2YROA

Solution structure of the c-terminal gal-bind lectin protein from human galectin-8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
155
structure length
155
Chain Sequence
GSSGSSGPKSGTPQLSLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSWSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-8
publication title Solution structure of the C-terminal Gal-bind lectin protein from Human Galectin-8
rcsb
source organism Homo sapiens
total genus 15
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yroA00
4P9XA 1AZDA 1W6QB 4FP3A 1SCRA 4KBBA 4YZ2A 2D6PA 2UWAA 2ENRA 1CR7A 4BQ1A 1UPSA 4GALA 3OPZA 1LJ7A 3AP7A 1D2SA 3O0VA 3OYWB 5DZGA 5T5JA 1VIWB 1IKPA 3N7MA 3PVNA 4XDQA 3AYDA 1JYCA 4Y1UA 4Q26A 4CTEA 2CYFA 4FPOB 3RS6A 4K20A 3L2YA 1ONAA 2SLIA 4ATFA 3AYAA 5JOXA 3SNMA 2G4IA 2W08A 3AZVA 2ZMLA 1QNYA 2D3RA 4FQZA 5JMCA 3RQ0A 1MS5A 1MS8A 5T5PA 1GKBA 3O5SA 4LBQB 4BLIA 2ZMNA 4UW5A 3MW4A 1MS4A 4YG3A 3NV1A 1MZ6A 1S1AA 2AR6A 4FPLA 1C1FA 1LGBA 4DS0A 3ZXKA 3LCPA 1YO8A 1KQRA 1X50A 1CVNA 1V00A 2GMEA 4I30A 4XE9A 5KXDA 2DYCA 3ASIA 2VW0A 4L8QA 1DLLA 2CNAA 4YZ4A 3OGGA 4XJUA 5IK5A 1MVEA 3V0AA 4JRAA 4YZ1A 2ZGUA 1GANA 2R49A 2ZACA 3PVEA 4ITCA 5JVVA 4P9WA 1BYHA 2E7QA 1Q8OA 3RMXA 4LBNA 4XXPA 3RMYA 1GZWB 3O0XA 2AGSA 5AVAA 5GJ6A 4Y1XA 3UL2A 4DQAA 3IKWA 1AF9A 3BTAA 1XQNA 4OZXA 2UWCA 1A3KA 1W0OA 3B69A 1LULA 1ULFA 4Y20B 2W68A 3NV3A 4W65A 1V6KA 3AZZA 1PZ8A 1URXA 5EYYA 5IT6A 2EXKA 1QDOA 1G9BA 2EXHA 3ENRA 3VKLA 2ZGOA 4DRRA 1G86A 1SLCA 2DU0A 4XJAA 1FAYA 1G9CA 2A70A 5IK4A 1KITA 2DUQA 3ILNA 1F9KA 4F83A 1BXHA 2CWMA 4Y1ZA 4YGCA 3SH3A 2AUYA 3DGTA 4AVTA 5T5OA 2NN8A 2EXIA 1FX5A 1DQ1A 1DHKB 2NMOA 1N3PA 2E6VA 1APNA 3AZWA 4JC1A 2PHFA 4LBKA 2E7TA 3NV2A 1IOAA 4M3CF 1LOGA 4H55A 4XBNA 2ERFA 5GLZA 3IN9A 3WG2A 3WHTA 1DQ0A 4XMIA 3AXEA 4BMBA 5JDBA 1I1EA 4PF5A 1FNYA 5T50A 2C9AA 1MS9A 3WV6A 3WCRA 3ZSKA 2NMNA 1AXKA 2DTYA 1LOEA 2R1BA 3OYWA 2DVAA 1RINA 3R4SA 4LBLA 3ZYPA 5DXDA 4YW4A 1DBNA 4LBOA 1IS6A 5DUVA 1W6PB 2NM1A 1NXD1 2YY1A 4FOWA 2ZBJA 2DVDA 5DUWA 4DPNA 2ZGLA 5SV8A 2WT0A 5L73A 3RSJA 4YW1A 2DVGA 1C1LA 2CY6A 1WBLA 3WDTA 1W6MB 1LCLA 1QMJA 2P34A 2JE9A 4LBJA 3SH4A 2UU8A 4Q8KA 1DQ4A 4LBQA 2JECA 3FUOA 4YM0A 3ZXEA 4YG6A 2GNBA 3QCWA 3WCSA 3V0BB 4ZKTB 4GXLA 5E8AA 1MACA 3N36A 1QU0A 3SITA 4P14A 2CTVA 2KM2A 2PHRA 3PMEA 4WVVA 4FPYA 2WLQA 2PHXA 4PCRA 4YGDA 4BPZA 2ZGPA 1JN2P 2JKBA 3A0KA 4FQ4A 1N3OA 2OUJA 1KJRA 1WW5A 4YLZA 1LENA 1LOCA 4AWDA 5KXEA 2WT2A 3AP6A 1JW6A 1DGLA 2W52A 1TEIA 2WKKA 2ZZJA 3AXDA 2YV8A 1CPMA 2JDZA 1HKDA 1O4YA 4JCKA 1GZ9A 3BOPA 1W6NB 1ULEA 1UN1A 1JOJA 1FYUA 3M3EA 4U2AA 5T52A 4C1WA 1SACA 1YXWA 4M3CB 2Z42A 1CN1A 2UWBA 3GNEA 1G8WA 2B7YA 4M3CE 3ZSMA 2NP0A 2DUOA 3BODA 3R4UA 2JJ6A 2OUHA 2EALA 2P3KA 1SBFA 2FMDA 4FP2A 1JXNA 1S0GA 2TEPA 3IPVA 5DUXA 2ZAAA 2VW1A 1LGCA 1DZQA 3ILRA 1MS3A 3PVOA 1GV9A 3OY8A 3RRDA 5GLVA 3VKNA 1ULGA 1SCSA 3B3QE 4YM2A 1ZM1A 1YI7A 2I2SA 1R1ZA 1Q8QA 1S0IA 5GM0A 2VUAA 4RL7A 1N1YA 4GWMA 1LHNA 3WHUA 1W6OB 3PJQA 2GN3A 5GZCA 4IQPA 3AP5A 4PQ9A 3T2TA 4GA9A 4GKYA 4XHXA 3N7KA 4XTPA 2NYYA 1AXZA 2W39A 5HCAA 3LSDA 2YROA 3POSA 3WOGA 1FATA 1LEMA 1LOAA 4GWNA 1FV2A 2ZGKA 2WNEA 1VLNA 3MPPG 3N7LA 3ATGA 2V73A 3N35A 1VALA 2VU9A 3OBRA 1W6PA 5E89A 3ZXJA 2GN7A 1LGNA 1Z78A 1HQLA 4CZSA 1WUVA 3WG1A 1DQ2A 1MR5A 4AGVA 3W58A 1N3QA 2ZA9A 4FPFA 2D7FA 1W6MA 2P3JA 1AX2A 4DFSA 2DU1A 2GDFA 1A78A 3SISA 1GICA 2R0HA 3FLRA 2VY0A 4YGBA 4WV8A 5DG2A 1GYKA 1S0CA 2AREA 3Q9OA 1CESA 4ZXKA 4FPJA 4XOGA 3APBA 3NWKA 4BOWA 1UX6A 3M2MA 2DTWA 3QLQA 2V5YA 3UJOA 3WDYA 4XHBA 1DYKA 4ISQA 3AZXA 1S0FA 1GLHA 1Z0HA 4FOQA 2WSUA 2EXJA 2ZMKA 2A71A 2AYHA 4MYEA 4M00A 1ENSA 4R9DA 3USUA 3WNXA 2VW2A 3M3CA 2ZGSA 1WD4A 4UW6A 1V6NA 3T1LA 3WDWA 3WVJA 1LU2A 3B9CA 2CL2A 3WG3A 1JHNA 3D4KA 3SH5A 1JBCA 4HL0A 2LALA 2EAKA 1U0AA 2ZHNA 1CPNA 5KXBA 1V6IA 4Y1VA 1LOFA 1LESA 2ZHLA 2VXRA 2OW4A 3I4IA 3MEPA 1S0BA 1BKZA 5FREA 1W6QA 1LECA 1G9AA 1KRIA 2Q5TA 1BJQA 2ZGQA 2GMPA 3VUOA 5CNAA 3A4UA 1AX0A 3MW2A 1V6JA 1S0JA 1HDKA 2XG3A 2WJSA 2OVUA 5CB7A 4DRVA 1Q8VA 2AH2A 4Q8LA 2R0FA 1CJPA 1S0DA 2D44A 1WLWA 4PBOA 1QOOA 2C5DA 3KQRA 5E88A 5DUUA 2A5ZA 2D6OX 1G9FA 1N47A 4Q1PA 1OQ1A 2YMZA 3O0WA 4YZ5A 1A8DA 1QKQA 3R05A 1AVBA 2BQPA 4Y26A 3WG4A 3ILFA 1ZA4A 3FFZA 5T54A 3B00A 1MZ5A 2WT1A 1LOFC 2ZGRA 1IS3A 2A3WA 1AX1A 4Y22B 4YGEA 2DWRA 3N7JA 3WDVA 4GKXA 3TAYA 5GLWA 4XBLA 1FNZA 1WLDA 1DIWA 3A0NA 4XIKA 2A75A 4XZPA 2JD4A 2H0BA 2D3PA 4YW5A 1JYIA 1SLTA 1WD3A 4YM1A 5GZEA 2ES3A 2D3SA 1SBEA 2DURA 2WQZC 4XBQA 1GZWA 4XIOA 1UAIA 1F5FA 4PBPA 3V65A 1MS1A 1RITA 3VV1A 1QOTA 1LHOA 2YXSA 3HN1A 2AENA 2ZHMA 2RHPA 3D6EA 4FOVA 4Y20A 2A6XA 2NZ9A 2D6KA 1N1SA 4YFWA 2ZHKA 1AXYA 1ENRA 1LHVA 1OFSA 2A3YA 2HYKA 4FPGA 1Q56A 3HR9A 1CQ9A 1N1VA 3O12A 5IK8A 4Y24A 1HQWA 4AVSA 1QF3A 4FVVA 3I8TA 5DZFA 4U36A 2EIGA 4K1YA 5FRAA 2ZKNA 4BLJA 5F9TA 5T55A 1SLBA 1N1TA 2LTNA 3V64A 2WSVA 1YYNA 4R9CA 1LU1A 3C2UA 4XJWA 2A6WA 1AJKA 1LEDA 4Q2FA 1GZCA 5CA6A 4Q1RA 3IMNA 5EYXA 3FLTA 1UL9A 4C1XA 1J1TA 1H9WA 5GZFA 3SLIA 2PHWA 3D5OA 2E53A 4Y1YA 4D69A 4Z8BA 5JOYA 5JOZA 4FPKA 4NOTA 1YRZA 2R1DA 4XYXA 4ATEA 5GZGA 4XMAA 4YW2A 2D6LX 1MVQA 