5I8YA

Strcuture of mouse acireductone dioxygenase bound to co2+ and 2-keto-4-(methylthio)-butyric acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 50
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i8yA00
4J1XA 2WC2A 2GH2A 5J3UA 4R8HA 1FT9A 2QNKA 3IDCB 4I0AA 3RZZA 4BH9A 1ZZBA 2FQPA 3PLQA 3B02A 4QXKA 2F4PA 5LEJA 2BEOA 3KGLA 3LA7A 4MUVA 3UKTA 5KHKA 3USSA 2QVSB 5FQ0B 1UCXA 4XF1A 1CAXB 1Q43A 2XLFA 2XL9A 1FI2A 5LRRA 4META 4AVBA 3EQEA 3NW4A 4YARA 2GC0A 5JSRA 1YFWA 3E5UA 3HT1A 4MZUA 3U10A 2ETEA 1J59A 4Q0QA 3H50A 1J1LA 1NXMA 1CGPA 2IXKA 2OZ6A 5CADA 3KMHA 4ORFA 2N7GA 2UY9A 4QM8A 4IEZA 2ET1A 3ACLA 2GC3A 1QXRA 3LZZA 4MX3A 5I8SA 3H3ZA 2MHFA 4BHPA 5CU1A 5JAXA 4EV0A 4XFAA 4KWJA 3KSCA 3ES4A 4O9EA 4IEOA 4QGNA 4LUKA 4FBFA 1YLLA 3E97A 1XE7A 3MPBA 1RUOA 1WA4A 3H9AA 3D0SA 1UIJA 1EP0A 3LA2A 3H1WA 3GYDA 3UKVA 1RL3A 4OLLA 1RC6A 3ETQA 4L2NA 5CVRA 1GQGA 4ZU7A 3HQXA 4GULA 3DKWA 4XF4A 3WW4A 2IXIA 5D1IA 4HBNA 5E1RA 3MDPA 2B8MA 4I2OA 3D0JA 4N9IA 4ZU4A 1FXZA 4J1WA 4HZFA 4A2UA 4AQ6A 4YNIA 1Y9QA 1TQ5A 4PIXA 3MYXA 3BPZA 4AVAA 3ELNA 2PHLA 1O3RA 3ST7A 3OD0A 3GBFA 3SMHA 3IWZA 3NVCA 4JV4A 2XLGA 3FHIB 5K8SA 2UYAA 1I6XA 1YFXA 4XFHA 3C3VA 4EROA 2EA7A 2V09A 1PMIA 2XLAA 3QOPA 5JCTA 4MV2A 4I09A 5BV6A 3S0MA 1H1IA 2PFWA 5HI0A 3ZDSA 3KCCA 3OGJA 1ZRRA 5BXXA 3SCFA 1VJ2A 2B9UA 2D93A 1DZTA 1ZNPA 4NVPA 4E2SA 1ZZ7A 4AVCA 3FFQA 5LRSA 3LWCA 5I8TA 4I3PA 1EPZA 2OA2A 5EFUA 2EAAA 4ZU5A 3WW1A 3NSTA 3DN7A 3H1YA 2OZJA 3IDBB 4Z07A 3WW3A 1OFNA 1DZRA 1LKNA 1YWKA 4IESA 2H6CA 4X6RB 1NYWA 1I5ZA 2PAEA 3CL1A 2D5HA 3EBRA 4I02A 4QGLA 4Q29A 4HN1A 4HVQA 1QWRA 3OCPA 5JSOA 3LAGA 4MGYE 4QMAA 5I0TA 2EVXA 4BYYA 3SHRA 3JZVA 1CAVA 2Q1ZB 3IBMA 4XFBA 3UKNA 1UIKA 4JTNA 5BPXA 5I93A 4E2QA 3I7DA 4FAGA 1HW5A 4JVAA 4IEQA 5FCCA 2H6BA 3NJZA 3OF1A 2HJIA 3BB6A 1CAVB 2PAMA 3RPQA 1UPIA 1ZZ8A 5FLHA 3H8UA 4LTAA 5C6CA 1YFYA 5T3NA 4UXAA 1J3QA 4IEWA 3U11A 4IEPA 2KXLA 3H1MA 2O1QA 2XKOA 2D5FA 5KHHA 1EY2A 4KU7A 3SCHA 2IC1A 3I59A 4FAHA 2E9QA 2O8QA 5E16A 1X82A 4IEVA 1XRUA 2VQAA 2GZWA 4LUMA 3TNPB 4CYDA 4EWEA 5BUVA 5FPZA 3DV8A 5FLJA 2Q30A 4D7TA 3CO2A 1IPJA 1G6NA 2IXJA 3I59B 4XFCA 2QJVA 2Q0AA 2Z2SB 4PIZA 4XF0A 1DGWA 2GAUA 4QGMA 5F1RA 1LR5A 3PNAA 4AQ2A 3RDIA 4HSLA 4PJYA 4PIYA 2OYZA 1X7NA 4Q0VA 1QXJA 3E5XA 4KL1A 3BALA 3H3UA 4YSFA 2I45A 1XE8A 1SEFA 2Z69A 4KWLA 4HVRA 1CAWA 1ZRDA 4MGIE 1OD5A 4KU8A 4X6QB 3CLPA 1ZX5A 5I0UA 3TNQA 2ET7A 1WLTA 2IXCA 3U0ZA 2PTMA 2XHKA 2XGXA 1NZCA 2QDRA 1UD1A 1O3QA 1CAWB 2H0VA 4FT8A 2GC1A 1J3RA 5I91A 2XKPA 5BY5A 4IEXA 3PVBB 1O5UA 4BIFA 4XETA 1O3TA 1LB2A 3HT2A 2Q4SA 1DGRA 4AXOA 1Q5OA 3NKTA 4LEJA 4MH0E 3RYPA 4JTOA 4O9GA 3S7IA 2BNOA 1ZVFA 3MZHA 1IPKA 3CEWA 1O7FA 2D40A 4K8FA 5I8YA 4ONUA 1VP6A 5KHJA 1OI6A 4DINB 1O5LA 3M3IA 4I01A 3E6CC 3I54A 2B5HA 3R6SA 4Q0SA 3EO6A 2PYTA 2VECA 2XL7A 5C8WA 3EJKA 3BCWA 1RGSA 4I0BA 4YRDA 4IEUA 3L2HA 2CAVA 5FDBA 2MNGA 5JR7B 1SFNA 4N9HA 2BNNA 2QCSB 1CAUA 1LRHA 1EYBA 2GU9A 2PHDA 3N4MA 1GQHA 3NL1A 5I0RA 4IERA 2K9ZA 3FX3A 2HKXA 4UBHA 4XFIA 3E5QA 1X8MA 2WFPA 1ZRCA 3H7JA 2IXLA 4QX5A 1U12A 5JSPA 5KHIA 3RNSA 2PA7A 1CAUB 4D7SA 1Y3TA 4MGZE 1J3PA 2ZKLA 2PAKA 3CF6E 4L11A 4LULA 4LLOA 1L3JA 2GC2A 1NE6A 2VPVA 4Z82A 5AVPA 1YHFA 3CJXA 4F7ZA 3G7DA 1VR3A 4KWKA 3FE5A 3ES1A 1X8EA 4IETA 1YFUA 3D82A 3DL3A 1RTVA 4HLTA 1CX4A 3LOIA 1ZRFA 4Q0PA 2BNMA 1WGPA 3FJSA 3OTFA 1JUHA 4EWDA 5FPXA 1NE4A 1OMIA 3WW2A 3O14A 4XF3A 2IXHA 3S7EA 5KBFA 5LEKA 5J7MA 1YUDA 2CGPA 2CAUA 3ROUA 1H1MA 5FLIA 4LA3A 4LA2A 4B29A 2ZCWA 3M70A 4TLFA 2C0ZA 1ZZ6A 4IEYA 4XF9A 1V70A 2MPFA 2PQQA 1ZZCA 4HVOA 4Q0UA 4P9GA 2BYVE 1J58A 3KGZA 4HMZA 2UYBA 3H7YA 4HSJA 2FMYA 3LA3A 4UBGA 1RUNA 4OFGA 2CV6A 2ATFA 2P17A 1ZREA 2Y0OA 4XFFA 3EHKA 1QY4A 1O4TA 4MGKE 3SXWA 3IIAA 5I0SA 3E6DA 3RYKA 4XEZA 4HN0A 2K0GA 5EZWA 3FWEA 4WVZA 4H7LA 3E6BA 4RD7A 4EWAA 1SQ4A 1Q3EA 1UW8A 3HIFA 2OPKA 5J48A 3SCGA 4QM9A 4YYOA 3BU7A 3RYRA 2BGCA 3QACA 3VHRA 4WZCA 4XFGA 4E2GA 4R52A 4F8AA 3FZ3A 1O3SA 1PM7A 2UY8A 4WBBA 1ZZ9A 5KHGA 5FQ0A 2DCTA 1CAXA
chains in the Genus database with same CATH superfamily
1E5SA 2PHTA 3PHMA 2W3JA 1LHWA 1OT5A 5FKBA 5GLZA 5H9PA 1FT9A 4M01A 5JIAA 1GR3A 1VBC1 1CQ9A 2HWC1 3NNJA 1CR7A 3PUSA 1RUH1 1ZZBA 5ABJA 3DGTA 5T55A 3ZPOA 5F2WA 4Y5Z0 3UKTA 2XVLA 2FDGA 4AQTA 4K3UA 3KWVA 1X9PA 4OHXA 2RM22 1CAXB 2RG4A 4XDPA 4WM7A 3RMXA 4NPRA 3RZMA 2Y6LA 5LRRA 5IK4A 1GWMA 4AVBA 2CNAA 3BOPA 1BYHA 2GC0A 3ZN6A 2HH9A 2IVIB 4I0WB 4E9KA 3E5UA 1W2NA 3U10A 5FOBB 1ASJ2 1A3KA 1YQ5A 1HLCA 3MUZ1 1J59A 3LDKA 3OEBA 3H50A 1J1LA 3CMGA 4XHBA 2EIDA 5E6HA 4QXCA 4S2FA 1NXMA 2LUWA 4LBQD 5D2AA 1RUC1 1POV1 2IXKA 2OZ6A 3MI8A 5KC5A 4TSVA 1QQP1 3QCWA 2N7GA 2UY9A 4QM8A 4BMEA 4OUMA 1BVP1 4CDWA 2ET1A 3ACLA 3LEKA 5KR7A 1H4GA 2DURA 1ZBA2 4KMQA 1QXRA 2R7EB 3DECA 4ET7A 5JI9A 4NPLA 3WD5A 5CU1A 2C4XA 4GWIA 1ENSA 2FD8A 1D2SA 1YCIA 4O65A 3Q8AA 2Y34A 2RMU1 4FQ4A 4UAPA 2WBKA 1NKGA 3M3CA 3BU0A 1SFYA 1O91A 1V6IA 4AW7A 2SBAA 1I5PA 4FBFA 5AC93 1YLLA 1XE7A 2ZOEB 3VBRA 3ON7A 3HN3A 1JOBA 3ZKYA 4CCEA 3AZYA 4QQOA 5IHRA 1WBFA 1R093 4JDNA 4QB2A 2Q8OA 2JDHA 3ZXLA 3RZJA 1NCQA 1Z78A 1EP0A 2VUAA 