2BDRA

Crystal structure of the putative ureidoglycolate hydrolase pp4288 from pseudomonas putida, northeast structural genomics target ppr49
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
166
Chain Sequence
MRTLMIEPLTKEAFAQFGDVIETDGSDHFMINNGSTMRFHKLATVETAEPEDKAIISIFRADAQDMPLTVRMLERHPLGSQAFIPLLGNPFLIVVAPVGDAPVSGLVRAFRSNGRQGVNYHRGVWHHPVLTIEKRDDFLVVDRSGSGNNCDEHYFTEEQMLILNPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate hydrolase
publication title Crystal Structure of the Putative Ureidoglycolate hydrolase PP4288 from Pseudomonas putida, Northeast Structural Genomics Target PpR49
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 33
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 4.3.2.3: Ureidoglycolate lyase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04115 Ureidogly_lyase Ureidoglycolate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.480 Mainly Beta Sandwich Jelly Rolls Ureidoglycolate hydrolase 2bdrA00
1XSRA 2BDRA 1XSQA 1YQCA
chains in the Genus database with same CATH superfamily
1BJQA 3DPRC 1ND2A 5A1LA 1TNRA 2HWB1 2O1QA 4LA3A 4N7UA 3TEYA 5DG2A 4GZ9A 2ARXA 2R043 2XLAA 1SLCA 3INAA 3KV5A 1BVVA 3L2YA 1OVPA 2JG9B 1O3RA 3MEPA 5DG1A 2YPDA 1Y4WA 5D1IA 2O0OA 3VBFA 4YW1A 2GC3A 2B39A 3BU7A 2WWSA 4HSJA 3ZFGB 1YI9A 2PAMA 4GQ7A 3JD73 4M4RA 2OKXA 3ZKYA 5FKBA 2HBTA 2CTVA 1LECA 4ONUA 4QPIA 4Q1RA 1MEC2 2XXZA 5F32A 1EAH2 3ZSKA 1XNKA 4NHMA 4K8RB 1W04A 1F35A 1MZFA 3MIGA 3VHOA 3ZYBA 3POJA 5LEJA 5CEHA 1FMD3 4Q2FA 3PVOA 2DCJA 4BQWA 4WM8B 3ZSLA 2PTMA 4Q0VA 4RS5C 1UN1A 3BKZA 2PHFA 2ARCA 4IESA 4XFFA 3JB8A 3WF3A 1QJU2 4IEUA 4FPKA 4JHZA 1BYHA 1Y9GA 1GZWA 3MI8A 5HCBA 3BU0A 1PGSA 3GJAA 2FDHA 4YRDA 1UW8A 4TWTA 3FE5A 4YPJA 1MS4A 5DXDA 3QBQA 1SLTA 2GNBA 2ZX1A 3CIHA 3CJXA 4MG2A 2W52A 1ZBE2 1M06G 4LO4B 1MS3A 5L19A 1TNFA 2VBDA 1SBEA 1RUH2 3AVSA 5EFUA 3RWKX 1GZ9A 1FT9A 1ZA7A 2WUHA 4AAXA 4GA9A 3NWKA 4C91A 1YYNA 2DDUA 2WWUA 4XJUA 2FMDA 4E9KA 5GM0A 3P1IA 4WVVA 5LRRA 2RS31 4S2HA 1QDOA 2HBUA 4UXAA 3VZJA 4F7ZA 3T2QA 3NV1A 3WCSA 1AX2A 1POV0 1V9U3 3VL8A 4AVTA 4XABA 1CZVA 3LFMA 1MS9A 3MIHA 3PIJA 4AVAA 2ZGPA 1Q3EA 3H3ZA 1UOBA 5L36A 3B69A 2W47A 1QH7A 1NQJA 5FJKA 5GZFA 3MUY1 5H9PA 3RNSA 1MQTA 3WDXA 2D5FA 1RMU3 3DYOA 3IDEA 4LBLA 2LTNA 2JDYA 4MX3A 4QXCA 3SH5A 5FYCA 1VBC3 4AI2A 1LGBA 1AR73 3FBMA 2QZ3A 4LXLA 3HQRA 1NE6A 4Q4W2 4QXKA 4DRRA 2I74A 5JOYA 1FPN3 1QHDA 2B7YA 4XOGA 5CADA 2Y60A 1ONAA 4XJ9A 1R1A1 3PU8A 2JG8A 4NHYA 4M0HA 1JODA 4Q8KA 3CZUA 4KWKA 2WQ4A 5DUWA 3S7IA 1AR61 3KGLA 1ZZCA 1XSQA 1RUOA 3CMGA 3MLLA 1LESA 1HLCA 2DVFA 2MNGA 4FO9A 2VE1A 4GWMA 4N8MA 1MZ5A 5F5IA 5CFDB 1H2MA 4YW3A 5L9VA 1H2KA 4CEWC 1W2OA 3ZSMA 2RDNA 3IDAA 1JI6A 4R4ZA 4W8JA 3ZXLA 4NWVA 5IK5A 1XSRA 2A3YA 5CISA 1F9KA 3JU9A 2VL4A 2YPJA 4CDQC 2TUNA 3VBSA 1GMMA 4SBVA 3RZMA 5JDBA 1G9FA 2X09A 1E5RA 4FTEA 5A3OA 1TMF2 2ZBJA 1RUE2 4OULA 1KDMA 1YCIA 2Q5TA 4DPNA 1IS5A 4Y4RA 3RZLA 4XFIA 1U0AA 2VVDA 3T2PA 5DMYA 1NYWA 3LZZA 4IEVA 2XBO1 3RYRA 5FY0A 2Y6JA 4FFHA 1NXMA 1AR62 4K1YA 3ZMNA 5FZCA 3WX5A 5JI9A 4YSFA 3MPBA 4M00A 2DYCA 2RMU3 1ODMA 1PK6C 3PVNA 1AXZA 4TYSA 4XAEA 3VBUB 2PMWB 3V0AB 1E5HA 2WN3A 3BTAA 2JG9A 4YM0A 1H1AA 4TLGA 3USUB 3V56A 5FP3A 5SV8A 2QDNA 2G9FA 3ZFGA 2LROA 4LKSA 3AYDA 2PHRA 3LAGA 1HRI2 4XBQA 5F2WA 1SBFA 3A0KA 4QDQA 4CDUB 2CAUA 3HBZA 3HEIA 3QH7A 4NHLA 3CBNA 3W58A 3DYMA 1QWRA 1K3IA 1Z7S1 2V72A 5A70A 3SMHA 3WT3A 2D3RA 2OA2A 4CU7A 3KZ4C 5HCFA 4EN6B 4WM8A 4MUVA 2E32A 4CCKA 2Q1FA 1H8TB 2Q4SA 1RUD1 4LIUA 4ZONA 5KWRA 2CAVA 4ZXKA 2XJRA 2Q8DA 3U10A 3MFAA 3TN93 1ENSA 3Q9OA 1WW5A 1XU1A 4UFKA 4TN7A 1RYYA 5EPAA 2ETEA 5GLVA 1CIYA 5L7OC 1V6LA 1LRHA 4LE3A 2JD9A 3D3AA 1SLAA 3K4DA 1UY4A 4CP1A 1RUJ1 3RMXA 5C5TA 3O1OA 2DBIA 5E8AA 2GNDA 2OQ6A 2VZOA 3HNMA 3RJ2X 3UJQA 5IK8A 1CAUB 4QU1A 3IKWA 3I2KA 3U37A 2R7EB 2VTXJ 2WSVA 3HR9A 3ACHA 3O0WA 2JE9A 1BBT1 4GAZA 3E1F1 2W87A 1T2XA 3KT4A 4W4ZA 2BOIA 1QY4A 4NHKA 4E8DA 5FIXA 4YFZA 3OG2A 2Y6LA 2QUOA 1DU3D 4J25A 4CCOA 4DMIA 5FZGA 2VVFA 3RPQA 4XHBA 3EHKA 1K5JA 3AP4A 2D6NA 2RHPA 1RJ7A 4PBPA 1H9PA 3SLIA 4AGRA 4ARYA 2OUHA 2VOWA 2HWC1 2QQKA 1YI7A 5JXIA 2QZ2A 1PX4A 3ABZA 4QKDA 2ZTNA 4DXRA 5DUVA 2BV4A 1KXGA 2JECA 4AE2A 3VZNA 1RUF3 5CFDA 5F5CA 2WSUA 1H6YA 2R30A 3O5SA 1VBA3 2PFWA 5DAXA 2ZMLA 5FYHA 5KHKA 1DQ0A 1ZYBA 2EXIA 5CG8A 1EV13 5I0DA 4CXWA 2R041 5IVYA 3J9SA 1NX9A 4DS0A 1UX6A 4HVRA 4AR2A 5EYXA 4QGMA 2DCYA 1S0FA 2Y34A 3GYDA 4Q8LA 5F3CA 3H8OA 2W1QA 4Y5TA 1QJY3 3SKJE 4P9YA 3NNMA 4FSJA 4LA2A 4XFBA 4Y26A 3N7LA 5T3NA 2FZ1A 1N3OA 1FOD3 2DU1A 3JD71 2O8QA 3DXTA 2O14A 3OY8B 1VALA 3G6JB 3JUUA 5J3UA 3AKPA 5F3GA 2Q8EA 4Y1ZA 3WW1A 1F8VA 2XWJB 2XKPA 4YWAA 4ES8A 2XVGA 4O61A 1FMD1 3M2MA 4XF3A 3BTZA 5EIYB 3Q8AA 3AMMA 1RVF2 1C1FA 5ISLA 1TZOA 3VBUA 2ZHMA 3V0AA 2XUMA 5A3WA 3USUA 2C9KA 2WO7A 2CGPA 4Q4X3 4YW5A 4A4AA 4I3GA 2R042 2Y64A 2VUAA 1HQWA 3ZM8A 2AZ5A 3UETA 1CZSA 1NLQA 1SDDB 3AZXA 2XJTA 3O0XA 4QQOA 2K0GA 1W0NA 3T4VA 5FV3A 2XGXA 4H3WA 3WV6A 5KXDA 5A80A 3W59A 3GZAA 1HQNA 2WZEA 4LUKA 3GZEA 5JXJA 2NMNA 3NNGA 4AGGA 5A1AA 4LKFA 1CPMA 1WBFA 1LB2A 2CWMA 1DCSA 4D6RA 5C4WC 2WT0A 1PO12 4TLFA 2JDPA 1EYBA 1GANA 5LCWL 1H8TA 4PI2A 1V9U1 3DL3A 3X29B 4MSVA 1ZRFA 2D6MA 2DU0A 2P3JA 3S6PA 4MVTA 4XACA 1W03A 1VBB3 4G9SB 2QQLA 3I54A 3NJVA 4L8QA 5IAVA 2XH6A 2JDAA 1GNYA 1XNTA 1WKYA 1ASJ3 1JBCA 1ND2C 4GWNA 1GBGA 3PDQA 2D93A 1VBC1 3ZN5A 2GZWA 1XRUA 2EIDA 1HB3A 2YHJA 1VBD2 2YXSA 2LRPA 1W6QB 2RDQA 3D6EA 5ABJB 4B4QA 3VBFC 2R063 4HKOA 1W6MB 4X8NA 3VKLA 3TEWA 1CAUA 3J7MA 2AYHA 3BIEA 5J36A 1H6XA 2VBBA 3ZPYA 1I1EA 2HYKA 2Y0IA 3HT1A 2BW8A 1KJLA 1DQ2A 1OI6A 1W3XA 2G9GA 1D2SA 4QPIC 4AOCA 5LBFA 4Y4YA 3TOJA 4AEMA 1H0BA 1OXCA 2XJPA 1US3A 3I2JA 2TNFA 5FP9A 5FZDA 3S7EA 1AX1A 1E5IA 4MGYE 2H6BA 3MF9A 4RSUA 2D3SA 2A6YA 5DZGA 4LHKA 2W91A 4N43B 3B01A 4QGNA 1WMDA 1DP0A 1L7QA 3OBRA 2AGSA 1AL0G 2VUJA 1V0AA 4YG6A 4AEKA 1RMU2 2BBVA 3U07A 3VZOA 1AR72 1EUUA 2VVEA 2ADEA 4FPFA 5FPVA 5A6YA 3ETPA 2GDFA 3OUJA 2F4LA 3OCPA 4PQQA 1FPN2 4IEPA 4Q4V1 3THDA 1IG3A 3FMGA 4LULA 2PHUA 4HKLA 1DYPA 3LA3A 2I45A 1JZ4A 3KF5A 3RDIA 1LOFA 4RQPB 2WNUB 2WC2A 3ACLA 5IVBA 1OVSA 1COV2 3WNPA 4TTGA 4B7EA 3KVBA 2RMU1 1APNA 3N35A 3K3NA 1NA1C 4WVMB 2G9ZA 5KHGA 1DZQA 5BYNA 4CXYA 1OPMA 1QMJA 2BVVA 4Y22B 3OY8A 3S0MA 3E6CC 1MQTC 1X7NA 3PIGA 1WCSA 1AXKA 4ASLA 1JW6A 2RS53 1LHWA 3HD8B 2FDFA 1IPKA 3H3LA 3IZOA 4IXLA 1VMHA 1JS9A 4Q26A 1FAYA 1VRH3 2EXKA 4FPEA 4Y1UA 2D98A 4AHWA 4N53B 3WD5A 2JG8C 1YJLA 2JIGA 3IAPA 4XUOA 3THPA 1J84A 1ZRCA 1LODA 2UWBA 5DABA 3GHMA 3N9MA 3OUHA 5D2AA 2YC0A 3FFZA 3TN91 1BK1A 1LU2A 1QU0A 3OUIA 5DPNA 2ILMA 4EJRA 1KGYA 4ZZ8A 2PQSA 5IVVA 2GALA 2E7TA 3TNPB 4B8EA 4CDXB 4Q1PA 1QJEA 3ZLIA 1J58A 4YZ3A 2W08A 1YHFA 2NP0A 3D82A 3RZJA 5LRSA 2MEV2 4JDOA 5C9AB 1SCRA 3VBSC 3BUCA 3RYPA 3I59B 1HB4A 4XJAA 2Y33A 3MF6A 4FFGA 3KS7A 4DXTA 5A7NA 1ENXA 2IZWA 1W8UA 3WF2A 2CYFA 3D4KA 4OHVA 3PTYA 2ZHLA 2J1UA 4FPCA 4NAMA 2XL9A 4L92A 3ZR6A 2W3JA 2WFF3 1XNDA 4LQRA 4YW7A 1CX4A 3AKTA 1SCSA 4ZU4A 5FRAA 4D0QA 1HX6A 4LOSA 4NN0A 3BPZA 5FCCA 4DRVA 1O6UA 3TN92 1SG3A 1F4AA 4AF9A 1BKZA 3DEMA 4DEVA 1D4VB 1UOFA 2JG9C 4YW6A 5ABJA 1W6QA 1JYTA 1YIPA 1W6MA 2WINB 3AJYA 3AKSA 4JKLA 3WP4A 2EIEA 2WLPA 3J26N 4DEQA 5FPUA 4Y24A 2EAAA 4CP0A 3ZDSA 5JPMB 4H2AA 2DFCA 5CVRA 4ES9A 4G4FA 5CKQA 4CVUA 1NT0A 5A3NA 1RUF1 2UU8A 4C90A 1GQHA 4FTBA 4K6BA 1PMIA 4XZUG 1BMV2 2ZHKA 4WM8C 4GB33 1C8M3 3C8XA 2YBPA 3AXEA 1EV11 4FVVA 4N43A 5D8AB 2YDEA 3LDBA 1ZREA 1G9CA 3ES4A 1WD3A 4AVBA 4EQVA 4R4XA 5LBBA 5FZ1A 3PTRB 5T5OA 1QJY1 5C3SA 3LGRA 3KB5A 4R9DA 2WA3A 1FOD1 4HPKB 5GZGA 3BTYA 3FLRA 5FYYA 1OA4A 4KWJA 3FLTA 4LO8A 5JR2A 5J48A 4ZS2A 5FPBA 1IOAA 2XUEA 4C1XA 1JZ2A 4JGYB 4KL1A 2XQXA 3ZXDA 4RQPA 3SHRA 1VAVA 2AEZA 3H8XA 1FNYA 4QB6A 4BK5A 1J83A 2WNUA 3ASIA 4BM8A 2RDRA 1BEV2 1PZ8A 1RXFA 5FZ3A 1LHNA 3IMNA 3MV11 2PHTA 3ZX7A 3I2DA 1VBA2 3AB0A 4IE4A 1GU3A 1YWKA 4WVMA 1PM4A 3WP6A 1GNZA 4P9JA 1T6GC 1WA6X 2J1TA 3MIEA 4I3PA 4Q4X1 4NRMA 3TYJA 4OQ8A 4WZCA 2YU1A 1XYPA 1XNAA 4XHXA 4RHV2 1HV1A 1OF3A 4Y22A 5FY9A 2QFEA 3Q8CA 4IGQA 2Q8OA 1I5PA 3AMQA 4CDUA 2D43A 5KHJA 3UKVA 1CN1A 1AHSA 4ISQA 4JGZB 3AXDA 2RJ2A 3VBHB 1JHJA 3WF0A 4BMEA 2W94A 1RB8G 1H9WA 1D4M1 1J3RA 4BQ1A 4D6QA 1ULEA 2IXHA 3IIIA 2VMHA 4N53A 4LHNA 4FCAA 4AI9A 5A6ZA 2C4XA 1GLHA 3POGA 2XG3A 2D6KA 1VBB1 2FQPA 4DUXA 2IC1A 5CFDC 1IS4A 5LY2A 1RGSA 4D7SA 2RJKA 1HRV2 1ASJ1 4CDXA 5JZGC 4KH9A 1EPZA 2BWAA 3PLQA 5LBEA 2WAOA 2VAUA 1O8PA 4GKXA 1I6XA 