4K21A 4FOYA 4AGGA 3GALA 2DVFA 3AJYA 2EF6A 1KDKA 3ZXFA 5EWSA 2DVBA 3WDXA 2GNMA 1IKQA 4NO4A 3H0OA 3AP4A 3JU9A 3U4XA 1WW7A 5H9RA 1Q8PA 1IS5A 1CONA 1C4RA 1PZ9A 3FLPA 3AK0A 1GBGA 4HANA 5DG1A 5JOWA 3V0BA 1Q8SA 3JUUA 3UJQA 1F31A 3ZSLA 1KDMA 2P37A 4Y22A 5F5QA 4AVVA 1JUIA 1QGLA 2JE7A 2ARBA 5GZDA 4ASMB 3ZVXA 4YZ3A 1FV3A 1DFQA 3MW3A 1GNHA 4YFZA 3OJBA 3CNAA 1UZYA 5BYNA 1DYPA 1V6MA 4BM8A 1LODA 2ZGNA 5HCBA 1W0PA 4TYSA 2R16A 2GALA 3M3OA 5EXOA 5H9QA 1W6NA 4XXAA 2XB6C 4P9YA 1SLAA 1BQPA 1UMZA 1NLSA 2E51A 3INAA 4M3CA 3VKMA 4LBQD 3OBTA 5T5LA 2DUPA 3KM5A 4M01A 2A7AA 1UZZA 1QDCA 1DQ6A 3FUQA 3IPVB 4FPHA 2P3IA 1PZ7A 1WCSA 5GLUA 4YG0A 3OY8B 1SLIA 3TB0A 3B01A 1VAVA 4XJ9A 3NV4A 3RG0A 3IM0A 4YW3A 5GALA 1EPWA 4XTMA 2A6ZA 2VH9A 2A6VA 1MS0A 2SBAA 5JLVA 1SBDA 2D43A 1YIFA 1CIWA 3UK9A 2CWSA 2DV9A 1ULCA 2PELA 2ZABA 1H30A 4R9AA 5DZEA 5LK5A 4CRQA 1D0HA 1W6OA 4UW4A 5H9SA 2D6NA 3WUCA 1ULDA 4AGRA 1AJOA 2A6YA 3BIWE 3WZ1A 1GSLA 1LHWA 2PHTA 3ZPYA 3POYA 5KXCA 4FPCA 1C57A 1QNWA 3AZYA 1G7YA 3LSEA 3M1HA 4XJ8A 4WZFA 3WDUA 3ZYRA 1IS4A 4K1ZA 2ARXA 1RIRA 1I3HA 1WW4A 4YM3A 3V0AB 1H9PA 4Q27A 3VKFC 1ENQA 4WVWA 4RA0A 4XILA 2UURA 5HCFA 2ZGTA 5CBLA 1HLCA 3VKOA 3AYEA 4AYUA 2A3XA 1LHUA 1SLLA 2PHUA 2GNDA 1SFYA 2YZ4A 1O4ZA 3AX4A 3POWA 1VAMA 3N3HA 1DQ5A 5IUQA 1LOBA 1WW6A 3HMYA 4XJZA 1Y7BA 2GNTA 3ZXLA 3FBYA 3AJZA 1QOSA 5CAZA 1V6OA 1WLCA 1OKQA 3AFKA 3M3QA 1G9DA 2ZGMA 2FHRA 2D6MA 4ISRA 3USUB 3DUIA 5GLTA 1B09A 1V6LA 1LTEA 3W59A 1BZWA 4FPEA 1KJLA 4UW3A 1WBFA 3AYCA 3ZSJA 4BMEA 1UKGA 1S0EA 4R9BA 3WUDA 3T1MA 2P2KA 4LBMA 4SLIA 2GMMA 5IK7A 3AP9A 3WLUA 5H9PA 4TZDA 1GNZA
chains in the Genus database with same CATH superfamily
2BWCA 2HEVF 1AZDA 1E5SA 3LPGA 3N9PA 4LHLA 4CDWB 1ZRRA 2D6PA 5LW9A 2BDRA 1H8TC 4GALA 1LJ7A 3K3NA 3OYWB 1IPJA 3PVNA 3ZFGB 4E4SA 2FQPA 1JYCA 4Y1UA 4N9IA 3WF4A 4QXCA 4Q26A 4CTEA 2CYFA 3NNLA 3M8LA 2VMFA 4I0WB 1XNDA 2DBIA 4ATFA 3AYAA 3SNMA 2WNUB 1XYOA 2VG9A 4RD7A 3H8OA 2ZMLA 4CUBA 1OD5A 1RUOA 1ZZCA 1BK1A 4BQ5A 1PK6C 1W3VA 3I2KA 4OCTA 4JVAA 4Q4X2 4B1LA 3O5SA 4LBQB 5JXGA 3CQOA 4YVWB 5FBJA 2OS2A 3D0JA 3MLLA 2XWBB 3NV1A 4EZ4A 1C5IA 1S1AA 2AR6A 3KT4A 4FPLA 1LGBA 4LIUA 1YO8A 1KQRA 1PVC3 1VMJA 2GMEA 5FXXA 4NROA 1HB2A 4QQ2A 4Z2WA 5BNQA 2JG9C 5LRRA 1VBC3 1WMFA 4HVOA 3U0ZA 1NLRA 1GOHA 3P3NA 1X7NA 1VBA3 4YZ4A 5IK5A 1WKYA 5DAWA 1JOBA 3V0AA 2DCYA 4EE2A 4EWDA 1RGSA 2VZTA 4YZ1A 2ZGUA 3PUAA 2IC1A 2R49A 3RJ2X 4ITCA 3RWKX 5IFPA 1XXNA 4QD2A 2P4EA 2V72A 1XPWA 2VZQA 5C8WA 2YU2A 4XXPA 1GZWB 3UL2A 1SQ4A 5IHRA 1S2KA 4ZHNA 3IKWA 1AF9A 3J7LA 3WNLA 3CL1A 3BTAA 4OZXA 5LBEA 1YHFA 1F15A 5D2AA 2C9KA 4B7KA 4W65A 1V6KA 3AZZA 1URXA 5FYMA 1GMMA 1QDOA 2XVKA 4DRRA 4Q4X3 1SLCA 2DU0A 1G9CA 1OLQA 1PMIA 2C4XA 2A70A 2JXAA 2XQRA 3C7FA 2DUQA 4QM8A 1OVSA 3ILNA 1F9KA 1XBFA 1XNAA 2R32A 2CWMA 4A6OA 2QQVA 5FZMA 4CXWA 3CBNA 3SEEA 4QB6A 2CDPA 4GULA 2TBVA 3VBRB 1TME2 4AI0A 4JC1A 1N3PA 2OIIA 4AXOA 2E7TA 5FY9A 2VGDA 4F8AA 1YI9A 1LOGA 4XBNA 1REEA 2ERFA 5C7GA 5L9RA 5J36A 4XMIA 1BMV2 4OI2A 1JTZX 4JZRA 4CCKA 4Z1VA 3B93A 5FXZA 1FNYA 3EO6A 4XUQA 2AC1A 3O1SA 2Y6FA 3WW2A 3ZSKA 1AXKA 3OYWA 1LOEA 3JXSA 3POEA 5LRSA 1YFYA 4UFKA 3GZTB 4RGGA 4EWAA 1W06A 3NMBA 4UOJA 3A22A 4COZA 4LBOA 1IS6A 2WA3A 4WM7B 4FOWA 4LE4A 3N9OA 4RS5B 5SV8A 3ELNA 3RSJA 4M4PA 3PURA 2WNUA 5KHKA 2UYBA 2P6CA 4Q4V3 2Y8KA 4ZONA 1SFNA 3P3PA 1HV0A 3VBSB 1LCLA 4Q8KA 4G4FA 4LBQA 3KHCA 3DKWA 4LUMA 4YVWA 3J7HA 1L7LA 1RUD3 2ZX0A 5FPZA 3QCWA 3SCGA 4ZKTB 4ONUA 4N53B 2W91A 3SITA 3VD3A 5FFOC 4KWKA 2CTVA 1BEV2 2PHRA 3PMEA 4H14A 2WLQA 5CFCA 4MGIE 1ULOA 2FCVA 3VBUC 2AEYA 2JKBA 3LIHA 1N3OA 2LUWA 2W9XA 4YW7A 2VCCA 3AKPA 3LA7A 1ODNA 3ZXAC 4AVAA 1JZ4A 2VUDA 4WBBA 5KHJA 2GP3A 2JDYA 5KXEA 1NCRB 3AXDA 1EPZA 3GYDA 3ACGA 3URFA 1PVC1 4JQTA 1HKDA 4BB3A 2WINB 1VBC1 1GWLA 3MF9A 5K9YA 1GZ9A 2D5FA 3PTRB 1W6NB 1ULEA 1UN1A 4L92A 3ZKYA 2WWJA 2WNUC 1PGW2 4U2AA 5LY2A 5A6ZA 1TNRA 1RUC2 2VZPA 3FWEA 1QJX3 2VULA 3ITQA 3ZMOA 4BISA 1G8WA 3ZSMA 3KT7A 2C0ZA 3GHNA 2DUOA 1ULPA 1HV1A 2EALA 4B4PA 2RS33 4LULA 4YVWC 4YARA 5DUXA 1MS3A 5FO9B 2QKDA 1VBD2 2GH8A 5FWJA 2WDBA 4GMP0 4BH9A 1YI7A 2PTMA 2I07B 1BEV3 2G1MA 3FL7A 3ALQA 4Z07A 4CU7A 3PDQA 3VBRA 4FTEA 5CFCC 2JICA 3QBQA 2VNOA 1H0BA 2UY9A 2VUAA 4Q4X1 4B4QA 4GWMA 5FPBA 3MF6A 3VHOA 1TNFA 2VNVA 1XB9A 3LPFA 1CGPA 1WWYA 4DY3A 3E97A 4CUCA 5FZOB 3I54A 2RR13 1JU4A 4XHXA 1KFXL 3T2TA 3U14A 3RZMA 4CVUA 1AXZA 1WA4A 2W39A 2YFUA 2YROA 4PI2A 2FCUA 3WOGA 3D3AA 1FATA 1YFWA 3MIDA 2YG0A 4GWNA 5FZBA 4IGOA 2E33A 2V73A 5A7WA 2VU9A 2J1TA 2W46A 4WM7A 5E89A 3ZXJA 1RUC3 2LW8A 4IERA 1Z78A 1ZNPA 3WG1A 1UY0A 4XEZA 5L36A 1MR5A 1TMF3 2XVLA 4E2SA 1Y9QA 3IIAA 1PNGA 4AQTA 3RZJA 1D0GA 3VBSA 4K7JA 4I2OA 1AX2A 4QKBA 2GDFA 2HBTA 5FZFA 4FAGA 4HVRA 2VVEA 2R0HA 4YGBA 2VY0A 5A7NA 1OUSA 3T4HB 5L7OB 1GYKA 4ATEA 2ORXA 1R64A 5CU1A 5IVJA 1RJ7A 1RUG2 1GQPA 2XJRA 1F35A 1PMHX 1NLQA 3VBRC 2BOJA 3ZYFA 4Q4V1 2ZX2A 1DGWX 4N53A 1DYKA 3K3OA 1E5RA 1S0FA 2OXBA 4A3XA 3DECA 4Z2AA 1RVF3 2EXJA 2RMU3 3OF1A 2OKXA 1W05A 1NKGA 2BGOA 2ZGSA 1WD4A 4IE0A 3UKTA 1RUD1 2VVFA 1C3HA 1PHMA 4MSVA 1JHNA 1NCRA 3D4KA 3HAGA 1PIV2 3KGZA 4DIQA 1U0AA 1HJFA 4LEJA 4JHZA 1CPNA 