2BDRA

Crystal structure of the putative ureidoglycolate hydrolase pp4288 from pseudomonas putida, northeast structural genomics target ppr49
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
166
Chain Sequence
MRTLMIEPLTKEAFAQFGDVIETDGSDHFMINNGSTMRFHKLATVETAEPEDKAIISIFRADAQDMPLTVRMLERHPLGSQAFIPLLGNPFLIVVAPVGDAPVSGLVRAFRSNGRQGVNYHRGVWHHPVLTIEKRDDFLVVDRSGSGNNCDEHYFTEEQMLILNPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ureidoglycolate hydrolase
publication title Crystal Structure of the Putative Ureidoglycolate hydrolase PP4288 from Pseudomonas putida, Northeast Structural Genomics Target PpR49
rcsb
source organism Pseudomonas putida
total genus 33
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 4.3.2.3: Ureidoglycolate lyase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04115 Ureidogly_lyase Ureidoglycolate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.480 Mainly Beta Sandwich Jelly Rolls Ureidoglycolate hydrolase 2bdrA00
1YQCA 1XSQA 2BDRA 1XSRA
chains in the Genus database with same CATH superfamily
2WAOA 2YPJA 1SFNA 2VZPA 5FZMA 4EN9B 4XJ8A 1W8OA 4HVOA 3WXPA 1DYPA 1L3JA 3DKWA 5JPMB 5H9RA 3ROUA 1RITA 1Z78A 1WW6A 1CPNA 1R083 1R1A2 4IE4A 4KBZA 1UY0A 2JDMA 2PYTA 4LO7A 4Y20B 3ZXJA 1R081 1XSQA 1KDKA 4CP1A 3I3MA 1RINA 1W6NB 4LOTA 1XNDA 2EAAA 3WQBA 4TXWA 5FZ3A 2Y0OA 3WW2A 4LT5A 1GNHA 1A34A 2C26A 1UD1A 2RMU2 2VMEA 1OLQA 5AFEA 3O0XA 4EN7B 2R0FA 3K3OA 4WM7B 5F8PA 1RC6A 3ZXAC 2RM23 5FP7A 5J36A 2JDZA 2RM21 2P3IA 4LE4A 2ZZQA 3VDCA 1QJX3 1A3KA 5J96B 2VMFA 1QJX1 3S57A 1IG0A 4JRAA 2YFZA 4RD7A 4CEYC 4Y20A 3CQOA 3HNYM 5FP8A 3BKZA 4O7XA 3RYRA 1H6XA 1W6NA 2GP3A 3FN9A 1MEC2 3U1XA 2VW2A 3DCQA 2ES3A 4O65A 4XIOA 5DDJ2 2DCZA 1RUH3 4IEQA 5CFDB 2IXHA 1RUH1 4DO0A 1POV3 1POV1 2WIIB 5FZEA 2BBVA 1RVF3 5BNOB 4NRMA 1FX5A 5KXCA 1LR5A 1RVF1 3VDDA 4BM8A 2Z2SB 1OA2A 3LFMA 3ZSLA 4JQTA 2CAVA 4NVPA 1SFPA 2NQYA 5FZ6A 2J1EA 3RWNA 3DYMA 5DAXA 3PVOA 4YYOA 4YVWC 1CPMA 1AZDA 4G9SB 4N43B 3TEZA 1DYOA 2VTXJ 2YC4A 2ZHNA 2WSUA 3Q8CA 1UMIA 5BNOA 1NE6A 2D6NA 2GN7A 3UGGA 3DUIA 2HH9A 1RTVA 2HWF2 4QKBA 3ZN4A 2HYKA 5C4WC 1QJFA 1QJZA 4Z8BA 4COWA 1AYN2 1JHNA 1W6OA 4QPIC 3C3VA 4GWJA 3RZGA 2P37A 4AQ2A 3CJIC 4QT6A 1BKZA 2JG8B 4QAWA 3DEMA 4XAEA 4JKLA 2ZHMA 5D8AB 2JD4A 1PMIA 1ULEA 4N43A 4NAOA 5JR7B 2E33A 4C1WA 1ZZCA 1HB1A 4L0PA 1OA3A 2EIGA 5GZFA 3HIFA 1OOPB 5T5LA 1JHJA 4FCAA 5JSRA 3I59B 4FBFA 2QQMA 1ZZBA 2VOVA 2D97A 4LKSA 4OZXA 5I8YA 1LTEA 4IGPA 3WW4A 3I3DA 1POV0 4FPYA 4JTNA 3HR9A 4L8QA 5AC92 4CCJA 3HBZA 1C5HA 2JG8A 3K2OA 1NCQC 3VBFB 2YU1A 3AVRA 3BB6A 4R9AA 3O1UA 1RUG3 2CY6A 5FZFA 4JHTA 1JZ4A 1RUG1 1OOPA 3FHIB 3DL3A 3VBSA 1RUOA 1UCXA 3I59A 2ZGSA 3GZEA 3THCA 4B1LA 2JDNA 1SHWB 1YWKA 4YG6A 5F3EA 4LPLA 5C8CB 2XLFA 2OA2A 4IV3A 2WN3A 4UW6A 3OPZA 3HQUA 1WLCA 3RG0A 1Y3TA 3USSA 1MS0A 1AF9A 5F3GA 2UWAA 2PXJA 1B35C 2DVGA 2GMPA 3PUAA 4BQYA 2N7GA 5LEKA 1JW6A 2EIBA 3AYAA 3T1LA 4TTGA 3H8OA 2F4LA 3J8F3 4MSVA 4S2DA 4MGKE 4YZ3A 3UGHA 3L2YA 4DFSA 1GOFA 1URXA 2ZGUA 3D0SA 3IZOA 3J8F1 1V6KA 5EHDA 5C8CA 4AXOA 2XVGA 4OQ9A 4XF9A 4ZU7A 2R062 4XBLA 2W0XA 1JBCA 5DAWA 3KM5A 3T4HB 5KHKA 1AXZA 2QQPA 1BVP1 2CAUA 2Y6LA 4FOYA 2DBNA 4UFIA 2NMNA 1W0PA 4DNYA 1CQ9A 3MFAA 4JGZB 1UPSA 3DPRC 3ILNA 1LAJA 1GWKA 3I2DA 2OUHA 2W1WA 3WUDA 2E6VA 3Q9OA 4QU1A 4B4RA 4KGGA 1S4CA 5K4LA 4AE2A 2X10A 4IL7A 3O1OA 1O7FA 2XXZA 1IKPA 5FYIA 2R7EB 2JB4A 1Q3EA 2W5FA 2Z42A 5EYXA 3KV9A 1QWRA 1FATA 4WVMB 1FNYA 4AL9A 4CPBD 2VMDA 3O1PA 4CDWC 1YQCA 3FLPA 1S0EA 5D2AA 3IMMA 3CDZB 3FLRA 4P9IA 4XUPA 1IQDC 3O0WA 2QQLA 4CDXC 5A70A 4QQLA 4UFHA 3B5LB 4M0HA 2DVBA 4SBVA 4H55A 5FZ9A 3VUOA 3RWKX 4ES8A 4BMBA 1SCRA 1WMEA 4LTAA 2ZKLA 3OUIA 4XF1A 2BDRA 5FKCA 4QU2A 1GQHA 2RG4A 4WVMA 4CDUB 5A3LA 1YRZA 1WCUA 2QZ2A 3AB0A 1HXS2 4AK3A 4CCDA 1U12A 1DBNA 4Q27A 1LB2A 4DXSA 3HN1A 1SEFA 1WCSA 3KHCA 5K8SA 5KHIA 4J6GA 2CSGA 2DUPA 2NZ9A 4BA6A 4D69A 3ZXLA 4MXWB 4N7IA 4RN5A 1ASJ2 2R1DA 2VMCA 4Y22B 1ST8A 3RMXA 5C3QA 1CGPA 2J1AA 1IPSA 2ZCWA 3PURA 3RZHA 1ND2C 2A75A 3VD7A 5FPXA 1PGW2 1LOFC 2VNGA 5IAVA 4CDQA 4XYXA 4CDUA 3GBFA 1J3PA 1DGWA 2DF7A 1NZIA 2WUHA 5KHJA 3SMHA 4E8CA 2ETEA 2LRPA 4M3CA 3TBDA 3U78A 1H4HA 5FYVA 3WP4A 4LMFA 1LHNA 2OQ7A 2AEZA 3SH4A 1N3OA 2HLEA 4DXRA 1E5HA 1PIV2 2UYBA 1W8WA 4YG3A 5BNNC 3AMNA 4MXWA 1GWLA 4Z82A 3S7IA 4KG8A 4Y22A 1K5MB 4MHUA 3MV11 4R9DA 3KHBA 4EZ4A 1A8DA 3P6BA 4YW6A 3WP3A 3MFCA 4QX1A 3HWJA 4CVUA 2XDVA 4XF0A 4NE9A 1X50A 3M70A 5FO7B 1JZ3A 4W6YA 3VHRA 3IDCB 1VALA 4Q1RA 4Q8LA 2WN2A 4YGDA 4YFZA 1DP0A 1H6YA 2Y0IA 2K9ZA 5DXDA 5JOYA 2V4VA 3RMYA 3VL9A 1LESA 1K5MA 1PX3A 3HT1A 3PMEA 3WX5A 4AAXA 5LBCA 4RS5B 3OB8A 4CP0A 4OI2A 2ADEA 2HBUA 3AJZA 2FCUA 2XQXA 1F9KA 3U37A 2JG9B 4YM3A 3SLIA 5EYYA 1X7NA 3USUA 4E8DA 3H8RA 1ZRDA 4QXBA 2P4EA 1AYM2 5JIUA 3T08A 4Q29A 4XEZA 5D21A 4B3NA 4XBQA 5IVBA 1DQ2A 2WT1A 4K8FA 2VPVA 5F39A 2C9AA 3TB0A 3CZJA 3KT1A 1H8VA 5J09A 4DIQA 1WLTA 5A1AA 1Q43A 1IKQA 4XVHA 2CWMA 4RS5A 1LOCA 3NV2A 3GCXA 2P34A 1FAYA 5CG9A 1EY2A 1KS5A 5CKQA 5FJHA 3NRUA 1W8HA 2FQPA 3OPTA 1U5YA 3N7JA 3IKWA 5ABJC 2RE9A 2GAUA 1Q56A 3WF3A 4CEWA 1DZRA 4KGQA 3JQWA 2R072 2DTYA 5IVFA 4EV0A 4AVBA 1ZX5A 2AGSA 3A4UA 1GFF2 3MIHA 4OUEA 1CR7A 3O1VA 2JKBA 3AMHA 2I74A 4OI1A 4OI4A 3LB9A 4QB1A 4HFSA 4D94A 3PU8A 2HWB3 3OF1A 2HWB1 1OSGA 1QDCA 2ET7A 4JVAA 1NXD1 2XJSA 3PMSA 1RB8G 4CXWA 5KXEA 2OZJA 3BTYA 3MZHA 4ZKTB 3VBUB 4MHRA 1S0IA 2WWJA 5F3IA 1W8TA 1EUUA 1XJAA 1VAVA 2ZGQA 4MLOA 1H9PA 1WW5A 2J1SA 2HKXA 3HQRA 4JX0A 1VBA3 2VBBA 3VZNA 1Y7BA 1TMF3 1X9TA 3ETQA 2BNMA 1VBA1 2A70A 3OEAA 5DAPA 3MO4A 5FMDA 1TMF1 5FZAA 2LTNA 2QQUA 4I0BA 3KT4A 2W2IA 3I3EA 1CAWB 3ZSMA 4O61A 3ZR6A 4I01A 4RR3A 3IDBB 3VBUA 2XONA 2CHHA 1X8MA 2RHPA 4LULA 1LODA 3HNMA 2SBAA 4AYUA 1WLWA 1AL22 5JZGB 3R05A 3ZXKA 2K46A 4A45A 3IM0A 3KQ4B 3D0JA 1QJEA 1CAWA 2WFF3 3R4DB 4N53B 4LUKA 3MV01 4LR4A 3ALQA 2WFF1 4IEVA 3B9CA 1FNZA 4LHKA 5FY8A 3ACFA 4DRRA 1QH6A 5C33A 4QQ2A 4MUVA 5FZGA 2WR9A 3GYDA 1XOYA 1AJOA 5CZKA 1LOAA 3NV4A 4B4PA 1OD5A 1I5ZA 3D8CA 4FVVA 5CIRA 2RS52 1JYXA 3JXSA 2EIEA 1XYNA 4PIXA 5FYYA 1VIWB 4XOGA 3ZSEA 4HXCA 1D2QA 4MADA 1BLZA 3ZKUA 5IUQA 1S2KA 3OGGA 5DQ0A 1GQGA 4W6WA 3MI8A 3B00A 4QB2A 3WD5A 2VBDA 2MPFA 2RDSA 3MLJA 5I8SA 1Z0HA 1REFA 1ULGA 3I7DA 4UFKA 2BVBA 2CYFA 5A7OA 1JOBA 4CCMA 1KQRA 2FDHA 3X29B 1H4GA 3MIGA 1VLNA 2HWC3 2YBSA 2BQPA 2CL2A 2HWC1 3PTYA 5FY5A 3ZLIA 4NO4A 1X36A 5FPVA 4ES9A 1H2LA 2QVSB 3I97A 2OT7A 3LIGA 4D7SA 3FHQA 3HN3A 2XMLA 4FTSA 3NKGA 4JKMA 3DXUA 1V6NA 4DY5A 3R6SA 3RPQA 4AFDA 4Q4X2 1VBC2 2V09A 4YW1A 1AVBA 3WQ1A 3LDBA 4N8MA 4DRVA 3VKLA 1LOBA 4CCLA 5K0UC 4NIHA 2YPDA 3ZYGA 4AEDC 3LAGA 4H14A 4HKLA 3C2UA 3ZFGC 4FAGA 1YCIA 3K4DA 5FP3A 3K77A 5C3OA 3SH5A 2DCYA 1UYXA 1GYKA 1HRI3 4K1ZA 3NW4A 4UF0A 3E6CC 1HRI1 3FE5A 4Z92B 4AHWA 4UT5A 1HN0A 2W9XA 1DGWX 2YYOA 1H1AA 4PLNA 4HONA 3ZXGA 2TEPA 3I3QA 1HQLA 2VOWA 1PHMA 3H3LA 3OYWB 4MXVA 5DZFA 4PI2A 1RGSA 4A7ZA 1QQP3 2MEV2 3ECQA 3OUHA 1QQP1 4D6RA 3PJQA 5H9SA 2XHKA 3CEWA 3V56A 5A6QA 5IHRA 4Q0VA 2JB8A 4QM9A 5GLTA 1PMJX 3NJYA 1JZ8A 1MVEA 1XQNA 5JXHA 1PK6C 1W2AX 1X33A 4NHMA 5LB6A 3PNAA 2NP0A 4COUA 4YRDA 1F31A 1S2EA 4V1PA 5FXXA 4AQTA 1H2KA 4FPHA 3WHTA 4C0BA 3OYWA 4EWDA 3U75A 2ZGLA 3NMBA 2WFPA 4ASLA 4LBKA 3SKJE 5FOJB 4AQSA 4M4PA 2OYZA 4QB6A 3THTA 1BMV1 1AJKA 2FDGA 4CE8A 3LE0A 4D7TA 2BFUS 4PQ9A 5JIAA 5LASA 2Q0AA 3VHPA 2IFRA 5TSWA 4PCRA 3D3AA 3O0VA 4OHWA 4KU8A 2VOXA 5A7PA 3EBRA 4NHXA 1IS6A 2UYAA 3K46A 4V2WA 1IPJA 5FXWA 4XUOA 4HSLA 1U5IA 4TSVA 1MQTB 4FFFA 1UO9A 3W59A 1EV12 1ODNA 1U5XA 3NWKA 2IC1A 3RJRA 1KEXA 3O1TA 1ZA7A 3WG2A 4ZZ8A 3IAQA 5A1LA 4AI8A 3OBTA 3KLSA 4XZPA 2VQTA 3RSJA 4IW3A 2ZS6B 3J7MA 3AFKA 3TNQA 5ACA2 4WM8A 2IXKA 3BOWA 4Q8KA 5FZ1A 4UI9L 1AHSA 5GLZA 2WT0A 4FXKB 5C9AC 4MGTA 1O6UA 2W91A 