5FPLA 4H7MA 5C9AA 1BCXA 2QBXA 1R082 3POIA 3RS6A 2P4EA 3I59A 4PLOA 1NXD1 1UPSA 4NE9A 2VJXA 2WLQA 3WDUA 2HWD2 1KRIA 2WNOA 1W2AX 3JCIA 1AR93 1JH5A 4Q0SA 3RYKA 4C0BA 1W9YA 4QX5A 4HVQA 4HBNA 2X29A 1IS6A 4QPYA 3DUIA 1UZZA 3KT1A 5EV7A 2YY1A 3I2IA 5FLJA 5FXWA 3TAYA 3FLPA 1H4HA 3VZMA 2QQIA 5BNPC 1F5JA 4XTMA 3KCXA 4JQTA 4JKKA 1ASJ2 4LK6A 2OT7A 4LKDA 3E97A 2R0FA 4MV2A 3VBUC 4XMAA 5I0UA 4XQ4A 4S2FA 4QPWA 5FZ8A 1AYM3 2I2SA 1HDKA 3WHUA 1UL9A 4AI1A 3AX4A 4K21A 1VBE3 2VMIA 4FAHA 2VBPA 4FQZA 4CDUC 2R062 5FPXA 1TQ5A 4CCEA 2XOMA 3VKFC 3ILNA 4DIQA 3AFKA 2CSGA 5F6LB 1WCKA 2WFPA 2P34A 2E33A 3A21A 4KNCA 4MGZE 5EWSA 4P9XA 3VBOB 4XFCA 1WW4A 3EMRA 4Z2WA 1RUI3 3ACIA 3IM0A 1WZXA 4JCKA 4RGKA 4CPBA 5FWJA 4LO6B 4KBBA 5D8AA 5HXVA 2Q1ZB 4FP2A 5LZ6A 3LIGA 3URFA 1VRBA 1ZRDA 2BYVE 5C3RA 1LNSA 1JYIA 5HI0A 4N7IA 2B8MA 4ARXA 1JU3A 5F3IA 5DUXA 1VP6A 1FNZA 1PGW1 4HPKA 2BOJA 1DLCA 4DXZA 3ZFEB 1SFPA 2RS51 4N9IA 2FD8A 4HG6B 3AK0A 4JGYA 2C6SA 4QT6A 4V1PA 2PHLA 2Q0AA 2WT2A 3AYAA 1XYOA 4HONA 3H3UA 4JRLA 1VRH1 4RYDA 1NY71 3ZXKA 5LA1A 2W92A 2R073 1XB9A 4A45A 3CF6E 1JYWA 4XYXA 1QJX1 4KGQA 2OIIA 4FI9A 3DYPA 4L11A 5LEKA 2RM23 2XKOA 4OZOA 1T6BX 3DKQA 4V2WA 3PUAA 4XJZA 4XJWA 3K77A 4XMIA 3UJOA 3ZO0B 2EICA 4YZ1A 3HWJA 1UO9A 4YYOA 3W5MA 5HXMA 3RGBA 2P6CA 1AJKA 4FPLA 4EROA 4A7ZA 5T54A 3H7JA 4JGZA 3NKGA 4QB1A 3ZYGA 3NAPC 3VBHA 5J37A 3WHTA 4FPHA 3KMHA 5JSRA 4IE7A 2P6HA 3LIHA 1FX5A 5K0UC 2DF7A 2Z69A 1JZ5A 5FXZA 5FXXA 5H9SA 1VAMA 2ATFA 2Y0OA 5T5LA 4WM7B 2Z2SB 2WN2A 4INDA 1OSGA 5T52A 2E7QA 4R9CA 3FHAA 4EZ4A 4Z8BA 4HOOA 1LOFC 1RITA 3WF4A 5IT6A 3O14A 1R1ZA 5GALA 1JMUB 5A7WB 2DV9A 4PQ9A 2ZGTA 5FZKA 2OYZA 1WCUA 4QHZA 5ANQA 5FJHA 3HMYA 3KT7A 3LOIA 3JQXA 3O1VA 1BK0A 4XPVA 3APBA 4RA0A 3WG2A 4PLNA 4XF4A 1BVP1 4AHYA 5KHIA 4S2DA 4JC1A 5I0SA 4NMIA 3J4UH 5FUNA 3LOBA 1S0GA 1OQ1A 1IG0A 3D5OA 1W6NB 1W05A 1NUKA 1QDCA 1XE7A 3WG3A 4AG4A 3A7QA 4GB31 4K7JA 3HQXA 1C8M1 1YRZA 2WFF2 5LASA 2CY6A 3ATGA 1K12A 1OMIA 3VN4A 1ZBA3 1AR81 1GKBA 3WW2A 1VIWB 2HWB2 2VC9A 3N9LA 4Q27A 4PI0A 3EO6A 5FY1A 3VBRB 2A6ZA 4NIHA 5BXXA 3R4UA 2A6WA 4QX8A 3LEKA 5IW0A 3RG0A 2BUKA 1S55A 2RV9A 2XR4A 4WBBA 4NIAA 1RINA 4RGGA 2ZEZA 4OI4A 3UYJA 4IE6A 1Q43A 4XAAA 3POFA 2NLRA 4LIVA 3VBOA 3I2HA 4MGSA 5GZEA 1G86A 1CAXB 2P1BA 2QDRA 4Y20B 5FZIA 4F83A 4DZGA 3PUSA 3MPPG 3ECQA 3ZFFB 1UY3A 1YFYA 4NR1A 2A1XA 2P5BA 4W6XA 5JR7B 2D44A 1UNBA 5JXGA 1UX7A 2JDUA 3SH3A 3W21A 2BU9A 3ON7A 5JOZA 5CA6A 5CNAA 2VOXA 4BOWA 1JUHA 5FZLA 4XE9A 2CV6A 5FYBA 1W8FA 3IBMA 3ZFEA 4XIOA 3WEZA 3HJRA 5FUIA 1UU5A 4L99A 2Y26A 3IIAA 4MXWB 1HN1A 1F4HA 2AC1A 3P5BA 5BNOB 4NAOA 4XF9A 4CXXA 1B35B 1MS1A 4IEZA 1OQEA 1PMHX 4Q0UA 1K5MB 1WMEA 1SBDA 2Q8CA 3FL7A 4S2GA 5FLIA 4QQLA 4FQ4A 1UZVA 2WDBA 1W9WA 2RS32 2VR4A 2IXCA 4AFDA 4GMP3 3O1RA 1UYYA 3PVEA 3QH6A 3T30A 5F37A 3J7HA 4QX1A 3LEMA 4IV3B 3TB0A 5C71A 1U5XA 2B46X 3OTFA 3RRDA 3AZYA 4NIDA 1W6OB 3MV01 3I2FA 4N43C 1LJ7A 2OUJA 4FFIA 1JYNA 5F3EA 1VAKA 3LEGA 3BN6A 2DUPA 4OHWA 5LATA 4ASKA 4CUCA 4QXBA 4UBGA 1YUDA 4QGLA 4DQAA 1XE0A 4YZ4A 3IT8A 5IVJA 4BH9A 1WMXA 1OFNA 2IVIB 1O4TA 3FC0A 3WOGA 1WCDJ 4YW4A 2NZ9A 1AR91 2B5HA 3B7MA 4Q4V3 3TRSB 1UF2C 3ZXFA 2BBAA 2EF6A 1DGWX 1YJKA 2RR13 5JVVA 5L9RA 1C5HA 1P8JA 4WM7A 4XC9A 2HYXA 1GSLA 1R1A2 4DUWA 4BISA 2DVDA 3KVAA 5DN2A 4LPLA 4RQPC 5FK8A 3CJIB 2K9ZA 2XHKA 1W2NA 3LE0A 1XNBA 5A7WA 3HNYM 1S0BA 4I09A 3U11A 3T08A 1DZRA 4FXKB 1DQ6A 1XOYA 1ZNPA 1H2LA 2VNVA 1Y3TA 2W95A 4IV1B 4YVSB 4CDWB 4X6QB 3WLUA 2FCTA 1H2NA 4LJHA 2AEYA 3M8LA 2JD4A 1AYM1 2VQTA 4D94A 2OPKA 4R9BA 1GNHA 1VBE1 2F17A 4BQ5A 5CKNA 4AQSA 5FPAA 1MS8A 1JZ6A 2IXJA 4KBZA 2X53S 4HT1T 4IGPA 4MGTA 2P2KA 3LDRA 5I8TA 3KQRA 2W1SA 3FHQA 3T0AA 3EQEA 1STMA 1PO23 1W6NA 5LY1A 1JOJA 3NNLA 2JB8A 1QJFA 1RUI1 1TME3 2CL2A 2XBO2 2ARBA 3AM2A 1OHFA 3WY6A 5EJ3A 4N53C 4WZFA 5E88A 1HW5A 2VOKA 3LA2A 4CU9A 4ITCA 4K3UA 4BK4A 2ZGQA 2VUDA 4JX0A 4L97A 1ALYA 3VBRA 4HL0A 2UYAA 4CDXC 4RR3B 3T2TA 4OFGA 2XWBB 1D7PM 1UAIA 2C9AA 3A4UA 3SH4A 3DCQA 1W9SA 5B2GB 5C9AC 4GALA 3CDZB 4N90A 5AVPA 3R4SA 4Y20A 1CAXA 2BWCA 2BZDA 4P00B 3HT2A 3LA7A 4HMZA 2KXLA 4BCUA 1QH6A 2R071 3S30A 1Z7S2 4BPZA 4CEYB 3ZFFA 4EWDA 2JWPA 1RUI2 1VPHA 3T1MA 1IGOA 3ZOIA 2KR2A 2RM21 4AEJA 1RUD2 5K8SA 1LHOA 4J6GA 1VE0A 5FR3A 4ZPIA 3N9PA 1EP0A 4LBQD 4OHXA 1G8WA 1HKDA 1W8HA 4XTPA 4MXWA 4BZ4A 4XBLA 1IQDC 5BNOA 5FWEA 1DG6A 3VL9A 1B35A 2WAAA 2E7AA 2WNVB 5FZAA 4LNVA 4KQ7A 1YO8A 4JHTA 1K5MA 1RUJ2 2VMCA 1DDLA 2X10A 5BUVA 4K8FA 1OOPB 2VGDA 3ZPOA 1SMVA 4AK3A 5J96B 1CJDA 3N7JA 2E51A 2FMYA 4JKMA 5A3TA 2K46A 1R093 4AFCA 5JMOA 2K2SA 1POQA 3FBYA 1BBT2 4IV3A 3GGLA 4OLLA 2B45X 4JRAA 2Z5WA 1W6OA 5D8AC 4KU8A 1SLBA 4W6YA 1RUG1 4XFHA 2GNTA 2X5IB 3CHXA 1YLLA 1XBFA 2BNNA 4QKNA 3THTA 1PVC3 3UK9A 2PYTA 3LKJA 2ADDA 1X33A 4OI2A 1F15A 2W39A 4NPMA 5FXVA 2DUQA 1W0PA 1OH3A 5FFOC 2ZOEB 2RVAA 2W5FA 1RUC3 2WIIB 1OUSA 4UYBA 3O1UA 1W3VA 2D7FA 2PLV3 5FZEA 2HWC2 2W9XA 2J1SA 3AL6A 3T09A 4CPBD 1HXS3 4Q4Y3 3CJIA 2LM3A 1O59A 2ZMKA 2QKDA 2VZ3A 2DCZA 1ZBA1 5JOXA 4IV1A 1SZBA 1OA3A 4YVSA 4AYUA 3UKNA 3I3QA 3BOPA 4CDWA 5F5QA 1NOVA 1OURA 1WA4A 1OPOA 3PMSA 2LW8A 2IXLA 5GJ6A 4LLOA 3ST7A 1LCLA 3WR0A 3KV4A 2NN8A 4I30A 3WVJA 1Y9QA 4N9HA 4IQPA 2JE8A 1E5SA 2VG9A 2XJSA 3W20A 1HB1A 2H6CA 2DUOA 3IN9A 4DNYA 2EIGA 3JD72 3QACA 2AENA 1PIV3 4SLIA 3VD7A 3WQBA 4Q0QA 3MHZA 3K4ZA 3VBHC 4KI5M 1N1YA 5IK7A 1ZZ9A 2ORXA 1D4M3 1GQGA 4C1WA 3MO4A 3O0VA 5M0TA 1FMD2 3ZIXA 3KSCA 3BIWE 1QIQA 5FYMA 1C3HA 4OCTA 4UFIA 3HN1A 3O1TA 1N47A 5T5PA 1ZBA2 4FP3A 5LBCA 5G05L 3B3QE 3J7LA 1JYXA 2I07B 2A70A 4RR3A 2BNMA 2DVGA 2J22A 5FZ7A 2YYOA 1HIXA 5FO8B 5BY5A 3CKHA 4KMQA 3IPVB 2ZCWA 5LB6A 2VUCA 3SCFA 3NQHA 5KR7A 2YV8A 2VZUA 4YGBA 5FZBA 2WYFA 4CEYA 4FTSA 4NOTA 3LWCA 2Y6KA 3M3CA 3LSDA 4YZ5A 1FI2A 1N1VA 1W8OA 5CBLA 2VTFA 4GMP1 5FY8A 1Q5OA 3RMYA 4Z2AA 1V9U2 3OBZA 3KF3A 4RD7A 5C3PA 4H14A 3UKTA 2J42A 4ATFA 4M0NA 2HWF3 3SCGA 3GNEA 4A3ZA 1JYVA 2OZJA 3CLPA 4WV8A 2CDOA 3ZSJA 4B7KA 4WVZA 4CUBA 2WNVA 2VULA 1RHI3 2AREA 1VBC2 3FHIB 3KGZA 4UW6A 4UAPA 3NKTA 1XE8A 2VPVA 1OOPA 2ZAHA 4RL7A 1O5UA 4QQ2A 1Z78A 4BYYA 5FZ6A 1LAJA 2A73B 4M3CB 2RR11 1LTEA 2ZMNA 4W65A 4ATEA 4YGDA 4GWIA 5FY4A 2BGOA 2ZGNA 3VBOC 1J3QA 4UFLA 1LENA 5FYIA 1H1IA 4CP9B 5E89A 1LGCA 2JX9A 4BQ3A 1IKQA 2XPJA 4YARA 4ZS3A 4XVHA 5EHDA 2CDPA 2X5IA 2XHNA 2J7MA 2Y6GA 4R9AA 4E8CA 3VZLA 4M01A 2D97A 1DGRN 1LR5A 2XQRA 3B94A 5CYYA 1G9BA 2HLEA 1GWLA 5E1RA 1X9PA 1QOSA 1CJPA 1N1TA 2BQPA 2EXJA 3ZFEC 4BQXA 1WGPA 1OLQA 5FY7A 3TEZA 1UY1A 5IVFA 1PO21 4Q4V2 5JSOA 3N9QA 2BGCA 1TME1 2RR12 4XCBA 5FBZA 3S5AA 1QNWA 2CGNA 5HV0A 1QOOA 5IAXA 2WS93 4B29A 3H9AA 4ZY9A 1QJX3 1C28A 1U12A 1GOFA 3JZVA 1PM7A 4A7YA 5F9TA 2YBSA 2XMLA 4EN0A 3KV6A 1OH4A 2VECA 3ZXAC 3G7DA 1ULOA 3A22A 2RMU2 4MXVA 2F6BA 4RGAA 1LOBA 4AFBA 1IPJA 2WO1A 3IDCB 1OLMA 1UZYA 4IUGA 2OPWA 1NCRB 1AYN3 2BDRA 1AF9A 3F95A 2B9UA 5A7PA 4AVVA 3V65A 1HB2A 2FDIA 3TEXA 3T2OA 1BLZA 4QKFA 4LBQB 2D6PA 2RG4A 3WUCA 1L7RA 2VMGA 4LORA 3IB3A 2JICA 1XPWA 3K48A 2VOVA 4A3XA 2BFUS 4AHXA 4QDSA 5JCTA 1TME2 2YG0A 2DVAA 2R16A 4LITA 2OQ7A 2JDKA 3NV4A 5LWBA 1R64A 5CIRA 5FZ4A 5K9YA 3J8F3 2Y8KA 5A1FA 1O3SA 1J3PA 2BVBA 3JXSA 1CX1A 1EY2A 3RVHA 2W1WA 3R6SA 4CCMA 2ZEYA 2WABA 4MOAA 2FBEA 2G1MA 4CSWA 2EVXA 1K45A 4DXSA 5J09A 1QEXA 2QCSB 3PUIA 4E27A 3IPVA 3V0BB 3VKMA 1PGL1 1XC6A 3ZFGC 4COZA 5ACA3 3GF6A 4BWOA 2NPIA 4IE0A 4XXAA 5FYUA 2GC1A 2B9VA 2R1DA 1R091 2PHXA 1OKOA 2IXKA 3DN7A 4GJYA 4PLMA 4BU2A 1PZ9A 1QJU3 4IEQA 1OT5A 1H1MA 2JKXA 1RC6A 4TXWA 2VZQA 4WVWA 1QXJA 1UQXA 4O7XA 5FBJA 4COVA 1AR83 1SDWA 1S4CA 4NIGA 4JQRA 4NO4A 1ZBE3 4MYEA 3L2HA 2JJ6A 2KA3A 4UBHA 4UT5A 3HBKA 1RUH3 1PVC1 1UYXA 3QCWA 4AEDB 4LHSA 3VBRC 2LALA 3GBGA 3OPWA 5T50A 1DYKA 3GBWA 3A23A 4FFFA 1I3HA 1RUC1 1H8VA 4AQTA 2ZZJA 2XONA 5JLVA 1O4ZA 4M3CA 4H55A 4GULA 2PLV1 1KS4A 3RI9A 5C3OA 1UMZA 3WDVA 3RZZA 4UF0B 1GZTA 2DCKA 3VUOA 2QNKA 3ZXEA 1HXS1 4Q4Y1 3ACGA 3DXUA 3K4AA 1N3PA 1LOCA 3LEIA 4P5YA 3WDWA 4CP9A 1RUF2 2A75A 2AH2A 3D0SA 2W46A 4PBOA 3RI8A 3ZFFC 4M4PA 1REDA 4QWNA 2A71A 3BCWA 2D5HA 4KG0A 1UMIA 1EV12 5LA2A 3V64A 2GP5A 4QX3A 2QQPA 3GCXA 5DAVA 4Q4W3 5C3QA 1NAEA 2BRTA 2LUWA 2ZGKA 3JBG3 4M3CE 4MLOA 1QJY2 1V00A 2P3KA 4QM9A 4A41A 3RSJA 1FOD2 1OUXA 1PIV1 2YMZA 3AYCA 3R4DB 4LLFA 2W68A 3IWZA 5BNOC 4PHZA 5JUVA 1B35C 2SLIA 1S0EA 2ZX3A 4I0WB 5FMDA 4BLIA 3PU3A 1K5MC 2HWE3 3P3NA 2PHWA 2Y38A 2QQVA 1HXS2 5I93A 2ENRA 3NVCA 5DZFA 1S2EA 2WRAA 4QX0A 2FDKA 3N9NA 5FK7A 1UZ0A 3OPTA 3RWNA 4IV3C 2VW2A 