4WM7C 5KXBA 1V6IA 4B4RA 3FHAA 5BV6A 1BMV1 1WA6X 2B39A 4PIZA 4Q4Y2 1YQCA 2X29A 5J37A 3DYOA 4HFSA 3VBSC 4H7MA 4IW3A 2XL9A 2HWD2 1AX0A 1S0JA 1HDKA 2XONA 2WJSA 5DDJ2 1O91A 1UMHA 1WCKA 2VQ0A 2KD7A 5F3IA 1ND3B 4FBFA 5FP7A 1R092 3POGA 1A8MA 4OQ8A 1WCDJ 3JQWA 1FXZA 4N53C 4NHXA 2Z79A 4CXYA 4PBOA 2C5DA 1KGYA 1QJX1 3OD4A 5FXWA 3AKRA 1C8NA 2VCAA 4QX0A 2W2IA 5LWBA 4E2QA 4Q1PA 4K3UA 4QMAA 1OQ1A 2YMZA 4BXSV 1MQTB 4XDPA 1ZRCA 3O0WA 1XSQA 3M7AA 1QKQA 2V5DA 3J9SA 3R05A 3SQOA 4DMIA 5K4LA 1NCRC 4FSJA 1PIV3 1HB4A 1BEV1 3BVCA 3P1IA 3CJIB 3O1RA 1YNAA 2A3WA 4YGEA 5CKQA 1CX1A 1OLRA 1ZZ7A 2BJSA 1FOD3 1ZRDA 5GLWA 3NNFA 1FNZA 3A0NA 5JWPA 4XIKA 3TYJA 4XZPA 4MGYE 4TN7A 1JYIA 2HWD3 2VUJA 4S2GA 3UGHA 2VVDA 1SHWB 4E27A 4ZZ8A 3QD6A 4NRMA 1SBEA 2RDRA 4XBQA 2XJQA 5I0SA 5JIAA 3V65A 1PGW1 3GDBA 3VV1A 2J1RA 1LHOA 2BUKA 2RS53 5DAPA 5L7OA 1RUC1 1XE0A 4NE9A 3D6EA 3GGLA 4GJZA 4GB32 2ZKLA 4Y20A 5T3NA 3H3UA 5FZ1A 1UY1A 5FKCA 4SBVA 3T08A 4MHUA 4QQOA 2X09A 1NE6A 2VTXA 5DMYA 1ENRA 3T09A 1W39A 2E63A 4FPGA 4LA3A 4BXFA 1RMU2 1DP0A 1GNYA 3WP5A 3T30A 4XQ4A 4A6SA 1C5HA 1PMJX 1QF3A 4FVVA 4X6QB 4PDWB 3B9IA 3J7MA 5T55A 5F37A 1N1TA 3V64A 2RM23 2F6BA 4XC9A 4R9CA 5FZ3A 1LU1A 4OHXA 5FXVA 3VD9A 4BU2A 1U5YA 2RMU1 3K48A 3CIHA 4BDVB 2W92A 4CDUB 1J58A 1U12A 1O3QA 5BNPB 2JD9A 3JD73 4S2DA 5FYSA 5FYTA 5FPXA 1H9WA 3SLIA 2W3JA 1VBE3 1OA4A 2VOXA 5FYHA 2ZCWA 2VQTA 5L7OC 2ZEYA 3VBOB 1ND3A 4XYXA 3S7EA 4GB33 3H8XA 4FCAA 5FP3A 4K21A 3OUJA 4FOYA 4HKLA 4LUKA 5FO7B 4QDSA 1S2BA 1NA1A 4OHZA 2DVFA 4AGGA 3C7OA 4RYDA 3KWVA 1KDKA 3CO2A 3MYXA 2DVBA 3GXUA 5EWSA 5KC6A 3WDXA 5JZGB 5FK7A 1IKQA 3BOWA 1O3TA 3H50A 3VBUB 1GWKA 1WW7A 2RVAA 3MIGA 3QOPA 2WQ4A 5FMDA 1C4RA 2QDNA 4HANA 3AK0A 1YWKA 3VZMA 5FOJB 1JU3A 3JUUA 3RZKA 3DF0A 1RUNA 4RGKA 3W20A 3ZSLA 1KDMA 3A7QA 5F5QA 4AVVA 3LOBA 5A6QA 1V0AA 5EPAA 4I3GA 5CVRA 1QEXA 3ZYIB 5BNOB 2ARBA 2J42A 5FP8A 4KH9A 5LB6A 3VBHB 3Q8FA 5D21A 1PIV1 3PU3A 1PX4A 4HPKA 1DFQA 2J1VA 3MW3A 1GNHA 1BK0A 3OJBA 1COV2 1UZYA 4P9IA 4OQ9A 3UESA 4D0QA 5FQ0B 5IVCA 1ND3C 1LODA 1W3XA 2HWC2 1VJ2A 3AMQA 2B8MA 2Y6KA 5HCBA 3SCFA 5FO8B 1CZSA 2GALA 3ACIA 1FOD1 2XB6C 1NA1C 1HIXA 2XBO2 1SLAA 4UI9L 2GP5A 4Q5OA 1NLSA 5HBAA 1W0NA 2HWD1 4IEVA 1AHSA 4XAEA 4M01A 2A7AA 1UZZA 2FZ1A 5DDJ1 3FUQA 1DQ6A 4YG0A 4OFGA 3B01A 4Y5Z0 1VAVA 3WNMA 1QJU3 4YRDA 5F32A 2R7EB 4O65A 1TE1B 2DCZA 3BPSA 5GALA 2W0XA 3CJIC 3KV5A 3LFMA 2SBAA 1QJEA 5JLVA 5FBZA 5I0UA 2D43A 3TRSB 4CDQA 3VL8A 3UK9A 2PELA 4K6BA 4R9AA 1RUJ2 5A32B 5LK5A 4DOUA 2AZ5A 5JUVA 5H9SA 2D6NA 1ULDA 4B1MA 1NY72 3WZ1A 2VZ1A 4O61A 4CDUA 1IG3A 1LHWA 3KZ4C 3GCWA 1IGOA 2VQUA 1COV3 4W6YA 1QNWA 2ARAA 2LS6A 2Y64A 3ZYRA 3LDKA 4XJ8A 3ZFEA 1QH6A 1CAWA 4Y4YA 3S0MA 4K1ZA 4AVBA 3NJYA 3B02A 5B4XA 4CU8A 4YM3A 4Q27A 2XBO3 3KCYA 4A41A 3LDRA 2VZVA 4PLOA 2UURA 4MGKE 2Q1ZB 4LIVA 2XXZA 1LHUA 1OURA 3JD71 5BY5A 2VBPA 2IXCA 3QACA 4KI5M 1EV12 4AL9A 2CGPA 1WZXA 3BGAA 3POWA 1VAMA 2K9ZA 5A7OA 5CIRA 4AI1A 3H1WA 3HMYA 1Y7BA 2GNTA 1POQA 1K5JA 3SKJE 4GB31 4I01A 4QGMA 1QOSA 1AYN3 1L7RA 1V6OA 4YSFA 5F5IA 4CDQC 1G9DA 4NPRA 2LM3A 1RUJ3 1HB3A 5FY4A 3USUB 4XCAA 4OUMA 4PIXA 4CDUC 2FCTA 4XFFA 1VMFA 2P5BA 5BNPC 2XLGA 1QH7A 5BNOA 1Z7S2 4QX3A 3WINE 2HLEA 3VBHA 3WF3A 3ZFEC 5JCTA 1UQXA 3KV9A 1EP0A 3T1MA 5C6CA 4D94A 4LBMA 4LOSA 3RZLA 5FQ0A 5H9PA 4WM8A 1GP5A 3SXWA 1RUI2 2GAUA 2XMLA 2YUEA 1IG0A 1UPSA 3DCQA 4I0BA 5EP9A 4BQ1A 5I8YA 3AP7A 3O0VA 4QAWA 5DZGA 5JZGC 1JYNA 3WW4A 2IXHA 1OD3A 4HLTA 4D6SA 2TUNA 1D4M2 3FHQA 3HEIA 4IEUA 3FZ3A 3U37A 1RUE3 3TNPB 3POBA 2X05A 2G4IA 1A6CA 3LD8A 1QNYA 4OULA 1WMEA 3VGIA 4OHWA 1QXRA 3H3LA 5JMCA 1X33A 4LKFA 5JAXA 5FZ8A 2BBVA 3K75B 4UW5A 1US2A 3MW4A 1Z7S3 5BNOC 1MS4A 4MO3M 3VBHC 3D82A 1MZ6A 2WS92 1QJY3 4IEWA 1C1FA 1S55A 1UKRA 3VHNA 3LCPA 1X50A 1CVNA 4QWNA 4I30A 3UNPA 4XUPA 2QJVA 1W8UA 2HWF2 1DLLA 4L8QA 4QU1A 3U75A 4ARXA 4MGTA 1ASJ3 1IPSA 5TSWA 3OUHA 3OGGA 4XJUA 1RUI3 4C90A 1SDWA 4DXSA 1OHFA 1X8EA 1YUDA 5F8PA 4A4AA 1W8HA 2VOWA 2HKXA 3VD5A 5IYYA 3T2QA 5FKBA 1COV1 2E7QA 4IEYA 3L2HA 5AVAA 2AGSA 4Y1XA 4ASKA 1CWPA 4FI9A 4AOCA 1CAVA 2UWCA 1DZTA 2XBO1 1LULA 1ULFA 1VPHA 1PNFA 3KQ4B 2UYAA 5EYYA 4JKLA 1UO9A 5IT6A 2XJVA 3ENRA 4M0NA 1OH4A 4L97A 5IK4A 2KA3A 2GU9A 2XGXA 5FMOL 4XF0A 5LBCA 3PMSA 3TEYA 4NWVA 4AR2A 1BXHA 3OB8A 2IXLA 2WS93 3DGTA 1MZFA 5T5OA 4QPGB 2WL1A 3EYPA 4W6WA 1DQ1A 3C8XA 1DHKB 2NPIA 1S4CA 3AMHA 3AZWA 3GBGA 4QXBA 5F5AA 2GC3A 1RUJ1 1ZZ6A 1LRHA 2H6BA 4LBKA 1NUKA 4D8MA 4H55A 1ZVFA 3WG2A 1UYXA 1NY71 3K4DA 5B4NA 1VBB2 4BMBA 1JZ8A 1I1EA 4PF5A 2WO2A 4QX7A 1JMUB 4QB2A 1HQNA 1MS9A 3WV6A 2GC2A 5FPAA 2NMNA 2DTYA 4EYUA 1BVP1 3ST7A 2EIEA 4IEOA 2RDQA 4YW4A 1YLLA 5DUWA 4DPNA 5CG8A 5AC92 4TTGA 3DKQA 2WT0A 1ODMA 2WWSA 2QQIA 1O7FA 4YW1A 1XJAA 4BCUA 4DO0A 3ZM8A 1C1LA 1J83A 2BNMA 4YVSB 1EV11 1QXJA 2YFZA 4ZU7A 1PO23 3NQHA 4TSVA 2Z2SB 3OBAA 1QMJA 2JE9A 3VDCA 1QJFA 2UU8A 3ZYHA 4QX5A 3T2PA 4HN0A 1NZCA 3PVBB 3VDDB 2OPWA 4LLOA 3O1UA 4YG6A 3RJRA 4Z92B 3V0BB 1RUE1 3RNSA 4CUAA 5E6HA 4E9KA 3N36A 2WFF2 4AEJA 3E5UA 4FPYA 2VTFA 2B9UA 2R6QA 4YGDA 4BPZA 4QQPA 1JN2P 3MO4A 5FYIA 3RZGA 4CCJA 4IEPA 5FYUA 1Z7S1 1WLTA 2NQYA 5FJKA 1P8JA 2WT2A 4DEVA 