1P8JA 2P6CA 1TME2 3KCCA 1MQTA 1W04A 4RA0A 1UIKA 4CUGA 2OVUA 3J7LA 1MZ6A 3AYCA 2IZWA 5F6LB 4ZZ5A 3CNAA 4XUQA 5J98B 1ZZ6A 3FX3A 1OXCA 1AR93 5DUVA 4D3WA 1AR91 3WW3A 5L7OC 3RZZA 2PAMA 4DUXA 5FWJA 5CEHA 1G9FA 1UOJA 3ELNA 4CTEA 3NQHA 3F2ZA 3B94A 3POSA 3RRDA 2JDYA 4OFGA 1O8SA 2E26A 2W95A 2Y33A 2AACA 4WM7C 1QF3A 1TVGA 1NA1C 2WINB 1RUJ3 3C7HA 3ORJA 1RUJ1 3L2HA 1SDDB 4EWAA 3OY8A 5A3PA 5EP9A 1NQJA 1AR83 4J1WA 5FCCA 1QH7A 5CU1A 1AR81 1YUDA 1UYPA 3ATGA 1VMFA 5FDBA 4RQPB 1W8UA 1PM4A 2BVVA 4BWOA 2GU9A 4GAZA 3OUJA 2GNMA 1GZTA 5L9VA 5KHGA 2C9KA 4XJWA 3BPZA 1ZZ7A 5GLUA 5CFDC 5GKAC 3I49A 3MIFA 2GH8A 3H42B 3ACGA 4Y3OA 2AYHA 2PLV3 1HIXA 4IE5A 2VUAA 4YGBA 2PLV1 1YQ8A 1Y43B 3CO2A 1Q8PA 1LNSA 4KBBA 4IERA 1JOJA 3J7HA 4QGLA 4QPGC 4Y4YA 2YC0A 4XJ9A 3VBHC 2VXRA 4KG0A 5A1FA 4DMIA 4RQPA 4YVSB 3SNMA 3JD73 4QD2A 3SCFA 3EJKA 3JD71 1PNFA 2ET1A 1O5LA 4LK7A 1OQEA 4Q0PA 3W58A 2ORZA 4IXLA 1QU0A 4XCAA 1PX4A 1S0CA 2ZACA 2C5DA 3RS6A 2UWBA 4ZU4A 4PJYA 2D6KA 3HAGA 1QJU2 2JE9A 2R042 1N47A 3E6DA 4MGSA 3V65A 3AP7A 5CG8A 4GIQA 3U11A 2XL9A 3BTAA 1H8TA 1QIQA 2HWE3 2BW8A 2GC3A 3WDXA 2HWE1 3PIJA 4WV8A 5FZ8A 1CIYA 1IG3A 2YUEA 1DHKB 2ZGOA 2RJ2A 4D6SA 4XF3A 5D8AC 2GC2A 3GBWA 4Q4V2 1BHGA 3N7LA 1HB3A 4A7YA 2YU2A 3TNPB 4JHZA 1WA4A 4FTBA 2RDQA 2W47A 1SQ4A 2WO7A 4BU2A 1OOPC 1D0GA 4Q0UA 5F3CA 2YGLA 4QGMA 2WYSA 1V9U2 3I3BA 5T5JA 1VBE2 4AEMA 5A3WA 1FPN2 4FFHA 5EJ3A 5C3RA 4I0WB 2HYXA 3AXEA 5H9PA 1VBB2 1VPHA 2O14A 5IW0A 1LJ7A 1Q8OA 3ZFFB 4FPKA 4XC9A 4O9EA 3VBFC 1LHWA 3MBWA 2YHJA 5HXMA 1C8NA 3NAPB 3B02A 3HPNA 2E32A 3WDVA 2W39A 3AJYA 4CP9B 3KB5A 1DQ1A 4XFIA 2VH9A 1HQNA 5CKMA 4NIGA 1GZCA 3DKQA 3LWCA 1RUC3 2JE7A 4BMEA 1CZVA 1RUC1 2A6ZA 3JUUA 4W65A 3VZJA 4L97A 3WDUA 2B4KA 4GH4C 4JGYC 2VU9A 1EAH2 5C8CC 1ZZ9A 4ATEA 3P3PA 5IAXA 1PO12 1AUYA 1UXXX 2ZHLA 3C8XA 2WNVC 3M2MA 2XBO2 5AVPA 3ZFFA 1G9AA 1O4TA 3A7QA 3NAPA 1PZ7A 3IB3A 4DS0A 1XE8A 5D1IA 1ZNPA 4BLJA 1PO23 4BIFA 1PO21 2JIGA 2RS33 4OMCA 3ZYBA 1GU3A 5C7GA 3OTFA 2RS31 4ZS2A 4GB33 1AX0A 1QOOA 5GJ6A 2J1VA 2WJSA 4GB31 3OD4A 2GMEA 2WS93 2XJQA 2HWF3 1K45A 2WS91 4JAAA 5KXDA 3T2TA 2HWF1 2QTWB 4AFBA 5FLJA 4XABA 2OZ6A 1R092 4R9BA 3RZKA 4JGZC 3UESA 3GDBA 2WZR2 5DUXA 4HKWA 1RMU2 1GLHA 2IUWA 4K1YA 2V5DA 5FZIA 3NJVA 2WLPA 4CCCA 1SFYA 3QCWA 4H7LA 3PIGA 1C8M2 2ZMNA 1ZREA 1IQAA 5DUUA 2GZWA 4Q4Y2 3S30A 3OOXA 4TLGA 1QHDA 2BOIA 5IVCA 5JPNB 4CRQA 3H50A 3UGFA 3VDDB 4B4QA 4OI0A 5JOZA 1S0JA 3RI9A 4RHV2 3F95A 4OULA 3TEWA 3GZTB 4JV4A 2H6CA 1RUD3 2YFUA 5JVVA 5GZDA 4LA2A 1RUD1 5E6HA 2WA4A 5FYTA 1MS5A 3K4ZA 3TWIA 5HCFA 4PF5A 1SBEA 4QX5A 4KQ7A 1A78A 2NLRA 4FPEA 5CAZA 3E1F1 5A6ZA 4FOQA 2JWPA 2JXAA 4K9SA 2AZ5A 2NYYA 1S2BA 4YW5A 1OKOA 4RSUA 4S2FA 4OYUA 2BNNA 3POWA 3T0BA 1YO8A 4LBOA 4XUTA 4YW7A 5LA2A 4ASMB 1W6OB 4Y1YA 4ZS3A 4COVA 1RUE2 2ADDA 2P2KA 2XLGA 2G9FA 4GALA 1SBDA 2QE3A 5A80A 2K2SA 3KV5A 3O1RA 4R9CA 4HPKB 4U2AA 4JDMA 4J25A 4HL0A 5HCAA 4ISRA 3T0AA 2ZEYA 1ZBE3 1AR62 4LO4B 1UZWA 1HV0A 1BXHA 3KGLA 1RHI2 1ZBE1 1PGL2 2AUYA 2GC0A 1JUIA 1V0AA 2IFWA 4XDOA 1FMD2 1TE1B 1UY3A 3SCHA 4IUGA 2VZRA 1QJY3 1VRBA 2X8KA 1J84A 2RS13 1QJY1 4P5YA 2LROA 3MLLA 4AW7A 2RS11 3DXTA 4GJYA 4PDWB 5BNPB 4IV1C 2VZVA 4HPKA 2Z4FA 3EQEA 5LW9A 5E88A 3FZ3A 1Z7S3 4XETA 5GLWA 4A44A 4META 3SITA 1Z7S1 2EICA 1NLRA 2XOMA 1GNYA 3M8LA 4MX3A 4QKDA 5LA1A 4AI9A 4HVRA 3H1WA 4AFAA 5IT6A 2BU9A 3ZPOA 3VBSB 2X5IB 3H3ZA 4AWDA 2DTWA 3I54A 5EJZB 3OCPA 2FDKA 4LE3A 5K9YA 1IS4A 4IV3B 1LGNA 3AZXA 4AZZA 3P3NA 1VBD3 3CHXA 1R082 4PDWA 4A3XA 3U07A 1W8ZA 1VBD1 5BNPA 3U4XA 3WCSA 2A7AA 1QNYA 1RJ7A 1SLBA 3FBYA 4RS5C 2GN3A 3ZMNA 2JG9C 3ZIWA 2FHRA 5GZEA 4BJ0A 4JKKA 2X5IA 4I3PA 2W1SA 5FYCA 1ZBA3 1UU6A 4AHXA 2RJLA 3AL6A 1QJX2 1ZBA1 1V6IA 2ZZJA 2EXHA 5GZGA 2XQRA 2KR2A 3GGLA 2DUQA 3K75B 2MHFA 4LO6B 3AL5A 4AEKA 1W05A 1I3HA 4MGIE 1CIWA 5FTTC 1F35A 5LWBA 3OBZA 4Y24A 5FZKA 1RUH2 2VW1A 3GZAA 4B1MA 5GLVA 1C5IA 1ASJ3 1UOFA 1W9SA 2CWSA 3WQ7A 1UPIA 1ASJ1 4IEYA 5C71A 5FUNA 1RVF2 4EE2A 4NUBA 3D5OA 3LZZA 4INDA 5A7NA 1OLME 3VD3A 1VRH3 3PUHA 2D44A 5LY1A 1O3QA 1VRH1 3ZIXA 1DGRA 1J1LA 3AKSA 4RGGA 5L19A 5C5UA 4U36A 1S0GA 5FRAA 2WO2A 4M3CF 4F7ZA 4JDOA 1OKQA 3WP6A 2UY9A 4AHYA 2IWGB 2VTXA 3B69A 3ACHA 3V0BB 1LEDA 2SLIA 2DUOA 1OFNA 3QOPA 4XQWA 4E4SA 1J3RA 1O3RA 3MW2A 1I1EA 1JU4A 2B42B 1FXZA 4JCKA 3KSCA 5CFCC 4LBQB 2Y6FA 3KWVA 3AP6A 3RDIA 1XNAA 4KWJA 5JOWA 5IK5A 4H3WA 4ITCA 2Z69A 1STMA 5DABA 4XFCA 5C3PA 5C5TA 3WNLA 1GP4A 3J7NA 3MIBA 4UW5A 3WHUA 1N1YA 3THPA 3U0ZA 2DWRA 3WV6A 2GMMA 4X6RB 4PQQA 3V0BA 4QDSA 3SC7X 1NY71 4CDQB 2HJIA 4QX3A 5KWRA 1M4WA 3KGZA 1HRV3 2LM3A 1JYCA 3I2IA 4LBQA 5JZGC 4M3CB 1HRV1 4AHZA 3NV1A 1D4M3 3DV8A 5IK7A 4K7JA 1XE0A 4BYYA 1D4M1 1RUG2 5E1RA 3VKOA 2BPA2 3H1MA 4N53C 1L7QA 5JLVA 1OVSA 4BLIA 2Q8DA 3ETPA 3THDA 2VVDA 1XBFA 3EO6A 3QACA 4I30A 4K6BA 4XFHA 2ZEZA 4NMIA 1WD3A 4Y1ZA 3ZR5A 4BK4A 3HBKA 3LSEA 4TYSA 2YG0A 4MO3M 2PA7A 5T54A 3IPVA 4E4HA 1RXFA 2IXCA 4UBHA 2GNDA 3BOPA 5LBFA 2RR13 4CEYA 3VKFC 3MLKA 2RR11 2PHRA 3LCPA 2D6OX 1W39A 1UZVA 3MEPA 5CNAA 4NIDA 1AR73 3G7DA 3LPFA 4YVWB 4C0HA 3J8F2 1AR71 1Q8SA 4BIOA 5FPLA 1H30A 3I8TA 4PIZA 4UFMA 4XHXA 3USUB 3OG2A 4BQXA 1PNGA 2XUEA 2EIDA 4XBNA 4CUCA 2OPWA 4EYUA 1V00A 2L9LA 3T2OA 1KFUL 5C4WB 1GKBA 5F2SA 3S5AA 2ZGPA 1WBFA 3AYEA 2Y6HA 3KQRA 4QX0A 3MICA 2ZBJA 3ASIA 4Q4W3 3S7EA 1RJ8A 4Q4W1 3GZUC 5J3UA 2FDFA 1JTZX 5A3OA 4YVWA 1GSLA 1QDOA 1WUVA 3HD8B 2GSYA 4LBLA 2TNFA 1G6NA 3WNNA 2ZGKA 2FCTA 3M3OA 5I0DA 5DG2A 1VMJA 2VCBA 3ZX7A 3PVBB 3KVBA 4NR1A 4CEWB 2LUWA 2ZGRA 4WVVA 3M4FA 4LKEA 3AKQA 1F15A 5C4WA 4MGYE 2E31A 4P00B 3L9JT 1WGPA 4M01A 1NAEA 4QPIA 1JOPA 4AGRA 4AAPA 1YNAA 4AFMA 3M3EA 4BPZA 4KMQA 1ZRFA 1MACA 1WMDA 1HKDA 1PMHX 2VNOA 1DZTA 3ILFA 2DVDA 5BXXA 1W3VA 2GC1A 3CMGA 5FO9B 2WKKA 4QXCA 3BIEA 4JC1A 3WCRA 3BU7A 3ZYFA 4GMP0 2AENA 3I2HA 1I6XA 4NPRA 3OBRA 1EYBA 1ACCA 1NE4A 1PVC3 2DDUA 1KXGA 3S5QA 1GICA 2NPIA 1PVC1 1T6GC 1DDLA 2VNVA 3IBMA 4W8JA 1ZM1A 1GANA 2NM1A 2B9UA 4D0QA 2Y64A 1QOTA 1YC61 4Y4RA 5G05L 4MZUA 1CJPA 3E5UA 4FPFA 1YXWA 2R49A 2CV6A 1MZ5A 1OVPA 4K20A 3U10A 1NCQA 3A22A 5B4NA 3WDTA 4HMZA 4I0AA 3LOBA 3J9SA 2VE1A 4NOTA 5KR7A 1OT5A 1RUF3 2JEMA 2WYFA 4QX8A 4YG0A 5F5QA 1B35B 1RUF1 2EF6A 3AZWA 2D93A 2WNUB 4RR3B 4EN6B 2BGOA 3BGAA 4QHOA 2VUJA 3BODA 3LDKA 5CVRA 4HT1T 3PTRB 4EWEA 4HETA 4YM2A 5IATA 2F6BA 4AVCA 2UY8A 3ZFEB 4XFBA 5I93A 3WR0A 1WW7A 5FY0A 4FO9A 2Q1MA 2QBXA 4X8NA 1XNCA 2C6SA 2QDRA 4NJ4A 2QFEA 1B35A 3FUQA 1MQTC 2D43A 2UU8A 2VQ0A 3KCYA 4YGCA 4YZ5A 2WWUA 2C0ZA 2VNRA 4DOUA 2WNUA 1ONAA 3M3QA 4GA9A 4M00A 2FZ2A 4BZ4A 2Q8OA 4N90A 2Y34A 1K3IA 1DU3D 1DGLA 4D8MA 1W9TA 1O3TA 4NHKA 1UNBA 1O5UA 3E97A 3K51A 3ZFEA 1NCRB 4IEUA 2DYCA 1W03A 1RXGA 4DUVA 3N4MA 2R6QA 2Q1FA 4KH9A 2DCJA 2QDNA 1LEMA 3WVJA 4FT8A 4AR2A 4BB3A 2WABA 3B7MA 3DPRA 1RUI3 5CYYA 4QKFA 2KD7A 1AX1A 1F2NA 1RUI1 5FY7A 1LHOA 1ZRIA 1NG0A 2A3WA 1S55A 3AKTA 2JDPA 1FV2A 3JB4C 2XJPA 1NCRA 5EJ1B 3EMRA 1OPOA 4WZFA 2WQZC 4CDWA 3AC0A 2LALA 5JWPA 4OVEA 5APAA 1AXKA 2DBIA 4XUNA 4LOSA 4PI0A 4PF1A 2B46X 1SPPB 4JDNA 4CDXA 1OI6A 3SEEA 2DV9A 2J1RA 4I3GA 4K21A 2W92A 1OH3A 5C6CA 3J4UH 4Y1VA 3UKTA 4F83A 2HEWF 3PUQA 4OHZA 1ND2B 2VCMA 4NIAA 1QXRA 4K8RB 1BQPA 3LD8A 5LEJA 1JYNA 3JB8A 1PZ8A 1UIJA 5IVJA 3WUCA 1CZTA 2HWB2 4NROA 4OQ8A 1XPWA 2ENRA 5EQUA 4XW3A 5DZGA 1SPPA 5A32B 4Q26A 3BTZA 1N3QA 4PLOA 3ZN5A 5FYSA 3W9AA 4HZFA 3N36A 4UF0B 1ND2A 3SCGA 1G9CA 1LOFA 4N7UA 5CBLA 3JBG3 4YVSC 3JBG1 2D6MA 4HN0A 4A4AA 3NKTA 3K48A 1LOGA 2VOKA 1VBA2 1J83A 3VBOC 3RJ2X 1NQDA 2BBAA 5KXBA 5I0UA 1ZYBA 5A32A 1CESA 5FLIA 5T3NA 5BNNA 3O7OA 2BUKA 1JZ5A 2VBPA 5FKBA 3GXUA 3LFIA 5EFUA 2W94A 4EROA 5EXOA 1Q5OA 4RFT0 1GZWB 3VDAA 5C8WA 1E57A 4BQ1A 5B2GB 3V0AB 4FTEA 5FZBA 1TG7A 3MYXA 1SCSA 1UU4A 4FP3A 4QM8A 4BOWA 3WF1A 4OHXA 4NPMA 4KL1A 2Y26A 3N7KA 1X9PA 4XMAA 