2YU2A 1C8NA 1KFXL 4Q4X2 3OD0A 1TMF3 1GYKA 1NCRA 1RUE3 3T1LA 1W9FA 4TZDA 1WW6A 3E6DA 2UWCA 3K46A 1O3TA 2ZAAA 4OMCA 4LBQA 2XJQA 4FPYA 1S2KA 1W06A 4ZXEA 3VHRA 3CL1A 3CO2A 4D69A 1UD1A 2WZR1 1A34A 1ZZBA 2XVLA 3AFGA 5EXOA 5FPZA 5GLUA 3RQ0A 3WP3A 5A7QA 1AL21 2ZEXA 4XIKA 2EXHA 4Q5OA 3I3EA 4CRQA 2VW1A 3PL0A 1D4M2 4URAA 1QOTA 2PHDA 4Z82A 4AFAA 2R6QA 4ZZ5A 4XDOA 3CJIC 2WO3A 4AQ2A 4YZ2A 2HWF1 1VBB2 3LDKA 3OSDA 1N3QA 2ZGUA 4BDVB 4ASMB 3SNMA 1HRI3 4COUA 4DFSA 4IV1C 4LBKA 5FOBB 2HEVF 5BNQA 5FYSA 5J1XA 3UNPA 3V0BA 1GFF2 1RHI1 3AJZA 3NJZA 5C8CB 1GZCA 4IETA 4CCCA 4YM2A 3WXPA 5FP8A 5GLTA 1S0CA 2ES3A 1X82A 4FOYA 3I7DA 3N4MA 1REFA 4PDWB 4HZFA 4W50A 1QJZA 2WZ8A 3C7FA 4XDQA 1WD4A 3LFIA 1IZ3A 3GBFA 1MR5A 3KCCA 1H8TC 4X6RB 3N36A 5CB7A 4OHYA 2HWF2 3D0JA 3Q8BA 5E16A 5ERLA 3ROUA 4AEDA 3WDTA 3M4FA 4FPJA 3GDBA 1ZA4A 4P9LA 5FMCA 5G04L 2UWAA 4BQ2A 1W99A 5IVEA 1NCQB 1GP6A 2ZHNA 3OBAA 3S57A 1UKRA 5DDJ3 1D0HA 4HXCA 4NVPA 3T3YA 5A7OA 2DBNA 1URXA 2DTWA 4UF0A 1UY2A 1J1TA 3SISA 3KHBA 2CHHA 1CWPA 1S1AA 3SCHA 4YG0A 2F4PA 2GMPA 2V4AA 2EALA 4Z07A 3TNQA 2GU9A 2WS91 4HKWA 3DKWA 2QJVA 1AVBA 1VMFA 1NA1B 2WQ8A 4BQYA 2RS13 3C2UA 3I4IA 3WINE 1V6IA 3B00A 4GD4A 1BZWA 1CPNA 5JXHA 3POBA 3LCPA 3MW4A 3NV3A 4LOTA 5FO7B 3UGGA 3EB7A 3ZIWA 4W6WA 1ENQA 1OD5A 2Q1MA 2QQJA 5KHHA 4CA9A 1BQPA 2VZTA 1AYN1 1D0GA 1IS3A 2OS2A 2VD7A 3I97A 5FREA 1PGW2 4LBJA 2GC0A 3QOPA 3OF1A 4AI3A 4OZXA 2FDGA 2RS52 2UURA 2PXJA 2H0BA 2YB7A 4NJ4A 1H4GA 1QGLA 1OOPC 3IDBB 1X9TA 4XUPA 1UCXA 4ZU7A 4EN7B 2QQMA 1VRH2 5F8PA 1NY72 2E53A 2WS92 4IEXA 4LK7A 1DLLA 2ZGMA 2EAKA 2WKKA 4QHOA 2WZPP 1QJX2 3J8F1 3PNAA 3VDAA 2GNMA 1SFNA 1GQPA 4YVWB 1ULGA 2D6OX 4QM8A 1ND3B 2BTVC 2GMEA 2WJSA 1RUG3 3B9IA 4I02A 4FOQA 1V6MA 2X5IC 4KWLA 3CEWA 3MIBA 4D8MA 4YNIA 2EIBA 1QQP3 1GP5A 3DF0A 3WW3A 1LULA 3R0RA 4IERA 3VD4A 3H1WA 5ACA1 1W8WA 5CFCB 1YFWA 2ZACA 4JAAA 3OEBA 1C1LA 3M3OA 5FMBA 3KM5A 1DF0A 2QQOA 3VDBA 5K4LA 4LBMA 2EA7A 4D7YA 4Y1VA 1QJU1 1RVF3 4IGOA 1POV3 2ZKNA 3RZGA 4UW4A 4V2VA 4XQDA 4Y33A 2YBKA 3H8UA 3LB9A 2IWGB 1C5IA 5LK5A 1UKGA 3J8F2 1OC1A 2NM1A 5T55A 1HQLA 5IJRA 5C5UA 1WMFA 2RJLA 4Y1XA 2YGLA 3L9JT 1ZBE1 1REEA 1H30A 5CZKA 3H50A 3FJSA 4U2AA 1RUH1 4PIYA 4MHRA 5C8CA 1AUYA 1XQNA 3WNXA 4XZPA 1J1LA 3D8CA 2VZPA 2E9QA 1W39A 3UGFA 4CCNA 5ACA2 1PO13 2HJIA 4XFAA 4A7KA 5JSPA 2BPA2 1WW7A 3SKVA 4DUVA 3Q8FA 3OPZA 1OFSA 5J7MA 1ULPA 4PDWA 3QLQA 4ORFA 4BIFA 4PF1A 2E31A 1YFUA 1F2NA 5GZDA 4JDMA 2X05A 4GWJA 5HCHA 2GP3A 4GB32 2GH2A 5FO9B 1C8M2 1UIJA 5JOWA 4JVAA 1CONA 1LHVA 3O7OA 4LO5B 1OD3A 4X8PA 2P17A 1AR82 2R1BA 4Q4W1 1D2QA 1HJGA 4EWEA 1VBD3 2YFUA 1C57A 1NCQA 3JBG1 3LPFA 3SC7X 4OMDA 4HSLA 3UGHA 2FCUA 4ZKTB 3AP7A 2ZA9A 5CAZA 1A8MA 2VU9A 5ABJC 3W5NA 1I5ZA 5SV5A 5A3UA 5CG9A 4EZHA 3P6BA 1IHMA 5FMOS 1CGPA 2HWE1 1NA1A 3T4HB 1VR3A 2ZABA 5K7PA 2WT1A 1ULCA 4QB2A 5A6QA 2OW4A 2HEYF 5GLZA 1GUIA 2IUWA 1JOPA 3HIFA 1NKGA 4I0BA 4IEOA 4QPGB 3VGIA 1GOGA 4YGCA 4E2QA 4J1XA 3KV9A 4L9BA 4CZSA 3VHPA 1TMF1 5BNNB 1RUE1 4P9GA 1O7FA 4FBFA 1PX3A 1OA2A 5H9RA 3JBG2 2J1VA 3WP5A 4AAPA 3AKQA 2CWSA 1YIFA 2JDZA 1FYUA 2JENA 3NV2A 3I2GA 3MDPA 4UW5A 5F6KA 5FZHA 1B09A 2AR6A 5A33B 4QQPA 5A3PA 2ZXQA 4XEZA 5FZMA 3RJRA 2C1FA 4BXSV 3AZVA 1XXNA 1PHMA 1COV3 1S0IA 1YQ5A 3ZN6B 3O1PA 2HWE2 4OQ9A 4KGGA 2JE7A 3M70A 5JZGB 4MADA 4CUAA 4YVWA 3U14A 4QMAA 2WNUC 3QD6A 3O1MA 1ND3A 1YNAA 1RTVA 2ID4A 2E26A 5F2SA 3AKRA 2GH8A 5AFEA 5C33A 1PMJX 1HRI1 2YC2A 3AMHA 3BPSA 4GIQA 3O12A 1JN2P 1UOJA 5CKMA 3AMNA 4AXOA 2AACA 2DTYA 1XNCA 1MZ6A 3RZHA 5CFCA 2BERA 2C5DA 4O9GA 3OEAA 4NHXA 3AP5A 3M1HA 1V6NA 2OVUA 3FWEA 5I0TA 2H0VA 3ZSEA 2WR9A 2ZGSA 1JU4A 4OI1A 1EUTA 1AR92 5FDBA 5KC5A 5LA0A 3NRUA 3E5UA 3GZTB 2VOTA 4ZHNA 5BNPB 4GMP0 2IFRA 3WNMA 4LBOA 1ZRRA 1OQDA 4Q29A 3CZJA 5IWFA 4BJ0A 5F39A 4NIIA 3NMBA 3ES1A 2MEV3 3DV8A 1S0JA 5J98B 4NRQA 1CAVB 3NNJA 5FP7A 1US2A 4PIXA 1GICA 4GH4B 2WA4A 5DDJ1 2ARAA 1V70A 3ZYHA 1AYM2 1NCRC 3THCA 2FZ2A 3H1YA 1VBE2 1GWKA 4J1WA 5FYZA 4E4DX 3PUHA 4OYUA 4IEYA 2RE9A 2V5YA 3M3IA 2VNOA 3VV1A 3HOBA 2PQQA 3OOXA 3MLJA 5T5JA 5I0RA 2CNAA 5IVCA 2E6VA 1PVXA 3OGJA 2QTWB 2A6VA 4IEWA 2RS11 3M3EA 1IQAA 2VXRA 5EJZB 4YM3A 5HCAA 4D6SA 4I2OA 4OI0A 1FATA 4MH0E 1QKQA 1BHGA 3VDDB 1W0OA 3HPNA 3WNLA 1VB4A 3AP9A 2IFWA 2XVKA 4FOVA 1JTZX 3WQ7A 1MVEA 4LEJA 3UL2A 3CNAA 1WBLA 3ZVXA 3WZ1A 3WNNA 4AQ6A 2YFZA 4DINB 1SACA 1OKQA 5FZOB 3U0ZA 5DDJ2 2DVBA 3VD3A 1YEWA 5JIUA 5C8WA 1WWYA 3GJBA 3LSEA 1G6NA 2LS6A 3GXUA 1AJOA 1SEFA 3H42B 5FMOL 2R49A 4HVOA 1ENRA 1LOAA 2GMMA 4AWDA 2R072 1A78A 3LD8A 1DGLA 3OGRA 4QPGA 4L0PA 2G19A 3BOWA 2RS12 5DUUA 1CAWB 3NJXA 5DAWA 4QX2A 2ZX4A 2RM22 2ZEWA 5FKCA 5BNNA 3POEA 3POYA 3I3MA 2BJSA 3NAPB 2J1RA 4QU2A 5DAQA 4EYUA 3ZKUA 4YM1A 1CVNA 1W2TA 4JTNA 4E4HA 1QQP1 4LUMA 1JZ7A 3WF1A 4AEDC 2GC2A 2O8OA 4AFMA 5K0UB 3B9CA 4DO0A 4LTAA 5A33A 4PJYA 4NRPA 1YFXA 4BE3A 1Q56A 1DHKB 4AI0A 1LEDA 4HK9A 2G4IA 2WO2A 4DY3A 2JB4A 3ZN6A 1BEV3 1JUIA 4JGYC 5EP9A 1RVF1 4A6OA 1POV1 3PJQA 5IYYA 5JZGA 3DPRB 4E4SA 3C7EA 2WBKA 1L7LA 2VTXA 1UMHA 3VLBB 1KD7A 1W28A 2TBVA 2XLGA 4JTOA 4ZU5A 2ZJCA 4B1LA 2BGPA 1N1SA 4HN0A 2YGMA 4RHV3 4XUQA 1AXYA 4AGVA 3EBRA 1O3QA 4PT6A 1DGWA 3GCWA 3ZYJB 1RUG2 5B4XA 1U5ZA 3KCYA 1DFQA 3KQ4B 2OX0A 1TE1B 3WSOA 4DOUA 5A3LA 1QQP2 1LEMA 3PJYA 4AL9A 1FV3A 2YZ4A 4F8AA 1PO11 1S0DA 3AMPA 3ZYIB 4XQWA 4JGZC 2PAEA 5I8YA 2R0HA 5AFBA 4AVCA 2V4VA 3C7GA 3MIDA 4XJ8A 2D40A 4XUNA 4RS5B 5KXBA 5F7UA 3MFCA 3JB4C 4CU8A 5BNPA 1ULDA 1LGNA 3PUQA 1XJAA 1ZZ6A 1HRV3 1UYPA 1ZVFA 4A42A 1YC61 2P37A 2B42B 5JIAA 4A6SA 5HBAA 1UZWA 4BLJA 4ET7A 3ALQA 1MS5A 3UESA 4XF1A 1XU2A 3WQ1A 4K20A 1W8ZA 4O65A 5C70A 1SLLA 1VBD1 1CAVA 3A0NA 2MHFA 2XDVA 1R083 3S5QA 1C4RA 4GH4A 2JDMA 1GR3A 4F3JA 1F31A 2JXAA 3BYWA 3H0OA 3SEEA 2X8KA 4OVEA 3MYXA 1IKPA 1VMJA 2A7AA 2HWD3 4O9EA 5FZFA 3MLKA 2JKBA 3GHNA 1CESA 1NLRA 1LOEA 5JI7A 1QXPA 3OYWB 1O4YA 1OLRA 2BEOA 2FCVA 2ZKLA 2PELA 2WZR3 5E6HA 1GWMA 5KXEA 1KS5A 1G7YA 2ORZA 3NW4A 1TG7A 5KC6A 1AL23 5FTTC 3AZZA 4FT8A 2GAUA 3LQCA 2BNOA 2Z42A 3K51A 2Q30A 3BGAA 2QQUA 5FP4A 3C7OA 5A3MA 4KG8A 1WLWA 3VDDA 4LMFA 2Z4FA 3SITA 5A7SA 1RMU1 4QDRA 4PF5A 2KM2A 3J7NA 1AR71 3F2ZA 1NZCA 3I3DA 3FUQA 3MBWA 3OB8A 5IFTA 1U5YA 4AW7A 5FZOA 1FPN1 1KDKA 3NJYA 2ZZQA 4RFT0 5FZ9A 4BMBA 1DIWA 1X36A 5AC93 2VM9A 4YG3A 4URTA 5C8CC 3GM8A 4K40A 4A2UA 4K1ZA 2P3YA 3C7HA 2C24A 1VB2A 2VMFA 3CQOA 4Y5SA 2VZVA 3N7MA 2QVSB 1COV1 3H7YA 5KBFA 3K3OA 4CEWB 4PDWC 5D21A 1RJ8A 1CAWA 1NLSA 1Q8SA 4B3NA 2VQAA 1G9AA 1UPIA 3ME2A 1W2UA 1MACA 2GN3A 2VNGA 3AL5A 4CDQB 2A3WA 2W1UA 4Z1VA 1HJFA 3NAPA 4HETA 4CCLA 1PZ7A 1ULFA 4QAWA 4CCDA 3DECA 3NSTA 2ZX0A 4XFGA 5L9BA 4E4ZA 2NQYA 4FAGA 3FX3A 1DQ1A 1JZ3A 5K0UA 3RZKA 3BODA 1MS0A 3KLSA 1NCQC 3E6BA 2VXJA 1O8SA 5TSWA 2ET1A 1F5FA 1JXNA 2ZS6B 3WG1A 5EJ1B 1RUNA 4XCAA 1DYOA 1CR7A 4NUBA 3B93A 2CU5A 1SPPB 3DPRA 4M3CF 1Q8PA 4NPLA 2A6XA 3H1MA 2C26A 1CQ9A 3ZYFA 1PK6B 1UYZA 4CTEA 3AC0A 1MZEA 1W8NA 2VCMA 1W8TA 4MZUA 4A44A 3K2OA 4C8DA 2WL1A 4IW3A 5CU1A 1MVQA 4QX7A 2MEV1 5C7GA 5JAXA 4OUSA 4TSVA 3HAGA 4Q0PA 1E57A 3BVCA 1NZIA 3ZR5A 1Q8QA 1VLNA 2FDJA 4Y1YA 3WUDA 1S2BA 4LHLA 1GP4A 1TEIA 3SQOA 1NQDA 4P5HA 4META 3FUOA 2BP6A 1LU1A 4I01A 4UFHA 5IUQA 4IDZA 1ZX5A 5EQUA 4GXLA 5F1RA 4RS5A 1V6KA 4AVSA 5IK4A 4COYA 1KFUL 1PNFA 2WYSA 3AZWA 5H9QA 5APAA 1BXHA 1PO22 4FPGA 2ZX2A 4P9WA 2WQZC 2V5DA 4PCRA 4DB5A 1YXWA 2VMEA 2JDNA 4YLZA 4EE2A 4QXHA 4LKEA 4WM7C 1OLME 3BB6A 4XF0A 1ZRIA 4YVWC 5L7OB 4KWUA 5BPXA 1ND3C 4LO7A 2WNEA 3T0BA 3M3QA 3BI3A 4UI9L 2VZRA 4MGKE 3NO8A 3AP6A 5DZEA 4MGIE 1UU6A 3FZ3A 1DBNA 1LHUA 4PIZA 3FN9A 1MEC3 1EAH3 2ZGRA 3KWVA 3OYWA 4NWWA 2VQUA 5FYVA 4NROA 5HPOA 5GZCA 2UY8A 5CFCC 3MGUA 1AX0A 5I91A 3JQWA 1BMV1 2JEMA 5A32B 1W9TA 4QHBA 4UFJA 3ENRA 1I9RA 2XJUA 3FFQA 4C0HA 3WCRA 4HLTA 3K75B 5ANNA 1UXZA 2RDSA 5B4NA 4P14A 2HWB3 1JHNA 2C0ZA 3OBTA 2VCAA 5BV6A 4OUMA 1RL3A 2DCTA 1Z0HA 1W6PB 3N9OA 3HNBM 4BXFA 1YQ2A 2OZ6A 4LE4A 1U5IA 4UFMA 2XL7A 1QXRA 2HEWF 4L2NA 4NPRA 4P08A 1CD3G 3EYPA 4QD2A 3N7KA 4JZRA 1V6OA 3RFRA 3U4XA 1FV2A 2VNRA 3MZHA 2PAKA 1PGL2 3NL1A 4CCJA 1BEV1 2W2IA 4XILA 4HK8A 2UY9A 1NE4A 4CU6A 3KD4A 5JPNB 1VBA1 4CEWA 1R092 1WLCA 2VO5A 4XURA 2L9LA 1A8DA 5FQ0B 1AZDA 3USSA 4BA6A 4OUEA 4RHV1 1OF4A 5EYYA 3ZDVA 1ACCA 1GV9A 2GN7A 2NYYA 4CDQA 5L73A 3GALA 2HH9A 2ZPXA 3AYEA 3GZUC 4UOJA 4XETA 1O5LA 3MW2A 2AUYA 2J1AA 5GKAC 4K9SA 4YGEA 3OGSA 2ZGLA 4CP2A 2A3XA 1J59A 1PVC2 4UWDA 3ZXGA 3KHCA 1DZTA 2HKXA 3P3PA 3ZMOA 2TEPA 5FLHA 2QQWA 3LF7A 1RUC2 3VB9A 2RS33 