5I8YA

Strcuture of mouse acireductone dioxygenase bound to co2+ and 2-keto-4-(methylthio)-butyric acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i8yA00
4AVCA 5JAXA 4XETA 2XKOA 5FPXA 2C0ZA 3BALA 4QM9A 5E16A 4YYOA 4N9HA 2BNMA 3O14A 1YFUA 3M70A 1EY2A 1XE8A 1CAUB 3EO6A 3ES4A 5J3UA 1VR3A 2XKPA 3D0JA 4IEXA 4YRDA 5I0RA 1NYWA 4IESA 5I0TA 4ONUA 3KSCA 3IDCB 2PTMA 4KWKA 1O4TA 3PLQA 4MGKE 5EZWA 1I5ZA 3LZZA 1Q3EA 2Q4SA 1ZRRA 1VP6A 2PYTA 4YNIA 4I0AA 4IEZA 1YUDA 4MGIE 2GC0A 3L2HA 2OZJA 5T3NA 2FQPA 3SCHA 1ZZCA 1G6NA 4UBGA 1Q5OA 3JZVA 3OTFA 4HLTA 3B02A 3ROUA 1IPKA 1FXZA 4X6QB 2Q30A 2UY8A 2UY9A 3E6CC 1LR5A 3S0MA 1NXMA 4L11A 2P17A 1ZZ8A 4R52A 3U10A 1YFYA 3ETQA 2EVXA 2IXCA 4I02A 4XFCA 1ZNPA 4FAGA 5FPZA 2OZ6A 3H1WA 5KHHA 3PNAA 1ZRDA 1X8EA 4JTOA 1EPZA 1OFNA 3HIFA 3D82A 5D1IA 2GZWA 5BPXA 4AQ6A 1U12A 1PMIA 2PAKA 1CAWB 4P9GA 4HVOA 2VPVA 2Z2SB 4JV4A 5LRSA 4AQ2A 3LA7A 4WBBA 1YFXA 5E1RA 1RUOA 4EWDA 2IXLA 2ZKLA 3KGZA 2GH2A 1O3RA 3SCGA 2N7GA 1EP0A 2CAVA 2D5HA 4PIYA 5KBFA 2UYBA 4YSFA 2ATFA 4XFAA 2QNKA 3NJZA 2E9QA 2UYAA 1O3SA 1RL3A 4EWAA 4AVAA 4QGNA 4XF3A 1ZRCA 3DKWA 2XLAA 4Q29A 3BU7A 4RD7A 2EA7A 4ZU7A 2B9UA 2H6CA 1FT9A 4QMAA 4PIXA 5KHGA 3UKNA 4AXOA 4IETA 1GQGA 2D40A 4MUVA 5I91A 1X82A 3RYPA 1RGSA 4DINB 3OCPA 3IIAA 4B29A 4FT8A 2K0GA 5KHJA 2Y0OA 5I8TA 1VJ2A 1SFNA 4D7SA 4D7TA 3KCCA 4J1WA 1ZX5A 3RZZA 1YHFA 3WW4A 2I45A 1CAXA 4LUMA 2GC2A 2PHLA 4H7LA 2H6BA 4XFHA 3I59A 4Q0VA 3FJSA 5BV6A 3SXWA 4QX5A 3BPZA 3H3UA 3CLPA 4XF1A 2D93A 5CADA 4IERA 5I0SA 4GULA 5I93A 3HT2A 1Q43A 3FHIB 4MV2A 4O9GA 3CL1A 4KU7A 1ZZ6A 2BGCA 3NSTA 4WVZA 1WA4A 2K9ZA 2PQQA 5FQ0B 3EQEA 4HMZA 4LTAA 4QM8A 3BCWA 1CAVA 4XF0A 3EJKA 1X7NA 3HT1A 4E2QA 2OPKA 5JSPA 1ZZBA 4A2UA 2H0VA 4E2GA 4Q0PA 3OF1A 1GQHA 2B5HA 1OD5A 1UIJA 5BXXA 1YFWA 5C8WA 1ZVFA 4PJYA 1Y9QA 1UCXA 5JR7B 3S7EA 5AVPA 5C6CA 4MX3A 3WW2A 2HJIA 3IBMA 4UXAA 2F4PA 1X8MA 2MPFA 3U11A 3TNPB 3DN7A 4ZU4A 3OGJA 3QACA 1WGPA 3SHRA 2EAAA 1J3QA 4Q0UA 2BNNA 4I01A 3UKTA 1UW8A 2IXKA 4K8FA 3MYXA 1HW5A 4HN1A 4MZUA 3EHKA 4XEZA 3E6BA 1J1LA 3FWEA 2FMYA 1TQ5A 3PVBB 4XFBA 2BNOA 1NE4A 4HVRA 3UKVA 5J48A 3LA3A 4Q0QA 5HI0A 5JSOA 3LA2A 4IEWA 4JVAA 2WFPA 1DGRA 1O5UA 1H1IA 4WZCA 3ZDSA 3ACLA 3RDIA 2Z69A 4Z07A 4HSLA 1UD1A 1O3QA 1J58A 1CAUA 1DZRA 1V70A 4XFGA 3H50A 5J7MA 4QGLA 2ET1A 2VQAA 4LULA 3SCFA 4FBFA 4BH9A 3GBFA 1RUNA 4NVPA 1ZZ7A 1DZTA 2DCTA 2MNGA 2GC1A 3NKTA 4CYDA 2PHDA 5JCTA 4OLLA 3RYRA 4QXKA 3ELNA 2O8QA 5FLJA 1J3PA 2V09A 3D0SA 1QWRA 2QJVA 2O1QA 2XLFA 4F8AA 2B8MA 5I0UA 3S7IA 1LB2A 2ZCWA 3E6DA 3H8UA 4IEUA 4YARA 1L3JA 4O9EA 1RTVA 4KL1A 2XGXA 5I8SA 3E5UA 1SQ4A 4HN0A 3NW4A 4KWLA 4EROA 3H7YA 3SMHA 1UPIA 5EFUA 3RNSA 2ET7A 1J3RA 3VHRA 4KU8A 3CF6E 1I6XA 4HZFA 5LEJA 4E2SA 2XL9A 1SEFA 2VECA 2QDRA 3E97A 2PAEA 3U0ZA 3NL1A 5CU1A 5CVRA 4JTNA 4PIZA 1OI6A 4I3PA 2MHFA 3CO2A 3FZ3A 4UBHA 3N4MA 4LA3A 2GU9A 4F7ZA 2CV6A 1CAWA 4BYYA 1O5LA 1JUHA 3WW1A 4HVQA 3DL3A 5I8YA 5K8SA 4Z82A 1H1MA 4MGYE 4Q0SA 4X6RB 3KGLA 2PFWA 3DV8A 4I09A 4ZU5A 3H3ZA 1Y3TA 4I0BA 3MPBA 4META 1XRUA 4L2NA 2CGPA 1CGPA 3HQXA 1ZRFA 2QVSB 1XE7A 1CAXB 3LWCA 4XFFA 2KXLA 1EYBA 4N9IA 1LRHA 3C3VA 1DGWA 3I59B 1LKNA 1WLTA 3H1MA 4R8HA 3TNQA 2GC3A 2XHKA 3CEWA 3H1YA 1ZREA 2QCSB 1QXRA 3R6SA 5KHKA 4XF4A 1O7FA 3RYKA 3QOPA 4HBNA 2XL7A 4TLFA 3MZHA 4IEVA 3H9AA 2IXJA 3RPQA 4IEQA 3NVCA 2WC2A 1QY4A 5BUVA 4HSJA 3ST7A 3G7DA 2OYZA 3USSA 3CJXA 1CAVB 2BEOA 4J1XA 4XFIA 3GYDA 2HKXA 5FLHA 1O3TA 3KMHA 2IXHA 2IXIA 4ORFA 4LA2A 4XF9A 4LUKA 5KHIA 3LOIA 3MDPA 4QGMA 3FE5A 4IEYA 4MH0E 3LAGA 5FDBA 3FX3A 1CX4A 1FI2A 1OMIA 3FFQA 3EBRA 4MGZE 3I7DA 1ZZ9A 4LLOA 4AVBA 3BB6A 4BHPA 5F1RA 2ETEA 1IPJA 3WW3A 1YWKA 1YLLA 2BYVE 2OA2A 1NE6A 2CAUA 1J59A 2XLGA 2IC1A 5BY5A 3ES1A 4BIFA 2D5FA 4OFGA 5FQ0A 5JSRA 5LEKA 3H7JA 4EV0A 4IEPA 3E5QA 4I2OA 3OD0A 1QXJA 3IWZA 4FAHA 1RC6A 3I54A 4LEJA 1UIKA 2Q0AA 4KWJA 3M3IA 1PM7A 2PA7A 5LRRA 3IDBB 5FLIA 2PAMA 4IEOA 1NZCA 2GAUA 5FCCA 2Q1ZB 3E5XA 4EWEA
chains in the Genus database with same CATH superfamily
4GZ9A 3C8XA 4XETA 1R093 2C0ZA 3VKOA 1CR7A 3ORJA 1GYKA 1CX1A 4AEDA 4YYOA 1R64A 2QQIA 5GZDA 4A6OA 4CEYC 5J36A 2W87A 3R05A 2BNMA 1CN1A 2BTVC 3O14A 3TN93 3K4ZA 1H1AA 1LHNA 1CAUB 2FHRA 2XJTA 4OCTA 5J3UA 5LY1A 4W50A 5CKMA 3D0JA 1LEDA 4YRDA 1W0NA 1NYWA 2DCYA 2ZZJA 4IESA 3RSJA 5G04L 1UAIA 4V1PA 3IDCB 2ZGQA 5JOYA 4Q4Y3 5EZWA 1FNZA 2Q4SA 4PF1A 2MEV2 4NE9A 2VBBA 1OD3A 1VP6A 2D6OX 3UYJA 1Q8OA 1H4HA 4P02B 3POGA 1M4WA 4H7MA 2JIJA 4MGIE 4UF0B 3ZN6A 4HKWA 3G6JB 2OZJA 1MS5A 2FQPA 4RGAA 1NY72 3AP6A 5DAWA 5EJZB 1SBFA 4BOWA 2Y64A 1QMJA 4RN5A 1VRH1 4BK4A 5FK7A 2Y34A 4DMIA 2EXKA 4PLMA 3DYMA 3VB9A 1A8DA 1A6CA 1K45A 1US2A 1GWLA 2HWF2 1VBE1 2RS11 3RJ2X 1OH4A 1QOSA 3K4AA 4GWJA 2YC2A 4L11A 3HN1A 1NCRA 3OGSA 4RR3C 3VBRC 1WBLA 3LKJA 1GZWA 3AK0A 3ZFFC 3NNGA 2A3YA 3AP5A 5FPLA 4CP1A 1HB4A 3CHXA 4IDZA 4UFMA 4NHMA 4S2GA 5K0UA 4R52A 1IG3A 1F4AA 3U10A 5FP7A 3O7OA 2ARAA 4M0HA 3CDZB 5B4NA 1C4RA 3ETQA 3ZR6A 1N3QA 2EVXA 2IXCA 3OPZA 2F17A 2W1QA 4I02A 4QB6A 1BEV2 3U37A 1HQNA 1MQTB 2OZ6A 5AVAA 3VZKA 2W46A 3H1WA 4XABA 4WM7C 2WYSA 1X8EA 5IK5A 