4XILA 3WT3A 2E63A 1H1MA 3O1SA 5DUWA 1BBT3 2ERFA 2R1BA 4QPYA 1UY2A 2YROA 4HSJA 1BBT1 3VZMA 4QDRA 1DLLA 1OD3A 1SBFA 2D3SA 2WFF2 4XQDA 4ZXKA 3NV3A 2ZGNA 3O1MA 3ABZA 1WCKA 1GZWA 2VZUA 3V0AA 2WZEA 2CTVA 1FOD3 1S1AA 5FMBA 1XYPA 3HVDA 4A41A 1JYIA 1W6MB 3ON7A 1FOD1 5FREA 4OUSA 5F5IA 1G9DA 1W0OA 3NNGA 3AZZA 4XF4A 3D82A 4BK5A 2ZKNA 4P5HA 4TLFA 1GP6A 3HQXA 4R4ZA 3LIHA 5CADA 4WM8B 5FY1A 1ENXA 5FO8B 1OA4A 4CCEA 4QWNA 3OD0A 3B01A 3T30A 4LBJA 3C7FA 5EZWA 2EALA 3T0DA 4C91A 1X82A 1IOAA 1I5PA 1HQWA 2WNOA 5FMOL 5F6KA 2AC1A 1W6MA 3JQXA 2G1MA 2HWD3 1WBLA 5LK5A 2HWD1 4MGQA 1UYYA 3VBRB 4HVQA 2BWCA 2W46A 4N9IA 5FYHA 2I2SA 3MDPA 4XXPA 1ULCA 5CKNA 2R16A 1COV2 1Q8QA 4J1XA 1O4ZA 2HWC2 3AM2A 4FFIA 5EV7A 2OIIA 2C4XA 4XTPA 2FBEA 3B3QE 4ZY9A 4B7EA 5A3NA 1CWPA 3LA3A 1S0DA 3E5XA 3BPSA 5A3TA 3LA2A 4XTMA 4Q0QA 3WDWA 5FR3A 5HV0A 1YQ5A 2VR4A 2Y8KA 4QKNA 3VBRA 3OY8B 4ORFA 1GP5A 2TBVA 2BWAA 1DIWA 1H2MA 3DGTA 2GALA 5H9QA 4RGKA 3ZDVA 2J1UA 3SH3A 4EQVA 2QKDA 2XH6A 1SLTA 1OUSA 2W3JA 1XU1A 1XE7A 5B4XA 1IS3A 1UQXA 3BVCA 2AEYA 3N9PA 2WRAA 1R64A 4GKXA 2A5ZA 3T2QA 1HRI2 2Q8CA 1WWYA 2WWSA 2A71A 3CF6E 5FPUA 5A33B 4KWLA 4KI5M 1QKQA 3VDDC 4G3YC 2W1QA 3VHOA 4LKDA 2D5FA 3SQOA 4XQ4A 4R8HA 2E51A 2ZX4A 4X6QB 1UF2C 1NLQA 3MIDA 3BN6A 1H9WA 3ZVXA 3VDBA 1EPZA 2ILMA 3J26N 1LULA 2PELA 3QD6A 3PVEA 1NZCA 2W08A 4OMDA 3AX4A 1REEA 4LBQD 1F4HA 1PM7A 4QGNA 1L7RA 3WNXA 3ZSKA 2YBKA 1XNBA 1NX9A 2WLQA 4GWMA 4QQHA 1XYOA 5A33A 5BNOC 5M0TA 5HBAA 4NRQA 3H0OA 2QNKA 1YFWA 1H8TB 1BMV2 1R1ZA 3H8UA 1UXZA 1UW8A 1WCDJ 2UURA 3AMQA 4XJUA 4PBOA 3ZYPA 3WF2A 5BPXA 4MYEA 3WINE 5G04L 2C24A 5J48A 4N43C 4YM1A 3B9IA 4FPOB 1JYWA 4M0NA 3OGJA 3ITQA 2FDJA 1SDWA 3NNFA 1N1TA 2QQJA 2A73B 2XKPA 4LKFA 1YQ6A 3TN93 4NIIA 5IVEA 3TN91 1JH5A 1WCQA 4L99A 3AMMA 4MVTA 2FD8A 1DZQA 2JG8C 3AP5A 1SLIA 2G9ZA 2AH2A 2DVFA 1R1A3 1OLMA 1W99A 2VD7A 3LEMA 1CN1A 1R1A1 2JJ6A 5L9BA 5I8TA 5K0UB 4GXLA 2BRTA 3FC0A 5LRRA 4AEDB 2WZR3 2ZAHA 1V6LA 2WZR1 3VBSC 3ZFGB 2RMU3 3ES4A 4UBGA 1IZ3A 2P5BA 2RMU1 3QH7A 1DQ6A 3WOGA 2BTVC 4GD4A 1IS5A 1N1SA 1AR92 4FFGA 3GF6A 2PQQA 3UNPA 4IV3C 2A3YA 2K0GA 4IEXA 5F7UA 4OUMA 4YFWA 2BNOA 3ZXDA 3ZYRA 1KGYA 3POGA 3EYPA 3KZ4C 1C28A 2OQ6A 2VMHA 4FOVA 4BH9A 1ULFA 3POYA 3PDQA 1UMHA 5K0UA 2JX9A 1MS3A 1MEC3 4AEDA 1GWMA 5FUIA 2CU5A 2QZ3A 4BE3A 4Z2WA 5C3SA 1RUNA 1MEC1 3PVNA 2LS6A 3ZFGA 5DDJ3 2ZEXA 2F4PA 5J37A 2CDOA 2VL4A 5DDJ1 2Q30A 1RUJ2 2RJKA 4IEOA 1EPWA 2JECA 3VN4A 4Z1VA 2E53A 4CCKA 2WDBA 3I2GA 5IVVA 4QXKA 1KRIA 1AR82 3A23A 2O0OA 5I0TA 1W6PB 2D7FA 1CZSA 4ZONA 4B8EA 1V6MA 2A1XA 4CXYA 3BCWA 2BP6A 3M7AA 5FPZA 3A0KA 3PUSA 3RFRA 2ZPXA 2PHUA 5J7MA 1D0HA 5LRSA 3RYKA 2X53S 2XG3A 1G9BA 2XHNA 5JR2A 4UFJA 2PLV2 2PHLA 4XMIA 4Q0SA 1PK6A 3S6PA 4UW3A 4D6QA 2WT2A 2JKXA 3OGRA 1PGL1 4NHYA 1W6PA 2CDPA 3FWEA 1CONA 5IWFA 1RL3A 1AYN3 2BOJA 1POQA 2ZJCA 3JD72 3JU9A 3M1HA 1K42A 2XUMA 1AYN1 2XL7A 3HEIA 1EP0A 5DAQA 2B8MA 2R30A 4H2AA 2V5YA 2XVKA 1W9WA 4LA3A 1U0AA 3N35A 5K7PA 1YFYA 3KMHA 4ISQA 2P3JA 4NRPA 1MS1A 4AI3A 5CISA 3POBA 2QQVA 5F9TA 3CU7A 1E5IA 1HJGA 3MHZA 3UJOA 3LSDA 5C9AB 1LHUA 1F8VA 4BXFA 4MGZE 1SLCA 3SKVA 2OXBA 3VKNA 2EA7A 4GWIA 4Y1XA 1JUHA 4QHBA 3IT8A 3OEBA 4FXGB 1S0BA 3VHNA 3MF9A 5AC93 1ND3B 5L7OB 3ZM8A 4DXTA 1JU3A 2RVAA 3ZXFA 5AC91 5HV4A 4LNVA 2WNEA 4DXZA 1O59A 2YC2A 4NN0A 4P9WA 1OMIA 1OC1A 2HEYF 2XJRA 1XNTA 5LA0A 2VMGA 5C9AA 1QNWA 2KM2A 4O9GA 3K4AA 1WZXA 2I07B 1L7LA 3WNKA 2ARBA 2OPKA 4BQWA 4CDQC 1NA1B 5JI7A 1CJDA 3DECA 3ZPYA 2JDHA 5FPBA 3VGIA 1UZ0A 2EAKA 1UX6A 4BCUA 2P6HA 2D3RA 4BQ5A 4P9YA 5KC6A 4BQ3A 1AX2A 2JD9A 4IE6A 5FZ7A 1NYWA 1ND3A 3LGRA 5L7OA 4XJAA 2BGPA 3WNOA 2I45A 3FMGA 4QX2A 3AZVA 5FMCA 1UY1A 1ULPA 2ZEWA 5L73A 3UYJA 4CU8A 5FYZA 2JDKA 1D4VB 1BEV2 2VZ1A 1OHFA 1W2UA 2VOTA 4GZ9A 1PGSA 1ENRA 1S0FA 4BQ4A 2UWCA 1RUC2 4I09A 5KHHA 5C70A 4WM7A 1ZVFA 2VXJA 4KNCA 1NA1A 4CU7A 2Q4SA 2XB6C 5FY9A 4JRLA 2E7AA 2R063 4YW4A 1JYTA 3GJBA 5LY2A 4QPGB 2R061 3VBHB 4XFFA 2B7YA 1PO22 4HBNA 5DAVA 1K5MC 4P02B 5FYBA 3MF6A 2RS32 2YV8A 5T55A 5FZ0A 5JDBA 5CFDA 4GB32 1UKGA 3FBMA 4COZA 1XXNA 2F17A 3N9LA 4AI1A 1EUTA 2E9QA 2XLAA 2WS92 1D7PM 3P1IA 1PZ9A 2XR4A 3WG4A 1UL9A 1UMZA 4DINB 4E27A 1C1FA 4QPGA 5ANNA 1W9YA 3VBHA 1GOHA 1SG3A 1IPKA 1ENQA 3ZYHA 3T1MA 2R0HA 4GJZA 5EIYB 4R52A 1VAKA 4AFCA 3R4UA 1VMHA 4HK9A 4UYBA 1SZBA 4CDUC 2DU1A 3D4KA 2DCKA 2VAUA 1A6CA 4NPLA 4YPJA 4URAA 3VKMA 2RM22 4YARA 2VZOA 4JTOA 4CA9A 3Q8BA 4YLZA 1V70A 4DZGA 3HOBA 4K3UA 3Q8EA 4CEWC 3N7MA 1GNZA 1T2XA 2ZHKA 3AXDA 5FOBB 3MUZ1 4AG4A 3NNJA 2ARCA 4NWWA 1CD3G 1GUIA 2Z5WA 4ZU5A 1HXS3 1RUD2 5HPOA 1JYVA 1SLLA 3OJBA 2VZSA 1HXS1 2H0VA 1M06G 3JCIA 5D8AA 1J3QA 3ZO0B 5A3UA 2QJVA 4NAMA 4OLLA 4QPWA 2XPJA 4ONUA 2WZPP 4P9LA 5L9RA 3BYWA 3CJXA 4AQ6A 5FPAA 5FZLA 4E9KA 1NLSA 4HG6B 3TAYA 5KBFA 4GH4B 1PGW1 4JGYB 3POEA 4URTA 2BV4A 2J42A 3SISA 4A6OA 3ZYJB 5JXJA 4CUAA 4H7MA 2XKOA 1OFSA 2WNVB 4E2QA 1GBGA 3VBFA 5AVAA 2VZ3A 5GALA 3LQCA 1PIV3 3H7YA 4W50A 1LENA 1YI7A 5FYUA 1PIV1 3I2OA 1MS9A 1ZBE2 3C7GA 3LEIA 3WQ0A 1QEXA 2Q8EA 5DG1A 2WNUC 2YXSA 4RR3C 3VBUC 2FMDA 2ZABA 4Y33A 4UFLA 5FK8A 3GJAA 3AKPA 4GH4A 4JGYA 3SXWA 2JENA 3ILRA 3KS7A 1KS4A 4LIUA 4QQPA 1QJY2 3LA7A 3ZFEC 3WNMA 2WNVA 2RS12 4FOWA 2V4AA 3E6BA 5E89A 2O8QA 1ZRRA 3VZOA 1IGOA 2ZAAA 1OUXA 3KVAA 1LKNA 3WP5A 2BERA 1Z7S2 3RQ0A 5AFBA 2Y6KA 3PJYA 2W68A 1K12A 2GDFA 2AREA 1O4YA 1UAIA 4LBNA 1VB4A 4RL7A 1QXJA 4A3ZA 1ENSA 5A6XA 3AK0A 3APBA 4XACA 5DMYA 4I02A 1AYM3 1D2SA 3I2KA 3AYDA 1AYM1 4COYA 1NCRC 5JAXA 3OSDA 5FYMA 1W2TA 1VBD2 2YY1A 2YDEA 3DF0A 4YSFA 3LPGA 2ZX1A 3IPVB 1SLAA 4IETA 1YI9A 2ZX3A 3MPBA 1JN2P 3ZOIA 4CEYB 1H1IA 4F8AA 4JGZA 3UV9A 5BY5A 4YW2A 1KITA 1N1VA 1U5ZA 3O12A 2ZTNA 1ZBA2 1JMUB 3ZMOA 4DQAA 4Y26A 3U4SA 3PLQA 1CAUB 5FP4A 5EPAA 3R4SA 1TQ5A 2R073 1V6JA 2E7TA 2PFWA 2R071 3CKHA 3H8XA 1TNFA 3INAA 4GMP3 4EJRA 1UU5A 4GMP1 4LEJA 2B39A 2JE8A 2VM9A 2VECA 2V73A 3FHAA 4LO5B 2JICA 2WZ8A 3N9OA 2MNGA 4ATFA 1FYUA 2B9VA 3CBNA 2KXLA 2VG9A 1A8MA 3I2FA 3QLQA 4IQPA 1JODA 1OPMA 2PQSA 1OBNA 3M3CA 3KCXA 4KWKA 3BIWE 3VD9A 1CAUA 1UOBA 2BEOA 4BHPA 4IEWA 1O91A 2XJVA 4CSWA 3V64A 3DYPA 2WAAA 4OHVA 3H3UA 2QUOA 1VRH2 4FP2A 3NNLA 3GNEA 1LGCA 2PAKA 3IAPA 3N9NA 4AVVA 4QPIB 2CGNA 2NMOA 4FQ4A 1IHMA 1UWWA 2QCSB 3WLUA 3CJIB 1UKRA 4IV1B 4P08A 4MG2A 1MVQA 1WMFA 3A21A 5JSOA 3NVCA 2WL1A 1WLDA 5A6YA 3IN9A 4X8PA 1C4RA 2A6VA 5FK7A 3IDAA 3TEXA 1NOVA 5EWSA 2Y60A 3CJIA 1AL23 4KWUA 4P9GA 5IYYA 3G6JB 4IV1A 4JZRA 1NCQB 1AL21 1UX7A 4IGOA 4IDZA 4W4ZA 3AP9A 5T52A 4Z07A 5HCBA 3HNBM 4L9BA 3U14A 3WG3A 1US3A 1J59A 1GV9A 1DQ5A 3OBAA 1TZOA 1NY72 2XGXA 5FBZA 4EZHA 1HDKA 1VE0A 4L11A 4XDQA 3AP4A 1DF0A 2VVEA 1QOSA 2VCAA 3FFZA 5JMOA 5DZEA 2RDNA 2W87A 2ZX2A 1QMJA 1HRV2 3UKVA 1RYYA 4ARXA 5IK8A 2QQIA 4IEPA 2ORXA 1GMMA 4AF9A 1T6BX 1D4M2 2J7MA 3IWZA 3AVSA 2VC9A 2VCCA 2RS53 3FUOA 5DN2A 1OH4A 2WO3A 2RS51 5T5PA 3UT0A 2ZMKA 2DFBA 2JG9A 4Y5TA 2PAEA 2VTFA 3DYOA 1XC6A 1YIPA 2FDIA 4L2NA 4LLFA 3CLPA 4FQZA 1XB9A 1W0NA 5F32A 1G8WA 1GQPA 1W90A 2ZGTA 1BJQA 4WM8C 1V6OA 1YEWA 2RR12 4XDPA 3ZDSA 4ARYA 3AZYA 2WC2A 4PT6A 1JZ7A 3RI8A 5ERLA 3POFA 4NHLA 4YZ1A 1JXNA 4Z2AA 1AR72 2IVJA 4Y5SA 3A0NA 2J1TA 5FWEA 5A3MA 3DPRB 4LK6A 1MZEA 2JDAA 2X05A 3RVHA 2W1UA 4W6XA 3PUIA 2BYVE 1NKGA 1JZ6A 3VBRC 2D6PA 1BK0A 2QQKA 4Q4X3 4TWTA 5FV3A 1VBC3 2XJTA 5A7SA 4XFGA 2OUJA 5SV8A 4FPJA 4Q4X1 5J1XA 4ZHNA 1VBC1 2DFCA 2IVIB 1F4AA 3GHMA 1LU2A 3N9QA 4Q4W2 4XFAA 5FXZA 4CCNA 1US2A 4EN0A 4CDWB 5CFCB 4IE0A 5FBJA 1ODMA 2YGMA 5LATA 4EN8B 1QGLA 1UZYA 3WNPA 2D98A 1H2NA 1KJRA 5T5OA 3MW4A 4WBBA 3WY6A 2EXIA 1BZWA 4AGVA 3BUCA 4AVAA 1OF3A 4CDXB 1YJLA 4IESA 4CP2A 3T2PA 4YZ2A 4E2SA 1ZA4A 3RZMA 5FY4A 4XCBA 1UYZA 2ZX0A 3E5QA 1LCLA 2IXJA 3WW1A 5LZ6A 3D6EA 3IMNA 1KJLA 3BI3A 3QH6A 4OHYA 2MEV3 5LBBA 1CX4A 2QQOA 4GKYA 2P3YA 5CFCA 2MEV1 