2W47A

Clostridium thermocellum cbm35 in complex with delta-4,5- anhydrogalacturonic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
135
structure length
135
Chain Sequence
ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSANAFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
total genus 28
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w47A00
1UY2A 1ULOA 3DYPA 1GOFA 1YQ2A 1K12A 3CKHA 4M4RA 4CUBA 3DYMA 4HG6B 1F4HA 3LEKA 1JYNA 3T0BA 2VC9A 3OEAA 3SEPA 2QQIA 4AG4A 1JZ2A 4FI9A 3I2KA 1SG3A 1NX9A 2ZEWA 5IYYA 3AC0A 2ZXQA 2V4VA 1GOHA 3K77A 1TVGA 3LEGA 4OUEA 1RYYA 3WEZA 1NUKA 1GU3A 3DYOA 3NNGA 3IB3A 2DDUA 1NKGA 2PQSA 4BXSV 4GZ9A 4CUAA 2E26A 3I3BA 2C4XA 1TG7A 3WNMA 1UY0A 1PMJX 4DUVA 1UXZA 1GNYA 3D3AA 4CU6A 2J1AA 4DEQA 2XOMA 5JR2A 1JU4A 2J1UA 1O8SA 5LA2A 1LNSA 1OT5A 4ZY9A 3WF2A 2EIBA 2VQTA 3FHQA 2VMCA 1UY1A 3UESA 3A22A 3I3EA 4UOJA 2QQOA 3C7GA 4XURA 4ZZ5A 2Y6KA 3ECQA 3K4AA 1O59A 2B4KA 1CZSA 1JYXA 2E32A 2ORZA 4W8JA 3OGSA 3MV01 5JXJA 3NRUA 5FUIA 3WF1A 2C26A 3W5MA 2BGPA 1W0NA 4P5YA 5JMOA 1W99A 1R64A 3CMGA 2VCBA 4DEVA 1H6XA 3WNOA 1UMHA 1K42A 4QPWA 2BGOA 3FL7A 2WN2A 4PF1A 1UWWA 2XQXA 3EYPA 4PT6A 3OGVA 3GM8A 2WDBA 1F4AA 1UY4A 2VMEA 2RV9A 4A4AA 2VZ1A 4XUOA 3DECA 4QAWA 4ZXEA 1IQDC 2W87A 1I5PA 2VO5A 3CQOA 2DCKA 1EUUA 2Y64A 4BJ0A 2X09A 2V5DA 2YG0A 2VZSA 2ZEZA 2J1SA 2DCJA 4ET7A 3LPGA 1UYYA 3ACFA 2VM9A 5G05L 5DN2A 3A7QA 2QQLA 5JXGA 4JX0A 4LKSA 1UMIA 3IIIA 4JHZA 4OZOA 2WO2A 3GGLA 3OGRA 4DUXA 1UZ0A 2R7EB 2WO3A 1UY3A 1L7QA 1J84A 2Y6LA 3I2GA 4QDQA 3WF0A 2X05A 1JZ4A 2C9KA 3MBWA 1K3IA 4QB2A 3T2OA 2VR4A 5DPNA 2W9XA 2VCAA 3NJXA 4OMCA 2VCCA 2WBKA 3ABZA 3CZJA 1MPXA 1HN1A 3WF3A 2L9LA 2WUHA 2VMFA 2VZQA 5C71A 4D8MA 1SDDB 1O8PA 2YC2A 2VTFA 4TXWA 1XNTA 4M4PA 2LS6A 4D0QA 1JYVA 2VZTA 4E8DA 1DLCA 4XUQA 3VDBA 4XVHA 3J7HA 2YB7A 1US2A 2QQJA 4DXTA 1JZ6A 3ETPA 3PUHA 4QDRA 2X10A 5IJRA 3HNBM 1BHGA 3HJRA 1K45A 1KGYA 1PX3A 1WKYA 2WQ8A 4KMQA 4QDSA 5LA1A 5HXMA 4IUGA 5G04L 4L0PA 3T0DA 5B4NA 3OB8A 1CX1A 4PQQA 2WO1A 3JXSA 2HYXA 4XZUG 2EIEA 1ULPA 4A44A 3T2QA 4TTGA 2VOTA 3NJVA 1JZ3A 4P08A 2J1EA 3SKVA 3MO4A 2ID4A 2ORXA 1W9SA 4ARYA 2W1SA 4GWJA 4CU7A 4DXRA 2WAAA 2W47A 5I0DA 5EIYB 1DP0A 4XUTA 3T09A 3THDA 2Y6GA 3HOBA 4LQRA 3ACGA 3E1F1 4XUNA 1W8OA 2YC4A 4A45A 2QBXA 1XPWA 3LE0A 4JKMA 1OD3A 5B4XA 3WNNA 2Y6JA 4ZZ8A 3LEIA 2Z4FA 2QQMA 2WZ8A 2EIDA 1OH4A 4CU8A 3C7EA 3ACHA 3HEIA 5EJZB 5DMYA 3WNLA 3C8XA 2WYSA 2EICA 4QX0A 1KEXA 2WABA 2W95A 1JZ7A 2VL4A 4CVUA 5J1XA 1DYOA 3VD5A 4BK5A 3OBAA 3VDCA 3VD4A 3EB7A 2VQUA 2WZEA 3SKJE 3GXUA 3P6BA 4A3ZA 5CZKA 5CYYA 4A41A 1CZVA 1W8NA 4P00B 4W4ZA 4YPJA 1SHWB 3NQHA 3T08A 2VZ3A 4QB1A 1JZ5A 2VZOA 4UAPA 1CIYA 4MGQA 1W9TA 5IHRA 5IFPA 1JI6A 5JXIA 3MUZ1 3WSOA 4OYUA 2Y6HA 2ZEXA 4DXSA 3CIHA 3LQCA 1P8JA 1EUTA 2VZVA 5IFTA 3C7OA 5C7GA 3T0AA 2J22A 2JKXA 1L7RA 5EJ1B 1CZTA 4KI5M 5LA0A 1PMHX 3UETA 3FHAA 2BZDA 2VMDA 3I97A 4QB6A 2VZPA 3VD3A 3K46A 4XUPA 5A1AA 2HLEA 2J7MA 1D7PM 4MO3M 4Z2AA 4BDVB 3C7HA 4KWUA 2ZEYA 3VD9A 1UXXX 4GWIA 2XONA 4W50A 4BK4A 1GQPA 1UYXA 2W94A 5LCWL 1GOGA 2QQNA 3LPFA 1JU3A 1T2XA 1GMMA 1OF4A 3MUY1 1WCQA 2VZUA 1JHJA 4LHSA 2LW8A 1PX4A 2JE8A 3I2FA 3OEBA 2J1RA 3UNPA 3WQBA 2VZRA 5DQ0A 3MV11 4QX2A 1US3A 3WNPA 2W1WA 3HPNA 4P02B 2J1VA 2KD7A 1XNAA 3C7FA 4A6OA 4QX1A 5C70A 3I2HA 1OF3A 3BN6A 3K75B 4JKKA 1NAEA 3K4ZA 2CDOA 2BERA 4MOAA 3T2PA 3CDZB 2JDAA 3F2ZA 2E33A 3THCA 3I2IA 2W1QA 5JXHA 3I3DA 1JZ8A 3CZUA 4MGSA 1J83A 4A42A 3ACIA 2JD9A 5HPOA 4AAXA 3P1IA 2WN3A 3A21A 2OKXA 2CDPA 2W92A 3IAQA 4OMDA 4QX3A 3SEEA 3HNMA 1XC6A 2B9VA 2W1UA 3IDAA 4CU9A 4DUWA 4JKLA 2RJ2A 2YFUA 3WF4A 3IAPA 1JYWA 3K4DA 2WAOA 4CUCA 3HNYM 4E8CA 1W9WA 3GDBA 3VDAA 3W5NA 2W5FA 4RYDA 1UYZA 2VJXA 4UI9L 1H6YA 2RVAA 2W91A 3WNKA 3U37A 2BBAA 4ARXA 2QQKA 4LPLA 3VD7A 3HN3A 3OG2A 2V72A 1GUIA 3BGAA 5F7UA 1UX7A 4MADA 2Y8KA 3FN9A 2J1TA 2XHNA 3A23A 3PUIA 4RN5A 3I2JA 2W46A 2YFZA 2E31A 5JUVA 2W3JA 3ZM8A
chains in the Genus database with same CATH superfamily
1BZWA 4Y3OA 1UY2A 4Q4W1 1W0OA 5FY9A 4XDPA 3NKTA 1PNGA 1SDWA 3ACLA 2OVUA 3E97A 5FPVA 2XKPA 4FOQA 3ALQA 2WA3A 1POV0 1PGW2 4HG6B 5J48A 5BNPB 3WDVA 4JQTA 4UW6A 3T0BA 4Q2FA 2C0ZA 4ORFA 1SLAA 1A6CA 3OEAA 5FBJA 1CQ9A 1JZ2A 4WVZA 1W9YA 5FZMA 4FI9A 1YIPA 2AC1A 5JPNB 3PDQA 5J37A 4CA9A 3AVSA 3M70A 1PIV3 3DPRC 1RINA 2P4EA 1V9U2 2UWAA 3BUCA 1YLLA 5DAWA 2ZS6B 3AMPA 3H7JA 5C8CA 1M06G 4WV8A 3U11A 3ZFEB 4OUEA 4YGEA 4NJ4A 1WMEA 4IEYA 3BTZA 1VBD2 3MI8A 4CXYA 3I54A 3NNGA 2Z5WA 1PGL1 3WZ1A 4N9HA 3GBGA 3SC7X 3TN92 3POJA 4K7JA 3RS6A 4FPFA 2E26A 1GV9A 2ZABA 3WDTA 4CUAA 5DUUA 4EN8B 5FP9A 4F7ZA 5KWRA 3E6CC 4LA3A 3LWCA 1GNHA 1OSGA 4FP2A 1F5FA 2WNUA 3I3MA 4XAAA 3TEWA 1DF0A 3VZMA 1FOD1 5DAVA 4NOTA 4BXFA 1V6OA 1SMVA 4URAA 2PHLA 4CU6A 4Y1ZA 4L99A 3U4SA 2OPWA 2XOMA 1DFQA 3JBG3 3MLLA 3ZX7A 4QGLA 2J1UA 4IV3B 1LNSA 3OUJA 4NRMA 4NPRA 2YPJA 3SISA 1ZBE2 2VQTA 1LTEA 3ZFFA 2VMCA 5CB7A 4MHRA 1DQ0A 2VECA 1PVC1 2WQZC 5FPAA 1RUF2 5ABJC 4LO8A 5FUNA 3SHRA 1CONA 3ECQA 5F39A 1O59A 2RS52 3S7EA 5C3SA 1BXHA 1N1SA 3ASIA 1TMF1 1DU3D 2XR4A 1UOBA 4TLGA 4AR2A 2DUOA 3W59A 2WSUA 5K0UB 1HQNA 3G6JB 5FZHA 3FMGA 4H3WA 2B5HA 2C26A 5AFBA 1OOPB 2X53S 1RUNA 1BKZA 1GR3A 2X5IB 5C4WC 1CAUB 2RS32 3NAPA 4P5YA 5JMOA 2V4AA 4I3PA 3CMGA 2F4PA 1QDCA 2VCBA 3MIDA 2AH2A 2Z69A 1H6XA 1JOPA 4AFAA 4Y1YA 2OZJA 1WCDJ 4XFIA 5A7WB 2HH9A 2BGOA 4LR4A 2WT1A 3CF6E 3FL7A 2MEV2 4NMIA 1B35C 1LEDA 2BU9A 4QHBA 3JBG2 2VMGA 4PF1A 1UWWA 4YM1A 3VBOC 4PT6A 1I6XA 1PVC3 5ERLA 3V65A 3H8OA 1EY2A 1DQ2A 2EXHA 1G9AA 1F4AA 5DZFA 1UY4A 2VMEA 4LK7A 4Q8LA 2R041 2R1DA 4A4AA 2PMWB 1VBA2 3UKTA 2PELA 3RDIA 1VBE1 1IQDC 1IS3A 1I5PA 2WLQA 5A3UA 5GZGA 1AL22 2P17A 2DCKA 3ZFEC 2X09A 3JZVA 4QWNA 3WW3A 4CSWA 5ISLA 3IMMA 4KGGA 4WZCA 1LOFC 5KC6A 4BB3A 3IWZA 4LIUA 1J1TA 2WNVC 2DCJA 3KF5A 1NCQB 3M4FA 1LHOA 3HMYA 2ZMLA 1APNA 1AYM2 1UYYA 3ACFA 3FLTA 4QPGB 4UF0B 1SEFA 2WS92 2PHXA 3MPBA 4S2DA 1Y43B 2R043 4G4FA 1QY4A 4YW3A 2I74A 5K7PA 4JX0A 5DUXA 4CRQA 1LR5A 1VE0A 1K5MC 1UMIA 1Y3TA 4RGGA 4D94A 4Z1VA 5J09A 3VBRA 4JHTA 4HSLA 4NHLA 3LIGA 3OGRA 5JIAA 4BIFA 3DF0A 5A33B 2ET1A 1UZYA 4ASKA 4M3CE 2Y6LA 1BVP1 4QDQA 2VULA 4N7IA 5HI0A 2XDVA 4AVSA 1IPSA 3AMNA 4XHBA 4K9SA 2C9KA 3MBWA 1EP0A 4ATEA 5L19A 2EALA 2VR4A 3O5SA 5JSOA 4RQPA 2OA2A 4BZ4A 5A70A 5FZ3A 3UK9A 1HN1A 1UIJA 1MZEA 5HCFA 4CDUB 5C71A 2WNEA 1GZCA 2OYZA 3O1TA 5GALA 4D8MA 4MH0E 1AXKA 1SDDB 1UMZA 3MPPG 4QX5A 2YC2A 5D1IA 1YQCA 4AVVA 5C8CC 2VTFA 1AR92 1QXRA 3RZZA 3M3CA 1OH3A 3URFA 5FLIA 1O7FA 1XNBA 1XSQA 1GP6A 4E8DA 5GLWA 2DU1A 4A2UA 2VY0A 4QXHA 4CCDA 2YB7A 1PZ7A 1US2A 3BYWA 2V09A 4O9EA 4CP0A 2RMU3 1MQTA 1WLTA 2A6YA 3FZ3A 4R9AA 4LKFA 2HEWF 1ZBA2 1JMUB 2K46A 1YCIA 5IJRA 4GMP1 3ZFGC 1RUI3 5CFDC 3DGTA 4XF9A 3WCRA 5CKNA 1ND3C 1JOJA 1UZWA 1OQEA 1PX3A 1WKYA 1WMDA 2DURA 4AOCA 4HPKB 1HRI3 2PHRA 4LXLA 4CTEA 1J3QA 5HXMA 1QKQA 4M3CA 3H3LA 4HK8A 4WBBA 5G04L 2PA7A 4Y26A 4L0PA 2HEYF 4OHXA 3K51A 5B4NA 2IXIA 3OB8A 4FOYA 4Q4Y2 4MGKE 1YO8A 3Q8BA 4LULA 2HYXA 3OCPA 2PLV3 3PU3A 4MSVA 3I59B 4OULA 3W58A 2WINB 1LHVA 4Q27A 4AFCA 5APAA 2YU1A 1FATA 2JG9C 2ZGNA 1UU4A 4AEMA 1JZ3A 2WWJA 4YGCA 1RVF2 3CJIA 1OBNA 3A4UA 4HSJA 4YG6A 3U07A 1E5IA 1JH5A 1RUOA 5C5TA 5JR7B 3N7JA 1XQNA 4CEYC 4CU7A 4DXRA 1OQ1A 2WAAA 1AYN2 4HANA 5FYTA 3WUCA 3NV2A 3CJIC 3ILNA 4K40A 3RYPA 1DP0A 5KHJA 1VJ2A 4XUTA 3UL2A 1Y9MA 1W6MB 3VKLA 2IXKA 4YZ3A 1IPJA 1LOGA 2JEMA 2QQUA 4XQDA 1W8OA 3WVJA 4BHPA 3NV1A 5JOYA 1XPWA 3KD4A 2KM2A 2WC2A 4JKMA 1OD3A 2D5FA 1AR62 2FDGA 1A34A 2OX0A 2Y6JA 4IGQA 3VBSB 4ZU7A 1Z78A 2Z4FA 2E7AA 4R4ZA 4JDMA 2VD7A 1VRH1 5K4LA 1ZBA3 5F3IA 5KHIA 4RS5B 4CEYA 2RMU2 2ZBJA 5L73A 3USUA 1NOVA 3WNLA 4Q4X1 5BNPC 4A3XA 1HQWA 3MLKA 4K8FA 5F32A 3N7LA 3W20A 4YVSC 1PK6C 1MS3A 5C9AB 1ASJ3 2XLFA 2EICA 2Y0IA 4QX0A 1T6GC 5F8PA 1LOEA 1ZZBA 2DCZA 2VH9A 4P14A 3TAYA 3ZXEA 4AHXA 1OLME 1HKDA 5EJ3A 1KS4A 2IVIB 2VOKA 1TMF3 1N1YA 4GH4B 4IV3C 4ISRA 3MW2A 1SCRA 4L2NA 1N47A 3EB7A 4L9BA 2WZEA 1ZRIA 4YW2A 3E5UA 5FYBA 1V00A 3OBZA 4E2SA 1KXGA 1CZVA 1W8NA 1X8EA 4XXAA 3RWNA 2TUNA 5FQ0B 1N3OA 5FIXA 1QJU2 4NVPA 4DFSA 5JOXA 2CYFA 4YWAA 2OT7A 4COVA 4AK3A 2HWC3 4JGZA 1NYWA 4R9DA 2VBBA 3OSDA 2DUPA 1MS5A 1QQP3 1D2QA 4X6QB 3B00A 1OFNA 1T6BX 5IW0A 3ZXLA 2HWD1 2HWD3 5JXIA 2OUHA 3SCFA 2AEYA 2ZGUA 3WSOA 4CCEA 5F1RA 2WT2A 5KHKA 4DXSA 1KQRA 4OI2A 1XE8A 2MEV1 2D6NA 1YIFA 3KT7A 3PNAA 2HWC1 4EJRA 4QQPA 5FBZA 3LD8A 3V64A 4U36A 3VLBB 1S0GA 1GNZA 2J22A 2QQWA 1KS5A 4OQ8A 3ZSLA 4V1PA 4QU1A 3M8LA 4AVBA 4OLLA 3ZPOA 5LA0A 5LASA 4B1LA 5GLVA 1OVSA 2VXRA 2BZDA 4E4HA 1KITA 5F5CA 2ZGKA 3WQ1A 4Q8KA 2VMDA 2G9FA 1UF2C 4QB6A 4BQ2A 1V6MA 2EIGA 2ADDA 2IZWA 5BNQA 4XUPA 2VW2A 1PVC2 3WINE 3SH5A 5LW9A 1ASJ1 2VTXJ 4QQ2A 5FMOS 3VD9A 1S0EA 5GLZA 2GSYA 1XXNA 3VHOA 2ZHNA 3UKNA 4E2GA 1QJU3 4AI0A 1ZVFA 4HONA 4YG0A 1ZZ7A 5EV7A 3LPFA 4LTAA 4Y1VA 4XJWA 5T3NA 3MUY1 4Q4X2 4H7MA 5DZEA 3VB9A 4CDUC 1W90A 1OD5A 4C8DA 1ALYA 5CA6A 3K2OA 1PX4A 1S0FA 3PUSA 3WDXA 1H2MA 1F8VA 4FPYA 1RJ8A 3VBUC 3TB0A 3I2FA 2J1RA 3U10A 1DBNA 4P9XA 1ENXA 2VZRA 4QKFA 2GH8A 2Z42A 1U5ZA 5A6XA 2DTWA 2RS53 2H6CA 4CP9A 3PVOA 3KLSA 3TN91 1C3HA 2A75A 2A6WA 4P02B 1I1EA 4AF9A 1ZRFA 4LO4B 4RR3A 5I8SA 1XNAA 2FDIA 4XHXA 4JDNA 1O3RA 4A6OA 1ZBE3 1LGNA 3PIJA 3ZYRA 5FQ0A 2GNTA 1C5IA 2K2SA 2D6PA 1NAEA 1VBA1 1YC61 4JKKA 5T5LA 1ZREA 3JUUA 2E53A 4MOAA 4QPGC 4AI8A 2TNFA 4CUGA 2JDAA 3ZN4A 2BGCA 5ACA1 1ULDA 4XXPA 1Q8QA 1NA1B 1JZ8A 2QFEA 1O91A 2P34A 2AUYA 3TYJA 4Q26A 5FZIA 1H9PA 3SLIA 1VBA3 5HPOA 4CZSA 1TE1B 3MYXA 3PVEA 1ACCA 1D0HA 1ZBE1 1PM4A 4OVEA 1F31A 5C9AA 3A21A 5CFDA 2W92A 4RL7A 1UO9A 4BYYA 4AEDA 2HWF1 4ES9A 3H1MA 2KR2A 3TN93 5BXXA 1Y9GA 1B35B 4QM8A 1PO13 3HNMA 3HQUA 2B9VA 4AFBA 1YQ5A 1MEC1 3ILRA 4I0WB 5FYIA 5F6LB 2RMU1 4FT8A 2YFUA 3AXEA 3IAPA 2YBKA 4AEKA 1HW5A 4LBNA 1RVF1 4UFHA 2WAOA 3AKSA 2K9ZA 3AJYA 2VNVA 4XETA 1QH7A 2DU0A 2WA4A 4JZRA 5M0TA 5JZGC 2C24A 4GULA 1U0AA 1ZX5A 1WCUA 2EXJA 4GAZA 1H6YA 1YUDA 3HN1A 3T3YA 4AFDA 5A3LA 4Z8BA 3HBKA 3U37A 2BBAA 4IEQA 3ZFGB 2CNAA 1GBGA 4LNVA 3BCWA 3HN3A 4IXLA 2FD8A 2V72A 3A0NA 2CAVA 2H0BA 1WD3A 4JGYC 4MADA 2J1TA 4XBQA 4MX3A 2O8OA 5EFUA 3GALA 3WT3A 1ONAA 4XYXA 4DB5A 2W0XA 5BNNA 5JUVA 1JODA 2W3JA 1XE0A 3BPZA 3ZYPA 4E4SA 2W2IA 3E6BA 3FE5A 4R9CA 3POEA 3WCSA 1W6OB 1X9TA 4N90A 2P1BA 4PI2A 4KU8A 5L9RA 3T4HB 5JSRA 4I02A 4ZS2A 3DYPA 1JYIA 2ZKLA 2DUQA 3DPRB 1YQ2A 4BQXA 4M4RA 3LB9A 4CUBA 3WD5A 4KWLA 4HPKA 4N53A 3UT0A 3X29B 3E5QA 2VVFA 5C3QA 5FWJA 1LECA 2GZWA 4XJAA 5FZ8A 3HBZA 1TME3 3V56A 1TQ5A 4QQOA 1ODNA 3AZVA 4HLTA 5CU1A 2XLGA 3IPVB 3AZWA 2WZR2 2YPDA 4FQZA 4BIOA 5B2GB 3U4XA 4ZS3A 3B93A 1NX9A 