5FO8B 1JI6A 4AHZA 2ENRA 2R063 1OBNA 3B7MA 3HIFA 2GZWA 5IATA 1CIYA 5LA0A 4K1ZA 2R071 4AQ6A 5E6HA 4QPYA 2R30A 4NIGA 2Z2SB 4JV4A 1W28A 3WG2A 1K5JA 4AQ2A 3V0BB 1AVBA 1AR72 3I2GA 3PHMA 4IV3A 4CDQC 4M01A 1UYYA 1ND2C 3A4UA 5FYBA 3N36A 3WNOA 4W6YA 2IXLA 4EWDA 2BZDA 1UKRA 2GH2A 2EICA 2UWCA 4YVSC 5EPAA 1R092 5IHRA 2ADEA 4FQZA 4YW5A 3SCGA 4BB3A 5C9AC 4PIYA 4LLFA 2QQJA 5FZ4A 4DPNA 1NQDA 5FY9A 3WSOA 1I9RA 2UYBA 5FTTC 5FZ8A 3I8TA 5C4WB 2ZGMA 2W68A 1SMVA 1WWYA 1FNYA 2ATFA 2DUQA 5FZ0A 3ZO0B 2J1TA 4NIHA 3OYWB 4AI3A 1IKPA 1KGYA 2XJVA 4JDNA 1PVXA 5CG9A 1YQ8A 2PN5A 4AVAA 4QGNA 1HDKA 2ZGUA 5ACA2 4WM8B 3DKWA 3K46A 1Y9MA 2W08A 5FY1A 2B9UA 2H6CA 5FZDA 2VULA 1JZ8A 2HLEA 1CPMA 1W2AX 3OGVA 3SNMA 4AI0A 2R16A 4RFT0 2D40A 3OBAA 1YQ2A 5D2AA 4FPCA 2BOIA 3VL9A 2PXJA 3RYPA 4BZ4A 1RGSA 4C0HA 2NP0A 2RMU1 5FRAA 3WVJA 1MVQA 1DQ5A 3OCPA 3WDYA 4DINB 3UNPA 3CJIC 2K0GA 2Y0OA 3INAA 1AR93 2G4IA 4OI4A 4CEYB 1SFNA 5JSPA 1ALYA 4J1WA 1NY71 2BU9A 1IS6A 1NCQC 2WO7A 2I45A 5ERLA 4E4HA 4B4RA 4LUMA 4RGGA 1H6YA 1WW5A 3ALQA 1LJ7A 4H7LA 1WLWA 4HK8A 5FIXA 4AL9A 1IGOA 3ENRA 2QKDA 3I59A 1LHOA 2VZPA 4Y22B 5BV6A 4QX5A 2RJ2A 2Y0IA 3BPZA 3CLPA 3H3UA 3OBZA 4XW3A 4BXFA 5CADA 5I0SA 1D7PM 2AENA 4Q4W3 1BCXA 1D2SA 4GULA 1RHI3 2WBKA 5I93A 1BBT2 1MZFA 4O61A 1CIWA 2BERA 4K9SA 1HB3A 1Q43A 4IW3A 1UYXA 2EXIA 4CA9A 5BNNB 2VXRA 3CL1A 5GLTA 3ZSEA 5LW9A 5C9AA 2BGCA 2C6SA 3CQOA 4HPKB 4WVZA 1BEV1 2WINB 3NQHA 3PUSA 4LK6A 1PGW2 1QDOA 3EQEA 2JB4A 4HMZA 2Z4FA 1SPPB 1OOPA 1GFF2 2C24A 2KD7A 2VZRA 2Y6JA 4EZ4A 3HT1A 5EP9A 5A7PA 3KS7A 5DABA 1ZZBA 1W90A 2D3RA 4RR3B 1W99A 1XSQA 3VBRB 1LECA 3M8LA 5LBEA 3B94A 1OVPA 3VBSA 4E2GA 1UY4A 2YUEA 3NMBA 4PQ9A 3ZFFB 2VMHA 5ANQA 5F37A 3ACHA 1L7RA 5JMCA 1Z7S3 1VRBA 5HCHA 4JGYC 1FPN3 1W2NA 3AKSA 4AWDA 4L99A 1DBNA 5BNOC 2A6VA 4NHKA 5JXHA 3M3EA 1BZWA 1RUG3 1H2NA 3T0BA 4Z2AA 3EXUA 5AVPA 4ASMB 5C6CA 1XU1A 4A3ZA 3LE0A 3L9JT 3PL0A 4WM7B 4GB32 4QPGC 1JHJA 2GNDA 3IBMA 2XQXA 4I0WB 1S0IA 4UXAA 1ND3C 5IWFA 4BLIA 2XPJA 1X9PA 2MPFA 4XE9A 4YGCA 4FXGB 4NPMA 2VXJA 2XR4A 4S2DA 3ZYHA 2A3WA 1TG7A 3JQXA 2JG8C 3I3DA 2VOTA 4M4RA 3HQRA 5ACA1 3P5BA 1WGPA 4GJYA 4AHYA 4CDQB 2OT7A 1KS5A 2SBAA 1ND2B 2JD4A 2WNVA 4LIVA 4A41A 3C7GA 1UW8A 1H9WA 2IXKA 1W8NA 2V4AA 5L9VA 3MYXA 1RXGA 4YVSB 3KV5A 3HNMA 2P4EA 2WA3A 3MIBA 4HXCA 1GLHA 1W8FA 4YM0A 1QOOA 2Y6FA 1XB9A 4ATFA 4NN0A 4FOVA 4XFBA 1HRV3 1SCSA 1UZ0A 4GA9A 2WNUA 1DQ1A 1PX3A 1UPSA 4ET7A 3ETPA 3U14A 2WFPA 2DFCA 3J7HA 5FZOB 1EV13 4Y1VA 2DCJA 3ACLA 4GALA 1VE0A 3RDIA 5DMYA 4QPIA 2WZR3 2FZ2A 3IDAA 3NJYA 4NRQA 4YZ3A 1J58A 1O3QA 2NMNA 1XSRA 5FXXA 3VZNA 5JLVA 1VBC2 2XBO2 2E7AA 5LZ6A 4XFGA 4CCLA 4BQ5A 1JYXA 3DYOA 3FBYA 4INDA 4UFJA 1XNDA 1KFXL 2W95A 4FBFA 1MS0A 3GBFA 5FP4A 3VBOC 3TEZA 5ISLA 3PTYA 4NVPA 3ZIXA 1GBGA 3MO4A 2EALA 1ZZ7A 5HBAA 1VBB3 5FZIA 1D2QA 2PHDA 4OLLA 4JGYA 1TNRA 1XJAA 1BBT1 3KD4A 4LKFA 3CJIB 1RUE2 3ELNA 5BNOA 5TSWA 4CP9A 3AZVA 4FXKB 2ZACA 1J3PA 1VAKA 5C3QA 1QWRA 3UV9A 3VD7A 1UX6A 1C57A 2ZTNA 2ZX3A 1RUH3 1UYPA 1NCQB 3AM2A 2CDPA 1QNWA 5C5TA 2ZCWA 4FO9A 5JDBA 3NRUA 1PVC3 1C8M1 4JDOA 1PO22 5A3MA 2DURA 2D43A 1ND3A 3N9PA 5BNPC 3HAGA 3K51A 1D0GA 4MXWB 3JQWA 4ZY9A 5F6KA 1H9PA 2FBEA 4RSUA 1YQCA 1GR3A 1W9YA 1WW7A 1COV1 3K75B 4PCRA 1BK0A 3HEIA 5D8AC 4KWLA 3SMHA 4M3CB 4XDOA 4AGGA 5F39A 2WO3A 4GH4C 5LA1A 5A7OA 3IMNA 4WVVA 5APAA 4UWDA 1SEFA 1H8VA 2HWD1 3PU3A 1X9TA 4M3CF 4AVVA 2QDRA 3JD72 3ZXEA 4J6GA 1CVNA 2GN7A 3NL1A 4GB31 4MXVA 5CBLA 4JTNA 4C1WA 2R1BA 1D4VB 5F3CA 2EIEA 4IGQA 4RHV3 2XH6A 4ES9A 1QXPA 4EN6B 1O6UA 3BU0A 2CV6A 4Y20A 3VBHC 3BOPA 1JUHA 4HVQA 4K3UA 2YC0A 5A1AA 3MEPA 2ORZA 1IQDC 2X5IA 1QIQA 4A7YA 3DGTA 4OHVA 1Y7BA 1PZ7A 1RUF2 1UY3A 4QDSA 4TYSA 1H1MA 2VR4A 2F4LA 3AKPA 3M7AA 5H9PA 3LD8A 4X6RB 3KGLA 2B4KA 4YZ4A 1ODNA 3BPSA 3H3ZA 1CJPA 4I0BA 2ZZQA 2JKBA 5K9YA 3RI9A 4L2NA 5LA2A 2CGPA 4N7IA 4QPGB 2YG0A 5EYXA 4MGSA 5LWBA 4KQ7A 1XE7A 2LS6A 4XBQA 4QT6A 3LWCA 4TSVA 4XFFA 4COYA 2QQWA 1ZBA3 2KXLA 3FN9A 2GMPA 1QJU3 1VBA2 1QF3A 3DCQA 3MW2A 2JG8B 3PUAA 4UOJA 1LKNA 5AFEA 1W2TA 4QKBA 3RJRA 1WCQA 2VGDA 5FBZA 5CNAA 5CZKA 4R8HA 1VBC1 2DV9A 2XBO1 4FPKA 5BNPA 1WCUA 2A6XA 5FAXA 3LF7A 4QXCA 5KHKA 4XBNA 3T4HB 2BW8A 2ZX1A 3N35A 4Y1XA 2GNBA 1W6QB 5D8AA 3VL8A 1H30A 4C91A 2Q1FA 3WDTA 4ZZ8A 3NJXA 3O0XA 5FO9B 1R1ZA 2D6KA 1W6MB 1GKBA 2QTWB 3LSDA 2ZX2A 2FD8A 3P6BA 3ST7A 5AC93 1POV0 3G7DA 3I2IA 3I3QA 4E4DX 1WUVA 3USSA 1CAVB 5FZ1A 2X09A 1AL22 4QD2A 3T1MA 2OX0A 2QZ2A 2LTNA 1DF0A 2XMLA 5FLHA 5BNQA 4JDMA 2E7TA 4DUWA 2IXHA 5KHIA 1H6XA 4OZXA 2WS93 1YYNA 4QGMA 3O1TA 4QQ2A 1WA6X 1GQPA 3V0AA 3FX3A 3VBOB 4DUXA 3FHAA 1CX4A 1OMIA 4NJ4A 1UL9A 4XOGA 4E8CA 4OHYA 3BB6A 1OF4A 1X33A 4HOOA 3RZLA 4CEWB 4JX0A 1CPNA 2BUKA 5FZHA 5A6XA 2FZ1A 3AZXA 1FX5A 4CCOA 1A78A 1XQNA 3GCWA 3FUQA 2I2SA 1UOGA 1PK6C 4DY5A 2BDRA 3DYPA 3KV9A 4P9XA 5DG2A 5KXEA 5GZCA 4Z2WA 4GWMA 2VC9A 4N53A 1I3HA 4OUEA 4LK7A 4XMAA 3VHNA 3JD71 4N43C 4BIFA 4DIQA 2BBAA 5BY5A 5DAXA 2W1WA 1F5JA 2QQMA 1QGLA 4JGZA 4EV0A 1WMDA 4SLIA 5KXCA 5DDJ3 1AJKA 1STMA 1ZBE2 4XQ4A 1IHMA 4YLZA 2YROA 2GNTA 1RVF3 3R4DB 3K2OA 4YW7A 2WYFA 3W59A 