2X09A 4G4FA 4IGQA 1UZZA 1KDMA 1KD7A 1YLLA 2CGOA 4CZSA 5HCHA 1I9RA 1E5SA 2VW0A 1YJKA 4FPGA 4AOCA 4HLTA 2GNBA 2Y6JA 2B45X 2ZMLA 4BISA 2DCTA 5F37A 1OQDA 2YZ4A 3ACLA 3UL2A 1PVC2 3AMPA 3Q8FA 3LEKA 4LHNA 3W5MA 2BGCA 2PN5A 1FV3A 5LA9A 2PHDA 2VQUA 4XAAA 4RFRB 3W5NA 4RQPC 1YFXA 2E7QA 2XWJB 4ASKA 3LEGA 5JI9A 3BTXA 3K3NA 2Q5TA 5JZGA 4MH0E 3MW3A 3N3HA 1AL0G 2VY0A 5CA6A 1NT0A 5JXIA 2PTMA 5HXVA 4BDVB 4YGEA 5FZOB 5I0SA 1RUF2 5JXGA 3GM8A 3TYJA 5BNNB 4N53A 4YW3A 4DEQA 1JS9A 3ZN6B 2CNAA 2XWBB 1NXMA 1GZ9A 2VUCA 1EV13 1LU1A 1H8TC 1BCXA 1EV11 1HB2A 4OZOA 4B7KA 4PLMA 4QDQA 2XJUA 4A2UA 4XHBA 5JCTA 5KC5A 1BVVA 1H0BA 5ACA3 3FLTA 3BALA 2PHXA 1TMF2 3DN7A 3RZLA 1COV3 5ACA1 3TOJA 3I2JA 4HKOA 5BNQA 5FZOA 1COV1 1WD4A 3AKRA 3ZKYA 3MUY1 2RDRA 3VD5A 5FZHA 2GP5A 2JDUA 3ZN6A 4YM0A 1TME3 2VZTA 4L92A 5FMOS 1TME1 1FI2A 3IIAA 1KFXL 3BU0A 3RGBA 1SACA 2P1BA 2PHTA 2BZDA 2IXIA 4PHZA 2WSVA 4CU6A 1ULDA 3W21A 4YWAA 1F5JA 3UKNA 4CYDA 1E5RA 1LECA 2OX0A 4XJZA 5LK7B 1X8EA 3WZ1A 4CCOA 1YIFA 2EVXA 1RUI2 1HV1A 3LOIA 4N9HA 3O5SA 4DY3A 3UJQA 3ZXEA 3WSOA 1Y4WA 1GOGA 2WBKA 4M3CE 3GBGA 3ZFFC 5BUVA 2G4IA 5ABJB 3UETA 3NAPC 4XIKA 3OGSA 4OCTA 4IEZA 1MPXA 1YFUA 4LIVA 2WA3A 3T09A 1VJ2A 2J22A 4A6SA 5BYNA 1XU2A 1N3PA 3NO8A 2OS2A 1WKYA 3ENRA 1W2NA 2GNTA 1F5FA 4WZCA 3VL8A 5LCWL 1BYHA 1NUKA 2QQNA 2G9GA 1Y9QA 4RYDA 4TZDA 4QXHA 3WEZA 2YMZA 3IDEA 2ATFA 1VAMA 1XRUA 3HMYA 5ABJA 2PMWB 1HB4A 3B93A 5A7WB 5I0RA 3GHNA 2W52A 3OPWA 4DPNA 3T4VA 1TNRA 1JI6A 1HN1A 1YHFA 1REDA 2DVAA 4LXLA 4P14A 5F1RA 5E8AA 2D3PA 1OF4A 3ACIA 2ARAA 1ZZ8A 4LUMA 4UXAA 2DU0A 4HK8A 1O3SA 4HOOA 3TRSB 2VJXA 2QQWA 4HANA 4FPCA 4AGGA 2VO5A 2ID4A 4E2GA 1DGRN 2D40A 4CPBA 5A7QA 1QJU3 1HJFA 4MOAA 4ZXEA 2R043 3PHMA 5FLHA 2ZXQA 5A7WA 4BQ2A 1QJU1 3W20A 2R041 4A42A 2P17A 3JBG2 4F3JA 1W9FA 3UK9A 1ZRCA 3JZVA 3QBQA 1VB2A 2WQ4A 2R32A 1W6QB 3LF7A 3WF4A 4PBPA 2ARXA 4DUWA 1QXPA 3FFQA 2FCVA 4SLIA 2OKXA 4Q4V3 3GCWA 4CU9A 2P3KA 3LKJA 4YZ4A 4Q4V1 5FP9A 4FAHA 5FIXA 4WVWA 3WF0A 3P5BA 2Q1ZB 4S2HA 2X29A 5JUVA 1SMVA 2EXJA 4RGAA 5GM0A 4KU7A 2Y38A 3N9MA 5IK4A 1CX1A 1VP6A 4LHSA 1AXYA 1C57A 1DCSA 1V9U3 2VVFA 2HBTA 1K5JA 1VBE3 2G19A 3AFGA 1FPN3 1V9U1 4UAPA 4Y1UA 5FZDA 3FL7A 1VBE1 3ZYIB 1FPN1 1HW5A 4FPLA 1J58A 1VBB3 1ND3C 1QQP2 1W6QA 2NN8A 2Y6GA 1TEIA 3H1YA 4GQ7A 5LBEA 1VBB1 2OW4A 4UWDA 3FJSA 4LHLA 2VZQA 2A3XA 1B09A 2BFUL 2VMIA 2A6YA 2LW8A 1LGBA 5ANQA 3MGUA 4DEVA 1BBT2 2VQAA 3ME2A 5IVYA 3CIHA 1UOGA 1DG6A 3KV4A 5DPNA 2XVLA 3VB9A 3KT7A 2H0BA 4S2GA 1UN1A 5JSPA 2Z79A 3M3IA 2TUNA 3GALA 1FOD2 3MIEA 5CB7A 1OQ1A 4AVTA 2KA3A 1EAH3 1WMXA 3VD4A 1LOEA 3EHKA 2VULA 1EAH1 1PO13 1W2OA 2C1FA 1C3HA 2XBO3 1PO11 3SEPA 2AR6A 2XBO1 4ET7A 2BJSA 1WA6X 2FZ1A 4YNIA 4NWVA 2H6BA 4LQRA 2VGDA 4QQOA 5F5CA 2JIJA 4XE9A 4PIYA 1DLCA 1HX6A 3NJZA 1G86A 2A6XA 5JOXA 1W06A 4C90A 5IFPA 2HWD2 3EB7A 1XNKA 1FT9A 3C7EA 1DQ0A 4FSJA 2D6LX 3POJA 3OGVA 4PDWC 5BNPC 4DB5A 3T3YA 3CZUA 1R093 3KV6A 1GR3A 4Q1PA 1R091 3MPPG 4ZPIA 4WVZA 3VBOB 1CAVB 3LDRA 3HJRA 3IIIA 1RMU3 4IE7A 4Y5Z0 5HI0A 4E4DX 2X5IC 3CL1A 4LJHA 1PVXA 1RMU1 1RIRA 2DURA 1C8M3 4GWNA 1WW4A 4C8DA 3NL1A 1DYKA 4MV2A 4Q4Y3 3PU3A 4XURA 1C8M1 1MR5A 5FZCA 3RNSA 4C1XA 3Q8AA 5I91A 4Q4Y1 4Q5OA 1MS8A 5FAXA 4XPVA 5JMCA 2RV9A 3VV1A 2YBPA 4YVSA 1OLRA 1VR3A 1YQ2A 3SHRA 4RHV3 1CVNA 1CAXB 1W8NA 4FI9A 4K40A 4RHV1 3NSTA 1ALYA 2B5HA 2VUDA 2ZA9A 5F5AA 1W3XA 4P9JA 4QMAA 1CAVA 3VBOA 4I2OA 1QY4A 5GZCA 4LO8A 1ULOA 4P9XA 5BV6A 1XSRA 5E16A 2EXKA 1O8PA 2IXLA 3TEYA 2WQ8A 1MZFA 3KD4A 4A7KA 1PK6B 4UOJA 1J1TA 1C1LA 5FQ0B 1JZ2A 3URFA 3WDYA 3H7JA 5FUPA 4LLOA 4TN7A 3RYPA 4E4ZA 4M4RA 2ZGMA 1UY4A 2D5HA 2ZOEB 3I4IA 5FFOC 1CAXA 1Y9GA 2V72A 5FJKA 5FXVA 1DQ4A 3ES1A 3NJXA 1RUE3 4QHZA 3PL0A 5SV5A 4JQRA 4LORA 1RUE1 1G7YA 5IJRA 4AEJA 2FMYA 1YYNA 4AI2A 4BXSV 3ZSJA 4R4XA 4CXXA 4V2VA 4AI0A 1BEV3 3NNMA 1HLCA 2O8OA 3KF5A 3RZJA 5ISLA 1BEV1 1MS4A 4CUBA 1AR63 3KF3A 1BK1A 5FQ0A 1RHI3 1AR61 1W8FA 4Q2FA 4XXAA 3VZKA 2PHWA 1APNA 1Q8VA 1RHI1 2HEVF 1Y9MA 2WO1A 3C7OA 3R0RA 5T50A 2O1QA 2CGPA 1OURA 4LITA 5F2WA 3S0MA 1FMD3 4UW4A 4QX7A 1W28A 2YB7A 4LBMA 3O14A 1FMD1 2GH2A 2A6WA 5IFTA 3H9AA 1DFQA 4AVSA 4B29A 3VZLA 3WG1A 4XZUG 4GULA 4CP9A 3ST7A 5FZ4A 1LRHA 5L36A 3POIA 3HT2A 3EXUA 4D7YA 3TN92 4HN1A 3VLBB 2PHFA 1LHVA 2HWE2
chains in the Genus database with same CATH topology
1YQCA 1XSQA 2BDRA 1XSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQC A;  1XSQ A;  2BDR A;  1XSR A; 
#chains in the Genus database with same CATH topology
 2WAO A;  2YPJ A;  1SFN A;  2VZP A;  5FZM A;  4EN9 B;  4XJ8 A;  1W8O A;  4HVO A;  3WXP A;  1DYP A;  1L3J A;  3DKW A;  5JPM B;  5H9R A;  3ROU A;  1RIT A;  1Z78 A;  1WW6 A;  1CPN A;  1R08 3;  1R1A 2;  4IE4 A;  4KBZ A;  1UY0 A;  2JDM A;  2PYT A;  4LO7 A;  4Y20 B;  3ZXJ A;  1R08 1;  1XSQ A;  1KDK A;  4CP1 A;  3I3M A;  1RIN A;  1W6N B;  4LOT A;  1XND A;  2EAA A;  3WQB A;  4TXW A;  5FZ3 A;  2Y0O A;  3WW2 A;  4LT5 A;  1GNH A;  1A34 A;  2C26 A;  1UD1 A;  2RMU 2;  2VME A;  1OLQ A;  5AFE A;  3O0X A;  4EN7 B;  2R0F A;  3K3O A;  4WM7 B;  5F8P A;  1RC6 A;  3ZXA C;  2RM2 3;  5FP7 A;  5J36 A;  2JDZ A;  2RM2 1;  2P3I A;  4LE4 A;  2ZZQ A;  3VDC A;  1QJX 3;  1A3K A;  5J96 B;  2VMF A;  1QJX 1;  3S57 A;  1IG0 A;  4JRA A;  2YFZ A;  4RD7 A;  4CEY C;  4Y20 A;  3CQO A;  3HNY M;  5FP8 A;  3BKZ A;  4O7X A;  3RYR A;  1H6X A;  1W6N A;  2GP3 A;  3FN9 A;  1MEC 2;  3U1X A;  2VW2 A;  3DCQ A;  2ES3 A;  4O65 A;  4XIO A;  5DDJ 2;  2DCZ A;  1RUH 3;  4IEQ A;  5CFD B;  2IXH A;  1RUH 1;  4DO0 A;  1POV 3;  1POV 1;  2WII B;  5FZE A;  2BBV A;  1RVF 3;  5BNO B;  4NRM A;  1FX5 A;  5KXC A;  1LR5 A;  1RVF 1;  3VDD A;  4BM8 A;  2Z2S B;  1OA2 A;  3LFM A;  3ZSL A;  4JQT A;  2CAV A;  4NVP A;  1SFP A;  2NQY A;  5FZ6 A;  2J1E A;  3RWN A;  3DYM A;  5DAX A;  3PVO A;  4YYO A;  4YVW C;  1CPM A;  1AZD A;  4G9S B;  4N43 B;  3TEZ A;  1DYO A;  2VTX J;  2YC4 A;  2ZHN A;  2WSU A;  3Q8C A;  1UMI A;  5BNO A;  1NE6 A;  2D6N A;  2GN7 A;  3UGG A;  3DUI A;  2HH9 A;  1RTV A;  2HWF 2;  4QKB A;  3ZN4 A;  2HYK A;  5C4W C;  1QJF A;  1QJZ A;  4Z8B A;  4COW A;  1AYN 2;  1JHN A;  1W6O A;  4QPI C;  3C3V A;  4GWJ A;  3RZG A;  2P37 A;  4AQ2 A;  3CJI C;  4QT6 A;  1BKZ A;  2JG8 B;  4QAW A;  3DEM A;  4XAE A;  4JKL A;  2ZHM A;  5D8A B;  2JD4 A;  1PMI A;  1ULE A;  4N43 A;  4NAO A;  5JR7 B;  2E33 A;  4C1W A;  1ZZC A;  1HB1 A;  4L0P A;  1OA3 A;  2EIG A;  5GZF A;  3HIF A;  1OOP B;  5T5L A;  1JHJ A;  4FCA A;  5JSR A;  3I59 B;  4FBF A;  2QQM A;  1ZZB A;  2VOV A;  2D97 A;  4LKS A;  4OZX A;  5I8Y A;  1LTE A;  4IGP A;  3WW4 A;  3I3D A;  1POV 0;  4FPY A;  4JTN A;  3HR9 A;  4L8Q A;  5AC9 2;  4CCJ A;  3HBZ A;  1C5H A;  2JG8 A;  3K2O A;  1NCQ C;  3VBF B;  2YU1 A;  3AVR A;  3BB6 A;  4R9A A;  3O1U A;  1RUG 3;  2CY6 A;  5FZF A;  4JHT A;  1JZ4 A;  1RUG 1;  1OOP A;  3FHI B;  3DL3 A;  3VBS A;  1RUO A;  1UCX A;  3I59 A;  2ZGS A;  3GZE A;  3THC A;  4B1L A;  2JDN A;  1SHW B;  1YWK A;  4YG6 A;  5F3E A;  4LPL A;  5C8C B;  2XLF A;  2OA2 A;  4IV3 A;  2WN3 A;  4UW6 A;  3OPZ A;  3HQU A;  1WLC A;  3RG0 A;  1Y3T A;  3USS A;  1MS0 A;  1AF9 A;  5F3G A;  2UWA A;  2PXJ A;  1B35 C;  2DVG A;  2GMP A;  3PUA A;  4BQY A;  2N7G A;  5LEK A;  1JW6 A;  2EIB A;  3AYA A;  3T1L A;  4TTG A;  3H8O A;  2F4L A;  3J8F 3;  4MSV A;  4S2D A;  4MGK E;  4YZ3 A;  3UGH A;  3L2Y A;  4DFS A;  1GOF A;  1URX A;  2ZGU A;  3D0S A;  3IZO A;  3J8F 1;  1V6K A;  5EHD A;  5C8C A;  4AXO A;  2XVG A;  4OQ9 A;  4XF9 A;  4ZU7 A;  2R06 2;  4XBL A;  2W0X A;  1JBC A;  5DAW A;  3KM5 A;  3T4H B;  5KHK A;  1AXZ A;  2QQP A;  1BVP 1;  2CAU A;  2Y6L A;  4FOY A;  2DBN A;  4UFI A;  2NMN A;  1W0P A;  4DNY A;  1CQ9 A;  3MFA A;  4JGZ B;  1UPS A;  3DPR C;  3ILN A;  1LAJ A;  1GWK A;  3I2D