3VN4A 2W52A 2ZZJA 1HXS2 1UU5A 2YV8A 4BQWA 1UZWA 1O4YA 2PQSA 2W1WA 1BVVA 1UY3A 3BOPA 3M4FA 1ASJ1 4LO8A 3WP6A 1FYUA 1RUI1 1JZ2A 3BYWA 4M3CB 1NAEA 2Z42A 1CN1A 2JKXA 2D5HA 1UYPA 4PF1A 4QHBA 4COWA 4NIGA 4RFT0 2B7YA 4KU8A 3KD4A 3R4UA 3HD8B 4AFAA 4BHPA 4CDXB 4A42A 2OUHA 4C0HA 4WVMB 2P3KA 2WYSA 2JDPA 2QBXA 5IWFA 1JXNA 1S0GA 2TEPA 3IPVA 4HG6B 2VW1A 3ILRA 3PVOA 1ND2A 4L0PA 3VKNA 1GV9A 3H7YA 3OPTA 2O14A 1VB2A 3B3QE 1DDLA 1K5MB 1ZM1A 3GHMA 4AQSA 2HWE2 4RN5A 4W4ZA 4CP0A 3SHRA 1JUHA 4P9JA 1R1ZA 4RFRB 1JS9A 5GM0A 1CX4A 5J1XA 1OOPA 3ETQA 2EA7A 1LHNA 5I8TA 1W6OB 3P5BA 2IVJA 4OI4A 4D3WA 3KMHA 4NHYA 4D7SA 4KG8A 5GZCA 4IQPA 1NOVA 2WN3A 1W8NA 5L19A 3T4VA 2WS91 3FE5A 4CP9B 3N9LA 4GA9A 4XETA 1HXS3 1OQDA 2DF7A 2NLRA 2X10A 2W94A 4LXLA 3LSDA 3POSA 4MGZE 1LEMA 2Y6JA 1WCUA 2HWF1 1VE0A 1Y4WA 1VLNA 4AEMA 3HPNA 1W2UA 3J8F2 2IXIA 4META 5A3OA 3POFA 3THCA 1EY2A 2VTXJ 2HBUA 5JSOA 1HQLA 3HQUA 4CZSA 3AL5A 3EB7A 4QX2A 3I97A 4YVSA 1W04A 1N3QA 1EUTA 2VZRA 4FPFA 4LQRA 1D7PM 1YIPA 2BYVE 3ZN5A 2MEV2 1ND2C 1A78A 5FAXA 3BCWA 1O5LA 4RQPB 4URTA 3VDDA 4RSUA 1S0CA 4BOWA 4XOGA 2FMYA 3APBA 5JXIA 4KG0A 1UX6A 4N7IA 3E6CC 3QLQA 2V5YA 3OOXA 3WDYA 4XHBA 4DXRA 4INDA 1OOPC 3MUZ1 3AZXA 3S7IA 1GLHA 1PO21 3KS7A 4XUTA 1Z0HA 1ZBE2 4NJ4A 5CFDA 5CKMA 1Y3TA 2CAUA 2QQUA 2Y60A 2ZMKA 3WP4A 2A71A 3BN6A 5A1LA 4R4ZA 5F3GA 4K9SA 3WNXA 4DY5A 5D8AB 4CCOA 3WDWA 3OGJA 1LU2A 1XC6A 4JKKA 1ENXA 2Q0AA 2CL2A 5JI7A 4HL0A 4UFLA 1US3A 4QX1A 3IT8A 3J8F3 4CA9A 2ZHNA 1LOFA 1VBB1 2ZHLA 1ZA7A 2VXRA 3NW4A 3THDA 5A7QA 3VBUA 1KEXA 1BKZA 2ADEA 2XKOA 1LECA 1KS5A 4YVSC 4CDWA 1R082 4DUWA 1BJQA 2ZGQA 2ETEA 2ZS6B 3JB4C 2XUMA 4R4XA 1K45A 3A4UA 3HN3A 1V6JA 3MW2A 5FIXA 4CDXA 4CE8A 4WVMA 3ZFGA 3VDDC 1AR62 5CB7A 1W9YA 2CGOA 3HJRA 5FYZA 2R0FA 4QXHA 1CJPA 1RUH2 3ZSEA 1WGPA 2WBKA 1I9RA 2D44A 2Q8CA 4AQ6A 1K5MA 4OMCA 2VAUA 3CJXA 4CU6A 4FFHA 1GP6A 5A3PA 5LY1A 5E88A 5CFDC 3ECQA 3OTFA 4ZZ5A 5FZ0A 4LO7A 2A5ZA 2D6OX 1G9FA 1ZYBA 2VZSA 4XF1A 4A7ZA 5C9AB 5LCWL 5FUPA 3SEPA 2Q8OA 2I74A 3AMPA 5DQ0A 4PIYA 2XPJA 1AVBA 1NCQB 4HN1A 1H1MA 4Y26A 3PJYA 3WG4A 3TEWA 3ILFA 5G04L 1ZA4A 1NQJA 2IUWA 4CP9A 4CCCA 1TME3 2WFF1 2XHNA 4QDQA 3W9AA 4XVHA 1MZ5A 1J59A 1CZTA 2ZGRA 1LOFC 1NQDA 1AX1A 4XUOA 1D2QA 4NHKA 1O6UA 3TAYA 4KBZA 5K0UB 2JDMA 4CDWC 1R083 4LNVA 3U07A 3KV4A 1MEC2 1SLTA 3G7DA 4QPYA 1HXS1 4QXKA 4CDXC 3BKZA 2ES3A 2IFWA 3ZFGC 5BXXA 1DGRN 1U5IA 2XJTA 2ID4A 2Y0OA 4J6GA 1GZWA 1GQHA 3ETPA 4HZFA 1RITA 3KB5A 3HN1A 2YXSA 1MZEA 1K5MC 2RDSA 4B29A 2RHPA 1OBNA 2YYOA 1VAKA 5J98B 2Z5WA 2A6XA 3WNNA 4D6RA 5A33B 3I3BA 3KVBA 4FFIA 1E57A 2ZHKA 4OLLA 4UFHA 4DXTA 5ABJB 2A3YA 4JTOA 4UFJA 1H2NA 4OYUA 1U5XA 1Q56A 2R062 5IK8A 3CEWA 3LZZA 3U10A 2WC2A 2HWE1 5DZFA 1NYWA 4BLJA 1SG3A 4HONA 5JOXA 1SLBA 5IVFA 4XCBA 4LPLA 4OVEA 4AG4A 4LHSA 2F4PA 4JGYB 1UY2A 2A6WA 4QPIB 2CV6A 1TQ5A 3CHXA 2TNFA 2W1SA 5C33A 4HOOA 4Q2FA 1MEC3 3LEGA 2IZWA 3PIJA 5EJZB 4CYDA 3NJZA 5CA6A 3IMNA 1HRI2 1UL9A 2ORZA 4XQWA 4OHVA 2Y6GA 4C1XA 4E2GA 1EYBA 1JI6A 4XURA 5GZFA 5FOBB 1X9PA 2YU1A 1ZRIA 1UIJA 3IIIA 2E53A 3J8F1 3R4DB 4FPKA 4YPJA 3ZKUA 1YQ6A 4XMAA 2QZ3A 5FCCA 3EJKA 3LE0A 1MVQA 4OUEA 4RS5A 4PJYA 4GMP3 1OA3A 3KHBA 5CISA 3U11A 2GC1A 1GQGA 3MIBA 5C9AA 2R063 5M0TA 1VBD3 1WCQA 3M3IA 5D8AC 3V56A 4AF9A 3SKVA 1OLME 3ON7A 1NCQA 1PZ9A 5JOWA 4G9SB 3HIFA 5FZEA 1UZ0A 4GIQA 3O14A 3U78A 3UJQA 1ZBE1 2FBEA 3THTA 4EWEA 3JB8A 3O7OA 1OMIA 2OQ7A 2K46A 4UWDA 3B5LB 3ZXGA 2BFUL 4P9LA 1JUIA 3H7JA 3U1XA 4O9GA 1LB2A 3PU8A 2PYTA 1AL0G 2VQAA 3ZVXA 4E8CA 1FV3A 1TME1 2LROA 3FJSA 5DN2A 1OC1A 2Z69A 5BYNA 2CGNA 3ZFFB 5IAVA 1V6MA 3PNAA 4TYSA 2R16A 4RS5C 1W6NA 4P9YA 3WEZA 1R081 4A44A 3MIEA 4CPBD 1ZREA 4IGQA 5FYYA 2DUPA 5C9AC 5A33A 4KGQA 1QDCA 1AR61 2P3IA 2VECA 1UOGA 1O3RA 3HNMA 3OY8B 4EV0A 3FN9A 1NCQC 1RUH1 1UXZA 1RUG3 2Y0IA 4GQ7A 5FLJA 4XTMA 3O1MA 2A6VA 1MS0A 5FZGA 3DPRB 3NJVA 1CIWA 5B2GB 2DV9A 2DDUA 1H30A 4NMIA 5EJ3A 4CEYB 4FTBA 4QPIA 4MH0E 4ZY9A 1AJOA 3JCIA 4AFBA 5HV0A 5FZOA 3POYA 2G9ZA 5A3UA 4WZFA 1W2TA 1IS4A 1RXGA 2BW8A 1REDA 2Y26A 1RIRA 3TOJA 3WQ0A 3VBFB 1WW4A 5FZHA 5FP9A 3M70A 4XILA 3ACFA 4Q29A 4Q4Y3 5C3SA 1HLCA 1MEC1 3CKHA 3VKOA 1V70A 4AAXA 2ZEXA 2GNDA 4HXCA 3PUIA 3LB9A 3ZOIA 3K4AA 5DDJ3 3USSA 3AKTA 4V2WA 2IXJA 3TEZA 1DQ5A 5IUQA 2VOTA 5FLIA 1R093 3ZXLA 5EIYB 3ZIXA 4BQ2A 4GH4B 4E4DX 3ACLA 3QH7A 1HX6A 4G3YC 3AFKA 1OKQA 3WD5A 3WQ1A 3WY6A 1LNSA 5CAZA 2OZJA 3M3QA 3S57A 4GMP1 1I5PA 3GBWA 4IESA 2VR4A 3MDPA 5C5TA 5LA1A 1RHI2 4QPIC 1JYVA 5HCHA 1V6LA 2R061 4K8FA 1BZWA 4FPEA 2YGLA 1VBD1 3IAQA 2E26A 2Q30A 1WBFA 4LLFA 3ZSJA 2JIGA 3EQEA 2JX9A 3H3ZA 3SC7X 3ZFFA 4AI2A 4CCMA 1O3SA 3AP9A 3IB3A 4XF3A 3WLUA 2HEWF 1E5IA 5I93A 4TZDA 2FDKA 4HT1T 4FFGA 3GZEA 3LA3A 1W6QB 3LOIA 4JGZB 1AUYA 1SCRA 2WZEA 4KBBA 4L11A 4YZ2A 5BNNB 1PVXA 2ENRA 1CR7A 2AEZA 2OT7A 1EUUA 3OPZA 4DZGA 5T5JA 1DGRA 2QQPA 1VIWB 1IKPA 3N7MA 4XABA 4MX3A 3AYDA 4IV1B 4Y4RA 5A70A 3DXUA 4LHNA 4ZU4A 4AFDA 2B5HA 1ONAA 2SLIA 3K2OA 2V4VA 3HQRA 5FTTC 1Y43B 2W08A 3CF6E 3AZVA 4QB1A 2O0OA 3PIGA 1RHI3 5I0TA 2R042 3DPRA 1MS8A 2BGPA 1FI2A 4W6XA 1GKBA 4AW7A 2ZMNA 1RMU3 1Q3EA 4CEYA 4DUVA 4COUA 1MQTA 1E5HA 4QKDA 4A3ZA 2PAKA 4XFGA 