1OURA 2RS33 1KEXA 5CFCA 3N9QA 1VB2A 3PMEA 4U2AA 4UFLA 1B35C 3M3IA 1PNFA 2G9ZA 2JDYA 2PA7A 3POEA 5JZGA 5F9TA 1YRZA 4KBZA 3IPVA 3MFAA 2XUEA 4FCAA 5LRRA 4CE8A 3IDBB 5L7OC 1XYNA 4GH4B 2B45X 5A33B 1NZCA 1RUF1 2GAUA 2Q1ZB 1RMU1 2WJSA 1O91A 3OB8A 2C4XA 5FZKA 5JAXA 3FLTA 2G19A 3GHNA 1UWWA 3VBUA 1MZ5A 2EXJA 4IV1C 2Z5WA 3I2DA 1LOEA 1ZBA2 2DYCA 2HWB1 4E27A 2C26A 2DVAA 1DHKB 5A32A 4XDQA 2UU8A 1ZM1A 1AR63 4XBLA 5ANNA 4AI1A 4XJUA 3D8CA 4DXRA 2XB6C 2A1XA 3ES4A 1WLCA 1VR3A 2XKPA 4LBNA 1K3IA 5IW0A 4IEXA 4QU2A 2VTFA 3N7JA 1VBA1 4QHBA 1LULA 4U36A 3VBHB 1MPXA 3KSCA 1W6PB 1NLQA 3PLQA 4DXSA 3GZUC 1VALA 1OQ1A 1ZRRA 3MGUA 4XJ9A 3RZKA 1E57A 2WT0A 1TZOA 4LE4A 1TMF3 5EHDA 3PVOA 5FKBA 2D6PA 2G1MA 1UMZA 2XOMA 5FOJB 1VMFA 4IEZA 3I2OA 2GC0A 3L2HA 4LBJA 1JZ4A 3OY8B 2CTVA 2FCUA 4HONA 5T3NA 4XIOA 4JZRA 2WQ8A 1LGNA 4CRQA 2VBPA 5DZFA 4LO5B 3WUDA 2AH2A 5CFDA 2ZJCA 1Q5OA 1DZQA 1GWMA 3ZXLA 3ABZA 3Q9OA 4HLTA 2VCCA 3B02A 3IKWA 1HRI2 1AL21 4Q4X2 3ROUA 5L73A 4AR2A 1D4M1 2Q30A 2UY9A 3E6CC 1LR5A 2ZX0A 1W6NA 2VNRA 3S0MA 2TUNA 4C1XA 3MICA 1N1VA 2VMDA 1C28A 5F3GA 3ZFEC 2HWC2 2QFEA 3ZXDA 2GN3A 2X8KA 1QHDA 4AW7A 4BMBA 1HQWA 1LU1A 3WQBA 4CCCA 1E5IA 5FY0A 5F6LB 5L7OA 1FYUA 4XTPA 1OUXA 1YFYA 4XFCA 5FPZA 4AEDC 5C71A 3WF2A 3LIGA 3N9OA 5JOWA 2VNOA 2ZGTA 3QBQA 4DXZA 2D97A 2ZEZA 1H2MA 1ULCA 1G7YA 2JDAA 4K21A 1V00A 3D82A 3L2YA 4XC9A 1POV1 2UWAA 1BVP1 2R043 4Q1RA 1OA3A 4AZZA 3AJZA 4E8DA 1CAWB 2VPVA 1E5HA 3AXDA 3NV3A 4H3WA 2RS52 5LRSA 1ZBE1 4B3NA 1QNYA 4WBBA 4Y33A 5E1RA 1RUOA 1F4HA 2NQYA 2O0OA 3O1MA 4LO6B 3PDQA 2WN3A 2J1EA 3P3PA 3VD3A 5CKNA 3KQ4B 2D5HA 5IVCA 3KB5A 3WV6A 1PK6B 5FZMA 5DAQA 3SLIA 1MVEA 3ZSJA 4YSFA 1DGLA 1I5PA 2RR13 3TB0A 5CEHA 1OUSA 3VD4A 4N43B 3CU7A 4D3WA 5JXJA 1RL3A 1GV9A 5C8CA 4RQPC 2ZXQA 1FAYA 2LW8A 4XF3A 3MFCA 4QPWA 3ZIWA 4IE0A 1ZRCA 1HN0A 1VBD3 4QAWA 2HBTA 1EUTA 1DGRN 3DXTA 4Q29A 1NCRC 1PX4A 2EA7A 4RD7A 3H8XA 4ZU7A 1W8UA 1B35B 1FT9A 2ADDA 1DCSA 3AVSA 4IE4A 3HD8B 2YV8A 1W9TA 2P3IA 4J25A 2VVEA 5IVBA 1UZYA 5HXMA 1M06G 4MUVA 5L19A 5I91A 5FYZA 3T2TA 1ASJ2 1MACA 2VL4A 4B29A 4IV1B 3J8F1 2C9AA 5KHJA 1R1A3 2JDNA 2LM3A 3I2FA 4LORA 4ZS3A 1SCRA 4D7TA 5HCAA 4YM3A 1ZX5A 3Q8AA 2D6NA 5JVVA 2WAOA 1HKDA 4FTEA 3VDDB 2WO1A 3WW4A 5ABJA 3JXSA 1CAXA 2YBKA 3K48A 1HV1A 4CU6A 2RM22 2DCKA 1HRI1 2PLV2 3OEAA 4QX7A 4LJHA 2CNAA 3BKZA 2ZGPA 2VMEA 4DEQA 4RS5B 1UXZA 3SXWA 4IV3C 1A3KA 2I74A 2XVKA 3OBTA 3C7FA 3PJYA 3LQCA 4XF1A 3SITA 1C5HA 4LBQB 3NWKA 1MEC2 3ZN4A 1JZ2A 2YMZA 5JXGA 1O8PA 2VUDA 2HWC1 4ZXKA 3S5QA 1JYWA 4PT6A 1ODMA 4L97A 2Q5TA 1GOFA 2VMFA 3I2KA 5FYCA 1BXHA 3DF0A 3D5OA 1G86A 1JUIA 3FHIB 4QXBA 1SLCA 1XU2A 4MV2A 4O9GA 3MBWA 4XAAA 5EJ1B 5H9QA 5FYVA 1GSLA 1ZZ6A 2HWE2 2BGOA 2R042 1HXS3 1W8WA 4TZDA 4YGDA 3NV1A 2PQQA 5KWRA 4W65A 1V6OA 1WBFA 5FQ0B 1MZ6A 3ECQA 4QDQA 3DECA 4EN0A 4H55A 3JBG3 2YFUA 1X7NA 2ZEWA 2ZKNA 1HJGA 4QXHA 2Q8DA 1IS4A 1FMD2 4RQPA 2RJLA 3MHZA 5F3EA 3W21A 5C3PA 5FWJA 3VD5A 3WEZA 1JS9A 3ZFEB 2CHHA 5DUXA 1QJX2 2JE7A 2VAUA 2VD7A 5FZCA 4LQRA 1GUIA 2RS51 4XILA 4AYUA 1GQHA 1AUYA 3VKFC 2B5HA 4HL0A 3K3OA 1HJFA 1PIV2 1UIJA 5G05L 4BA6A 1Y4WA 2QQVA 3WF4A 3ZVXA 4AHWA 2QDNA 5LK7B 4D6QA 1UCXA 2A75A 4A45A 2EIDA 5DQ0A 4FPFA 4AEDB 1MZEA 3H42B 3OJBA 3PUHA 4UT5A 5T50A 5B2GB 3O1OA 2HJIA 2H0BA 1CZVA 1E5RA 3MUY1 3WF1A 4G3YC 1OPMA 3SEEA 3WNXA 2F4PA 5FYMA 3KLSA 4RGKA 1QJFA 2F6BA 1AX1A 4NOTA 5LB6A 2G9GA 1UOJA 3U11A 2BGPA 3A7QA 4GKYA 4ZU4A 1GOGA 2OXBA 5F5AA 1A8MA 2VZSA 4P14A 1VB4A 2IVIB 4DOUA 2EAAA 3WINE 2DTYA 3VKNA 2BNNA 1HX6A 4CCKA 2R0FA 3UGGA 1W9WA 4ARYA 2YU1A 4K8FA 1PO13 1JW6A 3ZN6B 1YQ6A 4HN1A 1EAH1 1AYN2 1JXNA 2VZOA 3AKRA 1SHWB 3ZXJA 3AZYA 2RDQA 4CXWA 3E6BA 4W6WA 2E6VA 1G9AA 2WNOA 4LO7A 1RUD1 2WT2A 1ASJ1 5HXVA 1NE4A 4HVRA 5J48A 4Q0QA 3TN92 5HI0A 4Y5SA 3LA2A 4IEWA 5JSOA 4CDUC 3W20A 1DGRA 1O5UA 1H1IA 1WKYA 3ZDSA 5I0DA 1OOPC 3GCXA 2Z69A 4R9CA 1WMEA 3T4VA 1NCRB 3VHOA 1G9BA 2IUWA 4CDWA 3VBSC 1GZWB 2JG9A 2RM21 1D0HA 4XVHA 5FP8A 1IS5A 4Q4Y2 5GLUA 2JENA 2PLV1 3H50A 3UGHA 4GQ7A 4QGLA 2ET1A 2VQAA 5J7MA 3KHBA 1UN1A 2J1RA 3AMPA 5K0UB 1FV2A 1DYKA 4MADA 3UT0A 3U4XA 2JICA 2DWRA 3NNMA 1OC1A 1APNA 2QQUA 1DZTA 3OG2A 1MEC1 3NKTA 4CYDA 3WF3A 3D6EA 4K6BA 2BOJA 2MEV1 4IE7A 2XJUA 1HXS2 1NOVA 4O65A 2HWD3 4XPVA 3RYRA 3DPRA 3WHUA 1CESA 4LBMA 4COVA 2V09A 2X53S 4N8MA 4BU2A 4CPBD 4AEJA 2XLFA 4BQXA 4F8AA 3A23A 2FMDA 2HWE1 1NG0A 4NRPA 5I0UA 2ID4A 4Z1VA 4QHZA 2W92A 5GZGA 5HV4A 3E6DA 4LHNA 5F3IA 3ZXFA 2P5BA 3VZJA 1NA1C 4TLGA 5FPUA 4MGTA 1L3JA 2VOWA 3FMGA 1N1TA 5FXVA 1GZCA 4IV3B 5C7GA 2WFF3 1LOCA 3KV6A 1FMD1 3S6PA 2XGXA 5I8SA 2WNVC 4ISRA 4BLJA 1YI7A 2HWF1 1SQ4A 4FFIA 2GP3A 4CDXC 4HN0A 4QX0A 5LASA 3HBZA 3NW4A 2RDRA 3N9NA 1QJX1 2Y26A 2YHJA 2VQ0A 1LNSA 2D6MA 2NPIA 2YB7A 5FKCA 4D0QA 3SH4A 2DUPA 3ZFGC 1KRIA 1PIV1 4FOQA 5EFUA 1V0AA 2YC4A 1PZ8A 4KU8A 4QX8A 1C1LA 4X8NA 4HZFA 4Y1YA 3ZSLA 5LEJA 4XZUG 5C70A 2D6LX 3GHMA 5H9SA 2WNUC 4QQLA 2NN8A 3KCYA 2VECA 1LOFC 3BOWA 3GZEA 2AZ5A 3E97A 4CUCA 5LCWL 2R062 2PAEA 3U0ZA 5CU1A 1RITA 1TE1B 1OVSA 3K4DA 4GIQA 4QPIC 4YW1A 2WUHA 2DBIA 4CDUA 1CZTA 1LENA 2MHFA 3CO2A 4JRLA 