1SPPA 4CE8A 4DY5A 4XBNA 2XJVA 1WLDA 3U78A 2PLV2 4IE5A 2VCBA 3EJKA 2UYBA 2E63A 3SXWA 1PK6A 2VQ0A 3ELNA 1RXGA 4QKBA 1HRV1 2ET7A 4Y3OA 1IPSA 4Q4Y2 3ACFA 3MW3A 4ISRA 3VHNA 4CUGA 3DGTA 3VD9A 1KQRA 3WNOA 4D3WA 2JDHA 1UXXX 4QPGC 1HV0A 1SQ4A 4EN8B 5FYTA 1R081 3HVDA 2PN5A 4EN9B 4Z92B 4G3YC 4BB3A 4HN1A 3CU7A 1CZTA 2DFBA 1V6JA 3PVBB 5BNNC 5LK7B 1G9DA 1DQ4A 3OD4A 2HWD1 1WUVA 3PMEA 5A6XA 3Q8EA 1WLTA 2Z79A 1VJ2A 2KD7A 1L3JA 4RFRB 3NNFA 5DAPA 4EWAA 5C4WB 3N3HA 3I3BA 2ZGOA 1PIV2 1R1A3 2D6LX 1LKNA 4LBNA 4H7LA 1AR63 2MPFA 1YQ6A 4R52A 1X8MA 5DQ0A 2BFUL 5FZ0A 1DQ5A 2GSYA 3AVRA 1KJRA 4CYDA 4KU7A 5FY5A 4P9IA 5KXCA 1ND2B 4YW2A 5L7OA 4AI8A 1JOBA 1YQCA 4JV4A 4OHZA 5IATA 1K42A 4XXPA 4U36A 4FPOB 2VCCA 2IVJA 3ZXJA 4HANA 4MHUA 2ERFA 1OBNA 2SBAA 3SEPA 4AHZA 3VBFB 2PA7A 4YVSC 2R061 4CDWC 2CGOA 2V73A 3TBDA 1UIKA 1ZZ7A 2J1EA 3OGGA 5LA9A 5AC91 4XW3A 1RIRA 4QPIB 3WDYA 4BQ4A 1PNGA 4B4RA 4R8HA 1UOGA 1JYCA 4UW3A 1UY0A 1Y7BA 2WZR2 2XBO3 1YQ8A 4YFWA 1A6CA 5FUPA 5A32A 1ZZ8A 3LPGA 3HN3A 3ITQA 3M7AA 1AL22 1WCQA 2DWRA 1SFYA 2VZ1A 5IHRA 2VH9A 5LW9A 3PURA 3OGVA 2DURA 2YC4A 3MIFA 1TVGA 3PHMA 4QQHA 3TWIA 1Q8VA 1W6PA 1GZWB 5GLWA 1CIWA 4I0AA 1LOGA 2VW0A 5JMCA 1DGRA 4B4PA 1MPXA 2P3IA 1QF3A 3WG4A 2YROA 3E5QA 4B1MA 3MUZ1 3C3VA 5EZWA 4MO3M 1JZ8A 4GH4C 1ST8A 4RR3C 4MGQA 3I8TA 5I8SA 1RHI2 5AC92 4FOWA 3ETQA 4LT5A 2NMOA 1Z7S3 3I49A 3WQ0A 4IL7A 4GKYA 3WW4A 3W9AA 5FOJB 2W0XA 5IFPA 3ILRA 1KITA 2A5ZA 1RUD3 5FQ0A 2Y6HA 2VZSA 4CEYC 2V09A 1Y43B 3E5XA 3UT0A 1EPWA 3ORJA 3R05A 2N7GA 5C6CA 3UV9A 4FXGB 3VDDC 1MQTB 1X50A 5FAXA 3VKOA 3U4SA 1ODNA 3B5LB 3ILFA 1O91A 4E2SA 2IXIA 1UU4A 1RUJ3 1X8EA 5AVAA 3I2OA 3IAQA 4XDPA 4BHPA 2JIJA 4D7TA 3VDCA 1A3KA 1SHWB 2WNVC 5JWPA 1NG0A 2QQNA 4AZZA 3U1XA 3B02A 4EV0A 1M4WA 1SLIA 2JG8B 3ZYRA 3O1SA 2R32A 3POWA 1BBT3 3POSA 3T0DA 4RN5A 1KEXA 3EXUA 4BIOA 3MICA 3VZKA 1GOHA 3ZN4A 2VMDA 4HFSA 4E2GA 2VY0A 1XYNA 3IMMA 1UWWA 4P02B 4Y5Z0 2YUEA 3H8RA 3HQUA 3ZYPA 2WWJA 3VBSB 1FXZA 1W90A 4GJZA 3WNKA 3BALA 1Y9MA 5HV4A 1MEC1 1EAH1 1AYN2 5C4WA 1HN0A 1ZM1A 2XB6C 2FHRA 3BTXA 2Y6FA 3OJBA 2HWC3 3U75A 2QE3A 4LR4A 4COWA 1Q8OA 4JDNA 1QNYA 2WFF1 3VKNA 2D3PA 4XUTA 2B4KA 5F5AA 2OXBA 3VD5A 2XLFA
chains in the Genus database with same CATH topology
1XSRA 2BDRA 1XSQA 1YQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSR A;  2BDR A;  1XSQ A;  1YQC A; 
#chains in the Genus database with same CATH topology
 1BJQ A;  3DPR C;  1ND2 A;  5A1L A;  1TNR A;  2HWB 1;  2O1Q A;  4LA3 A;  4N7U A;  3TEY A;  5DG2 A;  4GZ9 A;  2ARX A;  2R04 3;  2XLA A;  1SLC A;  3INA A;  3KV5 A;  1BVV A;  3L2Y A;  1OVP A;  2JG9 B;  1O3R A;  3MEP A;  5DG1 A;  2YPD A;  1Y4W A;  5D1I A;  2O0O A;  3VBF A;  4YW1 A;  2GC3 A;  2B39 A;  3BU7 A;  2WWS A;  4HSJ A;  3ZFG B;  1YI9 A;  2PAM A;  4GQ7 A;  3JD7 3;  4M4R A;  2OKX A;  3ZKY A;  5FKB A;  2HBT A;  2CTV A;  1LEC A;  4ONU A;  4QPI A;  4Q1R A;  1MEC 2;  2XXZ A;  5F32 A;  1EAH 2;  3ZSK A;  1XNK A;  4NHM A;  4K8R B;  1W04 A;  1F35 A;  1MZF A;  3MIG A;  3VHO A;  3ZYB A;  3POJ A;  5LEJ A;  5CEH A;  1FMD 3;  4Q2F A;  3PVO A;  2DCJ A;  4BQW A;  4WM8 B;  3ZSL A;  2PTM A;  4Q0V A;  4RS5 C;  1UN1 A;  3BKZ A;  2PHF A;  2ARC A;  4IES A;  4XFF A;  3JB8 A;  3WF3 A;  1QJU 2;  4IEU A;  4FPK A;  4JHZ A;  1BYH A;  1Y9G A;  1GZW A;  3MI8 A;  5HCB A;  3BU0 A;  1PGS A;  3GJA A;  2FDH A;  4YRD A;  1UW8 A;  4TWT A;  3FE5 A;  4YPJ A;  1MS4 A;  5DXD A;  3QBQ A;  1SLT A;  2GNB A;  2ZX1 A;  3CIH A;  3CJX A;  4MG2 A;  2W52 A;  1ZBE 2;  1M06 G;  4LO4 B;  1MS3 A;  5L19 A;  1TNF A;  2VBD A;  1SBE A;  1RUH 2;  3AVS A;  5EFU A;  3RWK X;  1GZ9 A;  1FT9 A;  1ZA7 A;  2WUH A;  4AAX A;  4GA9 A;  3NWK A;  4C91 A;  1YYN A;  2DDU A;  2WWU A;  4XJU A;  2FMD A;  4E9K A;  5GM0 A;  3P1I A;  4WVV A;  5LRR A;  2RS3 1;  4S2H A;  1QDO A;  2HBU A;  4UXA A;  3VZJ A;  4F7Z A;  3T2Q A;  3NV1 A;  3WCS A;  1AX2 A;  1POV 0;  1V9U 3;  3VL8 A;  4AVT A;  4XAB A;  1CZV A;  3LFM A;  1MS9 A;  3MIH A;  3PIJ A;  4AVA A;  2ZGP A;  1Q3E A;  3H3Z A;  1UOB A;  5L36 A;  3B69 A;  2W47 A;  1QH7 A;  1NQJ A;  5FJK A;  5GZF A;  3MUY 1;  5H9P A;  3RNS A;  1MQT A;  3WDX A;  2D5F A;  1RMU 3;  3DYO A;  3IDE A;  4LBL A;  2LTN A;  2JDY A;  4MX3 A;  4QXC A;  3SH5 A;  5FYC A;  1VBC 3;  4AI2 A;  1LGB A;  1AR7 3;  3FBM A;  2QZ3 A;  4LXL A;  3HQR A;  1NE6 A;  4Q4W 2;  4QXK A;  4DRR A;  2I74 A;  5JOY A;  1FPN 3;  1QHD A;  2B7Y A;  4XOG A;  5CAD A;  2Y60 A;  1ONA A;  4XJ9 A;  1R1A 1;  3PU8 A;  2JG8 A;  4NHY A;  4M0H A;  1JOD A;  4Q8K A;  3CZU A;  4KWK A;  2WQ4 A;  5DUW A;  3S7I A;  1AR6 1;  3KGL A;  1ZZC A;  1XSQ A;  1RUO A;  3CMG A;  3MLL A;  1LES A;  1HLC A;  2DVF A;  2MNG A;  4FO9 A;  2VE1 A;  4GWM A;  4N8M A;  1MZ5 A;  5F5I A;  5CFD B;  1H2M A;  4YW3 A;  5L9V A;  1H2K A;  4CEW C;  1W2O A;  3ZSM A;  2RDN A;  3IDA A;  1JI6 A;  4R4Z A;  4W8J A;  3ZXL A;  4NWV A;  5IK5 A;  1XSR A;  2A3Y A;  5CIS A;  1F9K A;  3JU9 A;  2VL4 A;  2YPJ A;  4CDQ C;  2TUN A;  3VBS A;  1GMM A;  4SBV A;  3RZM A;  5JDB A;  1G9F A;  2X09 A;  1E5R A;  4FTE A;  5A3O A;  1TMF 2;  2ZBJ A;  1RUE 2;  4OUL A;  1KDM A;  1YCI A;  2Q5T A;  4DPN A;  1IS5 A;  4Y4R A;  3RZL A;  4XFI A;  1U0A A;  2VVD A;  3T2P A;  5DMY A;  1NYW A;  3LZZ A;  4IEV A;  2XBO 1;  3RYR A;  5FY0 A;  2Y6J A;  4FFH A;  1NXM A;  1AR6 2;  4K1Y A;  3ZMN A;  5FZC A;  3WX5 A;  5JI9 A;  4YSF A;  3MPB A;  4M00 A;  2DYC A;  2RMU 3;  1ODM A;  1PK6 C;  3PVN A;  1AXZ A;  4TYS A;  4XAE A;  3VBU B;  2PMW B;  3V0A B;  1E5H A;  2WN3 A;  3BTA A;  2JG9 A;  4YM0 A;  1H1A A;  4TLG A;  3USU B;  3V56 A;  5FP3 A;  5SV8 A;  2QDN A;  2G9F A;  3ZFG A;  2LRO A;  4LKS A;  3AYD A;  2PHR A;  3LAG A;  1HRI 2;  4XBQ A;  5F2W A;  1SBF A;  3A0K A;  4QDQ A;  4CDU B;  2CAU A;  3HBZ A;  3HEI A;  3QH7 A;  4NHL A;  3CBN A;  3W58 A;  3DYM A;  1QWR A;  1K3I A;  1Z7S 1;  2V72 A;  5A70 A;  3SMH A;  3WT3 A;  2D3R A;  2OA2 A;  4CU7 A;  3KZ4 C;  5HCF A;  4EN6 B;  4WM8 A;  4MUV A;  2E32 A;  4CCK A;  2Q1F A;  1H8T B;  2Q4S A;  1RUD 1;  4LIU A;  4ZON A;  5KWR A;  2CAV A;  4ZXK A;  2XJR A;  2Q8D A;  3U10 A;  3MFA A;  3TN9 3;  1ENS A;  3Q9O A;  1WW5 A;  1XU1 A;  4UFK A;  4TN7 A;  1RYY A;  5EPA A;  2ETE A;  5GLV A;  1CIY A;  5L7O C;  1V6L A;  1LRH A;  4LE3 A;  2JD9 A;  3D3A A;  1SLA A;  3K4D A;  1UY4 A;  4CP1 A;  1RUJ 1;  3RMX A;  5C5T A;  3O1O A;  2DBI A;  5E8A A;  2GND A;  2OQ6 A;  2VZO A;  3HNM A;  3RJ2 X;  3UJQ A;  5IK8 A;  1CAU B;  4QU1 A;  3IKW A;  3I2K A;  3U37 A;  2R7E B;  2VTX J;  2WSV A;  3HR9 A;  3ACH A;  3O0W A;  2JE9 A;  1BBT 1;  4GAZ A;  3E1F 1;  2W87 A;  1T2X A;  3KT4 A;  4W4Z A;  2BOI A;  1QY4 A;  4NHK A;  4E8D A;  5FIX A;  4YFZ A;  3OG2 A;  2Y6L A;  2QUO A;  1DU3 D;  4J25 A;  4CCO A;  4DMI A;  5FZG A;  2VVF A;  3RPQ A;  4XHB A;  3EHK A;  1K5J A;  3AP4 A;  2D6N A;  2RHP A;  1RJ7 A;  4PBP A;  1H9P A;  3SLI A;  4AGR A;  4ARY A;  2OUH A;  2VOW A;  2HWC 1;  2QQK A;  1YI7 A;  5JXI A;  2QZ2 A;  1PX4 A;  3ABZ A;  4QKD A;  2ZTN A;  4DXR A;  5DUV A;  2BV4 A;  1KXG A;  2JEC A;  4AE2 A;  3VZN A;  1RUF 3;  5CFD A;  5F5C A;  2WSU A;  1H6Y A;  2R30 A;  3O5S A;  1VBA 3;  2PFW A;  5DAX A;  2ZML A;  5FYH A;  5KHK A;  1DQ0 A;  1ZYB A;  2EXI A;  5CG8 A;  1EV1 3;  5I0D A;  4CXW A;  2R04 1;  5IVY A;  3J9S A;  1NX9 A;  4DS0 A;  1UX6 A;  4HVR A;  4AR2 A;  5EYX A;  4QGM A;  2DCY A;  1S0F A;  2Y34 A;  3GYD A;  4Q8L A;  5F3C A;  3H8O A;  2W1Q A;  4Y5T A;  1QJY 3;  3SKJ E;  4P9Y A;  3NNM A;  4FSJ A;  4LA2 A;  4XFB A;  4Y26 A;  3N7L A;  5T3N A;  2FZ1 A;  1N3O A;  1FOD 3;  2DU1 A;  3JD7 1;  2O8Q A;  3DXT A;  2O14 A;  3OY8 B;  1VAL A;  3G6J B;  3JUU A;  5J3U A;  3AKP A;  5F3G A;  2Q8E A;  4Y1Z A;  3WW1 A;  1F8V A;  2XWJ B;  2XKP A;  4YWA A;  4ES8 A;  2XVG A;  4O61 A;  1FMD 1;  3M2M A;  4XF3 A;  3BTZ A;  5EIY B;  3Q8A A;  3AMM A;  1RVF 2;  1C1F A;  5ISL A;  1TZO A;  3VBU A;  2ZHM A;  3V0A A;  2XUM A;  5A3W A;  3USU A;  2C9K A;  2WO7 A;  2CGP A;  4Q4X 3;  4YW5 A;  4A4A A;  4I3G A;  2R04 2;  2Y64 A;  2VUA A;  1HQW A;  3ZM8 A;  2AZ5 A;  3UET A;  1CZS A;  1NLQ A;  1SDD B;  3AZX A;  2XJT A;  3O0X A;  4QQO A;  2K0G A;  1W0N A;  3T4V A;  5FV3 A;  2XGX A;  4H3W A;  3WV6 A;  5KXD A;  5A80 A;  3W59 A;  3GZA A;  1HQN A;  2WZE A;  4LUK A;  3GZE A;  5JXJ A;  2NMN A;  3NNG A;  4AGG A;  5A1A A;  4LKF A;  1CPM A;  1WBF A;  1LB2 A;  2CWM A;  1DCS A;  4D6R A;  5C4W