3BU0A 4NIDA 4IEZA 3HD8B 1GFF2 3S30A 4LORA 2ZXQA 3H8UA 1RITA 1YFWA 4I3GA 5LWBA 4IV1B 5JCTA 2QNKA 1F35A 3AFGA 1AUYA 1RYYA 1OUXA 3KM5A 1ND3B 5BPXA 4AQTA 4PJYA 1SFYA 1AYM3 4Y5Z0 2Q1ZB 3OUHA 2ZMNA 2YY1A 3RJRA 3THPA 5F5AA 2GMPA 4N43B 4BXSV 3N9NA 4XFGA 4FAHA 2V5YA 5HBAA 4CDUA 2D6KA 3N7KA 3BVCA 3OJBA 1FV2A 4QT6A 4XQWA 1AR71 4Z07A 1AL23 1R091 5FREA 2D7FA 4AEDC 3PIGA 4P9GA 1TG7A 4ES8A 4QM9A 5LRSA 3S7IA 3WNMA 4GALA 1UY0A 2FZ1A 2CL2A 1Z0HA 4HT1T 4D6QA 2BWCA 5LK7B 1OC1A 5FYUA 5FTTC 1ND3A 2D98A 5A33A 2DVBA 5DDJ2 1BMV1 1ZBA1 2J1AA 2P2KA 2ZAAA 1S4CA 3VBRB 1LAJA 1W8HA 3AP9A 3Q8CA 2JG8C 3NSTA 1KFUL 3ZXAC 3OY8B 1CJPA 3J26N 3KGLA 5LA2A 4OHZA 3ZIWA 2WL1A 3VBFC 1CR7A 4AFMA 1GZWA 2EIBA 5T5OA 1W6NA 5A3TA 1AZDA 3S5QA 1UKGA 1UY1A 3D6EA 4LUKA 5DUWA 4YSFA 4UYBA 4JC1A 4BH9A 1YXWA 4LO5B 4NPMA 3PTRB 1REFA 4KWKA 5CIRA 3C2UA 5LATA 2AR6A 3K4AA 5FZ6A 1EAH3 3VV1A 2E63A 1IS5A 4N53B 3DCQA 2NYYA 3IDCB 3H0OA 4BLIA 1JYXA 3AM2A 1VAVA 1FOD3 3DPRA 3ZSKA 3MV01 2ZGOA 2IC1A 3VBUB 3NRUA 3WF1A 1XB9A 4XCAA 5FZBA 3PVBB 2A6XA 1UOJA 2AACA 2YMZA 4B7EA 5BNOC 3WW4A 3W5MA 1QEXA 2AZ5A 3BOWA 1G9DA 2YC0A 3WG1A 1RUF3 1RUE2 1W99A 1R64A 4NUBA 4DZGA 3T2TA 1HJGA 3IZOA 4AVCA 3IBMA 4LEJA 4TSVA 1K42A 1U5YA 1W0PA 4QPWA 3POBA 1AR82 1MS1A 2GH2A 2R0HA 1F9KA 2HBTA 1HQLA 1OOPC 3QBQA 3WW2A 2X5IA 1TZOA 5EXOA 1OLRA 1G8WA 3B7MA 1LB2A 2D93A 3VKFC 3UGHA 4FXKB 2G9ZA 1AR61 2RV9A 5FJHA 2ARCA 3T1MA 2BP6A 2VZ1A 4Q4Y1 4XUOA 4ZXEA 4FFIA 1VRH2 2VO5A 2YYOA 4B4PA 4J25A 4NHKA 5FR3A 5FZOB 1GWLA 2VTXA 3ORJA 3VL8A 2DCTA 4LBKA 3NJZA 4EWEA 4LBQD 2BFUL 5F2SA 2JKBA 5LY2A 1AR72 3VZKA 3NO8A 2VM9A 1FXZA 1VBD3 5FFOC 2WWSA 5DN2A 2DF7A 1R083 2QQLA 2QQPA 4XF0A 1AYN1 1DZRA 1W6PA 1AXYA 3KHBA 3R4SA 4FPCA 4IV3A 4LKSA 4Q4W3 3IIIA 5CKMA 1V9U3 4GJYA 1B35A 5LA9A 2RR12 4GKXA 2WNOA 3GGLA 4DS0A 5I8YA 3SXWA 2R1BA 1L7QA 1WMFA 1J84A 5D8AC 1O3TA 5FRAA 1MS8A 1O4TA 3U0ZA 1VR3A 4BWOA 1WW7A 4IL7A 3DL3A 1ULCA 5T54A 1G86A 1K3IA 1ZA4A 5JZGB 2ENRA 2EXKA 3PVNA 2A3WA 3WX5A 4OMCA 4Q0SA 2VCCA 2WBKA 1MPXA 4OI1A 3WF3A 2L9LA 2VMFA 2VZQA 3N9OA 1WUVA 3N4MA 1PGW1 3WQ0A 1NA1C 1M4WA 5CADA 4EQVA 5FY7A 5KXBA 5TSWA 1OURA 1JYVA 4MGTA 4R52A 1HB1A 2WZR1 4RR3B 4XUQA 3WDYA 2XPJA 1NY71 1CAWA 3N35A 4HVOA 4KWJA 1MR5A 2PTMA 3WQ7A 1JZ6A 3LDRA 3O1MA 2DYCA 3PUHA 2OW4A 2WZPP 5HCHA 2XBO3 3HNBM 3IMNA 1BHGA 1K45A 4XJUA 1KGYA 3BOPA 3HT1A 1STMA 1MS0A 1QJY2 1UAIA 2X8KA 3AP6A 4KMQA 4PF5A 2O0OA 4QDSA 5LA1A 2XWJB 4QX7A 4P5HA 4XBLA 5FK8A 5BV6A 3AP7A 4FVVA 3OPWA 3QH7A 1CX4A 4B4QA 5A7PA 3J4UH 4Z92B 1UU6A 2IFWA 2IXCA 2ZX3A 3M3QA 4XJZA 3RZLA 1CX1A 4DIQA 1NCRB 3JXSA 1VAKA 4JQRA 1AX1A 4XZUG 2FDJA 4D7YA 1VIWB 4CPBD 4WM8C 1GKBA 5DDJ1 2R32A 4TTGA 2R061 1VALA 1QQP2 3B02A 4Q0PA 1OLMA 1C1FA 2J1EA 4P08A 3MO4A 5A32A 2PAKA 3OBTA 4NHMA 1W9SA 4ARYA 2W1SA 4E4ZA 4DO0A 4PI0A 2OZ6A 4IE7A 5IAVA 3DKWA 2HEVF 3JD72 3LF7A 3L2YA 4AGVA 4EWDA 3D5OA 4QMAA 1BQPA 2PAEA 2AEZA 2CV6A 1GQGA 5EIYB 1GANA 2ZGTA 3S0MA 3OD4A 2D97A 1D2SA 2Q1FA 1WLDA 2KXLA 1ZNPA 3NL1A 5CAZA 1KD7A 3R05A 2Q8DA 4EN0A 5LBEA 3I2OA 3E1F1 1YFXA 4D69A 1RUJ3 1XE7A 1DCSA 1ND2A 4A45A 5F6KA 2BDRA 3KCCA 3WG4A 4KL1A 1GWKA 1NXMA 3M3IA 4Y33A 3ZSJA 5B4XA 3I3QA 4B1MA 5JOZA 2EAAA 3AVRA 1HRV2 3LEIA 4A7ZA 4IEPA 3W21A 2JIGA 3ZYJB 3ZN6A 2JICA 1RUE1 5CFCA 1OH4A 2RDQA 1V6JA 3C7EA 4G9SB 4P9JA 3RQ0A 1VBB3 2P3YA 3HEIA 1QIQA 1BMV2 1POV3 4NHXA 2BPA2 1KDMA 2VQAA 4CDXA 3RZJA 2XVLA 1RUD1 3GYDA 3OD0A 4I30A 3UYJA 2XJRA 2D44A 2D3SA 2O14A 1Q8SA 5FZEA 1XOYA 4FPKA 4NHYA 5FO7B 3NMBA 4ATFA 5IVFA 3ZN6B 4CVUA 2CGPA 4GH4A 4LITA 3Q8FA 5FJKA 5J1XA 5IK8A 3VD5A 1WWYA 4OFGA 1UOFA 1BBT3 3KZ4C 2VAUA 1LU2A 3TRSB 1TNRA 1LHUA 3VD4A 2E9QA 3IN9A 1W9FA 4Q0QA 5GKAC 1ND2B 1PHMA 5H9PA 3V0AB 1E5SA 2VNGA 3P6BA 5F5IA 4Q29A 3WNXA 1QJY1 1VBC3 3B9IA 4EN7B 1AX2A 2VCMA 3AZZA 2C6SA 5FDBA 1SHWB 3AYCA 5FZLA 2E6VA 1DQ5A 2A73B 4J1XA 3T08A 5AC93 2VZ3A 1JZ5A 2WS91 3CEWA 3D8CA 4GJZA 4UAPA 3ZYBA 4XBNA 2E7TA 1SBEA 2CGNA 4LBOA 1CIYA 3APBA 4D6RA 3H9AA 4AL9A 1YWKA 3WHTA 4CP1A 4C91A 1JI6A 3AMMA 5BNOA 4OUMA 2F17A 2LM3A 2ZEXA 4LOTA 4HN1A 1XRUA 1AR81 1SLTA 3KQ4B 3N7MA 4M00A 4K8RB 4QXCA 4XMAA 1EUTA 5T52A 3TEYA 2VZVA 5FZFA 1W8FA 2PQQA 4DRRA 3LA3A 5IFTA 1F5JA 1J59A 5C7GA 4YGBA 3T0AA 2DWRA 3INAA 4HBNA 1W6MA 1NCRA 1L7RA 3B9CA 4DPNA 1XSRA 2ES3A 3HT2A 5A7OA 1RUJ2 4LUMA 2ZX0A 1UQXA 4NRQA 2XL9A 1PMHX 5H9SA 1ENQA 3UETA 3BIEA 3N36A 4F8AA 2E51A 3WP6A 1RXFA 3VDDA 4D3WA 2AGSA 2PHWA 4COYA 2EVXA 2ZCWA 1QMJA 4S2GA 4RS5C 5DZGA 1F15A 1DZTA 1RXGA 3CJIB 4AQ2A 5FKBA 3ZDVA 2HLEA 3RI9A 4IDZA 2B9UA 1UZZA 4BDVB 1NXD1 1W2TA 2P6HA 3C7HA 4KWUA 3KQRA 4RR3C 2ZEYA 1DGWA 3J9SA 5HXVA 1FMD1 4GWIA 1PO22 2XONA 2OS2A 1D4M2 3THTA 1GQPA 3GHMA 1CAWB 1MZ6A 3UGFA 3P3PA 2QQNA 2WT0A 3M3EA 4GB31 3ZYIB 3ZFFC 1XU2A 3TNPB 3PLQA 3DUIA 4M3CB 1VMFA 2Q8CA 5KXCA 2VNOA 5FYHA 1RIRA 1JHJA 3AZXA 2QDRA 2JG9A 4I0AA 4BLJA 1RMU1 4OHYA 3H3UA 1JTZX 3NW4A 4CP2A 2FDHA 2ZHKA 5FMCA 2Q1MA 1CPNA 2JE8A 5K0UC 2UWCA 2FCVA 3UNPA 3WQBA 1C4RA 3Q9OA 2LUWA 1XJAA 1RHI1 4PHZA 5D8AB 2XJPA 1US3A 3DEMA 1VPHA 4XF3A 3TBDA 1S0CA 2W1WA 3WP3A 1RC6A 3UKVA 5A7SA 3MHZA 1QH6A 2BVVA 4ZKTB 1Z7S1 2KD7A 4NR1A 5ABJB 4SLIA 4AI9A 4P9LA 4U2AA 4QX1A 5C70A 2VPVA 2UY8A 3I2HA 2YXSA 1JHNA 2G1MA 1OF3A 3MFCA 1LCLA 5FMOL 5IVBA 3RZMA 5FP7A 1O5UA 1PM7A 2ZACA 2EAKA 1ND2C 1WW4A 4FPJA 5EYYA 2RDRA 5FZCA 4EROA 3H8XA 4NIGA 3PL0A 1L3JA 3CDZB 4UBGA 5JMCA 4QHZA 1RUH2 1ENSA 3THCA 2GAUA 4XFAA 2BEOA 5FPBA 2W1QA 3WR0A 1QNYA 2XJQA 2Q30A 1HB3A 4MGSA 2JJ6A 2JD4A 1ZZ6A 3LA2A 5FZOA 2GP3A 4AAXA 5H9RA 4C90A 1HXS2 3P1IA 3ZVXA 4AHZA 5CBLA 2GDFA 4Q1RA 4I0BA 3UJQA 5CFCC 1UIKA 1RMU3 2RS13 4OMDA 4QX3A 4NN0A 1H8VA 2WRAA 2XVKA 3H8RA 5JOWA 2XWBB 3ES4A 3MZHA 3MDPA 1H1MA 4NE9A 5J3UA 2SLIA 1LGCA 1H8TB 3GBWA 4RQPC 4S2FA 5LRRA 1RUC3 5A7QA 4JKLA 4FOWA 2C5DA 2NQYA 2GNDA 2RJ2A 1FPN3 1QJX3 4ZXKA 4PLNA 2XQRA 4QPGA 1NCQA 1IPKA 1R1A3 3WF4A 4BQ3A 2RE9A 2RS33 1KRIA 4CUCA 2Y33A 3LFIA 2DCYA 1YYNA 2LRPA 5GZDA 4DOUA 1H9WA 2R073 5E8AA 1OVPA 2W5FA 1C8M1 2WNVB 3OBRA 5E88A 4YFWA 1LHWA 1NE6A 1ULEA 3WNKA 1WA4A 2QQKA 3ILFA 3GZTB 2DFCA 1JUIA 4E4DX 1JS9A 1I5ZA 2Y6FA 3RVHA 4NAMA 1ZRDA 5L7OC 2WNVA 2H0VA 1AXZA 5F7UA 1HDKA 1K5MB 1UX7A 1ZZ8A 2WFF3 2Y8KA 3FN9A 1BK1A 3PUAA 3Q8EA 2XG3A 1N3PA 5FPUA 3VHPA 2HWB1 3KF3A 2E31A 1VBE2 2ZGMA 2GC0A 2WLPA 3H1YA 3HVDA 4X8NA 1LHNA 4YGDA 1W6NB 1CAUA 2BJSA 2YUEA 1AJKA 4UXAA 1CVNA 1XU1A 3OY8A 1H2LA 5FLJA 4UFLA 3GJBA 1ULOA 3SITA 1QNWA 3IDEA 5K0UA 1GOFA 4EV0A 3CKHA 4YVWC 2P3KA 4BA6A 4CPBA 1PGSA 1Y9QA 3DYMA 4YM3A 2XMLA 3NNFA 1JYNA 4N9IA 4RHV1 3BTYA 1LODA 3EQEA 1LGBA 3O1VA 4GQ7A 2RR11 1A3KA 4IQPA 3SEPA 3S57A 4N43C 3PMSA 1RUG2 4QKNA 4WM7C 3I2KA 5GJ6A 1NQDA 4JRLA 3RZHA 2NLRA 4BQ5A 3AX4A 3POWA 1H1AA 4N43A 1LRHA 2TEPA 2DVAA 2RDNA 2VBDA 3AC0A 4MGIE 4W6YA 1FPN2 1QJX2 1S0DA 1GOHA 2B45X 3K77A 5SV5A 4INDA 1TVGA 1S0BA 2ETEA 4CCCA 1DGWX 5FXZA 3WEZA 1VMJA 4I01A 4AHWA 3DYOA 1BJQA 5ABJA 1PO21 1NKGA 2WNUB 1PZ8A 1D4M1 3VDDC 5K9YA 1AR91 1W03A 4IEXA 3I3BA 1W2AX 4MVTA 5KHHA 1HXS3 1LJ7A 1UZVA 1ENRA 3J7LA 3AP5A 1EPWA 3AKPA 3KCXA 1PMJX 3AYEA 2JG9B 1H30A 4MUVA 3ZXGA 1UKRA 1GNYA 1NLQA 3D3AA 2V73A 4IEWA 2RM22 5A1LA 2VOWA 5FOJB 4L92A 4CEWA 3D4KA 4DEQA 5JR2A 1RJ7A 3CL1A 3ZXJA 1DG6A 3AL6A 3ZLIA 3SCHA 2DV9A 5H9QA 1W6OA 3BODA 5EHDA 4FSJA 1OT5A 1AVBA 2QVSB 4ZY9A 3WF2A 4S2HA 3FHIB 3K3NA 4JCKA 1Z7S2 3SMHA 4COUA 2RJLA 4META 2BWAA 3LOIA 4FP3A 4XCBA 3UESA 3A22A 4IE5A 1FYUA 3I3EA 4Q4V3 4IETA 4XTPA 4QKDA 3C7GA 2Q8OA 2BV4A 4XURA 2D40A 3WDUA 4C0BA 3HWJA 1S2EA 2Y6KA 3POYA 1WCSA 3GCWA 3MW3A 4PIZA 4GWNA 4WZFA 5BNPA 2R0FA 5I0TA 1COV3 1AL0G 3ZXKA 1CZSA 5DG1A 2E32A 3KB5A 3KSCA 3VDDB 5ANNA 2NPIA 1GP5A 5JXJA 5FUIA 1W6QA 1FAYA 3LOBA 5FY8A 2ARBA 1XNKA 3KV9A 4YRDA 3VBSC 2R49A 5FMBA 4YYOA 3AKQA 4HK9A 4CDQB 3QACA 3RRDA 2GN7A 1LULA 1JN2P 2HWF2 4IGPA 3PUQA 3WNOA 1UMHA 3ZIXA 1CGPA 1BVVA 1COV1 1IHMA 1SLIA 2WIIB 3P3NA 1VLNA 1D4VB 1VAMA 2GALA 4TZDA 1Q43A 3VBRC 2YBPA 2WN2A 3N9MA 1CWPA 4HL0A 3EYPA 4Q4V1 2JDNA 2RM23 3GZUC 3RPQA 1HB4A 4I09A 3DKQA 1UN1A 3GM8A 4CYDA 3H7YA 2WDBA 1DQ4A 2XKOA 1UOGA 4Q0UA 4TLFA 1LEMA 2PN5A 3DECA 2O1QA 4AEDB 1LOFA 2JE7A 1EV13 3I2DA 5C3OA 2D6OX 1OLQA 2GP5A 2ADEA 1YHFA 1DQ1A 3POSA 5IVYA 2EF6A 5I0UA 2P5BA 3EHKA 1DHKB 4IEOA 1FNYA 3LZZA 1FV3A 2ZEZA 2J1SA 1W8UA 2Z2SB 5LBCA 4ET7A 1OQDA 3R0RA 1OA4A 5A3MA 1G9CA 3A7QA 4AVTA 5J7MA 5JXGA 2CY6A 2AYHA 4DY5A 4OZOA 4JHZA 4QHOA 3KS7A 5T5JA 4BQ4A 1DYPA 2WO2A 1HX6A 3EJKA 2RM21 1BLZA 1V6NA 2JDPA 2IWGB 1G9BA 2YDEA 1UZ0A 1IG0A 2ZGLA 4WM8A 1U5IA 3ZYHA 2ERFA 1UY3A 1ZZCA 5A7NA 3HIFA 4IEVA 4Y24A 5HCBA 1RUG3 1PO12 3I2GA 1ZA7A 3AYAA 5KXDA 5CFCB 3WF0A 1NLRA 2CU5A 3IDBB 3WOGA 1MVEA 4QB2A 4AAPA 4CP9B 4AQSA 1H2KA 5DPNA 5FZ7A 3V0BA 2F4LA 3EBRA 3O12A 3WP5A 4AWDA 4K20A 3ABZA 3CZJA 4SBVA 5FO9B 2PHTA 3J7MA 2WUHA 4XFCA 4XFBA 4KG8A 3WXPA 1RHI2 1VBD1 1VB4A 5LZ6A 1PGL2 4WM7A 4H14A 1O8PA 4LHNA 4XE9A 2UURA 1UNBA 3FWEA 5J36A 4XC9A 3J8F3 1QU0A 1H2NA 3B01A 4RFRB 4IGOA 4HVQA 1XNTA 4D0QA 1BEV3 1WBFA 3KV4A 4PCRA 4YM0A 4BU2A 3DV8A 1RUD2 4XZPA 4B29A 2IXLA 1CESA 4XVHA 3J7HA 4YVWA 2VMIA 3MEPA 5AC91 2QQJA 5CKQA 3ME2A 1NQJA 1SLBA 3ETPA 2WFF2 1OFSA 1UU5A 5FUPA 5FZ1A 5A32B 2D3PA 2GC1A 4LJHA 4GD4A 4QDRA 1PK6B 2H6BA 4HMZA 5SV8A 3HJRA 1HV1A 3LGRA 1HRV3 5D2AA 1Q8PA 2GNMA 1G9FA 2YGMA 4P9YA 2Q4SA 3WHUA 2NMOA 2WQ8A 2HBUA 1KJLA 4KBBA 1PVXA 4IESA 4NRPA 1NT0A 3FBYA 1POQA 1RUF1 4NIAA 3T0DA 2Q5TA 1DLLA 3POIA 4PQQA 2WO1A 5CVRA 5FOBB 3VKOA 3O1RA 5FPZA 1KJRA 4A7KA 3I49A 2ZA9A 4UWDA 4YFZA 2EIEA 4YNIA 4QQLA 5DAQA 4FPGA 3TEXA 4A44A 3T2QA 1A8DA 3JD73 1D4M3 4LE4A 2BRTA 2R071 1PO23 2VOTA 1EAH1 3SKVA 2ORXA 2EXIA 3D0SA 4GWJA 3S5AA 2XJUA 1RMU2 3U75A 2W47A 2XLAA 2HWE3 3SQOA 4YW6A 2BFUS 5FKCA 2W52A 5DUVA 3RFRA 1I9RA 4FFFA 4IW3A 2P37A 4JGZB 3ZDSA 5IAXA 3NKGA 3T09A 1SLCA 3THDA 5T55A 1YEWA 4Q5OA 1S2BA 4JGYA 3HOBA 5JWPA 1QJZA 2VXJA 3OPTA 2QE3A 2WR9A 1TEIA 2UU8A 3ACGA 4GWMA 5GM0A 4XUNA 4B3NA 3ZMOA 5DABA 3LFMA 2YC4A 2QBXA 2VU9A 5A1FA 3WV6A 2OQ7A 3LE0A 3NAPC 1J1LA 2XGXA 4QPIC 3F95A 3WNNA 4XTMA 4YW5A 1CJDA 4YVSB 1EYBA 1NG0A 2BNOA 3VN4A 5JZGA 2QQMA 3D0JA 1FMD2 3O0VA 3O0XA 4D6SA 2BBVA 2R063 2EIDA 4ZHNA 1WW6A 4PIYA 2JENA 1RGSA 1RUH1 1QJEA 3RWKX 3ACHA 2ZHMA 4BISA 5ACA2 4GB32 2VNRA 4GIQA 2BYVE 2JDYA 3J8F1 4YM2A 5EJZB 5DMYA 5BUVA 2RJKA 5AVAA 4BQWA 4LBQA 3C8XA 4YZ1A 2WYSA 3N9QA 3AJZA 4CEYB 4FO9A 5JLVA 1OKOA 1BEV2 1W6PB 1J3PA 1YI7A 2WABA 3B3QE 3KT4A 4OHVA 3BIWE 5C4WA 3RJ2X 4Z2WA 1JZ7A 3VUOA 3VHNA 3M2MA 4B4RA 1DYOA 3ON7A 3ZO0B 2A6ZA 2Y38A 3GZEA 3VBFA 4BK5A 3W9AA 2JECA 2A1XA 3IM0A 1F2NA 1RUG1 3VDCA 4BQYA 1RHI3 2UYBA 4KNCA 4N7UA 1QOOA 1O6UA 5CZKA 1O5LA 5CYYA 