5A7QA 3VZLA 1F2NA 4UBHA 1UMIA 3HOBA 4A6SA 1YNAA 4LA3A 2GU9A 1LCLA 4CSWA 2JDUA 5F5QA 2VMGA 3FUOA 2Y60A 2Y8KA 1O5LA 5IAVA 3WQ7A 3WW1A 3NNFA 3DL3A 3VBFC 2BBVA 4XJZA 1OXCA 5I8YA 2GDFA 2A71A 5A70A 1QJY3 1VAMA 4Z82A 1ENXA 2A73B 1AR71 4TXWA 2J1VA 4CP0A 5C3SA 4MGYE 5IT6A 4A42A 1L7QA 4P5HA 4TTGA 4LKSA 1Y3TA 3ZYGA 1AYN1 1TEIA 1XXNA 1QJEA 2NMOA 4META 1XE0A 5IVJA 3MV01 1R091 2EXHA 4UI9L 4CVUA 2BVBA 3PURA 4BQ1A 5JMOA 5C9AB 5CKQA 3HQXA 4YW2A 2B39A 3IZOA 4FSJA 2RDNA 1KXGA 2DVDA 5J96B 3WDVA 4EN9B 1SFPA 3AFGA 4N9IA 2V5DA 2D3SA 3MLLA 3ACIA 4CP2A 1DGWA 3I59B 1ONAA 1LOAA 1Y9GA 4X8PA 1NA1A 1VIWB 2ARBA 3TNQA 4BQ4A 5FYHA 3CEWA 4I30A 4Q4Y1 3H1YA 4YW3A 4BJ0A 3RZMA 5T55A 2WIIB 3WCSA 1EPWA 2XL7A 3CZUA 1LEMA 2CGNA 2DCZA 1XNAA 1SLAA 3Q8EA 5FPAA 4CDXA 4FPLA 2J22A 1GNYA 4CCMA 1I1EA 1IOAA 2WLPA 4QWNA 3AYAA 3O5SA 1UX7A 2FCTA 3N7MA 3NVCA 3M3CA 5FK8A 5E88A 2PHTA 1AR92 2VH9A 1PZ9A 3ITQA 4IGPA 3ZFGA 1AHSA 1W39A 2G9FA 2ORXA 3AL5A 4HSJA 5BUVA 4SBVA 2DU1A 4C0BA 1NUKA 1DDLA 1AX2A 2OYZA 1FOD3 2WWJA 4HKOA 3WQ0A 4J1XA 4S2FA 1AX0A 1OOPB 1U5YA 4L92A 4YVWA 1AYM3 3GM8A 5EWSA 4A3XA 4S2HA 3RI8A 1LOFA 2KR2A 1JN2P 5FYYA 2D3PA 4FPGA 3A22A 3GDBA 4LA2A 3C7EA 4XF9A 3D4KA 5A3NA 3VBSB 3MDPA 3CNAA 2B9VA 1YC61 3CKHA 3AYDA 3T30A 5EQUA 4MH0E 2VU9A 2ZHNA 4FQ4A 1AR83 3LAGA 4NWWA 4DY3A 1ZYBA 4FOWA 4Q4W2 2X5IC 1RHI2 4NPLA 3HMYA 3TRSB 3I49A 1ZZ9A 3POWA 4LLOA 2QQPA 2WAAA 1RMU3 3VBFA 1UOFA 1QQP3 3U1XA 2PELA 5A3LA 5IK8A 1GMMA 4Q2FA 1YLLA 4WVWA 2W39A 4B4QA 5DUUA 2OA2A 1NE6A 5CYYA 1NT0A 1SLTA 4CCJA 1FV3A 2XLGA 5A3OA 2IC1A 1JMUB 4AI8A 3LDBA 1HQLA 1N3OA 3B00A 3S5AA 5KXDA 2BJSA 2VOXA 5AFBA 2D5FA 2W2IA 2R061 3RMYA 5FY4A 5JSRA 5LEKA 4KI5M 4Y26A 3LOBA 2XUMA 3B9IA 1OLRA 1PGW1 5E8AA 1HB1A 1GWKA 2A70A 2C5DA 3WCRA 4OYUA 4NUBA 4BQ2A 3T0AA 3PIJA 1S0FA 2WNVB 2C1FA 1RC6A 3I54A 4DB5A 4LEJA 1UO9A 4XUQA 1Z7S2 1UIKA 3AKTA 1DYOA 1XNKA 1FPN2 2CY6A 3TEXA 1XYOA 5FLIA 4COZA 1KFUL 2PAMA 1RUG2 3CBNA 1K42A 4IEOA 4JAAA 2AEZA 2WL1A 4A7ZA 5JIUA 4EWEA 2J42A 3JU9A 4OUMA 2UWBA 5T5PA 4WVMA 4ZKTB 1G9FA 3AYEA 4OMDA 5FZGA 3GNEA 2WNUB 4AVCA 5BYNA 3RZJA 3M1HA 2XKOA 3BALA 4BXSV 4K40A 1Q8VA 4UFHA 1K5MA 4QM9A 5E16A 2AREA 4BK5A 4E9KA 4QPIB 5FZ3A 1YFUA 3M70A 3E1F1 4OMCA 4PI0A 3LFIA 3EO6A 3TBDA 1GOHA 2XDVA 2VQUA 1JZ3A 2ZAAA 4ISQA 3KVBA 5FOBB 1JYCA 5I0TA 2VZ3A 3AJYA 1BLZA 1T2XA 2PTMA 2EIBA 5JI7A 5IK7A 4LXLA 1I5ZA 2HH9A 3LZZA 1GICA 2YPJA 3CZJA 5GKAC 1UU6A 1AXZA 2PYTA 2L9LA 1PHMA 2WR9A 1V9U3 4JGYB 1RUC3 3OOXA 4QX2A 3M3OA 2HEYF 1C8NA 5BNOB 3USUA 3PJQA 4CP9B 1REFA 1KD7A 3U07A 1HRV2 4BWOA 4DO0A 3MV11 4PHZA 1AYM2 3SCHA 1AR91 1OPOA 4UBGA 4Y4YA 5FV3A 4ES8A 1C3HA 1EV12 4N53C 2ZMNA 2WZR2 5IVYA 3JZVA 5IYYA 4JGZC 1ND3B 1U5XA 3UETA 1FXZA 2WZ8A 1FATA 4AFBA 1AR82 4X6QB 3GZTB 1BK1A 4LHLA 1NXMA 2E32A 5CFCC 3AMMA 4YZ1A 2P17A 3N7KA 1OLME 4XTMA 5JZGC 4F3JA 1REDA 2XJRA 1DIWA 2XVGA 1VBB2 4Q4W1 2IWGB 2A6ZA 4XQWA 1RHI1 4KH9A 4PDWC 4PQQA 3GALA 4AEKA 4XJWA 1OQDA 2ZS6B 4XUTA 3B9CA 1F31A 4RYDA 5DZEA 4DRVA 1RUJ3 1ZNPA 3VBUC 2DDUA 3I3BA 3U75A 1RUH2 1SBEA 1R083 1TME3 5FZEA 5KHHA 1W0OA 1RUE1 3PNAA 1S55A 3ON7A 3UJOA 1EPZA 1PVC2 1OFNA 1NKGA 5FZBA 3SC7X 4CCEA 4CCDA 1F15A 5GALA 1PMHX 1S0CA 3ZYRA 3OUHA 5FUPA 1LAJA 3M2MA 4Q4V3 3QCWA 4Y20B 2V72A 2PAKA 3AMQA 4KG0A 1YEWA 3I2HA 4LR4A 1RUI3 1AXYA 4K8RB 4AGVA 4NHLA 1PO21 2CSGA 2X5IB 3GBWA 3LA7A 2R0HA 3URFA 1YFXA 3THTA 1H0BA 3FHQA 4QKNA 1Z7S1 4TN7A 3O1SA 1FPN1 2PHXA 4EJRA 4IQPA 4PLOA 2YPDA 3MPPG 3SISA 1YJLA 4Y3OA 3J8F3 4OHZA 3FLPA 1RUG1 3EMRA 4DRRA 1DYPA 4JKKA 1RYYA 3AKQA 4P00B 4XJ8A 3V56A 2VNGA 3U78A 2GSYA 5T52A 2PQSA 4LOTA 5JUVA 5CFDC 3LFMA 1X50A 3GBGA 3MI8A 3MIDA 4JCKA 3J26N 4LPLA 4Q8KA 1O3SA 4RHV2 1W8ZA 3VV1A 4B4PA 4LOSA 2PHRA 3MW4A 2DVBA 4LO4B 4FFHA 2XLAA 3BU7A 5BNPB 2JDZA 4Q5OA 2W0XA 5A7WA 1CQ9A 1QDCA 1V9U2 3NV2A 4PIXA 4P5YA 3SQOA 2WO2A 4JQRA 4M3CE 4YPJA 5KHGA 4AXOA 1WLDA 2WT1A 5D8AB 2CWSA 1SG3A 2K46A 3NKGA 3W58A 3ILNA 2VM9A 3Q8BA 3N3HA 2XQRA 5F7UA 1UU5A 1S2BA 1H8TA 1REEA 1C1FA 5A6QA 5C3RA 1PGL2 4PDWA 2NZ9A 3WDUA 2VOKA 3ZN5A 4H2AA 3GF6A 5I8TA 1VJ2A 2YZ4A 3C2UA 4FPEA 4GD4A 1HRV1 4K1YA 2IVJA 1VRH3 5FMDA 5JI9A 1EV11 1GZTA 1QJU2 1QJZA 3D3AA 2WZR1 2GC2A 2W1UA 1VBE3 2RS13 4XUPA 4AAPA 2CGOA 2PHLA 4XFHA 2YFZA 4I3GA 3WP4A 3THPA 3V0AB 5FWEA 1YIFA 4C90A 2A5ZA 4LKEA 2J1AA 3WNPA 1G8WA 1XPWA 2AACA 5KXBA 3NV4A 1IG0A 4AK3A 3LB9A 2Y6GA 3HVDA 4ZXEA 1VAVA 3VLBB 3ZLIA 4V2VA 2CYFA 1W2OA 4CTEA 1GP6A 3HT2A 4M4PA 1KQRA 1Y43B 3VKMA 4EZHA 2Q8CA 5AC92 2ZBJA 5L36A 3BTYA 4Y5TA 2J1SA 3BVCA 4KU7A 3M3QA 5JIAA 2FDJA 1O4YA 3TAYA 4DXTA 4Z8BA 5FR3A 1YJKA 2A6YA 3NSTA 2WLQA 4N53B 2PHUA 1L7LA 4P9WA 2BQPA 1LHVA 1RUH1 1LESA 4XURA 3RMXA 4JGZB 4LTAA 4LBQD 2Y38A 3BCWA 4M00A 5C8CC 3O1VA 1O59A 2WS92 3JB4C 3EJKA 2R073 4XF0A 2TNFA 3WZ1A 1PVC1 4E2QA 4HANA 5LBFA 1XYPA 1S4CA 2WKKA 1UZVA 2RE9A 4L8QA 3VDAA 5DAVA 5CFCB 4Q8LA 2ZGRA 2W47A 2WDBA 5JZGB 2UURA 5JWPA 4Q0PA 2AR6A 3IPVB 2GALA 3OF1A 4K7JA 4NHXA 3W5MA 1OD5A 2VW1A 5FMOL 5H9RA 4O7XA 1YFWA 2ZGSA 5C8WA 1YXWA 4PJYA 3VGIA 1AZDA 4CU7A 4NWVA 5FZAA 3VBUB 3WG1A 4ASLA 2VO5A 4AEMA 5JXIA 1BJQA 2ZA9A 