C;  2WT0 A;  1PO1 2;  4TLF A;  2JDP A;  1EYB A;  1GAN A;  5LCW L;  1H8T A;  4PI2 A;  1V9U 1;  3DL3 A;  3X29 B;  4MSV A;  1ZRF A;  2D6M A;  2DU0 A;  2P3J A;  3S6P A;  4MVT A;  4XAC A;  1W03 A;  1VBB 3;  4G9S B;  2QQL A;  3I54 A;  3NJV A;  4L8Q A;  5IAV A;  2XH6 A;  2JDA A;  1GNY A;  1XNT A;  1WKY A;  1ASJ 3;  1JBC A;  1ND2 C;  4GWN A;  1GBG A;  3PDQ A;  2D93 A;  1VBC 1;  3ZN5 A;  2GZW A;  1XRU A;  2EID A;  1HB3 A;  2YHJ A;  1VBD 2;  2YXS A;  2LRP A;  1W6Q B;  2RDQ A;  3D6E A;  5ABJ B;  4B4Q A;  3VBF C;  2R06 3;  4HKO A;  1W6M B;  4X8N A;  3VKL A;  3TEW A;  1CAU A;  3J7M A;  2AYH A;  3BIE A;  5J36 A;  1H6X A;  2VBB A;  3ZPY A;  1I1E A;  2HYK A;  2Y0I A;  3HT1 A;  2BW8 A;  1KJL A;  1DQ2 A;  1OI6 A;  1W3X A;  2G9G A;  1D2S A;  4QPI C;  4AOC A;  5LBF A;  4Y4Y A;  3TOJ A;  4AEM A;  1H0B A;  1OXC A;  2XJP A;  1US3 A;  3I2J A;  2TNF A;  5FP9 A;  5FZD A;  3S7E A;  1AX1 A;  1E5I A;  4MGY E;  2H6B A;  3MF9 A;  4RSU A;  2D3S A;  2A6Y A;  5DZG A;  4LHK A;  2W91 A;  4N43 B;  3B01 A;  4QGN A;  1WMD A;  1DP0 A;  1L7Q A;  3OBR A;  2AGS A;  1AL0 G;  2VUJ A;  1V0A A;  4YG6 A;  4AEK A;  1RMU 2;  2BBV A;  3U07 A;  3VZO A;  1AR7 2;  1EUU A;  2VVE A;  2ADE A;  4FPF A;  5FPV A;  5A6Y A;  3ETP A;  2GDF A;  3OUJ A;  2F4L A;  3OCP A;  4PQQ A;  1FPN 2;  4IEP A;  4Q4V 1;  3THD A;  1IG3 A;  3FMG A;  4LUL A;  2PHU A;  4HKL A;  1DYP A;  3LA3 A;  2I45 A;  1JZ4 A;  3KF5 A;  3RDI A;  1LOF A;  4RQP B;  2WNU B;  2WC2 A;  3ACL A;  5IVB A;  1OVS A;  1COV 2;  3WNP A;  4TTG A;  4B7E A;  3KVB A;  2RMU 1;  1APN A;  3N35 A;  3K3N A;  1NA1 C;  4WVM B;  2G9Z A;  5KHG A;  1DZQ A;  5BYN A;  4CXY A;  1OPM A;  1QMJ A;  2BVV A;  4Y22 B;  3OY8 A;  3S0M A;  3E6C C;  1MQT C;  1X7N A;  3PIG A;  1WCS A;  1AXK A;  4ASL A;  1JW6 A;  2RS5 3;  1LHW A;  3HD8 B;  2FDF A;  1IPK A;  3H3L A;  3IZO A;  4IXL A;  1VMH A;  1JS9 A;  4Q26 A;  1FAY A;  1VRH 3;  2EXK A;  4FPE A;  4Y1U A;  2D98 A;  4AHW A;  4N53 B;  3WD5 A;  2JG8 C;  1YJL A;  2JIG A;  3IAP A;  4XUO A;  3THP A;  1J84 A;  1ZRC A;  1LOD A;  2UWB A;  5DAB A;  3GHM A;  3N9M A;  3OUH A;  5D2A A;  2YC0 A;  3FFZ A;  3TN9 1;  1BK1 A;  1LU2 A;  1QU0 A;  3OUI A;  5DPN A;  2ILM A;  4EJR A;  1KGY A;  4ZZ8 A;  2PQS A;  5IVV A;  2GAL A;  2E7T A;  3TNP B;  4B8E A;  4CDX B;  4Q1P A;  1QJE A;  3ZLI A;  1J58 A;  4YZ3 A;  2W08 A;  1YHF A;  2NP0 A;  3D82 A;  3RZJ A;  5LRS A;  2MEV 2;  4JDO A;  5C9A B;  1SCR A;  3VBS C;  3BUC A;  3RYP A;  3I59 B;  1HB4 A;  4XJA A;  2Y33 A;  3MF6 A;  4FFG A;  3KS7 A;  4DXT A;  5A7N A;  1ENX A;  2IZW A;  1W8U A;  3WF2 A;  2CYF A;  3D4K A;  4OHV A;  3PTY A;  2ZHL A;  2J1U A;  4FPC A;  4NAM A;  2XL9 A;  4L92 A;  3ZR6 A;  2W3J A;  2WFF 3;  1XND A;  4LQR A;  4YW7 A;  1CX4 A;  3AKT A;  1SCS A;  4ZU4 A;  5FRA A;  4D0Q A;  1HX6 A;  4LOS A;  4NN0 A;  3BPZ A;  5FCC A;  4DRV A;  1O6U A;  3TN9 2;  1SG3 A;  1F4A A;  4AF9 A;  1BKZ A;  3DEM A;  4DEV A;  1D4V B;  1UOF A;  2JG9 C;  4YW6 A;  5ABJ A;  1W6Q A;  1JYT A;  1YIP A;  1W6M A;  2WIN B;  3AJY A;  3AKS A;  4JKL A;  3WP4 A;  2EIE A;  2WLP A;  3J26 N;  4DEQ A;  5FPU A;  4Y24 A;  2EAA A;  4CP0 A;  3ZDS A;  5JPM B;  4H2A A;  2DFC A;  5CVR A;  4ES9 A;  4G4F A;  5CKQ A;  4CVU A;  1NT0 A;  5A3N A;  1RUF 1;  2UU8 A;  4C90 A;  1GQH A;  4FTB A;  4K6B A;  1PMI A;  4XZU G;  1BMV 2;  2ZHK A;  4WM8 C;  4GB3 3;  1C8M 3;  3C8X A;  2YBP A;  3AXE A;  1EV1 1;  4FVV A;  4N43 A;  5D8A B;  2YDE A;  3LDB A;  1ZRE A;  1G9C A;  3ES4 A;  1WD3 A;  4AVB A;  4EQV A;  4R4X A;  5LBB A;  5FZ1 A;  3PTR B;  5T5O A;  1QJY 1;  5C3S A;  3LGR A;  3KB5 A;  4R9D A;  2WA3 A;  1FOD 1;  4HPK B;  5GZG A;  3BTY A;  3FLR A;  5FYY A;  1OA4 A;  4KWJ A;  3FLT A;  4LO8 A;  5JR2 A;  5J48 A;  4ZS2 A;  5FPB A;  1IOA A;  2XUE A;  4C1X A;  1JZ2 A;  4JGY B;  4KL1 A;  2XQX A;  3ZXD A;  4RQP A;  3SHR A;  1VAV A;  2AEZ A;  3H8X A;  1FNY A;  4QB6 A;  4BK5 A;  1J83 A;  2WNU A;  3ASI A;  4BM8 A;  2RDR A;  1BEV 2;  1PZ8 A;  1RXF A;  5FZ3 A;  1LHN A;  3IMN A;  3MV1 1;  2PHT A;  3ZX7 A;  3I2D A;  1VBA 2;  3AB0 A;  4IE4 A;  1GU3 A;  1YWK A;  4WVM A;  1PM4 A;  3WP6 A;  1GNZ A;  4P9J A;  1T6G C;  1WA6 X;  2J1T A;  3MIE A;  4I3P A;  4Q4X 1;  4NRM A;  3TYJ A;  4OQ8 A;  4WZC A;  2YU1 A;  1XYP A;  1XNA A;  4XHX A;  4RHV 2;  1HV1 A;  1OF3 A;  4Y22 A;  5FY9 A;  2QFE A;  3Q8C A;  4IGQ A;  2Q8O A;  1I5P A;  3AMQ A;  4CDU A;  2D43 A;  5KHJ A;  3UKV A;  1CN1 A;  1AHS A;  4ISQ A;  4JGZ B;  3AXD A;  2RJ2 A;  3VBH B;  1JHJ A;  3WF0 A;  4BME A;  2W94 A;  1RB8 G;  1H9W A;  1D4M 1;  1J3R A;  4BQ1 A;  4D6Q A;  1ULE A;  2IXH A;  3III A;  2VMH A;  4N53 A;  4LHN A;  4FCA A;  4AI9 A;  5A6Z A;  2C4X A;  1GLH A;  3POG A;  2XG3 A;  2D6K A;  1VBB 1;  2FQP A;  4DUX A;  2IC1 A;  5CFD C;  1IS4 A;  5LY2 A;  1RGS A;  4D7S A;  2RJK A;  1HRV 2;  1ASJ 1;  4CDX A;  5JZG C;  4KH9 A;  1EPZ A;  2BWA A;  3PLQ A;  5LBE A;  2WAO A;  2VAU A;  1O8P A;  4GKX A;  1I6X A;  5FPL A;  4H7M A;  5C9A A;  1BCX A;  2QBX A;  1R08 2;  3POI A;  3RS6 A;  2P4E A;  3I59 A;  4PLO A;  1NXD 1;  1UPS A;  4NE9 A;  2VJX A;  2WLQ A;  3WDU A;  2HWD 2;  1KRI A;  2WNO A;  1W2A X;  3JCI A;  1AR9 3;  1JH5 A;  4Q0S A;  3RYK A;  4C0B A;  1W9Y A;  4QX5 A;  4HVQ A;  4HBN A;  2X29 A;  1IS6 A;  4QPY A;  3DUI A;  1UZZ A;  3KT1 A;  5EV7 A;  2YY1 A;  3I2I A;  5FLJ A;  5FXW A;  3TAY A;  3FLP A;  1H4H A;  3VZM A;  2QQI A;  5BNP C;  1F5J A;  4XTM A;  3KCX A;  4JQT A;  4JKK A;  1ASJ 2;  4LK6 A;  2OT7 A;  4LKD A;  3E97 A;  2R0F A;  4MV2 A;  3VBU C;  4XMA A;  5I0U A;  4XQ4 A;  4S2F A;  4QPW A;  5FZ8 A;  1AYM 3;  2I2S A;  1HDK A;  3WHU A;  1UL9 A;  4AI1 A;  3AX4 A;  4K21 A;  1VBE 3;  2VMI A;  4FAH A;  2VBP A;  4FQZ A;  4CDU C;  2R06 2;  5FPX A;  1TQ5 A;  4CCE A;  2XOM A;  3VKF C;  3ILN A;  4DIQ A;  3AFK A;  2CSG A;  5F6L B;  1WCK A;  2WFP A;  2P34 A;  2E33 A;  3A21 A;  4KNC A;  4MGZ E;  5EWS A;  4P9X A;  3VBO B;  4XFC A;  1WW4 A;  3EMR A;  4Z2W A;  1RUI 3;  3ACI A;  3IM0 A;  1WZX A;  4JCK A;  4RGK A;  4CPB A;  5FWJ A;  4LO6 B;  4KBB A;  5D8A A;  5HXV A;  2Q1Z B;  4FP2 A;  5LZ6 A;  3LIG A;  3URF A;  1VRB A;  1ZRD A;  2BYV E;  5C3R A;  1LNS A;  1JYI A;  5HI0 A;  4N7I A;  2B8M A;  4ARX A;  1JU3 A;  5F3I A;  5DUX A;  1VP6 A;  1FNZ A;  1PGW 1;  4HPK A;  2BOJ A;  1DLC A;  4DXZ A;  3ZFE B;  1SFP A;  2RS5 1;  4N9I A;  2FD8 A;  4HG6 B;  3AK0 A;  4JGY A;  2C6S A;  4QT6 A;  4V1P A;  2PHL A;  2Q0A A;  2WT2 A;  3AYA A;  1XYO A;  4HON A;  3H3U A;  4JRL A;  1VRH 1;  4RYD A;  1NY7 1;  3ZXK A;  5LA1 A;  2W92 A;  2R07 3;  1XB9 A;  4A45 A;  3CF6 E;  1JYW A;  4XYX A;  1QJX 1;  4KGQ A;  2OII A;  4FI9 A;  3DYP A;  4L11 A;  5LEK A;  2RM2 3;  2XKO A;  4OZO A;  1T6B X;  3DKQ A;  4V2W A;  3PUA A;  4XJZ A;  4XJW A;  3K77 A;  4XMI A;  3UJO A;  3ZO0 B;  2EIC A;  4YZ1 A;  3HWJ A;  1UO9 A;  4YYO A;  3W5M A;  5HXM A;  3RGB A;  2P6C A;  1AJK A;  4FPL A;  4ERO A;  4A7Z A;  5T54 A;  3H7J A;  4JGZ A;  3NKG A;  4QB1 A;  3ZYG A;  3NAP C;  3VBH A;  5J37 A;  3WHT A;  4FPH A;  3KMH A;  5JSR A;  4IE7 A;  2P6H A;  3LIH A;  1FX5 A;  5K0U C;  2DF7 A;  2Z69 A;  1JZ5 A;  5FXZ A;  5FXX A;  5H9S A;  1VAM A;  2ATF A;  2Y0O A;  5T5L A;  4WM7 B;  2Z2S B;  2WN2 A;  4IND A;  1OSG A;  5T52 A;  2E7Q A;  4R9C A;  3FHA A;  4EZ4 A;  4Z8B A;  4HOO A;  1LOF C;  1RIT A;  3WF4 A;  5IT6 A;  3O14 A;  1R1Z A;  5GAL A;  1JMU B;  5A7W B;  2DV9 A;  4PQ9 A;  2ZGT A;  5FZK A;  2OYZ A;  1WCU A;  4QHZ A;  5ANQ A;  5FJH A;  3HMY A;  3KT7 A;  3LOI A;  3JQX A;  3O1V A;  1BK0 A;  4XPV A;  3APB A;  4RA0 A;  3WG2 A;  4PLN A;  4XF4 A;  1BVP 1;  4AHY A;  5KHI A;  4S2D A;  4JC1 A;  5I0S A;  4NMI A;  3J4U H;  5FUN A;  3LOB A;  1S0G A;  1OQ1 A;  1IG0 A;  3D5O A;  1W6N B;  1W05 A;  1NUK A;  1QDC A;  1XE7 A;  3WG3 A;  4AG4 A;  3A7Q A;  4GB3 1;  4K7J A;  3HQX A;  1C8M 1;  1YRZ A;  2WFF 2;  5LAS A;  2CY6 A;  3ATG A;  1K12 A;  1OMI A;  3VN4 A;  1ZBA 3;  1AR8 1;  1GKB A;  3WW2 A;  1VIW B;  2HWB 2;  2VC9 A;  3N9L A;  4Q27 A;  4PI0 A;  3EO6 A;  5FY1 A;  3VBR B;  2A6Z A;  4NIH A;  5BXX A;  3R4U A;  2A6W A;  4QX8 A;  3LEK A;  5IW0 A;  3RG0 A;  2BUK A;  1S55 A;  2RV9 A;  2XR4 A;  4WBB A;  4NIA A;  1RIN A;  4RGG A;  2ZEZ A;  4OI4 A;  3UYJ A;  4IE6 A;  1Q43 A;  4XAA A;  3POF A;  2NLR A;  4LIV A;  3VBO A;  3I2H A;  4MGS A;  5GZE A;  1G86 A;  1CAX B;  2P1B A;  2QDR A;  4Y20 B;  