5FY7A 5LZ6A 4UW4A 1QOSA 2RR12 4N43A 4YPJA 4HG6B 1NZIA 3LA2A 1N1TA 4OMCA 4RL7A 5C71A 3ACHA 1BEV3 2RS33 4QPIC 3UKVA 5CG8A 3POEA 3I49A 5FPBA 4HPKB 5A3LA 1RL3A 1JYTA 1AR81 3I2FA 4AE2A 5JLVA 4QXBA 5EJZB 5L36A 4GJYA 5FJKA 3VBSA 4Y22A 4Y20A 1GQGA 2WT1A 4QPGC 1G86A 4QQLA 4Q1RA 3HQXA 1PO22 4XF4A 3OGSA 1XNTA 4YFZA 5FYCA 4BU2A 1W2AX 3EB7A 3IAQA 1KDKA 5D1IA 4ZPIA 3WP5A 3HQUA 3RJRA 3MDPA 2B8MA 1Z7S3 1H6XA 4OI4A 4I2OA 5F3EA 5EYXA 2DFCA 1FXZA 4R4ZA 4A2UA 1XBFA 2VCAA 2WIIB 1E5RA 4LITA 4PIXA 3V64A 3LIGA 1GP6A 1Q8OA 2YY1A 3AKQA 4AVAA 1U5ZA 4LBQB 2VM9A 5FMOL 4GH4A 4DEVA 4P9WA 4JV4A 2JDUA 3LF7A 4QB1A 3KV4A 3WR0A 1AXZA 1YFXA 2W52A 3BTAA 4XFHA 3HVDA 4Y5SA 4EROA 5J37A 2VNVA 1PMIA 1GOHA 4PCRA 3QOPA 3ACIA 4MV2A 2YYOA 3A22A 1H1IA 1QF3A 4CDQC 4Q5OA 4DIQA 1CN1A 3I8TA 3KCCA 4XPVA 1RUJ1 3WHUA 5C3PA 5FYVA 5BXXA 1V9U3 1KFXL 4FOQA 2B9UA 4GWJA 2DU1A 1UMIA 4JQRA 4FP3A 1F5JA 1REDA 1VBA2 2D93A 1UF2C 3G6JB 2XH6A 4JX0A 1ONAA 1QMJA 5FO8B 1D4M1 4AVVA 4ISQA 2JDYA 4YZ2A 5I8TA 4I3PA 4RN5A 3S6PA 1QDCA 1T2XA 3C7HA 2OA2A 5HXMA 2D6NA 2VD7A 3WW1A 3ZMOA 1JMUB 1NQJA 3V65A 3ZIWA 4MADA 3WW3A 1JYWA 1R1ZA 3VHPA 1PNFA 3TEXA 2WNOA 4IDZA 2ZHMA 4BCUA 4CA9A 2H6CA 3M1HA 3C2UA 5DXDA 3MFAA 4CVUA 4N7IA 3KM5A 1C8M3 1COV1 1EAH1 2RVAA 3OCPA 5EV7A 3ZXDA 1YYNA 3VD9A 3A23A 5IYYA 1HKDA 3VN4A 1VBE1 2WFF1 4BLIA 1VBD3 1CZTA 1OLRA 3KF5A 4QPWA 3OPZA 4XUQA 2ZS6B 2B39A 4BYYA 5JZGB 2P3KA 2XHNA 4YW4A 4Q4Y3 3JZVA 1OQ1A 2VU9A 1UZWA 1OOPB 4RHV2 3KCXA 4LKFA 4TXWA 4YW1A 1GNZA 5J98B 4BQ5A 2GNBA 3NAPB 1UIKA 5I93A 4FPHA 2RDQA 5DAXA 4FAGA 3TRSB 2VCMA 1HW5A 3U1XA 4EN0A 3T0BA 1AYM2 1FATA 1RHI1 1WWYA 1KQRA 5FAXA 1GQPA 2DF7A 1J1TA 4XMIA 3NJVA 5FZMA 5IJRA 3VD5A 4AAXA 2H6BA 5CBLA 4XZPA 2BBAA 2BFUS 5L9VA 4AYUA 1QJEA 3OF1A 2P5BA 2XBO3 4CSWA 4QU2A 4UOJA 5LA1A 1CAVB 1DYPA 1RINA 1SLAA 2PAMA 4Q4X2 4D6RA 5HPOA 1W06A 1LHNA 1GP4A 1SZBA 1ZZ8A 4QHOA 4YVWB 3H8UA 5FLHA 1DP0A 2IFRA 1YFYA 5T3NA 3WQ1A 4FTSA 5D8AC 3EYPA 3FUQA 3ZSLA 1KXGA 1J3QA 2A6WA 4FPEA 5B4NA 2KXLA 1KITA 5A6XA 1PX4A 5FJHA 1W6NB 1VRH2 4L8QA 2J1TA 4DOUA 3BGAA 4DXRA 3DKQA 1ULGA 2HBTA 1HXS2 3QLQA 5IFPA 2D5FA 2YFUA 1W2TA 2ZX0A 4W65A 2W0XA 3SCHA 4A6OA 3GZAA 5FZIA 5LCWL 4BQ4A 2O8QA 1XNCA 3UJQA 5E16A 2JG9C 3POIA 4IEVA 4XXPA 2V4AA 3F95A 3M8LA 3O5SA 4NAMA 4UT5A 5GLVA 5A33A 1GUIA 1BCXA 4Y1ZA 5FPZA 3GHNA 3LKJA 1LESA 5HBAA 1DGRN 1WCSA 1RUI1 2X8KA 2A6XA 1H9WA 3OY8A 5FZGA 4BB3A 4D7TA 3WG3A 2WS93 4ZKTB 3CO2A 4J25A 2JG8B 2NPIA 1G6NA 4XBLA 2BTVC 2GDFA 1H8TC 3WX5A 4XW3A 1PNGA 3QD6A 1H2NA 3U75A 3L9JT 4BQYA 2HWD2 1AL21 2C9AA 2EIGA 4PIZA 4QX0A 5GZCA 5CFDB 5A7WB 1S0DA 2Q1MA 1QH7A 1RUD3 1LECA 2P4EA 3KQRA 4TLGA 1POV0 4PJYA 1PGL2 5CKNA 5FYHA 4Q0VA 1IG0A 1PX3A 5A3OA 2YPJA 2ARCA 1U5XA 2IWGB 3AZZA 4QPIA 1LU1A 2Z4FA 4R9BA 1F4AA 3E5XA 4KL1A 1DU3D 4Q8LA 5IK8A 4YSFA 1YQCA 1GWLA 1R091 2VZSA 3HR9A 2ENRA 1I3HA 1DHKB 2G9GA 4EJRA 5FP8A 3AC0A 3OUJA 4P5HA 4QPGA 4CCKA 4KWLA 4HFSA 2RS31 3K4DA 1OA3A 4PT6A 2W47A 4ARXA 5CA6A 3NWKA 5FPVA 4PF5A 4L92A 2AR6A 4B7EA 4KU8A 3FHAA 1ZX5A 4XJZA 5I0UA 1ACCA 3W5NA 4ITCA 2IXCA 3HMYA 2JX9A 1MS9A 4NMIA 2QQJA 2YBSA 2R6QA 1KGYA 2XGXA 1OUSA 3UNPA 1QHDA 2A5ZA 2WO7A 2AUYA 1MQTC 3AYAA 1Z7S1 3P3NA 1IPSA 3CKHA 1JYVA 1LEDA 1CAWB 1AL0G 2H0VA 4H3WA 2AEYA 3W9AA 1BJQA 2XOMA 1JZ8A 2FCUA 4JGZB 3S5QA 5CZKA 5BY5A 4FPLA 1JZ5A 1O5UA 3PJQA 3CJIB 2ZGPA 1W9FA 4CEWC 2R30A 1LEMA 3EMRA 4IV3C 4UFLA 1PGW2 5CIRA 2B4KA 1MS8A 4N53C 2Q4SA 4AXOA 5KXEA 3MLJA 4YVSB 1Q5OA 2R041 1S0IA 3OBRA 1A8MA 1CPMA 3RYPA 1DCSA 4CDQA 3S7IA 3ZPYA 4AFAA 2OUHA 2WWUA 1JUIA 3CDZB 3LFIA 1K5MC 3U4SA 1O7FA 3BVCA 2V5YA 1HV1A 3AVRA 4R9CA 3GCWA 1DLCA 1FMD2 2JJ6A 4RR3A 5DN2A 2YU1A 4PHZA 4UF0A 2D6LX 1O5LA 4CDUA 1W39A 5EHDA 4CCNA 5IVBA 4ARYA 3BUCA 1UL9A 5F5AA 3I54A 3UGHA 1R1A3 2CHHA 2ZABA 1TG7A 1YIFA 3R6SA 3WF3A 4Q0SA 3EO6A 2B46X 2ZX2A 2YC4A 3PU3A 5FBZA 1O6UA 4JDMA 5T54A 2RV9A 2CL2A 2VECA 1YNAA 4RGKA 3VKLA 2JE9A 1AYN2 2BBVA 3EJKA 4CU8A 3OGGA 1AX1A 1PO11 5DDJ2 3L2HA 2CAVA 5FBJA 1O4ZA 2WNEA 4QKDA 2VXRA 1UXZA 4XAEA 4N9HA 5FY4A 4XYXA 3ZSJA 3RMYA 1FPN2 1UU6A 5L7OB 2YB7A 1CAUA 2WQZC 3POGA 1YQ6A 4OULA 4KGQA 2PHDA 3DPRC 2XJVA 5LBEA 1UMHA 3POFA 4JKMA 4BE3A 4IGPA 2K9ZA 3B5LB 3T2PA 5FP9A 3ZFEC 1Y43B 1DGWX 3M4FA 4CXXA 2A6YA 3LE0A 4LIVA 2UU8A 3E5QA 4NROA 2WFPA 3ILFA 3WNKA 1JYXA 2IXLA 2DYCA 4XBQA 4YGBA 5EIYB 3N9LA 2PXJA 3BI3A 4IV1B 1BMV1 3F2ZA 1PGSA 1SLLA 4CEYB 1UY4A 1W2OA 2ARBA 4Q4Y1 2BWAA 2VNRA 4D7SA 1Q8QA 4MGZE 3J8F3 1QJU2 1AHSA 4Q4W2 3ILRA 3VKOA 4LLOA 2VNGA 4P9IA 5FY1A 4WVMB 1T6GC 4Q4V1 2JKBA 1CIWA 4GB33 5D8AA 4Z82A 2AZ5A 2XBO1 2WZR1 4IE4A 3T1LA 2VZRA 3G7DA 5HXVA 4LNVA 3AKSA 2MEV3 1WW6A 3D82A 5LATA 5LBCA 4K8RB 4B1MA 3GNEA 1ND2B 4QQHA 4MXWA 1PK6B 4YGDA 2C1FA 4YM0A 5HCFA 4AOCA 5L19A 5GZFA 3LOIA 2VW2A 5JPMB 2JG9A 3DXUA 3ABZA 4Q0PA 4TWTA 2DVDA 3B3QE 5ACA1 1RUF1 1LHVA 3JD72 4DRRA 4P9LA 2RS12 1AXKA 1AX0A 4AI8A 4CCMA 5CFCC 4A42A 2IXHA 3S7EA 3Q8EA 4JDOA 2UWAA 4COWA 4ZZ8A 5C4WB 1DZQA 1ND3C 5LA0A 4LA3A 4LA2A 4B29A 1UN1A 1YJKA 5AFBA 2RJKA 4TLFA 3VZKA 3QH6A 4XIKA 5FMCA 4QT6A 5FREA 3BIEA 4IEYA 2PHXA 1VBC2 2HWC2 1K3IA 1V70A 2WS91 