1MEC2 1W2NA 2FDKA 1WD4A 4W4ZA 3MICA 2BQPA 4LA2A 4YPJA 1CIWA 1UX6A 3CU7A 2HWE2 4KGQA 5I0SA 4I2OA 3VKMA 1FX5A 2JWPA 1NLSA 4UW5A 3VZOA 4FBFA 2FMDA 1BCXA 2VE1A 4MGQA 5IVVA 1W9TA 3OUIA 3ZYFA 5IFPA 2VVEA 1LESA 2ZHLA 4XDQA 5LBFA 4BOWA 5K8SA 2Y6HA 1RUC1 4R8HA 1KDKA 4MGYE 3CIHA 3LQCA 2Y0OA 3ENRA 1SBDA 3H42B 2ARXA 2GC2A 2HJIA 2ZX1A 5GLTA 3NNJA 1HXS1 2XVGA 1GSLA 3P5BA 4RSUA 5EYXA 2JKXA 4PBOA 5FY5A 3WUDA 2FCUA 3ES1A 4H55A 3LSDA 5D21A 5CG9A 3H3ZA 4CXWA 1XBFA 3VBUA 4LOSA 3D82A 1LU1A 4JTOA 2JB8A 2JDKA 5FYMA 5FYYA 5CNAA 4H7LA 2VZPA 3FLRA 4DY3A 2ARAA 1IOAA 1YFYA 3MW4A 2UY9A 4CDXC 1Q8OA 4QPYA 2XJTA 3FFZA 4Y5SA 4EN6B 1AYN3 2BOJA 1ZRRA 3GNEA 4IE4A 4EWAA 1JXNA 2A3XA 4XF1A 1D7PM 3TWIA 4MO3M 2D43A 1NY72 4YZ4A 1REEA 4E27A 1AR83 3MIBA 1UXXX 2WYFA 2BNNA 1GZWB 1LKNA 2AREA 2GMMA 2K0GA 2Z79A 3LA7A 4BK4A 3N3HA 4C1XA 1UYXA 4ZPIA 5FO8B 3FX3A 4C1WA 2ZZJA 5IVEA 5LCWL 4CDWB 1GOGA 4RHV3 4RA0A 1G6NA 1MEC3 4AEJA 5IK5A 4MV2A 4F83A 3M1HA 5FP8A 1GMMA 1WCQA 4MG2A 3RNSA 1S0JA 1PO11 4Q4Y3 3N9PA 4IV1C 2IXHA 1DIWA 2MHFA 4ZU5A 2LW8A 4TYSA 3LIHA 3J7NA 1FOD2 4HN0A 5A80A 1K5JA 2WO7A 3R6SA 1COV2 2HWB2 3CBNA 5JI7A 3FC0A 3BI3A 4RGAA 4YW4A 2B39A 3WNPA 2XBO2 3HPNA 3R4UA 4Q4V2 3O14A 5ACA3 4KBZA 2VOVA 4LKDA 1X82A 2HYKA 1QDOA 2R062 3C7FA 3ST7A 1FMD3 1W3XA 1WCKA 4QXKA 2QJVA 4IV1A 1UPSA 3RYRA 3VZNA 1GP4A 1V6IA 4NWWA 4QPIB 3RMYA 5FYVA 4D7SA 1WGPA 4FFGA 4L11A 4GH4C 4AW7A 4Y4YA 4OCTA 3F2ZA 1TNFA 2NM1A 1IKQA 1REDA 1C8M3 3I2IA 4HVRA 4PIXA 4UF0A 3O0WA 4YG3A 3IPVA 5LEKA 5BYNA 3I3DA 4HXCA 1OPMA 1N1TA 4B8EA 1J83A 3GBFA 1AHSA 3ACIA 1EPZA 5C4WB 2JD9A 5GZCA 3VBHB 1C57A 2RS31 4LBMA 5IWFA 1BK0A 5E89A 3BB6A 3LDKA 2OKXA 1GWMA 1SACA 4B7KA 4BE3A 5KHGA 1V0AA 5DAPA 4CE8A 2GNBA 2CSGA 2FHRA 1LENA 1OA3A 2FZ2A 1DYKA 4UFMA 3RZGA 5F3EA 4IEUA 1HRV1 3SEEA 1AJOA 1XYPA 1XC6A 2W1UA 4K3UA 2QDNA 1W05A 4LO6B 4M0NA 1N3QA 3WLUA 4AVAA 2BW8A 2EA7A 4FAGA 4M01A 4YVSA 1YJKA 5BNNB 5C8WA 2Y26A 1S1AA 5JSPA 2C1FA 4K21A 4AXOA 3RSJA 4MHUA 3K4DA 4XOGA 1R082 3HNYM 3IKWA 1WMXA 2ZGSA 5I93A 5C9AC 1YQ6A 1W9WA 1V6KA 5L36A 1C1LA 1BEV1 1HV0A 3W5NA 4JGYB 5BY5A 4V2VA 3VKNA 1H0BA 3ZFGA 2RVAA 1HB2A 2IFRA 3KWVA 4AHYA 4ARXA 2WWUA 4MZUA 4LPLA 2ZGPA 1W8WA 3SNMA 1WLCA 3OG2A 2VG9A 5E6HA 1OPOA 3BGAA 4CCMA 1Z7S3 5A6ZA 2WFF1 3ZPYA 2VMHA 1UD1A 1CAXB 2Y60A 3I2JA 3H50A 4QU2A 5FYZA 2WNUC 5E16A 1ZYBA 2FQPA 3NWKA 1J3RA 5IUQA 4CCJA 2YV8A 4GMP0 5FP3A 3VHRA 3ZFFB 1MZFA 1POV1 2J42A 1TME1 5IK4A 1CD3G 5FPXA 4LT5A 1MVQA 5FZGA 3MGUA 3DXTA 3J8F2 4XMIA 4FXGB 3WDWA 1XYOA 1QHDA 1X8MA 3PJYA 4EYUA 1RUE3 1GYKA 1K12A 3O1OA 2FBEA 4FCAA 4LIVA 4X6RB 3ZKUA 1X7NA 4JDOA 4ASMB 5CFDB 4HKLA 1F4HA 4R4XA 3QH6A 3RI8A 3LEKA 1JYCA 1R1A1 3AYDA 5FY0A 3POGA 5A3NA 1OI6A 2N7GA 5FY1A 1W2OA 2VC9A 5FYCA 1N1VA 4PLMA 4EZ4A 3M7AA 2HKXA 2QQIA 4AG4A 1Q56A 1SFPA 1NA1A 2R072 2DVDA 2XJSA 1EV11 1YQ8A 3OTFA 1EAH2 1JBCA 1SG3A 4AQ6A 5FZ0A 5FZKA 1FNZA 4YVWB 4AZZA 4UFJA 1RB8G 1VB2A 2ZEWA 3LDBA 3SH3A 5IYYA 4A7YA 2V4VA 3AB0A 1SCSA 2VW0A 5BNNC 1W2UA 5A3PA 1O3SA 4O9GA 5FV3A 3LEGA 4O65A 4QKBA 5C8CB 1MS9A 2VUJA 4QQHA 2CHHA 2DVGA 2ZJCA 3B94A 1NUKA 1GU3A 3EMRA 1RTVA 3KVBA 3IB3A 2DDUA 2YZ4A 4O61A 2PQSA 4WM7B 4Z82A 5FWEA 2DBNA 5DDJ3 5F2WA 2VUDA 4GZ9A 1URXA 3BPSA 5I8TA 2C4XA 4OQ9A 4LKEA 3WG2A 4AI3A 4FPLA 4PQ9A 3AFKA 3K3OA 2DBIA 5FXWA 1X9PA 4DUVA 5KXEA 1WW5A 2X29A 4FPOB 1UXZA 4TWTA 4WM8B 3T4VA 1RUH3 1ODMA 4J1WA 2PAMA 5A3OA 2JIJA 3ZSEA 1LOCA 2YHJA 5EPAA 4XEZA 2LTNA 1JU4A 4A6SA 4EE2A 3ZMNA 1O8SA 2XBO1 2QUOA 2ZOEB 3GCXA 5GLUA 4CDWC 4FFHA 5JAXA 3FHQA 2HWF3 2RDSA 1YRZA 5J96B 2JG8A 1V6LA 1PZ9A 5HV0A 2WJSA 4KQ7A 2ZAHA 4EZHA 3O1SA 4Y22B 1PIV2 4UFIA 2X5IC 2QQOA 4UOJA 2PYTA 4M3CF 3VBOA 4URTA 3WP4A 4ZZ5A 5L7OB 2NMNA 2ILMA 5L9VA 4DRVA 2B4KA 1TME2 3E6DA 3FJSA 1OKQA 1B09A 2GN3A 2ORZA 2PHDA 4W8JA 1HJFA 4YARA 3OGSA 2HWE1 1QOTA 1SPPB 4MLOA 4Y1UA 2GU9A 2PLV1 2VW1A 4YW1A 4UW3A 2BTVC 3GJAA 4DMIA 5KR7A 1YNAA 3MF6A 2F6BA 4FOVA 1UL9A 4LHLA 2BGPA 2WSVA 4COWA 1W0NA 4IE6A 2OIIA 2XUMA 2OQ6A 3JD71 4MYEA 2LALA 4K1ZA 3KV5A 5FCCA 5J98B 1KFXL 2XB6C 4DEVA 1IKPA 1CAXA 1JW6A 3M3OA 2JDHA 5FLHA 1RUI1 3WG3A 1HIXA 1Q3EA 4PDWC 5F3CA 2DVFA 1WBLA 2C9AA 2RS12 4RFT0 2XQXA 3GF6A 4BMBA 3OGVA 3JB8A 2XUEA 3CHXA 3LEMA 1S0IA 1W6QB 2W39A 5I91A 2W08A 2VOXA 3B5LB 1OMIA 1ST8A 4JAAA 5C33A 1UPIA 1R081 3QCWA 5EQUA 1DZQA 4YW7A 3ZXDA 4QAWA 1MACA 3PURA 4X8PA 5T50A 1PNFA 2I45A 2W87A 3N9LA 4DNYA 2QQVA 2XJVA 3CQOA 3R4DB 2Y64A 1EUUA 2BNMA 2YBSA 3LAGA 1C8M2 4PBPA 3T30A 2V5DA 1DGRA 2YG0A 3DXUA 4BJ0A 2ATFA 5I0RA 2VZSA 3FUQA 5CISA 2ZMKA 1H1IA 2R30A 2DFBA 3LPGA 3OGGA 4AYUA 2D5HA 1GICA 5G05L 3PJQA 1YFUA 4XJ9A 3RMXA 3ZSMA 2XL7A 2IXJA 2R6QA 3C3VA 2A7AA 4PDWA 5FZAA 2HWD2 5C6CA 3JCIA 4NROA 4CEWB 3ZYGA 4DUXA 1X50A 2R7EB 4KU7A 2WO3A 3USUB 2I07B 2R16A 4AGGA 4ONUA 2HWB3 2QZ2A 4RS5A 2HWC2 3VBHA 4UT5A 2X05A 1CAVB 1JZ4A 4OZXA 1Q8VA 3T2OA 5JPMB 2W9XA 3VBSA 2VCAA 1LOAA 3NJXA 1VBC2 3ITQA 2A5ZA 3U1XA 4LHKA 5EP9A 4COZA 4BCUA 3VGIA 3CNAA 5FYSA 3OPZA 2VQ0A 4AI2A 1TMF2 5LY1A 1BBT2 5FP4A 1ZRCA 4QPIA 1YI9A 1GZTA 2CAUA 4RHV2 4E9KA 5A6YA 1OXCA 1VBB1 2A6VA 3MLJA 4TXWA 3A0KA 3S6PA 1GLHA 4M4PA 2LS6A 5IK7A 1R092 2VZTA 2VGDA 1DLCA 3RYKA 1QWRA 1VBE3 2ZX2A 1ASJ2 4XIOA 3VDBA 4N8MA 3KCYA 4W6WA 4PLOA 4D7TA 2QTWB 2D6MA 2XH6A 3KV6A 3ROUA 4BMEA 4DXTA 5FK7A 3JQWA 1IS6A 1C5HA 1WA6X 4QX8A 1FPN1 1QJX1 3FFQA 3GHNA 4QGNA 1RUJ1 4KG0A 2OPKA 4EN9B 1DDLA 1HLCA 2Y34A 3VBHC 1QGLA 3TNQA 2X10A 2GMEA 5AVPA 4E2QA 1W06A 4NIHA 5F5QA 2O8QA 3Q8AA 3LCPA 3AMQA 3I59A 3U78A 2IVJA 4YZ2A 4OI0A 1IGOA 1VP6A 5FAXA 5C3PA 4IUGA 3HQXA 2ZGQA 3ETQA 3RG0A 2A71A 4CDWA 2JE9A 3H1WA 4HKOA 4LLFA 4XAEA 4YZ5A 4OHWA 3SCGA 2JDMA 3IT8A 3KGZA 2OXBA 4Q4X3 2YROA 2B8MA 5IT6A 1R1A2 2NP0A 4WVMA 3FLPA 1AX0A 1ULPA 2VBPA 3KT1A 2PFWA 1RUC2 4JRAA 4LO7A 3TOJA 3RGBA 3ZKYA 4BQ1A 3BKZA 1UYPA 4GXLA 3NJVA 4NWVA 1YJLA 1SBFA 2ID4A 1K5MA 5ANQA 4MGZE 1MQTB 1V70A 1QOSA 1W28A 4MXWB 1RVF3 4UW4A 4LE3A 2BOIA 1J58A 2MPFA 4KH9A 2ZGRA 5I0DA 2RHPA 3USSA 1XYNA 5F37A 1G7YA 4W65A 2OUJA 2Y6GA 4C0HA 1O3QA 4XACA 2IUWA 3MIGA 4LQRA 3UJOA 2ZX4A 4LBLA 4QD2A 4AE2A 4UBHA 2VUAA 2A70A 1HRI2 3VZLA 2JX9A 2D6LX 4P9WA 4BM8A 4TN7A 3U14A 5JIUA 2LROA 1H8TC 4RQPB 3EO6A 4ZZ8A 4NPLA 3MIHA 2QZ3A 5T5PA 2VUCA 1H8TA 1OUSA 2UYAA 2WZ8A 1JOBA 2KA3A 3PU8A 1W8TA 2ZZQA 5JVVA 2VVDA 4CU8A 4GB33 3L9JT 3WW1A 1D0GA 1VRBA 3OOXA 4L8QA 5FZ4A 3OF1A 2CWSA 3IIAA 2YU2A 4ZU4A 1DQ6A 3AL5A 1WZXA 3LKJA 2NN8A 3I4IA 3QLQA 2B7YA 1KEXA 1ZZ9A 1X36A 4XF4A 3BTXA 4DINB 2W95A 4GA9A 4HOOA 4JVAA 2VL4A 4GKYA 4LBJA 4UFKA 1AR93 1ULFA 1PIV1 3LSEA 4LMFA 2DTYA 2BUKA 3VBFB 5KBFA 5L9BA 1QF3A 3OBAA 3T1LA 5GZEA 2Q8EA 4FTSA 4O7XA 2GC3A 4IERA 2VQUA 1IQAA 2FCTA 4GMP3 5HCAA 3SKJE 3GXUA 4A3ZA 3CJXA 3AP4A 3BU7A 4A41A 4XW3A 3MFAA 4P00B 1V9U1 1X33A 4LBQB 1MZ5A 4XJ8A 1NZCA 3NQHA 1HN0A 4G3YC 4QB1A 4QXBA 1Y4WA 4NIIA 1MQTC 3AKTA 4K1YA 3ZN5A 2NZ9A 2VZOA 4CCNA 3K48A 4IE0A 3CO2A 2RR13 4K6BA 5D8AA 4ASLA 4MXWA 1A78A 1E57A 2CGOA 5IHRA 3MUZ1 4OYUA 2A3YA 5HV4A 2P3JA 1DGLA 4HKWA 3MF9A 1P8JA 5A7WA 4MXVA 4Y4RA 1SFNA 2E7QA 2WS93 3C7OA 3FUOA 1MS4A 3JQXA 4WVMB 1W39A 1AR63 1JUHA 5EZWA 1AR73 4XQ4A 3SH4A 3NAPB 1JYTA 1NCQC 5EJ1B 3ZR6A 1CZTA 3CLPA 3KVAA 4KI5M 1OOPA 1QJY3 1VBC1 5A6QA 4RGKA 2YGLA 2D3RA 2JXAA 3PHMA 5DXDA 2P3IA 4F3JA 3FHAA 1S2KA 3O1PA 1W04A 2P6CA 3ZXFA 3WY6A 1QXJA 1GQHA 4V2WA 1CPMA 1O4YA 1BBT1 4JV4A 3POFA 2G4IA 3I97A 5DG2A 3RZKA 2JDZA 4WVWA 3VD3A 1IZ3A 5FZDA 2B42B 3K46A 4QGMA 5A1AA 2J7MA 4Q1PA 4FTEA 1OA2A 4Z2AA 1AF9A 1A8MA 1RUD3 2MEV3 4XFFA 5AC92 2AENA 3G7DA 4W50A 4OI4A 4OUSA 5LK5A 3BTAA 4XDOA 3TEZA 2W94A 4CCKA 1RL3A 1U12A 2PLV2 1E5HA 1JU3A 1QQP1 1OF4A 1T2XA 2ET7A 2RG4A 2ZPXA 4HFSA 4R9BA 4CDQC 4LLOA 3AXDA 3FBMA 2VZUA 3NV3A 5LBBA 4JGZC 1LOBA 1W8ZA 2G19A 2CTVA 2XXZA 3EXUA 4RD7A 4LHSA 3L2HA 5C3RA 2PHUA 4HETA 2B46X 1PK6A 3NJYA 3KHCA 3OEBA 2TBVA 2WFPA 4ZONA 5KC5A 1GZ9A 4AGRA 3HQRA 5BNOB 4ITCA 4XFHA 2PHFA 5DQ0A 3MV11 1L7LA 4QX2A 3MIEA 4LK6A 1CAVA 2WKKA 2RS11 4CEWC 4YLZA 3O7OA 2QCSB 2J1VA 1PMIA 1VBB2 5IVJA 5E1RA 3MIFA 4Q4W2 1QJU1 4BPZA 2QKDA 3AMHA 3ZFEA 4HZFA 4J6GA 4ISQA 1UCXA 1C28A 1Y7BA 3VL9A 4Y1XA 3B69A 3BN6A 3K75B 4FPHA 3K4ZA 2CDOA 2WQ4A 1FT9A 4PDWB 5LB6A 2FDFA 2JB4A 2MNGA 1AL21 1R093 2BERA 4XPVA 3T2PA 3V0AA 1XNCA 1VMHA 4WVVA 4NAOA 2E33A 5GZFA 2UWBA 3NNMA 4DXZA 5F9TA 5FZ9A 2BVBA 5JXHA 1I3HA 1VRH3 3QOPA 1EV12 3CZUA 1AYM1 3I7DA 3V0BB 3KMHA 5CEHA 4A42A 4FTBA 3ELNA 5IATA 3AZYA 3I8TA 5CG8A 3JB4C 5FXXA 5LEJA 2WN3A 1DGRN 3NV4A 2CDPA 4XABA 4CDXB 5F3GA 3AK0A 1S55A 3UGGA 5JDBA 1IS4A 1H4GA 3IAQA 3VZJA 3JU9A 2XHKA 4N53C 1O4ZA 5FPLA 3PMEA 5A3WA 3IDAA 3JBG1 2ZTNA 1QJFA 4CU9A 3NVCA 1C8NA 4DUWA 1FI2A 4JTNA 1BYHA 1NE4A 2W68A 1R1ZA 1H4HA 1QXPA 1NCRC 3DN7A 4M0HA 4XIKA 5AFEA 1W3VA 1JYWA 4H2AA 5FY4A 2R042 4E8CA 3AKRA 3HR9A 5DAXA 2WZR3 5C5UA 3GDBA 1ULGA 3ZR5A 4Y20B 3VDAA 4L97A 5IVCA 3OYWA 4RYDA 3PTYA 1XNDA 4FPEA 4CXXA 5FMDA 3BALA 1UYZA 2VJXA 4UI9L 2SBAA 2W91A 1CN1A 1SZBA 1SQ4A 2CWMA 2PXJA 2ZKNA 1U5XA 3ATGA 3HAGA 3ZOIA 1IG3A 1RUI2 1SPPA 5EWSA 1SLLA 4AI1A 3VD7A 5JI9A 4DQAA 1ZM1A 3OYWB 1GUIA 4Y20A 1WLWA 2Q0AA 4P9IA 5FXVA 2I2SA 4XILA 3O1UA 2FMYA 4Y5TA 1HRI1 2XHNA 4NO4A 1UW8A 3QD6A 4FQ4A 3A23A 1NZIA 3VBOB 5L7OA 3E5XA 3PUIA 4RN5A 2W46A 2YFZA 4Y22A 4CCOA 2RS51 3OGJA 4CCLA 4CDQA 3GZAA 2JG8B 4W6XA 3ZM8A 3NNLA 4Q0VA 2G9GA 2JDUA 3UV9A 1OHFA 1E5RA 1Q5OA
chains in the Genus database with same CATH topology