A;  2OUH A;  2W1W A;  3WUD A;  2E6V A;  3Q9O A;  4QU1 A;  4B4R A;  4KGG A;  1S4C A;  5K4L A;  4AE2 A;  2X10 A;  4IL7 A;  3O1O A;  1O7F A;  2XXZ A;  1IKP A;  5FYI A;  2R7E B;  2JB4 A;  1Q3E A;  2W5F A;  2Z42 A;  5EYX A;  3KV9 A;  1QWR A;  1FAT A;  4WVM B;  1FNY A;  4AL9 A;  4CPB D;  2VMD A;  3O1P A;  4CDW C;  1YQC A;  3FLP A;  1S0E A;  5D2A A;  3IMM A;  3CDZ B;  3FLR A;  4P9I A;  4XUP A;  1IQD C;  3O0W A;  2QQL A;  4CDX C;  5A70 A;  4QQL A;  4UFH A;  3B5L B;  4M0H A;  2DVB A;  4SBV A;  4H55 A;  5FZ9 A;  3VUO A;  3RWK X;  4ES8 A;  4BMB A;  1SCR A;  1WME A;  4LTA A;  2ZKL A;  3OUI A;  4XF1 A;  2BDR A;  5FKC A;  4QU2 A;  1GQH A;  2RG4 A;  4WVM A;  4CDU B;  5A3L A;  1YRZ A;  1WCU A;  2QZ2 A;  3AB0 A;  1HXS 2;  4AK3 A;  4CCD A;  1U12 A;  1DBN A;  4Q27 A;  1LB2 A;  4DXS A;  3HN1 A;  1SEF A;  1WCS A;  3KHC A;  5K8S A;  5KHI A;  4J6G A;  2CSG A;  2DUP A;  2NZ9 A;  4BA6 A;  4D69 A;  3ZXL A;  4MXW B;  4N7I A;  4RN5 A;  1ASJ 2;  2R1D A;  2VMC A;  4Y22 B;  1ST8 A;  3RMX A;  5C3Q A;  1CGP A;  2J1A A;  1IPS A;  2ZCW A;  3PUR A;  3RZH A;  1ND2 C;  2A75 A;  3VD7 A;  5FPX A;  1PGW 2;  1LOF C;  2VNG A;  5IAV A;  4CDQ A;  4XYX A;  4CDU A;  3GBF A;  1J3P A;  1DGW A;  2DF7 A;  1NZI A;  2WUH A;  5KHJ A;  3SMH A;  4E8C A;  2ETE A;  2LRP A;  4M3C A;  3TBD A;  3U78 A;  1H4H A;  5FYV A;  3WP4 A;  4LMF A;  1LHN A;  2OQ7 A;  2AEZ A;  3SH4 A;  1N3O A;  2HLE A;  4DXR A;  1E5H A;  1PIV 2;  2UYB A;  1W8W A;  4YG3 A;  5BNN C;  3AMN A;  4MXW A;  1GWL A;  4Z82 A;  3S7I A;  4KG8 A;  4Y22 A;  1K5M B;  4MHU A;  3MV1 1;  4R9D A;  3KHB A;  4EZ4 A;  1A8D A;  3P6B A;  4YW6 A;  3WP3 A;  3MFC A;  4QX1 A;  3HWJ A;  4CVU A;  2XDV A;  4XF0 A;  4NE9 A;  1X50 A;  3M70 A;  5FO7 B;  1JZ3 A;  4W6Y A;  3VHR A;  3IDC B;  1VAL A;  4Q1R A;  4Q8L A;  2WN2 A;  4YGD A;  4YFZ A;  1DP0 A;  1H6Y A;  2Y0I A;  2K9Z A;  5DXD A;  5JOY A;  2V4V A;  3RMY A;  3VL9 A;  1LES A;  1K5M A;  1PX3 A;  3HT1 A;  3PME A;  3WX5 A;  4AAX A;  5LBC A;  4RS5 B;  3OB8 A;  4CP0 A;  4OI2 A;  2ADE A;  2HBU A;  3AJZ A;  2FCU A;  2XQX A;  1F9K A;  3U37 A;  2JG9 B;  4YM3 A;  3SLI A;  5EYY A;  1X7N A;  3USU A;  4E8D A;  3H8R A;  1ZRD A;  4QXB A;  2P4E A;  1AYM 2;  5JIU A;  3T08 A;  4Q29 A;  4XEZ A;  5D21 A;  4B3N A;  4XBQ A;  5IVB A;  1DQ2 A;  2WT1 A;  4K8F A;  2VPV A;  5F39 A;  2C9A A;  3TB0 A;  3CZJ A;  3KT1 A;  1H8V A;  5J09 A;  4DIQ A;  1WLT A;  5A1A A;  1Q43 A;  1IKQ A;  4XVH A;  2CWM A;  4RS5 A;  1LOC A;  3NV2 A;  3GCX A;  2P34 A;  1FAY A;  5CG9 A;  1EY2 A;  1KS5 A;  5CKQ A;  5FJH A;  3NRU A;  1W8H A;  2FQP A;  3OPT A;  1U5Y A;  3N7J A;  3IKW A;  5ABJ C;  2RE9 A;  2GAU A;  1Q56 A;  3WF3 A;  4CEW A;  1DZR A;  4KGQ A;  3JQW A;  2R07 2;  2DTY A;  5IVF A;  4EV0 A;  4AVB A;  1ZX5 A;  2AGS A;  3A4U A;  1GFF 2;  3MIH A;  4OUE A;  1CR7 A;  3O1V A;  2JKB A;  3AMH A;  2I74 A;  4OI1 A;  4OI4 A;  3LB9 A;  4QB1 A;  4HFS A;  4D94 A;  3PU8 A;  2HWB 3;  3OF1 A;  2HWB 1;  1OSG A;  1QDC A;  2ET7 A;  4JVA A;  1NXD 1;  2XJS A;  3PMS A;  1RB8 G;  4CXW A;  5KXE A;  2OZJ A;  3BTY A;  3MZH A;  4ZKT B;  3VBU B;  4MHR A;  1S0I A;  2WWJ A;  5F3I A;  1W8T A;  1EUU A;  1XJA A;  1VAV A;  2ZGQ A;  4MLO A;  1H9P A;  1WW5 A;  2J1S A;  2HKX A;  3HQR A;  4JX0 A;  1VBA 3;  2VBB A;  3VZN A;  1Y7B A;  1TMF 3;  1X9T A;  3ETQ A;  2BNM A;  1VBA 1;  2A70 A;  3OEA A;  5DAP A;  3MO4 A;  5FMD A;  1TMF 1;  5FZA A;  2LTN A;  2QQU A;  4I0B A;  3KT4 A;  2W2I A;  3I3E A;  1CAW B;  3ZSM A;  4O61 A;  3ZR6 A;  4I01 A;  4RR3 A;  3IDB B;  3VBU A;  2XON A;  2CHH A;  1X8M A;  2RHP A;  4LUL A;  1LOD A;  3HNM A;  2SBA A;  4AYU A;  1WLW A;  1AL2 2;  5JZG B;  3R05 A;  3ZXK A;  2K46 A;  4A45 A;  3IM0 A;  3KQ4 B;  3D0J A;  1QJE A;  1CAW A;  2WFF 3;  3R4D B;  4N53 B;  4LUK A;  3MV0 1;  4LR4 A;  3ALQ A;  2WFF 1;  4IEV A;  3B9C A;  1FNZ A;  4LHK A;  5FY8 A;  3ACF A;  4DRR A;  1QH6 A;  5C33 A;  4QQ2 A;  4MUV A;  5FZG A;  2WR9 A;  3GYD A;  1XOY A;  1AJO A;  5CZK A;  1LOA A;  3NV4 A;  4B4P A;  1OD5 A;  1I5Z A;  3D8C A;  4FVV A;  5CIR A;  2RS5 2;  1JYX A;  3JXS A;  2EIE A;  1XYN A;  4PIX A;  5FYY A;  1VIW B;  4XOG A;  3ZSE A;  4HXC A;  1D2Q A;  4MAD A;  1BLZ A;  3ZKU A;  5IUQ A;  1S2K A;  3OGG A;  5DQ0 A;  1GQG A;  4W6W A;  3MI8 A;  3B00 A;  4QB2 A;  3WD5 A;  2VBD A;  2MPF A;  2RDS A;  3MLJ A;  5I8S A;  1Z0H A;  1REF A;  1ULG A;  3I7D A;  4UFK A;  2BVB A;  2CYF A;  5A7O A;  1JOB A;  4CCM A;  1KQR A;  2FDH A;  3X29 B;  1H4G A;  3MIG A;  1VLN A;  2HWC 3;  2YBS A;  2BQP A;  2CL2 A;  2HWC 1;  3PTY A;  5FY5 A;  3ZLI A;  4NO4 A;  1X36 A;  5FPV A;  4ES9 A;  1H2L A;  2QVS B;  3I97 A;  2OT7 A;  3LIG A;  4D7S A;  3FHQ A;  3HN3 A;  2XML A;  4FTS A;  3NKG A;  4JKM A;  3DXU A;  1V6N A;  4DY5 A;  3R6S A;  3RPQ A;  4AFD A;  4Q4X 2;  1VBC 2;  2V09 A;  4YW1 A;  1AVB A;  3WQ1 A;  3LDB A;  4N8M A;  4DRV A;  3VKL A;  1LOB A;  4CCL A;  5K0U C;  4NIH A;  2YPD A;  3ZYG A;  4AED C;  3LAG A;  4H14 A;  4HKL A;  3C2U A;  3ZFG C;  4FAG A;  1YCI A;  3K4D A;  5FP3 A;  3K77 A;  5C3O A;  3SH5 A;  2DCY A;  1UYX A;  1GYK A;  1HRI 3;  4K1Z A;  3NW4 A;  4UF0 A;  3E6C C;  1HRI 1;  3FE5 A;  4Z92 B;  4AHW A;  4UT5 A;  1HN0 A;  2W9X A;  1DGW X;  2YYO A;  1H1A A;  4PLN A;  4HON A;  3ZXG A;  2TEP A;  3I3Q A;  1HQL A;  2VOW A;  1PHM A;  3H3L A;  3OYW B;  4MXV A;  5DZF A;  4PI2 A;  1RGS A;  4A7Z A;  1QQP 3;  2MEV 2;  3ECQ A;  3OUH A;  1QQP 1;  4D6R A;  3PJQ A;  5H9S A;  2XHK A;  3CEW A;  3V56 A;  5A6Q A;  5IHR A;  4Q0V A;  2JB8 A;  4QM9 A;  5GLT A;  1PMJ X;  3NJY A;  1JZ8 A;  1MVE A;  1XQN A;  5JXH A;  1PK6 C;  1W2A X;  1X33 A;  4NHM A;  5LB6 A;  3PNA A;  2NP0 A;  4COU A;  4YRD A;  1F31 A;  1S2E A;  4V1P A;  5FXX A;  4AQT A;  1H2K A;  4FPH A;  3WHT A;  4C0B A;  3OYW A;  4EWD A;  3U75 A;  2ZGL A;  3NMB A;  2WFP A;  4ASL A;  4LBK A;  3SKJ E;  5FOJ B;  4AQS A;  4M4P A;  2OYZ A;  4QB6 A;  3THT A;  1BMV 1;  1AJK A;  2FDG A;  4CE8 A;  3LE0 A;  4D7T A;  2BFU S;  4PQ9 A;  5JIA A;  5LAS A;  2Q0A A;  3VHP A;  2IFR A;  5TSW A;  4PCR A;  3D3A A;  3O0V A;  4OHW A;  4KU8 A;  2VOX A;  5A7P A;  3EBR A;  4NHX A;  1IS6 A;  2UYA A;  3K46 A;  4V2W A;  1IPJ A;  5FXW A;  4XUO A;  4HSL A;  1U5I A;  4TSV A;  1MQT B;  4FFF A;  1UO9 A;  3W59 A;  1EV1 2;  1ODN A;  1U5X A;  3NWK A;  2IC1 A;  3RJR A;  1KEX A;  3O1T A;  1ZA7 A;  3WG2 A;  4ZZ8 A;  3IAQ A;  5A1L A;  4AI8 A;  3OBT A;  3KLS A;  4XZP A;  2VQT A;  3RSJ A;  4IW3 A;  2ZS6 B;  3J7M A;  3AFK A;  3TNQ A;  5ACA 2;  4WM8 A;  2IXK A;  3BOW A;  4Q8K A;  5FZ1 A;  4UI9 L;  1AHS A;  5GLZ A;  2WT0 A;  4FXK B;  5C9A C;  4MGT A;  1O6U A;  2W91 A;  1P8J A;  2P6C A;  1TME 2;  3KCC A;  1MQT A;  1W04 A;  4RA0 A;  1UIK A;  4CUG A;  2OVU A;  3J7L A;  1MZ6 A;  3AYC A;  2IZW A;  5F6L B;  4ZZ5 A;  3CNA A;  4XUQ A;  5J98 B;  1ZZ6 A;  3FX3 A;  1OXC A;  1AR9 3;  5DUV A;  4D3W A;  1AR9 1;  3WW3 A;  5L7O C;  3RZZ A;  2PAM A;  4DUX A;  5FWJ A;  5CEH A;  1G9F A;  1UOJ A;  3ELN A;  4CTE A;  3NQH A;  3F2Z A;  3B94 A;  3POS A;  3RRD A;  2JDY A;  4OFG A;  1O8S A;  2E26 A;  2W95 A;  2Y33 A;  2AAC A;  4WM7 C;  1QF3 A;  1TVG A;  1NA1 C;  2WIN B;  1RUJ 3;  3C7H A;  3ORJ A;  1RUJ 1;  3L2H A;  1SDD B;  4EWA A;  3OY8 A;  5A3P A;  5EP9 A;  1NQJ A;  1AR8 3;  4J1W A;  5FCC A;  1QH7 A;  5CU1 A;  1AR8 1;  1YUD A;  1UYP A;  3ATG A;  1VMF A;  5FDB A;  4RQP B;  1W8U A;  1PM4 A;  2BVV A;  4BWO A;  2GU9 A;  4GAZ A;  3OUJ A;  2GNM A;  1GZT A;  5L9V A;  5KHG A;  2C9K A;  4XJW A;  3BPZ A;  1ZZ7 A;  5GLU A;  5CFD C;  5GKA C;  3I49 A;  3MIF A;  2GH8 A;  3H42 B;  3ACG A;  4Y3O A;  2AYH A;  2PLV 3;  1HIX A;  4IE5 A;  2VUA A;  4YGB A;  2PLV 1;  1YQ8 A;  1Y43 B;  3CO2 A;  