4QX7A 4Y4YA 1RUH2 2HWE3 3ASIA 1LNSA 3R4DB 5BNOB 1ENQA 2ZX3A 1ZZCA 4BA6A 3WDYA 2R16A 2UWCA 1WZXA 4BK5A 1VALA 2R49A 3GJAA 5L9RA 1LCLA 2GNDA 5JOZA 3LGRA 5CEHA 2VOKA 2UYBA 3H7YA 4HSJA 1RUD1 3U37A 1FOD1 1LULA 3I3BA 1JHNA 5DPNA 1QJY3 4NHLA 2WLPA 4AEDC 5FTTC 2FCTA 2HWB3 4UFMA 1HRI3 3MIEA 1XOYA 4NIAA 3AB0A 3W21A 3UETA 1GLHA 3E6DA 3WZ1A 3WNLA 2NP0A 4LT5A 1GFF2 3M3EA 4CUGA 3P6BA 3LPGA 5EZWA 3RGBA 4WM8C 4WVZA 2IZWA 1RUC2 2YU2A 3E6BA 4COUA 3WQ7A 1QQP2 3A0KA 3HIFA 1OLMA 3CU7A 4I3GA 2BGCA 4D6QA 1HQLA 2ZEWA 4NRPA 2P1BA 1V6JA 3LEMA 1NCRB 1QJFA 3ZXAC 1EV13 2WYSA 5FZCA 1HN1A 1ZRIA 3J7HA 4UFKA 1SDWA 2O8OA 3VBFC 4F8AA 1RMU1 4CEWA 4URTA 2RMU2 2WNVC 3PIGA 2UY8A 1O4YA 4FPFA 4N53A 3I3MA 4EN6B 2XQXA 2EXJA 3AJZA 3V0BB 3V0AA 4TZDA 3SLIA 1GZCA 5FZ9A 3AKTA 2GH2A 4NHXA 2G1MA 4W6WA 1ULCA 4LO8A 2I07B 1X33A 1K5MA 1YXWA 4I0AA 3MF9A 3RZZA 4BH9A 4E27A 1JYCA 1OOPA 2QQUA 2FQPA 4FPYA 2JDAA 3TBDA 3THCA 4QXKA 2F4PA 4ZY9A 5SV5A 4TTGA 1OXCA 3ZYFA 1TME1 1RUG1 4YG3A 3K75B 2BEOA 3KGLA 3LA7A 4MUVA 5KHKA 1OUXA 3B00A 5FQ0B 1UCXA 4L99A 4XF1A 5L9BA 1LTEA 4CE8A 1Q43A 1AR82 1FV3A 1YO8A 4LOSA 2XLFA 3N7MA 1W6PA 4GD4A 2VW0A 3BTZA 4OMDA 3PU8A 5FZ0A 2FHRA 4META 4XE9A 5G04L 4CDWC 4DEQA 1JOPA 3EQEA 4LHLA 5FPAA 1H2MA 2OVUA 2CU5A 3U07A 4NWVA 5LY1A 3DCQA 2ZAHA 2IUWA 2ZA9A 1RVF1 1L7LA 2NLRA 2Y6KA 2ZGUA 3AZWA 4OHVA 3ZM8A 5KXCA 3RG0A 4JKKA 1W04A 4O61A 4BQ3A 1CGPA 1OA2A 3WG4A 5CADA 4B7KA 1W8FA 2E7QA 3VBRC 4QX8A 2W1QA 5JXIA 2CWSA 1ZA7A 3AFKA 2GC3A 2VMGA 4QDQA 1CIYA 2VMHA 4L97A 5EXOA 1NCQC 2QKDA 5FUIA 5I8SA 2A6VA 1QGLA 3OBAA 4NAOA 1BBT1 1ENXA 5FXZA 4OYUA 5IAXA 4BJ0A 3OGVA 1O8PA 3JBG3 4IEOA 2FBEA 4QGNA 4A41A 1OVSA 3Q9OA 3WP3A 2AREA 2JENA 3E97A 1WW4A 4AAPA 5SV8A 1RUJ2 2HBUA 1GOFA 5IVYA 3Q8CA 2R063 3UGGA 1OH3A 4E4DX 2OPWA 3B7MA 2RDSA 1ULEA 3D0SA 3RJ2X 5FXXA 4HETA 4AHYA 2ZHLA 4C0BA 4DY3A 3C8XA 3J8F1 1IOAA 1F8VA 1D4M2 2W9XA 4P9YA 3ZVXA 3H1WA 2EAKA 1NLSA 1F31A 2GNMA 5A1FA 4J6GA 1XJAA 5EJ1B 3VD7A 4XABA 2BOJA 4OLLA 5H9QA 2P6CA 4U36A 1RC6A 3T2TA 3VDDC 2VQTA 2DBNA 4D7YA 2AGSA 4B4PA 2OX0A 3LCPA 4Y1YA 2D6KA 1NY71 3WW4A 3VKNA 1VLNA 1RJ8A 4AGRA 5TSWA 4FQZA 4HBNA 1COV2 5CFCA 4CUAA 2X09A 1EAH2 3SH3A 1C8NA 2EIEA 3D0JA 3N9MA 4N9IA 3AZXA 3UGFA 2WAAA 4AQ6A 1VBE2 2WFF2 5JXGA 1W6OA 3NMBA 4B4QA 3N9PA 1QKQA 5F5CA 3IPVB 1MS0A 4LK7A 3VD3A 1RUE3 2BZDA 1H6YA 1ODMA 3O0VA 1CVNA 2AH2A 2CYFA 3CBNA 2PHLA 1O3RA 3ST7A 3KHBA 3OD0A 4AQSA 3IWZA 1W8NA 3NVCA 1DIWA 1N1YA 2GMPA 3VBHA 3ZXJA 4C8DA 1JBCA 2D6OX 5JI7A 1NA1B 5K8SA 1S0FA 3ZYBA 2G9ZA 1NLQA 1L7QA 3IMMA 1RHI2 4YW2A 3C3VA 4FCAA 4OZXA 3VBOB 3KVAA 2HWE1 5BV6A 3I2IA 3S0MA 3DXTA 2XB6C 2PFWA 4IXLA 5A7QA 5A7SA 1J84A 3SQOA 2W2IA 3OGJA 1ZRRA 2KR2A 4X8PA 1UY3A 5FMOS 4HKLA 3WG1A 1B35C 3TOJA 2J1SA 4D6SA 5CISA 2GSYA 2VUJA 2RS53 1DZTA 1ZNPA 5A7OA 5FZAA 2QQOA 4NVPA 1UAIA 4E2SA 1ZZ7A 1YJLA 3FFQA 4AVCA 5FMDA 3LWCA 2Q8DA 5LRSA 5IVEA 3VD4A 1PZ7A 1ZBE3 4WM8A 3JXSA 1E57A 1U5IA 2HWB1 2GNTA 4LQRA 5A32A 4UW6A 1R081 3H1YA 1BVVA 1YQ8A 3WXPA 3AP4A 1YWKA 5FUPA 3ZSEA 1NYWA 3HBZA 3AMPA 2KD7A 4Z2AA 3EBRA 4I02A 3U14A 3VBFA 1W0OA 1RUI2 1OQDA 4JGYC 4Q29A 1APNA 3ACFA 1QWRA 2VXJA 2WNVA 3LAGA 5EPAA 1JI6A 2OT7A 2R073 4MGYE 4PQQA 2OXBA 1AL22 1O59A 3WNXA 2Q1ZB 2H0BA 1UY0A 2HEWF 4LBMA 3ZYHA 5BPXA 4A3XA 3T4HB 3TN93 4JVAA 4N7UA 4IEQA 4K20A 4LOTA 1AVBA 5FCCA 1YI9A 3ZDVA 5JPNB 3O1SA 3J4UH 1QJX3 4A45A 1R092 2TBVA 4B8EA 3POJA 2J7MA 3BB6A 3IDAA 4CP9A 5DZEA 4DZGA 5K0UB 5IK7A 2RJLA 1Y9GA 1AR93 4Y1UA 1UPIA 2WNUC 3E1F1 4LXLA 2YG0A 1BEV2 2RS32 2VC9A 1PVC3 3IB3A 4W8JA 2DCJA 5FZBA 5C6CA 2ZHKA 3JCIA 4NHMA 3RFRA 1PHMA 1DF0A 2P3JA 4UXAA 1MEC1 4IEWA 3FFZA 3I4IA 3PUHA 4ASMB 1B09A 2O1QA 4P9JA 4XJUA 3WP4A 4DB5A 1TNRA 2HYKA 4QPYA 5GLWA 1EY2A 2NN8A 2W1UA 3DUIA 4FAHA 1PK6A 4GWNA 3VB9A 5BNNC 1Z7S2 2ZZJA 3AP5A 2GZWA 4CYDA 5IVFA 5F6LB 5BUVA 2ADEA 4OUSA 2QUOA 1PIV1 4BLJA 3ZKUA 2G19A 2HWF1 1GSLA 1UYPA 5DG1A 3K4AA 3VBUB 4OQ8A 2ZBJA 1DG6A 4AGVA 1UKRA 2NZ9A 3H8OA 4R9AA 4NJ4A 4IL7A 2JE8A 2AACA 3I59B 1GYKA 2QJVA 2R042 4XFCA 5C4WA 2Q0AA 5EYYA 2BVVA 1ASJ3 1UYXA 1W6MA 5AFEA 5C9AC 2PLV1 2Z2SB 3LDBA 1DDLA 4M3CF 4QQPA 4XF0A 4E8CA 2Y0IA 5F1RA 5HV4A 4QKBA 3MLKA 4LR4A 1DQ1A 1PVXA 4Q27A 5K9YA 4COYA 2JDNA 4PIYA 3GJBA 3APBA 4FOWA 4PLNA 1QXJA 1W05A 1QU0A 4LMFA 5IATA 1WMXA 4OHYA 1ZBA3 3HPNA 3OYWB 1UOJA 2EF6A 3MGUA 1UX6A 4AVSA 2I45A 1NT0A 3MHZA 4URAA 4AVTA 2GP5A 3ZN5A 3VDDA 4AHWA 1SEFA 4XUNA 5IT6A 3WVJA 3T2QA 1HN0A 1N3PA 5JR2A 1QH6A 4HVRA 4UI9L 4AL9A 1PO12 2P2KA 2QZ2A 4BQXA 2E53A 3LFMA 2DTYA 1OD5A 3ZFGB 4EYUA 1W9YA 2XDVA 2YDEA 4RS5B 5FKCA 4Z8BA 1MS1A 1CJDA 1S0CA 2IVJA 4XURA 1JS9A 4CUCA 1NQDA 1H8TB 1URXA 1X50A 2PTMA 1JOJA 4MXVA 1LHUA 4PDWB 3JQXA 5FYBA 5LBFA 1BHGA 1US2A 3HJRA 1OLME 3POSA 1K12A 5CG9A 1UD1A 2G4IA 3SNMA 2QQNA 4FT8A 5BNPB 1JN2P 2GC1A 3MLLA 2XWJB 4MOAA 2ZGTA 4RR3C 3R4SA 2XKPA 4Y1XA 5GLTA 2E51A 5GJ6A 1NLRA 2V72A 4DMIA 4EN9B 4LO4B 1AF9A 2C9KA 4XCBA 5DG2A 4XETA 5F8PA 2WT2A 4CDUC 5BYNA 3GF6A 3T0DA 1BMV2 2XG3A 5E88A 4Q4Y2 4UFIA 1PO23 1AJOA 3FLRA 2XUEA 3HT2A 5JXHA 3BKZA 3M2MA 3PTRB 4LEJA 5A7NA 2KA3A 2WA4A 5FXWA 1JH5A 5IW0A 4KBBA 