5CG9A 3DV8A 1RUG1 4BQ4A 2XL7A 2C1FA 1BBT2 1W2OA 2QE3A 1X36A 2ZTNA 4PQQA 5LZ6A 3ZFFC 1CD3G 5J3UA 3CJIA 5ACA2 1VP6A 2OX0A 3FMGA 1GR3A 4NPLA 3D0SA 5K7PA 3THPA 4ES9A 4B8EA 2W95A 2ZAHA 4JRAA 2WO1A 3ZR6A 4B7EA 3D8CA 2ZACA 5FV3A 2QNKA 3PTYA 4XACA 4IE7A 5A3WA 3KCXA 3RMXA 4LBNA 1CAUB 5C8CB 3RMYA 3WNPA 4DQAA 4UBGA 2VC9A 3GZAA 3B7MA 4R8HA 1A3KA 3UGGA 1SMVA 4TWTA 3WR0A 1VMHA 3NV3A 4Q4Y1 3T2OA 3O1OA 5FZKA 2R043 4FXGB 2W5FA 1O5UA 3DPRC 1YJKA 5KBFA 3VKLA 2ZGOA 1G86A 4I3PA 4Y3OA 4XJAA 4CUGA 3W5NA 1JHJA 4NRPA 1KITA 4CEYC 5I0DA 2GSYA 3NKTA 1OUXA 1MQTC 3RYKA 1UX7A 1SPPB 2VMIA 3NSTA 2KR2A 4Y1ZA 1R091 5FZ4A 2AUYA 1BBT3 1SDDB 4KNCA 4BIOA 4BK4A 2NN8A 2EXIA 5E16A 1FX5A 3WF0A 5ACA3 2OZ6A 4PDWA 1AL22 2WAOA 4PLMA 3BUCA 1OKOA 2PHFA 2X5IB 5J96B 3NV2A 4M3CF 4X6RB 3O1VA 3LEMA 3C7GA 3IN9A 4RHV2 2RS12 5BUVA 5BNNA 4YW6A 5DAXA 2CSGA 2Y33A 1NX9A 2B45X 2C9AA 5BNPA 4UF0B 1GUIA 4J1XA 1W90A 2R1BA 2DVAA 1RINA 3R4SA 4E4ZA 4LO4B 2HWC3 4IV1A 5DXDA 2WFPA 3OSDA 1DBNA 2D93A 1W6PB 3N4MA 1NXD1 1TVGA 4GH4C 2DVDA 1UYYA 2ZGLA 1F2NA 3VBOA 4ET7A 4C91A 3ZDSA 3MICA 2XKPA 2CY6A 3WDTA 3ZXDA 1OA2A 1W6MB 2B9VA 4LBJA 3SH4A 1RJ8A 1XNKA 4CPBA 1PGL2 1DQ4A 5JZGA 4LT5A 3VZJA 1OLMA 3FUOA 2XDVA 2GNBA 2VMCA 4CXXA 3WCSA 4ARYA 4GXLA 1DCSA 5E8AA 4PDWC 5ERLA 3DYPA 3RGBA 1JYWA 1QU0A 4HVQA 4P14A 4BE3A 4UBHA 1RHI1 2PLV2 4PCRA 3A0KA 4JGZC 2OUJA 4YLZA 4CU9A 1RMU1 1CIYA 4E8DA 5BNNC 1LOCA 3BALA 2VMGA 3KT1A 4KGGA 3N9NA 4CSWA 2E32A 1H2MA 2L9LA 5IW0A 1DGLA 5J09A 4LR4A 3EBRA 4IV1C 2DCKA 2G19A 1CPMA 1VRH2 2CAVA 3N9QA 2XOMA 3MPBA 2BWAA 4NUBA 4Q0VA 1RUF2 5GKAC 5C3RA 5C8CA 1K42A 3MUY1 3M3EA 1JOJA 5EHDA 3VBOC 3X29B 1XYNA 4TLGA 5T52A 4C1WA 4XW3A 2UWBA 2IXKA 1EV13 4M3CE 3T0DA 2NP0A 1OPMA 3BODA 3NNJA 3LEKA 2JJ6A 3GF6A 3ZDVA 4A45A 1GP4A 2VOVA 3FHIB 5JR2A 1LGCA 1DZQA 2XUEA 4LKSA 1HRV2 1ULGA 1SCSA 3CU7A 5LBBA 3H9AA 1FMD2 4JTNA 5FYBA 1AR92 4YYOA 2R041 1Q8QA 2PLV3 1S0IA 3I2HA 2Q1FA 3T3YA 4FTSA 1IQDC 5EQUA 5C3OA 1N1YA 3WXPA 2DCJA 3ZYGA 4AHYA 2GN3A 5A32A 5A7SA 2CHHA 3TN92 4PQ9A 3VHRA 4GKYA 3N7KA 1BBT1 4XTPA 2NYYA 5IJRA 5HCAA 4N43B 1ACCA 1UF2C 5C8CC 4ASLA 4TLFA 1LOAA 5ACA1 2QDRA 1FV2A 1X9TA 1G6NA 2WNEA 2ZGKA 3JBG2 3MPPG 4KQ7A 4LKDA 4NWWA 4P9GA 3H1YA 4N90A 3HVDA 1OF3A 2BZDA 1W6PA 3ABZA 3OBRA 5APAA 2Q4SA 1LGNA 3I2FA 2BBAA 3ZX7A 3I2DA 2YC0A 2ZZQA 1WUVA 2E9QA 1DQ2A 4N9HA 3OEBA 2YC2A 2D7FA 1W6MA 2P3JA 5I8SA 4DFSA 2BNOA 5F1RA 1D4M3 2HWC1 2ZX1A 1HRV3 5DG2A 3FLRA 1FMD3 2WZR2 2AREA 2QQKA 2YBKA 1CESA 2WZ8A 1AR93 4ZXKA 3NWKA 3PHMA 3M2MA 4FO9A 3UJOA 2H6CA 2KXLA 4H2AA 5DPNA 5FY0A 2P3YA 4ISQA 1W8TA 4QHZA 3I3EA 5FMCA 3E5XA 2WQ8A 1YCIA 2WSUA 3TN93 2AYHA 4MYEA 2JENA 4M00A 1IQAA 2WYFA 3USUA 1RB8G 3RDIA 1ZRFA 1CAXB 4UW6A 1UYZA 1RYYA 1V6NA 2FDJA 3T1LA 5EV7A 1YQ2A 3RWNA 4DEQA 3OPWA 1H2KA 4MUVA 3SH5A 3I2IA 4FFFA 2WNVB 1JBCA 3JBG3 2HWF3 5CYYA 2EAKA 2VE1A 4C0BA 4Y1VA 3HT1A 1LKNA 5FR3A 2OW4A 4UYBA 2E7AA 2QVSB 3MEPA 2FDIA 1S0BA 2VZOA 1G9AA 3MIHA 4H3WA 2GMPA 2DBNA 3I3DA 3IBMA 3WSOA 2XG3A 3JZVA 1VR3A 4QM9A 2OVUA 1UU4A 3BIEA 4DRVA 1Q8VA 2BRTA 2WZR3 3MGUA 4HK9A 2XJUA 2ZEWA 3I3MA 3Q8EA 4HETA 2Y38A 3MZHA 3IMMA 3KQRA 4NAOA 5DUUA 1NXMA 1GOGA 4BQ3A 2B46X 5C3PA 1N47A 1PGL1 1DZRA 3CLPA 2D98A 2ET1A 1A8DA 2OPKA 3S30A 2IFRA 3WF1A 3NRUA 3HT2A 1RTVA 2X53S 4N43A 2BOIA 2PLV1 3IDAA 1YQ8A 2WT1A 4MHRA 3OGSA 3S6PA 1QJZA 1VBB3 3N7JA 4X8NA 3WDVA 5F3CA 3WF2A 4FXKB 1ST8A 2RG4A 4MXVA 3FFQA 2H0BA 2D3PA 5LATA 2W1QA 4RGAA 5FPVA 1S2EA 5A80A 3LWCA 2QQWA 5GZEA 1VRH1 2CU5A 5EFUA 5DAVA 2WA4A 1RUF1 2JE8A 2D3SA 2QFEA 3ZPOA 3MHZA 4MGQA 4XIOA 1UAIA 2ZPXA 5AC93 4JX0A 3BU7A 2B4KA 4IUGA 4WZCA 1QOTA 4IV3B 4MOAA 2AENA 2ZHMA 4FOVA 1DLCA 2J1AA 1YFUA 2BP6A 2XJSA 4JRLA 2D6KA 3I2JA 5IVBA 4AFCA 1DG6A 1AXYA 4I0AA 4HKWA 1OFSA 1LHVA 5LBFA 3ZN6B 2GC0A 1D4M1 3HR9A 2WR9A 1HRV1 3O12A 4GZ9A 4QHOA 4Y24A 1CAXA 1HQWA 2P1BA 1FMD1 5I91A 4N43C 1AR91 5IVYA 5C71A 4HMZA 4AZZA 4D6QA 2WFF3 2Y6HA 3A21A 1RL3A 4K1YA 4NPMA 4QPGA 2WNVA 3IZOA 5FRAA 3RVHA 4COVA 3W5MA 3C2UA 4ZS3A 1OT5A 4XJWA 3TN91 1VBA2 2PAMA 1AJKA 4L2NA 2XR4A 1GZCA 3GJBA 2B42B 1AR82 5HPOA 3DN7A 3IWZA 1IHMA 3NKGA 1W2NA 2F4LA 5F6KA 1J1TA 1PGSA 2YB7A 3JBG1 5AFEA 1W9FA 4JAAA 4MV2A 3H1MA 5KC5A 3OG2A 3KF5A 2EIDA 4D69A 1M4WA 1DU3D 1H6YA 1H2LA 2DFCA 1IZ3A 5JOZA 5JOYA 2C24A 4NOTA 1YRZA 2WZPP 2X8KA 3CZUA 1J1LA 5CKNA 1KS4A 2D6LX 1F8VA 2E31A 3AJYA 4K8RB 3ZXFA 1JH5A 2YGMA 2GNMA 4NO4A 3JU9A 2GH2A 3KVAA 1Q8PA 2O8QA 2WZR1 4QKFA 4PHZA 2HWE3 2BNNA 4LA2A 4QPGC 3WNKA 4BA6A 2WNVC 3RYPA 3V0BA 1PO12 1Q8SA 3AKQA 4X8PA 5CFCB 1POV0 4S2HA 1F31A 2P37A 2C26A 3P6BA 2XQXA 3VD4A 2HYXA 1AR83 3B94A 4AHWA 1BLZA 1REFA 1QGLA 4LHKA 5FZIA 2JE7A 4QGLA 2WLPA 4ZS2A 3TBDA 2G9GA 2Q8DA 5GZDA 4YZ3A 1U5ZA 1NG0A 1IPKA 3BTYA 3AB0A 3AC0A 4ES8A 2QQJA 4LTAA 5ISLA 4BM8A 3HBKA 4XFBA 3AVSA 5H9QA 1JODA 4NHLA 4IV3A 3EMRA 4LJHA 4EN9B 1BQPA 1UMZA 2RE9A 3AFGA 2E51A 1R1A2 3ES4A 4M3CA 5FY8A 4Q4V2 5A7PA 3U4SA 2WN2A 3VL9A 5C70A 3KM5A 3LAGA 4QU2A 1POV3 2MEV3 2RDNA 4FPHA 1WCSA 5FYVA 3ZN6A 2G9FA 1UOFA 5IATA 1SLIA 2JG8B 3TB0A 1LAJA 2ZOEB 5AC91 4I09A 4PLNA 5A3MA 2VPVA 3RG0A 1EAH2 1PO13 1RUD2 2J7MA 3IM0A 3WW3A 4URAA 4JHTA 1GWMA 4NVPA 