B;  1F8V A;  2W1Q A;  1H4H A;  1J3P A;  4OZO A;  4PQQ A;  3M4F A;  1JOP A;  5FP3 A;  5T54 A;  1KFU L;  5FPL A;  4CE8 A;  3OGR A;  1NCQ B;  4QX2 A;  1WCU A;  1JYX A;  2MHF A;  3MUY 1;  2VOT A;  3I2D A;  3TAY A;  3TEW A;  2D3S A;  1DGR N;  1LRH A;  4HL0 A;  1A34 A;  4RS5 B;  5L7O A;  1CAX A;  2HEY F;  1JYW A;  4XFI A;  4Q4X 2;  4IE7 A;  2DCZ A;  2EIG A;  4ZY9 A;  3ETQ A;  3OCP A;  1H8T A;  4UWD A;  3C7E A;  3N7K A;  2VUD A;  1RUH 1;  5I91 A;  2ZS6 B;  4D7S A;  3AXD A;  3I2F A;  2XBO 3;  1XNK A;  3B9C A;  4I0B A;  2HWB 2;  2VVF A;  3ZX7 A;  1GZW B;  3FLT A;  4E4D X;  2P4E A;  4JCK A;  2ZOE B;  4IUG A;  3JCI A;  4ZU4 A;  1K5M C;  3K46 A;  4KGG A;  3BTX A;  2BNM A;  2PTM A;  1R08 1;  2OS2 A;  2WDB A;  5FXX A;  3I7D A;  3OPT A;  2BWA A;  1W6M B;  3CJX A;  3WW3 A;  4ASM B;  4BCU A;  3N3H A;  3M70 A;  5JSR A;  5IAV A;  3ZFE C;  2R06 2;  2XQR A;  1EYB A;  4AVC A;  1F4A A;  2ZCW A;  3QBQ A;  3HBK A;  4XF1 A;  4Y1X A;  5DZG A;  3ACI A;  3ATG A;  1OF3 A;  3VZM A;  2HWE 3;  1XOY A;  1AYM 3;  5AFE A;  3VBR C;  5F3C A;  2ZGQ A;  4XET A;  3N9O A;  2UUR A;  3WDU A;  5L19 A;  3JXS A;  3I3B A;  4P14 A;  4COY A;  3VZK A;  4CXW A;  3V64 A;  2VOV A;  1C8M 1;  1K5M B;  2R1B A;  3KZ4 C;  4N7I A;  5DQ0 A;  5FYU A;  1AF9 A;  5FR3 A;  4QKF A;  1UU5 A;  1UZY A;  3X29 B;  4D0Q A;  1DHK B;  4BQX A;  1JN2 P;  1PHM A;  5BY5 A;  3EJK A;  5FWE A;  2QQV A;  1JYI A;  4GWN A;  4XJ9 A;  4IQP A;  1WCQ A;  1SAC A;  2QQJ A;  1NCR C;  4YGB A;  1W2N A;  2RR1 3;  1QXP A;  1TMF 1;  4JTN A;  2QE3 A;  2Z69 A;  3KV9 A;  3KV6 A;  2WN2 A;  1AR8 2;  2GN7 A;  1HB4 A;  2VZ3 A;  3CEW A;  4XUO A;  4NHK A;  2I07 B;  2WO7 A;  5T5O A;  4K40 A;  1W2T A;  4RSU A;  1UYY A;  3OEB A;  3VBR B;  4QMA A;  2BTV C;  1IPJ A;  4CCE A;  2FDH A;  4M01 A;  4HAN A;  1DQ1 A;  3ABZ A;  3J8F 1;  2RS1 1;  4UOJ A;  4RFR B;  5FPU A;  3GJB A;  3HEI A;  1KDK A;  3NST A;  4HET A;  4XBL A;  4CVU A;  3OD0 A;  4NPL A;  2OII A;  3D6E A;  4LQR A;  2FDG A;  3S0M A;  5I0U A;  5J7M A;  3GBW A;  1CAW B;  3WP6 A;  4NRM A;  1GV9 A;  1YO8 A;  3AMQ A;  5F1R A;  1CAU B;  4JC1 A;  1NCR B;  2FCT A;  2BGO A;  2IC1 A;  2VQ0 A;  4NHY A;  4C8D A;  1PZ8 A;  1RUI 2;  4XPV A;  4CDX C;  1VRH 2;  4Y5T A;  2VAU A;  2RJK A;  3T4H B;  4ASL A;  5JUV A;  3WQ7 A;  4KQ7 A;  1RXF A;  4H55 A;  3AB0 A;  3O1V A;  5FZ7 A;  1OKO A;  4F3J A;  2NZ9 A;  5FXZ A;  3OTF A;  5A7O A;  1JZ5 A;  4GAL A;  4FVV A;  2J1R A;  1FOD 3;  5HV0 A;  1AR9 3;  3AMN A;  3N7J A;  1UOB A;  5L73 A;  2HBU A;  1SCR A;  3VL9 A;  5FV3 A;  4AFC A;  2HBT A;  4F8A A;  3VBH C;  1QF3 A;  3WT3 A;  4QWN A;  5EYX A;  4ZHN A;  2EID A;  4YM0 A;  1GYK A;  2G4I A;  5A7P A;  1O6U A;  1WW7 A;  4JX0 A;  5K0U A;  4OUE A;  2WLQ A;  3MIC A;  2PHL A;  3CJI B;  5FP9 A;  5FPV A;  3S5Q A;  4CDX B;  1FMD 2;  5FYB A;  1R1A 2;  1IZ3 A;  5JXI A;  2XUM A;  1NA1 A;  4XFF A;  1FNY A;  3SXW A;  4LXL A;  2WUH A;  3IPV B;  3WVJ A;  2NN8 A;  4MOA A;  1PIV 2;  3HT2 A;  2DUQ A;  3FE5 A;  4GB3 1;  4A3Z A;  1F5F A;  4IE6 A;  5KR7 A;  1S2K A;  1QJZ A;  1YFX A;  5FCC A;  5IJR A;  2CYF A;  1WA6 X;  3FBY A;  4YVW A;  2WO1 A;  4IND A;  3VBH B;  5JPN B;  1VPH A;  4YGE A;  4YVS A;  3V0B A;  1RXG A;  4FFG A;  1PGL 2;  5LBE A;  4DEV A;  1WLC A;  3SEE A;  4GH4 A;  2UY9 A;  1GQP A;  4XFG A;  4ISR A;  3EO6 A;  3SNM A;  2E32 A;  4JDM A;  3BTZ A;  4E4H A;  4LK6 A;  1QOO A;  2LW8 A;  1VMJ A;  3WDT A;  4P02 B;  2V73 A;  