4Q4V2 4LJHA 5A1AA 1B35A 4B1LA 1GMMA 3KV9A 3IMNA 2XBO2 2WZR2 1US3A 3AVSA 2BERA 4EE2A 1A6CA 2ERFA 3PMSA 5C8CB 3E6CC 5GKAC 3PDQA 3I3EA 1PZ8A 2I74A 5EWSA 2WR9A 3UYJA 1MQTB 1V0AA 1V6MA 3DYPA 2PYTA 2XL7A 1DQ2A 3VDBA 5ACA2 5J36A 1RUF2 4EWEA 3GZTB 4I0BA 4YRDA 2D7FA 3GGLA 4C0HA 1WMDA 4JGYA 1F35A 4IV3B 2BNNA 3GALA 2X5IB 1TEIA 4MG2A 4QX3A 4P00B 1EYBA 2QBXA 3LQCA 3N4MA 1LOGA 4M3CB 1HQWA 4UWDA 5I0RA 3BPSA 2WINB 4LO6B 2AEZA 4XOGA 3WLUA 2OKXA 3PUAA 2WS92 3NJXA 2HEYF 2J1EA 4R9DA 1ULDA 4XCAA 2VZ1A 2R071 3LEIA 5EQUA 5LB6A 4BOWA 3H7JA 1UOBA 4C1XA 4CXYA 4QX5A 5JSPA 2VCCA 3RNSA 4Q26A 2ZGLA 2PA7A 4UFJA 2X53S 5T5JA 4DQAA 5FWEA 4CCDA 5A6YA 1I1EA 3S30A 2ZJCA 3SKJE 3WT3A 4DUVA 3ALQA 4GMP3 1GZTA 1RUD2 2Y26A 3ILNA 2W91A 5FZOB 2ZKLA 1FOD2 5IVJA 2WNUA 4HOOA 4RQPB 1MZFA 4QWNA 2P34A 3KT1A 1M06G 4PI2A 4PLOA 1QJX1 2VPVA 4K6BA 1C5HA 3CJXA 4NIHA 2F4LA 4E4HA 3HN1A 1UMZA 2NMNA 3OPWA 3FE5A 2JB8A 1X8EA 3MIDA 4RHV3 1VMFA 1YFUA 3D8CA 3Q8BA 3DPRB 4DY5A 1XYOA 2E32A 4KQ7A 4CPBD 4Q8KA 5HCHA 2LALA 4MYEA 5D21A 4NHYA 4ASLA 3AKPA 1CX4A 2O0OA 1ULOA 1W3VA 1OKQA 4DPNA 5BNNA 4HKWA 5JMCA 2PHRA 3OTFA 4TYSA 4BQ1A 2B7YA 5CKMA 1NG0A 4AZZA 4RFRB 1NE4A 2PHUA 2VH9A 2JDPA 2D97A 1ULPA 1S2KA 5AC91 1CZVA 1SPPB 1V6LA 1RMU2 4Q4X3 4CP2A 2ILMA 5HCAA 2WWJA 5KBFA 3VLBB 1XSRA 1G9BA 1YUDA 1OF4A 2CAUA 2GMMA 5JOYA 4EN8B 4CP1A 5HV0A 4NRQA 4C90A 2C0ZA 2CWMA 2QQIA 4BXFA 4BM8A 2UWBA 5C33A 5C9AA 1VRH3 3ZYJB 1BEV1 2NMOA 3LSDA 3NNFA 4ZONA 1HXS3 3D4KA 2PQQA 3RVHA 3FHQA 1D0HA 1LJ7A 1JHJA 2ZGRA 4HVOA 5FYMA 3O1PA 1TME2 1RUG2 1LOBA 4LKEA 4H55A 1VMJA 4R4XA 1M4WA 1J58A 1V6OA 1MPXA 1W28A 4BPZA 1GOGA 5IVCA 3SH5A 2Z79A 2GH8A 4HMZA 3KT7A 5GALA 4ZXEA 1W3XA 1WBLA 3LA3A 4H14A 3WDUA 1UU5A 1JZ6A 1SLBA 2CV6A 3ZFFB 2ATFA 1S0JA 1H9PA 1SMVA 2P17A 2WN2A 4XFFA 1RXGA 1RJ7A 3VV1A 1QY4A 3WNOA 2BQPA 5DUVA 4A3ZA 3P1IA 2ZGSA 3IIAA 4LKSA 3SKVA 2VVEA 1RVF2 2Z42A 3LDRA 3OOXA 3POBA 5IWFA 1UWWA 4HN0A 4JQTA 3DYOA 2OQ7A 2V4VA 5JUVA 3FWEA 1E5HA 1IZ3A 3WCSA 2ADDA 1IS3A 1SQ4A 1W03A 2ZXQA 4LE3A 1IS4A 3HBKA 3KZ4C 4YW6A 3SCGA 4BQ2A 3BU7A 3NV2A 2RDRA 5JZGC 4GA9A 1GU3A 1DLLA 4E4SA 1REFA 4XQ4A 3H8RA 1OOPC 5M0TA 5C3SA 5A3NA 3VUOA 1IQAA 4CDXB 2A7AA 2R0HA 2VCBA 1Q8VA 1AJKA 1AZDA 1BBT2 2JECA 3FZ3A 1G9DA 4ATFA 1OHFA 3LEGA 3ZR5A 1V9U1 1MVEA 4WBBA 1GZWB 4PBPA 5JWPA 1WLCA 4LIUA 1CAXA 4P5YA 5FPUA 3IN9A 2WUHA 1W6QB 1XC6A 3WG2A 3KB5A 4AEDB 4R8HA 2QNKA 2IFWA 3IDCB 3B9CA 2GN3A 4YVWC 3PLQA 1WKYA 4BIOA 3J8F2 3MPPG 2VJXA 3ITQA 4XMAA 5LBBA 3WF4A 3ZMNA 2RDNA 1G9CA 4XTMA 1GNYA 3USSA 1WW5A 1XXNA 3CZJA 2J1UA 5E8AA 3USUB 3WUCA 2FZ2A 1C8M1 2YGLA 3K3OA 4L9BA 2XL9A 1SHWB 3H0OA 4B3NA 1WLDA 4Y24A 4NUBA 2XONA 4KG8A 5DZFA 2VOVA 1H0BA 4LKDA 4FVVA 4YARA 5T5PA 1NY72 4YG0A 5ABJB 5JSRA 2CDPA 2Y6GA 2ID4A 4MZUA 1VBD1 3ZYRA 1GICA 3PJYA 4M00A 2ETEA 3WHTA 1QOTA 1DFQA 1HB1A 4Q0QA 2OW4A 3AMQA 1EUTA 2LW8A 2JG8C 2YMZA 4YW5A 1FMD3 3ZR6A 2V73A 4WM7B 3KMHA 1DQ5A 4ORFA 3AL6A 1BK0A 4IEZA 2XJQA 5T5OA 5DMYA 2QDNA 1H30A 3I2OA 5CFDC 2Y64A 4P08A 3RS6A 3LZZA 3H3ZA 1D7PM 4M4RA 5ERLA 3UK9A 5B4XA 1IGOA 1GBGA 4NOTA 4KWJA 4V2WA 3J9SA 1UKGA 3KSCA 4O9EA 4DFSA 2HWE2 1YQ2A 5DDJ3 5C3QA 3BODA 4HPKA 5J09A 4CDWB 1LODA 3TYJA 4LHSA 4LPLA 2VZTA 1RUOA 1QNWA 4CCJA 1WA4A 2VNOA 3H9AA 1OH4A 1L7RA 2DWRA 5F3GA 1UIJA 1KS4A 4LE4A 4QKNA 3HNMA 1WMFA 1GV9A 1VPHA 3MBWA 4OZOA 5LA9A 3MO4A 3GYDA 2HWB2 2ZKNA 4KG0A 1R082 5FZ6A 5HCBA 3VKMA 2VZOA 2HYXA 3ETQA 2DVAA 3NV3A 4L2NA 2BDRA 4ES8A 4ZS2A 3N9NA 1T6BX 2I2SA 3DKWA 4LBQA 3VBHC 2PHFA 4FTBA 4N43B 2Q1FA 1O8SA 2ZGOA 1QJU3 4JGZC 4LO5B 5E1RA 5IFTA 4N8MA 2BOIA 4Q4W3 5LA2A 3CJIC 1XQNA 4XVHA 4ZU4A 2E31A 4J1WA 2VMFA 2TUNA 1OPMA 4HZFA 2YBPA 4YNIA 4YZ4A 4OI1A 3RWKX 2DBIA 2VVFA 1RITA 3K4ZA 4KNCA 5FY5A 3WF0A 3LPFA 4DNYA 1D0GA 4Z1VA 3I2KA 4XDOA 4YVSC 3VBSB 4Y22B 4Y20B 5DAWA 5GZDA 3ZO0B 5K7PA 2UURA 1RB8G 2E6VA 5C3RA 1K45A 1F2NA 2D3RA 3SHRA 4QHBA 4C1WA 3I2GA 2XLGA 4GIQA 2FDJA 1HRV3 3MV11 2UYAA 3KLSA 2J1AA 1ZYBA 3GM8A 5F5IA 3K2OA 1NOVA 1D4VB 4BXSV 5DAQA 2EA7A 2V09A 2XLAA 1H4HA 2RS13 4S2HA 5FK7A 4I09A 5F39A 1VB2A 3BN6A 3SITA 1S1AA 3LB9A 3ZDSA 4GH4B 1C4RA 5CKQA 2QQKA 1VJ2A 3RI8A 3WSOA 2C24A 4V2VA 4W6XA 4H2AA 1MEC2 2BRTA 3PIJA 5FY8A 2VBBA 2WABA 3MW2A 5FP7A 4QAWA 1VBC3 2HWC3 5L7OC 2VE1A 1RUH3 2LM3A 4K7JA 2ORZA 2DUQA 2OZJA 4Z07A 3SISA 1NUKA 1KRIA 1DZRA 4IESA 5JZGA 2K2SA 4YZ5A 1PM4A 3NJYA 4X6RB 3WDTA 2PAEA 1PIV2 3CL1A 2D5HA 3NAPA 2HWF2 2QZ3A 4IQPA 4YM2A 2EXIA 2VBPA 1WCKA 2TEPA 1XSQA 2OQ6A 4IV1C 4LORA 5JSOA 5JOWA 3JB8A 5FPLA 1WCUA 2X5IA 1JW6A 2OIIA 4QMAA 2CY6A 3K48A 3O0WA 4M3CA 2BWCA 2PLV2 1CAVA 3IBMA 1VBB3 1R1A1 1RUC3 4JTNA 1POV3 4YVWA 3I7DA 3VZOA 1QQP3 1EPWA 1UXXX 2QQLA 4YGCA 3RRDA 4CUBA 5FZ4A 2Y6FA 4Y33A 3HOBA 1BXHA 5LK5A 1W6NA 2J42A 2FDIA 4XZUG 2ZEXA 1HV0A 2XJRA 3SEEA 1ND2C 3MEPA 2HJIA 4KH9A 1PK6C 2VZPA 2VG9A 2WDBA 3K46A 3OD4A 1SBFA 2A3XA 2RMU3 1LAJA 1A34A 3EXUA 4LTAA 3HD8B 1W9WA 3CHXA 4U2AA 3S5AA 4OI0A 1W8WA 4IEPA 4FTEA 1OPOA 1W90A 2W1WA 3H1MA 3WNNA 3OBTA 2XKOA 2VTXJ 2GP3A 5JMOA 2D44A 3KF3A 1LOEA 2JG8A 5GLUA 2WN3A 3IDEA 5C4WC 4KU7A 2GALA 3WQ0A 2GMEA 2XXZA 1OQEA 4JZRA 2A70A 