2YROA

Solution structure of the c-terminal gal-bind lectin protein from human galectin-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
155
structure length
155
Chain Sequence
GSSGSSGPKSGTPQLSLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title Solution structure of the C-terminal Gal-bind lectin protein from Human Galectin-8
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 15
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yroA00
2D44A 2ZGLA 1ULCA 3R4UA 1BZWA 4YW1A 2H0BA 3PVEA 1J1TA 1V6IA 2C9AA 5F9TA 4YFWA 1G7YA 1OKQA 1BQPA 1WLCA 2I2SA 2DUPA 4ASMB 2W39A 2DUOA 1SLLA 3WDVA 3IPVA 2LALA 4YW5A 4IQPA 4XTPA 3I8TA 4DS0A 1UZYA 4Q8KA 3WG3A 1MS4A 3BODA 3BOPA 1LU2A 2EIGA 3WDXA 1LOFC 2GMEA 1MZ5A 4OZXA 1OFSA 4FOWA 4K1ZA 2FHRA 2R0HA 1WW7A 2V5YA 4BLJA 1QOSA 5CB7A 2AYHA 2OVUA 1AZDA 2ZGOA 1HQWA 1N1YA 2NZ9A 3OBRA 1Z78A 2W52A 3V0BA 1JW6A 1LOBA 2ARBA 3NWKA 1SLCA 1MS3A 2C5DA 4Y22B 5JOXA 1LCLA 1QDOA 1SLTA 2D7FA 2P3IA 2VW2A 3RMXA 2ZMKA 1W6NA 5JDBA 2Z42A 2A3WA 3H0OA 3AYEA 3OY8A 2JDZA 3R05A 4SLIA 3A0NA 2R1DA 2RHPA 4U36A 3MW4A 1KRIA 1N47A 1Q8OA 1SLIA 1MR5A 2DWRA 3C2UA 3A0KA 4F83A 1FYUA 3VV1A 2VW1A 5GZEA 3B9CA 3MPPG 4WV8A 1SACA 2VXRA 2EXIA 4GALA 2PHWA 3JU9A 4GWMA 2E7TA 3W58A 2D6LX 2ZGQA 3O5SA 5GZCA 3AP5A 1CIWA 5T5OA 3N7MA 3IPVB 1KDKA 4UW3A 2GMMA 1JBCA 1V6OA 3CNAA 3OPZA 3ZSLA 5DXDA 1LOCA 1DHKB 1WW5A 5GJ6A 1Z0HA 2NP0A 3IM0A 5JLVA 3V64A 1G8WA 2E6VA 4RA0A 1URXA 4NO4A 3ZPYA 1MS0A 3GNEA 1IS3A 1QU0A 3RQ0A 2PHXA 1C1FA 1DQ0A 1UAIA 1LGCA 1CPNA 2CYFA 2WJSA 4W65A 1PZ8A 5DZGA 4Y1ZA 4YZ1A 2D6KA 3DGTA 2D3RA 2WLQA 1DFQA 1AJOA 2SBAA 4YM2A 3TAYA 1W6NB 1S1AA 1Q8PA 1S0CA 2PELA 1SCRA 4XHBA 5DUXA 2ZAAA 2A70A 4YGCA 2AR6A 3OY8B 2DVAA 2VW0A 3T2TA 1AX1A 1U0AA 1I1EA 3N7KA 2GMPA 4P9YA 2NYYA 1NXD1 1A78A 3B3QE 2ZHMA 5GZGA 1G9AA 2PHUA 1Q8VA 3RS6A 3D5OA 1LTEA 2PHFA 5HCFA 1IS6A 3IN9A 1LHVA 2ENRA 2CWSA 3AX4A 4GKXA 2JD4A 5JOWA 4XMAA 3POWA 2WSUA 1GANA 3SH4A 3SISA 5CAZA 3AK0A 4P9WA 1C4RA 1W6PA 4YZ2A 4L8QA 2NMNA 1UKGA 1S0IA 3QCWA 3WG1A 4CRQA 1FAYA 5E89A 2DVDA 3WNXA 4FOQA 4JCKA 5DZFA 4YW3A 3FLRA 4XXAA 1H9WA 3L2YA 3B69A 2GDFA 2DU0A 2EAKA 5IUQA 3NV3A 5T55A 2Q5TA 2NM1A 4XIKA 1WBLA 2D3SA 4FQ4A 5BYNA 5EYXA 2WQZC 3HR9A 3IKWA 2CTVA 3N35A 2R1BA 1LECA 1Q8SA 1QOTA 1LHWA 1O4ZA 1Y7BA 2PHRA 2GNMA 2ZGTA 3SITA 2DVBA 1DQ1A 4FPKA 4K20A 2OW4A 1IKQA 3KQRA 1S0BA 1WD3A 2JJ6A 5T5JA 4XE9A 3SH3A 4FOVA 4YW2A 1AF9A 5DUVA 4FPGA 4HANA 2A6ZA 1MVQA 4XBQA 5DUUA 2ARXA 4Y24A 1KDMA 4BMBA 3I4IA 1BYHA 1ENSA 5GLZA 1G9DA 3RRDA 5EXOA 4R9AA 5JMCA 1V6MA 1JUIA 4FPEA 2GNBA 3RG0A 1AXKA 1LJ7A 1W6PB 2JECA 2CWMA 2E53A 5GZDA 3USUA 4FPOB 5KXDA 3ASIA 3NV1A 1DYKA 4H55A 1VAVA 1DYPA 1W6OA 1YI7A 1LEDA 1AJKA 3AFKA 1WD4A 1FNYA 1RITA 1HDKA 2OUHA 3MEPA 4M00A 2W68A 1QGLA 2ZGSA 5T5LA 4LBMA 1FX5A 1UPSA 1DQ6A 1ULGA 2DURA 2KM2A 4PQ9A 2A3XA 4Q26A 5JVVA 2YZ4A 1YXWA 4YM0A 4ATEA 1MS9A 1R1ZA 3AP6A 4M01A 5T5PA 2GALA 1BXHA 1DLLA 3LSEA 4P9XA 3D6EA 1G9CA 3Q9OA 1MZ6A 4XJZA 1KJRA 1GLHA 3PMEA 4K1YA 1QKQA 1CN1A 1QNWA 3WHUA 5KXBA 2DU1A 5T50A 3LCPA 5H9RA 2ERFA 1UL9A 1WBFA 2GN7A 3AP4A 4XILA 3FFZA 4WVWA 4Y26A 1DIWA 5GLTA 4FPHA 4M3CA 1IKPA 4Q1PA 1PZ7A 3AJYA 3AZYA 3UL2A 3OYWA 2W08A 4XJ8A 5H9QA 4YZ5A 3WZ1A 1LGBA 5FREA 1Q56A 1LENA 1V00A 3USUB 3QLQA 1A3KA 4AGRA 1W6OB 1UX6A 3WDTA 2AUYA 1FNZA 2GN3A 3DUIA 4LBQA 2XB6C 2A7AA 2LTNA 1AXYA 3M3QA 1AX0A 2VY0A 1SFYA 3N3HA 1QDCA 3LSDA 2ZMNA 4FP2A 3V0BB 1DZQA 4XYXA 4TYSA 2VUAA 4PF5A 4YGEA 2ES3A 3BIWE 1SBEA 4NOTA 2ZGUA 4XOGA 4Y1YA 1FATA 2P3JA 1WW6A 3KM5A 4LBQD 2ZGMA 1LESA 2V73A 3WHTA 5GALA 1APNA 4YW4A 1QOOA 3AZVA 2WKKA 3FBYA 3M3CA 4LBKA 1RIRA 4DFSA 2R16A 2E7QA 4Y1UA 1W6QA 4FPFA 4XXPA 3SLIA 1SLAA 4XBNA 1G9FA 1OQ1A 4Q2FA 3WUDA 1N3PA 4JC1A 2A75A 2UU8A 2YMZA 2ZHLA 4AVVA 1LOFA 4XJAA 4M3CB 1S0FA 2AENA 3AP7A 3FUQA 4FP3A 2DYCA 3OYWB 4R9DA 1CJPA 5AVAA 5GLVA 1RINA 3AYAA 5EWSA 3O0VA 3UJQA 3N36A 2A6VA 2EXKA 1V6LA 3D4KA 4LBLA 1JXNA 4Q8LA 5DUWA 5HCBA 4Q27A 4BOWA 1CONA 1YRZA 4LBQB 4Y1XA 1LOGA 5CNAA 1KITA 1V6JA 4U2AA 2AREA 1UMZA 4XBLA 2A6YA 5DG2A 3WUCA 5L73A 4C1WA 2PHTA 4DRRA 3WLUA 3VKLA 5GZFA 2YV8A 4Q1RA 4AVSA 2TEPA 4ATFA 1WCSA 4M3CE 1UZZA 3POSA 3ILNA 1WLWA 3ZXKA 2R49A 2JE9A 4AGGA 1ULEA 1S0JA 5GLWA 3OJBA 5KXEA 1H30A 4BM8A 2FMDA 2EALA 2EXHA 2GNDA 1LODA 2ZMLA 1N3QA 3AP9A 2WT1A 1MS8A 1S0DA 2ZGRA 3M3OA 1PZ9A 1EPWA 1WUVA 1X50A 2D6MA 1DQ2A 2ZGKA 3ENRA 1GNHA 1W6QB 3AYDA 3AZXA 3ILFA 4YGBA 1JYIA 2VU9A 1AVBA 3WVJA 4FQZA 3OGGA 4BMEA 1NLSA 3HMYA 3FLPA 3AXDA 5GLUA 1I3HA 3WG4A 3GALA 2DTWA 4AGVA 4BQ1A 3BTAA 1MS1A 1LEMA 3M1HA 1DQ4A 1CVNA 1IS4A 5JOZA 2HYKA 1HLCA 5H9SA 1ENRA 1LHNA 2ZABA 4FVVA 1WLDA 4XJ9A 1F5FA 3V65A 2A5ZA 4FPYA 4WZFA 3OBTA 5H9PA 4KBBA 3AZWA 1CESA 1ONAA 4RL7A 4FPCA 4DPNA 1JN2P 4YM1A 1SCSA 2CY6A 3VKOA 1JHNA 1N1SA 2WT0A 4ITCA 1C1LA 3B00A 2D43A 5IK4A 1LOEA 2ZHKA 4YG0A 4BPZA 4PCRA 1LGNA 1YYNA 1W6MA 2UWCA 4XMIA 2JE7A 1VAMA 1FV3A 3MW3A 1F31A 5E88A 4Z8BA 2AH2A 1S0GA 4AWDA 4TZDA 4DRVA 1WW4A 2P2KA 2D6NA 2NMOA 1N3OA 2B7YA 2G4IA 2UWAA 2A3YA 2D6PA 1LU1A 4AVTA 4CZSA 5DG1A 1D2SA 1ULFA 1GV9A 1MS5A 4MYEA 1GZWA 1B09A 2NN8A 3MW2A 4K21A 3VKMA 5JOYA 1IS5A 