1QIQ A;  5KXB A;  3RZJ A;  2RDN A;  2P17 A;  4LEJ A;  4LBN A;  1ODN A;  2CL2 A;  4Q2F A;  5AC9 3;  2BNO A;  2OQ7 A;  2CWS A;  2JDM A;  1UZV A;  3PIG A;  3JZV A;  3NJY A;  4UAP A;  3W59 A;  1SLL A;  2UWC A;  2B42 B;  1Q5O A;  1MEC 1;  2LTN A;  4DXZ A;  2DVA A;  3J7N A;  1V6M A;  4QQL A;  5A3O A;  2RJL A;  4Y1Z A;  3KVA A;  1QJF A;  4Q4X 3;  2PXJ A;  2DV9 A;  2CGO A;  3H7Y A;  5JSP A;  1UZ0 A;  2A73 B;  2EVX A;  3MGU A;  5EP9 A;  2X05 A;  4LKS A;  4BIS A;  1GOF A;  3NRU A;  1WD3 A;  4NPR A;  3J7L A;  4YW3 A;  4RYD A;  4E4S A;  4QGM A;  4RGK A;  2HWB 3;  3A0N A;  4CSW A;  4QHO A;  2A7A A;  2FDI A;  4K7J A;  3POJ A;  1GKB A;  1PO1 2;  4AHW A;  5CU1 A;  1CJD A;  2VUJ A;  3VHR A;  5T50 A;  1K12 A;  2XON A;  5LA0 A;  4QM9 A;  2H6B A;  1VMF A;  2JXA A;  3KMH A;  4OI4 A;  1RIT A;  1O4Z A;  5BUV A;  2HLE A;  3AJZ A;  2E53 A;  3A4U A;  3IZO A;  2R0H A;  5LB6 A;  1LGB A;  1LGN A;  1EPZ A;  5KXE A;  4XHB A;  2ILM A;  3WCR A;  4BDV B;  5I8Y A;  5K7P A;  3LEK A;  3LSE A;  4HKO A;  2JEC A;  5FTT C;  1F15 A;  1O8S A;  2YV8 A;  1WCS A;  5T5P A;  1SFY A;  3UET A;  3ZIX A;  4YZ2 A;  1W6P B;  3PUR A;  4Q4V 2;  2SBA A;  1W28 A;  3NNG A;  5A32 B;  1VBC 3;  3LEI A;  3JB4 C;  3KT7 A;  2D3R A;  4K3U A;  1JXN A;  2VVE A;  5FZD A;  3ZXL A;  4BMB A;  1XYP A;  5IHR A;  1X9T A;  2H0V A;  1STM A;  1CAV B;  1AXZ A;  1CPN A;  2QQO A;  3UES A;  4A6S A;  5A7Q A;  5J96 B;  1R09 2;  4MLO A;  3WDY A;  2W5F A;  1NG0 A;  1EUU A;  3B93 A;  1AX1 A;  1ASJ 2;  2BDR A;  4L9B A;  5CA6 A;  2DBI A;  3LDK A;  3RFR A;  3WF2 A;  5A7W A;  4M0N A;  1PZ9 A;  5EQU A;  3WHT A;  4JKK A;  4M0H A;  1C1L A;  3CIH A;  3B94 A;  1W2A X;  3RGB A;  2GC2 A;  4CUG A;  1H1M A;  3OG2 A;  2D43 A;  3ZN6 B;  4NR1 A;  1OD3 A;  4D6Q A;  1SPP B;  1UOG A;  2IXL A;  5FYI A;  3ZSL A;  1CWP A;  2X5I B;  2XQX A;  2YDE A;  2IXI A;  5BXX A;  4PDW C;  3CBN A;  2W9X A;  1XSR A;  1C5I A;  2ZX1 A;  2IXC A;  1UIJ A;  1POV 3;  2WNO A;  3L2Y A;  3OYW A;  4QX8 A;  3HD8 B;  2ZGR A;  2E7Q A;  2WA4 A;  3HNM A;  3JB8 A;  4UT5 A;  4CP1 A;  1RUI 3;  4BJ0 A;  5DMY A;  3T09 A;  1Q8O A;  1VRH 3;  2XPJ A;  3TBD A;  4UBH A;  1SEF A;  4H7L A;  4PQ9 A;  3O0W A;  3ES4 A;  5J09 A;  1Y43 B;  2EAL A;  1C57 A;  3ZYG A;  1S0F A;  1UW8 A;  3SCF A;  5F32 A;  1ULF A;  3I54 A;  4A2U A;  1QDC A;  2ADE A;  3JUU A;  4FP2 A;  4O65 A;  4AI1 A;  1B35 A;  2Y34 A;  3IAP A;  3POE A;  4E8C A;  2VBB A;  4IW3 A;  3RG0 A;  1HKD A;  1UIK A;  2C1F A;  2GC1 A;  1LED A;  1YQ6 A;  2DCK A;  4PDW B;  4PF1 A;  2Q8E A;  5FZB A;  4C0H A;  3AMH A;  1QH7 A;  4XJW A;  1SCS A;  3QCW A;  1MZ5 A;  1O59 A;  1AXK A;  3U07 A;  1PX3 A;  3E97 A;  4MXW A;  2OPK A;  1FMD 3;  4M4R A;  3FFQ A;  1N1S A;  3MW2 A;  4ATE A;  3ILF A;  2GSY A;  1WWY A;  4L99 A;  1PIV 3;  4S2G A;  1WLT A;  1O4Y A;  5EIY B;  3NAP A;  1GFF 2;  3AZV A;  1ACC A;  1NXM A;  2E6V A;  1X50 A;  2F17 A;  5BNP B;  4IGO A;  4K21 A;  4HSL A;  4IEP A;  1UF2 C;  2JIC A;  2YY1 A;  3HQR A;  2A75 A;  5FZE A;  4LUK A;  3ZOI A;  1FNZ A;  3RZM A;  5ACA 3;  4PJY A;  3KGL A;  2P2K A;  4JAA A;  3C2U A;  3N7L A;  4BH9 A;  1ULO A;  5FZ4 A;  5L9B A;  2ADD A;  4AG4 A;  2WS9 3;  2JB4 A;  2JDP A;  4Q0Q A;  4PBO A;  5CYY A;  3VZO A;  4C1W A;  2K9Z A;  2XBO 1;  5D2A A;  4RA0 A;  1ENX A;  3A21 A;  4MX3 A;  1QJU 1;  2EIE A;  3VHN A;  1UXX X;  5JIA A;  4CYD A;  1J1L A;  3PUQ A;  3T0D A;  4QPW A;  3MIH A;  5JCT A;  2VZV A;  