5A32B 4XCBA 4MX3A 5FPVA 3WW2A 3LGRA 5JOXA 2W94A 2EF6A 3UESA 5IK4A 3IIIA 3LPFA 1GP5A 1MS4A 5ABJC 3OGRA 5FUIA 4D6RA 4N7UA 4YW4A 5DDJ2 3BI3A 4NIDA 5SV5A 2X10A 4RHV1 5DUWA 1HIXA 3ZYBA 3OBRA 1RVF2 4C8DA 3AP7A 1DQ6A 2RS32 3NAPA 1ACCA 2QUOA 3QACA 3SHRA 1F9KA 1LTEA 4BCUA 4I01A 3UKTA 1HV0A 2Z42A 2BFUL 2ILMA 1W8HA 1WMFA 4D94A 1UNBA 2MEV3 1W6OA 4Z92B 1HW5A 2WNEA 4MZUA 2RHPA 1YO8A 2HEVF 1JTZX 1OHFA 1ULOA 2RMU3 4KGGA 3DKQA 4P9JA 2ZEYA 3WQ1A 4YWAA 4R9BA 3FWEA 4NHYA 2FMYA 3I3MA 1PGL1 1TQ5A 4LMFA 4B1LA 5CFDB 4YW6A 3KCXA 3AVRA 3B3QE 4GXLA 4V2WA 4W4ZA 1AR62 2AGSA 4JVAA 3AFKA 2V73A 1VPHA 2RS12 3GJBA 4WZCA 2E31A 3VN4A 4BE3A 3WUCA 2DVGA 3VDDA 3ZYPA 1ZBA1 4Z07A 4OI1A 1UD1A 1W6NB 4LHSA 1QJU1 2V5YA 1CAUA 4E4SA 4LBOA 1DZRA 1H2KA 2GP5A 3AMHA 4QX3A 1V70A 2HWF3 2KM2A 4GJZA 5GM0A 2XXZA 3OPTA 1RIRA 2ZGNA 1OA2A 4ARXA 3PU8A 1HN1A 4B7KA 1TMF2 4MYEA 1V6MA 1RUNA 2DCTA 2EIGA 4QDRA 4B1MA 2GC1A 5L7OB 3O1PA 3HNYM 1SDDB 4FPOB 4AVSA 3F2ZA 2ZMKA 3ZXAC 2VNVA 4EN7B 4NROA 1LGCA 4UF0A 2O8QA 3IM0A 5C4WC 4LIUA 1W04A 3R4UA 1SACA 5AC91 1BEV3 3ZXKA 1G9CA 2QJVA 2O1QA 1BQPA 3ACGA 4OI0A 2YBPA 3S7IA 2R1DA 3S30A 2ZPXA 3O0VA 5LA9A 4URAA 3WNMA 2OKXA 3WDWA 1RINA 4IEUA 4WM8C 1ULGA 3LCPA 3OUIA 3CIHA 5HCBA 2WS91 4DFSA 4OQ9A 4O9EA 2JDPA 3ZX7A 4W6XA 5CIRA 2B7YA 4Q4X1 1JYNA 1RTVA 2VW0A 1DGWX 2ZHKA 3OEBA 4KL1A 4KNCA 3I4IA 4AI9A 5JPNB 1RJ8A 4Y5Z0 2ARCA 4BQYA 1AR73 5F2SA 1J83A 2JECA 4EROA 2FDKA 3LEMA 4UW4A 5LBBA 3NNLA 4HT1T 2VUJA 3RNSA 4B7EA 2ET7A 1LGBA 1J3RA 1V6JA 1W03A 4R4ZA 2QQLA 4AI2A 2WABA 2QQOA 4XIKA 3AYCA 1SLLA 3SKVA 5SV8A 2WQ4A 4EN8B 1MQTA 2HYXA 2HBUA 1XNTA 4YZ2A 5C8CB 4GMP0 5T5OA 1UZWA 1RB8G 2WA4A 1NQJA 4QB2A 2VCAA 2YYOA 1YQ5A 3HNBM 4JC1A 3FZ3A 1IZ3A 1URXA 2OS2A 5GZFA 5HCFA 2Z79A 4CDWC 4CU8A 3MIHA 2JG9C 5DDJ1 3N4MA 3GZAA 5ACA3 1NXD1 1UKGA 5FPBA 1KDMA 3AL6A 1RVF1 3ASIA 1EUUA 4BYYA 2WQZC 1W06A 2JWPA 2RS31 4GWIA 3V0BA 2GH8A 2GMMA 2LUWA 2RMU2 4AVTA 4F83A 5K8SA 5DN2A 1GNHA 4MVTA 4MHUA 4XJAA 1BKZA 1V6KA 1ENQA 3I3EA 4Q0SA 2W91A 2OQ6A 4EQVA 2PFWA 3DV8A 1X36A 4CUBA 3DPRC 3HJRA 3POIA 2JIGA 1Z78A 5BNNC 1UZZA 3S57A 1O8SA 2JEMA 4Y24A 1DLLA 3KF5A 1XRUA 3MPBA 4G4FA 3THDA 1UOBA 3TYJA 2RR12 3WD5A 1GU3A 1HLCA 3T0DA 4MGQA 5LBCA 3I97A 5J1XA 2IZWA 2QVSB 5ABJB 5C4WA 1CAXB 1AR61 3PVNA 1DQ2A 1QEXA 3OYWA 1VBD2 3T1LA 1Q8PA 3H0OA 2DVFA 1LRHA 3ILFA 1NX9A 4JKMA 3ILRA 2B46X 4JHZA 2ZAHA 5FY8A 1WLTA 3T3YA 3ZM8A 5A3UA 5A6YA 5KC5A 4WM8A 5J98B 1UQXA 3H1MA 3J4UH 4GAZA 3MF9A 2A7AA 2GNMA 2GC3A 3UL2A 3OPWA 3DUIA 2QCSB 1QXRA 1UY2A 5F5IA 4XXPA 3KT4A 3C7OA 1ENSA 1WCKA 5K7PA 3R0RA 4ATEA 4TLFA 4UFKA 1TMF1 3MZHA 5DG1A 3PUQA 1PNGA 4IEVA 1PM4A 2IXJA 3H9AA 1BBT3 4IEQA 3RPQA 5D21A 4QQOA 1R1A2 3FC0A 4R4XA 3O0WA 3T2QA 4NIAA 4DS0A 2R7EB 2ZOEB 5F8PA 3V65A 2VZ1A 4ASKA 3A0NA 5LATA 1UYZA 3CJXA 2BEOA 4CEYA 4E4ZA 1YIPA 2HKXA 3KMHA 4OZOA 3K77A 4ZONA 4DQAA 1C8M3 1WCDJ 2IXIA 3Q8FA 4ORFA 2VUAA 2W52A 4LUKA 4RQPB 4BMEA 5A6ZA 4P9IA 2BPA2 3PMSA 2XVLA 3FE5A 4IEYA 3WR0A 1LU2A 4YFZA 2OUJA 1C5IA 5FDBA 5IFTA 1COV3 4Y22A 5FFOC 1V6LA 1FI2A 3FFQA 2XG3A 3POSA 4Q27A 5F1RA 4BHPA 3RQ0A 2ETEA 4KWUA 5FBJA 4FTBA 1W0PA 2P3YA 4BDVB 2WSVA 3BTXA 2BYVE 1DQ0A 3ZDVA 3B5LB 1QOTA 4LBKA 2CAUA 1ZRIA 4FP2A 5BNNA 2RDSA 2X05A 2BWCA 3WDXA 2YU2A 1B09A 4URTA 1UU4A 3M4FA 4GB33 4HPKA 3JBG2 3IN9A 3SKJE 1VMHA 4AF9A 1AL0G 2R041 1N47A 2DU0A 3H7JA 1W3XA 1SPPA 3OSDA 4IEPA 5F5CA 2R6QA 4A44A 4NAOA 3E5QA 1RXFA 3OD0A 2XJQA 4I2OA 2BP6A 1IKQA 1GANA 5IVVA 3N9MA 5FZ6A 4RR3A 3VBRA 4CU9A 1U5IA 4KWJA 1CWPA 3ZFFA 2Q1MA 3PTRB 4EYUA 1JU3A 4MOAA 2RVAA 1OSGA 3WP3A 4XUNA 4D8MA 4A7KA 1GZ9A 5J37A 1K12A 1LODA 4FI9A 4KG8A 4MLOA 1SZBA 3J7LA 5FPXA 2WN2A 1Q56A 5T5LA 2E53A 2O8OA 3R4SA 1GP4A 1GNZA 2JDHA 5GZEA 3WLUA 4N9HA 4YVWC 3ZSMA 2RR11 2QQKA 4HFSA 4WM7A 1EY2A 2XJSA 2AEYA 1DQ4A 1XE8A 5E89A 5HPOA 3MLKA 5KC6A 3KT1A 4RA0A 4CDWB 2FDFA 2JG9B 2NM1A 4Y1UA 1VBD1 5I0RA 4GMP1 2VZVA 3ZYFA 4ONUA 4NRMA 1VBC3 2XBO3 4KWKA 2Q8OA 1O4TA 3T08A 1WD3A 4MGKE 5CAZA 4CDQA 1Q3EA 1PO12 4NMIA 5IVFA 2J7MA 5A7SA 1ND2A 4YG6A 4YNIA 2D7FA 4OUSA 4XDPA 1CD3G 4XCAA 3KQRA 3LDRA 4FVVA 1PGSA 1OLMA 3DPRB 4I0AA 4IXLA 4YVSA 3WP6A 4COUA 1YUDA 2QBXA 5FYUA 5L9RA 1RUE3 3PVEA 1R1A1 4R9DA 3H8RA 1ZZCA 2A6WA 1G6NA 2DUOA 5EXOA 3PUIA 1DP0A 1KITA 1W9FA 3T2OA 1C8M2 4GKXA 2P6CA 1US3A 2W5FA 3UJQA 2P1BA 2P2KA 4ZZ5A 3TEWA 3P3NA 4LO8A 3KF3A 1VLNA 2Y6LA 2YXSA 3B93A 3OTFA 3VHPA 5FZOA 1BMV2 1IPKA 2YGLA 3AP9A 3TN91 3JCIA 1W05A 2UY8A 2VQTA 2CDOA 1COV2 1NZIA 3U4SA 1PO23 2JB8A 5C5UA 3POBA 3SH5A 4UW3A 4CPBA 1ZZ8A 4OHXA 1BYHA 5GLWA 2QZ3A 3IAQA 4K20A 1AXKA 5FJHA 2A3XA 4FTSA 2HWD2 4GWNA 4MG2A 3AZZA 4IE6A 3WNLA 1MS3A 2OVUA 3BIEA 1F5FA 2K2SA 4M0NA 1O4ZA 2Q8EA 4FAGA 1JZ7A 2IFWA 4N90A 3W9AA 3CJIA 1K5MC 4CZSA 2P6HA 4ZS2A 5LK5A 1HXS1 3RFRA 2VOVA 3IDEA 3IT8A 3WOGA 2JE8A 4JTOA 3WX5A 1ZRDA 2P3KA 3JD73 4CDUB 1N1SA 2HEWF 4AFCA 5D1IA 2J1UA 3X29B 3B69A 5BPXA 1NCQA 4KGQA 4NAMA 3JBG1 3BIWE 3EB7A 5JOZA 3POJA 1U12A 1PMIA 3ATGA 2WFF2 3GJAA 4OHWA 1KS4A 4P9GA 4HVOA 3RS6A 3TWIA 3ZKUA 4HG6B 5FZLA 2VZQA 2XONA 2RG4A 5EV7A 4MXWA 3Q8CA 3VD9A 5HV0A 2JXAA 3GGLA 4P9YA 