5FZI A;  4F83 A;  4DZG A;  3PUS A;  3MPP G;  3ECQ A;  3ZFF B;  1UY3 A;  1YFY A;  4NR1 A;  2A1X A;  2P5B A;  4W6X A;  5JR7 B;  2D44 A;  1UNB A;  5JXG A;  1UX7 A;  2JDU A;  3SH3 A;  3W21 A;  2BU9 A;  3ON7 A;  5JOZ A;  5CA6 A;  5CNA A;  2VOX A;  4BOW A;  1JUH A;  5FZL A;  4XE9 A;  2CV6 A;  5FYB A;  1W8F A;  3IBM A;  3ZFE A;  4XIO A;  3WEZ A;  3HJR A;  5FUI A;  1UU5 A;  4L99 A;  2Y26 A;  3IIA A;  4MXW B;  1HN1 A;  1F4H A;  2AC1 A;  3P5B A;  5BNO B;  4NAO A;  4XF9 A;  4CXX A;  1B35 B;  1MS1 A;  4IEZ A;  1OQE A;  1PMH X;  4Q0U A;  1K5M B;  1WME A;  1SBD A;  2Q8C A;  3FL7 A;  4S2G A;  5FLI A;  4QQL A;  4FQ4 A;  1UZV A;  2WDB A;  1W9W A;  2RS3 2;  2VR4 A;  2IXC A;  4AFD A;  4GMP 3;  3O1R A;  1UYY A;  3PVE A;  3QH6 A;  3T30 A;  5F37 A;  3J7H A;  4QX1 A;  3LEM A;  4IV3 B;  3TB0 A;  5C71 A;  1U5X A;  2B46 X;  3OTF A;  3RRD A;  3AZY A;  4NID A;  1W6O B;  3MV0 1;  3I2F A;  4N43 C;  1LJ7 A;  2OUJ A;  4FFI A;  1JYN A;  5F3E A;  1VAK A;  3LEG A;  3BN6 A;  2DUP A;  4OHW A;  5LAT A;  4ASK A;  4CUC A;  4QXB A;  4UBG A;  1YUD A;  4QGL A;  4DQA A;  1XE0 A;  4YZ4 A;  3IT8 A;  5IVJ A;  4BH9 A;  1WMX A;  1OFN A;  2IVI B;  1O4T A;  3FC0 A;  3WOG A;  1WCD J;  4YW4 A;  2NZ9 A;  1AR9 1;  2B5H A;  3B7M A;  4Q4V 3;  3TRS B;  1UF2 C;  3ZXF A;  2BBA A;  2EF6 A;  1DGW X;  1YJK A;  2RR1 3;  5JVV A;  5L9R A;  1C5H A;  1P8J A;  4WM7 A;  4XC9 A;  2HYX A;  1GSL A;  1R1A 2;  4DUW A;  4BIS A;  2DVD A;  3KVA A;  5DN2 A;  4LPL A;  4RQP C;  5FK8 A;  3CJI B;  2K9Z A;  2XHK A;  1W2N A;  3LE0 A;  1XNB A;  5A7W A;  3HNY M;  1S0B A;  4I09 A;  3U11 A;  3T08 A;  1DZR A;  4FXK B;  1DQ6 A;  1XOY A;  1ZNP A;  1H2L A;  2VNV A;  1Y3T A;  2W95 A;  4IV1 B;  4YVS B;  4CDW B;  4X6Q B;  3WLU A;  2FCT A;  1H2N A;  4LJH A;  2AEY A;  3M8L A;  2JD4 A;  1AYM 1;  2VQT A;  4D94 A;  2OPK A;  4R9B A;  1GNH A;  1VBE 1;  2F17 A;  4BQ5 A;  5CKN A;  4AQS A;  5FPA A;  1MS8 A;  1JZ6 A;  2IXJ A;  4KBZ A;  2X53 S;  4HT1 T;  4IGP A;  4MGT A;  2P2K A;  3LDR A;  5I8T A;  3KQR A;  2W1S A;  3FHQ A;  3T0A A;  3EQE A;  1STM A;  1PO2 3;  1W6N A;  5LY1 A;  1JOJ A;  3NNL A;  2JB8 A;  1QJF A;  1RUI 1;  1TME 3;  2CL2 A;  2XBO 2;  2ARB A;  3AM2 A;  1OHF A;  3WY6 A;  5EJ3 A;  4N53 C;  4WZF A;  5E88 A;  1HW5 A;  2VOK A;  3LA2 A;  4CU9 A;  4ITC A;  4K3U A;  4BK4 A;  2ZGQ A;  2VUD A;  4JX0 A;  4L97 A;  1ALY A;  3VBR A;  4HL0 A;  2UYA A;  4CDX C;  4RR3 B;  3T2T A;  4OFG A;  2XWB B;  1D7P M;  1UAI A;  2C9A A;  3A4U A;  3SH4 A;  3DCQ A;  1W9S A;  5B2G B;  5C9A C;  4GAL A;  3CDZ B;  4N90 A;  5AVP A;  3R4S A;  4Y20 A;  1CAX A;  2BWC A;  2BZD A;  4P00 B;  3HT2 A;  3LA7 A;  4HMZ A;  2KXL A;  4BCU A;  1QH6 A;  2R07 1;  3S30 A;  1Z7S 2;  4BPZ A;  4CEY B;  3ZFF A;  4EWD A;  2JWP A;  1RUI 2;  1VPH A;  3T1M A;  1IGO A;  3ZOI A;  2KR2 A;  2RM2 1;  4AEJ A;  1RUD 2;  5K8S A;  1LHO A;  4J6G A;  1VE0 A;  5FR3 A;  4ZPI A;  3N9P A;  1EP0 A;  4LBQ D;  4OHX A;  1G8W A;  1HKD A;  1W8H A;  4XTP A;  4MXW A;  4BZ4 A;  4XBL A;  1IQD C;  5BNO A;  5FWE A;  1DG6 A;  3VL9 A;  1B35 A;  2WAA A;  2E7A A;  2WNV B;  5FZA A;  4LNV A;  4KQ7 A;  1YO8 A;  4JHT A;  1K5M A;  1RUJ 2;  2VMC A;  1DDL A;  2X10 A;  5BUV A;  4K8F A;  1OOP B;  2VGD A;  3ZPO A;  1SMV A;  4AK3 A;  5J96 B;  1CJD A;  3N7J A;  2E51 A;  2FMY A;  4JKM A;  5A3T A;  2K46 A;  1R09 3;  4AFC A;  5JMO A;  2K2S A;  1POQ A;  3FBY A;  1BBT 2;  4IV3 A;  3GGL A;  4OLL A;  2B45 X;  4JRA A;  2Z5W A;  1W6O A;  5D8A C;  4KU8 A;  1SLB A;  4W6Y A;  1RUG 1;  4XFH A;  2GNT A;  2X5I B;  3CHX A;  1YLL A;  1XBF A;  2BNN A;  4QKN A;  3THT A;  1PVC 3;  3UK9 A;  2PYT A;  3LKJ A;  2ADD A;  1X33 A;  4OI2 A;  1F15 A;  2W39 A;  4NPM A;  5FXV A;  2DUQ A;  1W0P A;  1OH3 A;  5FFO C;  2ZOE B;  2RVA A;  2W5F A;  1RUC 3;  2WII B;  1OUS A;  4UYB A;  3O1U A;  1W3V A;  2D7F A;  2PLV 3;  5FZE A;  2HWC 2;  2W9X A;  2J1S A;  3AL6 A;  3T09 A;  4CPB D;  1HXS 3;  4Q4Y 3;  3CJI A;  2LM3 A;  1O59 A;  2ZMK A;  2QKD A;  2VZ3 A;  2DCZ A;  1ZBA 1;  5JOX A;  4IV1 A;  1SZB A;  1OA3 A;  4YVS A;  4AYU A;  3UKN A;  3I3Q A;  3BOP A;  4CDW A;  5F5Q A;  1NOV A;  1OUR A;  1WA4 A;  1OPO A;  3PMS A;  2LW8 A;  2IXL A;  5GJ6 A;  4LLO A;  3ST7 A;  1LCL A;  3WR0 A;  3KV4 A;  2NN8 A;  4I30 A;  3WVJ A;  1Y9Q A;  4N9H A;  4IQP A;  2JE8 A;  1E5S A;  2VG9 A;  2XJS A;  3W20 A;  1HB1 A;  2H6C A;  2DUO A;  3IN9 A;  4DNY A;  2EIG A;  3JD7 2;  3QAC A;  2AEN A;  1PIV 3;  4SLI A;  3VD7 A;  3WQB A;  4Q0Q A;  3MHZ A;  3K4Z A;  3VBH C;  4KI5 M;  1N1Y A;  5IK7 A;  1ZZ9 A;  2ORX A;  1D4M 3;  1GQG A;  4C1W A;  3MO4 A;  3O0V A;  5M0T A;  1FMD 2;  3ZIX A;  3KSC A;  3BIW E;  1QIQ A;  5FYM A;  1C3H A;  4OCT A;  4UFI A;  3HN1 A;  3O1T A;  1N47 A;  5T5P A;  1ZBA 2;  4FP3 A;  5LBC A;  5G05 L;  3B3Q E;  3J7L A;  1JYX A;  2I07 B;  2A70 A;  4RR3 A;  2BNM A;  2DVG A;  2J22 A;  5FZ7 A;  2YYO A;  1HIX A;  5FO8 B;  5BY5 A;  3CKH A;  4KMQ A;  3IPV B;  2ZCW A;  5LB6 A;  2VUC A;  3SCF A;  3NQH A;  5KR7 A;  2YV8 A;  2VZU A;  4YGB A;  5FZB A;  2WYF A;  4CEY A;  4FTS A;  4NOT A;  3LWC A;  2Y6K A;  3M3C A;  3LSD A;  4YZ5 A;  1FI2 A;  1N1V A;  1W8O A;  5CBL A;  2VTF A;  4GMP 1;  5FY8 A;  1Q5O A;  3RMY A;  4Z2A A;  1V9U 2;  3OBZ A;  3KF3 A;  4RD7 A;  5C3P A;  4H14 A;  3UKT A;  2J42 A;  4ATF A;  4M0N A;  2HWF 3;  3SCG A;  3GNE A;  4A3Z A;  1JYV A;  2OZJ A;  3CLP A;  4WV8 A;  2CDO A;  3ZSJ A;  4B7K A;  4WVZ A;  4CUB A;  2WNV A;  2VUL A;  1RHI 3;  2ARE A;  1VBC 2;  3FHI B;  3KGZ A;  4UW6 A;  4UAP A;  3NKT A;  1XE8 A;  2VPV A;  1OOP A;  2ZAH A;  4RL7 A;  1O5U A;  4QQ2 A;  1Z78 A;  4BYY A;  5FZ6 A;  1LAJ A;  2A73 B;  4M3C B;  2RR1 1;  1LTE A;  2ZMN A;  4W65 A;  4ATE A;  4YGD A;  4GWI A;  5FY4 A;  2BGO A;  2ZGN A;  3VBO C;  1J3Q A;  4UFL A;  1LEN A;  5FYI A;  1H1I A;  4CP9 B;  5E89 A;  1LGC A;  2JX9 A;  4BQ3 A;  1IKQ A;  2XPJ A;  4YAR A;  4ZS3 A;  4XVH A;  5EHD A;  2CDP A;  2X5I A;  2XHN A;  2J7M A;  2Y6G A;  4R9A A;  4E8C A;  3VZL A;  4M01 A;  2D97 A;  1DGR N;  1LR5 A;  2XQR A;  3B94 A;  5CYY A;  1G9B A;  2HLE A;  1GWL A;  5E1R A;  1X9P A;  1QOS A;  1CJP A;  1N1T A;  2BQP A;  2EXJ A;  3ZFE C;  4BQX A;  1WGP A;  1OLQ A;  5FY7 A;  3TEZ A;  1UY1 A;  5IVF A;  1PO2 1;  4Q4V 2;  5JSO A;  3N9Q A;  2BGC A;  1TME 1;  2RR1 2;  4XCB A;  5FBZ A;  3S5A A;  1QNW A;  2CGN A;  5HV0 A;  1QOO A;  5IAX A;  2WS9 3;  4B29 A;  3H9A A;  4ZY9 A;  1QJX 3;  1C28 A;  1U12 A;  1GOF A;  3JZV A;  1PM7 A;  4A7Y A;  5F9T A;  2YBS A;  2XML A;  4EN0 A;  3KV6 A;  1OH4 A;  2VEC A;  3ZXA C;  3G7D A;  1ULO A;  3A22 A;  2RMU 2;  4MXV A;  2F6B A;  4RGA A;  1LOB A;  4AFB A;  1IPJ A;  2WO1 A;  3IDC B;  1OLM A;  1UZY A;  4IUG A;  2OPW A;  1NCR B;  1AYN 3;  2BDR A;  1AF9 A;  3F95 A;  2B9U A;  5A7P A;  4AVV A;  3V65 A;  1HB2 A;  2FDI A;  3TEX A;  3T2O A;  1BLZ A;  4QKF A;  4LBQ B;  2D6P A;  2RG4 A;  3WUC A;  1L7R A;  2VMG A;  4LOR A;  3IB3 A;  2JIC A;  1XPW A;  3K48 A;  2VOV A;  4A3X A;  2BFU S;  4AHX A;  4QDS A;  5JCT A;  1TME 2;  2YG0 A;  2DVA A;  2R16 A;  4LIT A;  2OQ7 A;  2JDK A;  3NV4 A;  5LWB A;  1R64 A;  5CIR A;  5FZ4 A;  5K9Y A;  3J8F 3;  2Y8K A;  5A1F A;  1O3S A;  1J3P A;  2BVB A;  3JXS A;  1CX1 A;  1EY2 A;  3RVH A;  2W1W A;  3R6S A;  4CCM A;  2ZEY A;  2WAB A;  4MOA A;  2FBE A;  2G1M A;  4CSW A;  2EVX A;  1K45 A;  4DXS A;  5J09 A;  1QEX A;  2QCS B;  3PUI A;  4E27 A;  3IPV A;  3V0B B;  3VKM A;  1PGL 1;  1XC6 A;  3ZFG C;  4COZ A;  5ACA 3;  3GF6 A;  4BWO A;  2NPI A;  4IE0 A;  4XXA A;  5FYU A;  2GC1 A;  2B9V A;  2R1D A;  1R09 1;  2PHX A;  1OKO A;  2IXK A;  3DN7 A;  4GJY A;  4PLM A;  4BU2 A;  1PZ9 A;  1QJU 3;  4IEQ A;  1OT5 A;  1H1M A;  2JKX A;  1RC6 A;  4TXW A;  2VZQ A;  4WVW A;  1QXJ A;  1UQX A;  4O7X A;  5FBJ A;  4COV A;  1AR8 3;  1SDW A;  1S4C A;  4NIG A;  4JQR A;  4NO4 A;  1ZBE 3;  4MYE A;  3L2H A;  2JJ6 A;  2KA3 A;  4UBH A;  4UT5 A;  3HBK A;  1RUH 3;  1PVC 1;  1UYX A;  3QCW A;  4AED B;  4LHS A;  3VBR C;  2LAL A;  3GBG A;  3OPW A;  5T50 A;  1DYK A;  3GBW A;  3A23 A;  4FFF A;  1I3H A;  1RUC 1;  1H8V A;  4AQT A;  2ZZJ A;  2XON A;  5JLV A;  1O4Z A;  4M3C A;  4H55 A;  4GUL A;  2PLV 1;  1KS4 A;  3RI9 A;  5C3O A;  1UMZ A;  3WDV A;  3RZZ A;  4UF0 B;  1GZT A;  2DCK A;  3VUO A;  2QNK A;  3ZXE A;  1HXS 1;  4Q4Y 1;  3ACG A;  3DXU A;  3K4A A;  1N3P A;  1LOC A;  3LEI A;  4P5Y A;  3WDW A;  4CP9 A;  