4MSV A;  1WKY A;  3ZYR A;  2TBV A;  2BFU S;  4LUL A;  3GM8 A;  4JGY A;  5FFO C;  4JDO A;  4Q4Y 2;  4EQV A;  1E5H A;  1SLA A;  3AXE A;  4NRO A;  4QX0 A;  4YZ3 A;  1QXJ A;  1XNC A;  2O0O A;  3BIE A;  1XXN A;  1UZW A;  2ARX A;  2OKX A;  4C90 A;  3P5B A;  5E16 A;  2JG8 A;  1SBE A;  3PLQ A;  1J3Q A;  1NLQ A;  2GNM A;  2VOW A;  2HH9 A;  2HWE 1;  1AYM 1;  1YI9 A;  2VZO A;  3LEG A;  4FOW A;  4G9S B;  3ZYP A;  5C9A A;  1RUO A;  3ZXF A;  3KCX A;  1PGW 1;  3AM2 A;  4I02 A;  3DYM A;  1AR7 2;  5A33 B;  4WVM B;  3ACL A;  4LUM A;  4OHV A;  1RTV A;  2BRT A;  3M3E A;  2ZAC A;  4P9I A;  4YSF A;  1G8W A;  1RUH 3;  5H9P A;  2BBV A;  2D5F A;  1EUT A;  4COZ A;  2CGP A;  5CKQ A;  1GWM A;  2X53 S;  4LLO A;  4U2A A;  3RJ2 X;  5HBA A;  3DL3 A;  2XL7 A;  2RR1 1;  1RED A;  2FMY A;  1NZI A;  1ZM1 A;  1PZ7 A;  3P3P A;  1AJO A;  2KR2 A;  1OFN A;  5FIX A;  3DF0 A;  1B09 A;  5E1R A;  4AK3 A;  2DUR A;  2A6V A;  4FPK A;  4JGZ C;  3VBS A;  1HB2 A;  1YFU A;  4E8D A;  3E6D A;  2JKX A;  4KWL A;  2ET1 A;  1V00 A;  2ZZJ A;  1QXR A;  1NT0 A;  1ZZ6 A;  2XJU A;  4IL7 A;  1U0A A;  4OHX A;  1MQT A;  2WAO A;  1W3V A;  3EHK A;  3PJQ A;  4HK8 A;  4KG0 A;  4WM7 A;  3ZSM A;  4LO6 B;  4Q4V 3;  1TEI A;  5IK8 A;  1BBT 1;  1KXG A;  1W2U A;  3WNM A;  1G9D A;  5LW9 A;  3U14 A;  1OOP C;  1UY2 A;  2A3Y A;  1V6J A;  3ETP A;  1UQX A;  5A3P A;  4FP3 A;  4A41 A;  1REF A;  3LAG A;  4V2V A;  5DUX A;  1R09 3;  5GLT A;  5HCA A;  2D6N A;  4S2D A;  5CKN A;  1LHN A;  1BXH A;  1C8M 3;  3RZG A;  2ZXQ A;  1ASJ 3;  3GXU A;  5B2G B;  3ZYH A;  2Y8K A;  2ETE A;  2JIJ A;  2ORZ A;  3C7G A;  3SH4 A;  1Z0H A;  1IPK A;  1FOD 1;  2B5H A;  3N36 A;  1AR9 1;  5APA A;  2RDR A;  1CZT A;  2RS5 1;  4IXL A;  3MYX A;  2D6K A;  2VZ1 A;  4GKX A;  3T1L A;  2FDJ A;  1A8M A;  1TMF 3;  4UF0 A;  1D0G A;  3VKO A;  2VZU A;  4XDQ A;  2IVJ A;  3RZL A;  5BNQ A;  5EJ1 B;  4QXC A;  1N3Q A;  1FPN 2;  3AKP A;  3K4A A;  1PK6 A;  1O91 A;  5AFB A;  4QKB A;  2GH8 A;  2BOI A;  4HPK B;  1BEV 2;  3VBU A;  3VZN A;  2BVB A;  5K9Y A;  1LHO A;  4EZ4 A;  2WWU A;  1W0N A;  2R1D A;  2RM2 1;  5IW0 A;  4XF3 A;  2W08 A;  5FPZ A;  1DF0 A;  4FPJ A;  3RPQ A;  4Y20 A;  5EPA A;  5F3I A;  4X6R B;  4D8M A;  1VAL A;  1S2B A;  2DFC A;  4FO9 A;  1ENS A;  1GU3 A;  1ND2 B;  1WW5 A;  2VW0 A;  1SBD A;  1W8T A;  2ZKN A;  1UMH A;  4PT6 A;  2D44 A;  1Y9G A;  2FZ1 A;  2IZW A;  1Q8S A;  4FCA A;  4BA6 A;  4DY5 A;  5D8A B;  5GLW A;  3T30 A;  3DEM A;  5C6C A;  2F4L A;  1NY7 2;  5GZE A;  3WR0 A;  2WNV C;  1JU4 A;  1YLL A;  1CZS A;  4AR2 A;  4RL7 A;  4BU2 A;  5CG8 A;  1KDM A;  2VUA A;  4H3W A;  1XC6 A;  2HKX A;  2A6Y A;  4WV8 A;  3M3Q A;  2B9V A;  4EN7 B;  1HN1 A;  1YI7 A;  5CZK A;  5FZH A;  1XYO A;  4A7K A;  4UXA A;  3T2T A;  4QPI C;  4A6O A;  1Z78 A;  5F5C A;  5E89 A;  4V1P A;  4N43 A;  2BW8 A;  4LJH A;  1BQP A;  1SLB A;  1G9F A;  2VZT A;  4KI5 M;  4Q4X 1;  5ISL A;  4HVQ A;  2DFB A;  4XZU G;  1AJK A;  1LOF A;  2W94 A;  1QEX A;  1V9U 2;  3I8T A;  3B7M A;  4GB3 3;  3GBF A;  4L0P A;  5CB7 A;  1ND3 C;  1KD7 A;  4TSV A;  5A3W A;  1LAJ A;  2B7Y A;  5D1I A;  4M00 A;  1JUH A;  5GLU A;  5HI0 A;  1L7Q A;  1IS4 A;  3FBM A;  4S2H A;  5FBZ A;  3W9A A;  3AC0 A;  1S55 A;  2HWB 1;  5C70 A;  5FYH A;  3ZXJ A;  1WD4 A;  2QDN A;  5J1X A;  5ABJ C;  3FN9 A;  1W03 A;  4QPI B;  1DLL A;  1EV1 2;  2A71 A;  3LGR A;  1UN1 A;  4O9G A;  4WM8 C;  2PLV 2;  4Q4Y 3;  2C24 A;  2R06 1;  1V6O A;  2XVL