2ZKLA 3KGZA 3WNKA 4MO3M 2YGMA 1O3RA 2WWSA 5A3WA 1RUF3 4ITCA 2VCMA 2ZMLA 2N7GA 1EP0A 4M3CA 4QHOA 2XJPA 5GJ6A 2CAVA 1MS9A 2E63A 1Q8SA 3C7HA 3JB8A 5KBFA 3DEMA 2LRPA 2HWB3 4OQ8A 3HN3A 2VCBA 2V4VA 3KM5A 3LSEA 4XHXA 1ENRA 2QNKA 3DXUA 4OI2A 3NJZA 4XFAA 2E9QA 2QE3A 2UYAA 2ZX4A 4PBOA 4EWAA 3BUCA 4Q26A 1ULEA 4AE2A 1POQA 1S0DA 4YGEA 1S0GA 5FYIA 5M0TA 2OPWA 3QD6A 2NLRA 4NO4A 4AAXA 1NA1B 1VBA3 1KJRA 3WF0A 2VUCA 2OQ7A 4QMAA 4TWTA 3BTZA 1DG6A 2JDMA 1QJY2 3UKNA 4CDXB 1T6BX 1W8OA 2XWBB 2VY0A 3K3NA 1NLSA 1J84A 4IETA 4CEWC 1GQGA 2VVFA 1PO11 1X82A 3MIGA 1XNCA 3ZFGB 4CXYA 2VTXJ 2WZEA 3KWVA 3IIAA 5FO7B 4YZ5A 4FT8A 5FZFA 1YI9A 4YVWB 4D7SA 3WXPA 3KCCA 3IMMA 1OA4A 3RZZA 4QPGA 4IL7A 4XYXA 1YHFA 1S2EA 1AL23 2WSUA 1D4M3 1QH6A 2PHWA 2QQNA 4XQDA 1MS8A 2H6BA 3RVHA 3POYA 1BMV1 4HK9A 2JG8A 1QU0A 4Q0VA 3FJSA 3VKLA 2VBDA 1OQEA 1S0EA 2D93A 4IERA 4LNVA 4QKDA 3VBFB 2KA3A 3AZWA 3B01A 1XBFA 1WW4A 3BYWA 3WG4A 3ZOIA 2CWMA 4CXXA 4QX1A 2BVVA 5FZ9A 5CG8A 3BN6A 2WWUA 1W6QA 2D44A 1JYTA 2VE1A 5FREA 3HWJA 4XZPA 2TBVA 1U0AA 1WZXA 2C9KA 2DBNA 3A21A 2WRAA 3ZYJB 1W6MA 1DLCA 1FOD2 4BISA 2JDKA 4L0PA 1JODA 1WA4A 2K9ZA 4KMQA 4DZGA 5IAXA 5A1FA 3ZYIB 4NIIA 4QM8A 1CAVA 1POV3 2D98A 2R49A 2W1SA 3QLQA 3NO8A 1HB2A 2IFRA 1OT5A 1XNBA 2E7QA 1MS1A 2OPKA 3LDKA 2VVDA 4MSVA 4PLNA 1S2KA 1S1AA 2O14A 5GLZA 2H0VA 4A2UA 1W8TA 3ACFA 4FFGA 2P37A 1ZBE3 2WFF1 3J7NA 3HBKA 3TEYA 3MUZ1 1RMU2 2DF7A 1QQP2 2JJ6A 3KVAA 5FYTA 3T2PA 4YGBA 3VBOA 3IAPA 3QH6A 1H8TC 5BXXA 1ZVFA 5DUVA 4WVMB 1Z0HA 2HWB2 4CEWA 1DFQA 3KV4A 1E5SA 1Y9QA 3RZHA 4FPHA 3H8OA 1KJLA 3AP4A 4ZPIA 2ES3A 5JPMB 5JR7B 3RGBA 2OIIA 4UFIA 3S7EA 1K5MB 3VUOA 3RWKX 2E33A 5CISA 2FDGA 2YY1A 4FOYA 1XOYA 4QQHA 1LOGA 1H2LA 2Y33A 1X8MA 3P1IA 3O1UA 3POFA 4H14A 2DTWA 4QKFA 3TNPB 3DN7A 2FDHA 4PF5A 3OGJA 4AOCA 1T6GC 3NJVA 2W3JA 1KDKA 4P9LA 4PI2A 1J3QA 4Q0UA 3W5NA 3KZ4C 3N9LA 4IUGA 2VG9A 1F8VA 1QJY1 3USUB 3KHCA 1JOBA 1LHUA 2GMEA 2CL2A 4BQWA 2VMIA 5FXZA 5KR7A 2DFBA 3EHKA 3I2JA 4GH4A 4Q1PA 1H4GA 2AUYA 1J1LA 3OGGA 3QH7A 4UW5A 4XEZA 5A33A 3ZMOA 4QU1A 2EAKA 2W9XA 3PVBB 5IVEA 2BNOA 5FMOS 3UKVA 3LA3A 4WV8A 1D4M2 2JD9A 4YFWA 1W2UA 4A4AA 2BV4A 4B8EA 2I07B 2ZGKA 1QH7A 3BTAA 3CMGA 3ZPYA 4HSLA 1N3PA 1OF3A 3AMNA 1SBDA 2OW4A 3N7LA 1HRI3 2X29A 4Q4X3 3ZMNA 3KT7A 1WCSA 4P08A 3WP5A 1SLBA 4BM8A 1AF9A 2R32A 4LULA 1UF2C 3AC0A 3ZPOA 3SCFA 3VBHA 1XC6A 4BH9A 1JYVA 3ZR5A 3THCA 2Y6HA 1W6PA 1N1YA 1RUC2 4XXAA 5A80A 2HWC3 1JOPA 5EYYA 2MNGA 5FJKA 1F35A 3J9SA 4LKDA 4AQTA 5JCTA 3WY6A 2VZUA 4L9BA 4QXKA 3RRDA 5A3PA 2B42B 1IS3A 4YM1A 3AXEA 1JBCA 4MHRA 4PBPA 5FLJA 1UY1A 3D0SA 5IUQA 5GLVA 2BFUS 4UAPA 1S0BA 3OY8A 4HETA 1PMJX 3SEPA 1FOD1 4AFDA 2B8MA 4LT5A 4WZFA 4XMIA 1LB2A 1AYM1 3FL7A 3HQUA 3UK9A 5FUNA 4OVEA 4W8JA 1UXXX 3MIFA 4EE2A 3H8UA 3VDCA 4COWA 4YARA 4R9AA 3NAPC 5DAPA 2BWAA 3AB0A 3JUUA 2VMCA 3O12A 1G9DA 2AYHA 4NPRA 1AR81 3E5UA 3PIGA 2HYKA 2RS53 1WW6A 1ST8A 2ZGLA 5EIYB 3H7YA 1Q8QA 2VJXA 1W9SA 4G9SB 3FBMA 1YCIA 5CA6A 3F95A 5FY7A 1QQP1 1A34A 1UPIA 1RUJ2 1VBB1 4YG0A 4KBBA 3VHRA 1U5ZA 1I6XA 3CF6E 4FPYA 4XAEA 3GXUA 5IFPA 4Y4RA 1AJOA 2NYYA 1R082 5A1LA 1TME2 4CUGA 4E2SA 5C33A 2XL9A 4LHKA 1ULFA 2ZEXA 1WD4A 2LALA 3VDDC 1S0JA 5CVRA 4PIZA 3VZOA 3HPNA 5FMBA 1OI6A 2WZPP 3WT3A 3IB3A 4Q4V2 4I3PA 1JYIA 3ZKYA 3NNJA 4JHTA 1RUI2 4NR1A 4FFFA 5A7WB 3ZSKA 4F7ZA 4RS5C 4HKLA 4IE5A 2ZHLA 1CAWA 3T09A 2P3JA 3LEGA 3WNNA 1LHWA 5J09A 4QB1A 1OKOA 2JX9A 5A7NA 3A0KA 5FY5A 2YDEA 1H8TB 5CB7A 5DPNA 1RJ7A 3J8F2 4QQPA 3BODA 4PDWB 1EAH3 1UMHA 2VW2A 4I09A 4ZU5A 2XWJB 4DNYA 4LBLA 4D7YA 5F2WA 1RUD3 4LITA 1ASJ3 2RV9A 1PK6A 2RJKA 3SH3A 2TEPA 1CGPA 2SLIA 1OLQA 2ARXA 1ULDA 5FYSA 1ZRFA 3LEIA 1JZ5A 1LOBA 3UGFA 3ZXGA 1W3VA 4FP3A 2YBSA 4N43A 2FDIA 1EYBA 1DU3D 3APBA 4LE3A 2Y6KA 4CUAA 1SLIA 3C3VA 5C3OA 5EJ3A 2FCVA 4DUVA 1SDWA 2RM23 4JRAA 4AQSA 2PLV3 3HR9A 1V6IA 5B4XA 2ERFA 1WMXA 2XHKA 2VZTA 1ZREA 5IJRA 3J7MA 3R6SA 4CCNA 4XF4A 1B35A 1O7FA 2ZHMA 3RYKA 3QOPA 2PHFA 3H3LA 4HBNA 4RL7A 2LROA 2P34A 4D6SA 4XUOA 1MEC3 1OH3A 1RUC1 1V9U1 1JU4A 3WG3A 2CU5A 3FFZA 2ZABA 2WC2A 1QY4A 4AHXA 5FZ7A 1ULPA 4AGRA 3VZMA 1MQTC 1VRH2 4IV1A 4JQTA 4YM2A 4YG3A 3RG0A 3FLRA 2E26A 2HWE3 1BVVA 1OFSA 4XACA 3TOJA 4XFIA 4D69A 3GYDA 4RFRB 1VBE2 1QKQA 1O3TA 1JHNA 1VMJA 3LOIA 3ME2A 5F32A 2JKXA 5A3TA 5FXWA 5T54A 5DZGA 1FMD3 3MF6A 5L9BA 4RS5A 1P8JA 2PMWB 1QJX3 3EBRA 3I7DA 3EYPA 3MLJA 4MGZE 5K4LA 1JZ6A 4AVBA 2OUHA 2XHNA 5FP9A 3RWNA 3MW3A 4LBQA 2JE9A 1JH5A 5T5JA 1IPJA 3LIHA 1PIV3 3LEKA 3WW3A 1YWKA 1TNFA 3BGAA 4UW6A 2BRTA 2ZGOA 1RUJ1 4BIOA 1OKQA 1IQAA 4AG4A 1BHGA 1UY0A 1J59A 3AX4A 3V64A 1R081 4AFAA 1TME1 4BPZA 3ES1A 2R072 5DXDA 4OFGA 3RZGA 1CJDA 1CZSA 4JKLA 5FQ0A 2AC1A 4GMP3 1IPSA 3NAPB 4Q4V1 1ZA7A 1QXJA 4ZHNA 5FMCA 5LY2A 5JR2A 3VDBA 1RUI1 3OD4A 3IWZA 4IGOA 5FP3A 4FAHA 2VTXA 1J1TA 4UYBA 1ZA4A 5K0UC 2Q0AA 3WHTA 1EAH2 1PM7A 3ZFEA 3O1RA 1W6OB 1NAEA 4Y1ZA 3MIEA 4AFMA 1MR5A 3OUJA 1CONA 1RUD2 4XHBA 1V6NA 4DEVA 1TVGA 2E51A 3LPGA 1NLRA 5FCCA 1SFYA 4BQ3A 3E5XA 1JOJA 4OULA 1AYN3 4FPJA
chains in the Genus database with same CATH topology