1UY2A 1ULOA 3DYPA 1GOFA 1YQ2A 1K12A 3CKHA 4M4RA 4CUBA 3DYMA 4HG6B 1F4HA 3LEKA 1JYNA 3T0BA 2VC9A 3OEAA 3SEPA 2QQIA 4AG4A 1JZ2A 4FI9A 3I2KA 1SG3A 1NX9A 2ZEWA 5IYYA 3AC0A 2ZXQA 2V4VA 1GOHA 3K77A 1TVGA 3LEGA 4OUEA 1RYYA 3WEZA 1NUKA 1GU3A 3DYOA 3NNGA 3IB3A 2DDUA 1NKGA 2PQSA 4BXSV 4GZ9A 4CUAA 2E26A 3I3BA 2C4XA 1TG7A 3WNMA 1UY0A 1PMJX 4DUVA 1UXZA 1GNYA 3D3AA 4CU6A 2J1AA 4DEQA 2XOMA 5JR2A 1JU4A 2J1UA 1O8SA 5LA2A 1LNSA 1OT5A 4ZY9A 3WF2A 2EIBA 2VQTA 3FHQA 2VMCA 1UY1A 3UESA 3A22A 3I3EA 4UOJA 2QQOA 3C7GA 4XURA 4ZZ5A 2Y6KA 3ECQA 3K4AA 1O59A 2B4KA 1CZSA 1JYXA 2E32A 2ORZA 4W8JA 3OGSA 3MV01 5JXJA 3NRUA 5FUIA 3WF1A 2C26A 3W5MA 2BGPA 1W0NA 4P5YA 5JMOA 1W99A 1R64A 3CMGA 2VCBA 4DEVA 1H6XA 3WNOA 1UMHA 1K42A 4QPWA 2BGOA 3FL7A 2WN2A 4PF1A 1UWWA 2XQXA 3EYPA 4PT6A 3OGVA 3GM8A 2WDBA 1F4AA 1UY4A 2VMEA 2RV9A 4A4AA 2VZ1A 4XUOA 3DECA 4QAWA 4ZXEA 1IQDC 2W87A 1I5PA 2VO5A 3CQOA 2DCKA 1EUUA 2Y64A 4BJ0A 2X09A 2V5DA 2YG0A 2VZSA 2ZEZA 2J1SA 2DCJA 4ET7A 3LPGA 1UYYA 3ACFA 2VM9A 5G05L 5DN2A 3A7QA 2QQLA 5JXGA 4JX0A 4LKSA 1UMIA 3IIIA 4JHZA 4OZOA 2WO2A 3GGLA 3OGRA 4DUXA 1UZ0A 2R7EB 2WO3A 1UY3A 1L7QA 1J84A 2Y6LA 3I2GA 4QDQA 3WF0A 2X05A 1JZ4A 2C9KA 3MBWA 1K3IA 4QB2A 3T2OA 2VR4A 5DPNA 2W9XA 2VCAA 3NJXA 4OMCA 2VCCA 2WBKA 3ABZA 3CZJA 1MPXA 1HN1A 3WF3A 2L9LA 2WUHA 2VMFA 2VZQA 5C71A 4D8MA 1SDDB 1O8PA 2YC2A 2VTFA 4TXWA 1XNTA 4M4PA 2LS6A 4D0QA 1JYVA 2VZTA 4E8DA 1DLCA 4XUQA 3VDBA 4XVHA 3J7HA 2YB7A 1US2A 2QQJA 4DXTA 1JZ6A 3ETPA 3PUHA 4QDRA 2X10A 5IJRA 3HNBM 1BHGA 3HJRA 1K45A 1KGYA 1PX3A 1WKYA 2WQ8A 4KMQA 4QDSA 5LA1A 5HXMA 4IUGA 5G04L 4L0PA 3T0DA 5B4NA 3OB8A 1CX1A 4PQQA 2WO1A 3JXSA 2HYXA 4XZUG 2EIEA 1ULPA 4A44A 3T2QA 4TTGA 2VOTA 3NJVA 1JZ3A 4P08A 2J1EA 3SKVA 3MO4A 2ID4A 2ORXA 1W9SA 4ARYA 2W1SA 4GWJA 4CU7A 4DXRA 2WAAA 2W47A 5I0DA 5EIYB 1DP0A 4XUTA 3T09A 3THDA 2Y6GA 3HOBA 4LQRA 3ACGA 3E1F1 4XUNA 1W8OA 2YC4A 4A45A 2QBXA 1XPWA 3LE0A 4JKMA 1OD3A 5B4XA 3WNNA 2Y6JA 4ZZ8A 3LEIA 2Z4FA 2QQMA 2WZ8A 2EIDA 1OH4A 4CU8A 3C7EA 3ACHA 3HEIA 5EJZB 5DMYA 3WNLA 3C8XA 2WYSA 2EICA 4QX0A 1KEXA 2WABA 2W95A 1JZ7A 2VL4A 4CVUA 5J1XA 1DYOA 3VD5A 4BK5A 3OBAA 3VDCA 3VD4A 3EB7A 2VQUA 2WZEA 3SKJE 3GXUA 3P6BA 4A3ZA 5CZKA 5CYYA 4A41A 1CZVA 1W8NA 4P00B 4W4ZA 4YPJA 1SHWB 3NQHA 3T08A 2VZ3A 4QB1A 1JZ5A 2VZOA 4UAPA 1CIYA 4MGQA 1W9TA 5IHRA 5IFPA 1JI6A 5JXIA 3MUZ1 3WSOA 4OYUA 2Y6HA 2ZEXA 4DXSA 3CIHA 3LQCA 1P8JA 1EUTA 2VZVA 5IFTA 3C7OA 5C7GA 3T0AA 2J22A 2JKXA 1L7RA 5EJ1B 1CZTA 4KI5M 5LA0A 1PMHX 3UETA 3FHAA 2BZDA 2VMDA 3I97A 4QB6A 2VZPA 3VD3A 3K46A 4XUPA 5A1AA 2HLEA 2J7MA 1D7PM 4MO3M 4Z2AA 4BDVB 3C7HA 4KWUA 2ZEYA 3VD9A 1UXXX 4GWIA 2XONA 4W50A 4BK4A 1GQPA 1UYXA 2W94A 5LCWL 1GOGA 2QQNA 3LPFA 1JU3A 1T2XA 1GMMA 1OF4A 3MUY1 1WCQA 2VZUA 1JHJA 4LHSA 2LW8A 1PX4A 2JE8A 3I2FA 3OEBA 2J1RA 3UNPA 3WQBA 2VZRA 5DQ0A 3MV11 4QX2A 1US3A 3WNPA 2W1WA 3HPNA 4P02B 2J1VA 2KD7A 1XNAA 3C7FA 4A6OA 4QX1A 5C70A 3I2HA 1OF3A 3BN6A 3K75B 4JKKA 1NAEA 3K4ZA 2CDOA 2BERA 4MOAA 3T2PA 3CDZB 2JDAA 3F2ZA 2E33A 3THCA 3I2IA 2W1QA 5JXHA 3I3DA 1JZ8A 3CZUA 4MGSA 1J83A 4A42A 3ACIA 2JD9A 5HPOA 4AAXA 3P1IA 2WN3A 3A21A 2OKXA 2CDPA 2W92A 3IAQA 4OMDA 4QX3A 3SEEA 3HNMA 1XC6A 2B9VA 2W1UA 3IDAA 4CU9A 4DUWA 4JKLA 2RJ2A 2YFUA 3WF4A 3IAPA 1JYWA 3K4DA 2WAOA 4CUCA 3HNYM 4E8CA 1W9WA 3GDBA 3VDAA 3W5NA 2W5FA 4RYDA 1UYZA 2VJXA 4UI9L 1H6YA 2RVAA 2W91A 3WNKA 3U37A 2BBAA 4ARXA 2QQKA 4LPLA 3VD7A 3HN3A 3OG2A 2V72A 1GUIA 3BGAA 5F7UA 1UX7A 4MADA 2Y8KA 3FN9A 2J1TA 2XHNA 3A23A 3PUIA 4RN5A 3I2JA 2W46A 2YFZA 2E31A 5JUVA 2W3JA 3ZM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UY2 A;  1ULO A;  3DYP A;  1GOF A;  1YQ2 A;  1K12 A;  3CKH A;  4M4R A;  4CUB A;  3DYM A;  4HG6 B;  1F4H A;  3LEK A;  1JYN A;  3T0B A;  2VC9 A;  3OEA A;  3SEP A;  2QQI A;  4AG4 A;  1JZ2 A;  4FI9 A;  3I2K A;  1SG3 A;  1NX9 A;  2ZEW A;  5IYY A;  3AC0 A;  2ZXQ A;  2V4V A;  1GOH A;  3K77 A;  1TVG A;  3LEG A;  4OUE A;  1RYY A;  3WEZ A;  1NUK A;  1GU3 A;  3DYO A;  3NNG A;  3IB3 A;  2DDU A;  1NKG A;  2PQS A;  4BXS V;  4GZ9 A;  4CUA A;  2E26 A;  3I3B A;  2C4X A;  1TG7 A;  3WNM A;  1UY0 A;  1PMJ X;  4DUV A;  1UXZ A;  1GNY A;  3D3A A;  4CU6 A;  2J1A A;  4DEQ A;  2XOM A;  5JR2 A;  1JU4 A;  2J1U A;  1O8S A;  5LA2 A;  1LNS A;  1OT5 A;  4ZY9 A;  3WF2 A;  2EIB A;  2VQT A;  3FHQ A;  2VMC A;  1UY1 A;  3UES A;  3A22 A;  3I3E A;  4UOJ A;  2QQO A;  3C7G A;  4XUR A;  4ZZ5 A;  2Y6K A;  3ECQ A;  3K4A A;  1O59 A;  2B4K A;  1CZS A;  1JYX A;  2E32 A;  2ORZ A;  4W8J A;  3OGS A;  3MV0 1;  5JXJ A;  3NRU A;  5FUI A;  3WF1 A;  2C26 A;  3W5M A;  2BGP A;  1W0N A;  4P5Y A;  5JMO A;  1W99 A;  1R64 A;  3CMG A;  2VCB A;  4DEV A;  1H6X A;  3WNO A;  1UMH A;  1K42 A;  4QPW A;  2BGO A;  3FL7 A;  2WN2 A;  4PF1 A;  1UWW A;  2XQX A;  3EYP A;  4PT6 A;  3OGV A;  3GM8 A;  2WDB A;  1F4A A;  1UY4 A;  2VME A;  2RV9 A;  4A4A A;  2VZ1 A;  4XUO A;  3DEC A;  4QAW A;  4ZXE A;  1IQD C;  2W87 A;  1I5P A;  2VO5 A;  3CQO A;  2DCK A;  1EUU A;  2Y64 A;  4BJ0 A;  2X09 A;  2V5D A;  2YG0 A;  2VZS A;  2ZEZ A;  2J1S A;  2DCJ A;  4ET7 A;  3LPG A;  1UYY A;  3ACF A;  2VM9 A;  5G05 L;  5DN2 A;  3A7Q A;  2QQL A;  5JXG A;  4JX0 A;  4LKS A;  1UMI A;  3III A;  4JHZ A;  4OZO A;  2WO2 A;  3GGL A;  3OGR A;  4DUX A;  1UZ0 A;  2R7E B;  2WO3 A;  1UY3 A;  1L7Q A;  1J84 A;  2Y6L A;  3I2G A;  4QDQ A;  3WF0 A;  2X05 A;  1JZ4 A;  2C9K A;  3MBW A;  1K3I A;  4QB2 A;  3T2O A;  2VR4 A;  5DPN A;  2W9X A;  2VCA A;  3NJX A;  4OMC A;  2VCC A;  2WBK A;  3ABZ A;  3CZJ A;  1MPX A;  1HN1 A;  3WF3 A;  2L9L A;  2WUH A;  2VMF A;  2VZQ A;  5C71 A;  4D8M A;  1SDD B;  1O8P A;  2YC2 A;  2VTF A;  4TXW A;  1XNT A;  4M4P A;  2LS6 A;  4D0Q A;  1JYV A;  2VZT A;  4E8D A;  1DLC A;  4XUQ A;  3VDB A;  4XVH A;  3J7H A;  2YB7 A;  1US2 A;  2QQJ A;  4DXT A;  1JZ6 A;  3ETP A;  3PUH A;  4QDR A;  2X10 A;  5IJR A;  3HNB M;  1BHG A;  3HJR A;  1K45 A;  1KGY A;  1PX3 A;  1WKY A;  2WQ8 A;  4KMQ A;  4QDS A;  5LA1 A;  5HXM A;  4IUG A;  5G04 L;  4L0P A;  3T0D A;  5B4N A;  3OB8 A;  1CX1 A;  4PQQ A;  2WO1 A;  3JXS A;  2HYX A;  4XZU G;  2EIE A;  1ULP A;  4A44 A;  3T2Q A;  4TTG A;  2VOT A;  3NJV A;  1JZ3 A;  4P08 A;  2J1E A;  3SKV A;  3MO4 A;  2ID4 A;  2ORX A;  1W9S A;  4ARY A;  2W1S A;  4GWJ A;  4CU7 A;  4DXR A;  2WAA A;  2W47 A;  5I0D A;  5EIY B;  1DP0 A;  4XUT A;  3T09 A;  3THD A;  2Y6G A;  3HOB A;  4LQR A;  3ACG A;  3E1F 1;  4XUN A;  1W8O A;  2YC4 A;  4A45 A;  2QBX A;  1XPW A;  3LE0 A;  4JKM A;  1OD3 A;  5B4X A;  3WNN A;  2Y6J A;  4ZZ8 A;  3LEI A;  2Z4F A;  2QQM A;  2WZ8 A;  2EID A;  1OH4 A;  4CU8 A;  3C7E A;  3ACH A;  3HEI A;  5EJZ B;  5DMY A;  3WNL A;  3C8X A;  2WYS A;  2EIC A;  4QX0 A;  1KEX A;  2WAB A;  2W95 A;  1JZ7 A;  2VL4 A;  4CVU A;  5J1X A;  1DYO A;  3VD5 A;  4BK5 A;  3OBA A;  3VDC A;  3VD4 A;  3EB7 A;  2VQU A;  2WZE A;  3SKJ E;  3GXU A;  3P6B A;  4A3Z A;  5CZK A;  5CYY A;  4A41 A;  1CZV A;  1W8N A;  4P00 B;  4W4Z A;  4YPJ A;  1SHW B;  3NQH A;  3T08 A;  2VZ3 A;  4QB1 A;  1JZ5 A;  2VZO A;  4UAP A;  1CIY A;  4MGQ A;  1W9T A;  5IHR A;  5IFP A;  1JI6 A;  5JXI A;  3MUZ 1;  3WSO A;  4OYU A;  2Y6H A;  2ZEX A;  4DXS A;  3CIH A;  3LQC A;  1P8J A;  1EUT A;  2VZV A;  5IFT A;  3C7O A;  5C7G A;  3T0A A;  2J22 A;  2JKX A;  1L7R A;  5EJ1 B;  1CZT A;  4KI5 M;  5LA0 A;  1PMH X;  3UET A;  3FHA A;  2BZD A;  2VMD A;  3I97 A;  4QB6 A;  2VZP A;  3VD3 A;  3K46 A;  4XUP A;  5A1A A;  2HLE A;  2J7M A;  1D7P M;  4MO3 M;  4Z2A A;  4BDV B;  3C7H A;  4KWU A;  2ZEY A;  3VD9 A;  1UXX X;  4GWI A;  2XON A;  4W50 A;  4BK4 A;  1GQP A;  1UYX A;  2W94 A;  5LCW L;  1GOG A;  2QQN A;  3LPF A;  1JU3 A;  1T2X A;  1GMM A;  1OF4 A;  3MUY 1;  1WCQ A;  2VZU A;  1JHJ A;  4LHS A;  2LW8 A;  1PX4 A;  2JE8 A;  3I2F A;  3OEB A;  2J1R A;  3UNP A;  3WQB A;  2VZR A;  5DQ0 A;  3MV1 1;  4QX2 A;  1US3 A;  3WNP A;  2W1W A;  3HPN A;  4P02 B;  2J1V A;  2KD7 A;  1XNA A;  3C7F A;  4A6O A;  4QX1 A;  5C70 A;  3I2H A;  1OF3 A;  3BN6 A;  3K75 B;  4JKK A;  1NAE A;  3K4Z A;  2CDO A;  2BER A;  4MOA A;  3T2P A;  3CDZ B;  2JDA A;  3F2Z A;  2E33 A;  3THC A;  3I2I A;  2W1Q A;  5JXH A;  3I3D A;  1JZ8 A;  3CZU A;  4MGS A;  1J83 A;  4A42 A;  3ACI A;  2JD9 A;  5HPO A;  4AAX A;  3P1I A;  2WN3 A;  3A21 A;  2OKX A;  2CDP A;  2W92 A;  3IAQ A;  4OMD A;  4QX3 A;  3SEE A;  3HNM A;  1XC6 A;  2B9V A;  2W1U A;  3IDA A;  4CU9 A;  4DUW A;  4JKL A;  2RJ2 A;  2YFU A;  3WF4 A;  3IAP A;  1JYW A;  3K4D A;  2WAO A;  4CUC A;  3HNY M;  4E8C A;  1W9W A;  3GDB A;  3VDA A;  3W5N A;  2W5F A;  4RYD A;  1UYZ A;  2VJX A;  4UI9 L;  1H6Y A;  2RVA A;  2W91 A;  3WNK A;  3U37 A;  2BBA A;  4ARX A;  2QQK A;  4LPL A;  3VD7 A;  3HN3 A;  3OG2 A;  2V72 A;  1GUI A;  3BGA A;  5F7U A;  1UX7 A;  4MAD A;  2Y8K A;  3FN9 A;  2J1T A;  2XHN A;  3A23 A;  3PUI A;  4RN5 A;  3I2J A;  2W46 A;  2YFZ A;  2E31 A;  5JUV A;  2W3J A;  3ZM8 A; 
#chains in the Genus database with same CATH topology
 1BZW A;  4Y3O A;  1UY2 A;  4Q4W 1;  1W0O A;  5FY9 A;  4XDP A;  3NKT A;  1PNG A;  1SDW A;  3ACL A;  2OVU A;  3E97 A;  5FPV A;  2XKP A;  4FOQ A;  3ALQ A;  2WA3 A;  1POV 0;  1PGW 2;  4HG6 B;  5J48 A;  5BNP B;  3WDV A;  4JQT A;  4UW6 A;  3T0B A;  4Q2F A;  2C0Z A;  4ORF A;  1SLA A;  1A6C A;  3OEA A;  5FBJ A;  1CQ9 A;  1JZ2 A;  4WVZ A;  1W9Y A;  5FZM A;  4FI9 A;  1YIP A;  2AC1 A;  5JPN B;  3PDQ A;  5J37 A;  4CA9 A;  3AVS A;  3M70 A;  1PIV 3;  3DPR C;  1RIN A;  2P4E A;  1V9U 2;  2UWA A;  3BUC A;  1YLL A;  5DAW A;  2ZS6 B;  3AMP A;  3H7J A;  5C8C A;  1M06 G;  4WV8 A;  3U11 A;  3ZFE B;  4OUE A;  4YGE A;  4NJ4 A;  1WME A;  4IEY A;  3BTZ A;  1VBD 2;  3MI8 A;  4CXY A;  3I54 A;  3NNG A;  2Z5W A;  1PGL 1;  3WZ1 A;  4N9H A;  3GBG A;  3SC7 X;  3TN9 2;  3POJ A;  4K7J A;  3RS6 A;  4FPF A;  2E26 A;  1GV9 A;  2ZAB A;  3WDT A;  4CUA A;  5DUU A;  4EN8 B;  5FP9 A;  4F7Z A;  5KWR A;  3E6C C;  4LA3 A;  3LWC A;  1GNH A;  1OSG A;  4FP2 A;  1F5F A;  2WNU A;  3I3M A;  4XAA A;  3TEW A;  1DF0 A;  3VZM A;  1FOD 1;  5DAV A;  4NOT A;  4BXF A;  1V6O A;  1SMV A;  4URA A;  2PHL A;  4CU6 A;  4Y1Z A;  4L99 A;  3U4S A;  2OPW A;  2XOM A;  1DFQ A;  3JBG 3;  3MLL A;  3ZX7 A;  4QGL A;  2J1U A;  4IV3 B;  1LNS A;  3OUJ A;  4NRM A;  4NPR A;  2YPJ A;  3SIS A;  1ZBE 2;  2VQT A;  1LTE A;  3ZFF A;  2VMC A;  5CB7 A;  4MHR A;  1DQ0 A;  2VEC A;  1PVC 1;  2WQZ C;  5FPA A;  1RUF 2;  5ABJ C;  4LO8 A;  5FUN A;  3SHR A;  1CON A;  3ECQ A;  5F39 A;  1O59 A;  2RS5 2;  3S7E A;  5C3S A;  1BXH A;  1N1S A;  3ASI A;  1TMF 1;  1DU3 D;  2XR4 A;  1UOB A;  4TLG A;  4AR2 A;  2DUO A;  3W59 A;  2WSU A;  5K0U B;  1HQN A;  3G6J B;  5FZH A;  3FMG A;  4H3W A;  2B5H A;  2C26 A;  5AFB A;  1OOP B;  2X53 S;  1RUN A;  1BKZ A;  1GR3 A;  2X5I B;  5C4W C;  1CAU B;  2RS3 2;  3NAP A;  4P5Y A;  5JMO A;  2V4A A;  4I3P A;  3CMG A;  2F4P A;  1QDC A;  2VCB A;  3MID A;  2AH2 A;  2Z69 A;  1H6X A;  1JOP A;  4AFA A;  4Y1Y A;  2OZJ A;  1WCD J;  4XFI A;  5A7W B;  2HH9 A;  2BGO A;  4LR4 A;  2WT1 A;  3CF6 E;  3FL7 A;  2MEV 2;  4NMI A;  1B35 C;  1LED A;  2BU9 A;  4QHB A;  3JBG 2;  2VMG A;  4PF1 A;  1UWW A;  4YM1 A;  3VBO C;  4PT6 A;  1I6X A;  1PVC 3;  5ERL A;  3V65 A;  3H8O A;  1EY2 A;  1DQ2 A;  2EXH A;  1G9A A;  1F4A A;  5DZF A;  1UY4 A;  2VME A;  4LK7 A;  4Q8L A;  2R04 1;  2R1D A;  4A4A A;  2PMW B;  1VBA 2;  3UKT A;  2PEL A;  3RDI A;  1VBE 1;  1IQD C;  1IS3 A;  1I5P A;  2WLQ A;  5A3U A;  5GZG A;  1AL2 2;  2P17 A;  2DCK A;  3ZFE C;  2X09 A;  3JZV A;  4QWN A;  3WW3 A;  4CSW A;  5ISL A;  3IMM A;  4KGG A;  4WZC A;  1LOF C;  5KC6 A;  4BB3 A;  3IWZ A;  4LIU A;  1J1T A;  2WNV C;  2DCJ A;  3KF5 A;  1NCQ B;  3M4F A;  1LHO A;  3HMY A;  2ZML A;  1APN A;  1AYM 2;  1UYY A;  3ACF A;  3FLT A;  4QPG B;  4UF0 