A;  1Y4W A;  1SG3 A;  2DCJ A;  2J1E A;  2J42 A;  3QH6 A;  4A7Y A;  3S30 A;  4GQ7 A;  3D0S A;  3I4I A;  3MEP A;  1D4M 2;  1LU2 A;  1FAT A;  2UU8 A;  4P9L A;  1H1A A;  1SLC A;  5LEK A;  1NAE A;  1GZT A;  4LHS A;  1EAH 2;  1K45 A;  1MEC 3;  5A6Q A;  2Y64 A;  1JYC A;  4KWJ A;  4W6W A;  3ZN5 A;  3UGH A;  1KS4 A;  4GWJ A;  3A7Q A;  3LB9 A;  2CU5 A;  3POB A;  1OPM A;  1AR7 3;  3FWE A;  3O5S A;  3ROU A;  1RMU 2;  4AEM A;  2QQW A;  2YHJ A;  1W06 A;  1DZQ A;  1HW5 A;  4WM8 B;  1BK1 A;  3WCS A;  5JOX A;  4CZS A;  2WT2 A;  2VMH A;  4UFK A;  4CCJ A;  1N3O A;  1WMX A;  2A3W A;  2CAV A;  1GOH A;  3FJS A;  2VGD A;  1WMF A;  1X33 A;  4FFI A;  1CX1 A;  2VTX A;  5FY0 A;  3A23 A;  4BQ5 A;  3NKT A;  4LBQ D;  1AR8 1;  3OUH A;  1COV 2;  1EY2 A;  1ZZ8 A;  4KU7 A;  5FZL A;  2WSV A;  5HCH A;  2EXK A;  1HQW A;  1XBF A;  4M3C B;  4SBV A;  4ES8 A;  4EWA A;  1JH5 A;  1XE0 A;  3TEX A;  1F35 A;  1HX6 A;  3DKQ A;  3ZFG A;  3ZIW A;  4NRP A;  4AYU A;  1VMH A;  2J1U A;  2ZX3 A;  5T5L A;  5DN2 A;  4PBP A;  4I09 A;  4FPF A;  1TZO A;  4CCK A;  1S1A A;  5C8C C;  1JYV A;  3DYP A;  3E5U A;  5C71 A;  1JZ2 A;  4TZD A;  4QDS A;  1POV 1;  1ZZ7 A;  3FHA A;  3NV1 A;  1W2O A;  1AYN 2;  3RWN A;  5LK5 A;  3W5M A;  1ZBE 2;  1RUI 1;  1X9P A;  2GN3 A;  5C4W C;  1VRH 1;  2J1A A;  3EQE A;  2PAM A;  4Q1R A;  2RS3 2;  3B9I A;  4AL9 A;  5LA9 A;  1L3J A;  3HNY M;  4NPM A;  5ANN A;  2QQN A;  1W8F A;  5FO8 B;  1JZ8 A;  4FOQ A;  4NN0 A;  4AOC A;  1CD3 G;  5LRS A;  4CEW A;  2AH2 A;  1U12 A;  4P9Y A;  4YNI A;  3KQ4 B;  2OPW A;  3I97 A;  4BK5 A;  4DFS A;  2VNR A;  1ZZC A;  5FOB B;  3IMM A;  2D93 A;  2MNG A;  2NP0 A;  1BMV 2;  1QH6 A;  5LBC A;  1UXZ A;  5C8C B;  2XUE A;  3R4S A;  1LB2 A;  2AEN A;  3JBG 2;  5FAX A;  2VJX A;  3VN4 A;  4XUR A;  5KHG A;  1LKN A;  1RUE 2;  3WDV A;  4CUA A;  1I3H A;  2PMW B;  2YRO A;  1FPN 3;  3PTR B;  4B3N A;  4XXA A;  3N7M A;  2Z2S B;  4YW2 A;  2FMD A;  2YGL A;  1OH4 A;  1FV3 A;  4OI1 A;  1FMD 1;  4ONU A;  1R1A 1;  2J7M A;  5C4W B;  1CQ9 A;  2AZ5 A;  2R6Q A;  2ARE A;  2BER A;  3CF6 E;  1BEV 3;  1CIW A;  3OGS A;  4MAD A;  2VC9 A;  2UYA A;  1PIV 1;  2BZD A;  2Y6K A;  1SBF A;  2PHR A;  1W9Y A;  2P37 A;  3FLR A;  3GHN A;  3IIA A;  3LPG A;  4I0W B;  4YLZ A;  2EIC A;  2D5H A;  3H8X A;  5LBF A;  1RGS A;  3AZX A;  5FKC A;  4NAM A;  4LE4 A;  1CON A;  3C7F A;  5A1F A;  5EYY A;  2VM9 A;  3KD4 A;  3U78 A;  4PF5 A;  3H42 B;  4RR3 A;  4B1L A;  5A6Y A;  1PVC 2;  1TME 2;  1PGL 1;  4CDQ A;  4D69 A;  4QX3 A;  4YWA A;  4NAO A;  3MDP A;  2YC4 A;  2W2I A;  4NHM A;  4QD2 A;  4E4Z A;  3WG3 A;  3RI9 A;  1ZBA 2;  4LIT A;  4ORF A;  3USU A;  4BLJ A;  3LOB A;  2QZ3 A;  2ZGK A;  5F7U A;  5JXJ A;  4B7K A;  2D6P A;  3K3N A;  4JRA A;  4XQW A;  3WF4 A;  1H0B A;  1XU1 A;  4AGV A;  4AVA A;  1OHF A;  2L9L A;  2KM2 A;  4HKL A;  2LRO A;  3MFC A;  3TB0 A;  2KXL A;  4XFB A;  2ZEY A;  2YPJ A;  3KV4 A;  1UL9 A;  3AKR A;  3ZFF A;  2OZ6 A;  1VAK A;  1ZRR A;  3BB6 A;  1UYP A;  1W8H A;  4KMQ A;  2BPA 2;  3L2H A;  3VBO A;  3AZZ A;  3I2H A;  4E27 A;  3AKS A;  2OQ6 A;  4YG6 A;  5J98 B;  2DVD A;  4XAC A;  3PME A;  3BKZ A;  3D5O A;  4Y3O A;  1W3X A;  3WQ1 A;  2BGP A;  5C5T A;  4UBG A;  3HQX A;  4CDU A;  2QDR A;  3FZ3 A;  1RYY A;  2QKD A;  3WQ0 A;  1UPS A;  3ZPO A;  1RUC 2;  5A3M A;  1YQ8 A;  1G9B A;  4OVE A;  1I9R A;  3KCC A;  1X36 A;  1PO1 1;  3ACH A;  4QDR A;  5FPB A;  3RWK X;  5IT6 A;  1GLH A;  3H9A