4XETA 1R093 2C0ZA 1CR7A 1GYKA 4AEDA 4YYOA 4CEYC 5GZDA 5J36A 3R05A 2BNMA 1CN1A 2BTVC 3O14A 3TN93 1H1AA 1LHNA 1CAUB 2FHRA 2XJTA 5J3UA 3D0JA 1LEDA 4YRDA 1NYWA 2DCYA 2ZZJA 4IESA 3RSJA 1UAIA 4V1PA 3IDCB 2ZGQA 5JOYA 4Q4Y3 5EZWA 1FNZA 2Q4SA 2MEV2 1VP6A 2D6OX 1Q8OA 1H4HA 1M4WA 4H7MA 4MGIE 3ZN6A 4HKWA 3G6JB 2OZJA 1MS5A 2FQPA 4RGAA 1NY72 3AP6A 1SBFA 4BOWA 1QMJA 1VRH1 4DMIA 2EXKA 4PLMA 1A8DA 1A6CA 2HWF2 1VBE1 2RS11 3RJ2X 1QOSA 4L11A 3HN1A 1NCRA 4RR3C 3VBRC 1WBLA 3LKJA 1GZWA 3AK0A 3ZFFC 2A3YA 3AP5A 4CP1A 4NHMA 4S2GA 5K0UA 4R52A 3U10A 3O7OA 4M0HA 1C4RA 3ETQA 1N3QA 2EVXA 2IXCA 3OPZA 4I02A 1BEV2 1HQNA 1MQTB 2OZ6A 5AVAA 3VZKA 3H1WA 4WM7C 5IK5A 1X8EA 5FO8B 4AHZA 2ENRA 2R063 3HIFA 3B7MA 2GZWA 4K1ZA 2R071 4AQ6A 4QPYA 2R30A 2Z2SB 4JV4A 3WG2A 3V0BB 4AQ2A 1AVBA 1AR72 3PHMA 4IV3A 4CDQC 4M01A 1ND2C 3A4UA 3N36A 4EWDA 4W6YA 2IXLA 1UKRA 2GH2A 2UWCA 4YVSC 1R092 4YW5A 4FQZA 3SCGA 5C9AC 4PIYA 4LLFA 4DPNA 1NQDA 1I9RA 2UYBA 5FTTC 3I8TA 5C4WB 2ZGMA 2W68A 1SMVA 3ZO0B 1FNYA 2ATFA 2DUQA 3OYWB 4AI3A 1IKPA 2XJVA 4JDNA 1PVXA 5CG9A 2PN5A 4AVAA 4QGNA 1HDKA 2ZGUA 5ACA2 4WM8B 3DKWA 2W08A 2B9UA 2H6CA 2VULA 1CPMA 3SNMA 4AI0A 2R16A 4RFT0 2D40A 4FPCA 3VL9A 4BZ4A 3RYPA 1RGSA 4C0HA 2NP0A 2RMU1 5FRAA 3WVJA 1MVQA 1DQ5A 3OCPA 3WDYA 4DINB 3CJIC 2K0GA 2Y0OA 3INAA 1AR93 2G4IA 4OI4A 4CEYB 1SFNA 1ALYA 4J1WA 1NY71 1IS6A 1NCQC 2I45A 4B4RA 4LUMA 4RGGA 1WW5A 3ALQA 1LJ7A 4H7LA 1WLWA 4HK8A 1IGOA 3ENRA 2QKDA 3I59A 1LHOA 4Y22B 5BV6A 4QX5A 2Y0IA 3BPZA 3CLPA 3H3UA 4XW3A 5CADA 5I0SA 2AENA 4Q4W3 1BCXA 1D2SA 4GULA 1RHI3 5I93A 1BBT2 1MZFA 1CIWA 4K9SA 1Q43A 2EXIA 5BNNB 2VXRA 3CL1A 5GLTA 3ZSEA 5C9AA 2BGCA 4HPKB 4WVZA 1BEV1 2WINB 1PGW2 1QDOA 3EQEA 4HMZA 1OOPA 1GFF2 3HT1A 3KS7A 1ZZBA 4RR3B 2D3RA 3VBRB 3VBSA 1LECA 3M8LA 3B94A 4E2GA 2YUEA 3ZFFB 4PQ9A 2VMHA 5JMCA 1Z7S3 4JGYC 1FPN3 3AKSA 4AWDA 4L99A 1DBNA 5BNOC 2A6VA 4NHKA 3M3EA 1BZWA 1RUG3 1H2NA 3EXUA 5AVPA 4ASMB 5C6CA 1XU1A 3L9JT 4WM7B 4GB32 4QPGC 2GNDA 3IBMA 4I0WB 2XPJA 1S0IA 4UXAA 1ND3C 4BLIA 2MPFA 4XE9A 4YGCA 4FXGB 4S2DA 2A3WA 3JQXA 2JG8C 5ACA1 1WGPA 4CDQB 4AHYA 1KS5A 2SBAA 1ND2B 2JD4A 2WNVA 1UW8A 1H9WA 2IXKA 3MYXA 4YVSB 2WA3A 3MIBA 1GLHA 4YM0A 1QOOA 4ATFA 4NN0A 4FOVA 4XFBA 1HRV3 1SCSA 4GA9A 2WNUA 1DQ1A 1UPSA 2WFPA 2DFCA 1EV13 4Y1VA 2DCJA 3ACLA 4GALA 3RDIA 4QPIA 2WZR3 2FZ2A 4YZ3A 1O3QA 1J58A 2NMNA 3VZNA 5JLVA 2XBO2 1VBC2 2E7AA 4XFGA 3FBYA 4INDA 1XNDA 1KFXL 4FBFA 1MS0A 3GBFA 3VBOC 3PTYA 4NVPA 3ZIXA 1GBGA 2EALA 1ZZ7A 5HBAA 1VBB3 1D2QA 2PHDA 4OLLA 4JGYA 1TNRA 3KD4A 1BBT1 3CJIB 1RUE2 3ELNA 5BNOA 5TSWA 3AZVA 4FXKB 2ZACA 1J3PA 1VAKA 1QWRA 3UV9A 1UX6A 1C57A 2ZTNA 2ZX3A 1RUH3 1NCQB 3AM2A 1QNWA 2ZCWA 4FO9A 5JDBA 5A3MA 1PVC3 1C8M1 4JDOA 1PO22 2DURA 2D43A 1ND3A 5BNPC 3HAGA 3K51A 1D0GA 4MXWB 3JQWA 5F6KA 1H9PA 2FBEA 4RSUA 1GR3A 5D8AC 1WW7A 1COV1 4PCRA 4KWLA 3SMHA 4M3CB 4AGGA 4GH4C 3IMNA 4WVVA 1SEFA 1H8VA 2HWD1 4M3CF 4AVVA 2QDRA 3JD72 3ZXEA 4J6GA 1CVNA 2GN7A 3NL1A 4GB31 4MXVA 5CBLA 4JTNA 4C1WA 2R1BA 1D4VB 4RHV3 2XH6A 4ES9A 1QXPA 4EN6B 2CV6A 4Y20A 3VBHC 3BOPA 1JUHA 4HVQA 4K3UA 2YC0A 3MEPA 2X5IA 4A7YA 3DGTA 4OHVA 1Y7BA 1PZ7A 1RUF2 4TYSA 5H9PA 1H1MA 3M7AA 3AKPA 4X6RB 3KGLA 4YZ4A 3H3ZA 1CJPA 4I0BA 2ZZQA 2JKBA 5K9YA 3RI9A 4L2NA 2CGPA 4N7IA 4QPGB 5EYXA 4KQ7A 1XE7A 4XBQA 4QT6A 3LWCA 4TSVA 4XFFA 4COYA 1ZBA3 2KXLA 2GMPA 1QJU3 1VBA2 1QF3A 3MW2A 2JG8B 1LKNA 5AFEA 3RJRA 2VGDA 5FBZA 5CNAA 4R8HA 1VBC1 2DV9A 2XBO1 4FPKA 5BNPA 5FAXA 2A6XA 5KHKA 4XBNA 2BW8A 2ZX1A 3N35A 4Y1XA 1W6QB 2GNBA 5D8AA 3VL8A 1H30A 4C91A 3WDTA 3O0XA 5FO9B 1R1ZA 2D6KA 1W6MB 1GKBA 3LSDA 2ZX2A 3ST7A 5AC93 1POV0 3G7DA 4E4DX 1WUVA 3USSA 1CAVB 4QD2A 1AL22 3T1MA 2QZ2A 2LTNA 1DF0A 5FLHA 5BNQA 4JDMA 2E7TA 2IXHA 5KHIA 4OZXA 2WS93 1YYNA 4QGMA 4QQ2A 3V0AA 3FX3A 3VBOB 1CX4A 1OMIA 1UL9A 4XOGA 4OHYA 3BB6A 1X33A 4CEWB 1CPNA 2BUKA 2FZ1A 3AZXA 1FX5A 1A78A 1XQNA 3FUQA 2I2SA 1PK6C 4DY5A 4P9XA 5DG2A 5KXEA 5GZCA 4Z2WA 4GWMA 4N53A 4XMAA 1I3HA 3VHNA 5BY5A 3JD71 4N43C 4BIFA 1F5JA 1QGLA 4JGZA 4EV0A 1WMDA 4SLIA 5KXCA 5DDJ3 1AJKA 4XQ4A 1ZBE2 1IHMA 4YLZA 2YROA 2GNTA 1RVF3 3R4DB 3W59A 2RS33 5CFCA 1VB2A 3PMEA 4U2AA 1B35C 3M3IA 1PNFA 2PA7A 5JZGA 5F9TA 1YRZA 3IPVA 3MFAA 4FCAA 5LRRA 3IDBB 5L7OC 1XYNA 4GH4B 2B45X 5A33B 1NZCA 1RUF1 2GAUA 2Q1ZB 1RMU1 2WJSA 1O91A 5JAXA 3FLTA 3GHNA 3VBUA 1MZ5A 2EXJA 4IV1C 2Z5WA 3I2DA 1LOEA 1ZBA2 2DYCA 2HWB1 4E27A 2DVAA 1DHKB 5A32A 4XDQA 2UU8A 1ZM1A 1AR63 4XBLA 4AI1A 4XJUA 3D8CA 2XB6C 3ES4A 1WLCA 1VR3A 2XKPA 4LBNA 4IEXA 4QU2A 3N7JA 1VBA1 4QHBA 1LULA 4U36A 3VBHB 3KSCA 1W6PB 3PLQA 3GZUC 1VALA 1OQ1A 1ZRRA 3MGUA 4XJ9A 1E57A 2WT0A 4LE4A 1TMF3 3PVOA 2D6PA 1UMZA 5FOJB 4IEZA 2GC0A 3L2HA 4LBJA 3OY8B 2CTVA 5T3NA 4XIOA 1LGNA 4CRQA 5DZFA 4LO5B 3WUDA 2AH2A 5CFDA 2ZJCA 1Q5OA 1DZQA 3ZXLA 3Q9OA 4HLTA 3B02A 3IKWA 1HRI2 1AL21 4Q4X2 3ROUA 5L73A 1D4M1 2Q30A 2UY9A 3E6CC 1LR5A 2ZX0A 1W6NA 2VNRA 3S0MA 2TUNA 4C1XA 3MICA 1N1VA 1C28A 3ZFEC 2HWC2 2QFEA 3ZXDA 2GN3A 2X8KA 1QHDA 4AW7A 4BMBA 1HQWA 1LU1A 5F6LB 5L7OA 1FYUA 4XTPA 1YFYA 4XFCA 5FPZA 4AEDC 5JOWA 2VNOA 2ZGTA 3QBQA 4DXZA 2D97A 1H2MA 1ULCA 1G7YA 4K21A 1V00A 3D82A 3L2YA 1POV1 2UWAA 