2EXJA 3R4SA 4GXLA 4LBJA 3WV6A 2CNAA 4YLZA 4AYUA 5CBLA 2BQPA 5IK5A 4I30A 3ZXJA 1G86A 3APBA 2WT2A 3IMNA 2WSVA 1KQRA 3N7JA 4PBPA 2ZZJA 2P3KA 4R9CA 3VUOA 3UK9A 4LBOA 4DQAA 3T1LA 1JOJA 4ISRA 2YY1A 2DV9A 1GZCA 4P14A 1G9BA 5IK7A 3N7LA 3ZYPA 2DUQA 1GNZA 2A6XA 5T54A 3ZXLA 5HCAA 1GICA 1VLNA 4BLIA 4C1XA 2ZGNA 1W0PA 1GSLA 1AX2A 2ZKNA 3ZXFA 4YG6A 1W6MB 1DQ5A 2UWBA 5GM0A 1BKZA 2VH9A 1C57A 1H9PA 4YZ3A 1QF3A 1ULDA 5SV8A 5F5QA 4YM3A 3ATGA 3WG2A 3O12A 5FRAA 1SBFA 3ILRA 4YG3A 1V6NA 3A4UA 1YIFA 3O0XA 5LK5A 2GNTA 1GZ9A 1GYKA 2D3PA 3AJZA 1GZWB 3O0WA 3WCRA 4HL0A 1UN1A 3RSJA 4YZ4A 4FOYA 1LULA 3TB0A 1ZM1A 1VIWB 2ZHNA 2P34A 4XJUA 3PVNA 2A71A 3V0AA 4Y20A 3POYA 2R0FA 1LOAA 4JRAA 1GKBA 1Q8QA 3ZSKA 2YXSA 4GWNA 4XDQA 1O4YA 2DTYA 4FPJA 1JYCA 1N1VA 5IK8A 2SLIA 2DVGA 3HN1A 1SBDA 1MACA 2ZGPA 4XJWA 3SNMA 4GA9A 3U4XA 3WDYA 4D69A 2ZBJA 2WNEA 3JUUA 3PVOA 4ISQA 3M2MA 3NV4A 1W0OA 3VKFC 1ENQA 1FV2A 1S0EA 2ZA9A 1CPMA 1HKDA 4LBNA 2ZACA 5E8AA 4ZKTB 3M3EA 3ZSJA 3VKNA 3AYCA 1D0HA 1LHUA 2CL2A 2E51A 4UW4A 4XIOA 2XG3A 4Y1VA 3WOGA 1XQNA 1AXZA 1ZA4A 3B01A 1V6KA 3AZZA 3AXEA 4PBOA 3ZYRA 3T1MA 1VALA 1BJQA 2DVFA 1GBGA 1LHOA 1QNYA 2D6OX 4FPLA 2A6WA 2AGSA 5T52A 3V0AB 4Y20B 1CQ9A 4YFZA 1MVEA 4UW5A 3WDWA 2P37A 1DGLA 1TEIA 3PJQA 4ZXKA 1HQLA 1IOAA 3UJOA 1N1TA 3FUOA 2JKBA 3WDUA 2UURA 5DZEA 5EYYA 3FLTA 3RMYA 4YGDA 1YO8A 3SH5A 3ZXEA 3WCSA 1F9KA 4XZPA 1QMJA 4Y22A 3W59A 4XHXA 2YROA 5CA6A 4XTMA 4GKYA 2EF6A 5IT6A 3NV2A 4M3CF 3ZVXA 1DBNA 1SLBA 2OUJA 4CTEA 3ZSMA 4WVVA 4R9BA 1CR7A 5KXCA 4UW6A 3INAA 1KJLA 1A8DA
chains in the Genus database with same CATH superfamily
1R083 2Y6HA 3DYPA 1O5UA 2ZGLA 4E4ZA 5A33B 2XUMA 4PDWA 2MNGA 3R4UA 4TLGA 2VQTA 1BZWA 1K3IA 1QJZA 1MZFA 4QPWA 1VBD3 5JR7B 4FFHA 3WQ1A 1XYNA 1V6IA 4NPLA 3P3NA 2WINB 1OKQA 1BQPA 1WLCA 2I2SA 1Y9MA 1PHMA 5BNOB 4DS0A 1R64A 4UF0A 3DPRC 3H1YA 4MXVA 5CKMA 2RM21 1LU2A 4ZU5A 1MZ5A 2BZDA 3E5XA 1OFSA 2WUHA 4K1ZA 5FV3A 4AVBA 2WO3A 3T09A 1F2NA 4UXAA 3KS7A 5FZIA 1CAXB 5A7WA 2PLV3 4CEWC 1UU4A 2ARBA 2PYTA 3NWKA 4IEVA 5ACA1 3VHRA 1H4HA 2C5DA 4EWAA 3ZFGA 2WDBA 3ZXAC 3UKTA 1SLTA 3DEMA 3HT1A 1ZRIA 4QHZA 3JXSA 2A3WA 4BQXA 4YW7A 1H6YA 3OY8A 4BU2A 3I7DA 2RHPA 5FYCA 1ZRDA 1UOGA 4U36A 2RS33 2PA7A 4L92A 1XNAA 1GWLA 4PDWB 4F83A 2WL1A 2FD8A 2VE1A 2JDNA 3B02A 3EXUA 5LEKA 2JG9A 4LKDA 4XF1A 1SACA 5F2WA 5DDJ3 2CGOA 5FY7A 3VZNA 4FBFA 1W28A 2PHWA 3RZJA 4GWMA 2E7TA 2AZ5A 3JCIA 5ERLA 5GZCA 4XFGA 1BMV1 5GKAC 1YFUA 3POGA 1GOHA 1NE4A 2G9GA 5HPOA 1LOCA 4IEYA 2Y64A 4NHKA 5GJ6A 2NP0A 4B1MA 3NNLA 2OQ6A 1ZBE3 5FXXA 4O65A 4BQ2A 5A7WB 3ZPYA 1MS0A 3GNEA 3HQRA 1QU0A 5KBFA 3QH6A 4IV1B 1C1FA 1DQ0A 1UAIA 4IEUA 1QEXA 2WJSA 3WW1A 4ASKA 3ZFGB 1YJKA 3PL0A 2MEV2 4BIOA 4F7ZA 4KNCA 1OI6A 3CJIB 1K5MA 1Q8PA 2BFUL 2I45A 4D8MA 1PO12 4DY5A 3OY8B 2VW0A 4BK5A 1RMU1 1AX1A 3U0ZA 1UZ0A 4RQPC 3H7YA 4N7IA 2GMPA 4IV3A 3CBNA 4ZZ5A 3WW4A 1G9AA 3VDDA 1ZBA1 1CX4A 2JG9B 1DGRN 5LA9A 3VBFA 3IN9A 1W9FA 4WM7C 2Z4FA 5LATA 5C5TA 4CPBD 2WSUA 3GHMA 3N4MA 3H8UA 1G6NA 4JX0A 2BJSA 2P4EA 3GBFA 4L8QA 4QXKA 1NQJA 4A6SA 1UKGA 3QCWA 2X09A 1FAYA 3KGZA 3JD72 4AFBA 2JWPA 2JDMA 4N53C 4AI0A 5IVJA 3P6BA 2EIEA 2E7AA 2RS53 3PHMA 3B69A 3J8F2 1V0AA 2HWD3 3EO6A 4QU2A 4OMDA 2ZXQA 4A3ZA 2NM1A 1EAH3 4JZRA 4EN6B 3BPSA 3GCWA 1VRH3 3I3QA 1ACCA 2B4KA 2EICA 2CTVA 2J1VA 1Q8SA 4QQHA 1VBD1 1LHWA 1VMFA 1RUH2 4AQ2A 4BDVB 2DVBA 3QACA 2B45X 5JZGC 3T30A 4JQRA 4K20A 2VULA 3KQRA 1K5MB 3OGJA 1S0BA 1WD3A 3NO8A 2JJ6A 1YHFA 1TE1B 4AR2A 4Q0VA 4GMP0 2WNUA 2XMLA 1PVC1 2KR2A 2VVEA 5DUUA 2XOMA 2ARXA 4UI9L 1QQP1 1VP6A 5J98B 4AEDC 4O7XA 2ZEWA 1OXCA 1BYHA 3JZVA 4UOJA 1J84A 1ZZ8A 3VBFB 4JRLA 5LB6A 3W21A 1JUIA 2ORXA 1TNRA 2FDJA 4FPEA 1SDWA 5FY0A 2JIJA 2HYXA 4URTA 1CIYA 3RGBA 1QJU3 3LIGA 4MHRA 5E6HA 1F15A 5FQ0A 4O9EA 3WP4A 4AVCA 4HVRA 5FO9B 5KXDA 3ASIA 3NV1A 1HIXA 4K40A 1DYPA 1ST8A 2JDUA 3LKJA 1H4GA 1W6OA 1Y9QA 2CV6A 2B5HA 2OX0A 4H3WA 4H7LA 1RUD3 2WZR3 2VTXJ 5FFOC 5LY2A 2YC0A 4AFCA 1IPSA 4M00A 1RUC1 2W68A 4HVQA 3GBWA 4LBMA 4MSVA 3ZOIA 1FX5A 1QJEA 2HEYF 1DF0A 3IBMA 1E5HA 1YC61 2X10A 2W2IA 2YZ4A 4QX1A 3OB8A 3VHNA 5BUVA 1YXWA 3S0MA 1SHWB 3F95A 4L2NA 2R043 4QB6A 3S7IA 5C5UA 3T2QA 2WNUB 3A7QA 3BUCA 1JH5A 1MS9A 1VBA3 3AP6A 1JZ4A 5T5PA 2GALA 5JSPA 1ASJ1 5FZKA 1GQPA 2R071 1BXHA 3CO2A 4QKBA 5FZ6A 4P9XA 3D6EA 2Q8OA 4XJZA 2DCJA 2B9VA 5BXXA 5FPLA 3H8RA 5JIUA 5FYHA 1JOPA 4UAPA 5FPAA 3POBA 5KXBA 1UKRA 3C8XA 4XFAA 2PFWA 2LS6A 4Y3OA 1UL9A 1WBFA 3AP4A 5J96B 4G3YC 4KU8A 2XDVA 2Y6LA 3N9PA 4Q1PA 1CD3G 3AZYA 3MICA 4HN0A 4MGZE 1W3VA 3OYWA 3PU8A 5FQ0B 1EV13 3RPQA 1LGBA 4XUOA 5FREA 3TN91 2PMWB 3KV4A 4QQOA 5IWFA 3QLQA 4KBZA 4NHYA 2BNOA 3WNOA 1W6OB 3WDTA 2GN3A 4MGYE 4RGKA 3CZUA 2YU2A 3PIJA 1PGW2 3WDVA 4G9SB 1AXYA 2X05A 1AX0A 2VY0A 3LZZA 2N7GA 2VNGA 3ES4A 4R4ZA 4UYBA 2WA4A 3LSDA 5F6KA 4CU9A 1ZZ6A 2K46A 3VZOA 4Z2AA 5LA0A 3I3MA 3QD6A 4YGEA 4CCLA 4PLOA 3AL6A 2GC3A 1AR82 4LUKA 3ZXDA 2KXLA 2FBEA 5FZ0A 1HRV3 5L9BA 1SEFA 3HQUA 3ACFA 4LBQD 4CXXA 2V73A 4AK3A 1JYWA 3AZVA 2PXJA 2QCSB 4C0BA 2TUNA 4LBKA 4CPBA 2BP6A 2W1SA 3I2IA 4QXHA 1AL23 4NRMA 2VBPA 4Y1UA 3KMHA 1D4M2 1PK6A 4GAZA 4PDWC 4DXSA 3ZN6A 2DCKA 3WQ0A 