A;  1LTE A;  1LNS A;  1ZRI A;  2CWM A;  2VQU A;  5GZD A;  3ZN4 A;  1EV1 3;  1CR7 A;  1AX0 A;  1AZD A;  1QJU 3;  2V4V A;  4HSJ A;  1TNR A;  3HR9 A;  1GWK A;  2P6C A;  2K2S A;  1OI6 A;  4WBB A;  3B69 A;  3H8U A;  3K4D A;  4Y26 A;  3A22 A;  4A3X A;  5KHJ A;  2HWD 2;  1MS1 A;  1RUD 2;  2P3Y A;  2VMF A;  1MS8 A;  4R52 A;  1VLN A;  3GZT B;  1C8N A;  3HNB M;  1EAH 3;  2Q8O A;  4ZZ5 A;  4IEZ A;  2OA2 A;  1S0B A;  4RQP C;  4Q4V 1;  4QKN A;  2VMG A;  2ARC A;  1XE7 A;  2XJP A;  3M3O A;  5FXW A;  4CXX A;  4WVV A;  5FYM A;  4QB1 A;  4AHY A;  3OY8 B;  1DGW A;  4Z2A A;  4CEY C;  1LES A;  5EJ3 A;  4JV4 A;  3H3Z A;  4P9W A;  1R09 1;  2JDY A;  2KA3 A;  3SH5 A;  5FJH A;  3HMY A;  5F6L B;  1UX7 A;  4Y22 B;  1LHW A;  1IQD C;  4OQ8 A;  2RDQ A;  1HXS 2;  1ASJ 1;  3KF5 A;  4XQ4 A;  2SLI A;  4IV3 C;  1KEX A;  4IEX A;  4CCC A;  4BIO A;  5BNN A;  3M3I A;  4FXK B;  4WZF A;  3UK9 A;  1YFY A;  5F2W A;  4EN9 B;  1COV 3;  3P3N A;  1DQ6 A;  3QAC A;  2C4X A;  2GP3 A;  2XKP A;  4NHX A;  4IV1 A;  3PUH A;  4RQP B;  4CDW A;  2WT0 A;  4B7E A;  5A6Z A;  4H7M A;  4QGN A;  3HBZ A;  3IN9 A;  2BP6 A;  5FYS A;  2YBP A;  4NIH A;  3KWV A;  1DGW X;  2GZW A;  1M06 G;  2GP5 A;  4GMP 3;  3VD9 A;  4CEY B;  4NHL A;  4AVB A;  1UY1 A;  4CP9 B;  2Y6F A;  3D4K A;  4DY3 A;  1E57 A;  1DG6 A;  3CMG A;  5CFD A;  1OVP A;  3JD7 2;  1UMZ A;  5LA1 A;  1SHW B;  3OYW B;  2K46 A;  2QTW B;  3OBZ A;  5FP4 A;  1AYN 3;  1YQ5 A;  3TNQ A;  3ZYF A;  1ZBE 3;  3FUQ A;  3DPR C;  1QHD A;  4BME A;  1NKG A;  1WLD A;  4NID A;  1DFQ A;  4IV3 B;  3UKN A;  2RS3 3;  1BBT 3;  1OA4 A;  2WO3 A;  3MFA A;  4OCT A;  3TEY A;  1ULG A;  4MV2 A;  3AZW A;  2ZGM A;  5F5I A;  1N47 A;  2C9K A;  2J1T A;  4FFH A;  3U10 A;  2Y6G A;  3CJI C;  1S0I A;  5GAL A;  2R7E B;  3MV1 1;  4RGA A;  2IVI B;  3SCH A;  1B35 B;  2XJQ A;  3P6B A;  5JWP A;  4W65 A;  3VD7 A;  2HWC 2;  5JOY A;  4QB2 A;  1SFP A;  2DTW A;  3BCW A;  3JBG 3;  3I2K A;  4PLN A;  2OXB A;  1RUE 3;  2BU9 A;  1GZC A;  3MIG A;  1CX4 A;  1A8D A;  1DYP A;  1VP6 A;  2RS5 3;  4LIU A;  4ZKT B;  2WO2 A;  5FJK A;  2VE1 A;  4P08 A;  3DPR B;  3I2G A;  3AYE A;  2JEM A;  4W8J A;  4P5H A;  3IMN A;  1S0C A;  2HWF 2;  3IDE A;  2VCA A;  4XTP A;  5LAS A;  2GME A;  5JIU A;  3VDD A;  5JZG A;  1IKP A;  3HN3 A;  4LKD A;  3SKV A;  4C0B A;  4W6Y A;  3S6P A;  3PUI A;  1W04 A;  3EYP A;  5FZF A;  4R9D A;  2D6M A;  2ZAA A;  1KJL A;  5LRR A;  2RM2 3;  1C28 A;  2RV9 A;  3OBA A;  1PVC 3;  1TME 3;  2VNG A;  1PNG A;  2DVB A;  2YBK A;  3ES1 A;  4Y1V A;  4Q0U A;  1IG3 A;  1AHS A;  1H6Y A;  1XNB A;  2W0X A;  3DEC A;  3E6B A;  3M1H A;  1MAC A;  2J1V A;  3TNP B;  5CFC A;  1AXY A;  4IES A;  2JG9 C;  1URX A;  1ZBA 3;  5IVB A;  1W6O A;  2WKK A;  3MW3 A;  2ATF A;  2E26 A;  4Y5S A;  3CZJ A;  4Q27 A;  1UKG A;  5G04 L;  2DYC A;  4UYB A;  5KXD A;  2VMI A;  5DAB A;  2I74 A;  2A6Z A;  3ZDV A;  2VG9 A;  1BZW A;  1VJ2 A;  3C3V A;  2PA7 A;  5A80 A;  3ST7 A;  3SQO A;  3POW A;  4UFM A;  1Y7B A;  4CA9 A;  4GAZ A;  4Q4Y 1;  4YRD A;  5FYT A;  3MI8 A;  3OB8 A;  3BAL A;  5JR2 A;  3HOB A;  2RMU 2;  3MZH A;  4AAX A;  1W6N B;  4KL1 A;  4WZC A;  2WAA A;  4EJR A;  3VKL A;  1HLC A;  1RUF 2;  4CPB A;  4NII A;  5A7N A;  2DTY A;  1OF4 A;  4N53 C;  3U4S A;  4R8H A;  5FY5 A;  2ZX2 A;  3VL8 A;  4TYS A;  5IVC A;  1JOD A;  2DWR A;  2JG9 B;  3BOD A;  2BUK A;  3NNF A;  4OUS A;  1AR7 1;  4DXT A;  2CDP A;  5GZC A;  2YUE A;  5CAD A;  1UYZ A;  