2VMCA 1NXD1 1XRUA 3GHMA 3TNPB 4QQ2A 4MLOA 5CFDA 4DUWA 5A80A 4FI9A 5A7WA 5BNOC 1MR5A 3DV8A 2A3WA 3JB4C 1KD7A 4LHNA 2Q30A 5F7UA 3J7LA 4A44A 4UYBA 3GZEA 1IPJA 2D3PA 3O1TA 2FDHA 4JC1A 3FC0A 3POWA 4GB31 3O7OA 4KWUA 2NYYA 4G3YC 4NHKA 4XJ9A 2OUJA 5A33B 2ZMNA 2MEV1 2GAUA 4QGMA 1LR5A 5JIUA 3PNAA 1FYUA 5FZ8A 3TWIA 1C57A 1RYYA 2FMDA 2YROA 3OY8B 2OYZA 3CNAA 1Y9MA 4MSVA 3O1VA 4A4AA 2CSGA 3I97A 3KT4A 1FAYA 3ZSMA 2QQWA 5EP9A 3BALA 3H3UA 1TNFA 1Z0HA 3AKRA 4NWWA 3HWJA 4M4PA 5DQ0A 1XE8A 1UZYA 1JYNA 2C5DA 2W94A 3NRUA 4BISA 1TE1B 2VOTA 2YUEA 2Z69A 2KM2A 4P9XA 1UZVA 4AR2A 1CAWA 5KXBA 2E63A 3PVOA 3B01A 4AEMA 2ZZQA 4FPGA 1QNYA 4JGZA 1QOOA 3J7NA 4MGIE 3SEPA 1DQ6A 2C6SA 3CJIA 3ME2A 4OHWA 4QPIB 1RUJ3 3TNQA 4D3WA 4QDRA 2W87A 3OBZA 3AMNA 4BZ4A 3QH7A 4KGGA 5C5TA 1JODA 4YVSA 2JB4A 3VZNA 1D4M3 1NZCA 2QDRA 4QPGB 3T2OA 5H9RA 2WQ8A 1H2LA 2HEVF 5ANNA 1LHOA 4AWDA 1CJPA 2R072 1AR73 3I2DA 3PVBB 4SBVA 2DCYA 1O3TA 2XJTA 3ENRA 1QJY1 4FXKB 2ZGKA 4Y3OA 3AM2A 4W50A 5FZEA 5FMBA 5A3PA 4HKOA 1HRI1 4RYDA 1HRV1 3GBWA 1AX2A 3PVNA 4MH0E 5T5LA 3O1MA 1COV3 4O9GA 2BNOA 3AXDA 3GXUA 1IPKA 4FFFA 5IUQA 3JU9A 4ZS3A 5FYIA 1IS5A 1VBE3 2WFF3 2D40A 2YC0A 1GWKA 4LBOA 1W8ZA 2RE9A 1E5IA 1HIXA 1QJX2 1SLIA 1CONA 4K8FA 4K9SA 4ONUA 5I8YA 5KHJA 4DINB 1TMF3 2XJSA 3ZYGA 2WA3A 1F4HA 3M7AA 3M3IA 3NNLA 4I01A 5FO9B 3X29B 1PMHX 5L7OA 3KD4A 2B5HA 1WLWA 3RSJA 1K42A 1EV11 2VUDA 4B4RA 4CDQB 5KWRA 4LHKA 5FZ7A 1STMA 4YW7A 1RHI3 2Q8EA 4GAZA 2YPDA 1H1AA 3B93A 3W59A 4RR3B 5A1LA 3BCWA 4IEUA 1AXYA 4UF0B 4OUEA 5FDBA 1UX7A 1YRZA 2MNGA 4K1YA 4PI0A 4AHXA 4CDUB 4Z2WA 5AC92 1UPSA 1SFNA 2Y33A 2ZEZA 4IV1A 4NIIA 4AFDA 5AVAA 4CEYA 1AR63 1REEA 3K51A 1BQPA 3NL1A 3P3PA 1YC61 4IERA 1S0GA 5FFOC 2VBDA 2PQSA 1H8VA 2ORXA 2HKXA 1QEXA 2JIJA 2BJSA 5C3OA 3H3LA 4XBNA 4XFIA 1BZWA 2VOXA 3POYA 1S55A 4WVMA 1HQNA 2FDFA 1ZM1A 4CRQA 1X8MA 2VW1A 2VUCA 2W5FA 1CPNA 2B45X 5IK5A 1CAUB 3ZN4A 3O1OA 4LLFA 4IGOA 4FSJA 3WOGA 2DFBA 1X9TA 1VBB1 4I30A 1DYOA 1Y3TA 3UL2A 3JQWA 1ND2A 4HT1T 4KI5M 1UOGA 1QXPA 1SLTA 1XNBA 2ZMKA 4YLZA 1F9KA 1RUI3 1A78A 1EUUA 4L11A 2JEMA 3VHOA 1L3JA 1KFUL 2WZ8A 4YG6A 2QQVA 3WY6A 4IE5A 2JICA 1VMHA 2DUOA 5L73A 1NE6A 2RM23 3IZOA 1N1SA 3KCYA 2VL4A 3AP6A 5AVPA 3Q8FA 1ULFA 1YHFA 3K3NA 1CX1A 4JHTA 1AL23 3OGRA 3L2YA 4NO4A 1DGLA 3WINE 1WCQA 3DL3A 3NV4A 1F5FA 1ZRFA 3NNMA 3AFGA 3ACGA 4CU9A 1WGPA 4Y1VA 4CCCA 4A7KA 2CGOA 3JBG1 5J96B 5D8AB 2EXHA 4UW5A 3V56A 5BNOA 2VZ3A 3N7LA 3O14A 2WZPP 5F3CA 1NA1C 3ATGA 1LOCA 2VULA 4GKXA 1HB2A 4QKFA 1MZ5A 1FV2A 1V9U2 2R061 3PUQA 5J7MA 4MXWB 3VL9A 2JE7A 3ROUA 4WVVA 3VBOC 3KHCA 2ZCWA 4ZHNA 2JG9B 3M70A 2BGPA 2WAOA 4GQ7A 1ZZ6A 3MF6A 4RFT0 4OVEA 2RJ2A 3MIHA 1UO9A 4HK9A 4JHZA 4V1PA 4XJAA 3CZUA 2WSVA 3MIFA 4HK8A 3ZIXA 4BDVB 4CCOA 1QJZA 2JD4A 1W9SA 1G9FA 2LRPA 4Q0UA 5A6QA 3AP7A 3KGZA 4AFBA 2DU0A 1TVGA 5F32A 1YIPA 4C91A 5DAPA 5F3IA 3I2JA 1VAVA 5A3UA 2DVFA 3J26N 4N90A 1C8M2 2RR13 1RUNA 2EICA 1DYKA 1XU1A 5J1XA 1S0BA 2Y0OA 3AZVA 5C5UA 2A6ZA 4MGSA 2L9LA 2D6PA 2ZX4A 3HAGA 1NCRA 1O4TA 4MGKE 1VBD2 2R043 1MVQA 1W0NA 3ORJA 1RUE1 4CTEA 5DUXA 4XUTA 3HNBM 3PURA 1CD3G 3N7KA 2K0GA 2YFZA 1IKPA 3RZGA 4RD7A 5FP3A 1OSGA 1Q3EA 1UW8A 1GKBA 3OSDA 4FOVA 5J48A 1QIQA 3V0BA 3NV1A 2NM1A 4YYOA 3T3YA 3N7JA 3QACA 3I2HA 4ZZ5A 5FUNA 3VHRA 4XFGA 2VY0A 1W0PA 1JYIA 1JZ7A 4LK6A 2XJPA 4XHXA 5FOJB 1MZEA 2DTWA 3RZLA 2BW8A 5C70A 2Y6JA 2E7TA 5FQ0A 5KHGA 1WMEA 2DCTA 2ES3A 1PO13 2RS51 4Y26A 1AR71 2VTFA 4YZ3A 5FZFA 5IVVA 4J1XA 4M3CE 2WC2A 2G9FA 5J3UA 4DO0A 2A73B 4Z92B 4XUPA 5K0UC 2JIGA 3AXEA 3C7EA 1ZBE1 3VGIA 1G7YA 4DXTA 1OA4A 3AMHA 3B02A 1SLCA 5LEJA 1W8TA 2ZX1A 4PLMA 3T0AA 4FP2A 4CEWB 3T30A 2WO3A 3WF2A 4N53B 3I3QA 1V00A 3D5OA 2WRAA 3IT8A 2QVSB 3V0AB 3MICA 3OB8A 1JTZX 1VBA3 3LOBA 5KC6A 4FPCA 2B42B 1FI2A 1TMF1 4A7YA 1K5MB 5IAVA 2A3YA 4AK3A 2FDKA 3NW4A 2WL1A 4G4FA 5A3WA 1DQ4A 4FO9A 1LGNA 1YFWA 1Q8SA 3HT1A 4FFGA 5FYZA 1PMJX 3O12A 2E7AA 2ARAA 4XXAA 3TEZA 2LS6A 4Q4V3 3VBUC 1JZ3A 3DEMA 3T08A 1IQDC 4XAAA 2EIBA 4EZ4A 1W6PB 1N3OA 2WZR3 2C26A 3TN91 5FYUA 3IAPA 4FPOB 4XTPA 1XNAA 5FY0A 3JUUA 1AR61 4QX1A 3FLTA 5EJ3A 3WP6A 4AI2A 5F5QA 1ENRA 4MX3A 4ASKA 2QE3A 2XJUA 2MHFA 4BHPA 2XUMA 5JAXA 4EV0A 1G8WA 4XFAA 5FZDA 1AR91 5T52A 3SC7X 2CGNA 2YZ4A 4BMBA 1XPWA 1RUF3 1PVC1 3ES4A 4E8DA 5APAA 1N1VA 1SCSA 4LUKA 4JKLA 2ZHNA 3ZFEB 2EALA 2VAUA 4QB6A 4LBKA 3AL5A 1AYM3 5K4LA 1C3HA 5C7GA 1G9AA 2BGOA 2PELA 3MPBA 4ATEA 5CAZA 5FRAA 3R4UA 2YXSA 3OPTA 4IW3A 4BWOA 2D43A 2DVGA 5BNQA 2R0FA 1ST8A 3ZFGC 3WDXA 4RS5C 3TB0A 2ZGQA 5JXJA 5LY2A 4OHZA 5G05L 2RM21 2VMDA 2VR4A 1KEXA 4XIOA 4PDWC 5LASA 2R1BA 3LIHA 3ZSKA 3ZXFA 4JRLA 3IPVA 3O0XA 4FOYA 5CVRA 4ZU7A 1OVPA 2XPJA 4GULA 3MW4A 5BNPC 2IXIA 3HEIA 4YZ1A 2JDMA 4Q2FA 1FOD3 4JAAA 1ASJ1 1NA1A 2D3SA 5FZ1A 3P5BA 4AHZA 4NE9A 4DRVA 5B2GB 1VE0A 1Y9QA 4IGQA 3VBOA 1TQ5A 1S4CA 4AEJA 2A75A 5F9TA 1AUYA 2PN5A 3KV6A 4EQVA 3MYXA 3BPZA 2VOWA 4NIDA 3ELNA 4CXWA 1IG3A 4D8MA 1ZBA1 3GBFA 4H7MA 1R1A2 3SMHA 3FHIB 4GKYA 3VDCA 5FWJA 4M0NA 4MHRA 5CFCB 2Z5WA 1I6XA 1KJLA 2HWD3 4XJ8A 1J83A 3KS7A 2W39A 1XNKA 2VQ0A 3CIHA 3QBQA 1W6OB 1ND3B 3FL7A 4NIGA 5C8CC 3MV01 