3SLIA 2XJQA 1OA3A 4EQVA 1QJFA 1XPWA 4NR1A 4NPMA 5EHDA 3ZKYA 5LA1A 4HBNA 3AKRA 1NCQA 3OYWB 4R9DA 1CJPA 5GLVA 2YBSA 5EWSA 3CZJA 3O0VA 3UJQA 5FUNA 4URAA 1QH7A 3N36A 4QT6A 4LBLA 1JXNA 4TLFA 4Q27A 3H1WA 2A73B 4XF0A 2IFWA 2X5IA 4Y1XA 3ZIWA 4NJ4A 2RM22 3K46A 4U2AA 2AREA 4NIIA 2WYFA 2A6YA 1QWRA 4KGGA 5DG2A 4NROA 2PHTA 3TNQA 4Q0SA 3EBRA 3OD0A 1TME2 4K8FA 5A3WA 2FCUA 2Q8EA 3IDBB 2IXCA 3CQOA 3ZMOA 2DCZA 2TEPA 4OI4A 2QQOA 3LWCA 3AKPA 3RZHA 1HW5A 3JQXA 1S0JA 4X8NA 5ACA2 4W6YA 4LULA 1D4VB 1US3A 4NIDA 3OD4A 3AP9A 3KHCA 3CDZB 5IW0A 3RWKX 3CL1A 3N9NA 3BOWA 5FXWA 5IVEA 2C4XA 1DQ2A 2D6MA 3AYDA 1H8TA 1RXFA 3SXWA 1JYIA 1X8EA 2VU9A 3WVJA 4AQ6A 2JG9C 4BMEA 3MLJA 4CDXA 2J1RA 5GLUA 2WZEA 4CSWA 2DTWA 1MS1A 3CHXA 5FZOA 2R7EB 3CEWA 1CAUA 1POV0 1WCUA 1X9TA 4NUBA 2A5ZA 2YPJA 3KT4A 4RL7A 4BXFA 2Y6GA 5FZ3A 4YM1A 3SKVA 2X5IB 2LROA 4I09A 3GF6A 4LK7A 3UKNA 5ANNA 4DUVA 4D7SA 1JUHA 1LOEA 4Q0PA 3VBUA 4PCRA 2UWCA 4V2WA 4H7MA 3AKTA 1T6BX 2DBNA 5E88A 2XL7A 2AH2A 4Z8BA 4TZDA 4DRVA 5FLJA 1K5MC 2P2KA 3E6DA 2D6NA 4CU8A 4E8CA 1VBB2 2Q8DA 2VTFA 4LE4A 1F4HA 4A2UA 4GB31 5FXZA 1N3OA 2B7YA 2MEV3 2R30A 2WIIB 1PX3A 2MHFA 5FKCA 4IV3C 3N9LA 3K2OA 1D2SA 1GZWA 1IQAA 1H8TB 1PO13 1UXZA 3VDDC 5FUIA 5CKNA 4ZPIA 1RMU2 4LBJA 3WV6A 2CNAA 3VBFC 4CDXB 5A3OA 2YBKA 4ZHNA 2P17A 3IMNA 5FZOB 4JDOA 1ZBA2 3Q8FA 1QJX1 1CAUB 2P3KA 2ZX4A 3UK9A 3BU7A 5CADA 4QX3A 4OQ9A 2CSGA 2VL4A 1YQCA 2BERA 4OHXA 5A32A 2W87A 3N7LA 4PQQA 1F5JA 3O1UA 3W9AA 3JD73 4MUVA 5HCAA 1AL21 2D5HA 3ACLA 3E6BA 4NN0A 2RMU3 5BNPA 3IDAA 1UMIA 2ZKNA 2O14A 3ITQA 4LR4A 4MGQA 5CIRA 3J8F3 2UWBA 1UOBA 5FZ8A 4KWKA 4RSUA 3PUAA 4XQDA 1PMJX 4YZ3A 5KC5A 5SV8A 4NHXA 4CP9A 3M4FA 5LA2A 2VMDA 2XQRA 2WNUC 2EVXA 5FRAA 1RUH3 1OLME 1YLLA 2UY8A 3WF2A 5A6QA 3ALQA 3A4UA 3R4DB 4GMP1 4W50A 4BCUA 2GNTA 3KVBA 4PI2A 5FMDA 3WCRA 1GZWB 4JGZA 1DG6A 2BNNA 5F5CA 3WW3A 4UBHA 4OFGA 3X29B 3RSJA 1LULA 1PVC2 4L9BA 4QXCA 3VD9A 1ZM1A 1VIWB 1STMA 2ZHNA 2ZTNA 4XJUA 4CP0A 5HXMA 2R0FA 1BLZA 1GKBA 5I0TA 1S4CA 4JTNA 3PUHA 5APAA 4GWNA 1OVPA 1O4YA 2DTYA 5C8CA 2ZX2A 3H3ZA 2PHLA 1T6GC 4HOOA 1OVSA 3HN1A 5A32B 5EJ3A 3EQEA 4GA9A 4KWLA 4YWAA 3VHPA 3WDYA 3KVAA 2HWC2 4CEWA 1JTZX 5FJKA 2D98A 5BNPB 1FV2A 3PLQA 1S0EA 1W8UA 4FFIA 2VZTA 3LEKA 1HB4A 3JB4C 3OUIA 2FDGA 2PN5A 5E16A 3U07A 1FMD1 1WGPA 3UYJA 1KFXL 5AC91 2GH8A 1RUC2 2K2SA 4CP9B 1POV3 1D0HA 4K7JA 1W9SA 2YC2A 2XG3A 1JZ7A 4B8EA 3B01A 3DYOA 4RR3A 3WSOA 4E2GA 4XAEA 2W9XA 5DAWA 2VMHA 4JGZB 4CDQA 4CEYC 4LE3A 4BE3A 1BJQA 5FY1A 4Q0QA 4FPLA 3I3BA 1ASJ2 2R072 2A6WA 1OLQA 1J59A 1NLQA 1RL3A 3WDWA 1DGLA 3PJQA 2IWGB 5FZ7A 1HQLA 5C8CB 3WDUA 2JKBA 3O1VA 4INDA 5EJ1B 4FXGB 5DZEA 2Y0OA 5EYYA 3WQ7A 3LPFA 5LASA 2IFRA 4C8DA 5JI9A 3WCSA 1UX7A 3ELNA 4HONA 2QKDA 4FO9A 4Q29A 4XHXA 4CEWB 3TN92 3A23A 4OI1A 3NV2A 1EUUA 3S7EA 3IDCB 4ZY9A 1FOD1 1EY2A 3HT2A 5G04L 3HAGA 1CR7A 3HVDA 2QE3A 1X8MA 4R9BA 4CCKA 3O1RA 4EV0A 2C1FA 2D44A 1UXXX 2AACA 4HETA 1UOFA 3WF0A 1W2UA 1GZTA 2CDOA 2QQMA 4YW1A 3HNMA 2BEOA 1J1TA 4RR3B 1A8MA 4Z1VA 1PK6C 4CDQB 5F9TA 1G7YA 3NNJA 4MVTA 4QX5A 3UGHA 2Q30A 1SZBA 2DUPA 3PTRB 4ASMB 4A42A 1JHJA 3MUY1 3ZYFA 4D7YA 1NQDA 4XTPA 3WG3A 5K7PA 3BOPA 1D4M3 5FK7A 3SCGA 5F5AA 2C9KA 4EN8B 2XPJA 1UOJA 5JXHA 5FMOL 1NCQC 1WW7A 3BYWA 4HMZA 4MGIE 4CA9A 4FTBA 2OVUA 1KEXA 4NHMA 4AXOA 1AZDA 3OPTA 2ZGOA 1HQWA 2JXAA 2W1QA 5F3IA 2NZ9A 3IT8A 3Q8BA 4COVA 1JW6A 4KGQA 4LA2A 4BIFA 4NIGA 2JENA 2DBIA 2X5IC 5FDBA 1SLCA 1H1IA 5JOXA 4ET7A 1VB2A 5IJRA 4FFFA 2HWF1 2P3IA 4B1LA 3LF7A 1GWKA 3ZFEC 1P8JA 1W6NA 2VVFA 2E63A 4MO3M 3TOJA 1YEWA 4SBVA 4B4PA 2RM23 5G05L 2JDZA 3OBAA 3U14A 3ZN5A 3A0NA 3AM2A 3WW2A 4H14A 1PNGA 1W05A 3BVCA 4GIQA 5JI7A 1GUIA 1N47A 3MIFA 1TME3 4AVAA 2VCBA 5C3SA 2QUOA 1FYUA 2Y8KA 3HD8B 2VW1A 2YUEA 3B9CA 3VD3A 4AEDA 3MPPG 4WV8A 1UU6A 2EXIA 4GALA 3JU9A 5ACA3 3W58A 1H8TC 4UFKA 3AP5A 1CIWA 1VPHA 5A1FA 4CDXC 1KDKA 4WM7B 3UGFA 4KMQA 4UW3A 5IVYA 2WABA 5LZ6A 1CJDA 3OPZA 4TWTA 5A3UA 2BV4A 4KL1A 5LY1A 5DXDA 2XVLA 3NNFA 1FPN2 1HQNA 2BTVC 4ZZ8A 3O1PA 1Z0HA 3URFA 4C90A 5A1AA 4ES9A 2E6VA 4RA0A 1URXA 2FCTA 4NO4A 1RUJ1 2ZZQA 1IS3A 2VMIA 3RQ0A 1K12A 4K8RB 4PLNA 2CYFA 1SG3A 4W65A 1PZ8A 3LIHA 4WVZA 4ARYA 1XNTA 3I2JA 5DZGA 3Q8AA 4XQWA 2D6KA 3DGTA 3NL1A 2BYVE 1W9YA 5FLHA 1K45A 2WLQA 4YM2A 5FZEA 3VBUC 4CCCA 1W6NB 1S1AA 1S0CA 4XHBA 1Z7S2 1SCRA 2VAUA 4XZUG 3SCFA 5JZGB 2A70A 1U0AA 5FP8A 1H0BA 3N7KA 2YU1A 3OTFA 4XDPA 2ZHMA 2RDRA 1QHDA 4OUMA 4QB2A 3RS6A 4AEDB 1HJFA 3MYXA 2PHFA 4XVHA 1IS6A 5HCFA 3E5QA 4A7KA 1VBB3 3AX4A 3IWZA 2JD9A 3POWA 2QQWA 3SH4A 3TYJA 2FQPA 4GB32 4AAPA 1WWYA 4P9WA 5CAZA 4YZ2A 4K3UA 3UKVA 2NMNA 1DGWA 1S0IA 2K0GA 2XH6A 3VD5A 3AKQA 3NRUA 3WG1A 5C33A 3C7GA 1AYN1 3JBG1 3OGVA 4CVUA 3AFGA 1RMU3 3ZYGA 1PGW1 3J4UH 2DU0A 4COYA 5B4NA 1OSGA 3NV3A 5T55A 1X7NA 2Q5TA 5FR3A 3V0BB 3ZYHA 2P6HA 1WBLA 1ZBA3 1W8WA 5FYYA 3DV8A 3HQXA 3HR9A 1QJX2 3IKWA 2CHHA 5EYXA 5JUVA 1LECA 4AL9A 1QOTA 1O4ZA 2ADEA 2ZGTA 2ZX3A 1AR81 2Z5WA 2Y6KA 3DECA 1IQDC 3UNPA 3BALA 4TN7A 5FZBA 1VB4A 4FOVA 4YW2A 1AF9A 4FPGA 4HANA 4XBQA 1VMHA 1DYOA 4Y24A 1HB2A 3RZMA 3IAQA 3TEZA 4GH4A 3I4IA 1ENSA 4XUQA 4AZZA 3I54A 1QXJA 4R9AA 5FK8A 4WZCA 