B;  1SEF A;  2WS9 2;  2PHX A;  3MPB A;  4S2D A;  1Y43 B;  2R04 3;  4G4F A;  1QY4 A;  4YW3 A;  2I74 A;  5K7P A;  4JX0 A;  5DUX A;  4CRQ A;  1LR5 A;  1VE0 A;  1K5M C;  1UMI A;  1Y3T A;  4RGG A;  4D94 A;  4Z1V A;  5J09 A;  3VBR A;  4JHT A;  4HSL A;  4NHL A;  3LIG A;  3OGR A;  5JIA A;  4BIF A;  3DF0 A;  5A33 B;  2ET1 A;  1UZY A;  4ASK A;  4M3C E;  2Y6L A;  1BVP 1;  4QDQ A;  2VUL A;  4N7I A;  5HI0 A;  2XDV A;  4AVS A;  1IPS A;  3AMN A;  4XHB A;  4K9S A;  2C9K A;  3MBW A;  1EP0 A;  4ATE A;  5L19 A;  2EAL A;  2VR4 A;  3O5S A;  5JSO A;  4RQP A;  2OA2 A;  4BZ4 A;  5A70 A;  5FZ3 A;  3UK9 A;  1HN1 A;  1UIJ A;  1MZE A;  5HCF A;  4CDU B;  5C71 A;  2WNE A;  1GZC A;  2OYZ A;  3O1T A;  5GAL A;  4D8M A;  4MH0 E;  1AXK A;  1SDD B;  1UMZ A;  3MPP G;  4QX5 A;  2YC2 A;  5D1I A;  1YQC A;  4AVV A;  5C8C C;  2VTF A;  1AR9 2;  1QXR A;  3RZZ A;  3M3C A;  1OH3 A;  3URF A;  5FLI A;  1O7F A;  1XNB A;  1XSQ A;  1GP6 A;  4E8D A;  5GLW A;  2DU1 A;  4A2U A;  2VY0 A;  4QXH A;  4CCD A;  2YB7 A;  1PZ7 A;  1US2 A;  3BYW A;  2V09 A;  4O9E A;  4CP0 A;  2RMU 3;  1MQT A;  1WLT A;  2A6Y A;  3FZ3 A;  4R9A A;  4LKF A;  2HEW F;  1ZBA 2;  1JMU B;  2K46 A;  1YCI A;  5IJR A;  4GMP 1;  3ZFG C;  1RUI 3;  5CFD C;  3DGT A;  4XF9 A;  3WCR A;  5CKN A;  1ND3 C;  1JOJ A;  1UZW A;  1OQE A;  1PX3 A;  1WKY A;  1WMD A;  2DUR A;  4AOC A;  4HPK B;  1HRI 3;  2PHR A;  4LXL A;  4CTE A;  1J3Q A;  5HXM A;  1QKQ A;  4M3C A;  3H3L A;  4HK8 A;  4WBB A;  5G04 L;  2PA7 A;  4Y26 A;  4L0P A;  2HEY F;  4OHX A;  3K51 A;  5B4N A;  2IXI A;  3OB8 A;  4FOY A;  4Q4Y 2;  4MGK E;  1YO8 A;  3Q8B A;  4LUL A;  2HYX A;  3OCP A;  2PLV 3;  3PU3 A;  4MSV A;  3I59 B;  4OUL A;  3W58 A;  2WIN B;  1LHV A;  4Q27 A;  4AFC A;  5APA A;  2YU1 A;  1FAT A;  2JG9 C;  2ZGN A;  1UU4 A;  4AEM A;  1JZ3 A;  2WWJ A;  4YGC A;  1RVF 2;  3CJI A;  1OBN A;  3A4U A;  4HSJ A;  4YG6 A;  3U07 A;  1E5I A;  1JH5 A;  1RUO A;  5C5T A;  5JR7 B;  3N7J A;  1XQN A;  4CEY C;  4CU7 A;  4DXR A;  1OQ1 A;  2WAA A;  1AYN 2;  4HAN A;  5FYT A;  3WUC A;  3NV2 A;  3CJI C;  3ILN A;  4K40 A;  3RYP A;  1DP0 A;  5KHJ A;  1VJ2 A;  4XUT A;  3UL2 A;  1Y9M A;  1W6M B;  3VKL A;  2IXK A;  4YZ3 A;  1IPJ A;  1LOG A;  2JEM A;  2QQU A;  4XQD A;  1W8O A;  3WVJ A;  4BHP A;  3NV1 A;  5JOY A;  1XPW A;  3KD4 A;  2KM2 A;  2WC2 A;  4JKM A;  1OD3 A;  2D5F A;  1AR6 2;  2FDG A;  1A34 A;  2OX0 A;  2Y6J A;  4IGQ A;  3VBS B;  4ZU7 A;  1Z78 A;  2Z4F A;  2E7A A;  4R4Z A;  4JDM A;  2VD7 A;  1VRH 1;  5K4L A;  1ZBA 3;  5F3I A;  5KHI A;  4RS5 B;  4CEY A;  2RMU 2;  2ZBJ A;  5L73 A;  3USU A;  1NOV A;  3WNL A;  4Q4X 1;  5BNP C;  4A3X A;  1HQW A;  3MLK A;  4K8F A;  5F32 A;  3N7L A;  3W20 A;  4YVS C;  1PK6 C;  1MS3 A;  5C9A B;  1ASJ 3;  2XLF A;  2EIC A;  2Y0I A;  4QX0 A;  1T6G C;  5F8P A;  1LOE A;  1ZZB A;  2DCZ A;  2VH9 A;  4P14 A;  3TAY A;  3ZXE A;  4AHX A;  1OLM E;  1HKD A;  5EJ3 A;  1KS4 A;  2IVI B;  2VOK A;  1TMF 3;  1N1Y A;  4GH4 B;  4IV3 C;  4ISR A;  3MW2 A;  1SCR A;  4L2N A;  1N47 A;  3EB7 A;  4L9B A;  2WZE A;  1ZRI A;  4YW2 A;  3E5U A;  5FYB A;  1V00 A;  3OBZ A;  4E2S A;  1KXG A;  1CZV A;  1W8N A;  1X8E A;  4XXA A;  3RWN A;  2TUN A;  5FQ0 B;  1N3O A;  5FIX A;  1QJU 2;  4NVP A;  4DFS A;  5JOX A;  2CYF A;  4YWA A;  2OT7 A;  4COV A;  4AK3 A;  2HWC 3;  4JGZ A;  1NYW A;  4R9D A;  2VBB A;  3OSD A;  2DUP A;  1MS5 A;  1QQP 3;  1D2Q A;  4X6Q B;  3B00 A;  1OFN A;  1T6B X;  5IW0 A;  3ZXL A;  2HWD 1;  2HWD 3;  5JXI A;  2OUH A;  3SCF A;  2AEY A;  2ZGU A;  3WSO A;  4CCE A;  5F1R A;  2WT2 A;  5KHK A;  4DXS A;  1KQR A;  4OI2 A;  1XE8 A;  2MEV 1;  2D6N A;  1YIF A;  3KT7 A;  3PNA A;  2HWC 1;  4EJR A;  4QQP A;  5FBZ A;  3LD8 A;  3V64 A;  4U36 A;  3VLB B;  1S0G A;  1GNZ A;  2J22 A;  2QQW A;  1KS5 A;  4OQ8 A;  3ZSL A;  4V1P A;  4QU1 A;  3M8L A;  4AVB A;  4OLL A;  3ZPO A;  5LA0 A;  5LAS A;  4B1L A;  5GLV A;  1OVS A;  2VXR A;  2BZD A;  4E4H A;  1KIT A;  5F5C A;  2ZGK A;  3WQ1 A;  4Q8K A;  2VMD A;  2G9F A;  1UF2 C;  4QB6 A;  4BQ2 A;  1V6M A;  2EIG A;  2ADD A;  2IZW A;  5BNQ A;  4XUP A;  2VW2 A;  1PVC 2;  3WIN E;  3SH5 A;  5LW9 A;  1ASJ 1;  2VTX J;  4QQ2 A;  5FMO S;  3VD9 A;  1S0E A;  5GLZ A;  2GSY A;  1XXN A;  3VHO A;  2ZHN A;  3UKN A;  4E2G A;  1QJU 3;  4AI0 A;  1ZVF A;  4HON A;  4YG0 A;  1ZZ7 A;  5EV7 A;  3LPF A;  4LTA A;  4Y1V A;  4XJW A;  5T3N A;  3MUY 1;  4Q4X 2;  4H7M A;  5DZE A;  3VB9 A;  4CDU C;  1W90 A;  1OD5 A;  4C8D A;  1ALY A;  5CA6 A;  3K2O A;  1PX4 A;  1S0F A;  3PUS A;  3WDX A;  1H2M A;  1F8V A;  4FPY A;  1RJ8 A;  3VBU C;  3TB0 A;  3I2F A;  2J1R A;  3U10 A;  1DBN A;  4P9X A;  1ENX A;  2VZR A;  4QKF A;  2GH8 A;  2Z42 A;  1U5Z A;  5A6X A;  2DTW A;  2RS5 3;  2H6C A;  4CP9 A;  3PVO A;  3KLS A;  3TN9 1;  1C3H A;  2A75 A;  2A6W A;  4P02 B;  1I1E A;  4AF9 A;  1ZRF A;  4LO4 B;  4RR3 A;  5I8S A;  1XNA A;  2FDI A;  4XHX A;  4JDN A;  1O3R A;  4A6O A;  1ZBE 3;  1LGN A;  3PIJ A;  3ZYR A;  5FQ0 A;  2GNT A;  1C5I A;  2K2S A;  2D6P A;  1NAE A;  1VBA 1;  1YC6 1;  4JKK A;  5T5L A;  1ZRE A;  3JUU A;  2E53 A;  4MOA A;  4QPG C;  4AI8 A;  2TNF A;  4CUG A;  2JDA A;  3ZN4 A;  2BGC A;  5ACA 1;  1ULD A;  4XXP A;  1Q8Q A;  1NA1 B;  1JZ8 A;  2QFE A;  1O91 A;  2P34 A;  2AUY A;  3TYJ A;  4Q26 A;  5FZI A;  1H9P A;  3SLI A;  1VBA 3;  5HPO A;  4CZS A;  1TE1 B;  3MYX A;  3PVE A;  1ACC A;  1D0H A;  1ZBE 1;  1PM4 A;  4OVE A;  1F31 A;  5C9A A;  3A21 A;  5CFD A;  2W92 A;  4RL7 A;  1UO9 A;  4BYY A;  4AED A;  2HWF 1;  4ES9 A;  3H1M A;  2KR2 A;  3TN9 3;  5BXX A;  1Y9G A;  1B35 B;  4QM8 A;  1PO1 3;  3HNM A;  3HQU A;  2B9V A;  4AFB A;  1YQ5 A;  1MEC 1;  3ILR A;  4I0W B;  5FYI A;  5F6L B;  2RMU 1;  4FT8 A;  2YFU A;  3AXE A;  3IAP A;  2YBK A;  4AEK A;  1HW5 A;  4LBN A;  1RVF 1;  4UFH A;  2WAO A;  3AKS A;  2K9Z A;  3AJY A;  2VNV A;  4XET A;  1QH7 A;  2DU0 A;  2WA4 A;  4JZR A;  5M0T A;  5JZG C;  2C24 A;  4GUL A;  1U0A A;  1ZX5 A;  1WCU A;  2EXJ A;  4GAZ A;  1H6Y A;  1YUD A;  3HN1 A;  3T3Y A;  4AFD A;  5A3L A;  4Z8B A;  3HBK A;  3U37 A;  2BBA A;  4IEQ A;  3ZFG B;  2CNA A;  1GBG A;  4LNV A;  3BCW A;  3HN3 A;  4IXL A;  2FD8 A;  2V72 A;  3A0N A;  2CAV A;  2H0B A;  1WD3 A;  4JGY C;  4MAD A;  2J1T A;  4XBQ A;  4MX3 A;  2O8O A;  5EFU A;  3GAL A;  3WT3 A;  1ONA A;  4XYX A;  4DB5 A;  2W0X A;  5BNN A;  5JUV A;  1JOD A;  2W3J A;  1XE0 A;  3BPZ A;  3ZYP A;  4E4S A;  2W2I A;  3E6B A;  3FE5 A;  4R9C A;  3POE A;  3WCS A;  1W6O B;  1X9T A;  4N90 A;  2P1B A;  4PI2 A;  4KU8 A;  5L9R A;  3T4H B;  5JSR A;  4I02 A;  4ZS2 A;  3DYP A;  1JYI A;  2ZKL A;  2DUQ A;  3DPR B;  1YQ2 A;  4BQX A;  4M4R A;  3LB9 A;  4CUB A;  3WD5 A;  4KWL A;  4HPK A;  4N53 A;  3UT0 A;  3X29 B;  3E5Q A;  2VVF A;  5C3Q A;  5FWJ A;  1LEC A;  2GZW A;  4XJA A;  5FZ8 A;  3HBZ A;  1TME 3;  3V56 A;  1TQ5 A;  4QQO A;  1ODN A;  3AZV A;  4HLT A;  5CU1 A;  2XLG A;  3IPV B;  3AZW A;  2WZR 2;  2YPD A;  4FQZ A;  4BIO A;  5B2G B;  3U4X A;  4ZS3 A;  3B93 A;  1NX9 A;  3BU0 A;  4NID A;  4IEZ A;  3HD8 B;  1GFF 2;  3S30 A;  4LOR A;  2ZXQ A;  3H8U A;  1RIT A;  1YFW A;  4I3G A;  5LWB A;  4IV1 B;  5JCT A;  2QNK A;  1F35 A;  3AFG A;  1AUY A;  1RYY A;  1OUX A;  3KM5 A;  1ND3 B;  5BPX A;  4AQT A;  4PJY A;  1SFY A;  1AYM 3;  4Y5Z 0;  2Q1Z B;  3OUH A;  2ZMN A;  2YY1 A;  3RJR A;  3THP A;  5F5A A;  2GMP A;  4N43 B;  4BXS V;  3N9N A;  4XFG A;  4FAH A;  2V5Y A;  5HBA A;  4CDU A;  2D6K A;  3N7K A;  3BVC A;  3OJB A;  1FV2 A;  4QT6 A;  4XQW A;  1AR7 1;  4Z07 A;  1AL2 3;  1R09 1;  5FRE A;  2D7F A;  4AED C;  3PIG A;  4P9G A;  1TG7 A;  4ES8 A;  4QM9 A;  5LRS A;  3S7I A;  3WNM A;  4GAL A;  1UY0 A;  2FZ1 A;  2CL2 A;  1Z0H A;  4HT1 T;  4D6Q A;  2BWC A;  5LK7 B;  1OC1 A;  5FYU A;  5FTT C;  1ND3 A;  2D98 A;  5A33 A;  2DVB A;  5DDJ 2;  1BMV 1;  1ZBA 1;  2J1A A;  2P2K A;  2ZAA A;  1S4C A;  3VBR B;  1LAJ A;  1W8H A;  3AP9 A;  3Q8C A;  2JG8 C;  3NST A;  1KFU L;  3ZXA C;  3OY8 B;  1CJP A;  3J26 N;  3KGL A;  5LA2 A;  4OHZ A;  3ZIW A;  2WL1 A;  3VBF C;  1CR7 A;  4AFM A;  1GZW A;  2EIB A;  5T5O A;  1W6N A;  5A3T A;  1AZD A;  3S5Q A;  1UKG A;  1UY1 A;  3D6E A;  4LUK A;  5DUW A;  4YSF A;  4UYB A;  4JC1 A;  4BH9 A;  1YXW A;  4LO5 B;  4NPM A;  3PTR B;  1REF A;  4KWK A;  5CIR A;  3C2U A;  5LAT A;  2AR6 A;  3K4A A;  5FZ6 A;  1EAH 3;  3VV1 A;  2E63 A;  1IS5 A;  4N53 B;  3DCQ A;  2NYY A;  3IDC B;  3H0O A;  4BLI A;  1JYX A;  3AM2 A;  1VAV A;  1FOD 3;  3DPR A;  3ZSK A;  3MV0 1;  2ZGO A;  2IC1 A;  3VBU B;  3NRU A;  3WF1 A;  1XB9 A;  4XCA A;  5FZB A;  3PVB B;  2A6X A;  1UOJ A;  2AAC A;  2YMZ A;  4B7E A;  5BNO C;  3WW4 A;  3W5M A;  1QEX A;  2AZ5 A;  3BOW A;  1G9D A;  2YC0 A;  3WG1 A;  1RUF 3;  1RUE 2;  1W99 A;  1R64 A;  4NUB A;  4DZG A;  3T2T A;  1HJG A;  3IZO A;  4AVC A;  3IBM A;  4LEJ A;  4TSV A;  1K42 A;  1U5Y A;  1W0P A;  4QPW A;  3POB A;  1AR8 2;  1MS1 A;  2GH2 A;  2R0H A;  1F9K A;  2HBT A;  1HQL A;  1OOP C;  3QBQ A;  3WW2 A;  2X5I A;  1TZO A;  5EXO A;  1OLR A;  1G8W A;  3B7M A;  1LB2 A;  2D93 A;  3VKF C;  3UGH A;  4FXK B;  2G9Z A;  1AR6 1;  2RV9 A;  5FJH A;  2ARC A;  3T1M A;  2BP6 A;  2VZ1 A;  4Q4Y 1;  4XUO A;  4ZXE A;  4FFI A;  1VRH 2;  2VO5 A;  2YYO A;  4B4P A;  4J25 A;  4NHK A;  5FR3 A;  5FZO B;  1GWL A;  2VTX A;  3ORJ A;  3VL8 A;  2DCT A;  4LBK A;  3NJZ A;  4EWE A;  4LBQ D;  2BFU L;  5F2S A;  2JKB A;  5LY2 A;  1AR7 2;  3VZK A;  3NO8 A;  2VM9 A;  1FXZ A;  1VBD 3;  5FFO C;  2WWS A;  5DN2 A;  2DF7 A;  1R08 3;  2QQL A;  2QQP A;  4XF0 A;  1AYN 1;  1DZR A;  1W6P A;  1AXY A;  3KHB A;  3R4S A;  4FPC A;  4IV3 A;  4LKS A;  4Q4W 3;  3III A;  5CKM A;  1V9U 3;  4GJY A;  1B35 A;  5LA9 A;  2RR1 2;  4GKX A;  2WNO A;  3GGL A;  4DS0 A;  5I8Y A;  3SXW A;  2R1B A;  1L7Q A;  1WMF A;  1J84 A;  5D8A C;  1O3T A;  5FRA A;  1MS8 A;  1O4T A;  3U0Z A;  1VR3 A;  4BWO A;  1WW7 A;  4IL7 A;  3DL3 A;  1ULC A;  5T54 A;  1G86 A;  1K3I A;  1ZA4 A;  5JZG B;  2ENR A;  2EXK A;  3PVN A;  2A3W A;  3WX5 A;  4OMC A;  4Q0S A;  2VCC A;  2WBK A;  1MPX A;  4OI1 A;  3WF3 A;  2L9L A;  2VMF A;  2VZQ A;  3N9O A;  1WUV A;  3N4M A;  1PGW 1;  3WQ0 A;  1NA1 C;  1M4W A;  5CAD A;  4EQV A;  5FY7 A;  5KXB A;  5TSW A;  1OUR A;  1JYV A;  4MGT A;  4R52 A;  1HB1 A;  2WZR 1;  4RR3 B;  4XUQ A;  3WDY A;  2XPJ A;  1NY7 1;  1CAW A;  3N35 A;  4HVO A;  4KWJ A;  1MR5 A;  2PTM A;  3WQ7 A;  1JZ6 A;  3LDR A;  3O1M A;  2DYC A;  3PUH A;  2OW4 A;  2WZP P;  5HCH A;  2XBO 3;  3HNB M;  3IMN A;  1BHG A;  1K45 A;  4XJU A;  1KGY