1RUC 3;  4YPJ A;  4PCR A;  5LY1 A;  4BOW A;  5JAX A;  3IAQ A;  4LBQ B;  1L7R A;  5KHK A;  1GUI A;  1TG7 A;  2I2S A;  2Y0O A;  1JZ4 A;  3PU8 A;  3OBT A;  4DS0 A;  3IDA A;  3CLP A;  3Q8E A;  1UY4 A;  1HQL A;  4LPL A;  3DGT A;  1SQ4 A;  4GXL A;  4N53 B;  4A42 A;  2HWD 3;  2YU2 A;  1RUD 3;  4HOO A;  2XOM A;  1RIR A;  3ENR A;  5JLV A;  1X8E A;  2JE8 A;  3TWI A;  3NVC A;  1NCQ A;  1UWW A;  2A70 A;  1MR5 A;  1IOA A;  2R06 3;  4KNC A;  1VBD 2;  2LS6 A;  1LOB A;  4RS5 A;  4AVV A;  2VL4 A;  4GIQ A;  4YW7 A;  4N9H A;  1T2X A;  2D40 A;  1NX9 A;  4NO4 A;  3O1T A;  2W47 A;  1Z7S 2;  4CCL A;  2D6O X;  4XZP A;  3OD4 A;  1CPM A;  2VQA A;  2PAK A;  4OUL A;  1NLS A;  3ZO0 B;  5I0S A;  3NNL A;  2LAL A;  4QXB A;  1UAI A;  4JHT A;  3U11 A;  3DCQ A;  3PUS A;  2WRA A;  5FZO A;  2G9G A;  2UWA A;  3B00 A;  3V65 A;  3VBF A;  1HXS 3;  2X5I C;  2EXJ A;  1ZA7 A;  3O1S A;  3WP4 A;  1GZW A;  4ATF A;  5GZG A;  1HB3 A;  2WII B;  4MXV A;  4FAH A;  3ZMO A;  2VW1 A;  4LO5 B;  5FLI A;  5FP7 A;  2DUP A;  1QJY 2;  1OD5 A;  2ZHN A;  1JZ6 A;  4LT5 A;  2ZGO A;  3MLL A;  2JDZ A;  2XDV A;  5DZF A;  4DO0 A;  2P34 A;  4FXG B;  4JRL A;  4BLI A;  4I01 A;  1J3R A;  1AR8 3;  4QX7 A;  1FPN 1;  1OSG A;  1JTZ X;  1QKQ A;  3I3D A;  5DAP A;  1OPO A;  1Y9Q A;  2FCV A;  1POQ A;  3LEM A;  2GH2 A;  3ECQ A;  3USS A;  4N90 A;  4AHZ A;  1Y9M A;  1AUY A;  1BEV 1;  3ZXA C;  3GGL A;  2YBS A;  4QQO A;  4AED C;  4EV0 A;  1A78 A;  1N1T A;  4EN0 A;  3Q8C A;  1DZR A;  1CJP A;  4QHB A;  3H8O A;  2D98 A;  4CUC A;  5FZ6 A;  5LWB A;  5AVA A;  3H8R A;  5H9S A;  1K5M A;  1CZV A;  3DYO A;  2IFW A;  3KM5 A;  3HWJ A;  4FQZ A;  4XUN A;  2W95 A;  4B4P A;  4LE3 A;  1OQ1 A;  3ZFE A;  3TRS B;  3O1P A;  4MHU A;  4TLG A;  5BYN A;  2DF7 A;  1GWL A;  4P9X A;  4OFG A;  5FO7 B;  4FPY A;  4NIA A;  2XML A;  2WFP A;  1NY7 1;  3VHO A;  5C3O A;  5BNP C;  2D97 A;  5HXM A;  3WV6 A;  3VBR A;  4AED B;  3I3M A;  2W68 A;  1W99 A;  2PHD A;  4LTA A;  2Y6H A;  4LO4 B;  1QOS A;  2HWF 3;  1QJE A;  5C7G A;  1XND A;  5CAZ A;  1MZ6 A;  4IEV A;  3O0V A;  2P3J A;  2NM1 A;  3AVR A;  3NMB A;  1RUJ 2;  3W20 A;  1GAN A;  4AW7 A;  2AEZ A;  1J1T A;  1R1A 3;  3OF1 A;  1CAW A;  4XJA A;  3M2M A;  4X6Q B;  3H0O A;  1QMJ A;  2XLA A;  3OUJ A;  5BPX A;  1CAU A;  3ZM8 A;  4BQ2 A;  1NCR A;  1ZVF A;  4Q0V A;  3VZJ A;  2C26 A;  3Q9O A;  4DPN A;  5DG2 A;  2QVS B;  2WWS A;  5JXH A;  3KLS A;  1S4C A;  3POF A;  4Q4W 2;  5C3R A;  4AQ2 A;  4QHZ A;  4QB6 A;  5DUU A;  1HRV 2;  1AL2 2;  1MZF A;  1FI2 A;  1RUG 2;  3SHR A;  2Y60 A;  2E7T A;  3CHX A;  5FBJ A;  1OBN A;  1J83 A;  1ALY A;  1YXW A;  3PL0 A;  1I6X A;  3T0B A;  4HLT A;  2JDH A;  4MZU A;  1GZ9 A;  1V6I A;  1EV1 1;  4AFM A;  4L92 A;  4CTE A;  3DV8 A;  3V0A B;  3WUC A;  1LOC A;  2WNU C;  1O7F A;  2WAB A;  3Q8B A;  1RL3 A;  4CDX A;  2RMU 3;  3T2O A;  5J3U A;  1D4M 1;  2EA7 A;  3FHI B;  4OUM A;  3IPV A;  4LHK A;  4FQ4 A;  5ANQ A;  4AQ6 A;  2V5D A;  3RJR A;  3GZU C;  2Q8D A;  1EAH 1;  1NZC A;  2CSG A;  2VR4 A;  3CU7 A;  4TXW A;  3AYD A;  3B3Q E;  3MUZ 1;  1U5X A;  3POG A;  1YWK A;  1FX5 A;  4B1M A;  5BNO C;  3H1M A;  4HVR A;  2WZE A;  3E5Q A;  2IFR A;  4CU6 A;  1F9K A;  5A3L A;  1K5J A;  2VMC A;  1RMU 1;  3VBH A;  4X8N A;  3KVB A;  4XFC A;  3WHU A;  1V6N A;  3RMX A;  1F5J A;  3OPW A;  3HAG A;  2Q30 A;  2VTF A;  5FUP A;  3NJV A;  2VZQ A;  2WNU B;  1Q8P A;  3BVC A;  4MET A;  1D2Q A;  4FPH A;  3WQB A;  