1IPJA 3DKWA 4JGZC 1BEV2 5J37A 3RZKA 2BWCA 1DLCA 3D82A 1XJAA 1NCRA 2GNBA 4TTGA 1O3SA 1LJ7A 2J1TA 3K77A 4IE7A 1KGYA 1BBT1 2CWMA 2YFUA 3OBZA 4IEOA 3RFRA 4OLLA 5GZDA 3IB3A 3USUA 5IYYA 4B29A 4H55A 1DYKA 1VAVA 2DDUA 1PVC3 5CG8A 2DFBA 1LEDA 4FCAA 1PMIA 1QJY1 2HWE2 3ZSEA 1QQP3 1WD4A 5C8CC 1LNSA 1O5LA 4IESA 1GU3A 3VGIA 1W8OA 1FNYA 1TME1 2VJXA 3VDAA 3NKTA 2WO1A 5I8SA 1CAVA 3WNMA 3IIIA 5BY5A 1H2LA 2C0ZA 3RDIA 2DURA 1K5JA 2A3XA 2XLAA 3AL5A 1WMFA 2HWC3 2WR9A 4QMAA 1WA4A 4J1XA 4NPRA 4Q4V1 1TQ5A 3ZR5A 5LRSA 1MZ6A 3Q8CA 1KJRA 3WXPA 1S2KA 4GH4B 5FY4A 3WHUA 4RR3C 1FMD2 1RHI1 5FZFA 1YIPA 1JMUB 4KG0A 5AC92 1RUC3 2R32A 4CDQC 2ERFA 3R6SA 2GN7A 3MIDA 4Y26A 1NCRB 3IAPA 2VC9A 3K4AA 3ACGA 3I2DA 1PZ7A 2GAUA 5FUPA 5C3OA 4A41A 1DCSA 2P1BA 2C24A 4FXKB 2W08A 2Q4SA 2WO7A 3J7HA 5JMOA 4IEQA 4RN5A 1O4TA 3USUB 4UF0B 1A3KA 1UMHA 3UT0A 1ASJ3 2R073 2XB6C 5KHHA 4OUSA 2GC2A 1W8NA 2WC2A 3M3QA 2ZEZA 1SFYA 5C3PA 5CFCA 3ON7A 4CU6A 1CAVB 4FP2A 1DZQA 4XCAA 2VUAA 4PF5A 1OD3A 3KV9A 3BIWE 3L2HA 1VBB1 2ETEA 2ZGUA 4XOGA 5BNQA 4YW6A 3H3LA 5FKBA 3H9AA 3U11A 2WWSA 2WFPA 1JU4A 1LESA 2DFCA 3TN93 2XJVA 4V2VA 1QOOA 3K75B 2WFF1 4YVSA 2QTWB 1KS4A 1C8M1 1RIRA 4UFJA 2R16A 1XOYA 1FOD2 2BRTA 3TEWA 2PHDA 2GSYA 1HN0A 4ES8A 1G9FA 1HJGA 5LCWL 5F37A 1UPIA 1S2BA 2ZHLA 4AVVA 2OYZA 4MGTA 2HJIA 1LOFA 4QQPA 2IXKA 5EV7A 2QVSB 1DU3D 3E5UA 3WQBA 1JZ2A 3AYAA 5T3NA 3BN6A 2RR11 2OZ6A 1RUI1 3AKSA 1KFUL 3D4KA 4J1WA 3FE5A 4Q8LA 4CE8A 5A3TA 1CONA 2ZAHA 3OOXA 2Y34A 2VZUA 3W20A 5CNAA 1X36A 3BU0A 1UMZA 4XBLA 3WUCA 4GWIA 4DRRA 5CFCB 5KHIA 2RDSA 1COV1 4ZU7A 4AOCA 5L9VA 2EIBA 5D8AA 3KV6A 1YQ6A 4XABA 4M3CE 4Y4RA 1UD1A 1WLWA 4AGGA 1ULEA 5GLWA 2W0XA 3OJBA 5BV6A 2WQ8A 2EALA 3LFIA 1N3QA 4UFIA 4YVSB 2HWF2 4L0PA 5I0SA 2ZGRA 3M3OA 3HEIA 2JICA 1X50A 5FBJA 3ENRA 5FTTC 2VMEA 5J1XA 2G1MA 4LO7A 3S57A 2WBKA 3NMBA 1NY72 2RDQA 1Y4WA 2VCCA 2QQVA 3D8CA 4IV3B 4P9IA 5FYMA 3FLPA 3RNSA 4JGYA 5FZ9A 4YYOA 3WG4A 1REDA 1R1A1 3VDDB 4ASLA 1UYPA 3GGLA 1IPKA 3GALA 4AGVA 4BQ1A 3BTAA 1ND3A 5C6CA 1LEMA 2FZ1A 4QQ2A 1DQ4A 1CVNA 2H0VA 3ABZA 1RYYA 3LD8A 3T4VA 1HLCA 5H9SA 5KHJA 2UYBA 1ENRA 5A1LA 2ZABA 1IZ3A 1TNFA 1WLDA 3J7LA 4LLFA 1F5FA 2CAVA 3V65A 4I3PA 5JR2A 5H9PA 3TNPB 4Y33A 4KBBA 1ONAA 2BVBA 2HWC1 4FPCA 5C3RA 1A34A 1JN2P 1OC1A 5A7PA 3VKOA 1X82A 3HBKA 4OUEA 5F32A 1FPN3 3ACIA 1ODMA 2R061 4LKEA 2ZHKA 5FYIA 1PM4A 5KC6A 1NUKA 1W6MA 2HBTA 5D8AB 3UETA 4XMIA 2ARCA 2JE7A 2BFUS 4TSVA 1RUJ2 3MW3A 1F31A 3VN4A 3ZFFA 1YFXA 4CUGA 4XFCA 1EUTA 3T08A 2XJUA 4P5YA 5FAXA 4DIQA 2O8OA 4Q4X2 4CUAA 1F8VA 3FBMA 3T0AA 3FJSA 2DCTA 5B2GB 2D6PA 2E33A 4AVTA 4A3XA 1Z7S3 4MYEA 2BU9A 2QFEA 1B09A 4K21A 2EXJA 4GXLA 4EN0A 3ST7A 3KCCA 4OHVA 3HBZA 2BQPA 2J1UA 4JGYB 2IXLA 4I30A 3QBQA 3ZXJA 1G86A 3APBA 3K4ZA 1DP0A 2WT2A 4CEYA 2WSVA 3O1SA 5I0RA 4XF4A 4BISA 3VUOA 4I02A 1W3XA 3BB6A 4E2QA 5FYUA 5FOJB 1JS9A 2XKOA 1OQDA 2GC1A 1W04A 4GB33 4I01A 2DV9A 1GZCA 4P14A 4EYUA 5IK7A 4LIUA 1YQ2A 3LE0A 2VZ1A 1RXGA 1GNZA 1WMXA 2A6XA 3OGRA 5T54A 1VLNA 3ZX7A 4C1XA 1AYN2 2WS91 3JBG2 3DXUA 3ZDVA 3TEXA 4MLOA 4XCBA 4FSJA 1W6MB 5EZWA 4S2HA 1BKZA 1D2QA 4ZU4A 4AHXA 3LOIA 5J7MA 3Q8EA 3F2ZA 5HV0A 1QJX3 4P9JA 4YM3A 4QPGA 1C3HA 1OD5A 1SBFA 5C70A 3U37A 4XUPA 1V6NA 1QIQA 1HN1A 4QKDA 5LK5A 4NRPA 3TBDA 3AJZA 4GH4C 4QGLA 4HL0A 2CDPA 4IETA 4FOYA 4BHPA 4AQTA 4B4RA 3TB0A 3ZIXA 4DOUA 2P34A 4IE4A 4QD2A 5FZDA 4CEYB 3FC0A 1NCRC 3OUHA 3EHKA 1E5IA 3UESA 4QX0A 4CCMA 4CCJA 5HCHA 1W90A 4N90A 4CXYA 2YG0A 4OI2A 4NAMA 5JXJA 5AVPA 4FPJA 4BB3A 4S2FA 1ZZCA 1REEA 2DVGA 1SBDA 1MACA 1AR71 4YPJA 4XJWA 4EZ4A 4GMP3 2HEWF 2OQ7A 1BBT2 4D69A 3OEBA 2ZBJA 3WEZA 1W0OA 1GR3A 5F5IA 3DF0A 4ZXEA 3I2FA 1NT0A 2HWE3 1QJY2 2KA3A 4OULA 4CCOA 1EPZA 3ZFEA 2BWAA 4GULA 2WA3A 4ZKTB 4I0BA 2YGMA 3U1XA 4XIOA 3RZZA 4I0AA 1XQNA 4DUWA 1XC6A 1X33A 2IXIA 5FIXA 3LB9A 3AZZA 5DABA 5FO7B 4PBOA 3VL8A 5A3PA 4P02B 3T1MA 2BBVA 1QNYA 1PK6B 4Q4V2 1OT5A 4L11A 1V9U1 3ZN6B 1FPN1 3HNBM 2AGSA 4P5HA 5T52A 2P5BA 5A7NA 3ZMNA 5ISLA 1CQ9A 4HK8A 3RYKA 4YFZA 3POJA 1U5ZA 2P37A 1FMD3 1RHI2 5AC93 2XL9A 3MFAA 3M3IA 3ORJA 2L9LA 5M0TA 5JSRA 1NCQB 3FLTA 3BIEA 4JVAA 4YGDA 1F9KA 1CZSA 3GBGA 4XZPA 5CZKA 1I6XA 4META 4DXRA 2RVAA 2EF6A 4GKYA 1Z7S1 5CFCC 1DBNA 2OUJA 4CTEA 1B35A 4N43C 1GOGA 1IGOA 4WVVA 2ILMA 1XNCA 2VOKA 4LUMA 4UW6A 1SFPA 4PLMA 3M7AA 4IE6A 1WCDJ 3ZFEB 5EJZB 3VD4A 3I3DA 1A8DA 1K42A 3PJYA 4FI9A 1ULCA 2ATFA 1NA1A 1OH3A 4YVSC 3JB8A 3PVEA 4D0QA 5F1RA 3KF3A 4AHYA 2EAAA 5IATA 1LKNA 4BQYA 3C3VA 5DAPA 2Y60A 3ZR6A 5FZHA 4AHZA 1SLLA 3NKGA 3VL9A 3IPVA 2LALA 4JTOA 2WFF2 3D3AA 3I8TA 4IQPA 1J83A 4PT6A 1C8M2 2A1XA 3VBRA 4Q8KA 4GJZA 1MPXA 1FOD3 2ZS6B 3DKQA 1HV0A 1LOFC 2GMEA 4OZXA 2E31A 2FHRA 1W8TA 3B94A 4BLJA 5FP3A 1QOSA 5CB7A 5AFBA 3C7EA 3ZN4A 3M70A 4M0HA 2GH2A 4HSJA 1IG3A 5D21A 5JIAA 1Z78A 1YFWA 3V0BA 3PDQA 1LOBA 2YC4A 4JHZA 5C9AA 2NQYA 4F3JA 1DDLA 2YHJA 2PAMA 1LCLA 1W9WA 2PQSA 5HXVA 3MO4A 1REFA 4D6SA 1GP6A 2RR12 1HRI1 1LAJA 2JDYA 2D7FA 1RUI2 2VW2A 2WN2A 4RS5A 4XACA 3RMXA 1B35B 5CISA 2Z42A 5D8AC 3FFQA 3O7OA 3AYEA 3R05A 4SLIA 3VBUB 3K48A 4BH9A 4YVWA 3ETPA 1COV2 2DWRA 1O8SA 3A22A 3C2UA 1XE8A 2HBUA 3VV1A 1NA1B 2BOIA 