3MFAA 5KHGA 1HN0A 2VH9A 2PHLA 5FLHA 1JZ7A 1ZBE3 1T6GC 2CWSA 1ULCA 2UY8A 2ZABA 2PAEA 2EAAA 4DXZA 4CRQA 1ZX5A 5JSPA 1D0HA 1UMIA 1W6OA 4Y5TA 5GZGA 4XZUG 3POJA 3WUCA 3IDCB 2ARCA 2A6YA 4KWUA 4QX8A 4AGRA 3ZPYA 1O59A 1H1AA 5FUNA 5FZAA 2QQOA 5SV5A 3AZYA 1G7YA 3LSEA 4J25A 1K12A 3MV01 4AHXA 1YJLA 1DF0A 5A7WB 5IVEA 4UAPA 4P08A 1XE8A 2WABA 5F2WA 4IV3C 4QT6A 5JXJA 3NJXA 4HK8A 1R1A3 5HCFA 2ZGTA 2VD7A 2CDOA 2XLAA 3AYEA 1SLLA 3OEAA 2PHUA 3OBZA 4NIAA 1QJX2 1SFYA 4A7YA 4GD4A 5J7MA 3K4ZA 2JDUA 4OUSA 5CZKA 1AR63 5L9VA 5JXHA 3N3HA 2RS32 2Q1MA 4BQYA 1GOFA 4XJZA 2R30A 1EAH3 1RUH3 1W8ZA 2VJXA 3RZZA 4AEKA 4RQPA 5KHHA 5A3NA 2J1SA 1WLCA 1FPN2 2MNGA 2RJKA 2BVBA 2FHRA 2H0VA 4ISRA 3DUIA 4AHZA 3K77A 1LTEA 3W59A 1H4GA 2FDGA 3AL6A 4FT8A 3PLQA 4XFHA 1F4HA 2D40A 1O8PA 2VMDA 5D8AA 2RR12 1UKGA 4NIDA 3WUDA 4MG2A 1XU2A 1Q5OA 2WO3A 4SLIA 3ZYJB 4B3NA 3VZOA 1I5ZA 1VBA1 3WP3A 2OQ6A 3NNMA 3LF7A 5IFTA 5FWEA 1XNBA 4P9XA 4DINB 2VOKA 4FP3A 2O8OA 2VXJA 4EJRA 1AR81 3BPZA 4N7UA 1J84A 2UWAA 2Q8EA 3NNGA 1D2SA 3BB6A 4UFMA 1TMF2 3LGRA 4XDQA 1OXCA 2FD8A 4NN0A 2FDHA 4IEZA 3TWIA 3I3QA 1B35B 2JG8A 4FPOB 4K20A 4RQPC 3RS6A 3L2YA 3LIGA 3Q8BA 4LITA 1QIQA 2XH6A 1FPN3 4UFIA 5FPLA 3UT0A 2BERA 5KWRA 4KU7A 4CCNA 2D3RA 4FQZA 1W99A 3RQ0A 4A7KA 1UCXA 4CCEA 5FDBA 2WNOA 1MS5A 4QQLA 3EHKA 5T5PA 1POV1 4AFMA 2MEV1 4JDOA 4BLIA 1RVF2 2W87A 2RMU2 4KMQA 4HBNA 4IGPA 2W47A 4YG3A 2J1EA 3CZJA 4PI0A 4BWOA 3I2OA 1PO11 4DS0A 1BHGA 3ZXKA 4XE9A 5KXDA 3BI3A 1V00A 4OHYA 1XNCA 5C4WB 2DYCA 5JR7B 3ASIA 2VW0A 3WT3A 4DUXA 2CNAA 4IL7A 4LE3A 5F39A 3VLBB 1MVEA 3I49A 4IE5A 1W8FA 4Z82A 4Q0PA 2VM9A 3KCCA 1HRI3 1GANA 1UOJA 3OD0A 3PVEA 4XF4A 5K0UA 5JVVA 3WQ7A 3GBFA 3Q8CA 4P9WA 1JYXA 2YDEA 1BYHA 1Q8OA 1SZBA 2PHDA 1UPIA 2VCBA 3O0XA 5GJ6A 2JG8C 3A23A 3WNOA 1JZ5A 1XQNA 1XRUA 3HNYM 1W0OA 3B69A 2PN5A 5FYCA 1K3IA 3J26N 3LKJA 2W68A 4Y20B 1R1A1 5F2SA 1H1IA 3ZIWA 1PZ8A 5JPMB 2EXKA 3ZO0B 1G9BA 2EXHA 2ILMA 5FP4A 4M0HA 3AMNA 1FAYA 3UV9A 2EIBA 1UY4A 4V2VA 5IVVA 3SCHA 5ABJA 4F83A 4O7XA 4LO6B 4YGCA 5JIUA 4COYA 1L7QA 1EAH1 3ROUA 3SH3A 2RV9A 4AVTA 5A6XA 1W8WA 4Q0SA 4LOTA 3MLJA 5FY5A 2NMOA 3VZKA 2E6VA 1APNA 4IXLA 3FC0A 4Q4W2 3GM8A 1IOAA 3DYMA 5FMOS 5GLZA 4JGYA 5K0UC 1DQ0A 1FOD2 1OF4A 3AXEA 3ZMNA 5JDBA 3RFRA 1F5JA 5T50A 2QUOA 1ZZ9A 2QZ2A 3WCRA 4CP2A 4LBLA 1YEWA 3ZYPA 3POIA 5DUVA 2NM1A 1B35A 2YY1A 2ZBJA 3FX3A 5L73A 1NA1B 1UWWA 2RS52 3OCPA 2DVGA 3BTZA 1H4HA 1WBLA 3AMMA 3VZLA 5BPXA 1LR5A 2P34A 2EVXA 5ABJC 2RS31 2QQLA 3F95A 2JECA 4YM0A 3ZXEA 4LORA 1FPN1 3KSCA 4GWIA 4P5HA 1J3RA 3BU0A 1MACA 2K0GA 4AE2A 4GJYA 4Q4W3 4QQHA 3UKVA 2KM2A 4WVVA 5C4WA 1RC6A 2PHXA 2RM22 4JGYC 2ZGPA 1FT9A 4FQ4A 1KJRA 1WW5A 1ZBA2 1LENA 2ZEZA 4NIIA 2WIIB 1KD7A 5D1IA 2RR11 4AWDA 4BK5A 4GWJA 1TZOA 4HPKB 3AP6A 3JD72 1JW6A 2WKKA 5DAQA 1TEIA 1VRBA 3ACHA 3TNQA 4D7TA 1F4AA 2JDZA 2V4AA 3LEIA 3KLSA 3C7HA 1HN1A 4JCKA 5FZ7A 1B35C 4LK6A 1VBE2 3I7DA 5EJ1B 3K51A 1QXPA 1SACA 1ALYA 1YXWA 4BYYA 1HRI1 5LEKA 5HXVA 2HJIA 4K40A 4EN6B 3GNEA 1GFF2 1TMF1 2AACA 2HWB2 4GAZA 1Y9GA 2WUHA 5I0RA 1SBFA 2FMDA 4FP2A 4BJ0A 3WHTA 2ZAAA 2OYZA 3RRDA 3OY8A 5GLVA 2YPJA 4YM2A 4IEQA 5FUIA 2VUCA 5C4WC 3CMGA 2I2SA 2J22A 2LRPA 3IAPA 3KGLA 4CDQB 5A3LA 3WQBA 1Y9MA 3H8RA 4RL7A 2JDAA 4ZXEA 3WHUA 5A1FA 1ZBA3 1RVF1 3PJQA 1JZ3A 5FZDA 3ME2A 3VZNA 3AP5A 5LA2A 4XFAA 1NT0A 4C8DA 3ZFEB 4AQ2A 3C3VA 1CAWB 1YFXA 3N7LA 3ATGA 3N35A 4XFCA 5C5UA 5JI9A 1VALA 3VBFA 2XVGA 4CEWB 1W9WA 2GN7A 5AVPA 1W03A 1CZVA 2QQMA 4EQVA 2HWB3 2IVIB 4AGVA 3W58A 2ZA9A 4IETA 4OI1A 5LEJA 2DU1A 3SISA 1GICA 2YC4A 4JKMA 3SMHA 4ORFA 1QWRA 4XPVA 3ZR5A 4WV8A 3VDBA 1I6XA 3Q9OA 3PUSA 1QJU2 2QCSB 4FPJA 2BGCA 1NE4A 2DTWA 4GH4A 4Y5SA 1UW8A 1W28A 2Y34A 3NAPB 2Z4FA 3RI9A 3NVCA 4OZOA 4IE6A 3J7NA 2QQNA 4FOQA 4XAAA 2JDHA 4EN8B 4R9DA 5FZ9A 1ENSA 3BTXA 1HW5A 2VW2A 3M3CA 4RR3B 3ZYBA 5CEHA 3WVJA 1T6BX 3B9CA 4LMFA 3WG3A 2O1QA 2JEMA 1AR72 2LALA 1QQP2 2P6HA 3F2ZA 3H8UA 4Q4W1 4EROA 5LA0A 2JDKA 1ZZ8A 3DEMA 5FY7A 3VBFC 4EZHA 4WM8B 4AK3A 4OI0A 1LESA 4KL1A 3RPQA 4BQXA 4YWAA 2FDFA 2JB8A 2RJLA 3I4IA 1X82A 2JDNA 3E1F1 3Q8AA 2HEYF 1W6QA 4JGZA 5FREA 5G05L 2Q5TA 4EN0A 1KRIA 5CADA 2D97A 1X8MA 4BZ4A 2XWJB 3VUOA 5CNAA 1PM4A 1KXGA 2OA2A 1UZVA 5JMOA 4MADA 2ADDA 4QPWA 4ZU5A 1H8VA 4W50A 2AH2A 4Q8LA 3PUHA 5FY1A 3LA2A 3LFIA 2RS51 2WWUA 4XFIA 3ES1A 1S0DA 3S5QA 1WLWA 1AYN2 2VNGA 1QOOA 4LK7A 4AEDB 4NRQA 3VDAA 3E6BA 3H42B 1Q43A 3VHPA 4MLOA 4YZ5A 1STMA 5ANNA 3GCXA 5AFBA 2ZJCA 4P02B 1M06G 2BQPA 2XLFA 4EN7B 1OI6A 2EICA 5F3EA 3FBMA 1AR73 1O8SA 1QQP3 1SEFA 1C28A 3B00A 3FFZA 2PFWA 5T54A 1AL23 2VBBA 4HSJA 2MHFA 2RM21 1CJDA 4QDRA 1QHDA 4Y22B 4XUNA 1IS3A 1UXXX 3J4UH 2DWRA 1ZBA1 4H7LA 2VMEA 4R52A 4RHV3 1DYOA 2RS13 4GKXA 4XBLA 3O1PA 1WLDA 1DIWA 4CEWA 2A75A 2JD4A 4E4HA 1HJGA 2K2SA 2ZX3A 4YW5A 1WD3A 3W21A 4YM1A 1TG7A 1W9SA 4UXAA 3C7EA 4AI3A 1DGWA 5FPUA 4J1WA 1CAVB 3S5AA 1VBE1 2DURA 2WQZC 3HOBA 1CAUA 3HWJA 3HBZA 1F5FA 2VBDA 1C8M2 4PBPA 4A2UA 1MS1A 1XOYA 4L99A 3AM2A 1RUE2 5JSRA 4O9EA 4KWJA 2HWB1 1AYM2 1V9U2 3HQXA 4AAPA 3UKNA 2NZ9A 3NAPA 2PQQA 3MFCA 1N1SA 3CDZB 4YFWA 1XE7A 1H6XA 4Q0QA 5J48A 5ANQA 2HYKA 1CQ9A 1N1VA 2F17A 1A34A 1SPPA 4RR3A 