1RUF 2;  2A75 A;  2AH2 A;  3D0S A;  2W46 A;  4PBO A;  3RI8 A;  3ZFF C;  4M4P A;  1RED A;  4QWN A;  2A71 A;  3BCW A;  2D5H A;  4KG0 A;  1UMI A;  1EV1 2;  5LA2 A;  3V64 A;  2GP5 A;  4QX3 A;  2QQP A;  3GCX A;  5DAV A;  4Q4W 3;  5C3Q A;  1NAE A;  2BRT A;  2LUW A;  2ZGK A;  3JBG 3;  4M3C E;  4MLO A;  1QJY 2;  1V00 A;  2P3K A;  4QM9 A;  4A41 A;  3RSJ A;  1FOD 2;  1OUX A;  1PIV 1;  2YMZ A;  3AYC A;  3R4D B;  4LLF A;  2W68 A;  3IWZ A;  5BNO C;  4PHZ A;  5JUV A;  1B35 C;  2SLI A;  1S0E A;  2ZX3 A;  4I0W B;  5FMD A;  4BLI A;  3PU3 A;  1K5M C;  2HWE 3;  3P3N A;  2PHW A;  2Y38 A;  2QQV A;  1HXS 2;  5I93 A;  2ENR A;  3NVC A;  5DZF A;  1S2E A;  2WRA A;  4QX0 A;  2FDK A;  3N9N A;  5FK7 A;  1UZ0 A;  3OPT A;  3RWN A;  4IV3 C;  2VW2 A;  2YU2 A;  1C8N A;  1KFX L;  4Q4X 2;  3OD0 A;  1TMF 3;  1GYK A;  1NCR A;  1RUE 3;  3T1L A;  1W9F A;  4TZD A;  1WW6 A;  3E6D A;  2UWC A;  3K46 A;  1O3T A;  2ZAA A;  4OMC A;  4LBQ A;  2XJQ A;  4FPY A;  1S2K A;  1W06 A;  4ZXE A;  3VHR A;  3CL1 A;  3CO2 A;  4D69 A;  1UD1 A;  2WZR 1;  1A34 A;  1ZZB A;  2XVL A;  3AFG A;  5EXO A;  5FPZ A;  5GLU A;  3RQ0 A;  3WP3 A;  5A7Q A;  1AL2 1;  2ZEX A;  4XIK A;  2EXH A;  4Q5O A;  3I3E A;  4CRQ A;  2VW1 A;  3PL0 A;  1D4M 2;  4URA A;  1QOT A;  2PHD A;  4Z82 A;  4AFA A;  2R6Q A;  4ZZ5 A;  4XDO A;  3CJI C;  2WO3 A;  4AQ2 A;  4YZ2 A;  2HWF 1;  1VBB 2;  3LDK A;  3OSD A;  1N3Q A;  2ZGU A;  4BDV B;  4ASM B;  3SNM A;  1HRI 3;  4COU A;  4DFS A;  4IV1 C;  4LBK A;  5FOB B;  2HEV F;  5BNQ A;  5FYS A;  5J1X A;  3UNP A;  3V0B A;  1GFF 2;  1RHI 1;  3AJZ A;  3NJZ A;  5C8C B;  1GZC A;  4IET A;  4CCC A;  4YM2 A;  3WXP A;  5FP8 A;  5GLT A;  1S0C A;  2ES3 A;  1X82 A;  4FOY A;  3I7D A;  3N4M A;  1REF A;  4PDW B;  4HZF A;  4W50 A;  1QJZ A;  2WZ8 A;  3C7F A;  4XDQ A;  1WD4 A;  3LFI A;  1IZ3 A;  3GBF A;  1MR5 A;  3KCC A;  1H8T C;  4X6R B;  3N36 A;  5CB7 A;  4OHY A;  2HWF 2;  3D0J A;  3Q8B A;  5E16 A;  5ERL A;  3ROU A;  4AED A;  3WDT A;  3M4F A;  4FPJ A;  3GDB A;  1ZA4 A;  4P9L A;  5FMC A;  5G04 L;  2UWA A;  4BQ2 A;  1W99 A;  5IVE A;  1NCQ B;  1GP6 A;  2ZHN A;  3OBA A;  3S57 A;  1UKR A;  5DDJ 3;  1D0H A;  4HXC A;  4NVP A;  3T3Y A;  5A7O A;  2DBN A;  1URX A;  2DTW A;  4UF0 A;  1UY2 A;  1J1T A;  3SIS A;  3KHB A;  2CHH A;  1CWP A;  1S1A A;  3SCH A;  4YG0 A;  2F4P A;  2GMP A;  2V4A A;  2EAL A;  4Z07 A;  3TNQ A;  2GU9 A;  2WS9 1;  4HKW A;  3DKW A;  2QJV A;  1AVB A;  1VMF A;  1NA1 B;  2WQ8 A;  4BQY A;  2RS1 3;  3C2U A;  3I4I A;  3WIN E;  1V6I A;  3B00 A;  4GD4 A;  1BZW A;  1CPN A;  5JXH A;  3POB A;  3LCP A;  3MW4 A;  3NV3 A;  4LOT A;  5FO7 B;  3UGG A;  3EB7 A;  3ZIW A;  4W6W A;  1ENQ A;  1OD5 A;  2Q1M A;  2QQJ A;  5KHH A;  4CA9 A;  1BQP A;  2VZT A;  1AYN 1;  1D0G A;  1IS3 A;  2OS2 A;  2VD7 A;  3I97 A;  5FRE A;  1PGW 2;  4LBJ A;  2GC0 A;  3QOP A;  3OF1 A;  4AI3 A;  4OZX A;  2FDG A;  2RS5 2;  2UUR A;  2PXJ A;  2H0B A;  2YB7 A;  4NJ4 A;  1H4G A;  1QGL A;  1OOP C;  3IDB B;  1X9T A;  4XUP A;  1UCX A;  4ZU7 A;  4EN7 B;  2QQM A;  1VRH 2;  5F8P A;  1NY7 2;  2E53 A;  2WS9 2;  4IEX A;  4LK7 A;  1DLL A;  2ZGM A;  2EAK A;  2WKK A;  4QHO A;  2WZP P;  1QJX 2;  3J8F 1;  3PNA A;  3VDA A;  2GNM A;  1SFN A;  1GQP A;  4YVW B;  1ULG A;  2D6O X;  4QM8 A;  1ND3 B;  2BTV C;  2GME A;  2WJS A;  1RUG 3;  3B9I A;  4I02 A;  4FOQ A;  1V6M A;  2X5I C;  4KWL A;  3CEW A;  3MIB A;  4D8M A;  4YNI A;  2EIB A;  1QQP 3;  1GP5 A;  3DF0 A;  3WW3 A;  1LUL A;  3R0R A;  4IER A;  3VD4 A;  3H1W A;  5ACA 1;  1W8W A;  5CFC B;  1YFW A;  2ZAC A;  4JAA A;  3OEB A;  1C1L A;  3M3O A;  5FMB A;  3KM5 A;  1DF0 A;  2QQO A;  3VDB A;  5K4L A;  4LBM A;  2EA7 A;  4D7Y A;  4Y1V A;  1QJU 1;  1RVF 3;  4IGO A;  1POV 3;  2ZKN A;  3RZG A;  4UW4 A;  4V2V A;  4XQD A;  4Y33 A;  2YBK A;  3H8U A;  3LB9 A;  2IWG B;  1C5I A;  5LK5 A;  1UKG A;  3J8F 2;  1OC1 A;  2NM1 A;  5T55 A;  1HQL A;  5IJR A;  5C5U A;  1WMF A;  2RJL A;  4Y1X A;  2YGL A;  3L9J T;  1ZBE 1;  1REE A;  1H30 A;  5CZK A;  3H50 A;  3FJS A;  4U2A A;  1RUH 1;  4PIY A;  4MHR A;  5C8C A;  1AUY A;  1XQN A;  3WNX A;  4XZP A;  1J1L A;  3D8C A;  2VZP A;  2E9Q A;  1W39 A;  3UGF A;  4CCN A;  5ACA 2;  1PO1 3;  2HJI A;  4XFA A;  4A7K A;  5JSP A;  2BPA 2;  1WW7 A;  3SKV A;  4DUV A;  3Q8F A;  3OPZ A;  1OFS A;  5J7M A;  1ULP A;  4PDW A;  3QLQ A;  4ORF A;  4BIF A;  4PF1 A;  2E31 A;  1YFU A;  1F2N A;  5GZD A;  4JDM A;  2X05 A;  4GWJ A;  5HCH A;  2GP3 A;  4GB3 2;  2GH2 A;  5FO9 B;  1C8M 2;  1UIJ A;  5JOW A;  4JVA A;  1CON A;  1LHV A;  3O7O A;  4LO5 B;  1OD3 A;  4X8P A;  2P17 A;  1AR8 2;  2R1B A;  4Q4W 1;  1D2Q A;  1HJG A;  4EWE A;  1VBD 3;  2YFU A;  1C57 A;  1NCQ A;  3JBG 1;  3LPF A;  3SC7 X;  4OMD A;  4HSL A;  3UGH A;  2FCU A;  4ZKT B;  3AP7 A;  2ZA9 A;  5CAZ A;  1A8M A;  2VU9 A;  5ABJ C;  3W5N A;  1I5Z A;  5SV5 A;  5A3U A;  5CG9 A;  4EZH A;  3P6B A;  1IHM A;  5FMO S;  1CGP A;  2HWE 1;  1NA1 A;  3T4H B;  1VR3 A;  2ZAB A;  5K7P A;  2WT1 A;  1ULC A;  4QB2 A;  5A6Q A;  2OW4 A;  2HEY F;  5GLZ A;  1GUI A;  2IUW A;  1JOP A;  3HIF A;  1NKG A;  4I0B A;  4IEO A;  4QPG B;  3VGI A;  1GOG A;  4YGC A;  4E2Q A;  4J1X A;  3KV9 A;  4L9B A;  4CZS A;  3VHP A;  1TMF 1;  5BNN B;  1RUE 1;  4P9G A;  1O7F A;  4FBF A;  1PX3 A;  1OA2 A;  5H9R A;  3JBG 2;  2J1V A;  3WP5 A;  4AAP A;  3AKQ A;  2CWS A;  1YIF A;  2JDZ A;  1FYU A;  2JEN A;  3NV2 A;  3I2G A;  3MDP A;  4UW5 A;  5F6K A;  5FZH A;  1B09 A;  2AR6 A;  5A33 B;  4QQP A;  5A3P A;  2ZXQ A;  4XEZ A;  5FZM A;  3RJR A;  2C1F A;  4BXS V;  3AZV A;  1XXN A;  1PHM A;  1COV 3;  1S0I A;  1YQ5 A;  3ZN6 B;  3O1P A;  2HWE 2;  4OQ9 A;  4KGG A;  2JE7 A;  3M70 A;  5JZG B;  4MAD A;  4CUA A;  4YVW A;  3U14 A;  4QMA A;  2WNU C;  3QD6 A;  3O1M A;  1ND3 A;  1YNA A;  1RTV A;  2ID4 A;  2E26 A;  5F2S A;  3AKR A;  2GH8 A;  5AFE A;  5C33 A;  1PMJ X;  1HRI 1;  2YC2 A;  3AMH A;  3BPS A;  4GIQ A;  3O12 A;  1JN2 P;  1UOJ A;  5CKM A;  3AMN A;  4AXO A;  2AAC A;  2DTY A;  1XNC A;  1MZ6 A;  3RZH A;  5CFC A;  2BER A;  2C5D A;  4O9G A;  3OEA A;  4NHX A;  3AP5 A;  3M1H A;  1V6N A;  2OVU A;  3FWE A;  5I0T A;  2H0V A;  3ZSE A;  2WR9 A;  2ZGS A;  1JU4 A;  4OI1 A;  1EUT A;  1AR9 2;  5FDB A;  5KC5 A;  5LA0 A;  3NRU A;  3E5U A;  3GZT B;  2VOT A;  4ZHN A;  5BNP B;  4GMP 0;  2IFR A;  3WNM A;  4LBO A;  1ZRR A;  1OQD A;  4Q29 A;  3CZJ A;  5IWF A;  4BJ0 A;  5F39 A;  4NII A;  3NMB A;  3ES1 A;  2MEV 3;  3DV8 A;  1S0J A;  5J98 B;  4NRQ A;  1CAV B;  3NNJ A;  5FP7 A;  1US2 A;  4PIX A;  1GIC A;  4GH4 B;  2WA4 A;  5DDJ 1;  2ARA A;  1V70 A;  3ZYH A;  1AYM 2;  1NCR C;  3THC A;  2FZ2 A;  3H1Y A;  1VBE 2;  1GWK A;  4J1W A;  5FYZ A;  4E4D X;  3PUH A;  4OYU A;  4IEY A;  2RE9 A;  2V5Y A;  3M3I A;  2VNO A;  3VV1 A;  3HOB A;  2PQQ A;  3OOX A;  3MLJ A;  5T5J A;  5I0R A;  2CNA A;  5IVC A;  2E6V A;  1PVX A;  3OGJ A;  2QTW B;  2A6V A;  4IEW A;  2RS1 1;  3M3E A;  1IQA A;  2VXR A;  5EJZ B;  4YM3 A;  5HCA A;  4D6S A;  4I2O A;  4OI0 A;  1FAT A;  4MH0 E;  1QKQ A;  1BHG A;  3VDD B;  1W0O A;  3HPN A;  3WNL A;  1VB4 A;  3AP9 A;  2IFW A;  2XVK A;  4FOV A;  1JTZ X;  3WQ7 A;  1MVE A;  4LEJ A;  3UL2 A;  3CNA A;  1WBL A;  3ZVX A;  3WZ1 A;  3WNN A;  4AQ6 A;  2YFZ A;  4DIN B;  1SAC A;  1OKQ A;  5FZO B;  3U0Z A;  5DDJ 2;  2DVB A;  3VD3 A;  1YEW A;  5JIU A;  5C8W A;  1WWY A;  3GJB A;  3LSE A;  1G6N A;  2LS6 A;  3GXU A;  1AJO A;  1SEF A;  3H42 B;  5FMO L;  2R49 A;  4HVO A;  1ENR A;  1LOA A;  2GMM A;  4AWD A;  2R07 2;  1A78 A;  3LD8 A;  1DGL A;  3OGR A;  4QPG A;  4L0P A;  2G19 A;  3BOW A;  2RS1 2;  5DUU A;  1CAW B;  3NJX A;  5DAW A;  4QX2 A;  2ZX4 A;  2RM2 2;  2ZEW A;  5FKC A;  5BNN A;  3POE A;  3POY A;  3I3M A;  2BJS A;  3NAP B;  2J1R A;  4QU2 A;  5DAQ A;  4EYU A;  3ZKU A;  4YM1 A;  1CVN A;  1W2T A;  4JTN A;  4E4H A;  1QQP 1;  4LUM A;  1JZ7 A;  3WF1 A;  4AED C;  2GC2 A;  2O8O A;  4AFM A;  5K0U B;  3B9C A;  4DO0 A;  4LTA A;  5A33 A;  4PJY A;  4NRP A;  1YFX A;  4BE3 A;  1Q56 A;  1DHK B;  4AI0 A;  1LED A;  4HK9 A;  2G4I A;  2WO2 A;  4DY3 A;  2JB4 A;  3ZN6 A;  1BEV 3;  1JUI A;  4JGY C;  5EP9 A;  1RVF 1;  4A6O A;  1POV 1;  3PJQ A;  5IYY A;  5JZG A;  3DPR B;  4E4S A;  3C7E A;  2WBK A;  1L7L A;  2VTX A;  1UMH A;  3VLB B;  1KD7 A;  1W28 A;  2TBV A;  2XLG A;  4JTO A;  4ZU5 A;  2ZJC A;  4B1L A;  2BGP A;  1N1S A;  4HN0 A;  2YGM A;  4RHV 3;  4XUQ A;  1AXY A;  