3NKGA 3PUIA 1JXNA 1GNHA 2VZUA 1KJRA 4AF9A 5JCTA 3VDAA 1XYNA 3PMEA 5CYYA 3UV9A 5HI0A 2P3IA 4YWAA 1RMU3 4WV8A 4GWMA 4LBNA 4LO7A 3VBHB 3SCFA 1JZ2A 2BV4A 2TNFA 1WW7A 1HX6A 3AYEA 5FP4A 3NAPC 4PBOA 3ZXEA 3A7QA 3I3DA 2RR11 3D6EA 3BOWA 1F15A 5CNAA 1EPZA 2XR4A 5EFUA 1QDOA 2EAAA 2X5IC 4WVWA 3GDBA 4MHUA 4ZU5A 3VL8A 1HJFA 3DN7A 3KQ4B 3NSTA 4FPKA 3ZLIA 3ZXGA 3IDBB 4S2DA 1TME3 1RUG3 4D0QA 1ALYA 1KS5A 1OFNA 4AI0A 3T09A 1LKNA 3WEZA 3WV6A 1PO21 1I5ZA 3O1UA 4HL0A 2WSUA 4QGLA 3WQBA 5DZGA 4A7ZA 3AYDA 3N9QA 4HN1A 4HVQA 4WM8B 3DYMA 2ZGMA 1VAKA 1H2KA 4W6YA 1OURA 3TAYA 2BFUL 5A32B 2XQRA 3FBYA 3TEYA 2DUPA 2DVBA 3MUY1 4GB32 5I0TA 2EVXA 2WYFA 1LOFC 4HXCA 4QDSA 5FO7B 2Y38A 1RVF3 5K0UA 4DXZA 1ZA4A 4RGAA 2MEV2 1MS4A 4XILA 2ZEYA 4XFBA 4RQPC 1C28A 3AK0A 2A1XA 3UKNA 4XUOA 1UZ0A 1XB9A 4IE6A 3C7GA 3VBFB 4E2QA 5A70A 2E26A 2B9VA 1BK1A 2WNVB 2ZPXA 1DQ0A 4MVTA 4OI2A 3W5MA 3D3AA 2BPA2 3NJZA 3LD8A 5FY9A 2F17A 3AMMA 1BBT3 2YC2A 3RPQA 2A71A 4FFIA 5DAVA 3ZN6B 3RZKA 4E4ZA 5FZKA 1UY1A 4SLIA 4DS0A 1IHMA 2ZTNA 4D94A 1VBA1 2W92A 4Y5TA 4F3JA 3LSEA 4G9SB 3U11A 3S57A 4A6SA 3PTYA 2VMIA 1AYN3 4QX2A 1RXFA 3R05A 4P14A 5F2SA 3VBUA 4AFMA 2FZ1A 5KHHA 3W58A 4CP9B 4D69A 2IC1A 2R1DA 3I59A 2QQMA 1DBNA 2E9QA 1X82A 1XNDA 3GZUC 1FPN3 4CU6A 2CDOA 2WQ4A 2VQAA 4LUMA 1IS6A 1VAMA 4EN7B 2F6BA 3K77A 4JCKA 3BYWA 1SCRA 1LU2A 2K46A 4UFHA 4GMP1 1UYZA 3B9IA 3GBGA 1SDDB 3C7FA 1KDMA 2QFEA 2YV8A 5FYYA 2YHJA 4RA0A 5FLJA 4COVA 1P8JA 2VGDA 2WLQA 1QJY2 3MW3A 3ZX7A 1OF3A 1C1LA 1WUVA 1W99A 2WT0A 2IXJA 1HRI2 4INDA 1V6KA 1CZSA 4CU7A 1HRV2 3A0NA 3VBRB 1XYPA 3OYWA 2BU9A 1V6NA 2W46A 3MIBA 5FZHA 3IIIA 2DDUA 4RHV1 2DCKA 5LWBA 1UZZA 1DGWA 3ZFFC 4O7XA 1W2UA 1GP5A 1NCQB 1R64A 4AQ2A 4YW3A 3RDIA 4HSLA 4Q1PA 2EXKA 4QHZA 4XDQA 1X7NA 3URFA 1W8UA 3WUDA 5ISLA 1AYM1 3ZFGA 3AJYA 3AX4A 4RS5A 5E89A 4DUXA 1OLQA 3ECQA 5FXVA 4AI9A 3AYCA 4HONA 1EV12 1H8TA 1NX9A 3C7OA 5GM0A 4ES9A 3SH4A 4UW3A 1YI7A 4PDWA 5LW9A 1UQXA 1W6MB 2ZACA 3WF1A 4AEKA 1OKOA 4Q4X1 3MIGA 4P02B 4RGGA 5FZ3A 2WZEA 2VVDA 4DXSA 2JD9A 3INAA 4GJZA 1UU4A 2VQUA 2ZGNA 5FV3A 5BNPA 1PZ9A 1ZRDA 2Q5TA 2JKXA 4CDXC 4X6QB 1MZ6A 2AYHA 3CLPA 2X29A 3W20A 3BTXA 1VRH1 3U78A 1VB4A 2ET7A 3JD73 1WLTA 1HXS1 3AP9A 1HDKA 3U0ZA 4XACA 1S0EA 3N9OA 2BVBA 2XHKA 1LOAA 3RWNA 2VMEA 3VDDB 5JDBA 5LK7B 5F6KA 4FXGB 3BTYA 4EZHA 1O3QA 3FLPA 1J3RA 5I91A 2AENA 4AGGA 2RHPA 2WJSA 2ZAAA 2Q8CA 2JDZA 1R083 4IEXA 1FX5A 4LBLA 5DUUA 5CB7A 3RZHA 4BIFA 3RI9A 3TEWA 4K21A 3VKFC 4QD2A 1OFSA 2J1VA 1LB2A 2W95A 5GZEA 1VBB2 2DV9A 4IE0A 1C5IA 1DGRA 2BUKA 5C8CA 3OUIA 2J1RA 3NKTA 4JTOA 4NR1A 2XWBB 4COZA 2HWD1 1NAEA 4XJWA 1ZVFA 1MQTA 4Y4RA 5FR3A 3MZHA 3CEWA 1SG3A 1XU2A 1WD4A 3WCRA 4AG4A 3ETPA 1RIRA 3VHNA 2V5DA 3T4VA 3H42B 4XQWA 5A7PA 5ABJC 1UYYA 1K5JA 1VP6A 1OI6A 2XMLA 1OBNA 1OD3A 3BIWE 3KVBA 1PGL1 1LGCA 1MS3A 4CEYC 4IV3A 2WWSA 3CQOA 2ARXA 3H8XA 1Y7BA 4NN0A 1WA6X 5FK8A 2LROA 4WM7C 4FPJA 4MO3M 1BLZA 2D6MA 1B35B 5C8WA 2WO1A 5FYTA 4QU1A 3JBG2 1RGSA 2J22A 1WCDJ 2JWPA 3FBMA 2VZQA 5JR7B 1SACA 4YGEA 1VRBA 2CTVA 4X8NA 2QCSB 3N35A 4NPMA 1LRHA 2R062 3N3HA 2PHWA 1HB4A 2GU9A 1S2EA 2QQPA 1GQHA 4CZSA 3HQRA 4BQWA 4M0HA 3U4XA 4AFCA 1N3QA 1LOFA 5F37A 1MEC3 2Y60A 5FZOA 5JVVA 5GZGA 3FX3A 2JDKA 3M3QA 1GANA 4OCTA 4ISRA 3T1MA 3UESA 2DCZA 4UBHA 3GCXA 4RQPA 1FNZA 5FYSA 1VIWB 3B94A 1LENA 3HNYM 1ZRCA 4AI1A 1POQA 1JU3A 1SFPA 1U12A 3OEAA 4JGYB 5FZLA 5KHIA 4IUGA 2AC1A 1PGW1 2VTXA 3DPRA 5KXDA 1PIV3 2HWF3 1J3PA 1MS5A 2PAKA 3CF6E 3FUOA 3J7MA 4YM1A 4LULA 3ZFEA 4K40A 3RQ0A 3WDWA 2W68A 2BP6A 2GC2A 4CCLA 2PMWB 1GZ9A 5A3MA 4XQDA 1N47A 1AR83 1FMD1 3A21A 4F7ZA 1RUE2 2VO5A 4N43C 4YFWA 2P3YA 3OJBA 1VR3A 2PLV3 4KWKA 1MACA 1SBEA 1SPPA 3ES1A 2WKKA 4IETA 4XC9A 2LTNA 3N36A 3R0RA 1S2BA 1UY2A 2WO2A 4FFHA 1RTVA 2R32A 4HLTA 1WD3A 2WNUB 1A8DA 3VBSC 2BNMA 2GN7A 3FJSA 1ODNA 2FCVA 1AYN1 1JUHA 2QTWB 1SBDA 4EWDA 1HJGA 5FPXA 3PL0A 4BK4A 2Y6HA 5DDJ1 1OMIA 3WW2A 4XF3A 1U0AA 1W9TA 3M3OA 1BKZA 2E33A 2XVGA 4NRMA 5LEKA 1FPN1 2CGPA 2X10A 2Y8KA 3ZXKA 3NO8A 1XE0A 3WNPA 3OG2A 1H1MA 2RS52 5FLIA 3WNMA 1AR72 3VZMA 3USUA 5BNNB 1CWPA 3OUHA 3ZYPA 4GXLA 4CP0A 5DUWA 4W4ZA 4L0PA 3VZLA 4TN7A 4S2GA 4XF9A 4PF1A 2X05A 4GH4C 1ZBE2 3ZFFA 5JOXA 3A4UA 1Y4WA 3THTA 1NCRC 2MPFA 1FNYA 2W1SA 4K1ZA 3ZOIA 4P9GA 2D98A 4OQ9A 2BYVE 3THPA 3FN9A 3THDA 1CESA 4WZFA 3UT0A 4PQ9A 3B69A 1C1FA 1UOFA 1ND3A 5T50A 2O14A 4GMP0 2FMYA 4IE7A 4UBGA 1QJU1 4OFGA 3ZYIB 5C9AB 4GZ9A 4Q4W1 4F83A 1TMF2 1W8HA 2JXAA 4AI3A 4MGTA 1IKQA 1ZREA 4LBJA 2W08A 3EHKA 4CPBA 3IM0A 3MFCA 4JRAA 3SXWA 5I0SA 4CDXA 1D2QA 4MGQA 2VZVA 2HLEA 2YBKA 3RYKA 2P6HA 4XEZA 3PVEA 2ZMLA 3UJOA 3O1RA 2NQYA 2P37A 4H7LA 2XVKA 5DABA 1JZ4A 1Q8PA 1GZWA 4KBZA 4EWAA 2OPKA 3TN92 1EAH3 3NQHA 5I0DA 3KV5A 4QM9A 4QXHA 5FIXA 3WDVA 4YM3A 1OC1A 1W6QA 3RYRA 5ACA3 5A6ZA 3IKWA 4AEDA 2SLIA 3JD71 1TZOA 4WZCA 4HANA 1AR62 1U5YA 2YGMA 2RS11 4E2GA 1LGBA 3FMGA 4GALA 4R52A 1W8OA 3DF0A 3NNGA 1AR92 3VZJA 1O3SA 1JU4A 1YEWA 1PM7A 4ZXKA 5A3TA 1X36A 2OS2A 1PVC2 1HB3A 1ZZ9A 4RSUA 1UNBA 1Q56A 5H9SA 1I9RA 5ANQA
chains in the Genus database with same CATH topology