A;  3BOP A;  3HT1 A;  1STM A;  1MS0 A;  1QJY 2;  1UAI A;  2X8K A;  3AP6 A;  4KMQ A;  4PF5 A;  2O0O A;  4QDS A;  5LA1 A;  2XWJ B;  4QX7 A;  4P5H A;  4XBL A;  5FK8 A;  5BV6 A;  3AP7 A;  4FVV A;  3OPW A;  3QH7 A;  1CX4 A;  4B4Q A;  5A7P A;  3J4U H;  4Z92 B;  1UU6 A;  2IFW A;  2IXC A;  2ZX3 A;  3M3Q A;  4XJZ A;  3RZL A;  1CX1 A;  4DIQ A;  1NCR B;  3JXS A;  1VAK A;  4JQR A;  1AX1 A;  4XZU G;  2FDJ A;  4D7Y A;  1VIW B;  4CPB D;  4WM8 C;  1GKB A;  5DDJ 1;  2R32 A;  4TTG A;  2R06 1;  1VAL A;  1QQP 2;  3B02 A;  4Q0P A;  1OLM A;  1C1F A;  2J1E A;  4P08 A;  3MO4 A;  5A32 A;  2PAK A;  3OBT A;  4NHM A;  1W9S A;  4ARY A;  2W1S A;  4E4Z A;  4DO0 A;  4PI0 A;  2OZ6 A;  4IE7 A;  5IAV A;  3DKW A;  2HEV F;  3JD7 2;  3LF7 A;  3L2Y A;  4AGV A;  4EWD A;  3D5O A;  4QMA A;  1BQP A;  2PAE A;  2AEZ A;  2CV6 A;  1GQG A;  5EIY B;  1GAN A;  2ZGT A;  3S0M A;  3OD4 A;  2D97 A;  1D2S A;  2Q1F A;  1WLD A;  2KXL A;  1ZNP A;  3NL1 A;  5CAZ A;  1KD7 A;  3R05 A;  2Q8D A;  4EN0 A;  5LBE A;  3I2O A;  3E1F 1;  1YFX A;  4D69 A;  1RUJ 3;  1XE7 A;  1DCS A;  1ND2 A;  4A45 A;  5F6K A;  2BDR A;  3KCC A;  3WG4 A;  4KL1 A;  1GWK A;  1NXM A;  3M3I A;  4Y33 A;  3ZSJ A;  5B4X A;  3I3Q A;  4B1M A;  5JOZ A;  2EAA A;  3AVR A;  1HRV 2;  3LEI A;  4A7Z A;  4IEP A;  3W21 A;  2JIG A;  3ZYJ B;  3ZN6 A;  2JIC A;  1RUE 1;  5CFC A;  1OH4 A;  2RDQ A;  1V6J A;  3C7E A;  4G9S B;  4P9J A;  3RQ0 A;  1VBB 3;  2P3Y A;  3HEI A;  1QIQ A;  1BMV 2;  1POV 3;  4NHX A;  2BPA 2;  1KDM A;  2VQA A;  4CDX A;  3RZJ A;  2XVL A;  1RUD 1;  3GYD A;  3OD0 A;  4I30 A;  3UYJ A;  2XJR A;  2D44 A;  2D3S A;  2O14 A;  1Q8S A;  5FZE A;  1XOY A;  4FPK A;  4NHY A;  5FO7 B;  3NMB A;  4ATF A;  5IVF A;  3ZN6 B;  4CVU A;  2CGP A;  4GH4 A;  4LIT A;  3Q8F A;  5FJK A;  5J1X A;  5IK8 A;  3VD5 A;  1WWY A;  4OFG A;  1UOF A;  1BBT 3;  3KZ4 C;  2VAU A;  1LU2 A;  3TRS B;  1TNR A;  1LHU A;  3VD4 A;  2E9Q A;  3IN9 A;  1W9F A;  4Q0Q A;  5GKA C;  1ND2 B;  1PHM A;  5H9P A;  3V0A B;  1E5S A;  2VNG A;  3P6B A;  5F5I A;  4Q29 A;  3WNX A;  1QJY 1;  1VBC 3;  3B9I A;  4EN7 B;  1AX2 A;  2VCM A;  3AZZ A;  2C6S A;  5FDB A;  1SHW B;  3AYC A;  5FZL A;  2E6V A;  1DQ5 A;  2A73 B;  4J1X A;  3T08 A;  5AC9 3;  2VZ3 A;  1JZ5 A;  2WS9 1;  3CEW A;  3D8C A;  4GJZ A;  4UAP A;  3ZYB A;  4XBN A;  2E7T A;  1SBE A;  2CGN A;  4LBO A;  1CIY A;  3APB A;  4D6R A;  3H9A A;  4AL9 A;  1YWK A;  3WHT A;  4CP1 A;  4C91 A;  1JI6 A;  3AMM A;  5BNO A;  4OUM A;  2F17 A;  2LM3 A;  2ZEX A;  4LOT A;  4HN1 A;  1XRU A;  1AR8 1;  1SLT A;  3KQ4 B;  3N7M A;  4M00 A;  4K8R B;  4QXC A;  4XMA A;  1EUT A;  5T52 A;  3TEY A;  2VZV A;  5FZF A;  1W8F A;  2PQQ A;  4DRR A;  3LA3 A;  5IFT A;  1F5J A;  1J59 A;  5C7G A;  4YGB A;  3T0A A;  2DWR A;  3INA A;  4HBN A;  1W6M A;  1NCR A;  1L7R A;  3B9C A;  4DPN A;  1XSR A;  2ES3 A;  3HT2 A;  5A7O A;  1RUJ 2;  4LUM A;  2ZX0 A;  1UQX A;  4NRQ A;  2XL9 A;  1PMH X;  5H9S A;  1ENQ A;  3UET A;  3BIE A;  3N36 A;  4F8A A;  2E51 A;  3WP6 A;  1RXF A;  3VDD A;  4D3W A;  2AGS A;  2PHW A;  4COY A;  2EVX A;  2ZCW A;  1QMJ A;  4S2G A;  4RS5 C;  5DZG A;  1F15 A;  1DZT A;  1RXG A;  3CJI B;  4AQ2 A;  5FKB A;  3ZDV A;  2HLE A;  3RI9 A;  4IDZ A;  2B9U A;  1UZZ A;  4BDV B;  1NXD 1;  1W2T A;  2P6H A;  3C7H A;  4KWU A;  3KQR A;  4RR3 C;  2ZEY A;  1DGW A;  3J9S A;  5HXV A;  1FMD 1;  4GWI A;  1PO2 2;  2XON A;  2OS2 A;  1D4M 2;  3THT A;  1GQP A;  3GHM A;  1CAW B;  1MZ6 A;  3UGF A;  3P3P A;  2QQN A;  2WT0 A;  3M3E A;  4GB3 1;  3ZYI B;  3ZFF C;  1XU2 A;  3TNP B;  3PLQ A;  3DUI A;  4M3C B;  1VMF A;  2Q8C A;  5KXC A;  2VNO A;  5FYH A;  1RIR A;  1JHJ A;  3AZX A;  2QDR A;  2JG9 A;  4I0A A;  4BLJ A;  1RMU 1;  4OHY A;  3H3U A;  1JTZ X;  3NW4 A;  4CP2 A;  2FDH A;  2ZHK A;  5FMC A;  2Q1M A;  1CPN A;  2JE8 A;  5K0U C;  2UWC A;  2FCV A;  3UNP A;  3WQB A;  1C4R A;  3Q9O A;  2LUW A;  1XJA A;  1RHI 1;  4PHZ A;  5D8A B;  2XJP A;  1US3 A;  3DEM A;  1VPH A;  4XF3 A;  3TBD A;  1S0C A;  2W1W A;  3WP3 A;  1RC6 A;  3UKV A;  5A7S A;  3MHZ A;  1QH6 A;  2BVV A;  4ZKT B;  1Z7S 1;  2KD7 A;  4NR1 A;  5ABJ B;  4SLI A;  4AI9 A;  4P9L A;  4U2A A;  4QX1 A;  5C70 A;  2VPV A;  2UY8 A;  3I2H A;  2YXS A;  1JHN A;  2G1M A;  1OF3 A;  3MFC A;  1LCL A;  5FMO L;  5IVB A;  3RZM A;  5FP7 A;  1O5U A;  1PM7 A;  2ZAC A;  2EAK A;  1ND2 C;  1WW4 A;  4FPJ A;  5EYY A;  2RDR A;  5FZC A;  4ERO A;  3H8X A;  4NIG A;  3PL0 A;  1L3J A;  3CDZ B;  4UBG A;  5JMC A;  4QHZ A;  1RUH 2;  1ENS A;  3THC A;  2GAU A;  4XFA A;  2BEO A;  5FPB A;  2W1Q A;  3WR0 A;  1QNY A;  2XJQ A;  2Q30 A;  1HB3 A;  4MGS A;  2JJ6 A;  2JD4 A;  1ZZ6 A;  3LA2 A;  5FZO A;  2GP3 A;  4AAX A;  5H9R A;  4C90 A;  1HXS 2;  3P1I A;  3ZVX A;  4AHZ A;  5CBL A;  2GDF A;  4Q1R A;  4I0B A;  3UJQ A;  5CFC C;  1UIK A;  1RMU 3;  2RS1 3;  4OMD A;  4QX3 A;  4NN0 A;  1H8V A;  2WRA A;  2XVK A;  3H8R A;  5JOW A;  2XWB B;  3ES4 A;  3MZH A;  3MDP A;  1H1M A;  4NE9 A;  5J3U A;  2SLI A;  1LGC A;  1H8T B;  3GBW A;  4RQP C;  4S2F A;  5LRR A;  1RUC 3;  5A7Q A;  4JKL A;  4FOW A;  2C5D A;  2NQY A;  2GND A;  2RJ2 A;  1FPN 3;  1QJX 3;  4ZXK A;  4PLN A;  2XQR A;  4QPG A;  1NCQ A;  1IPK A;  1R1A 3;  3WF4 A;  4BQ3 A;  2RE9 A;  2RS3 3;  1KRI A;  4CUC A;  2Y33 A;  3LFI A;  2DCY A;  1YYN A;  2LRP A;  5GZD A;  4DOU A;  1H9W A;  2R07 3;  5E8A A;  1OVP A;  2W5F A;  1C8M 1;  2WNV B;  3OBR A;  5E88 A;  4YFW A;  1LHW A;  1NE6 A;  1ULE A;  3WNK A;  1WA4 A;  2QQK A;  3ILF A;  3GZT B;  2DFC A;  1JUI A;  4E4D X;  1JS9 A;  1I5Z A;  2Y6F A;  3RVH A;  4NAM A;  1ZRD A;  5L7O C;  2WNV A;  2H0V A;  1AXZ A;  5F7U A;  1HDK A;  1K5M B;  1UX7 A;  1ZZ8 A;  2WFF 3;  2Y8K A;  3FN9 A;  1BK1 A;  3PUA A;  3Q8E A;  2XG3 A;  1N3P A;  5FPU A;  3VHP A;  2HWB 1;  3KF3 A;  2E31 A;  1VBE 2;  2ZGM A;  2GC0 A;  2WLP A;  3H1Y A;  3HVD A;  4X8N A;  1LHN A;  4YGD A;  1W6N B;  1CAU A;  2BJS A;  2YUE A;  1AJK A;  4UXA A;  1CVN A;  1XU1 A;  3OY8 A;  1H2L A;  5FLJ A;  4UFL A;  3GJB A;  1ULO A;  3SIT A;  1QNW A;  3IDE A;  5K0U A;  1GOF A;  4EV0 A;  3CKH A;  4YVW C;  2P3K A;  4BA6 A;  4CPB A;  1PGS A;  1Y9Q A;  3DYM A;  4YM3 A;  2XML A;  3NNF A;  1JYN A;  4N9I A;  4RHV 1;  3BTY A;  1LOD A;  3EQE A;  1LGB A;  3O1V A;  4GQ7 A;  2RR1 1;  1A3K A;  4IQP A;  3SEP A;  3S57 A;  4N43 C;  3PMS A;  1RUG 2;  4QKN A;  4WM7 C;  3I2K A;  5GJ6 A;  1NQD A;  4JRL A;  3RZH A;  2NLR A;  4BQ5 A;  3AX4 A;  3POW A;  1H1A A;  4N43 A;  1LRH A;  2TEP A;  2DVA A;  2RDN A;  2VBD A;  3AC0 A;  4MGI E;  4W6Y A;  1FPN 2;  1QJX 2;  1S0D A;  1GOH A;  2B45 X;  3K77 A;  5SV5 A;  4IND A;  1TVG A;  1S0B A;  2ETE A;  4CCC A;  1DGW X;  5FXZ A;  3WEZ A;  1VMJ A;  4I01 A;  4AHW A;  3DYO A;  1BJQ A;  5ABJ A;  1PO2 1;  1NKG A;  2WNU B;  1PZ8 A;  1D4M 1;  3VDD C;  5K9Y A;  1AR9 1;  1W03 A;  4IEX A;  3I3B A;  1W2A X;  4MVT A;  5KHH A;  1HXS 3;  1LJ7 A;  1UZV A;  1ENR A;  3J7L A;  3AP5 A;  1EPW A;  3AKP A;  3KCX A;  1PMJ X;  3AYE A;  2JG9 B;  1H30 A;  4MUV A;  3ZXG A;  1UKR A;  1GNY A;  1NLQ A;  3D3A A;  2V73 A;  4IEW A;  2RM2 2;  5A1L A;  2VOW A;  5FOJ B;  4L92 A;  4CEW A;  3D4K A;  4DEQ A;  5JR2 A;  1RJ7 A;  3CL1 A;  3ZXJ A;  1DG6 A;  3AL6 A;  3ZLI A;  3SCH A;  2DV9 A;  5H9Q A;  1W6O A;  3BOD A;  5EHD A;  4FSJ A;  1OT5 A;  1AVB A;  2QVS B;  4ZY9 A;  3WF2 A;  4S2H A;  3FHI B;  3K3N A;  4JCK A;  1Z7S 2;  3SMH A;  4COU A;  2RJL A;  4MET A;  2BWA A;  3LOI A;  4FP3 A;  4XCB A;  3UES A;  3A22 A;  4IE5 A;  1FYU A;  3I3E A;  4Q4V 3;  4IET A;  4XTP A;  4QKD A;  3C7G A;  2Q8O A;  2BV4 A;  4XUR A;  2D40 A;  3WDU A;  4C0B A;  3HWJ A;  1S2E A;  2Y6K A;  3POY A;  1WCS A;  3GCW A;  3MW3 A;  4PIZ A;  4GWN A;  4WZF A;  5BNP A;  2R0F A;  5I0T A;  1COV 3;  1AL0 G;  3ZXK A;  1CZS A;  5DG1 A;  2E32 A;  3KB5 A;  3KSC A;  3VDD B;  5ANN A;  2NPI A;  1GP5 A;  5JXJ A;  5FUI A;  1W6Q A;  1FAY A;  3LOB A;  5FY8 A;  2ARB A;  1XNK A;  3KV9 A;  4YRD A;  3VBS C;  2R49 A;  5FMB A;  4YYO A;  3AKQ A;  4HK9 A;  4CDQ B;  3QAC A;  3RRD A;  2GN7 A;  1LUL A;  1JN2 P;  2HWF 2;  4IGP A;  3PUQ A;  3WNO A;  1UMH A;  3ZIX A;  1CGP A;  1BVV A;  1COV 1;  1IHM A;  1SLI A;  2WII B;  3P3N A;  1VLN A;  1D4V B;  1VAM A;  2GAL A;  4TZD A;  1Q43 A;  3VBR C;  2YBP A;  2WN2 A;  3N9M A;  1CWP A;  4HL0 A;  3EYP A;  4Q4V 1;  2JDN A;  2RM2 3;  3GZU C;  3RPQ A;  1HB4 A;  4I09 A;  3DKQ A;  1UN1 A;  3GM8 A;  4CYD A;  3H7Y A;  2WDB A;  1DQ4 A;  2XKO A;  1UOG A;  4Q0U A;  4TLF A;  1LEM A;  2PN5 A;  3DEC A;  2O1Q A;  4AED B;  1LOF A;  2JE7 A;  1EV1 3;  3I2D A;  5C3O A;  2D6O X;  1OLQ A;  2GP5 A;  2ADE A;  1YHF A;  1DQ1 A;  3POS A;  5IVY A;  2EF6 A;  5I0U A;  2P5B A;  3EHK A;  1DHK B;  4IEO A;  1FNY A;  3LZZ A;  1FV3 A;  2ZEZ A;  2J1S A;  1W8U A;  2Z2S B;  5LBC A;  4ET7 A;  1OQD A;  3R0R A;  1OA4 A;  5A3M A;  1G9C A;  3A7Q A;  4AVT A;  5J7M A;  5JXG A;  2CY6 A;  2AYH A;  4DY5 A;  4OZO A;  4JHZ A;  4QHO A;  3KS7 A;  5T5J A;  4BQ4 A;  1DYP A;  2WO2 A;  1HX6 A;  3EJK A;  2RM2 1;  1BLZ A;  1V6N A;  2JDP A;  2IWG B;  1G9B A;  2YDE A;  1UZ0 A;  1IG0 A;  2ZGL A;  4WM8 A;  1U5I A;  3ZYH A;  2ERF A;  1UY3 A;  1ZZC A;  5A7N A;  3HIF A;  4IEV A;  4Y24 A;  5HCB A;  1RUG 3;  1PO1 2;  3I2G A;  1ZA7 A;  3AYA A;  5KXD A;  5CFC B;  3WF0 A;  1NLR A;  2CU5 A;  3IDB B;  3WOG A;  1MVE A;  4QB2 A;  4AAP A;  4CP9 B;  4AQS A;  1H2K A;  5DPN A;  5FZ7 A;  3V0B A;  2F4L A;  3EBR A;  3O12 A;  3WP5 A;  4AWD A;  4K20 A;  3ABZ A;  3CZJ A;  4SBV A;  5FO9 B;  2PHT A;  3J7M A;  2WUH A;  4XFC A;  4XFB A;  4KG8 A;  3WXP A;  1RHI 2;  1VBD 1;  1VB4 A;  5LZ6 A;  1PGL 2;  4WM7 A;  4H14 A;  1O8P A;  4LHN A;  4XE9 A;  2UUR A;  1UNB A;  3FWE A;  5J36 A;  4XC9 A;  3J8F 3;  1QU0 A;  1H2N A;  3B01 A;  4RFR B;  4IGO A;  4HVQ A;  1XNT A;  4D0Q A;  1BEV 3;  1WBF A;  3KV4 A;  4PCR A;  4YM0 A;  4BU2 A;  3DV8 A;  1RUD 2;  4XZP A;  4B29 A;  2IXL A;  1CES A;  4XVH A;  3J7H A;  4YVW A;  2VMI A;  3MEP A;  5AC9 1;  2QQJ A;  5CKQ A;  3ME2 A;  1NQJ A;  1SLB A;  3ETP A;  2WFF 2;  1OFS A;  1UU5 A;  5FUP A;  5FZ1 A;  5A32 B;  2D3P A;  2GC1 A;  4LJH A;  4GD4 A;  4QDR A;  1PK6 B;  2H6B A;  4HMZ A;  5SV8 A;  3HJR A;  1HV1 A;  3LGR A;  1HRV 3;  5D2A A;  1Q8P A;  2GNM A;  1G9F A;  2YGM A;  4P9Y A;  2Q4S A;  3WHU A;  2NMO A;  2WQ8 A;  2HBU A;  1KJL A;  4KBB A;  1PVX A;  4IES A;  4NRP A;  1NT0 A;  3FBY A;  1POQ A;  1RUF 1;  4NIA A;  3T0D A;  2Q5T A;  1DLL A;  3POI A;  4PQQ A;  2WO1 A;  5CVR A;  5FOB B;  3VKO A;  3O1R A;  