4AGV A;  3EBR A;  1O3Q A;  4PT6 A;  1DGW A;  3GCW A;  3ZYJ B;  1RUG 2;  5B4X A;  1U5Z A;  3KCY A;  1DFQ A;  3KQ4 B;  2OX0 A;  1TE1 B;  3WSO A;  4DOU A;  5A3L A;  1QQP 2;  1LEM A;  3PJY A;  4AL9 A;  1FV3 A;  2YZ4 A;  4F8A A;  1PO1 1;  1S0D A;  3AMP A;  3ZYI B;  4XQW A;  4JGZ C;  2PAE A;  5I8Y A;  2R0H A;  5AFB A;  4AVC A;  2V4V A;  3C7G A;  3MID A;  4XJ8 A;  2D40 A;  4XUN A;  4RS5 B;  5KXB A;  5F7U A;  3MFC A;  3JB4 C;  4CU8 A;  5BNP A;  1ULD A;  1LGN A;  3PUQ A;  1XJA A;  1ZZ6 A;  1HRV 3;  1UYP A;  1ZVF A;  4A42 A;  1YC6 1;  2P37 A;  2B42 B;  5JIA A;  4A6S A;  5HBA A;  1UZW A;  4BLJ A;  4ET7 A;  3ALQ A;  1MS5 A;  3UES A;  4XF1 A;  1XU2 A;  3WQ1 A;  4K20 A;  1W8Z A;  4O65 A;  5C70 A;  1SLL A;  1VBD 1;  1CAV A;  3A0N A;  2MHF A;  2XDV A;  1R08 3;  3S5Q A;  1C4R A;  4GH4 A;  2JDM A;  1GR3 A;  4F3J A;  1F31 A;  2JXA A;  3BYW A;  3H0O A;  3SEE A;  2X8K A;  4OVE A;  3MYX A;  1IKP A;  1VMJ A;  2A7A A;  2HWD 3;  4O9E A;  5FZF A;  3MLK A;  2JKB A;  3GHN A;  1CES A;  1NLR A;  1LOE A;  5JI7 A;  1QXP A;  3OYW B;  1O4Y A;  1OLR A;  2BEO A;  2FCV A;  2ZKL A;  2PEL A;  2WZR 3;  5E6H A;  1GWM A;  5KXE A;  1KS5 A;  1G7Y A;  2ORZ A;  3NW4 A;  1TG7 A;  5KC6 A;  1AL2 3;  5FTT C;  3AZZ A;  4FT8 A;  2GAU A;  3LQC A;  2BNO A;  2Z42 A;  3K51 A;  2Q30 A;  3BGA A;  2QQU A;  5FP4 A;  3C7O A;  5A3M A;  4KG8 A;  1WLW A;  3VDD A;  4LMF A;  2Z4F A;  3SIT A;  5A7S A;  1RMU 1;  4QDR A;  4PF5 A;  2KM2 A;  3J7N A;  1AR7 1;  3F2Z A;  1NZC A;  3I3D A;  3FUQ A;  3MBW A;  3OB8 A;  5IFT A;  1U5Y A;  4AW7 A;  5FZO A;  1FPN 1;  1KDK A;  3NJY A;  2ZZQ A;  4RFT 0;  5FZ9 A;  4BMB A;  1DIW A;  1X36 A;  5AC9 3;  2VM9 A;  4YG3 A;  4URT A;  5C8C C;  3GM8 A;  4K40 A;  4A2U A;  4K1Z A;  2P3Y A;  3C7H A;  2C24 A;  1VB2 A;  2VMF A;  3CQO A;  4Y5S A;  2VZV A;  3N7M A;  2QVS B;  1COV 1;  3H7Y A;  5KBF A;  3K3O A;  4CEW B;  4PDW C;  5D21 A;  1RJ8 A;  1CAW A;  1NLS A;  1Q8S A;  4B3N A;  2VQA A;  1G9A A;  1UPI A;  3ME2 A;  1W2U A;  1MAC A;  2GN3 A;  2VNG A;  3AL5 A;  4CDQ B;  2A3W A;  2W1U A;  4Z1V A;  1HJF A;  3NAP A;  4HET A;  4CCL A;  1PZ7 A;  1ULF A;  4QAW A;  4CCD A;  3DEC A;  3NST A;  2ZX0 A;  4XFG A;  5L9B A;  4E4Z A;  2NQY A;  4FAG A;  3FX3 A;  1DQ1 A;  1JZ3 A;  5K0U A;  3RZK A;  3BOD A;  1MS0 A;  3KLS A;  1NCQ C;  3E6B A;  2VXJ A;  1O8S A;  5TSW A;  2ET1 A;  1F5F A;  1JXN A;  2ZS6 B;  3WG1 A;  5EJ1 B;  1RUN A;  4XCA A;  1DYO A;  1CR7 A;  4NUB A;  3B93 A;  2CU5 A;  1SPP B;  3DPR A;  4M3C F;  1Q8P A;  4NPL A;  2A6X A;  3H1M A;  2C26 A;  1CQ9 A;  3ZYF A;  1PK6 B;  1UYZ A;  4CTE A;  3AC0 A;  1MZE A;  1W8N A;  2VCM A;  1W8T A;  4MZU A;  4A44 A;  3K2O A;  4C8D A;  2WL1 A;  4IW3 A;  5CU1 A;  1MVQ A;  4QX7 A;  2MEV 1;  5C7G A;  5JAX A;  4OUS A;  4TSV A;  3HAG A;  4Q0P A;  1E57 A;  3BVC A;  1NZI A;  3ZR5 A;  1Q8Q A;  1VLN A;  2FDJ A;  4Y1Y A;  3WUD A;  1S2B A;  4LHL A;  1GP4 A;  1TEI A;  3SQO A;  1NQD A;  4P5H A;  4MET A;  3FUO A;  2BP6 A;  1LU1 A;  4I01 A;  4UFH A;  5IUQ A;  4IDZ A;  1ZX5 A;  5EQU A;  4GXL A;  5F1R A;  4RS5 A;  1V6K A;  4AVS A;  5IK4 A;  4COY A;  1KFU L;  1PNF A;  2WYS A;  3AZW A;  5H9Q A;  5APA A;  1BXH A;  1PO2 2;  4FPG A;  2ZX2 A;  4P9W A;  2WQZ C;  2V5D A;  4PCR A;  4DB5 A;  1YXW A;  2VME A;  2JDN A;  4YLZ A;  4EE2 A;  4QXH A;  4LKE A;  4WM7 C;  1OLM E;  3BB6 A;  4XF0 A;  1ZRI A;  4YVW C;  5L7O B;  4KWU A;  5BPX A;  1ND3 C;  4LO7 A;  2WNE A;  3T0B A;  3M3Q A;  3BI3 A;  4UI9 L;  2VZR A;  4MGK E;  3NO8 A;  3AP6 A;  5DZE A;  4MGI E;  1UU6 A;  3FZ3 A;  1DBN A;  1LHU A;  4PIZ A;  3FN9 A;  1MEC 3;  1EAH 3;  2ZGR A;  3KWV A;  3OYW A;  4NWW A;  2VQU A;  5FYV A;  4NRO A;  5HPO A;  5GZC A;  2UY8 A;  5CFC C;  3MGU A;  1AX0 A;  5I91 A;  3JQW A;  1BMV 1;  2JEM A;  5A32 B;  1W9T A;  4QHB A;  4UFJ A;  3ENR A;  1I9R A;  2XJU A;  3FFQ A;  4C0H A;  3WCR A;  4HLT A;  3K75 B;  5ANN A;  1UXZ A;  2RDS A;  5B4N A;  4P14 A;  2HWB 3;  1JHN A;  2C0Z A;  3OBT A;  2VCA A;  5BV6 A;  4OUM A;  1RL3 A;  2DCT A;  1Z0H A;  1W6P B;  3N9O A;  3HNB M;  4BXF A;  1YQ2 A;  2OZ6 A;  4LE4 A;  1U5I A;  4UFM A;  2XL7 A;  1QXR A;  2HEW F;  4L2N A;  4NPR A;  4P08 A;  1CD3 G;  3EYP A;  4QD2 A;  3N7K A;  4JZR A;  1V6O A;  3RFR A;  3U4X A;  1FV2 A;  2VNR A;  3MZH A;  2PAK A;  1PGL 2;  3NL1 A;  4CCJ A;  1BEV 1;  2W2I A;  4XIL A;  4HK8 A;  2UY9 A;  1NE4 A;  4CU6 A;  3KD4 A;  5JPN B;  1VBA 1;  4CEW A;  1R09 2;  1WLC A;  2VO5 A;  4XUR A;  2L9L A;  1A8D A;  5FQ0 B;  1AZD A;  3USS A;  4BA6 A;  4OUE A;  4RHV 1;  1OF4 A;  5EYY A;  3ZDV A;  1ACC A;  1GV9 A;  2GN7 A;  2NYY A;  4CDQ A;  5L73 A;  3GAL A;  2HH9 A;  2ZPX A;  3AYE A;  3GZU C;  4UOJ A;  4XET A;  1O5L A;  3MW2 A;  2AUY A;  2J1A A;  5GKA C;  4K9S A;  4YGE A;  3OGS A;  2ZGL A;  4CP2 A;  2A3X A;  1J59 A;  1PVC 2;  4UWD A;  3ZXG A;  3KHC A;  1DZT A;  2HKX A;  3P3P A;  3ZMO A;  2TEP A;  5FLH A;  2QQW A;  3LF7 A;  1RUC 2;  3VB9 A;  2RS3 3;  1SPP A;  4CE8 A;  4DY5 A;  4XBN A;  2XJV A;  1WLD A;  3U78 A;  2PLV 2;  4IE5 A;  2VCB A;  3EJK A;  2UYB A;  2E63 A;  3SXW A;  1PK6 A;  2VQ0 A;  3ELN A;  1RXG A;  4QKB A;  1HRV 1;  2ET7 A;  4Y3O A;  1IPS A;  4Q4Y 2;  3ACF A;  3MW3 A;  4ISR A;  3VHN A;  4CUG A;  3DGT A;  3VD9 A;  1KQR A;  3WNO A;  4D3W A;  2JDH A;  1UXX X;  4QPG C;  1HV0 A;  1SQ4 A;  4EN8 B;  5FYT A;  1R08 1;  3HVD A;  2PN5 A;  4EN9 B;  4Z92 B;  4G3Y C;  4BB3 A;  4HN1 A;  3CU7 A;  1CZT A;  2DFB A;  1V6J A;  3PVB B;  5BNN C;  5LK7 B;  1G9D A;  1DQ4 A;  3OD4 A;  2HWD 1;  1WUV A;  3PME A;  5A6X A;  3Q8E A;  1WLT A;  2Z79 A;  1VJ2 A;  2KD7 A;  1L3J A;  4RFR B;  3NNF A;  5DAP A;  4EWA A;  5C4W B;  3N3H A;  3I3B A;  2ZGO A;  1PIV 2;  1R1A 3;  2D6L X;  1LKN A;  4LBN A;  4H7L A;  1AR6 3;  2MPF A;  1YQ6 A;  4R52 A;  1X8M A;  5DQ0 A;  2BFU L;  5FZ0 A;  1DQ5 A;  2GSY A;  3AVR A;  1KJR A;  4CYD A;  4KU7 A;  5FY5 A;  4P9I A;  5KXC A;  1ND2 B;  4YW2 A;  5L7O A;  4AI8 A;  1JOB A;  1YQC A;  4JV4 A;  4OHZ A;  5IAT A;  1K42 A;  4XXP A;  4U36 A;  4FPO B;  2VCC A;  2IVJ A;  3ZXJ A;  4HAN A;  4MHU A;  2ERF A;  1OBN A;  2SBA A;  3SEP A;  4AHZ A;  3VBF B;  2PA7 A;  4YVS C;  2R06 1;  4CDW C;  2CGO A;  2V73 A;  3TBD A;  1UIK A;  1ZZ7 A;  2J1E A;  3OGG A;  5LA9 A;  5AC9 1;  4XW3 A;  1RIR A;  4QPI B;  3WDY A;  4BQ4 A;  1PNG A;  4B4R A;  4R8H A;  1UOG A;  1JYC A;  4UW3 A;  1UY0 A;  1Y7B A;  2WZR 2;  2XBO 3;  1YQ8 A;  4YFW A;  1A6C A;  5FUP A;  5A32 A;  1ZZ8 A;  3LPG A;  3HN3 A;  3ITQ A;  3M7A A;  1AL2 2;  1WCQ A;  2DWR A;  1SFY A;  2VZ1 A;  5IHR A;  2VH9 A;  5LW9 A;  3PUR A;  3OGV A;  2DUR A;  2YC4 A;  3MIF A;  1TVG A;  3PHM A;  4QQH A;  3TWI A;  1Q8V A;  1W6P A;  1GZW B;  5GLW A;  1CIW A;  4I0A A;  1LOG A;  2VW0 A;  5JMC A;  1DGR A;  4B4P A;  1MPX A;  2P3I A;  1QF3 A;  3WG4 A;  2YRO A;  3E5Q A;  4B1M A;  3MUZ 1;  3C3V A;  5EZW A;  4MO3 M;  1JZ8 A;  4GH4 C;  1ST8 A;  4RR3 C;  4MGQ A;  3I8T A;  5I8S A;  1RHI 2;  5AC9 2;  4FOW A;  3ETQ A;  4LT5 A;  2NMO A;  1Z7S 3;  3I49 A;  3WQ0 A;  4IL7 A;  4GKY A;  3WW4 A;  3W9A A;  5FOJ B;  2W0X A;  5IFP A;  3ILR A;  1KIT A;  2A5Z A;  1RUD 3;  5FQ0 A;  2Y6H A;  2VZS A;  4CEY C;  2V09 A;  1Y43 B;  3E5X A;  3UT0 A;  1EPW A;  3ORJ A;  3R05 A;  2N7G A;  5C6C A;  3UV9 A;  4FXG B;  3VDD C;  1MQT B;  1X50 A;  5FAX A;  3VKO A;  3U4S A;  1ODN A;  3B5L B;  3ILF A;  1O91 A;  4E2S A;  2IXI A;  1UU4 A;  1RUJ 3;  1X8E A;  5AVA A;  3I2O A;  3IAQ A;  4XDP A;  4BHP A;  2JIJ A;  4D7T A;  3VDC A;  1A3K A;  1SHW B;  2WNV C;  5JWP A;  1NG0 A;  2QQN A;  4AZZ A;  3U1X A;  3B02 A;  4EV0 A;  1M4W A;  1SLI A;  2JG8 B;  3ZYR A;  3O1S A;  2R32 A;  3POW A;  1BBT 3;  3POS A;  3T0D A;  4RN5 A;  1KEX A;  3EXU A;  4BIO A;  3MIC A;  3VZK A;  1GOH A;  3ZN4 A;  2VMD A;  4HFS A;  4E2G A;  2VY0 A;  1XYN A;  3IMM A;  1UWW A;  4P02 B;  4Y5Z 0;  2YUE A;  3H8R A;  3HQU A;  3ZYP A;  2WWJ A;  3VBS B;  1FXZ A;  1W90 A;  4GJZ A;  3WNK A;  3BAL A;  1Y9M A;  5HV4 A;  1MEC 1;  1EAH 1;  1AYN 2;  5C4W A;  1HN0 A;  1ZM1 A;  2XB6 C;  2FHR A;  3BTX A;  2Y6F A;  3OJB A;  2HWC 3;  3U75 A;  2QE3 A;  4LR4 A;  4COW A;  1Q8O A;  4JDN A;  1QNY A;  2WFF 1;  3VKN A;  2D3P A;  4XUT A;  2B4K A;  5F5A A;  2OXB A;  3VD5 A;  2XLF A; 
#chains in the Genus database with same CATH homology
 1XSR A;  2BDR A;  1XSQ A;  1YQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...