2FMYA 5GZEA 2XVGA 3POIA 1BEV1 5LK7B 1ZX5A 5CEHA 5FWEA 4B3NA 3BI3A 2VR4A 2D6LX 3D0SA 1NXMA 4J6GA 3N7MA 3IPVB 3TEYA 2HWF3 3B93A 4JGYC 2XBO1 1UIKA 1WA6X 4X6RB 3VBRB 1IG0A 1V6OA 2PAEA 2XHNA 1TG7A 4IE5A 1W0NA 3ZSLA 5FOBB 5JWPA 1ND3C 1VMJA 1BK0A 2HWE1 2VTXA 2V4VA 1WW5A 3DXTA 5JLVA 1QXRA 1G8WA 5FPVA 1R1A2 4LHKA 4CYDA 4V1PA 1RTVA 2PHXA 5LW9A 4KU7A 1LGCA 5C9AB 1OPOA 1W99A 3I3EA 4E9KA 2J1AA 4Y1ZA 1CGPA 1LR5A 2VNOA 3J9SA 2D3RA 4S2GA 1E5RA 3KT1A 1AJOA 2QDNA 2SBAA 4RS5B 1J3RA 1O8PA 2PELA 2ID4A 5DUXA 4YGCA 3BTXA 2AR6A 4JQTA 2DVAA 4FTEA 3T2TA 3TWIA 3ZFFC 4Q4W1 2R062 4LO8A 3FN9A 3CJXA 2NYYA 1NXD1 3PUSA 4PJYA 4DINB 1RUJ3 2VD7A 2XKPA 1Q8VA 1HV1A 3ETQA 1I9RA 3LDKA 2ENRA 4GKXA 4XETA 2JD4A 4B4QA 4EROA 1OPMA 4Q4X3 4QDQA 4LOSA 1H2NA 1BCXA 1C4RA 4XAAA 1GWMA 5FYVA 5JXIA 4ONUA 4YNIA 4CRQA 1HXS2 2RE9A 1PO21 3WNXA 3OF1A 4JCKA 4FTSA 3FLRA 4XXAA 1H9WA 4UBGA 5CG9A 3L2YA 2GDFA 2LRPA 5DQ0A 5IUQA 4DUXA 1JYVA 3KF5A 5FPUA 5IVFA 3ECQA 1GNYA 2D3SA 2RS11 4OZOA 2WQZC 2C26A 3N35A 5FYTA 5FBZA 3FMGA 3SITA 1OFNA 2PHRA 4BA6A 2ZJCA 4AI3A 5F3CA 3MV11 2ZOEB 4FPKA 1TMF1 3LGRA 3RI9A 5FP4A 1BVP1 5DMYA 3GHNA 1VRBA 4XE9A 4NIHA 4CCNA 2XJTA 3LEMA 4AFMA 1AYN3 3MDPA 3JBG3 2WS92 4XUTA 1MVQA 2QQIA 4QPIA 1QY4A 4AEKA 4QPGC 1AR61 5F8PA 3GZEA 4ZS3A 5A7SA 4BMBA 2VOTA 5GLZA 3RRDA 5EXOA 2V5DA 1PIV1 2Z69A 4Z07A 4Q0UA 2QNKA 4Y5Z0 5KHKA 4GJYA 1MEC1 1UWWA 4BWOA 3RG0A 1AR83 1AXKA 4RD7A 5FJHA 2FCVA 1ZZBA 3PU3A 1YFYA 4QPYA 4W6WA 1W2TA 2Q1ZB 4OHWA 4FPOB 2W1WA 2MPFA 2VXJA 5FZ1A 5C8WA 1AJKA 3AFKA 1F4AA 2YBPA 5JAXA 4JDMA 3LFMA 2TBVA 2RG4A 4IEXA 5C3QA 1XYOA 2GU9A 3RYRA 2DCYA 2ZGSA 1QGLA 4OYUA 2B39A 3T4HB 4AQSA 2W46A 1O91A 4AI1A 1UPSA 2J1SA 4KG8A 1W2AX 4PQ9A 5FYZA 4COWA 2HWB2 1AR72 4YM0A 1UW8A 1BBT3 4ATEA 2F17A 1OURA 3NW4A 3N9MA 3QH7A 1NX9A 3LSEA 1DLLA 1NY71 2RS52 1OF4A 1QJY3 2BBAA 2PAKA 3Q9OA 4Z82A 3T3YA 3ZO0B 1GLHA 1ENXA 1QKQA 1CN1A 1DZTA 2HWD2 3KQ4B 3AVSA 4AW7A 2W1UA 3LCPA 1UY0A 4Y5TA 1U5IA 1RUG2 5FP7A 4XILA 1M06G 4FAGA 2H6BA 3FFZA 1DIWA 2F6BA 4FPHA 1IKPA 2VMCA 3NNMA 2LM3A 4IGPA 2LUWA 3UL2A 4BZ4A 2JDPA 4YZ5A 5A6YA 2WAAA 3WZ1A 1O3QA 1Q56A 4XFFA 1V00A 1YI9A 5FMBA 1XNBA 4JKMA 2VZOA 2CGPA 5JSOA 3POFA 1J1LA 4Q4V3 2C6SA 4HPKA 5FY8A 2AUYA 3THPA 1V9U2 5A7OA 2BVVA 3DUIA 3FHIB 2A7AA 2E32A 2LTNA 4LHNA 1RUNA 3MV01 3P5BA 4EN9B 1RHI3 1ZNPA 3B9IA 3OCPA 3E97A 4OCTA 3I2HA 1A6CA 4E4SA 2ES3A 1SBEA 1EYBA 2BGCA 4NOTA 4Y1YA 3RVHA 4LXLA 1B35C 4Q4X1 4DXTA 4A7YA 1WW6A 1Q43A 3KM5A 3HWJA 2ZGMA 1OOPA 1U5XA 5GALA 4YW4A 4MHUA 2IUWA 4XFBA 2QQLA 5A3MA 2VBBA 4DFSA 2E7QA 1W6QA 4FPFA 1NA1C 1XE7A 4R52A 4YARA 2ZEXA 3T0DA 1OQ1A 2WO2A 4Q2FA 4AI8A 1ZZ7A 1N3PA 3W5NA 2A75A 2YMZA 4QKNA 1RUE1 4XJAA 1S0FA 4AAXA 2AENA 3VBRC 5FMOS 2ET1A 1RINA 2JG8A 5FZCA 4DB5A 5IVCA 3HIFA 3OGSA 1V6LA 5DUWA 3O14A 2WFF3 4HPKB 3RJ2X 1MQTA 4ZS2A 1RUF1 1C8M3 3PUIA 3VZMA 1VBE1 4YRDA 3SEEA 1X9PA 3MIEA 4XQ4A 5A6ZA 3NAPA 3HOBA 5A7QA 1AHSA 2VUDA 4M4PA 4C91A 3BTZA 2WNVA 3NJXA 5L73A 4N8MA 1XSQA 3EJKA 3I59A 3VB9A 3VKLA 4C1WA 5C9AC 4UT5A 3EB7A 5FZMA 2YV8A 2ZCWA 5CYYA 4LMFA 3MF6A 4ATFA 1WCSA 2JB4A 2UY9A 3DCQA 3ILNA 3POSA 4RS5C 3WY6A 2KD7A 2JE9A 2R49A 3ZXKA 3NQHA 1H30A 5FZGA 2FMDA 4JKLA 2EA7A 4AEMA 1OOPB 2GNDA 3MPBA 2RR13 2ZMLA 1J58A 3MHZA 4YVWC 1HRI2 3WINE 1RUI3 2WT1A 1MS8A 1UNBA 1RC6A 1PZ9A 2O1QA 1VJ2A 3O1OA 1WUVA 1WKYA 3IM0A 3MLKA 4YGBA 5BNOA 1GNHA 1W6QB 3ILFA 3AZXA 5IVBA 4XURA 3I49A 2D5FA 1AVBA 4NAOA 5HBAA 3SEPA 3OGGA 2QBXA 1NLSA 3HMYA 4WBBA 5F3EA 3AXDA 1I3HA 1R091 4DO0A 2G9ZA 1COV3 4FAHA 5KWRA 1JU3A 4I2OA 5JOZA 1IS4A 1CAXA 2QQUA 3WNPA 3U78A 5IAXA 3KLSA 4FVVA 4XJ9A 1GMMA 1OLMA 5IFTA 3AMMA 1HRV2 4FPYA 4WZFA 3RJRA 4DPNA 1MQTB 4HVOA 2JB8A 2XBO2 1SCSA 1N1SA 2WT0A 3B00A 2WAOA 2D43A 4MH0E 1C28A 1W06A 2WNVB 4I0WB 4X6QB 3O1MA 2QQJA 4YG0A 1ODNA 3S5QA 1YYNA 1OHFA 1R1A3 2W94A 4RYDA 1YCIA 1VAMA 3RI8A 4P9GA 4HK9A 4PI0A 1AYM2 1RJ8A 4KWJA 1WW4A 5JXGA 3MIHA 4AG4A 1ND2A 4RHV1 1PMHX 2ZPXA 2NMOA 3KB5A 1JZ3A 1VR3A 2XR4A 2A3YA 4WM8A 4CZSA 1Y3TA 1GV9A 1VBC1 1C5HA 1XU2A 5LBCA 1IS5A 3PTYA 4AYUA 5AFEA 4Q4W2 3SMHA 5FPXA 2R063 2F4PA 5IK5A 1NG0A 3GZAA 3PMSA 1F35A 3AVRA 2VGDA 4QAWA 3N7JA 1BVVA 4PBPA 2ZZJA 5DPNA 3ZLIA 4LTAA 4LA3A 4R9CA 4D6QA 4IV1A 4LBOA 3BTYA 4XC9A 3T1LA 1JOJA 4ISRA 4XDOA 1OA2A 4QGMA 5EPAA 3N9OA 4EWEA 2ZKLA 3S6PA 2IXHA 2DUQA 1HXS3 4PIYA 1GICA 3CJIA 4BLIA 3VBOC 3P1IA 1PO22 1GSLA 1AX2A 3KCYA 5B4XA 3AMNA 3ZM8A 4YG6A 1AR92 1XB9A 2JE8A 2OT7A 1C57A 4DEQA 2RJLA 3VZJA 4BQ3A 4N43A 2RS12 2VOWA 4COZA 1QF3A 5IHRA 4AF9A 4N9IA 5F5QA 2VOXA 2GZWA 1ND2B 1UZVA 4JKKA 1JZ5A 3ILRA 4YG3A 2X53S 4QPIC 3GZUC 2XUEA 4WM8B 5FXVA 3U4SA 1TMF2 2CU5A 5DAVA 3VDBA 3IMMA 1H1MA 1GZ9A 1GYKA 3O0WA 1JYXA 5LBBA 2O0OA 1UN1A 4EE2A 5I0DA 4BM8A 2WS93 4QQLA 4L99A 5F39A 4PF1A 5LEJA 1E5SA 3FWEA 1CWPA 1IHMA 4BQ4A 1AR62 2A71A 4Y20A 1KS5A 4CU7A 1H2MA 1LOAA 2X8KA 4XPVA 1XYPA 4JRAA 4NVPA 3R0RA 1Q8QA 2W95A 4F8AA 1PIV2 5ANQA 2QJVA 4XFHA 3HN3A 1JYCA 1N1VA 1UY4A 4D3WA 3ZYIB 4BK4A 3VBHA 1MEC2 2WWJA 2VOVA 1KD7A 4AI9A 4Q4Y1 3THDA 2WNEA 3JUUA 4IDZA 3M2MA 5D1IA 3VKFC 4A6OA 4N7UA 1ENQA 4A4AA 4IW3A 1CPMA 1WLTA 5D2AA 4O61A 4LBNA 3GJBA 3M3EA 4N43B 4P9LA 