4YG3 A;  4CU9 A;  2IUW A;  1U5Z A;  4FPE A;  2JX9 A;  5F37 A;  1PO1 3;  5FRE A;  1COV 1;  3T3Y A;  5FMO L;  1ZZB A;  2EF6 A;  1WW4 A;  2XXZ A;  2P3K A;  4QPG C;  3THC A;  4BQ4 A;  2CHH A;  3O1O A;  1QQP 2;  5J37 A;  4FTB A;  1BVV A;  5BNO B;  4R4Z A;  4DZG A;  3S7I A;  2VME A;  2RDS A;  1EP0 A;  1ZA4 A;  3I49 A;  1HIX A;  3LCP A;  4XIO A;  3LDB A;  4D7T A;  4GMP 1;  2Q4S A;  4K9S A;  3WUD A;  5FKB A;  1JOB A;  4HZF A;  1QNY A;  5KHI A;  4Y24 A;  5LK7 B;  3O1M A;  4DUX A;  4B8E A;  4PI2 A;  2GDF A;  2QQI A;  1AYN 1;  2VNV A;  3KHB A;  1ZBE 1;  4E2G A;  1S2E A;  3LFI A;  1KFX L;  4XUT A;  1VIW B;  3LF7 A;  2RS3 1;  1CES A;  3M8L A;  2OYZ A;  1YEW A;  3UV9 A;  3J4U H;  2R04 2;  2YB7 A;  3UGF A;  4LBK A;  4QPG B;  1YYN A;  2P1B A;  3LFM A;  4UFJ A;  3OSD A;  1OUS A;  5F8P A;  2VCM A;  1MVE A;  3PUA A;  2B8M A;  3AFK A;  3R4U A;  2QJV A;  1BMV 1;  2X09 A;  3ZDS A;  3THT A;  3QD6 A;  1BCX A;  1LGC A;  1SLI A;  3JBG 1;  2ZMN A;  2MEV 2;  1RUE 1;  3KT4 A;  4W4Z A;  4XFH A;  5FLJ A;  1WME A;  2EAA A;  1ND2 C;  1MS5 A;  3WZ1 A;  2A3X A;  3IT8 A;  1TQ5 A;  2QUO A;  3KQR A;  4CP2 A;  4WVW A;  3HT1 A;  1W6P A;  5D8A C;  3ZXE A;  3AL5 A;  5A32 A;  3KS7 A;  2TEP A;  3DXU A;  4R4X A;  2HEV F;  4HT1 T;  4QQP A;  3FX3 A;  1CAV A;  1YIF A;  4FT8 A;  3IBM A;  4XW3 A;  3LZZ A;  4FTS A;  3BTY A;  5T52 A;  3LA2 A;  3CKH A;  2W39 A;  1G6N A;  3K2O A;  1PVC 1;  1TME 1;  3OJB A;  4AI2 A;  4L2N A;  4H14 A;  1BHG A;  2K0G A;  3T0A A;  1D4V B;  2I45 A;  2Q0A A;  2ZA9 A; 
#chains in the Genus database with same CATH homology
 2BZD A;  2Y6K A;  5I0D A;  3LPG A;  2EIC A;  2ID4 A;  2YC2 A;  2VMD A;  3C8X A;  1K42 A;  3MBW A;  2HYX A;  2EID A;  3C7F A;  3WNO A;  2VM9 A;  4JX0 A;  4OUE A;  1JZ3 A;  5JXI A;  4QX3 A;  3C7H A;  3CDZ B;  5JXG A;  2YC4 A;  2WUH A;  4A44 A;  1UY3 A;  4MOA A;  2QQL A;  2Y6L A;  1CIY A;  3CQO A;  4A3Z A;  4FI9 A;  3C7O A;  5F7U A;  5JXJ A;  3WF4 A;  5IJR A;  2L9L A;  2WO1 A;  2ZEY A;  2WQ8 A;  4DEV A;  3SEE A;  3WEZ A;  1GQP A;  4KMQ A;  2E32 A;  3FL7 A;  2LW8 A;  3I2H A;  1D7P M;  2V72 A;  4P02 B;  5IFP A;  2KD7 A;  2BGP A;  4GZ9 A;  1RYY A;  4KWU A;  3F2Z A;  4UAP A;  4QDR A;  3ACH A;  2WN3 A;  4ZXE A;  1LNS A;  3MV0 1;  2VQU A;  4OMD A;  3LE0 A;  2V4V A;  3NQH A;  3SEP A;  3OGV A;  1UZ0 A;  2X05 A;  1XPW A;  4LKS A;  1GOF A;  3NRU A;  2W91 A;  3K4D A;  2ZEZ A;  3A22 A;  2QQM A;  1NUK A;  4QAW A;  3SKJ E;  4RYD A;  2VMF A;  5B4X A;  5LA2 A;  4RN5 A;  3HNB M;  1PMH X;  1GMM A;  4ZZ5 A;  4W50 A;  1K12 A;  2XON A;  5LA0 A;  4A45 A;  4QB1 A;  1O8P A;  4Z2A A;  2HLE A;  1UX7 A;  4BDV B;  3LEK A;  1IQD C;  1O8S A;  1KEX A;  3UET A;  1R64 A;  2QBX A;  4XUQ A;  1JHJ A;  2W1U A;  3WSO A;  2C4X A;  3NNG A;  1JI6 A;  3LEI A;  4TTG A;  1UMI A;  3PUH A;  5IHR A;  4M4P A;  3UES A;  2QQO A;  2PQS A;  3P1I A;  2W5F A;  4P5Y A;  3VD9 A;  1EUU A;  4DXS A;  1UY1 A;  1XNA A;  3CMG A;  5LA1 A;  1SHW B;  3WF2 A;  2ZEX A;  2WYS A;  4JKL A;  1NKG A;  4JKK A;  2WO3 A;  3CIH A;  1W8O A;  3T2Q A;  3OG2 A;  2C9K A;  2J1T A;  2Y6G A;  1OD3 A;  2W46 A;  2R7E B;  2ZEW A;  3MV1 1;  2XQX A;  3P6B A;  4CU8 A;  3VD7 A;  2W87 A;  2W9X A;  2Z4F A;  4DXR A;  4QB2 A;  3I2K A;  4JKM A;  3HNM A;  2VZR A;  4BJ0 A;  5DMY A;  3T09 A;  4UI9 L;  3U37 A;  3VDB A;  2WO2 A;  4P08 A;  3I2G A;  4W8J A;  2WZ8 A;  2VCA A;  1DLC A;  3IAP A;  2W1S A;  4E8C A;  3HN3 A;  3SKV A;  3PUI