5FPZ A;  1KJR A;  4A7K A;  3I49 A;  2ZA9 A;  4UWD A;  4YFZ A;  2EIE A;  4YNI A;  4QQL A;  5DAQ A;  4FPG A;  3TEX A;  4A44 A;  3T2Q A;  1A8D A;  3JD7 3;  1D4M 3;  4LE4 A;  2BRT A;  2R07 1;  1PO2 3;  2VOT A;  1EAH 1;  3SKV A;  2ORX A;  2EXI A;  3D0S A;  4GWJ A;  3S5A A;  2XJU A;  1RMU 2;  3U75 A;  2W47 A;  2XLA A;  2HWE 3;  3SQO A;  4YW6 A;  2BFU S;  5FKC A;  2W52 A;  5DUV A;  3RFR A;  1I9R A;  4FFF A;  4IW3 A;  2P37 A;  4JGZ B;  3ZDS A;  5IAX A;  3NKG A;  3T09 A;  1SLC A;  3THD A;  5T55 A;  1YEW A;  4Q5O A;  1S2B A;  4JGY A;  3HOB A;  5JWP A;  1QJZ A;  2VXJ A;  3OPT A;  2QE3 A;  2WR9 A;  1TEI A;  2UU8 A;  3ACG A;  4GWM A;  5GM0 A;  4XUN A;  4B3N A;  3ZMO A;  5DAB A;  3LFM A;  2YC4 A;  2QBX A;  2VU9 A;  5A1F A;  3WV6 A;  2OQ7 A;  3LE0 A;  3NAP C;  1J1L A;  2XGX A;  4QPI C;  3F95 A;  3WNN A;  4XTM A;  4YW5 A;  1CJD A;  4YVS B;  1EYB A;  1NG0 A;  2BNO A;  3VN4 A;  5JZG A;  2QQM A;  3D0J A;  1FMD 2;  3O0V A;  3O0X A;  4D6S A;  2BBV A;  2R06 3;  2EID A;  4ZHN A;  1WW6 A;  4PIY A;  2JEN A;  1RGS A;  1RUH 1;  1QJE A;  3RWK X;  3ACH A;  2ZHM A;  4BIS A;  5ACA 2;  4GB3 2;  2VNR A;  4GIQ A;  2BYV E;  2JDY A;  3J8F 1;  4YM2 A;  5EJZ B;  5DMY A;  5BUV A;  2RJK A;  5AVA A;  4BQW A;  4LBQ A;  3C8X A;  4YZ1 A;  2WYS A;  3N9Q A;  3AJZ A;  4CEY B;  4FO9 A;  5JLV A;  1OKO A;  1BEV 2;  1W6P B;  1J3P A;  1YI7 A;  2WAB A;  3B3Q E;  3KT4 A;  4OHV A;  3BIW E;  5C4W A;  3RJ2 X;  4Z2W A;  1JZ7 A;  3VUO A;  3VHN A;  3M2M A;  4B4R A;  1DYO A;  3ON7 A;  3ZO0 B;  2A6Z A;  2Y38 A;  3GZE A;  3VBF A;  4BK5 A;  3W9A A;  2JEC A;  2A1X A;  3IM0 A;  1F2N A;  1RUG 1;  3VDC A;  4BQY A;  1RHI 3;  2UYB A;  4KNC A;  4N7U A;  1QOO A;  1O6U A;  5CZK A;  1O5L A;  5CYY A;  1MEC 2;  1W2N A;  2FDK A;  1WD4 A;  4W4Z A;  3MIC A;  2BQP A;  4LA2 A;  4YPJ A;  1CIW A;  1UX6 A;  3CU7 A;  2HWE 2;  4KGQ A;  5I0S A;  4I2O A;  3VKM A;  1FX5 A;  2JWP A;  1NLS A;  4UW5 A;  3VZO A;  4FBF A;  2FMD A;  1BCX A;  2VE1 A;  4MGQ A;  5IVV A;  1W9T A;  3OUI A;  3ZYF A;  5IFP A;  2VVE A;  1LES A;  2ZHL A;  4XDQ A;  5LBF A;  4BOW A;  5K8S A;  2Y6H A;  1RUC 1;  4R8H A;  1KDK A;  4MGY E;  3CIH A;  3LQC A;  2Y0O A;  3ENR A;  1SBD A;  3H42 B;  2ARX A;  2GC2 A;  2HJI A;  2ZX1 A;  5GLT A;  3NNJ A;  1HXS 1;  2XVG A;  1GSL A;  3P5B A;  4RSU A;  5EYX A;  2JKX A;  4PBO A;  5FY5 A;  3WUD A;  2FCU A;  3ES1 A;  4H55 A;  3LSD A;  5D21 A;  5CG9 A;  3H3Z A;  4CXW A;  1XBF A;  3VBU A;  4LOS A;  3D82 A;  1LU1 A;  4JTO A;  2JB8 A;  2JDK A;  5FYM A;  5FYY A;  5CNA A;  4H7L A;  2VZP A;  3FLR A;  4DY3 A;  2ARA A;  1IOA A;  1YFY A;  3MW4 A;  2UY9 A;  4CDX C;  1Q8O A;  4QPY A;  2XJT A;  3FFZ A;  4Y5S A;  4EN6 B;  1AYN 3;  2BOJ A;  1ZRR A;  3GNE A;  4IE4 A;  4EWA A;  1JXN A;  2A3X A;  4XF1 A;  1D7P M;  3TWI A;  4MO3 M;  2D43 A;  1NY7 2;  4YZ4 A;  1REE A;  4E27 A;  1AR8 3;  3MIB A;  1UXX X;  2WYF A;  2BNN A;  1GZW B;  1LKN A;  2ARE A;  2GMM A;  2K0G A;  2Z79 A;  3LA7 A;  4BK4 A;  3N3H A;  4C1X A;  1UYX A;  4ZPI A;  5FO8 B;  3FX3 A;  4C1W A;  2ZZJ A;  5IVE A;  5LCW L;  4CDW B;  1GOG A;  4RHV 3;  4RA0 A;  1G6N A;  1MEC 3;  4AEJ A;  5IK5 A;  4MV2 A;  4F83 A;  3M1H A;  5FP8 A;  1GMM A;  1WCQ A;  4MG2 A;  3RNS A;  1S0J A;  1PO1 1;  4Q4Y 3;  3N9P A;  4IV1 C;  2IXH A;  1DIW A;  2MHF A;  4ZU5 A;  2LW8 A;  4TYS A;  3LIH A;  3J7N A;  1FOD 2;  4HN0 A;  5A80 A;  1K5J A;  2WO7 A;  3R6S A;  1COV 2;  2HWB 2;  3CBN A;  5JI7 A;  3FC0 A;  3BI3 A;  4RGA A;  4YW4 A;  2B39 A;  3WNP A;  2XBO 2;  3HPN A;  3R4U A;  4Q4V 2;  3O14 A;  5ACA 3;  4KBZ A;  2VOV A;  4LKD A;  1X82 A;  2HYK A;  1QDO A;  2R06 2;  3C7F A;  3ST7 A;  1FMD 3;  1W3X A;  1WCK A;  4QXK A;  2QJV A;  4IV1 A;  1UPS A;  3RYR A;  3VZN A;  1GP4 A;  1V6I A;  4NWW A;  4QPI B;  3RMY A;  5FYV A;  4D7S A;  1WGP A;  4FFG A;  4L11 A;  4GH4 C;  4AW7 A;  4Y4Y A;  4OCT A;  3F2Z A;  1TNF A;  2NM1 A;  1IKQ A;  1RED A;  1C8M 3;  3I2I A;  4HVR A;  4PIX A;  4UF0 A;  3O0W A;  4YG3 A;  3IPV A;  5LEK A;  5BYN A;  3I3D A;  4HXC A;  1OPM A;  1N1T A;  4B8E A;  1J83 A;  3GBF A;  1AHS A;  3ACI A;  1EPZ A;  5C4W B;  2JD9 A;  5GZC A;  3VBH B;  1C57 A;  2RS3 1;  4LBM A;  5IWF A;  1BK0 A;  5E89 A;  3BB6 A;  3LDK A;  2OKX A;  1GWM A;  1SAC A;  4B7K A;  4BE3 A;  5KHG A;  1V0A A;  5DAP A;  4CE8 A;  2GNB A;  2CSG A;  2FHR A;  1LEN A;  1OA3 A;  2FZ2 A;  1DYK A;  4UFM A;  3RZG A;  5F3E A;  4IEU A;  1HRV 1;  3SEE A;  1AJO A;  1XYP A;  1XC6 A;  2W1U A;  4K3U A;  2QDN A;  1W05 A;  4LO6 B;  4M0N A;  1N3Q A;  3WLU A;  4AVA A;  2BW8 A;  2EA7 A;  4FAG A;  4M01 A;  4YVS A;  1YJK A;  5BNN B;  5C8W A;  2Y26 A;  1S1A A;  5JSP A;  2C1F A;  4K21 A;  4AXO A;  3RSJ A;  4MHU A;  3K4D A;  4XOG A;  1R08 2;  3HNY M;  3IKW A;  1WMX A;  2ZGS A;  5I93 A;  5C9A C;  1YQ6 A;  1W9W A;  1V6K A;  5L36 A;  1C1L A;  1BEV 1;  1HV0 A;  3W5N A;  4JGY B;  5BY5 A;  4V2V A;  3VKN A;  1H0B A;  3ZFG A;  2RVA A;  1HB2 A;  2IFR A;  3KWV A;  4AHY A;  4ARX A;  2WWU A;  4MZU A;  4LPL A;  2ZGP A;  1W8W A;  3SNM A;  1WLC A;  3OG2 A;  2VG9 A;  5E6H A;  1OPO A;  3BGA A;  4CCM A;  1Z7S 3;  5A6Z A;  2WFF 1;  3ZPY A;  2VMH A;  1UD1 A;  1CAX B;  2Y60 A;  3I2J A;  3H50 A;  4QU2 A;  5FYZ A;  2WNU C;  5E16 A;  1ZYB A;  2FQP A;  3NWK A;  1J3R A;  5IUQ A;  4CCJ A;  2YV8 A;  4GMP 0;  5FP3 A;  3VHR A;  3ZFF B;  1MZF A;  1POV 1;  2J42 A;  1TME 1;  5IK4 A;  1CD3 G;  5FPX A;  4LT5 A;  1MVQ A;  5FZG A;  3MGU A;  3DXT A;  3J8F 2;  4XMI A;  4FXG B;  3WDW A;  1XYO A;  1QHD A;  1X8M A;  3PJY A;  4EYU A;  1RUE 3;  1GYK A;  1K12 A;  3O1O A;  2FBE A;  4FCA A;  4LIV A;  4X6R B;  3ZKU A;  1X7N A;  4JDO A;  4ASM B;  5CFD B;  4HKL A;  1F4H A;  4R4X A;  3QH6 A;  3RI8 A;  3LEK A;  1JYC A;  1R1A 1;  3AYD A;  5FY0 A;  3POG A;  5A3N A;  1OI6 A;  2N7G A;  5FY1 A;  1W2O A;  2VC9 A;  5FYC A;  1N1V A;  4PLM A;  4EZ4 A;  3M7A A;  2HKX A;  2QQI A;  4AG4 A;  1Q56 A;  1SFP A;  1NA1 A;  2R07 2;  2DVD A;  2XJS A;  1EV1 1;  1YQ8 A;  3OTF A;  1EAH 2;  1JBC A;  1SG3 A;  4AQ6 A;  5FZ0 A;  5FZK A;  1FNZ A;  4YVW B;  4AZZ A;  4UFJ A;  1RB8 G;  1VB2 A;  2ZEW A;  3LDB A;  3SH3 A;  5IYY A;  4A7Y A;  2V4V A;  3AB0 A;  1SCS A;  2VW0 A;  5BNN C;  1W2U A;  5A3P A;  1O3S A;  4O9G A;  5FV3 A;  3LEG A;  4O65 A;  4QKB A;  5C8C B;  1MS9 A;  2VUJ A;  4QQH A;  2CHH A;  2DVG A;  2ZJC A;  3B94 A;  1NUK A;  1GU3 A;  3EMR A;  1RTV A;  3KVB A;  3IB3 A;  2DDU A;  2YZ4 A;  4O61 A;  2PQS A;  4WM7 B;  4Z82 A;  5FWE A;  2DBN A;  5DDJ 3;  5F2W A;  2VUD A;  4GZ9 A;  1URX A;  3BPS A;  5I8T A;  2C4X A;  4OQ9 A;  4LKE A;  3WG2 A;  4AI3 A;  4FPL A;  4PQ9 A;  3AFK A;  3K3O A;  2DBI A;  5FXW A;  1X9P A;  4DUV A;  5KXE A;  1WW5 A;  2X29 A;  4FPO B;  1UXZ A;  4TWT A;  4WM8 B;  3T4V A;  1RUH 3;  1ODM A;  4J1W A;  2PAM A;  5A3O A;  2JIJ A;  3ZSE A;  1LOC A;  2YHJ A;  5EPA A;  4XEZ A;  2LTN A;  1JU4 A;  4A6S A;  4EE2 A;  3ZMN A;  1O8S A;  2XBO 1;  2QUO A;  2ZOE B;  3GCX A;  5GLU A;  4CDW C;  4FFH A;  5JAX A;  3FHQ A;  2HWF 3;  2RDS A;  1YRZ A;  5J96 B;  2JG8 A;  1V6L A;  1PZ9 A;  5HV0 A;  2WJS A;  4KQ7 A;  2ZAH A;  4EZH A;  3O1S A;  4Y22 B;  1PIV 2;  4UFI A;  2X5I C;  2QQO A;  4UOJ A;  2PYT A;  4M3C F;  3VBO A;  4URT A;  3WP4 A;  4ZZ5 A;  5L7O B;  2NMN A;  2ILM A;  5L9V A;  4DRV A;  2B4K A;  1TME 2;  3E6D A;  3FJS A;  1OKQ A;  1B09 A;  2GN3 A;  2ORZ A;  2PHD A;  4W8J A;  1HJF A;  4YAR A;  3OGS A;  2HWE 1;  1QOT A;  1SPP B;  4MLO A;  4Y1U A;  2GU9 A;  2PLV 1;  2VW1 A;  4YW1 A;  4UW3 A;  2BTV C;  3GJA A;  4DMI A;  5KR7 A;  1YNA A;  3MF6 A;  2F6B A;  4FOV A;  1UL9 A;  4LHL A;  2BGP A;  2WSV A;  4COW A;  1W0N A;  4IE6 A;  2OII A;  2XUM A;  2OQ6 A;  3JD7 1;  4MYE A;  2LAL A;  4K1Z A;  3KV5 A;  5FCC A;  5J98 B;  1KFX L;  2XB6 C;  4DEV A;  1IKP A;  1CAX A;  1JW6 A;  3M3O A;  2JDH A;  5FLH A;  1RUI 1;  3WG3 A;  1HIX A;  1Q3E A;  4PDW C;  5F3C A;  2DVF A;  1WBL A;  2C9A A;  2RS1 2;  4RFT 0;  2XQX A;  3GF6 A;  4BMB A;  3OGV A;  3JB8 A;  2XUE A;  3CHX A;  3LEM A;  1S0I A;  1W6Q B;  2W39 A;  5I91 A;  2W08 A;  2VOX A;  3B5L B;  1OMI A;  1ST8 A;  4JAA A;  5C33 A;  1UPI A;  1R08 1;  3QCW A;  5EQU A;  1DZQ A;  4YW7 A;  3ZXD A;  4QAW A;  1MAC A;  3PUR A;  4X8P A;  5T50 A;  1PNF A;  2I45 A;  2W87 A;  3N9L A;  4DNY A;  2QQV A;  2XJV A;  3CQO A;  3R4D B;  2Y64 A;  1EUU A;  2BNM A;  2YBS A;  3LAG A;  1C8M 2;  4PBP A;  3T30 A;  2V5D A;  1DGR A;  2YG0 A;  3DXU A;  4BJ0 A;  2ATF A;  5I0R A;  2VZS A;  3FUQ A;  5CIS A;  2ZMK A;  1H1I A;  2R30 A;  2DFB A;  3LPG A;  3OGG A;  4AYU A;  2D5H A;  1GIC A;  5G05 L;  3PJQ A;  1YFU A;  4XJ9 A;  3RMX A;  3ZSM A;  2XL7 A;  2IXJ A;  2R6Q A;  3C3V A;  2A7A A;  4PDW A;  5FZA A;  2HWD 2;  5C6C A;  3JCI A;  4NRO A;  4CEW B;  3ZYG A;  4DUX A;  1X50 A;  2R7E B;  4KU7 A;  2WO3 A;  3USU B;  2I07 B;  2R16 A;  4AGG A;  4ONU A;  2HWB 3;  2QZ2 A;  4RS5 A;  2HWC 2;  3VBH A;  4UT5 A;  2X05 A;  1CAV B;  1JZ4 A;  4OZX A;  1Q8V A;  3T2O A;  5JPM B;  2W9X A;  3VBS A;  2VCA A;  1LOA A;  3NJX A;  1VBC 2;  3ITQ A;  2A5Z A;  3U1X A;  4LHK A;  5EP9 A;  4COZ A;  4BCU A;  3VGI A;  3CNA A;  5FYS A;  3OPZ A;  2VQ0 A;  4AI2 A;  1TMF 2;  5LY1 A;  1BBT 2;  5FP4 A;  1ZRC A;  4QPI A;  1YI9 A;  1GZT A;  2CAU A;  4RHV 2;  4E9K A;  5A6Y A;  1OXC A;  1VBB 1;  2A6V A;  3MLJ A;  4TXW A;  3A0K A;  3S6P A;  1GLH A;  4M4P A;  2LS6 A;  5IK7 A;  1R09 2;  2VZT A;  2VGD A;  1DLC A;  3RYK A;  1QWR A;  1VBE 3;  2ZX2 A;  1ASJ 2;  4XIO A;  3VDB A;  4N8M A;  3KCY A;  4W6W A;  4PLO A;  4D7T A;  2QTW B;  2D6M A;  2XH6 A;  3KV6 A;  3ROU A;  4BME A;  4DXT A;  5FK7 A;  3JQW A;  1IS6 A;  1C5H A;  1WA6 X;  4QX8 A;  1FPN 1;  1QJX 1;  3FFQ A;  3GHN A;  4QGN A;  1RUJ 1;  4KG0 A;  2OPK A;  4EN9 B;  1DDL A;  1HLC A;  2Y34 A;  3VBH C;  1QGL A;  3TNQ A;  2X10 A;  2GME A;  5AVP A;  4E2Q A;  1W06 A;  4NIH A;  5F5Q A;  2O8Q A;  3Q8A A;  3LCP A;  3AMQ A;  3I59 A;  3U78 A;  2IVJ A;  4YZ2 A;  4OI0 A;  1IGO A;  1VP6 A;  5FAX A;  5C3P A;  4IUG A;  3HQX A;  2ZGQ A;  3ETQ A;  3RG0 A;  2A71 A;  4CDW A;  2JE9 A;  3H1W A;  4HKO A;  4LLF A;  4XAE A;  4YZ5 A;  4OHW A;  3SCG A;  2JDM A;  3IT8 A;  3KGZ A;  2OXB A;  4Q4X 3;  2YRO A;  2B8M A;  5IT6 A;  1R1A 2;  2NP0 A;  4WVM A;  3FLP A;  1AX0 A;  1ULP A;  2VBP A;  3KT1 A;  2PFW A;  1RUC 2;  4JRA A;  4LO7 A;  3TOJ A;  3RGB A;  3ZKY A;  4BQ1 A;  3BKZ A;  1UYP A;  4GXL A;  3NJV A;  4NWV A;  1YJL A;  1SBF A;  2ID4 A;  1K5M A;  5ANQ A;  4MGZ E;  1MQT B;  1V70 A;  1QOS A;  