4AI2A 3VKNA 4UFLA 5HV4A 1RJ7A 2E51A 3FHQA 4MZUA 2WQ4A 4R8HA 4MXWA 4CP1A 1GFF2 3GXUA 3WOGA 3WD5A 1AXZA 4BQWA 2HWB3 4LEJA 1AR73 5TSWA 3DYMA 1XE0A 2YYOA 1OA4A 2RJ2A 4RFRB 3K3OA 5FY5A 3ZYRA 4HSLA 2DVFA 1GBGA 1LHOA 2XLGA 4DXZA 3WF3A 5A80A 3WP5A 5I8YA 4RFT0 2RMU2 5I8TA 1ULPA 4GQ7A 1RGSA 2XQXA 4Y20B 1OUSA 2VZRA 5F7UA 2UYAA 3RWNA 1MVEA 4UW5A 5FZ4A 2BGOA 3P3PA 4OHZA 1R081 2OPKA 5FYSA 4ZXKA 4LORA 4JAAA 5K4LA 2VCMA 1RUG3 1ZA7A 2UURA 4NWWA 3VBHB 1YO8A 3SH5A 4RGGA 2IXJA 4A7ZA 1QMJA 1OF3A 3MBWA 4Y22A 3D0JA 3WP3A 2GP5A 1SFNA 5IVVA 2QQNA 3LDRA 3GM8A 1VAKA 4M3CF 3ZVXA 3VBSA 2EIDA 2AEZA 3N9QA 1V9U3 2WN3A 3T2OA 3ZSMA 1D7PM 4MGSA 1FXZA 1OUXA 3IDEA 2VZPA 4LO5B 2FDIA 5BPXA 1OMIA 4BXSV 4LOTA 4LHLA 1QXPA 4LIVA 1UY2A 1OOPC 5C71A 2PLV1 4MXWB 2H0BA 2ARAA 1L7LA 2WZ8A 3H3UA 2C9AA 3FHAA 3NSTA 4YFWA 4AEJA 3OPWA 2W39A 2DUOA 1HXS1 4YW5A 3K51A 4E2SA 5FO8B 1YUDA 1UZYA 1WCKA 4BJ0A 1MS4A 3BODA 2EIGA 3WDXA 4FOWA 3JQWA 2R0HA 2V5YA 2RS31 4EJRA 1ZZ9A 1XBFA 2AYHA 1ND3B 2JG8C 1N1YA 3I2KA 4AFDA 1S55A 3OBRA 2FDKA 2OKXA 1RUE2 2W52A 5CFDA 5DDJ1 3ZYJB 1MQTC 1YQ5A 2ZEYA 2JEMA 2W91A 3C7FA 1MS3A 4Y22B 2RV9A 3NAPC 5L7OC 2E9QA 2VCAA 2WNVC 1PGL2 1QDOA 3OUJA 3VBSB 2ZMKA 2TNFA 5LWBA 3E1F1 4LKSA 3OG2A 1RUF2 5JDBA 2XJRA 1VBE2 3H0OA 1W2OA 2R1DA 3H50A 1NYWA 1Y43B 1ZBE1 3MW4A 1KRIA 1Q8OA 1SLIA 2F4LA 2K9ZA 3LA7A 2WZPP 2Q1FA 1MR5A 3ZFFB 3A0KA 3HJRA 4E27A 2VNVA 4IE0A 3KWVA 4BYYA 4NHLA 4NE9A 1BHGA 2VXRA 5BNOC 3U75A 2ZGQA 2VBDA 3O5SA 5T5OA 4QM8A 1HRI3 4UFHA 5EIYB 4DY3A 3S5AA 2GMMA 1D0GA 1JBCA 3CNAA 4CDUA 2B42B 2HEVF 2LW8A 1ZVFA 2VG9A 1DHKB 2AEYA 2Y6FA 3V64A 1R092 2O8QA 2XWBB 4LNVA 3UV9A 3DL3A 5CFDB 1H1AA 3VZLA 1GP4A 1DGRA 1BEV3 1CPNA 4Z92B 4S2DA 3PIGA 4IGOA 2I74A 1I5ZA 2JDKA 4QDRA 2HWB1 2VZ3A 3MUZ1 1V70A 3GCXA 4YZ1A 4QM9A 1DFQA 3TAYA 2XBO3 1XXNA 1RVF2 1WZXA 2ZAAA 3A21A 2FDFA 3S30A 5JCTA 2G19A 1I1EA 2RS51 3WNKA 1UY1A 1C5IA 5FY9A 1U12A 2HWD1 4P9YA 5CKQA 3SCHA 1ND2C 1A78A 3B3QE 5F2SA 5I0UA 5GZGA 4QGNA 1EAH1 3AB0A 2PHUA 1VRH1 4IXLA 3D5OA 1AL0G 1RUG1 1LTEA 1AYM3 1MZEA 2J42A 2VUCA 4QPGB 4WM8C 4Y4YA 1LHVA 3U10A 2CWSA 4HLTA 5JOWA 1WMEA 4GWJA 4XMAA 3MGUA 1GANA 4HXCA 4RHV2 2QZ3A 1JYTA 2Y0IA 3SISA 3AK0A 4LLOA 1W6PA 4AHWA 2NPIA 2QZ2A 3VHOA 2QQKA 3VD7A 4CDUB 1SDDB 1O59A 5E89A 1UYXA 1VBC2 2DVDA 3AMQA 4FOQA 5DZFA 5EQUA 1CAWA 4YW3A 5C7GA 4Q4W3 3KSCA 4IV1C 4GZ9A 1YWKA 2EAKA 3POEA 4XIKA 3ZFGC 1HX6A 4FQ4A 5FLIA 5BYNA 4OVEA 2R1BA 3WP6A 3ME2A 3CJIC 2VECA 5BNNA 1Y7BA 3LOBA 1TVGA 2GNMA 2Y38A 1DQ1A 1NOVA 1QJU1 2IVJA 3HNYM 4LPLA 2RJKA 2OW4A 1IKQA 1T2XA 5T5JA 4IEPA 3SH3A 5DUVA 3CF6E 4LK6A 1PO23 3CLPA 1W8HA 4IEZA 2A6ZA 3ZDSA 5K8SA 3H8XA 3SC7X 1RUD1 1AR93 2WZR1 2W92A 3MI8A 3NVCA 1KDMA 2R6QA 3PUQA 4R4XA 4KI5M 1UY3A 2D97A 1G9DA 2RS13 5JMCA 1V6MA 5EP9A 4CCEA 1JZ8A 2VNRA 3I2GA 1Q5OA 1W6PB 1VE0A 2JECA 1BMV2 1TMF3 2R041 1L3JA 1Q3EA 2VZQA 2E53A 4HN1A 4XW3A 1XNDA 4MOAA 1VBA1 2OS2A 1AUYA 1CAWB 3UGGA 1PX4A 1YI7A 4IGQA 1GP5A 4JDNA 1AR63 2E26A 3VBHC 4BQ5A 1RITA 3KV5A 1HDKA 1UYYA 2ADDA 2OUHA 3MEPA 3SHRA 3T0BA 4PIZA 5T5LA 5A3LA 1SPPA 3LA3A 4G4FA 1OQEA 1JODA 1PIV3 1SMVA 4ZONA 3OSDA 5DN2A 5BNNB 2VM9A 1DQ6A 2H6CA 1ULGA 5JVVA 2KM2A 4Q26A 2YGLA 4RGAA 1MEC3 5C4WA 3SKJE 3FZ3A 3VLBB 4CDWA 1EV11 2OA2A 2VMGA 4LHSA 3H8OA 1RUOA 4Q4Y2 4L97A 1R1ZA 1XSRA 4JV4A 4M01A 2BGPA 1NAEA 2WNOA 4HKLA 1G9CA 2QQPA 3H7JA 1CX1A 5K0UA 3PMEA 4K1YA 1QNWA 3FX3A 2DU1A 3ES1A 1W2NA 4HT1T 5T50A 5IFPA 1JYNA 1H2KA 5H9RA 3IIAA 1NZIA 4K9SA 2JKXA 5GLTA 4WVWA 4M3CA 2FZ2A 3AJYA 4DNYA 4FT8A 1UYZA 2XWJB 3BCWA 3VZKA 1HRV1 2VZVA 4XJ8A 5H9QA 4OQ8A 4QWNA 1OBNA 5ABJA 1LENA 2XJPA 2VQAA 4LITA 4QDSA 2XLFA 4AGRA 4DEVA 1UX6A 3K4DA 2W5FA 1W03A 1FNZA 1NE6A 5LBEA 1J3PA 3LDBA 2V4AA 4LBQA 4QHOA 3WNLA 5FPBA 1L7RA 4QB1A 5A3NA 2CAUA 5L9RA 4QU1A 4MG2A 1R082 1SPPB 3N3HA 1QDCA 2ZMNA 1FI2A 1POQA 1SQ4A 4NWVA 1AYM1 4XYXA 2Q1MA 4TYSA 1O6UA 4UFMA 4XF9A 4AE2A 3RZGA 3V56A 1VBD2 5IAVA 3VBSC 5C4WB 4CDWB 1FATA 4XFIA 2P3JA 2B9UA 3WT3A 3OEAA 3THCA 3ACHA 3KCXA 3WHTA 4HG6B 1APNA 2GC0A 2VUJA 3NJZA 2WKKA 3FBYA 1HB3A 3G7DA 3M3CA 4HFSA 4C0HA 5EFUA 1UO9A 3NJVA 5FYBA 4YVWB 5CU1A 5K0UB 1QQP2 2B8MA 2YFZA 4XXPA 4CUBA 1SLAA 4XBNA 4OHYA 2IC1A 2W47A 3B5LB 3M8LA 3WUDA 2VVDA 3FL7A 1UF2C 3DPRA 4JC1A 2UU8A 3CIHA 1UQXA 2PLV2 4M3CB 4M4RA 2YDEA 3AP7A 3FUQA 1TZOA 4FP3A 2DYCA 5AVAA 1DZRA 2RDNA 1S2EA 5KHGA 5ABJB 2J7MA 1ZREA 1ZYBA 4E8DA 3QOPA 2A6VA 1PVXA 2EXKA 4BOWA 5HCBA 5K9YA 3J26N 2HLEA 2Y33A 3J7NA 4ORFA 3ZKUA 1YRZA 4LBQB 3MIBA 1LOGA 1OLRA 1KITA 1V6JA 1ULOA 5CFDC 1PGSA 1AR91 2PQQA 5FP9A 3WLUA 1BK1A 2RS32 5GZFA 4J25A 3VBOA 2Q8CA 3C7OA 1OKOA 4TXWA 2WWUA 2G9FA 4LJHA 4P00B 4IUGA 1RUE3 4Q1RA 4AVSA 3MFCA 1UZZA 2Y6JA 2B46X 5DDJ2 3KGLA 1O3TA 3LPGA 4IEWA 5KXEA 1U5YA 1Y9GA 2XJSA 4KQ7A 2EXHA 2V72A 1LODA 3MIGA 3SQOA 5LRRA 1LB2A 5J48A 2HH9A 1CZVA 3AC0A 1S0DA 4LKFA 1EPWA 3GDBA 1RUF3 1H6XA 2ZGKA 1VBE3 4OMCA 4FQZA 3LQCA 3O1TA 4D94A 4JHTA 3LAGA 2VQUA 1UZWA 4EZHA 1ZBE2 5CVRA 3DPRB 1XU1A 3I97A 4E4DX 4MADA 3ZPOA 3M1HA 3MZHA 2P3YA 1W39A 2HYKA 3PNAA 1LHNA 3WX5A 4CDUC 2P6CA 2OZJA 2J1EA 1GQGA 5J3UA 2MEV1 3BPZA 3OBTA 3AZWA 1CESA 4WVMA 2WLPA 3WR0A 2JX9A 4CP2A 