2PHTA 3PHMA 1LHWA 5GLZA 5H9PA 1FT9A 4M01A 5JIAA 1GR3A 1VBC1 1CQ9A 2HWC1 1CR7A 1RUH1 1ZZBA 5ABJA 3DGTA 5T55A 4Y5Z0 3UKTA 2XVLA 4AQTA 4K3UA 4OHXA 2RM22 1CAXB 4WM7A 3RMXA 4NPRA 5LRRA 5IK4A 4AVBA 2CNAA 3BOPA 1BYHA 2GC0A 3ZN6A 4I0WB 4E9KA 3E5UA 3U10A 5FOBB 1ASJ2 1A3KA 1HLCA 1J59A 3H50A 1J1LA 4XHBA 4S2FA 1NXMA 2LUWA 4LBQD 1RUC1 1POV1 2IXKA 2OZ6A 3MI8A 5KC5A 4TSVA 1QQP1 3QCWA 2N7GA 2UY9A 4QM8A 4BMEA 4OUMA 1BVP1 4CDWA 2ET1A 3ACLA 1H4GA 2DURA 1ZBA2 1QXRA 5JI9A 3WD5A 5CU1A 1ENSA 1D2SA 1YCIA 2RMU1 4FQ4A 3M3CA 1SFYA 1O91A 1V6IA 4AW7A 2SBAA 4FBFA 5AC93 1YLLA 1XE7A 2ZOEB 3VBRA 3AZYA 4QQOA 1WBFA 1R093 4JDNA 2Q8OA 3ZXLA 1NCQA 1Z78A 1EP0A 2VUAA 4UW4A 1QOSA 2RR12 4N43A 4RL7A 3LA2A 1N1TA 1BEV3 2RS33 4QPIC 3UKVA 5CG8A 4HPKB 5A3LA 1RL3A 1AR81 4AE2A 5JLVA 5L36A 3VBSA 4Y22A 4Y20A 1GQGA 2WT1A 4QPGC 1G86A 4QQLA 4Q1RA 3HQXA 1PO22 4XF4A 4YFZA 5D1IA 1KDKA 3WP5A 3RJRA 3MDPA 2B8MA 1Z7S3 4OI4A 4I2OA 5EYXA 2DFCA 1FXZA 4R4ZA 4A2UA 2WIIB 4PIXA 3V64A 2YY1A 3AKQA 4AVAA 1U5ZA 4LBQB 5FMOL 4GH4A 4P9WA 4JV4A 3WR0A 1AXZA 1YFXA 2W52A 3BTAA 4XFHA 4EROA 5J37A 1PMIA 4PCRA 3QOPA 4MV2A 2YYOA 1H1IA 1QF3A 4CDQC 1CN1A 3I8TA 3KCCA 4XPVA 1RUJ1 3WHUA 5BXXA 1V9U3 1KFXL 4FOQA 2B9UA 2DU1A 4JQRA 4FP3A 1F5JA 1REDA 1VBA2 2D93A 1UF2C 3G6JB 2XH6A 1ONAA 1QMJA 5FO8B 1D4M1 4AVVA 4ISQA 4YZ2A 5I8TA 4I3PA 3S6PA 1QDCA 2OA2A 2D6NA 3WW1A 3ZMOA 1NQJA 3V65A 3ZIWA 3WW3A 1R1ZA 3VHPA 1PNFA 2ZHMA 4BCUA 2H6CA 3M1HA 3C2UA 5DXDA 3MFAA 4N7IA 3KM5A 1C8M3 1COV1 1EAH1 3OCPA 5EV7A 3ZXDA 1YYNA 1HKDA 3VN4A 1VBE1 2WFF1 4BLIA 1VBD3 1OLRA 3OPZA 2ZS6B 2B39A 4BYYA 5JZGB 2P3KA 4YW4A 4Q4Y3 3JZVA 1OQ1A 2VU9A 4RHV2 1OOPB 4YW1A 3KCXA 3SHRA 4B4RA 4EN6B 1GNZA 5J98B 2GNBA 3NAPB 1UIKA 5I93A 4FPHA 4FAGA 3TRSB 1HW5A 4EN0A 1AYM2 1FATA 1RHI1 1KQRA 5FAXA 2DF7A 1J1TA 4XMIA 2H6BA 5CBLA 4XZPA 2BFUS 3OF1A 2XBO3 4QU2A 1CAVB 1DYPA 1RINA 1SLAA 2PAMA 4Q4X2 1LHNA 1ZZ8A 4YVWB 3H8UA 5FLHA 2IFRA 1YFYA 5T3NA 3WQ1A 4FTSA 5D8AC 3FUQA 3ZSLA 1KXGA 1J3QA 2A6WA 4FPEA 2KXLA 1KITA 1W6NB 1VRH2 4L8QA 5ACA3 4DOUA 3QLQA 1ULGA 1HXS2 2D5FA 2ZX0A 4W65A 2W0XA 3SCHA 3GZAA 2O8QA 1XNCA 3UJQA 5E16A 2JG9C 4IEVA 4XXPA 3M8LA 3O5SA 5A33A 5GLVA 4Y1ZA 1BCXA 5FPZA 3GHNA 3LKJA 1LESA 5HBAA 1DGRN 1WCSA 1RUI1 2X8KA 2A6XA 1H9WA 3OY8A 1Q56A 4D7TA 3WG3A 2WS93 4ZKTB 3CO2A 2JG8B 2NPIA 1G6NA 4XBLA 2BTVC 2GDFA 1H8TC 3WX5A 4XW3A 1PNGA 3QD6A 1H2NA 3L9JT 2HWD2 1AL21 2C9AA 2EIGA 4PIZA 5GZCA 5CFDB 1S0DA 2Q1MA 1QH7A 1RUD3 1LECA 3KQRA 1POV0 4PJYA 1PGL2 4Q0VA 2YPJA 1U5XA 2IWGB 3AZZA 4QPIA 1LU1A 4R9BA 3E5XA 4KL1A 4Q8LA 1DU3D 5IK8A 4YSFA 1R091 3HR9A 2ENRA 1I3HA 1DHKB 2G9GA 4EJRA 4P5HA 4QPGA 4KWLA 4HFSA 2RS31 1OA3A 5CA6A 3NWKA 4PF5A 4L92A 2AR6A 4B7EA 4KU8A 1ZX5A 4XJZA 5I0UA 4ITCA 2IXCA 3HMYA 2JX9A 1MS9A 2R6QA 2XGXA 1QHDA 2A5ZA 2AUYA 1MQTC 3AYAA 1Z7S1 3P3NA 1LEDA 1CAWB 1AL0G 2H0VA 4H3WA 3W9AA 1BJQA 4JGZB 5BY5A 4FPLA 1O5UA 3PJQA 3CJIB 2ZGPA 4CEWC 2R30A 1LEMA 4IV3C 1PGW2 5CIRA 1MS8A 4N53C 2Q4SA 4AXOA 5KXEA 3MLJA 4YVSB 1Q5OA 2R041 1S0IA 3OBRA 1A8MA 1CPMA 3RYPA 4CDQA 3S7IA 3ZPYA 4AFAA 2OUHA 1JUIA 1K5MC 1O7FA 2V5YA 1HV1A 4R9CA 4AYUA 1FMD2 2JJ6A 4RR3A 2D6LX 1O5LA 4CDUA 1W39A 1UL9A 3I54A 1R1A3 2ZABA 1YIFA 3R6SA 4Q0SA 3EO6A 2B46X 2ZX2A 5FBZA 5T54A 4JDMA 2CL2A 2VECA 1YNAA 3VKLA 2JE9A 1AYN2 2BBVA 3EJKA 3OGGA 1AX1A 1PO11 5DDJ2 3L2HA 2CAVA 1O4ZA 2WNEA 2VXRA 4N9HA 3ZSJA 4XYXA 3RMYA 1FPN2 1UU6A 5L7OB 1CAUA 2WQZC 4OULA 4KGQA 2PHDA 3DPRC 2XJVA 4BE3A 2K9ZA 3B5LB 3ZFEC 1Y43B 1DGWX 3M4FA 2A6YA 2UU8A 3E5QA 2WFPA 3ILFA 2IXLA 2DYCA 4XBQA 4YGBA 4IV1B 1BMV1 4CEYB 1PGSA 1SLLA 2ARBA 4Q4Y1 2BWAA 2VNRA 4D7SA 1Q8QA 4MGZE 3J8F3 1QJU2 1AHSA 4Q4W2 3ILRA 3VKOA 4LLOA 2VNGA 4P9IA 4WVMB 1T6GC 4Q4V1 2JKBA 1CIWA 4GB33 5D8AA 4Z82A 2AZ5A 2XBO1 2WZR1 3T1LA 3G7DA 5HXVA 4LNVA 3AKSA 2MEV3 1WW6A 3D82A 3GNEA 1ND2B 4QQHA 4MXWA 1PK6B 4YGDA 2C1FA 4YM0A 5HCFA 5L19A 5GZFA 3LOIA 2VW2A 5JPMB 2JG9A 4Q0PA 4TWTA 2DVDA 3B3QE 5ACA1 1RUF1 1LHVA 3JD72 4DRRA 4P9LA 2RS12 1AXKA 1AX0A 4AI8A 5CFCC 2IXHA 3S7EA 4JDOA 2UWAA 4COWA 5C4WB 1DZQA 1ND3C 4LA3A 4LA2A 4B29A 1UN1A 1YJKA 5AFBA 2RJKA 4TLFA 3VZKA 3QH6A 4XIKA 4QT6A 5FREA 4IEYA 2PHXA 1VBC2 2HWC2 2WS91 1V70A 4Y4YA 1RUH2 2HWE3 3ASIA 3R4DB 5BNOB 1ENQA 2ZX3A 1ZZCA 4BA6A 3WDYA 2R16A 2UWCA 1VALA 2R49A 1LCLA 2GNDA 5JOZA 3LGRA 2VOKA 2UYBA 3H7YA 4HSJA 1RUD1 1FOD1 1LULA 1JHNA 1QJY3 4NHLA 2WLPA 4AEDC 5FTTC 2HWB3 1HRI3 3MIEA 3AB0A 3WZ1A 1GLHA 3E6DA 2NP0A 4LT5A 1GFF2 3M3EA 5EZWA 4WM8C 4WVZA 2IZWA 1RUC2 3E6BA 4COUA 3WQ7A 1QQP2 3A0KA 3HIFA 3CU7A 4I3GA 2BGCA 1HQLA 1V6JA 1NCRB 3ZXAC 1EV13 1SDWA 2O8OA 3VBFC 4F8AA 1RMU1 4CEWA 4URTA 2RMU2 2WNVC 2UY8A 1O4YA 4FPFA 4N53A 3V0AA 2EXJA 3AJZA 3V0BB 4TZDA 3SLIA 1GZCA 3AKTA 2GH2A 4W6WA 1ULCA 4LO8A 2I07B 1X33A 1K5MA 1YXWA 4I0AA 3MF9A 3RZZA 4BH9A 4E27A 1JYCA 1OOPA 2FQPA 4FPYA 3TBDA 4QXKA 2F4PA 5SV5A 1TME1 1RUG1 4YG3A 2BEOA 3KGLA 3LA7A 4MUVA 5KHKA 3B00A 5FQ0B 1UCXA 4L99A 4XF1A 1LTEA 1Q43A 1AR82 1FV3A 1YO8A 2XLFA 3N7MA 1W6PA 2VW0A 4CDWC 2FHRA 4META 4XE9A 4LHLA 3EQEA 1H2MA 2OVUA 3U07A 4NWVA 2ZAHA 2ZA9A 1RVF1 2NLRA 3AZWA 2ZGUA 4OHVA 5KXCA 3RG0A 1CGPA 1OA2A 3WG4A 5CADA 4B7KA 2E7QA 