1Q8P A;  1LNS A;  4KBB A;  4IER A;  1JOJ A;  3J7H A;  4QGL A;  4QPG C;  4Y4Y A;  2YC0 A;  4XJ9 A;  3VBH C;  2VXR A;  4KG0 A;  5A1F A;  4DMI A;  4RQP A;  4YVS B;  3SNM A;  3JD7 3;  4QD2 A;  3SCF A;  3EJK A;  3JD7 1;  1PNF A;  2ET1 A;  1O5L A;  4LK7 A;  1OQE A;  4Q0P A;  3W58 A;  2ORZ A;  4IXL A;  1QU0 A;  4XCA A;  1PX4 A;  1S0C A;  2ZAC A;  2C5D A;  3RS6 A;  2UWB A;  4ZU4 A;  4PJY A;  2D6K A;  3HAG A;  1QJU 2;  2JE9 A;  2R04 2;  1N47 A;  3E6D A;  4MGS A;  3V65 A;  3AP7 A;  5CG8 A;  4GIQ A;  3U11 A;  2XL9 A;  3BTA A;  1H8T A;  1QIQ A;  2HWE 3;  2BW8 A;  2GC3 A;  3WDX A;  2HWE 1;  3PIJ A;  4WV8 A;  5FZ8 A;  1CIY A;  1IG3 A;  2YUE A;  1DHK B;  2ZGO A;  2RJ2 A;  4D6S A;  4XF3 A;  5D8A C;  2GC2 A;  3GBW A;  4Q4V 2;  1BHG A;  3N7L A;  1HB3 A;  4A7Y A;  2YU2 A;  3TNP B;  4JHZ A;  1WA4 A;  4FTB A;  2RDQ A;  2W47 A;  1SQ4 A;  2WO7 A;  4BU2 A;  1OOP C;  1D0G A;  4Q0U A;  5F3C A;  2YGL A;  4QGM A;  2WYS A;  1V9U 2;  3I3B A;  5T5J A;  1VBE 2;  4AEM A;  5A3W A;  1FPN 2;  4FFH A;  5EJ3 A;  5C3R A;  4I0W B;  2HYX A;  3AXE A;  5H9P A;  1VBB 2;  1VPH A;  2O14 A;  5IW0 A;  1LJ7 A;  1Q8O A;  3ZFF B;  4FPK A;  4XC9 A;  4O9E A;  3VBF C;  1LHW A;  3MBW A;  2YHJ A;  5HXM A;  1C8N A;  3NAP B;  3B02 A;  3HPN A;  2E32 A;  3WDV A;  2W39 A;  3AJY A;  4CP9 B;  3KB5 A;  1DQ1 A;  4XFI A;  2VH9 A;  1HQN A;  5CKM A;  4NIG A;  1GZC A;  3DKQ A;  3LWC A;  1RUC 3;  2JE7 A;  4BME A;  1CZV A;  1RUC 1;  2A6Z A;  3JUU A;  4W65 A;  3VZJ A;  4L97 A;  3WDU A;  2B4K A;  4GH4 C;  4JGY C;  2VU9 A;  1EAH 2;  5C8C C;  1ZZ9 A;  4ATE A;  3P3P A;  5IAX A;  1PO1 2;  1AUY A;  1UXX X;  2ZHL A;  3C8X A;  2WNV C;  3M2M A;  2XBO 2;  5AVP A;  3ZFF A;  1G9A A;  1O4T A;  3A7Q A;  3NAP A;  1PZ7 A;  3IB3 A;  4DS0 A;  1XE8 A;  5D1I A;  1ZNP A;  4BLJ A;  1PO2 3;  4BIF A;  1PO2 1;  2JIG A;  2RS3 3;  4OMC A;  3ZYB A;  1GU3 A;  5C7G A;  3OTF A;  2RS3 1;  4ZS2 A;  4GB3 3;  1AX0 A;  1QOO A;  5GJ6 A;  2J1V A;  2WJS A;  4GB3 1;  3OD4 A;  2GME A;  2WS9 3;  2XJQ A;  2HWF 3;  1K45 A;  2WS9 1;  4JAA A;  5KXD A;  3T2T A;  2HWF 1;  2QTW B;  4AFB A;  5FLJ A;  4XAB A;  2OZ6 A;  1R09 2;  4R9B A;  3RZK A;  4JGZ C;  3UES A;  3GDB A;  2WZR 2;  5DUX A;  4HKW A;  1RMU 2;  1GLH A;  2IUW A;  4K1Y A;  2V5D A;  5FZI A;  3NJV A;  2WLP A;  4CCC A;  1SFY A;  3QCW A;  4H7L A;  3PIG A;  1C8M 2;  2ZMN A;  1ZRE A;  1IQA A;  5DUU A;  2GZW A;  4Q4Y 2;  3S30 A;  3OOX A;  4TLG A;  1QHD A;  2BOI A;  5IVC A;  5JPN B;  4CRQ A;  3H50 A;  3UGF A;  3VDD B;  4B4Q A;  4OI0 A;  5JOZ A;  1S0J A;  3RI9 A;  4RHV 2;  3F95 A;  4OUL A;  3TEW A;  3GZT B;  4JV4 A;  2H6C A;  1RUD 3;  2YFU A;  5JVV A;  5GZD A;  4LA2 A;  1RUD 1;  5E6H A;  2WA4 A;  5FYT A;  1MS5 A;  3K4Z A;  3TWI A;  5HCF A;  4PF5 A;  1SBE A;  4QX5 A;  4KQ7 A;  1A78 A;  2NLR A;  4FPE A;  5CAZ A;  3E1F 1;  5A6Z A;  4FOQ A;  2JWP A;  2JXA A;  4K9S A;  2AZ5 A;  2NYY A;  1S2B A;  4YW5 A;  1OKO A;  4RSU A;  4S2F A;  4OYU A;  2BNN A;  3POW A;  3T0B A;  1YO8 A;  4LBO A;  4XUT A;  4YW7 A;  5LA2 A;  4ASM B;  1W6O B;  4Y1Y A;  4ZS3 A;  4COV A;  1RUE 2;  2ADD A;  2P2K A;  2XLG A;  2G9F A;  4GAL A;  1SBD A;  2QE3 A;  5A80 A;  2K2S A;  3KV5 A;  3O1R A;  4R9C A;  4HPK B;  4U2A A;  4JDM A;  4J25 A;  4HL0 A;  5HCA A;  4ISR A;  3T0A A;  2ZEY A;  1ZBE 3;  1AR6 2;  4LO4 B;  1UZW A;  1HV0 A;  1BXH A;  3KGL A;  1RHI 2;  1ZBE 1;  1PGL 2;  2AUY A;  2GC0 A;  1JUI A;  1V0A A;  2IFW A;  4XDO A;  1FMD 2;  1TE1 B;  1UY3 A;  3SCH A;  4IUG A;  2VZR A;  1QJY 3;  1VRB A;  2X8K A;  1J84 A;  2RS1 3;  1QJY 1;  4P5Y A;  2LRO A;  3MLL A;  4AW7 A;  2RS1 1;  3DXT A;  4GJY A;  4PDW B;  5BNP B;  4IV1 C;  2VZV A;  4HPK A;  2Z4F A;  3EQE A;  5LW9 A;  5E88 A;  3FZ3 A;  1Z7S 3;  4XET A;  5GLW A;  4A44 A;  4MET A;  3SIT A;  1Z7S 1;  2EIC A;  1NLR A;  2XOM A;  1GNY A;  3M8L A;  4MX3 A;  4QKD A;  5LA1 A;  4AI9 A;  4HVR A;  3H1W A;  4AFA A;  5IT6 A;  2BU9 A;  3ZPO A;  3VBS B;  2X5I B;  3H3Z A;  4AWD A;  2DTW A;  3I54 A;  5EJZ B;  3OCP A;  2FDK A;  4LE3 A;  5K9Y A;  1IS4 A;  4IV3 B;  1LGN A;  3AZX A;  4AZZ A;  3P3N A;  1VBD 3;  3CHX A;  1R08 2;  4PDW A;  4A3X A;  3U07 A;  1W8Z A;  1VBD 1;  5BNP A;  3U4X A;  3WCS A;  2A7A A;  1QNY A;  1RJ7 A;  1SLB A;  3FBY A;  4RS5 C;  2GN3 A;  3ZMN A;  2JG9 C;  3ZIW A;  2FHR A;  5GZE A;  4BJ0 A;  4JKK A;  2X5I A;  4I3P A;  2W1S A;  5FYC A;  1ZBA 3;  1UU6 A;  4AHX A;  2RJL A;  3AL6 A;  1QJX 2;  1ZBA 1;  1V6I A;  2ZZJ A;  2EXH A;  5GZG A;  2XQR A;  2KR2 A;  3GGL A;  2DUQ A;  3K75 B;  2MHF A;  4LO6 B;  3AL5 A;  4AEK A;  1W05 A;  1I3H A;  4MGI E;  1CIW A;  5FTT C;  1F35 A;  5LWB A;  3OBZ A;  4Y24 A;  5FZK A;  1RUH 2;  2VW1 A;  3GZA A;  4B1M A;  5GLV A;  1C5I A;  1ASJ 3;  1UOF A;  1W9S A;  2CWS A;  3WQ7 A;  1UPI A;  1ASJ 1;  4IEY A;  5C71 A;  5FUN A;  1RVF 2;  4EE2 A;  4NUB A;  3D5O A;  3LZZ A;  4IND A;  5A7N A;  1OLM E;  3VD3 A;  1VRH 3;  3PUH A;  2D44 A;  5LY1 A;  1O3Q A;  1VRH 1;  3ZIX A;  1DGR A;  1J1L A;  3AKS A;  4RGG A;  5L19 A;  5C5U A;  4U36 A;  1S0G A;  5FRA A;  2WO2 A;  4M3C F;  4F7Z A;  4JDO A;  1OKQ A;  3WP6 A;  2UY9 A;  4AHY A;  2IWG B;  2VTX A;  3B69 A;  3ACH A;  3V0B B;  1LED A;  2SLI A;  2DUO A;  1OFN A;  3QOP A;  4XQW A;  4E4S A;  1J3R A;  1O3R A;  3MW2 A;  1I1E A;  1JU4 A;  2B42 B;  1FXZ A;  4JCK A;  3KSC A;  5CFC C;  4LBQ B;  2Y6F A;  3KWV A;  3AP6 A;  3RDI A;  1XNA A;  4KWJ A;  5JOW A;  5IK5 A;  4H3W A;  4ITC A;  2Z69 A;  1STM A;  5DAB A;  4XFC A;  5C3P A;  5C5T A;  3WNL A;  1GP4 A;  3J7N A;  3MIB A;  4UW5 A;  3WHU A;  1N1Y A;  3THP A;  3U0Z A;  2DWR A;  3WV6 A;  2GMM A;  4X6R B;  4PQQ A;  3V0B A;  4QDS A;  3SC7 X;  1NY7 1;  4CDQ B;  2HJI A;  4QX3 A;  5KWR A;  1M4W A;  3KGZ A;  1HRV 3;  2LM3 A;  1JYC A;  3I2I A;  4LBQ A;  5JZG C;  4M3C B;  1HRV 1;  4AHZ A;  3NV1 A;  1D4M 3;  3DV8 A;  5IK7 A;  4K7J A;  1XE0 A;  4BYY A;  1D4M 1;  1RUG 2;  5E1R A;  3VKO A;  2BPA 2;  3H1M A;  4N53 C;  1L7Q A;  5JLV A;  1OVS A;  4BLI A;  2Q8D A;  3ETP A;  3THD A;  2VVD A;  1XBF A;  3EO6 A;  3QAC A;  4I30 A;  4K6B A;  4XFH A;  2ZEZ A;  4NMI A;  1WD3 A;  4Y1Z A;  3ZR5 A;  4BK4 A;  3HBK A;  3LSE A;  4TYS A;  2YG0 A;  4MO3 M;  2PA7 A;  5T54 A;  3IPV A;  4E4H A;  1RXF A;  2IXC A;  4UBH A;  2GND A;  3BOP A;  5LBF A;  2RR1 3;  4CEY A;  3VKF C;  3MLK A;  2RR1 1;  2PHR A;  3LCP A;  2D6O X;  1W39 A;  1UZV A;  3MEP A;  5CNA A;  4NID A;  1AR7 3;  3G7D A;  3LPF A;  4YVW B;  4C0H A;  3J8F 2;  1AR7 1;  1Q8S A;  4BIO A;  5FPL A;  1H30 A;  3I8T A;  4PIZ A;  4UFM A;  4XHX A;  3USU B;  3OG2 A;  4BQX A;  1PNG A;  2XUE A;  2EID A;  4XBN A;  4CUC A;  2OPW A;  4EYU A;  1V00 A;  2L9L A;  3T2O A;  1KFU L;  5C4W B;  1GKB A;  5F2S A;  3S5A A;  2ZGP A;  1WBF A;  3AYE A;  2Y6H A;  3KQR A;  4QX0 A;  3MIC A;  2ZBJ A;  3ASI A;  4Q4W 3;  3S7E A;  1RJ8 A;  4Q4W 1;  3GZU C;  5J3U A;  2FDF A;  1JTZ X;  5A3O A;  4YVW A;  1GSL A;  1QDO A;  1WUV A;  3HD8 B;  2GSY A;  4LBL A;  2TNF A;  1G6N A;  3WNN A;  2ZGK A;  2FCT A;  3M3O A;  5I0D A;  5DG2 A;  1VMJ A;  2VCB A;  3ZX7 A;  3PVB B;  3KVB A;  4NR1 A;  4CEW B;  2LUW A;  2ZGR A;  4WVV A;  3M4F A;  4LKE A;  3AKQ A;  1F15 A;  5C4W A;  4MGY E;  2E31 A;  4P00 B;  3L9J T;  1WGP A;  4M01 A;  1NAE A;  4QPI A;  1JOP A;  4AGR A;  4AAP A;  1YNA A;  4AFM A;  3M3E A;  4BPZ A;  4KMQ A;  1ZRF A;  1MAC A;  1WMD A;  1HKD A;  1PMH X;  2VNO A;  1DZT A;  3ILF A;  2DVD A;  5BXX A;  1W3V A;  2GC1 A;  3CMG A;  5FO9 B;  2WKK A;  4QXC A;  3BIE A;  4JC1 A;  3WCR A;  3BU7 A;  3ZYF A;  4GMP 0;  2AEN A;  3I2H A;  1I6X A;  4NPR A;  3OBR A;  1EYB A;  1ACC A;  1NE4 A;  1PVC 3;  2DDU A;  1KXG A;  3S5Q A;  1GIC A;  2NPI A;  1PVC 1;  1T6G C;  1DDL A;  