2JIGA 1NZCA 2CY6A 2J22A 1JHNA 3KZ4C 4ITCA 1PO11 4A45A 1C1LA 4D6RA 1ZRFA 5IK4A 3BGAA 4EN7B 3CU7A 3H42B 4QXBA 4BPZA 1JI6A 4K6BA 1M4WA 1LGNA 1R093 3VBOB 2OPWA 1QH6A 2JDAA 4MV2A 5A6XA 1FV3A 4OI0A 5KR7A 4YSFA 1S0GA 4AWDA 4RQPA 1HB1A 1GOFA 1W9TA 3H1MA 2I07B 4B7KA 3C7HA 4HKWA 2G4IA 2VMFA 2BW8A 3AMHA 3DN7A 4QX7A 2UWAA 1LU1A 2D93A 2BPA2 2ORZA 1H8VA 3JD71 1RVF3 1ULFA 1MS5A 2VO5A 4WM7A 5DG1A 2Y26A 2NN8A 3MW2A 4CCDA 4QPIB 3VKMA 2RMU1 5JOYA 4W8JA 3R4SA 3CMGA 5L36A 1EP0A 4YLZA 5CBLA 1CZTA 2AC1A 3J8F1 4X8PA 4LT5A 3K3NA 4GD4A 1J3QA 3IZOA 4QHBA 1KQRA 1EAH2 4N53A 1VRH2 1JZ6A 3GZTB 5FWJA 3L9JT 2DF7A 4COUA 4KH9A 4DQAA 1RUH1 3NJYA 3B7MA 4P08A 4RHV3 2YY1A 4Y5SA 5I93A 4WVMB 4Z2WA 1G9BA 3KD4A 2HKXA 3T2PA 3ZYPA 2X29A 4CXWA 2OXBA 3PURA 2Z79A 3ZXLA 1W8FA 2ET7A 1VBC3 4KWUA 2ZGNA 2XXZA 1W0PA 2IZWA 5JZGA 2Z2SB 3ZXFA 5L7OA 5BNNC 1DQ5A 2XGXA 5GM0A 4AFAA 1PM7A 2VH9A 1H9PA 2VPVA 4N9HA 4RQPB 5JPNB 1ULDA 4B7EA 1O7FA 3ATGA 3O12A 3WG2A 5A70A 4LO6B 4XEZA 5L19A 4I3GA 3E6CC 4E4HA 2W3JA 1QJU2 1YIFA 1UCXA 1US2A 3O0XA 2OIIA 2VZSA 2XVKA 2JDHA 3PVBB 1W8ZA 2D3PA 4M0NA 5DAQA 5FPZA 4YZ4A 4CUCA 1DGWX 3TRSB 4PHZA 2BDRA 4IERA 5F6LB 1RUD2 1L7QA 3PVNA 3V0AA 2WZR2 3POYA 3MLLA 4N53B 3ZXGA 1KXGA 2WRAA 4PIXA 5DAXA 4O9GA 4HZFA 1POV1 3LEGA 3ZSKA 2YXSA 4XDQA 4D7TA 5IK8A 1WCQA 2Q0AA 4IL7A 2GP3A 2SLIA 2XONA 3EMRA 4NRQA 1ZRRA 2ZGPA 1ZRCA 3SNMA 2V09A 3U4XA 1E57A 4W6XA 4XF3A 2VQ0A 4XUNA 2R042 4W4ZA 1PGL1 3ROUA 4DZGA 3PVOA 4ISQA 5LBFA 3I2OA 4LQRA 1VBA2 1C8NA 2XHKA 3LEIA 3NV4A 4QX2A 4FFGA 5E1RA 5I91A 1NLRA 2ZA9A 2YB7A 5L7OB 3W5MA 4NMIA 1NKGA 2YPDA 1HKDA 4MGKE 5E8AA 2ZACA 3WNNA 5SV5A 5J36A 3GJAA 1PNFA 4CDWC 3ZSJA 5C4WC 5FZAA 1O3RA 3HPNA 1JOBA 3AYCA 1LHUA 2CL2A 3EYPA 5A33A 4UW4A 3USSA 4ARXA 1GQHA 4Y1VA 1ZA4A 3J7MA 2FDHA 1V6KA 4EWDA 3AXEA 1EV12 1XNKA 2D40A 4Q4Y3 5K0UC 1UIJA 1OH4A 2BNMA 3THTA 1VALA 3WF1A 3BKZA 1UU5A 2D6OX 2QDRA 1RB8G 5F3GA 3RZLA 2BUKA 5J09A 4UWDA 3KT7A 3V0AB 1WMDA 4NIAA 4H2AA 3KHBA 2ZX1A 5JPMB 4Q5OA 3WF4A 1TEIA 1IOAA 3UJOA 1N1TA 3FUOA 5ABJC 4MX3A 1LRHA 4LO4B 3RMYA 3ZYBA 3G6JB 1I5PA 3ZXEA 5HI0A 2JG8B 1XRUA 5BNPC 2IVIB 3CKHA 3LA2A 4QX8A 3W59A 2YROA 3RYPA 1YJLA 1YQ8A 5FCCA 4A44A 4XTMA 5CA6A 5FZLA 3AMPA 4QKFA 1RVF1 5IT6A 1SLBA 3GYDA 2PTMA 1AL22 3NAPB 5FMCA 1D4M1 1YNAA 2ZX0A 2NLRA 3VDCA 5KXCA 3I59B 3INAA 2WYSA 4HKOA 2BOJA 2CGNA 1FT9A 3MF9A 3NNGA 1ALYA 1KJLA 4DMIA
chains in the Genus database with same CATH topology
1R083 4E4ZA 1O5UA 2ZGLA 5A33B 2XUMA 4PDWA 2MNGA 3R4UA 1BZWA 1QJZA 1MZFA 1VBD3 5JR7B 3WQ1A 1XYNA 1V6IA 3P3NA 2WINB 1OKQA 1BQPA 1WLCA 2I2SA 1PHMA 5BNOB 4DS0A 3DPRC 3H1YA 4MXVA 2RM21 1LU2A 4ZU5A 1MZ5A 3E5XA 4AVBA 1OFSA 4K1ZA 1F2NA 4UXAA 3KS7A 1CAXB 2PLV3 4CEWC 1UU4A 2ARBA 2PYTA 3NWKA 4IEVA 5ACA1 3VHRA 1H4HA 2C5DA 4EWAA 3ZFGA 3ZXAC 3UKTA 1SLTA 3HT1A 2A3WA 3OY8A 3I7DA 2RHPA 1ZRDA 4U36A 2RS33 2PA7A 4L92A 4F83A 4PDWB 2WL1A 3B02A 3EXUA 5LEKA 2JG9A 4XF1A 3VZNA 1SACA 5DDJ3 2CGOA 4FBFA 2PHWA 4GWMA 2E7TA 2AZ5A 3JCIA 5GZCA 4XFGA 1BMV1 5GKAC 1YFUA 1NE4A 2G9GA 1LOCA 4IEYA 5GJ6A 4NHKA 2NP0A 1ZBE3 3ZPYA 1MS0A 3GNEA 1QU0A 5KBFA 3QH6A 4IV1B 1C1FA 1DQ0A 1UAIA 4IEUA 2WJSA 3WW1A 3ZFGB 1YJKA 2MEV2 4BIOA 4F7ZA 4KNCA 1OI6A 3CJIB 1K5MA 1Q8PA 2BFUL 2I45A 1PO12 4DY5A 3OY8B 2VW0A 1RMU1 1AX1A 3U0ZA 4RQPC 3H7YA 4N7IA 2GMPA 4IV3A 3WW4A 1G9AA 3VDDA 1ZBA1 1CX4A 2JG9B 1DGRN 3VBFA 3IN9A 4WM7C 2WSUA 3GHMA 3N4MA 3H8UA 1G6NA 3GBFA 4L8QA 4QXKA 1NQJA 1UKGA 3QCWA 3KGZA 1FAYA 4AFBA 3JD72 4AI0A 4N53C 2E7AA 2RS53 3PHMA 3B69A 3J8F2 2HWD3 3EO6A 4QU2A 2NM1A 1EAH3 4EN6B 1VRH3 2CTVA 1Q8SA 4QQHA 1VBD1 1LHWA 1RUH2 4AQ2A 2DVBA 3QACA 2B45X 5JZGC 4JQRA 4K20A 2VULA 3KQRA 1K5MB 3OGJA 1S0BA 1WD3A 3NO8A 2JJ6A 1YHFA 1TE1B 4Q0VA 4GMP0 2WNUA 1PVC1 5DUUA 2VVEA 2ARXA 5J98B 1QQP1 1VP6A 4AEDC 1BYHA 3JZVA 1ZZ8A 3VBFB 4JRLA 1JUIA 1TNRA 4FPEA 1SDWA 4URTA 1QJU3 5FQ0A 4O9EA 3WP4A 4AVCA 4HVRA 5FO9B 5KXDA 3ASIA 3NV1A 1HIXA 4K40A 1DYPA 3LKJA 4H3WA 1H4GA 1W6OA 1Y9QA 2CV6A 2B5HA 4H7LA 1RUD3 2WZR3 5FFOC 2YC0A 4AFCA 4M00A 1RUC1 2W68A 4HVQA 3GBWA 4LBMA 4MSVA 1FX5A 2HEYF 1DF0A 3IBMA 2YZ4A 3VHNA 5BUVA 1YXWA 3S0MA 4L2NA 2R043 3S7IA 2WNUB 1JH5A 1MS9A 1VBA3 3AP6A 5T5PA 2GALA 5JSPA 1ASJ1 2R071 1BXHA 3CO2A 2Q8OA 4P9XA 3D6EA 4XJZA 2DCJA 5BXXA 5JIUA 5KXBA 1UKRA 4XFAA 2PFWA 1UL9A 1WBFA 3AP4A 5J96B 4G3YC 4KU8A 4Q1PA 1CD3G 3AZYA 3MICA 4HN0A 4MGZE 3OYWA 5FQ0B 1EV13 3RPQA 1LGBA 5FREA 3TN91 4QQOA 3QLQA 2BNOA 1W6OB 3WDTA 2GN3A 4MGYE 1PGW2 4G9SB 1AXYA 1AX0A 2VY0A 3LZZA 2N7GA 2VNGA 3ES4A 4R4ZA 5F6KA 2WA4A 3LSDA 1ZZ6A 3VZOA 3QD6A 4YGEA 4PLOA 2GC3A 1AR82 4LUKA 3ZXDA 2KXLA 2FBEA 1HRV3 1SEFA 4LBQD 2V73A 4AK3A 3AZVA 2QCSB 4C0BA 2TUNA 4LBKA 1AL23 4Y1UA 3KMHA 1D4M2 1PK6A 4PDWC 3ZN6A 2DCKA 3WQ0A 3SLIA 2XJQA 1OA3A 4NR1A 4HBNA 3AKRA 1NCQA 3OYWB 4R9DA 1CJPA 5GLVA 5EWSA 3O0VA 3UJQA 1QH7A 3N36A 4QT6A 4LBLA 1JXNA 4TLFA 4Q27A 3H1WA 2A73B 4XF0A 2IFWA 2X5IA 4Y1XA 3ZIWA 2RM22 4U2AA 2AREA 5DG2A 2A6YA 1QWRA 4KGGA 3TNQA 2PHTA 4Q0SA 3EBRA 3OD0A 1TME2 4K8FA 3IDBB 2IXCA 3ZMOA 2DCZA 2TEPA 4OI4A 3LWCA 3AKPA 1HW5A 3JQXA 1S0JA 4X8NA 5ACA2 4W6YA 4LULA 1D4VB 3OD4A 3AP9A 3CL1A 3BOWA 2D6MA 1DQ2A 3AYDA 