1W28 A;  4MXW B;  1RVF 3;  4UW4 A;  4LE3 A;  2BOI A;  1J58 A;  2MPF A;  4KH9 A;  2ZGR A;  5I0D A;  2RHP A;  3USS A;  1XYN A;  5F37 A;  1G7Y A;  4W65 A;  2OUJ A;  2Y6G A;  4C0H A;  1O3Q A;  4XAC A;  2IUW A;  3MIG A;  4LQR A;  3UJO A;  2ZX4 A;  4LBL A;  4QD2 A;  4AE2 A;  4UBH A;  2VUA A;  2A70 A;  1HRI 2;  3VZL A;  2JX9 A;  2D6L X;  4P9W A;  4BM8 A;  4TN7 A;  3U14 A;  5JIU A;  2LRO A;  1H8T C;  4RQP B;  3EO6 A;  4ZZ8 A;  4NPL A;  3MIH A;  2QZ3 A;  5T5P A;  2VUC A;  1H8T A;  1OUS A;  2UYA A;  2WZ8 A;  1JOB A;  2KA3 A;  3PU8 A;  1W8T A;  2ZZQ A;  5JVV A;  2VVD A;  4CU8 A;  4GB3 3;  3L9J T;  3WW1 A;  1D0G A;  1VRB A;  3OOX A;  4L8Q A;  5FZ4 A;  3OF1 A;  2CWS A;  3IIA A;  2YU2 A;  4ZU4 A;  1DQ6 A;  3AL5 A;  1WZX A;  3LKJ A;  2NN8 A;  3I4I A;  3QLQ A;  2B7Y A;  1KEX A;  1ZZ9 A;  1X36 A;  4XF4 A;  3BTX A;  4DIN B;  2W95 A;  4GA9 A;  4HOO A;  4JVA A;  2VL4 A;  4GKY A;  4LBJ A;  4UFK A;  1AR9 3;  1ULF A;  1PIV 1;  3LSE A;  4LMF A;  2DTY A;  2BUK A;  3VBF B;  5KBF A;  5L9B A;  1QF3 A;  3OBA A;  3T1L A;  5GZE A;  2Q8E A;  4FTS A;  4O7X A;  2GC3 A;  4IER A;  2VQU A;  1IQA A;  2FCT A;  4GMP 3;  5HCA A;  3SKJ E;  3GXU A;  4A3Z A;  3CJX A;  3AP4 A;  3BU7 A;  4A41 A;  4XW3 A;  3MFA A;  4P00 B;  1V9U 1;  1X33 A;  4LBQ B;  1MZ5 A;  4XJ8 A;  1NZC A;  3NQH A;  1HN0 A;  4G3Y C;  4QB1 A;  4QXB A;  1Y4W A;  4NII A;  1MQT C;  3AKT A;  4K1Y A;  3ZN5 A;  2NZ9 A;  2VZO A;  4CCN A;  3K48 A;  4IE0 A;  3CO2 A;  2RR1 3;  4K6B A;  5D8A A;  4ASL A;  4MXW A;  1A78 A;  1E57 A;  2CGO A;  5IHR A;  3MUZ 1;  4OYU A;  2A3Y A;  5HV4 A;  2P3J A;  1DGL A;  4HKW A;  3MF9 A;  1P8J A;  5A7W A;  4MXV A;  4Y4R A;  1SFN A;  2E7Q A;  2WS9 3;  3C7O A;  3FUO A;  1MS4 A;  3JQX A;  4WVM B;  1W39 A;  1AR6 3;  1JUH A;  5EZW A;  1AR7 3;  4XQ4 A;  3SH4 A;  3NAP B;  1JYT A;  1NCQ C;  5EJ1 B;  3ZR6 A;  1CZT A;  3CLP A;  3KVA A;  4KI5 M;  1OOP A;  1QJY 3;  1VBC 1;  5A6Q A;  4RGK A;  2YGL A;  2D3R A;  2JXA A;  3PHM A;  5DXD A;  2P3I A;  4F3J A;  3FHA A;  1S2K A;  3O1P A;  1W04 A;  2P6C A;  3ZXF A;  3WY6 A;  1QXJ A;  1GQH A;  4V2W A;  1CPM A;  1O4Y A;  1BBT 1;  4JV4 A;  3POF A;  2G4I A;  3I97 A;  5DG2 A;  3RZK A;  2JDZ A;  4WVW A;  3VD3 A;  1IZ3 A;  5FZD A;  2B42 B;  3K46 A;  4QGM A;  5A1A A;  2J7M A;  4Q1P A;  4FTE A;  1OA2 A;  4Z2A A;  1AF9 A;  1A8M A;  1RUD 3;  2MEV 3;  4XFF A;  5AC9 2;  2AEN A;  3G7D A;  4W50 A;  4OI4 A;  4OUS A;  5LK5 A;  3BTA A;  4XDO A;  3TEZ A;  2W94 A;  4CCK A;  1RL3 A;  1U12 A;  2PLV 2;  1E5H A;  1JU3 A;  1QQP 1;  1OF4 A;  1T2X A;  2ET7 A;  2RG4 A;  2ZPX A;  4HFS A;  4R9B A;  4CDQ C;  4LLO A;  3AXD A;  3FBM A;  2VZU A;  3NV3 A;  5LBB A;  4JGZ C;  1LOB A;  1W8Z A;  2G19 A;  2CTV A;  2XXZ A;  3EXU A;  4RD7 A;  4LHS A;  3L2H A;  5C3R A;  2PHU A;  4HET A;  2B46 X;  1PK6 A;  3NJY A;  3KHC A;  3OEB A;  2TBV A;  2WFP A;  4ZON A;  5KC5 A;  1GZ9 A;  4AGR A;  3HQR A;  5BNO B;  4ITC A;  4XFH A;  2PHF A;  5DQ0 A;  3MV1 1;  1L7L A;  4QX2 A;  3MIE A;  4LK6 A;  1CAV A;  2WKK A;  2RS1 1;  4CEW C;  4YLZ A;  3O7O A;  2QCS B;  2J1V A;  1PMI A;  1VBB 2;  5IVJ A;  5E1R A;  3MIF A;  4Q4W 2;  1QJU 1;  4BPZ A;  2QKD A;  3AMH A;  3ZFE A;  4HZF A;  4J6G A;  4ISQ A;  1UCX A;  1C28 A;  1Y7B A;  3VL9 A;  4Y1X A;  3B69 A;  3BN6 A;  3K75 B;  4FPH A;  3K4Z A;  2CDO A;  2WQ4 A;  1FT9 A;  4PDW B;  5LB6 A;  2FDF A;  2JB4 A;  2MNG A;  1AL2 1;  1R09 3;  2BER A;  4XPV A;  3T2P A;  3V0A A;  1XNC A;  1VMH A;  4WVV A;  4NAO A;  2E33 A;  5GZF A;  2UWB A;  3NNM A;  4DXZ A;  5F9T A;  5FZ9 A;  2BVB A;  5JXH A;  1I3H A;  1VRH 3;  3QOP A;  1EV1 2;  3CZU A;  1AYM 1;  3I7D A;  3V0B B;  3KMH A;  5CEH A;  4A42 A;  4FTB A;  3ELN A;  5IAT A;  3AZY A;  3I8T A;  5CG8 A;  3JB4 C;  5FXX A;  5LEJ A;  2WN3 A;  1DGR N;  3NV4 A;  2CDP A;  4XAB A;  4CDX B;  5F3G A;  3AK0 A;  1S55 A;  3UGG A;  5JDB A;  1IS4 A;  1H4G A;  3IAQ A;  3VZJ A;  3JU9 A;  2XHK A;  4N53 C;  1O4Z A;  5FPL A;  3PME A;  5A3W A;  3IDA A;  3JBG 1;  2ZTN A;  1QJF A;  4CU9 A;  3NVC A;  1C8N A;  4DUW A;  1FI2 A;  4JTN A;  1BYH A;  1NE4 A;  2W68 A;  1R1Z A;  1H4H A;  1QXP A;  1NCR C;  3DN7 A;  4M0H A;  4XIK A;  5AFE A;  1W3V A;  1JYW A;  4H2A A;  5FY4 A;  2R04 2;  4E8C A;  3AKR A;  3HR9 A;  5DAX A;  2WZR 3;  5C5U A;  3GDB A;  1ULG A;  3ZR5 A;  4Y20 B;  3VDA A;  4L97 A;  5IVC A;  3OYW A;  4RYD A;  3PTY A;  1XND A;  4FPE A;  4CXX A;  5FMD A;  3BAL A;  1UYZ A;  2VJX A;  4UI9 L;  2SBA A;  2W91 A;  1CN1 A;  1SZB A;  1SQ4 A;  2CWM A;  2PXJ A;  2ZKN A;  1U5X A;  3ATG A;  3HAG A;  3ZOI A;  1IG3 A;  1RUI 2;  1SPP A;  5EWS A;  1SLL A;  4AI1 A;  3VD7 A;  5JI9 A;  4DQA A;  1ZM1 A;  3OYW B;  1GUI A;  4Y20 A;  1WLW A;  2Q0A A;  4P9I A;  5FXV A;  2I2S A;  4XIL A;  3O1U A;  2FMY A;  4Y5T A;  1HRI 1;  2XHN A;  4NO4 A;  1UW8 A;  3QD6 A;  4FQ4 A;  3A23 A;  1NZI A;  3VBO B;  5L7O A;  3E5X A;  3PUI A;  4RN5 A;  2W46 A;  2YFZ A;  4Y22 A;  4CCO A;  2RS5 1;  3OGJ A;  4CCL A;  4CDQ A;  3GZA A;  2JG8 B;  4W6X A;  3ZM8 A;  3NNL A;  4Q0V A;  2G9G A;  2JDU A;  3UV9 A;  1OHF A;  1E5R A;  1Q5O A; 
#chains in the Genus database with same CATH homology
 1UY2 A;  1ULO A;  3DYP A;  1GOF A;  1YQ2 A;  1K12 A;  3CKH A;  4M4R A;  4CUB A;  3DYM A;  4HG6 B;  1F4H A;  3LEK A;  1JYN A;  3T0B A;  2VC9 A;  3OEA A;  3SEP A;  2QQI A;  4AG4 A;  1JZ2 A;  4FI9 A;  3I2K A;  1SG3 A;  1NX9 A;  2ZEW A;  5IYY A;  3AC0 A;  2ZXQ A;  2V4V A;  1GOH A;  3K77 A;  1TVG A;  3LEG A;  4OUE A;  1RYY A;  3WEZ A;  1NUK A;  1GU3 A;  3DYO A;  3NNG A;  3IB3 A;  2DDU A;  1NKG A;  2PQS A;  4BXS V;  4GZ9 A;  4CUA A;  2E26 A;  3I3B A;  2C4X A;  1TG7 A;  3WNM A;  1UY0 A;  1PMJ X;  4DUV A;  1UXZ A;  1GNY A;  3D3A A;  4CU6 A;  2J1A A;  4DEQ A;  2XOM A;  5JR2 A;  1JU4 A;  2J1U A;  1O8S A;  5LA2 A;  1LNS A;  1OT5 A;  4ZY9 A;  3WF2 A;  2EIB A;  2VQT A;  3FHQ A;  2VMC A;  1UY1 A;  3UES A;  3A22 A;  3I3E A;  4UOJ A;  2QQO A;  3C7G A;  4XUR A;  4ZZ5 A;  2Y6K A;  3ECQ A;  3K4A A;  1O59 A;  2B4K A;  1CZS A;  1JYX A;  2E32 A;  2ORZ A;  4W8J A;  3OGS A;  3MV0 1;  5JXJ A;  3NRU A;  5FUI A;  3WF1 A;  2C26 A;  3W5M A;  2BGP A;  1W0N A;  4P5Y A;  5JMO A;  1W99 A;  1R64 A;  3CMG A;  2VCB A;  4DEV A;  1H6X A;  3WNO A;  1UMH A;  1K42 A;  4QPW A;  2BGO A;  3FL7 A;  2WN2 A;  4PF1 A;  1UWW A;  2XQX A;  3EYP A;  4PT6 A;  3OGV A;  3GM8 A;  2WDB A;  1F4A A;  1UY4 A;  2VME A;  2RV9 A;  4A4A A;  2VZ1 A;  4XUO A;  3DEC A;  4QAW A;  4ZXE A;  1IQD C;  2W87 A;  1I5P A;  2VO5 A;  3CQO A;  2DCK A;  1EUU A;  2Y64 A;  4BJ0 A;  2X09 A;  2V5D A;  2YG0 A;  2VZS A;  2ZEZ A;  2J1S A;  2DCJ A;  4ET7 A;  3LPG A;  1UYY A;  3ACF A;  2VM9 A;  5G05 L;  5DN2 A;  3A7Q A;  2QQL A;  5JXG A;  4JX0 A;  4LKS A;  1UMI A;  3III A;  4JHZ A;  4OZO A;  2WO2 A;  3GGL A;  3OGR A;  4DUX A;  1UZ0 A;  2R7E B;  2WO3 A;  1UY3 A;  1L7Q A;  1J84 A;  2Y6L A;  3I2G A;  4QDQ A;  3WF0 A;  2X05 A;  1JZ4 A;  2C9K A;  3MBW A;  1K3I A;  4QB2 A;  3T2O A;  2VR4 A;  5DPN A;  2W9X A;  2VCA A;  3NJX A;  4OMC A;  2VCC A;  2WBK A;  3ABZ A;  3CZJ A;  1MPX A;  1HN1 A;  3WF3 A;  2L9L A;  2WUH A;  2VMF A;  2VZQ A;  5C71 A;  4D8M A;  1SDD B;  1O8P A;  2YC2 A;  2VTF A;  4TXW A;  1XNT A;  4M4P A;  2LS6 A;  4D0Q A;  1JYV A;  2VZT A;  4E8D A;  1DLC A;  4XUQ A;  3VDB A;  4XVH A;  3J7H A;  2YB7 A;  1US2 A;  2QQJ A;  4DXT A;  1JZ6 A;  3ETP A;  3PUH A;  4QDR A;  2X10 A;  5IJR A;  3HNB M;  1BHG A;  3HJR A;  1K45 A;  1KGY A;  1PX3 A;  1WKY A;  2WQ8 A;  4KMQ A;  4QDS A;  5LA1 A;  5HXM A;  4IUG A;  5G04 L;  4L0P A;  3T0D A;  5B4N A;  3OB8 A;  1CX1 A;  4PQQ A;  2WO1 A;  3JXS A;  2HYX A;  4XZU G;  2EIE A;  1ULP A;  4A44 A;  3T2Q A;  4TTG A;  2VOT A;  3NJV A;  1JZ3 A;  4P08 A;  2J1E A;  3SKV A;  3MO4 A;  2ID4 A;  2ORX A;  1W9S A;  4ARY A;  2W1S A;  4GWJ A;  4CU7 A;  4DXR A;  2WAA A;  2W47 A;  5I0D A;  5EIY B;  1DP0 A;  4XUT A;  3T09 A;  3THD A;  2Y6G A;  3HOB A;  4LQR A;  3ACG A;  3E1F 1;  4XUN A;  1W8O A;  2YC4 A;  4A45 A;  2QBX A;  1XPW A;  3LE0 A;  4JKM A;  1OD3 A;  5B4X A;  3WNN A;  2Y6J A;  4ZZ8 A;  3LEI A;  2Z4F A;  2QQM A;  2WZ8 A;  2EID A;  1OH4 A;  4CU8 A;  3C7E A;  3ACH A;  3HEI A;  5EJZ B;  5DMY A;  3WNL A;  3C8X A;  2WYS A;  2EIC A;  4QX0 A;  1KEX A;  2WAB A;  2W95 A;  1JZ7 A;  2VL4 A;  4CVU A;  5J1X A;  1DYO A;  3VD5 A;  4BK5 A;  3OBA A;  3VDC A;  3VD4 A;  3EB7 A;  2VQU A;  2WZE A;  3SKJ E;  3GXU A;  3P6B A;  4A3Z A;  5CZK A;  5CYY A;  4A41 A;  1CZV A;  1W8N A;  4P00 B;  4W4Z A;  4YPJ A;  1SHW B;  3NQH A;  3T08 A;  2VZ3 A;  4QB1 A;  1JZ5 A;  2VZO A;  4UAP A;  1CIY A;  4MGQ A;  1W9T A;  5IHR A;  5IFP A;  1JI6 A;  5JXI A;  3MUZ 1;  3WSO A;  4OYU A;  2Y6H A;  2ZEX A;  4DXS A;  3CIH A;  3LQC A;  1P8J A;  1EUT A;  2VZV A;  5IFT A;  3C7O A;  5C7G A;  3T0A A;  2J22 A;  2JKX A;  1L7R A;  5EJ1 B;  1CZT A;  4KI5 M;  5LA0 A;  1PMH X;  3UET A;  3FHA A;  2BZD A;  2VMD A;  3I97 A;  4QB6 A;  2VZP A;  3VD3 A;  3K46 A;  4XUP A;  5A1A A;  2HLE A;  2J7M A;  1D7P M;  4MO3 M;  4Z2A A;  4BDV B;  3C7H A;  4KWU A;  2ZEY A;  3VD9 A;  1UXX X;  4GWI A;  2XON A;  4W50 A;  4BK4 A;  1GQP A;  1UYX A;  2W94 A;  5LCW L;  1GOG A;  2QQN A;  3LPF A;  1JU3 A;  1T2X A;  1GMM A;  1OF4 A;  3MUY 1;  1WCQ A;  2VZU A;  1JHJ A;  4LHS A;  2LW8 A;  1PX4 A;  2JE8 A;  3I2F A;  3OEB A;  2J1R A;  3UNP A;  3WQB A;  2VZR A;  5DQ0 A;  3MV1 1;  4QX2 A;  1US3 A;  3WNP A;  2W1W A;  3HPN A;  4P02 B;  2J1V A;  2KD7 A;  1XNA A;  3C7F A;  4A6O A;  4QX1 A;  5C70 A;  3I2H A;  1OF3 A;  3BN6 A;  3K75 B;  4JKK A;  1NAE A;  3K4Z A;  2CDO A;  2BER A;  4MOA A;  3T2P A;  3CDZ B;  2JDA A;  3F2Z A;  2E33 A;  3THC A;  3I2I A;  2W1Q A;  5JXH A;  3I3D A;  1JZ8 A;  3CZU A;  4MGS A;  1J83 A;  4A42 A;  3ACI A;  2JD9 A;  5HPO A;  4AAX A;  3P1I A;  2WN3 A;  3A21 A;  2OKX A;  2CDP A;  2W92 A;  3IAQ A;  4OMD A;  4QX3 A;  3SEE A;  3HNM A;  1XC6 A;  2B9V A;  2W1U A;  3IDA A;  4CU9 A;  4DUW A;  4JKL A;  2RJ2 A;  2YFU A;  3WF4 A;  3IAP A;  1JYW A;  3K4D A;  2WAO A;  4CUC A;  3HNY M;  4E8C A;  1W9W A;  3GDB A;  3VDA A;  3W5N A;  2W5F A;  4RYD A;  1UYZ A;  2VJX A;  4UI9 L;  1H6Y A;  2RVA A;  2W91 A;  3WNK A;  3U37 A;  2BBA A;  4ARX A;  2QQK A;  4LPL A;  3VD7 A;  3HN3 A;  3OG2 A;  2V72 A;  1GUI A;  3BGA A;  5F7U A;  1UX7 A;  4MAD A;  2Y8K A;  3FN9 A;  2J1T A;  2XHN A;  3A23 A;  3PUI A;  4RN5 A;  3I2J A;  2W46 A;  2YFZ A;  2E31 A;  5JUV A;  2W3J A;  3ZM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...