1BVP1 2R043 4Q1RA 1OA3A 3AJZA 1CAWB 2VPVA 3AXDA 3NV3A 4H3WA 2RS52 5LRSA 1ZBE1 4B3NA 1QNYA 4WBBA 5E1RA 1RUOA 2NQYA 2O0OA 4LO6B 3P3PA 2D5HA 3KB5A 3WV6A 1PK6B 3SLIA 1MVEA 3ZSJA 4YSFA 1DGLA 2RR13 3TB0A 4N43B 3CU7A 4D3WA 1RL3A 1GV9A 5C8CA 4RQPC 1FAYA 4XF3A 3MFCA 3ZIWA 1ZRCA 1VBD3 1DGRN 4Q29A 1NCRC 4RD7A 2EA7A 4ZU7A 1B35B 1FT9A 3HD8B 2YV8A 2P3IA 2VVEA 1UZYA 1M06G 4MUVA 5L19A 5I91A 3T2TA 1ASJ2 1MACA 4B29A 4IV1B 3J8F1 2C9AA 5KHJA 1R1A3 2LM3A 1SCRA 4D7TA 5HCAA 4YM3A 1ZX5A 2D6NA 5JVVA 1HKDA 4FTEA 3VDDB 3WW4A 5ABJA 1CAXA 3K48A 1HV1A 2RM22 2DCKA 1HRI1 2PLV2 2CNAA 2ZGPA 4RS5B 3SXWA 4IV3C 1A3KA 2I74A 2XVKA 3OBTA 3PJYA 4XF1A 3SITA 1C5HA 4LBQB 3NWKA 1MEC2 3ZN4A 2YMZA 4ZXKA 2HWC1 4L97A 2Q5TA 1BXHA 3DF0A 3D5OA 1G86A 1JUIA 3FHIB 1SLCA 1XU2A 4MV2A 4O9GA 5H9QA 1GSLA 1ZZ6A 2HWE2 2R042 1HXS3 4TZDA 4YGDA 3NV1A 2PQQA 5KWRA 4W65A 1V6OA 1WBFA 5FQ0B 1MZ6A 3ECQA 4EN0A 4H55A 3JBG3 1X7NA 2ZKNA 1IS4A 1FMD2 4RQPA 2RJLA 3ZFEB 5DUXA 1QJX2 2JE7A 2RS51 4XILA 4AYUA 1GQHA 1AUYA 3VKFC 2B5HA 4HL0A 1PIV2 1UIJA 4BA6A 4AHWA 3ZVXA 5LK7B 2QDNA 1UCXA 2A75A 4FPFA 4AEDB 1MZEA 3OJBA 5T50A 5B2GB 2HJIA 2H0BA 4G3YC 1OPMA 3WNXA 2F4PA 3KLSA 2F6BA 1AX1A 4NOTA 3U11A 2G9GA 4GKYA 4ZU4A 1A8MA 4P14A 1VB4A 4DOUA 2EAAA 3WINE 2DTYA 3VKNA 2BNNA 1HX6A 2R0FA 4K8FA 1PO13 1JW6A 3ZN6B 4HN1A 1EAH1 1AYN2 1JXNA 3AKRA 3ZXJA 3AZYA 3E6BA 4W6WA 2E6VA 1G9AA 4LO7A 1RUD1 2WT2A 1ASJ1 5HXVA 1NE4A 4HVRA 5J48A 4Q0QA 3TN92 5HI0A 5JSOA 3LA2A 4IEWA 4CDUC 3ZDSA 1DGRA 1O5UA 1H1IA 1OOPC 2Z69A 4R9CA 1WMEA 1NCRB 3VHOA 1G9BA 4CDWA 3VBSC 1GZWB 2JG9A 2RM21 1D0HA 5GLUA 1IS5A 4Q4Y2 2JENA 2PLV1 3H50A 5J7MA 4GQ7A 4QGLA 2ET1A 2VQAA 1UN1A 3AMPA 5K0UB 1FV2A 1DYKA 3U4XA 2JICA 2DWRA 1APNA 1DZTA 1MEC1 3NKTA 4CYDA 3D6EA 4K6BA 2MEV1 3RYRA 2XJUA 1HXS2 1NOVA 4XPVA 2HWD3 3WHUA 3DPRA 1CESA 4LBMA 4COVA 2V09A 2X53S 4AEJA 2XLFA 4F8AA 2FMDA 2HWE1 1NG0A 5I0UA 4Z1VA 5GZGA 3E6DA 4LHNA 3ZXFA 3VZJA 1NA1C 1L3JA 2VOWA 3FMGA 1N1TA 1GZCA 4IV3B 2WFF3 1LOCA 3S6PA 1FMD1 2XGXA 5I8SA 2WNVC 4ISRA 4BLJA 1YI7A 1SQ4A 2HWF1 4CDXC 5KXBA 4HN0A 3HBZA 3NW4A 1QJX1 2Y26A 2YHJA 2VQ0A 2D6MA 2NPIA 3SH4A 2DUPA 3ZFGC 1KRIA 1PIV1 4FOQA 5EFUA 1PZ8A 4KU8A 1C1LA 4X8NA 4HZFA 4Y1YA 3ZSLA 5LEJA 2D6LX 3GHMA 5H9SA 2WNUC 4QQLA 2NN8A 3KCYA 2VECA 1LOFC 3BOWA 2AZ5A 3E97A 2R062 2PAEA 3U0ZA 5CU1A 1RITA 1TE1B 4YW1A 4GIQA 4QPIC 4CDUA 1LENA 2MHFA 3CO2A 4JRLA 3VZLA 1F2NA 4UBHA 1YNAA 4LA3A 2GU9A 1LCLA 5F5QA 2VMGA 3FUOA 1O5LA 3WQ7A 3WW1A 3DL3A 3VBFC 2BBVA 4XJZA 5I8YA 2GDFA 2A71A 1QJY3 1VAMA 4Z82A 1ENXA 2A73B 1AR71 5IT6A 4CP0A 4MGYE 4P5HA 1Y3TA 3ZYGA 1AYN1 1TEIA 1XXNA 4META 2NMOA 1R091 2EXHA 2BVBA 4BQ1A 3HQXA 4YW2A 2B39A 4FSJA 1KXGA 2DVDA 5J96B 3WDVA 4EN9B 3AFGA 4N9IA 2D3SA 3MLLA 4CP2A 1DGWA 3I59B 1ONAA 1LOAA 4X8PA 1NA1A 1VIWB 2ARBA 3TNQA 3CEWA 4I30A 4Q4Y1 3H1YA 4YW3A 5T55A 2WIIB 3WCSA 1EPWA 2XL7A 1LEMA 2CGNA 2DCZA 4CDXA 1SLAA 1I1EA 4FPLA 1IOAA 2WLPA 3AYAA 3O5SA 3N7MA 3NVCA 3M3CA 5E88A 2PHTA 1AR92 2VH9A 1PZ9A 3ZFGA 5C9AB 1AHSA 1W39A 2G9FA 5BUVA 4HSJA 4SBVA 2DU1A 4C0BA 1DDLA 1AX2A 2OYZA 1FOD3 4HKOA 3WQ0A 4J1XA 4S2FA 1AX0A 1OOPB 1U5YA 4L92A 4YVWA 1AYM3 5EWSA 4A3XA 4S2HA 3RI8A 1LOFA 1JN2P 2D3PA 4FPGA 4LA2A 4XF9A 3D4KA 3VBSB 3MDPA 3CNAA 3AYDA 4MH0E 2VU9A 2ZHNA 4FQ4A 1AR83 3LAGA 4NWWA 4DY3A 1ZYBA 4FOWA 4Q4W2 2X5IC 1RHI2 3HMYA 3TRSB 1ZZ9A 3POWA 4LLOA 2QQPA 1RMU3 3VBFA 1QQP3 2PELA 5A3LA 5IK8A 4Q2FA 1YLLA 4WVWA 2W39A 4B4QA 5DUUA 2OA2A 1NE6A 1SLTA 1FV3A 2XLGA 2IC1A 4AI8A 1HQLA 1N3OA 3B00A 5KXDA 2VOXA 5AFBA 2D5FA 2R061 3RMYA 5JSRA 5LEKA 4Y26A 3LOBA 2XUMA 3B9IA 1OLRA 1PGW1 5E8AA 3WCRA 2A70A 2C5DA 1S0FA 2WNVB 2C1FA 1RC6A 3I54A 4DB5A 4LEJA 1Z7S2 1UIKA 3AKTA 1XNKA 1FPN2 2CY6A 1XYOA 5FLIA 4COZA 1KFUL 2PAMA 1RUG2 4IEOA 4JAAA 4A7ZA 2WL1A 5JIUA 4EWEA 3JU9A 4OUMA 2UWBA 5T5PA 4WVMA 4ZKTB 1G9FA 3AYEA 4AVCA 3GNEA 2WNUB 5BYNA 3M1HA 2XKOA 3BALA 4K40A 1Q8VA 1K5MA 4QM9A 5E16A 2AREA 4E9KA 4QPIB 1YFUA 3M70A 3EO6A 3TBDA 2ZAAA 4ISQA 5FOBB 1JYCA 5I0TA 3AJYA 2PTMA 5JI7A 5IK7A 1I5ZA 3LZZA 1GICA 2YPJA 5GKAC 1UU6A 1AXZA 2PYTA 1PHMA 4JGYB 1V9U3 1RUC3 3M3OA 2HEYF 1C8NA 5BNOB 3USUA 3PJQA 1REFA 1KD7A 3U07A 1HRV2 4BWOA 1AYM2 3SCHA 1AR91 1OPOA 4UBGA 4ES8A 1C3HA 1EV12 4N53C 2ZMNA 2WZR2 3JZVA 4JGZC 1ND3B 1U5XA 1FXZA 1FATA 4AFBA 1AR82 4X6QB 3GZTB 1BK1A 4LHLA 1NXMA 5CFCC 3AMMA 4YZ1A 2P17A 3N7KA 4XTMA 5JZGC 4F3JA 1REDA 2XJRA 1DIWA 2XVGA 1VBB2 4Q4W1 2IWGB 2A6ZA 4XQWA 1RHI1 4KH9A 4PDWC 3GALA 4AEKA 4XJWA 1OQDA 2ZS6B 3B9CA 1F31A 5DZEA 4DRVA 1RUJ3 1ZNPA 3VBUC 1RUH2 1SBEA 1R083 1TME3 5KHHA 1W0OA 1RUE1 3PNAA 1S55A 3UJOA 1EPZA 1PVC2 1OFNA 3ZYRA 5GALA 1S0CA 3M2MA 4Q4V3 3QCWA 4Y20B 2PAKA 3AMQA 4KG0A 4LR4A 1RUI3 1AXYA 4AGVA 4NHLA 1PO21 2X5IB 3GBWA 3LA7A 2R0HA 3URFA 1YFXA 3THTA 1H0BA 1Z7S1 1FPN1 2PHXA 4EJRA 4IQPA 4PLOA 3MPPG 3SISA 1YJLA 3J8F3 4OHZA 3FLPA 1RUG1 4DRRA 1DYPA 3AKQA 3V56A 4XJ8A 2VNGA 2GSYA 5T52A 5CFDC 1X50A 3GBGA 3MI8A 3MIDA 4JCKA 3J26N 4Q8KA 1O3SA 4RHV2 4B4PA 3VV1A 2PHRA 3MW4A 2DVBA 4LO4B 2XLAA 3BU7A 5BNPB 2JDZA 2W0XA 1CQ9A 1QDCA 1V9U2 3NV2A 4PIXA 5KHGA 4JQRA 4M3CE 4AXOA 1WLDA 2WT1A 5D8AB 2CWSA