1JYTA 4AVSA 5KHIA 2J1UA 1UU6A 2R072 3I8TA 1PX3A 1QJY2 4U36A 2EIGA 2ZKNA 5F9TA 2LTNA 4DNYA 4JDNA 2WSVA 1YYNA 2YPDA 3GZUC 2ZX4A 4CP1A 1UOBA 4L9BA 1ASJ2 2X5IA 2VNRA 4CEWC 1LEDA 5C3QA 1XU1A 4Q1RA 5EYXA 1YQ5A 3FLTA 1RXFA 3NL1A 1VRH3 2C6SA 2VO5A 4UF0A 1SFPA 2YBPA 1RUF3 3PL0A 2PHWA 3R6SA 1C8M3 3D5OA 2VMHA 4Y1YA 4Z8BA 5KR7A 2YHJA 5HV4A 2R1DA 3MIFA 1MPXA 1OQEA 1YC61 5FMBA 4YW2A 1AYM3 1V9U3 3T0AA 2DFBA 4F3JA 3NAPC 3GALA 4CCLA 4XDOA 4PT6A 1D4VB 2EF6A 1H8TB 1JOPA 5FJHA 4AEDA 2BU9A 3N9MA 4Q0UA 5A3TA 5DABA 5A6YA 3I2GA 3H0OA 3AP4A 3U4XA 5F6LB 1PM7A 2VCMA 4RR3C 5H9RA 4AI8A 4HKOA 1IS5A 1OFNA 1QJU1 1UIKA 3QH6A 2R073 1CONA 4NAMA 4YNIA 3FLPA 1GBGA 5DG1A 5E1RA 4MXWB 2BEOA 2WRAA 4N8MA 4P00B 2BVVA 3VD7A 3MV11 1PK6B 4D7YA 5LA9A 4WM8C 4DB5A 2X5IC 4Y22A 2BV4A 3JQXA 3K46A 2JB4A 3EXUA 3ZN4A 2VL4A 3OGRA 2PA7A 3UETA 3MBWA 4ASMB 3NO8A 1AR71 1WMXA 1QQP1 5FZ6A 2XHKA 1AL21 1T2XA 3CNAA 4YFZA 4NIHA 4XF9A 4CCDA 1DYPA 2JG9B 5FZLA 3DXTA 2ZGNA 3I59B 1O4TA 1W0PA 2VZ3A 2BFUS 4RHV1 3M3OA 2A73B 4JDMA 2RS11 4XXAA 4W8JA 5EXOA 4IE4A 5EZWA 5A1AA 4F7ZA 3L9JT 4MVTA 3INAA 4P5YA 3HNBM 2JWPA 5FK8A 4LBQD 3VKMA 3OBTA 4AEDC 5T5LA 2ZXQA 4V1PA 1PO22 2Y6LA 3PUQA 3IPVB 4BIFA 4NR1A 1PZ7A 5GLUA 1ND2B 2A1XA 2FZ2A 3KV6A 4XJ9A 3NV4A 3E5QA 3WX5A 1OPOA 2P17A 1AYN1 4YW3A 3LDBA 2IWGB 4JQRA 1EPWA 3G6JB 1OVPA 2A6ZA 3RYRA 1KFUL 1OOPB 1SBDA 4XQDA 1XSRA 5L9BA 1YIFA 2GZWA 4UT5A 5HI0A 2BPA2 2N7GA 3OUIA 1GZTA 4KWLA 5DZEA 5F5CA 5HXMA 1QY4A 2DCTA 2PXJA 2WO7A 3MI8A 1OH3A 4UW4A 3BIWE 4LKEA 4MZUA 1GSLA 4AI9A 2PHTA 2QTWB 1HB1A 5KXCA 1UD1A 2HH9A 4FPCA 1C57A 4QKNA 1JZ6A 3E6DA 3M1HA 2WAAA 3WDUA 5F7UA 3O1TA 2ARXA 3AKSA 1I3HA 5FZCA 5IAXA 1H9PA 5JPNB 3VKFC 1WMDA 3UYJA 1ENQA 3V0AB 1ZZBA 4WVWA 2PMWB 4RA0A 2BTVC 4TXWA 4IDZA 5LASA 3UGFA 4HSLA 5CBLA 3DL3A 2W1UA 4M4RA 4QGNA 4AYUA 1W2AX 2A3XA 3ORJA 3RZHA 2YBSA 4Y33A 4IEXA 1W9TA 4LO5B 4S2FA 2YZ4A 1H8TA 4OMDA 1XYPA 1O4ZA 1W8OA 3AX4A 1C8M1 4JV4A 2V09A 3VB9A 4AVCA 1LOBA 1WW6A 2JIJA 3FBYA 3IDBB 3KF3A 3AJZA 3WW1A 3OGVA 3TEXA 3T0BA 1AYM1 1UNBA 1V9U1 2RJ2A 2VZUA 4MXWA 5K8SA 3R0RA 1VB4A 3GJAA 2ZGMA 5CFDB 1J3PA 2D6MA 2ATFA 1PK6A 2I45A 5GLTA 1B09A 3ZLIA 1BCXA 1J3QA 1GU3A 4FAHA 1KJLA 4I02A 2ET7A 4WVZA 1L3JA 1OSGA 3AYCA 1XNTA 4UW3A 2R071 4ZPIA 1QJY1 2XJPA 4BMEA 1S0EA 3IDEA 4R9BA 3LQCA 2P2KA 3AVRA 3RI8A 2GMMA 4MGSA 4NHMA 5IK7A 1PVC2 5LK7B 2JG9A 3MLKA 2MPFA 1VBC2 3I59A 1GNZA 1NZIA
chains in the Genus database with same CATH topology
2BWCA 2HEVF 1AZDA 4LHLA 4CDWB 1ZRRA 2D6PA 1H8TC 4GALA 1LJ7A 3OYWB 1IPJA 3PVNA 3ZFGB 4E4SA 2FQPA 1JYCA 4Y1UA 4N9IA 4Q26A 4CTEA 2CYFA 3M8LA 4I0WB 1XNDA 4ATFA 3AYAA 3SNMA 2WNUB 1XYOA 2VG9A 4RD7A 2ZMLA 1OD5A 1RUOA 1ZZCA 1BK1A 1PK6C 4JVAA 4Q4X2 3O5SA 4LBQB 4YVWB 3D0JA 3MLLA 2XWBB 3NV1A 1C5IA 1S1AA 2AR6A 3KT4A 4FPLA 1LGBA 1YO8A 1KQRA 1PVC3 2GMEA 4Z2WA 4QQ2A 5BNQA 2JG9C 5LRRA 1VBC3 1WMFA 4HVOA 3U0ZA 1NLRA 3P3NA 1X7NA 1VBA3 4YZ4A 5IK5A 3V0AA 2DCYA 4EWDA 1RGSA 4YZ1A 2ZGUA 2IC1A 2R49A 3RJ2X 4ITCA 1XXNA 4QD2A 5C8WA 4XXPA 1GZWB 3UL2A 1SQ4A 1S2KA 3IKWA 1AF9A 3CL1A 3BTAA 4OZXA 1YHFA 4B7KA 4W65A 1V6KA 3AZZA 1URXA 1QDOA 2XVKA 4DRRA 4Q4X3 1SLCA 2DU0A 1G9CA 1OLQA 1PMIA 2JXAA 2A70A 2DUQA 4QM8A 3ILNA 1F9KA 2R32A 2CWMA 4GULA 2TBVA 3VBRB 1TME2 4AI0A 4JC1A 1N3PA 2OIIA 4AXOA 2E7TA 2VGDA 4F8AA 1YI9A 1LOGA 4XBNA 1REEA 2ERFA 5J36A 4XMIA 1BMV2 4OI2A 1JTZX 4Z1VA 3B93A 1FNYA 3EO6A 3WW2A 3ZSKA 1AXKA 3OYWA 1LOEA 5LRSA 1YFYA 3GZTB 4RGGA 4EWAA 4COZA 4LBOA 1IS6A 2WA3A 4WM7B 4FOWA 4LE4A 4RS5B 5SV8A 3ELNA 3RSJA 5KHKA 2WNUA 2UYBA 4Q4V3 1SFNA 3P3PA 1HV0A 3VBSB 1LCLA 4Q8KA 4G4FA 4LBQA 3DKWA 4LUMA 4YVWA 1RUD3 2ZX0A 5FPZA 3QCWA 3SCGA 4ZKTB 4ONUA 4N53B 3SITA 5FFOC 4KWKA 2CTVA 1BEV2 2PHRA 3PMEA 4H14A 2WLQA 5CFCA 4MGIE 3VBUC 2JKBA 1N3OA 2LUWA 3AKPA 3LA7A 3ZXAC 4AVAA 5KHJA 4WBBA 5KXEA 1NCRB 3AXDA 1EPZA 3GYDA 3URFA 1PVC1 1HKDA 2WINB 1VBC1 3MF9A 5K9YA 1GZ9A 2D5FA 1W6NB 1ULEA 1UN1A 4L92A 2WNUC 1PGW2 4U2AA 1TNRA 1RUC2 3FWEA 1QJX3 2VULA 3ZMOA 1G8WA 3ZSMA 3KT7A 2C0ZA 3GHNA 2DUOA 1HV1A 2EALA 4B4PA 2RS33 4LULA 4YVWC 4YARA 5DUXA 1MS3A 5FO9B 2QKDA 1VBD2 2GH8A 4BH9A 4GMP0 1YI7A 2PTMA 2I07B 1BEV3 4Z07A 3ALQA 3VBRA 4FTEA 5CFCC 2JICA 3QBQA 2VNOA 1H0BA 2UY9A 2VUAA 4Q4X1 4B4QA 4GWMA 3MF6A 3VHOA 1TNFA 1CGPA 4DY3A 3E97A 3I54A 2RR13 3T2TA 4XHXA 1KFXL 1AXZA 1WA4A 2W39A 2YROA 3WOGA 1FATA 1YFWA 3MIDA 4GWNA 2V73A 2VU9A 3ZXJA 4WM7A 5E89A 1RUC3 4IERA 1Z78A 1ZNPA 3WG1A 4XEZA 5L36A 1MR5A 1TMF3 2XVLA 4E2SA 1Y9QA 3IIAA 1PNGA 4AQTA 1D0GA 3VBSA 4K7JA 4I2OA 1AX2A 2GDFA 4FAGA 4HVRA 2VVEA 2R0HA 4YGBA 2VY0A 5L7OB 1GYKA 4ATEA 5CU1A 1RJ7A 1RUG2 2XJRA 3VBRC 4Q4V1 2ZX2A 1DGWX 4N53A 1DYKA 1S0FA 4A3XA 1RVF3 2EXJA 2RMU3 3OF1A 2ZGSA 1WD4A 3UKTA 1RUD1 2VVFA 1C3HA 1PHMA 4MSVA 1JHNA 1NCRA 3D4KA 3HAGA 1PIV2 3KGZA 1U0AA 4LEJA 1CPNA 4WM7C 5KXBA 1V6IA 4B4RA 1BMV1 5BV6A 2B39A 4PIZA 4Q4Y2 2X29A 5J37A 4HFSA 3VBSC 4H7MA 2XL9A 2HWD2 1AX0A 1S0JA 1HDKA 2WJSA 5DDJ2 1O91A 1WCKA 2VQ0A 1ND3B 4FBFA 1R092 1A8MA 1WCDJ 3JQWA 1FXZA 4N53C 2Z79A 4PBOA 2C5DA 3OD4A 1QJX1 3AKRA 1C8NA 4E2QA 4Q1PA 4K3UA 4QMAA 1OQ1A 2YMZA 1MQTB 1ZRCA 3O0WA 3M7AA 1QKQA 3J9SA 3R05A 4DMIA 1NCRC 4FSJA 1PIV3 