3VBRC 2CWSA 3AFKA 2GC3A 2VMGA 2VMHA 4L97A 5EXOA 1NCQC 2QKDA 5I8SA 2A6VA 1QGLA 1BBT1 1ENXA 4IEOA 3JBG3 2FBEA 4QGNA 3Q9OA 3WP3A 2AREA 2JENA 3E97A 1WW4A 5SV8A 1RUJ2 2R063 4E4DX 3B7MA 1ULEA 3D0SA 3RJ2X 4AHYA 4HETA 2ZHLA 4C0BA 4DY3A 3J8F1 1IOAA 1F8VA 1D4M2 4P9YA 3ZVXA 3H1WA 2EAKA 1NLSA 1F31A 2GNMA 4J6GA 4OLLA 5H9QA 4U36A 1RC6A 3T2TA 3VDDC 4D7YA 2AGSA 4B4PA 3LCPA 4Y1YA 2D6KA 1NY71 3WW4A 3VKNA 1VLNA 1RJ8A 4AGRA 5TSWA 4FQZA 4HBNA 1COV2 5CFCA 1EAH2 3SH3A 1C8NA 3D0JA 4N9IA 3AZXA 4AQ6A 1VBE2 2WFF2 1W6OA 4B4QA 1QKQA 3IPVB 1MS0A 1RUE3 3O0VA 1CVNA 2AH2A 2CYFA 2PHLA 1O3RA 3ST7A 3OD0A 4AQSA 3IWZA 3NVCA 3VBHA 1DIWA 1N1YA 2GMPA 3ZXJA 5K8SA 1JBCA 2D6OX 1NA1B 1S0FA 1RHI2 4YW2A 3C3VA 4FCAA 4OZXA 3VBOB 2HWE1 5BV6A 3S0MA 2XB6C 2PFWA 4IXLA 3OGJA 1ZRRA 4X8PA 5FMOS 4HKLA 3WG1A 1B35C 3TOJA 2GSYA 2VUJA 2RS53 1DZTA 1ZNPA 4NVPA 1UAIA 4E2SA 1ZZ7A 1YJLA 3FFQA 4AVCA 5LRSA 3LWCA 1PZ7A 1ZBE3 4WM8A 1E57A 1U5IA 2HWB1 2GNTA 5A32A 4UW6A 1R081 3H1YA 1BVVA 3WXPA 3AP4A 1YWKA 3ZSEA 1NYWA 3HBZA 3AMPA 3EBRA 4I02A 3VBFA 1W0OA 1RUI2 1OQDA 4JGYC 4Q29A 1APNA 1QWRA 2WNVA 3LAGA 2R073 4MGYE 1AL22 3WNXA 2Q1ZB 2H0BA 2HEWF 4LBMA 5BPXA 4A3XA 3TN93 4JVAA 4N7UA 4IEQA 4K20A 5FCCA 1AVBA 1YI9A 5JPNB 3J4UH 1QJX3 1R092 2TBVA 4B8EA 5IK7A 3BB6A 4DZGA 5DZEA 5K0UB 2RJLA 1AR93 4Y1UA 1UPIA 2WNUC 1BEV2 2RS32 1PVC3 2DCJA 5C6CA 2ZHKA 3JCIA 4NHMA 1PHMA 1DF0A 2P3JA 4UXAA 1MEC1 4IEWA 3FFZA 3I4IA 4ASMB 1B09A 2O1QA 4P9JA 4XJUA 3WP4A 4DB5A 1TNRA 2HYKA 4QPYA 5GLWA 1EY2A 2NN8A 4FAHA 3DUIA 1PK6A 4GWNA 5BNNC 1Z7S2 2ZZJA 3AP5A 2GZWA 4CYDA 5F6LB 5BUVA 4OUSA 2QUOA 1PIV1 4BLJA 2HWF1 1GSLA 5DG1A 3VBUB 2ZBJA 1DG6A 4AGVA 1UKRA 2NZ9A 4R9AA 4IL7A 3I59B 4XFCA 1GYKA 2QJVA 2R042 5C4WA 2Q0AA 5EYYA 2BVVA 1ASJ3 1W6MA 5AFEA 5C9AC 2PLV1 2Z2SB 1DDLA 4M3CF 4QQPA 4XF0A 2Y0IA 5F1RA 3MLKA 4LR4A 1DQ1A 1PVXA 4Q27A 5K9YA 4COYA 4PIYA 3APBA 4FOWA 4PLNA 1QXJA 1QU0A 4OHYA 1ZBA3 3OYWB 2EF6A 3MGUA 1UX6A 4AVSA 2I45A 4AVTA 3ZN5A 5IT6A 3VDDA 4AHWA 1SEFA 3WVJA 1N3PA 1QH6A 4HVRA 1PO12 2P2KA 2QZ2A 2E53A 2DTYA 1OD5A 3ZFGB 4Z8BA 4RS5B 2YDEA 1MS1A 1CJDA 1S0CA 1NQDA 1H8TB 2PTMA 1URXA 1X50A 1JOJA 4MXVA 1LHUA 4PDWB 3JQXA 3POSA 5CG9A 1UD1A 2G4IA 3SNMA 4FT8A 5BNPB 1JN2P 2GC1A 3MLLA 2XWJB 4RR3C 2ZGTA 5GLTA 3R4SA 2XKPA 4Y1XA 2E51A 5GJ6A 1NLRA 4DMIA 4EN9B 4LO4B 1AF9A 5DG2A 4XETA 4CDUC 2WT2A 5BYNA 1BMV2 3GF6A 2XG3A 5E88A 4Q4Y2 1PO23 1AJOA 3FLRA 3HT2A 3M2MA 4LEJA 2KA3A 2WA4A 1JH5A 4KBBA 4Q4V2 1B35A 3IMNA 2XBO2 2WZR2 1A6CA 2ERFA 3PMSA 5C8CB 3E6CC 5GKAC 1PZ8A 2I74A 5EWSA 1MQTB 1V6MA 2PYTA 2XL7A 1DQ2A 5ACA2 5J36A 1RUF2 3GZTB 4I0BA 4YRDA 2D7FA 4C0HA 1WMDA 4JGYA 4IV3B 2BNNA 3GALA 2X5IB 1TEIA 1EYBA 3N4MA 1LOGA 4M3CB 1HQWA 5I0RA 2WINB 4LO6B 4XOGA 3WLUA 2WS92 2HEYF 4R9DA 1ULDA 4BOWA 2R071 4C1XA 3H7JA 4QX5A 5JSPA 3RNSA 4Q26A 2ZGLA 2PA7A 2X53S 5T5JA 4DQAA 1I1EA 3S30A 2ZJCA 3WT3A 3ALQA 4GMP3 1RUD2 2Y26A 3ILNA 2ZKLA 1FOD2 2WNUA 4RQPB 1MZFA 2P34A 3KT1A 1M06G 4PLOA 1QJX1 2VPVA 4K6BA 1C5HA 3CJXA 3HN1A 1UMZA 2NMNA 3FE5A 4RHV3 1X8EA 3MIDA 1YFUA 3D8CA 4DY5A 3DPRB 1XYOA 4Q8KA 4KQ7A 2LALA 4MYEA 4ASLA 3AKPA 1CX4A 2O0OA 5BNNA 4DPNA 1OKQA 5JMCA 4HKWA 2PHRA 3OTFA 4TYSA 4BQ1A 2B7YA 1NG0A 1NE4A 2PHUA 2VH9A 2D97A 1S2KA 5AC91 1V6LA 4Q4X3 1RMU2 4CP2A 2ILMA 5HCAA 5KBFA 3VLBB 1G9BA 1YUDA 2CAUA 2GMMA 5JOYA 4EN8B 4CP1A 4C90A 2C0ZA 2CWMA 5C9AA 4BM8A 2UWBA 5C33A 1VRH3 3ZYJB 1BEV1 2NMOA 3LSDA 1HXS3 3D4KA 2PQQA 4HVOA 1D0HA 1LJ7A 2ZGRA 1TME2 1RUG2 1LOBA 4H55A 4R4XA 1M4WA 1J58A 1V6OA 4BPZA 3SH5A 2Z79A 2GH8A 4HMZA 3KT7A 5GALA 1WBLA 3LA3A 4H14A 3WDUA 1UU5A 1SLBA 2CV6A 3ZFFB 2ATFA 1S0JA 1H9PA 1SMVA 2P17A 4XFFA 3VV1A 1RJ7A 1QY4A 2BQPA 5DUVA 2ZGSA 3IIAA 2VVEA 1RVF2 2Z42A 4HN0A 3FWEA 1IZ3A 3WCSA 1IS3A 1SQ4A 4LE3A 1IS4A 3KZ4C 3SCGA 3BU7A 3NV2A 5JZGC 4GA9A 1DLLA 4E4SA 1REFA 4XQ4A 1OOPC 3VUOA 1IQAA 4CDXB 2A7AA 2R0HA 1Q8VA 1AJKA 1AZDA 1BBT2 2JECA 3FZ3A 1G9DA 4ATFA 1OHFA 1V9U1 1MVEA 4WBBA 1GZWB 4PBPA 5JWPA 1WLCA 1CAXA 3IN9A 1W6QB 3WG2A 3KB5A 4AEDB 4R8HA 2QNKA 2IFWA 3IDCB 3B9CA 2GN3A 4YVWC 3PLQA 4BIOA 3J8F2 3MPPG 4XMAA 3ZMNA 1G9CA 4XTMA 3USSA 1WW5A 1XXNA 5E8AA 3USUB 3WUCA 2FZ2A 1C8M1 2YGLA 4L9BA 2XL9A 3H0OA 4B3NA 1WLDA 4Y24A 4KG8A 5DZFA 2VOVA 1H0BA 4FVVA 4YARA 5T5PA 1NY72 4YG0A 5ABJB 5JSRA 4MZUA 1VBD1 3ZYRA 1GICA 3PJYA 4M00A 2ETEA 3WHTA 1QOTA 1DFQA 4Q0QA 2OW4A 3AMQA 2JG8C 2YMZA 4YW5A 1FMD3 2V73A 4WM7B 3KMHA 1DQ5A 4ORFA 4IEZA 2XJQA 5T5OA 2QDNA 1H30A 5CFDC 3RS6A 3LZZA 3H3ZA 3UK9A 1IGOA 1GBGA 4NOTA 4KWJA 3J9SA 1UKGA 3KSCA 4O9EA 4DFSA 2HWE2 5DDJ3 3BODA 4HPKA 5J09A 4CDWB 1LODA 3TYJA 1RUOA 1QNWA 1WA4A 2VNOA 3H9AA 2DWRA 1UIJA 1KS4A 4LE4A 1WMFA 1GV9A 3GYDA 2HWB2 2ZKNA 4KG0A 1R082 5HCBA 3VKMA 3ETQA 2DVAA 3NV3A 4L2NA 4ES8A 4LBQA 2I2SA 3DKWA 3VBHC 2PHFA 4FTBA 4N43B 4LO5B 2ZGOA 1QJU3 4JGZC 5E1RA 4Q4W3 3CJIC 1XQNA 4ZU4A 4J1WA 4HZFA 2TUNA 1OPMA 4YZ4A 4YNIA 4OI1A 2VVFA 1RITA 4KNCA 4DNYA 4Z1VA 1D0GA 3VBSB 4YVSC 4Y22B 4Y20B 5GZDA 3ZO0B 5K7PA 2UURA 1RB8G 2E6VA 2D3RA 1F2NA 4QHBA 4C1WA 2XLGA 4GIQA 3KLSA 1HRV3 2UYAA 1ZYBA 1NOVA 1D4VB 2EA7A 2V09A 2XLAA 1H4HA 2RS13 4S2HA 4I09A 1VB2A 3SITA 1S1AA