2VNV A;  3IBM A;  4W8J A;  1ZM1 A;  1GAN A;  2NM1 A;  2B9U A;  4D0Q A;  2Y64 A;  1QOT A;  1YC6 1;  4Y4R A;  5G05 L;  4MZU A;  1CJP A;  3E5U A;  4FPF A;  1YXW A;  2R49 A;  2CV6 A;  1MZ5 A;  1OVP A;  4K20 A;  3U10 A;  1NCQ A;  3A22 A;  5B4N A;  3WDT A;  4HMZ A;  4I0A A;  3LOB A;  3J9S A;  2VE1 A;  4NOT A;  5KR7 A;  1OT5 A;  1RUF 3;  2JEM A;  2WYF A;  4QX8 A;  4YG0 A;  5F5Q A;  1B35 B;  1RUF 1;  2EF6 A;  3AZW A;  2D93 A;  2WNU B;  4RR3 B;  4EN6 B;  2BGO A;  3BGA A;  4QHO A;  2VUJ A;  3BOD A;  3LDK A;  5CVR A;  4HT1 T;  3PTR B;  4EWE A;  4HET A;  4YM2 A;  5IAT A;  2F6B A;  4AVC A;  2UY8 A;  3ZFE B;  4XFB A;  5I93 A;  3WR0 A;  1WW7 A;  5FY0 A;  4FO9 A;  2Q1M A;  2QBX A;  4X8N A;  1XNC A;  2C6S A;  2QDR A;  4NJ4 A;  2QFE A;  1B35 A;  3FUQ A;  1MQT C;  2D43 A;  2UU8 A;  2VQ0 A;  3KCY A;  4YGC A;  4YZ5 A;  2WWU A;  2C0Z A;  2VNR A;  4DOU A;  2WNU A;  1ONA A;  3M3Q A;  4GA9 A;  4M00 A;  2FZ2 A;  4BZ4 A;  2Q8O A;  4N90 A;  2Y34 A;  1K3I A;  1DU3 D;  1DGL A;  4D8M A;  1W9T A;  1O3T A;  4NHK A;  1UNB A;  1O5U A;  3E97 A;  3K51 A;  3ZFE A;  1NCR B;  4IEU A;  2DYC A;  1W03 A;  1RXG A;  4DUV A;  3N4M A;  2R6Q A;  2Q1F A;  4KH9 A;  2DCJ A;  2QDN A;  1LEM A;  3WVJ A;  4FT8 A;  4AR2 A;  4BB3 A;  2WAB A;  3B7M A;  3DPR A;  1RUI 3;  5CYY A;  4QKF A;  2KD7 A;  1AX1 A;  1F2N A;  1RUI 1;  5FY7 A;  1LHO A;  1ZRI A;  1NG0 A;  2A3W A;  1S55 A;  3AKT A;  2JDP A;  1FV2 A;  3JB4 C;  2XJP A;  1NCR A;  5EJ1 B;  3EMR A;  1OPO A;  4WZF A;  2WQZ C;  4CDW A;  3AC0 A;  2LAL A;  5JWP A;  4OVE A;  5APA A;  1AXK A;  2DBI A;  4XUN A;  4LOS A;  4PI0 A;  4PF1 A;  2B46 X;  1SPP B;  4JDN A;  4CDX A;  1OI6 A;  3SEE A;  2DV9 A;  2J1R A;  4I3G A;  4K21 A;  2W92 A;  1OH3 A;  5C6C A;  3J4U H;  4Y1V A;  3UKT A;  4F83 A;  2HEW F;  3PUQ A;  4OHZ A;  1ND2 B;  2VCM A;  4NIA A;  1QXR A;  4K8R B;  1BQP A;  3LD8 A;  5LEJ A;  1JYN A;  3JB8 A;  1PZ8 A;  1UIJ A;  5IVJ A;  3WUC A;  1CZT A;  2HWB 2;  4NRO A;  4OQ8 A;  1XPW A;  2ENR A;  5EQU A;  4XW3 A;  5DZG A;  1SPP A;  5A32 B;  4Q26 A;  3BTZ A;  1N3Q A;  4PLO A;  3ZN5 A;  5FYS A;  3W9A A;  4HZF A;  3N36 A;  4UF0 B;  1ND2 A;  3SCG A;  1G9C A;  1LOF A;  4N7U A;  5CBL A;  3JBG 3;  4YVS C;  3JBG 1;  2D6M A;  4HN0 A;  4A4A A;  3NKT A;  3K48 A;  1LOG A;  2VOK A;  1VBA 2;  1J83 A;  3VBO C;  3RJ2 X;  1NQD A;  2BBA A;  5KXB A;  5I0U A;  1ZYB A;  5A32 A;  1CES A;  5FLI A;  5T3N A;  5BNN A;  3O7O A;  2BUK A;  1JZ5 A;  2VBP A;  5FKB A;  3GXU A;  3LFI A;  5EFU A;  2W94 A;  4ERO A;  5EXO A;  1Q5O A;  4RFT 0;  1GZW B;  3VDA A;  5C8W A;  1E57 A;  4BQ1 A;  5B2G B;  3V0A B;  4FTE A;  5FZB A;  1TG7 A;  3MYX A;  1SCS A;  1UU4 A;  4FP3 A;  4QM8 A;  4BOW A;  3WF1 A;  4OHX A;  4NPM A;  4KL1 A;  2Y26 A;  3N7K A;  1X9P A;  4XMA A;  4XIL A;  3WT3 A;  2E63 A;  1H1M A;  3O1S A;  5DUW A;  1BBT 3;  2ERF A;  2R1B A;  4QPY A;  1UY2 A;  2YRO A;  4HSJ A;  1BBT 1;  3VZM A;  4QDR A;  1DLL A;  1OD3 A;  1SBF A;  2D3S A;  2WFF 2;  4XQD A;  4ZXK A;  3NV3 A;  2ZGN A;  3O1M A;  3ABZ A;  1WCK A;  1GZW A;  2VZU A;  3V0A A;  2WZE A;  2CTV A;  1FOD 3;  1S1A A;  5FMB A;  1XYP A;  3HVD A;  4A41 A;  1JYI A;  1W6M B;  3ON7 A;  1FOD 1;  5FRE A;  4OUS A;  5F5I A;  1G9D A;  1W0O A;  3NNG A;  3AZZ A;  4XF4 A;  3D82 A;  4BK5 A;  2ZKN A;  4P5H A;  4TLF A;  1GP6 A;  3HQX A;  4R4Z A;  3LIH A;  5CAD A;  4WM8 B;  5FY1 A;  1ENX A;  5FO8 B;  1OA4 A;  4CCE A;  4QWN A;  3OD0 A;  3B01 A;  3T30 A;  4LBJ A;  3C7F A;  5EZW A;  2EAL A;  3T0D A;  4C91 A;  1X82 A;  1IOA A;  1I5P A;  1HQW A;  2WNO A;  5FMO L;  5F6K A;  2AC1 A;  1W6M A;  3JQX A;  2G1M A;  2HWD 3;  1WBL A;  5LK5 A;  2HWD 1;  4MGQ A;  1UYY A;  3VBR B;  4HVQ A;  2BWC A;  2W46 A;  4N9I A;  5FYH A;  2I2S A;  3MDP A;  4XXP A;  1ULC A;  5CKN A;  2R16 A;  1COV 2;  1Q8Q A;  4J1X A;  1O4Z A;  2HWC 2;  3AM2 A;  4FFI A;  5EV7 A;  2OII A;  2C4X A;  4XTP A;  2FBE A;  3B3Q E;  4ZY9 A;  4B7E A;  5A3N A;  1CWP A;  3LA3 A;  1S0D A;  3E5X A;  3BPS A;  5A3T A;  3LA2 A;  4XTM A;  4Q0Q A;  3WDW A;  5FR3 A;  5HV0 A;  1YQ5 A;  2VR4 A;  2Y8K A;  4QKN A;  3VBR A;  3OY8 B;  4ORF A;  1GP5 A;  2TBV A;  2BWA A;  1DIW A;  1H2M A;  3DGT A;  2GAL A;  5H9Q A;  4RGK A;  3ZDV A;  2J1U A;  3SH3 A;  4EQV A;  2QKD A;  2XH6 A;  1SLT A;  1OUS A;  2W3J A;  1XU1 A;  1XE7 A;  5B4X A;  1IS3 A;  1UQX A;  3BVC A;  2AEY A;  3N9P A;  2WRA A;  1R64 A;  4GKX A;  2A5Z A;  3T2Q A;  1HRI 2;  2Q8C A;  1WWY A;  2WWS A;  2A71 A;  3CF6 E;  5FPU A;  5A33 B;  4KWL A;  4KI5 M;  1QKQ A;  3VDD C;  4G3Y C;  2W1Q A;  3VHO A;  4LKD A;  2D5F A;  3SQO A;  4XQ4 A;  4R8H A;  2E51 A;  2ZX4 A;  4X6Q B;  1UF2 C;  1NLQ A;  3MID A;  3BN6 A;  1H9W A;  3ZVX A;  3VDB A;  1EPZ A;  2ILM A;  3J26 N;  1LUL A;  2PEL A;  3QD6 A;  3PVE A;  1NZC A;  2W08 A;  4OMD A;  3AX4 A;  1REE A;  4LBQ D;  1F4H A;  1PM7 A;  4QGN A;  1L7R A;  3WNX A;  3ZSK A;  2YBK A;  1XNB A;  1NX9 A;  2WLQ A;  4GWM A;  4QQH A;  1XYO A;  5A33 A;  5BNO C;  5M0T A;  5HBA A;  4NRQ A;  3H0O A;  2QNK A;  1YFW A;  1H8T B;  1BMV 2;  1R1Z A;  3H8U A;  1UXZ A;  1UW8 A;  1WCD J;  2UUR A;  3AMQ A;  4XJU A;  4PBO A;  3ZYP A;  3WF2 A;  5BPX A;  4MYE A;  3WIN E;  5G04 L;  2C24 A;  5J48 A;  4N43 C;  4YM1 A;  3B9I A;  4FPO B;  1JYW A;  4M0N A;  3OGJ A;  3ITQ A;  2FDJ A;  1SDW A;  3NNF A;  1N1T A;  2QQJ A;  2A73 B;  2XKP A;  4LKF A;  1YQ6 A;  3TN9 3;  4NII A;  5IVE A;  3TN9 1;  1JH5 A;  1WCQ A;  4L99 A;  3AMM A;  4MVT A;  2FD8 A;  1DZQ A;  2JG8 C;  3AP5 A;  1SLI A;  2G9Z A;  2AH2 A;  2DVF A;  1R1A 3;  1OLM A;  1W99 A;  2VD7 A;  3LEM A;  1CN1 A;  1R1A 1;  2JJ6 A;  5L9B A;  5I8T A;  5K0U B;  4GXL A;  2BRT A;  3FC0 A;  5LRR A;  4AED B;  2WZR 3;  2ZAH A;  1V6L A;  2WZR 1;  3VBS C;  3ZFG B;  2RMU 3;  3ES4 A;  4UBG A;  1IZ3 A;  2P5B A;  2RMU 1;  3QH7 A;  1DQ6 A;  3WOG A;  2BTV C;  4GD4 A;  1IS5 A;  1N1S A;  1AR9 2;  4FFG A;  3GF6 A;  2PQQ A;  3UNP A;  4IV3 C;  2A3Y A;  2K0G A;  4IEX A;  5F7U A;  4OUM A;  4YFW A;  2BNO A;  3ZXD A;  3ZYR A;  1KGY A;  3POG A;  3EYP A;  3KZ4 C;  1C28 A;  2OQ6 A;  2VMH A;  4FOV A;  4BH9 A;  1ULF A;  3POY A;  3PDQ A;  1UMH A;  5K0U A;  2JX9 A;  1MS3 A;  1MEC 3;  4AED A;  1GWM A;  5FUI A;  2CU5 A;  2QZ3 A;  4BE3 A;  4Z2W A;  5C3S A;  1RUN A;  1MEC 1;  3PVN A;  2LS6 A;  3ZFG A;  5DDJ 3;  2ZEX A;  2F4P A;  5J37 A;  2CDO A;  2VL4 A;  5DDJ 1;  2Q30 A;  1RUJ 2;  2RJK A;  4IEO A;  1EPW A;  2JEC A;  3VN4 A;  4Z1V A;  2E53 A;  4CCK A;  2WDB A;  3I2G A;  5IVV A;  4QXK A;  1KRI A;  1AR8 2;  3A23 A;  2O0O A;  5I0T A;  1W6P B;  2D7F A;  1CZS A;  4ZON A;  4B8E A;  1V6M A;  2A1X A;  4CXY A;  3BCW A;  2BP6 A;  3M7A A;  5FPZ A;  3A0K A;  3PUS A;  3RFR A;  2ZPX A;  2PHU A;  5J7M A;  1D0H A;  5LRS A;  3RYK A;  2X53 S;  2XG3 A;  1G9B A;  2XHN A;  5JR2 A;  4UFJ A;  2PLV 2;  2PHL A;  4XMI A;  4Q0S A;  1PK6 A;  3S6P A;  4UW3 A;  4D6Q A;  2WT2 A;  2JKX A;  3OGR A;  1PGL 1;  4NHY A;  1W6P A;  2CDP A;  3FWE A;  1CON A;  5IWF A;  1RL3 A;  1AYN 3;  2BOJ A;  1POQ A;  2ZJC A;  3JD7 2;  3JU9 A;  3M1H A;  1K42 A;  2XUM A;  1AYN 1;  2XL7 A;  3HEI A;  1EP0 A;  5DAQ A;  2B8M A;  2R30 A;  4H2A A;  2V5Y A;  2XVK A;  1W9W A;  4LA3 A;  1U0A A;  3N35 A;  5K7P A;  1YFY A;  3KMH A;  4ISQ A;  2P3J A;  4NRP A;  1MS1 A;  4AI3 A;  5CIS A;  3POB A;  2QQV A;  5F9T A;  3CU7 A;  1E5I A;  1HJG A;  3MHZ A;  3UJO A;  3LSD A;  5C9A B;  1LHU A;  1F8V A;  4BXF A;  4MGZ E;  1SLC A;  3SKV A;  2OXB A;  3VKN A;  2EA7 A;  4GWI A;  4Y1X A;  1JUH A;  4QHB A;  3IT8 A;  3OEB A;  4FXG B;  1S0B A;  3VHN A;  3MF9 A;  5AC9 3;  1ND3 B;  5L7O B;  3ZM8 A;  4DXT A;  1JU3 A;  2RVA A;  3ZXF A;  5AC9 1;  5HV4 A;  4LNV A;  2WNE A;  4DXZ A;  1O59 