1BEV1 3CJIB 1YNAA 2A3WA 4YGEA 1OLRA 1ZZ7A 1ZRDA 1FOD3 5GLWA 1FNZA 3A0NA 5JWPA 4XIKA 3TYJA 4XZPA 4MGYE 1JYIA 2HWD3 2VUJA 4S2GA 2VVDA 4E27A 3QD6A 1SBEA 4XBQA 2XJQA 5I0SA 5JIAA 3V65A 1PGW1 3VV1A 1LHOA 2BUKA 2RS53 5L7OA 1RUC1 3D6EA 4GB32 2ZKLA 4Y20A 5T3NA 3H3UA 4SBVA 4QQOA 1NE6A 1ENRA 1W39A 2E63A 4FPGA 4LA3A 1RMU2 3WP5A 4XQ4A 1C5HA 1QF3A 4FVVA 4X6QB 4PDWB 3B9IA 5T55A 1N1TA 3V64A 2RM23 2F6BA 4R9CA 1LU1A 4OHXA 1U5YA 2RMU1 3K48A 4CDUB 1J58A 1U12A 1O3QA 5BNPB 3JD73 4S2DA 5FPXA 1H9WA 3SLIA 1VBE3 1OA4A 2VOXA 2ZCWA 5L7OC 3VBOB 1ND3A 4XYXA 3S7EA 4GB33 4FCAA 4K21A 5FO7B 4FOYA 4HKLA 4LUKA 4OHZA 4AGGA 1S2BA 1NA1A 2DVFA 1KDKA 3CO2A 3MYXA 2DVBA 5EWSA 5KC6A 3WDXA 5JZGB 1IKQA 3BOWA 1O3TA 3H50A 1WW7A 3MIGA 3QOPA 2WQ4A 1C4RA 2QDNA 4HANA 3AK0A 1YWKA 3VZMA 5FOJB 3JUUA 3DF0A 1RUNA 3ZSLA 1KDMA 5F5QA 4AVVA 3LOBA 4I3GA 5CVRA 3ZYIB 5BNOB 2ARBA 4KH9A 3VBHB 1PIV1 4HPKA 1DFQA 3MW3A 1GNHA 3OJBA 4P9IA 1COV2 1UZYA 5FQ0B 1ND3C 1LODA 2HWC2 3AMQA 1VJ2A 5HCBA 2B8MA 3SCFA 3ZMNA 5FO8B 2GALA 1FOD1 2XB6C 1NA1C 1HIXA 2XBO2 1SLAA 1NLSA 5HBAA 2HWD1 4IEVA 1AHSA 4M01A 2A7AA 1UZZA 2FZ1A 5DDJ1 3FUQA 1DQ6A 4YG0A 4OFGA 3B01A 4Y5Z0 1VAVA 1QJU3 4YRDA 1TE1B 2DCZA 5GALA 2W0XA 3CJIC 2SBAA 5JLVA 5FBZA 5I0UA 2D43A 3TRSB 4CDQA 3VL8A 3UK9A 2PELA 4K6BA 4R9AA 1RUJ2 5A32B 5LK5A 4DOUA 2AZ5A 5H9SA 2D6NA 1ULDA 1NY72 3WZ1A 4CDUA 1LHWA 3KZ4C 1IGOA 1COV3 4W6YA 1QNWA 3ZYRA 4XJ8A 3ZFEA 1QH6A 1CAWA 4Y4YA 3S0MA 4K1ZA 4AVBA 3B02A 4YM3A 4Q27A 2XBO3 3KCYA 4PLOA 2UURA 4MGKE 2Q1ZB 1LHUA 3JD71 5BY5A 2IXCA 3QACA 1EV12 2CGPA 3POWA 1VAMA 2K9ZA 5CIRA 4AI1A 3H1WA 3HMYA 1Y7BA 2GNTA 4GB31 4I01A 4QGMA 1QOSA 1AYN3 1V6OA 4YSFA 4CDQC 1G9DA 4NPRA 2LM3A 1RUJ3 3USUB 4OUMA 4PIXA 4CDUC 4XFFA 5BNPC 2XLGA 1QH7A 5BNOA 1Z7S2 3WINE 3VBHA 5JCTA 3ZFEC 3T1MA 1EP0A 5C6CA 4D94A 4LBMA 5FQ0A 5H9PA 4WM8A 3SXWA 1RUI2 2GAUA 2YUEA 4BQ1A 1UPSA 4I0BA 5I8YA 3AP7A 3O0VA 5DZGA 5JZGC 3WW4A 2IXHA 4HLTA 2TUNA 1D4M2 4IEUA 3FZ3A 1RUE3 3TNPB 2G4IA 1A6CA 1QNYA 4OULA 1WMEA 3VGIA 4OHWA 1QXRA 5JMCA 1X33A 5JAXA 2BBVA 4UW5A 3MW4A 1Z7S3 5BNOC 1MS4A 3VBHC 3D82A 1MZ6A 2WS92 1QJY3 4IEWA 1C1FA 1S55A 1UKRA 3VHNA 3LCPA 1X50A 1CVNA 4I30A 2QJVA 2HWF2 1DLLA 4L8QA 1ASJ3 5TSWA 3OGGA 4XJUA 1RUI3 4C90A 1SDWA 1OHFA 1X8EA 1YUDA 2VOWA 2HKXA 1COV1 2E7QA 4IEYA 3L2HA 5AVAA 2AGSA 4Y1XA 1CAVA 2UWCA 1DZTA 2XBO1 1LULA 1ULFA 1PNFA 2UYAA 5EYYA 5IT6A 2XJVA 3ENRA 4M0NA 4L97A 5IK4A 2KA3A 2GU9A 2XGXA 5FMOL 4XF0A 3PMSA 4NWVA 1BXHA 2IXLA 2WS93 3DGTA 1MZFA 5T5OA 4QPGB 2WL1A 4W6WA 1DQ1A 1DHKB 2NPIA 3AMHA 3AZWA 3GBGA 2GC3A 1RUJ1 1ZZ6A 1LRHA 2H6BA 4LBKA 4H55A 1ZVFA 3WG2A 1NY71 1I1EA 1VBB2 4BMBA 4PF5A 1HQNA 1MS9A 3WV6A 2GC2A 2NMNA 2DTYA 1BVP1 3ST7A 4IEOA 4YW4A 1YLLA 5DUWA 4DPNA 5CG8A 5AC92 2WT0A 2WWSA 1O7FA 4YW1A 4BCUA 1C1LA 2BNMA 4YVSB 1EV11 1QXJA 4ZU7A 1PO23 4TSVA 2Z2SB 1QMJA 2JE9A 2UU8A 4QX5A 4HN0A 1NZCA 3PVBB 3VDDB 4LLOA 4YG6A 3RJRA 4Z92B 3V0BB 1RUE1 3RNSA 4E9KA 3N36A 2WFF2 4AEJA 3E5UA 4FPYA 2B9UA 2R6QA 4YGDA 4BPZA 4QQPA 1JN2P 4IEPA 1Z7S1 1WLTA 2NQYA 2WT2A 3VN4A 2W52A 2ZZJA 1HXS2 1UU5A 2YV8A 1O4YA 1BVVA 3M4FA 3BOPA 1ASJ1 4LO8A 3WP6A 1FYUA 1RUI1 4M3CB 2Z42A 1CN1A 2D5HA 4QHBA 4COWA 4RFT0 2B7YA 4KU8A 3KD4A 3R4UA 3HD8B 4AFAA 4BHPA 4CDXB 2OUHA 4C0HA 4WVMB 2P3KA 1JXNA 1S0GA 2TEPA 3IPVA 2VW1A 3ILRA 3PVOA 1ND2A 3VKNA 1GV9A 3H7YA 1VB2A 3B3QE 1DDLA 1K5MB 1ZM1A 3GHMA 4AQSA 2HWE2 4CP0A 3SHRA 1JUHA 4P9JA 1R1ZA 5GM0A 1CX4A 1OOPA 3ETQA 2EA7A 1LHNA 5I8TA 1W6OB 4OI4A 4D3WA 3KMHA 4D7SA 5GZCA 4KG8A 4IQPA 1NOVA 5L19A 2WS91 3FE5A 4GA9A 4XETA 1HXS3 1OQDA 2DF7A 2NLRA 3LSDA 3POSA 4MGZE 1LEMA 2HWF1 1VLNA 4AEMA 1W2UA 3J8F2 2IXIA 4META 1EY2A 5JSOA 1HQLA 4CZSA 4YVSA 1N3QA 4FPFA 1YIPA 2BYVE 3ZN5A 2MEV2 1ND2C 1A78A 5FAXA 3BCWA 1O5LA 4RQPB 4URTA 3VDDA 4RSUA 1S0CA 4BOWA 4XOGA 2FMYA 3APBA 4KG0A 1UX6A 4N7IA 3E6CC 3QLQA 2V5YA 3WDYA 4XHBA 4INDA 1OOPC 3AZXA 3S7IA 1GLHA 1PO21 3KS7A 1Z0HA 1ZBE2 5CFDA 1Y3TA 2CAUA 2ZMKA 3WP4A 2A71A 4R4ZA 4K9SA 3WNXA 4DY5A 5D8AB 3WDWA 3OGJA 1LU2A 1ENXA 2Q0AA 2CL2A 5JI7A 4HL0A 3IT8A 3J8F3 2ZHNA 1LOFA 1VBB1 2ZHLA 2VXRA 3NW4A 3VBUA 1BKZA 2XKOA 1LECA 1KS5A 4YVSC 4CDWA 1R082 1BJQA 2ZGQA 2ETEA 2ZS6B 3JB4C 2XUMA 4R4XA 3A4UA 3MW2A 1V6JA 4CDXA 4WVMA 3ZFGA 3VDDC 1AR62 5CB7A 2CGOA 2R0FA 1CJPA 1RUH2 3ZSEA 1WGPA 1I9RA 2D44A 4AQ6A 1K5MA 3CJXA 5E88A 5CFDC 3ECQA 3OTFA 4LO7A 2A5ZA 2D6OX 1G9FA 1ZYBA 4XF1A 4A7ZA 5C9AB 2Q8OA 2I74A 3AMPA 4PIYA 1AVBA 1NCQB 4HN1A 1H1MA 4Y26A 3PJYA 3WG4A 3ILFA 1ZA4A 1NQJA 1TME3 2WFF1 3W9AA 1MZ5A 1J59A 2ZGRA 1LOFC 1NQDA 1AX1A 1D2QA 4NHKA 3TAYA 5K0UB 4CDWC 1R083 4LNVA 3U07A 1MEC2 1SLTA 3G7DA 4QPYA 1HXS1 4QXKA 4CDXC 2ES3A 2IFWA 3ZFGC 5BXXA 1DGRN 1U5IA 2Y0OA 2XJTA 4J6GA 1GZWA 1GQHA 4HZFA 1RITA 3KB5A 3HN1A 2YXSA 1MZEA 1K5MC 4B29A 2RHPA 2YYOA 5J98B 1VAKA 2Z5WA 2A6XA 5A33B 1E57A 2ZHKA 4OLLA 5ABJB 2A3YA 4JTOA 1H2NA 1U5XA 1Q56A 2R062 5IK8A 3CEWA 3LZZA 3U10A 2WC2A 2HWE1 5DZFA 1NYWA 4BLJA 5JOXA 1SLBA 4OVEA 4AG4A 2F4PA 4JGYB 2A6WA 4QPIB 2CV6A 1TQ5A 5C33A 2TNFA 4Q2FA 4CYDA 1MEC3 2IZWA 5CA6A 3NJZA 3IMNA 1HRI2 1UL9A 4XQWA 4OHVA 4C1XA 4E2GA 1EYBA 5GZFA 5FOBB 1UIJA 2E53A 3J8F1 3R4DB 4FPKA 4XMAA 2QZ3A 5FCCA