A;  3EYP A;  3CZU A;  2DCK A;  4PF1 A;  2VO5 A;  3OBA A;  2RV9 A;  1O59 A;  1PX3 A;  3BN6 A;  4M4R A;  1YQ2 A;  4MO3 M;  2BBA A;  1H6Y A;  3DEC A;  4P00 B;  3FHQ A;  2J1V A;  1MPX A;  1GNY A;  5EIY B;  3I2I A;  2E26 A;  5G05 L;  3CZJ A;  5G04 L;  2VCB A;  4DUV A;  1PX4 A;  3WF0 A;  2E31 A;  3VD3 A;  3D3A A;  4GWI A;  4A4A A;  2XHN A;  3OB8 A;  5JR2 A;  1ULO A;  5JMO A;  3HOB A;  4AG4 A;  4AAX A;  5CYY A;  2WAA A;  3NJX A;  3A21 A;  3HJR A;  2EIE A;  2JD9 A;  3MO4 A;  1UXX X;  2EIB A;  4XUP A;  5EJZ B;  3WNL A;  1OF4 A;  3I2J A;  1W9W A;  4QPW A;  3T0D A;  1H6X A;  3BGA A;  4ZZ8 A;  2VZV A;  1WKY A;  4DXT A;  1W8N A;  2CDP A;  3GM8 A;  1UYZ A;  4YPJ A;  2ORX A;  4QX0 A;  1US2 A;  3IAQ A;  5FUI A;  2OKX A;  4MGS A;  1L7R A;  1GUI A;  1TG7 A;  2RVA A;  4OYU A;  1JZ4 A;  2VZO A;  3LEG A;  3IDA A;  2J22 A;  1UY4 A;  4LPL A;  1K3I A;  4A42 A;  3DYM A;  5B4N A;  2XOM A;  3LPF A;  2JE8 A;  1UWW A;  3IB3 A;  2E33 A;  1JU3 A;  2W92 A;  2LS6 A;  1EUT A;  2VL4 A;  1T2X A;  1NX9 A;  2W47 A;  3OEA A;  4QDQ A;  4OMC A;  2W1W A;  1JZ7 A;  3K77 A;  2X10 A;  3HPN A;  4E8D A;  2JKX A;  1PMJ X;  1TVG A;  2CDO A;  3ACF A;  4BK4 A;  2WAO A;  1KGY A;  3WNM A;  1JZ6 A;  1US3 A;  3VD4 A;  5IFT A;  1UY2 A;  3ETP A;  2DDU A;  3UNP A;  1UY0 A;  4A41 A;  3I3D A;  3ECQ A;  2ZXQ A;  3GXU A;  2Y8K A;  2ORZ A;  3C7G A;  3GGL A;  1DYO A;  1F4H A;  1CZT A;  4CUC A;  2VZ1 A;  1ULP A;  3THD A;  1CZV A;  2VZU A;  3DYO A;  5EJ1 B;  4XUN A;  2W95 A;  5DPN A;  3GDB A;  3K4A A;  3WF1 A;  4CUB A;  1W0N A;  1GOG A;  3K75 B;  5HXM A;  1W9T A;  1W99 A;  2Y6H A;  4D8M A;  3VDC A;  5C7G A;  1GU3 A;  1UMH A;  4PT6 A;  4MGQ A;  3ZM8 A;  3EB7 A;  2C26 A;  1JU4 A;  4ET7 A;  1CZS A;  5JXH A;  2RJ2 A;  1XC6 A;  4QB6 A;  1DP0 A;  2B9V A;  1HN1 A;  2YG0 A;  1OT5 A;  5CZK A;  2WBK A;  4JHZ A;  1J83 A;  3WNK A;  4A6O A;  5HPO A;  3T0B A;  2VZT A;  4KI5 M;  3VDA A;  4XZU G;  3T2P A;  2W94 A;  2W3J A;  4QX1 A;  2WAB A;  4L0P A;  1P8J A;  3T2O A;  4DUW A;  2W1Q A;  4OZO A;  4DEQ A;  1L7Q A;  4PQQ A;  2Y6J A;  3WNP A;  1UYX A;  3AC0 A;  2V5D A;  5C70 A;  3OGR A;  4QX2 A;  1JYX A;  2J1S A;  3MUY 1;  2VOT A;  2VR4 A;  5J1X A;  1XNT A;  4TXW A;  3MUZ 1;  3FN9 A;  4CU6 A;  2WZE A;  1JYW A;  2VMC A;  4ZY9 A;  1SG3 A;  2DCJ A;  2J1E A;  3C7E A;  2VTF A;  3NJV A;  2VZQ A;  3T08 A;  1J84 A;  3I2F A;  3W5N A;  1NAE A;  4LHS A;  3WQB A;  1K45 A;  4CU9 A;  4HG6 B;  2Y64 A;  4IUG A;  4XVH A;  3E1F 1;  2VZS A;  3ACG A;  3K46 A;  3A7Q A;  4GWJ A;  3THC A;  1SDD B;  2WDB A;  2VME A;  1F4A A;  4ARY A;  1GOH A;  3ACI A;  1OF3 A;  1CX1 A;  4DUX A;  2QQI A;  3A23 A;  3LQC A;  5IYY A;  4XUT A;  1JYN A;  3JXS A;  3I3B A;  2YFU A;  2QQK A;  5DQ0 A;  2YB7 A;  3WF3 A;  4D0Q A;  2J1U A;  2VCC A;  5DN2 A;  1I5P A;  1WCQ A;  2QQJ A;  2VZP A;  2X09 A;  3DYP A;  5C71 A;  1JZ2 A;  1JYV A;  4QDS A;  3J7H A;  3FHA A;  3W5M A;  2WN2 A;  4W4Z A;  2VZ3 A;  5A1A A;  2J1A A;  2VQT A;  4XUO A;  1UYY A;  3OEB A;  2JDA A;  3HNY M;  2QQN A;  1JZ8 A;  3ABZ A;  4UOJ A;  3HEI A;  4CVU A;  3I97 A;  4BK5 A;  2YFZ A;  4LQR A;  1W9S A;  3K4Z A;  2VC9 A;  1UXZ A;  2B4K A;  4CU7 A;  2VJX A;  3III A;  4XUR A;  2BGO A;  3I3E A;  4CUA A;  3CKH A;  5LCW L;  3VD5 A;  5JUV A;  1OH4 A;  4BXS V;  1BHG A;  2J7M A;  3T0A A;  3WNN A;  4ARX A;  2BER A;  1JZ5 A;  3OGS A;  4MAD A;  2J1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...