1H8TA 3SXWA 1JYIA 1X8EA 2VU9A 3WVJA 4AQ6A 2JG9C 4BMEA 3MLJA 4CDXA 5GLUA 2DTWA 1MS1A 3CEWA 1CAUA 1POV0 2A5ZA 2YPJA 3KT4A 4RL7A 4YM1A 2X5IB 4I09A 3UKNA 3GF6A 4D7SA 1JUHA 1LOEA 4Q0PA 3VBUA 4PCRA 2UWCA 4H7MA 3AKTA 5E88A 2XL7A 2AH2A 4Z8BA 4TZDA 4DRVA 5FLJA 1K5MC 2P2KA 3E6DA 2D6NA 1VBB2 4LE4A 4A2UA 4GB31 1N3OA 2B7YA 2MEV3 2R30A 2WIIB 2MHFA 4IV3C 1D2SA 1GZWA 1IQAA 1H8TB 1PO13 3VDDC 1RMU2 4LBJA 3WV6A 2CNAA 3VBFC 4CDXB 2P17A 3IMNA 4JDOA 1ZBA2 1QJX1 1CAUB 2P3KA 2ZX4A 3UK9A 3BU7A 5CADA 5A32A 4OHXA 3N7LA 1F5JA 3W9AA 3JD73 4MUVA 5HCAA 1AL21 2D5HA 3ACLA 3E6BA 4NN0A 2RMU3 5BNPA 2ZKNA 4LR4A 5CIRA 3J8F3 2UWBA 4KWKA 4RSUA 4XQDA 4YZ3A 5KC5A 5SV8A 3M4FA 2WNUC 2EVXA 5FRAA 1RUH3 1YLLA 2UY8A 3ALQA 3A4UA 3R4DB 4GMP1 4BCUA 2GNTA 3WCRA 3WW3A 1GZWB 4JGZA 1DG6A 2BNNA 4UBHA 4OFGA 3X29B 3RSJA 1LULA 1PVC2 4L9BA 1ZM1A 1VIWB 2ZHNA 2ZTNA 4XJUA 4CP0A 2R0FA 1GKBA 5I0TA 4JTNA 4GWNA 1O4YA 2DTYA 5C8CA 2ZX2A 3H3ZA 2PHLA 1T6GC 3HN1A 5A32B 5EJ3A 3EQEA 4GA9A 4KWLA 3VHPA 3WDYA 2HWC2 4CEWA 1JTZX 2D98A 5BNPB 1FV2A 3PLQA 1S0EA 3JB4C 2PN5A 5E16A 3U07A 1FMD1 1WGPA 1KFXL 5AC91 2GH8A 1RUC2 2K2SA 1POV3 1D0HA 4K7JA 2XG3A 4B8EA 3B01A 4RR3A 4E2GA 4CDQA 2VMHA 4JGZB 4CEYC 4LE3A 4BE3A 1BJQA 4Q0QA 4FPLA 1ASJ2 2R072 2A6WA 1OLQA 1J59A 1RL3A 3WDWA 1DGLA 3PJQA 2IWGB 1HQLA 5C8CB 3WDUA 2JKBA 4INDA 4FXGB 5DZEA 2Y0OA 5EYYA 3WQ7A 2IFRA 5JI9A 3WCSA 3ELNA 4Q29A 2QKDA 4FO9A 4XHXA 4CEWB 3TN92 4OI1A 3NV2A 3S7EA 3IDCB 1FOD1 1EY2A 3HT2A 3HAGA 1CR7A 4R9BA 2QE3A 1X8MA 4EV0A 2C1FA 2D44A 4HETA 1W2UA 4YW1A 2BEOA 1J1TA 4RR3B 1A8MA 4Z1VA 1PK6C 4CDQB 5F9TA 1G7YA 4QX5A 4MVTA 2Q30A 2DUPA 4ASMB 4D7YA 1NQDA 4XTPA 3WG3A 5K7PA 3BOPA 1D4M3 3SCGA 4EN8B 2XPJA 5FMOL 1NCQC 1WW7A 4HMZA 4MGIE 4FTBA 2OVUA 4NHMA 4AXOA 1AZDA 2ZGOA 1HQWA 2JXAA 2NZ9A 3IT8A 4COVA 1JW6A 4KGQA 4LA2A 4BIFA 2JENA 2X5IC 5FDBA 1SLCA 1H1IA 5JOXA 1VB2A 2HWF1 2P3IA 3ZFEC 1W6NA 2VVFA 2E63A 3TOJA 4SBVA 4B4PA 2RM23 2JDZA 3ZN5A 3A0NA 3AM2A 3WW2A 4H14A 1PNGA 4GIQA 5JI7A 4AVAA 1N47A 3MIFA 1TME3 2QUOA 1FYUA 3HD8B 2VW1A 2YUEA 3B9CA 4AEDA 3MPPG 4WV8A 1UU6A 2EXIA 4GALA 3JU9A 5ACA3 3W58A 1H8TC 3AP5A 1CIWA 4CDXC 1KDKA 4WM7B 4UW3A 1CJDA 3OPZA 4TWTA 4KL1A 5DXDA 2XVLA 1FPN2 1HQNA 2BTVC 1Z0HA 3URFA 4C90A 4ES9A 2E6VA 4RA0A 1URXA 4NO4A 1RUJ1 2ZZQA 1IS3A 2VMIA 3RQ0A 4PLNA 2CYFA 4W65A 1PZ8A 4WVZA 5DZGA 4XQWA 2D6KA 3DGTA 3NL1A 2BYVE 5FLHA 2WLQA 4YM2A 3VBUC 1W6NB 1S1AA 1S0CA 4XHBA 1Z7S2 1SCRA 3SCFA 5JZGB 2A70A 1U0AA 1H0BA 3N7KA 3OTFA 2ZHMA 1QHDA 4OUMA 3RS6A 4AEDB 3MYXA 2PHFA 5HCFA 1IS6A 3E5QA 4A7KA 1VBB3 3AX4A 3IWZA 3POWA 3SH4A 3TYJA 2FQPA 4GB32 5CAZA 4P9WA 4YZ2A 4K3UA 3UKVA 2NMNA 1DGWA 1S0IA 2K0GA 2XH6A 3WG1A 3AKQA 5C33A 1AYN1 3JBG1 3AFGA 1RMU3 3ZYGA 1PGW1 3J4UH 2DU0A 4COYA 1OSGA 3NV3A 5T55A 1X7NA 2Q5TA 1WBLA 1ZBA3 3DV8A 3HQXA 3HR9A 1QJX2 3IKWA 5EYXA 1LECA 1QOTA 1O4ZA 2ZGTA 2ZX3A 1AR81 2Z5WA 3BALA 1VB4A 4FOVA 4YW2A 1AF9A 4FPGA 4HANA 4XBQA 4Y24A 4GH4A 3I4IA 1ENSA 3I54A 1QXJA 4R9AA 4WZCA 1IPJA 3DKWA 4JGZC 1BEV2 5J37A 2BWCA 3D82A 1NCRA 2GNBA 1O3SA 1LJ7A 2CWMA 1BBT1 4IEOA 4OLLA 5GZDA 3USUA 4B29A 4H55A 1DYKA 1VAVA 1PVC3 5CG8A 2DFBA 1LEDA 4FCAA 1PMIA 1QJY1 2HWE2 3ZSEA 1QQP3 1WD4A 5C8CC 1O5LA 4IESA 3VGIA 1FNYA 1TME1 3NKTA 5I8SA 1CAVA 5BY5A 1H2LA 2C0ZA 3RDIA 2DURA 2A3XA 2XLAA 1WMFA 2HWC3 4QMAA 1WA4A 4J1XA 4NPRA 4Q4V1 1TQ5A 5LRSA 1MZ6A 3WXPA 1KJRA 1S2KA 4GH4B 3WHUA 4RR3C 1FMD2 1RHI1 1YIPA 4KG0A 5AC92 1RUC3 2R32A 4CDQC 2ERFA 3R6SA 2GN7A 3MIDA 4Y26A 1NCRB 3I2DA 1PZ7A 2GAUA 4FXKB 2W08A 2Q4SA 4IEQA 3USUB 1O4TA 1A3KA 1ASJ3 2R073 2XB6C 5KHHA 4OUSA 2GC2A 2WC2A 3M3QA 1SFYA 5CFCA 1CAVB 4FP2A 1DZQA 2VUAA 4PF5A 3L2HA 3BIWE 1VBB1 2ETEA 2ZGUA 4XOGA 5BNQA 3H9AA 3U11A 2WWSA 2WFPA 1LESA 2DFCA 3TN93 2XJVA 1QOOA 2WFF1 4YVSA 1KS4A 1C8M1 1RIRA 2R16A 1FOD2 2PHDA 2GSYA 4ES8A 1G9FA 1UPIA 1S2BA 2ZHLA 4AVVA 2OYZA 2HJIA 1LOFA 4QQPA 2IXKA 5EV7A 2QVSB 1DU3D 3E5UA 3AYAA 5T3NA 2RR11 2OZ6A 1RUI1 3AKSA 1KFUL 3D4KA 4J1WA 3FE5A 4Q8LA 1CONA 2ZAHA 5CNAA 1X36A 1UMZA 4XBLA 3WUCA 4DRRA 5CFCB 5KHIA 1COV1 4ZU7A 5D8AA 4M3CE 1UD1A 1WLWA 4AGGA 1ULEA 5GLWA 2W0XA 3OJBA 5BV6A 2EALA 1N3QA 4YVSB 2HWF2 5I0SA 2ZGRA 3M3OA 2JICA 1X50A 5FTTC 3ENRA 4LO7A 1NY72 3D8CA 4IV3B 4P9IA 3FLPA 3RNSA 4JGYA 4YYOA 3WG4A 1REDA 1R1A1 3VDDB 4ASLA 1IPKA 3GALA 4AGVA 4BQ1A 3BTAA 1ND3A 5C6CA 1LEMA 2FZ1A 4QQ2A 1DQ4A 1CVNA 2H0VA 5KHJA 1HLCA 5H9SA 2UYBA 1ENRA 2ZABA 1IZ3A 1TNFA 1WLDA 4LLFA 1F5FA 2CAVA 3V65A 4I3PA 5H9PA 3TNPB 4KBBA 1ONAA 2BVBA 2HWC1 4FPCA 1JN2P 3VKOA 1X82A 1FPN3 2R061 2ZHKA 5KC6A 1W6MA 5D8AB 4XMIA 2JE7A 2BFUS 4TSVA 1RUJ2 3MW3A 1F31A 3VN4A 3ZFFA 1YFXA 4XFCA 2XJUA 5FAXA 2O8OA 4Q4X2 1F8VA 3FBMA 3FJSA 2DCTA 5B2GB 2D6PA 4AVTA 4A3XA 1Z7S3 4MYEA 2QFEA 1B09A 4K21A 2EXJA 4GXLA 4EN0A 3ST7A 3KCCA 4OHVA 3HBZA 2BQPA 4JGYB 2IXLA 4I30A 3QBQA 3ZXJA 1G86A 3APBA 4CEYA 2WT2A 2WSVA 5I0RA 4XF4A 3VUOA 4I02A 3BB6A 4E2QA 5FOJB 2XKOA 1OQDA 2GC1A 4GB33 4I01A 2DV9A 1GZCA 4P14A 5IK7A 1GNZA 2A6XA 5T54A 3ZX7A 1VLNA 4C1XA 1AYN2 2WS91 3JBG2 4MLOA 4FSJA 1W6MB 5EZWA 4S2HA 1BKZA 1D2QA 4ZU4A 4AHXA 3LOIA 5J7MA 1QJX3 4P9JA 4YM3A 4QPGA 1C3HA 1OD5A 1SBFA 1V6NA 5LK5A 3TBDA 3AJZA 4GH4C