A;  2YC2 A;  4NN0 A;  4P9W A;  1OMI A;  1OC1 A;  2HEY F;  2XJR A;  1XNT A;  5LA0 A;  2VMG A;  5C9A A;  1QNW A;  2KM2 A;  4O9G A;  3K4A A;  1WZX A;  2I07 B;  1L7L A;  3WNK A;  2ARB A;  2OPK A;  4BQW A;  4CDQ C;  1NA1 B;  5JI7 A;  1CJD A;  3DEC A;  3ZPY A;  2JDH A;  5FPB A;  3VGI A;  1UZ0 A;  2EAK A;  1UX6 A;  4BCU A;  2P6H A;  2D3R A;  4BQ5 A;  4P9Y A;  5KC6 A;  4BQ3 A;  1AX2 A;  2JD9 A;  4IE6 A;  5FZ7 A;  1NYW A;  1ND3 A;  3LGR A;  5L7O A;  4XJA A;  2BGP A;  3WNO A;  2I45 A;  3FMG A;  4QX2 A;  3AZV A;  5FMC A;  1UY1 A;  1ULP A;  2ZEW A;  5L73 A;  3UYJ A;  4CU8 A;  5FYZ A;  2JDK A;  1D4V B;  1BEV 2;  2VZ1 A;  1OHF A;  1W2U A;  2VOT A;  4GZ9 A;  1PGS A;  1ENR A;  1S0F A;  4BQ4 A;  2UWC A;  1RUC 2;  4I09 A;  5KHH A;  5C70 A;  4WM7 A;  1ZVF A;  2VXJ A;  4KNC A;  1NA1 A;  4CU7 A;  2Q4S A;  2XB6 C;  5FY9 A;  4JRL A;  2E7A A;  2R06 3;  4YW4 A;  1JYT A;  3GJB A;  5LY2 A;  4QPG B;  2R06 1;  3VBH B;  4XFF A;  2B7Y A;  1PO2 2;  4HBN A;  5DAV A;  1K5M C;  4P02 B;  5FYB A;  3MF6 A;  2RS3 2;  2YV8 A;  5T55 A;  5FZ0 A;  5JDB A;  5CFD A;  4GB3 2;  1UKG A;  3FBM A;  4COZ A;  1XXN A;  2F17 A;  3N9L A;  4AI1 A;  1EUT A;  2E9Q A;  2XLA A;  2WS9 2;  1D7P M;  3P1I A;  1PZ9 A;  2XR4 A;  3WG4 A;  1UL9 A;  1UMZ A;  4DIN B;  4E27 A;  1C1F A;  4QPG A;  5ANN A;  1W9Y A;  3VBH A;  1GOH A;  1SG3 A;  1IPK A;  1ENQ A;  3ZYH A;  3T1M A;  2R0H A;  4GJZ A;  5EIY B;  4R52 A;  1VAK A;  4AFC A;  3R4U A;  1VMH A;  4HK9 A;  4UYB A;  1SZB A;  4CDU C;  2DU1 A;  3D4K A;  2DCK A;  2VAU A;  1A6C A;  4NPL A;  4YPJ A;  4URA A;  3VKM A;  2RM2 2;  4YAR A;  2VZO A;  4JTO A;  4CA9 A;  3Q8B A;  4YLZ A;  1V70 A;  4DZG A;  3HOB A;  4K3U A;  3Q8E A;  4CEW C;  3N7M A;  1GNZ A;  1T2X A;  2ZHK A;  3AXD A;  5FOB B;  3MUZ 1;  4AG4 A;  3NNJ A;  2ARC A;  4NWW A;  1CD3 G;  1GUI A;  2Z5W A;  4ZU5 A;  1HXS 3;  1RUD 2;  5HPO A;  1JYV A;  1SLL A;  3OJB A;  2VZS A;  1HXS 1;  2H0V A;  1M06 G;  3JCI A;  5D8A A;  1J3Q A;  3ZO0 B;  5A3U A;  2QJV A;  4NAM A;  4OLL A;  4QPW A;  2XPJ A;  4ONU A;  2WZP P;  4P9L A;  5L9R A;  3BYW A;  3CJX A;  4AQ6 A;  5FPA A;  5FZL A;  4E9K A;  1NLS A;  4HG6 B;  3TAY A;  5KBF A;  4GH4 B;  1PGW 1;  4JGY B;  3POE A;  4URT A;  2BV4 A;  2J42 A;  3SIS A;  4A6O A;  3ZYJ B;  5JXJ A;  4CUA A;  4H7M A;  2XKO A;  1OFS A;  2WNV B;  4E2Q A;  1GBG A;  3VBF A;  5AVA A;  2VZ3 A;  5GAL A;  3LQC A;  1PIV 3;  3H7Y A;  4W50 A;  1LEN A;  1YI7 A;  5FYU A;  1PIV 1;  3I2O A;  1MS9 A;  1ZBE 2;  3C7G A;  3LEI A;  3WQ0 A;  1QEX A;  2Q8E A;  5DG1 A;  2WNU C;  2YXS A;  4RR3 C;  3VBU C;  2FMD A;  2ZAB A;  4Y33 A;  4UFL A;  5FK8 A;  3GJA A;  3AKP A;  4GH4 A;  4JGY A;  3SXW A;  2JEN A;  3ILR A;  3KS7 A;  1KS4 A;  4LIU A;  4QQP A;  1QJY 2;  3LA7 A;  3ZFE C;  3WNM A;  2WNV A;  2RS1 2;  4FOW A;  2V4A A;  3E6B A;  5E89 A;  2O8Q A;  1ZRR A;  3VZO A;  1IGO A;  2ZAA A;  1OUX A;  3KVA A;  1LKN A;  3WP5 A;  2BER A;  1Z7S 2;  3RQ0 A;  5AFB A;  2Y6K A;  3PJY A;  2W68 A;  1K12 A;  2GDF A;  2ARE A;  1O4Y A;  1UAI A;  4LBN A;  1VB4 A;  4RL7 A;  1QXJ A;  4A3Z A;  1ENS A;  5A6X A;  3AK0 A;  3APB A;  4XAC A;  5DMY A;  4I02 A;  1AYM 3;  1D2S A;  3I2K A;  3AYD A;  1AYM 1;  4COY A;  1NCR C;  5JAX A;  3OSD A;  5FYM A;  1W2T A;  1VBD 2;  2YY1 A;  2YDE A;  3DF0 A;  4YSF A;  3LPG A;  2ZX1 A;  3IPV B;  1SLA A;  4IET A;  1YI9 A;  2ZX3 A;  3MPB A;  1JN2 P;  3ZOI A;  4CEY B;  1H1I A;  4F8A A;  4JGZ A;  3UV9 A;  5BY5 A;  4YW2 A;  1KIT A;  1N1V A;  1U5Z A;  3O12 A;  2ZTN A;  1ZBA 2;  1JMU B;  3ZMO A;  4DQA A;  4Y26 A;  3U4S A;  3PLQ A;  1CAU B;  5FP4 A;  5EPA A;  3R4S A;  1TQ5 A;  2R07 3;  1V6J A;  2E7T A;  2PFW A;  2R07 1;  3CKH A;  3H8X A;  1TNF A;  3INA A;  4GMP 3;  4EJR A;  1UU5 A;  4GMP 1;  4LEJ A;  2B39 A;  2JE8 A;  2VM9 A;  2VEC A;  2V73 A;  3FHA A;  4LO5 B;  2JIC A;  2WZ8 A;  3N9O A;  2MNG A;  4ATF A;  1FYU A;  2B9V A;  3CBN A;  2KXL A;  2VG9 A;  1A8M A;  3I2F A;  3QLQ A;  4IQP A;  1JOD A;  1OPM A;  2PQS A;  1OBN A;  3M3C A;  3KCX A;  4KWK A;  3BIW E;  3VD9 A;  1CAU A;  1UOB A;  2BEO A;  4BHP A;  4IEW A;  1O91 A;  2XJV A;  4CSW A;  3V64 A;  3DYP A;  2WAA A;  4OHV A;  3H3U A;  2QUO A;  1VRH 2;  4FP2 A;  3NNL A;  3GNE A;  1LGC A;  2PAK A;  3IAP A;  3N9N A;  4AVV A;  4QPI B;  2CGN A;  2NMO A;  4FQ4 A;  1IHM A;  1UWW A;  2QCS B;  3WLU A;  3CJI B;  1UKR A;  4IV1 B;  4P08 A;  4MG2 A;  1MVQ A;  1WMF A;  3A21 A;  5JSO A;  3NVC A;  2WL1 A;  1WLD A;  5A6Y A;  3IN9 A;  4X8P A;  1C4R A;  2A6V A;  5FK7 A;  3IDA A;  3TEX A;  1NOV A;  5EWS A;  2Y60 A;  3CJI A;  1AL2 3;  4KWU A;  4P9G A;  5IYY A;  3G6J B;  4IV1 A;  4JZR A;  1NCQ B;  1AL2 1;  1UX7 A;  4IGO A;  4IDZ A;  4W4Z A;  3AP9 A;  5T52 A;  4Z07 A;  5HCB A;  3HNB M;  4L9B A;  3U14 A;  3WG3 A;  1US3 A;  1J59 A;  1GV9 A;  1DQ5 A;  3OBA A;  1TZO A;  1NY7 2;  2XGX A;  5FBZ A;  4EZH A;  1HDK A;  1VE0 A;  4L11 A;  4XDQ A;  3AP4 A;  1DF0 A;  2VVE A;  1QOS A;  2VCA A;  3FFZ A;  5JMO A;  5DZE A;  2RDN A;  2W87 A;  2ZX2 A;  1QMJ A;  1HRV 2;  3UKV A;  1RYY A;  4ARX A;  5IK8 A;  2QQI A;  4IEP A;  2ORX A;  1GMM A;  4AF9 A;  1T6B X;  1D4M 2;  2J7M A;  3IWZ A;  3AVS A;  2VC9 A;  2VCC A;  2RS5 3;  3FUO A;  5DN2 A;  1OH4 A;  2WO3 A;  2RS5 1;  5T5P A;  3UT0 A;  2ZMK A;  2DFB A;  2JG9 A;  4Y5T A;  2PAE A;  2VTF A;  3DYO A;  1XC6 A;  1YIP A;  2FDI A;  4L2N A;  4LLF A;  3CLP A;  4FQZ A;  1XB9 A;  1W0N A;  5F32 A;  1G8W A;  1GQP A;  1W90 A;  2ZGT A;  1BJQ A;  4WM8 C;  1V6O A;  1YEW A;  2RR1 2;  4XDP A;  3ZDS A;  4ARY A;  3AZY A;  2WC2 A;  4PT6 A;  1JZ7 A;  3RI8 A;  5ERL A;  3POF A;  4NHL A;  4YZ1 A;  1JXN A;  4Z2A A;  1AR7 2;  2IVJ A;  4Y5S A;  3A0N A;  2J1T A;  5FWE A;  5A3M A;  3DPR B;  4LK6 A;  1MZE A;  2JDA A;  2X05 A;  3RVH A;  2W1U A;  4W6X A;  3PUI A;  2BYV E;  1NKG A;  1JZ6 A;  3VBR C;  2D6P A;  1BK0 A;  2QQK A;  4Q4X 3;  4TWT A;  5FV3 A;  1VBC 3;  2XJT A;  5A7S A;  4XFG A;  2OUJ A;  5SV8 A;  4FPJ A;  4Q4X 1;  5J1X A;  4ZHN A;  1VBC 1;  2DFC A;  2IVI B;  1F4A A;  3GHM A;  1LU2 A;  3N9Q A;  4Q4W 2;  4XFA A;  5FXZ A;  4CCN A;  1US2 A;  4EN0 A;  4CDW B;  5CFC B;  4IE0 A;  5FBJ A;  1ODM A;  2YGM A;  5LAT A;  4EN8 B;  1QGL A;  1UZY A;  3WNP A;  2D98 A;  1H2N A;  1KJR A;  5T5O A;  3MW4 A;  4WBB A;  3WY6 A;  2EXI A;  1BZW A;  4AGV A;  3BUC A;  4AVA A;  1OF3 A;  4CDX B;  1YJL A;  4IES A;  4CP2 A;  3T2P A;  4YZ2 A;  4E2S A;  1ZA4 A;  3RZM A;  5FY4 A;  4XCB A;  1UYZ A;  2ZX0 A;  3E5Q A;  1LCL A;  2IXJ A;  3WW1 A;  5LZ6 A;  3D6E A;  3IMN A;  1KJL A;  3BI3 A;  3QH6 A;  4OHY A;  2MEV 3;  5LBB A;  1CX4 A;  2QQO A;  4GKY A;  2P3Y A;  5CFC A;  2MEV 1;  2X09 A;  4G4F A;  4IGQ A;  1UZZ A;  1KDM A;  1KD7 A;  1YLL A;  2CGO A;  4CZS A;  5HCH A;  1I9R A;  1E5S A;  2VW0 A;  1YJK A;  4FPG A;  4AOC A;  4HLT A;  2GNB A;  2Y6J A;  2B45 X;  2ZML A;  4BIS A;  2DCT A;  5F37 A;  1OQD A;  2YZ4 A;  3ACL A;  3UL2 A;  1PVC 2;  3AMP A;  3Q8F A;  3LEK A;  4LHN A;  3W5M A;  2BGC A;  2PN5 A;  1FV3 A;  5LA9 A;  2PHD A;  2VQU A;  4XAA A;  4RFR B;  3W5N A;  4RQP C;  1YFX A;  2E7Q A;  2XWJ B;  4ASK A;  3LEG A;  5JI9 A;  3BTX A;  3K3N A;  2Q5T A;  5JZG A;  4MH0 E;  3MW3 A;  3N3H A;  1AL0 G;  2VY0 A;  5CA6 A;  1NT0 A;  5JXI A;  2PTM A;  5HXV A;  4BDV B;  4YGE A;  5FZO B;  5I0S A;  1RUF 2;  5JXG A;  3GM8 A;  3TYJ A;  5BNN B;  4N53 A;  4YW3 A;  4DEQ A;  1JS9 A;  3ZN6 B;  2CNA A;  2XWB B;  1NXM A;  1GZ9 A;  2VUC A;  1EV1 3;  1LU1 A;  1H8T C;  1BCX A;  1EV1 1;  1HB2 A;  4OZO A;  4B7K A;  4PLM A;  4QDQ A;  2XJU A;  4A2U A;  4XHB A;  5JCT A;  5KC5 A;  1BVV A;  1H0B A;  5ACA 3;  3FLT A;  3BAL A;  2PHX A;  1TMF 2;  3DN7 A;  3RZL A;  1COV 3;  5ACA 1;  3TOJ A;  3I2J A;  4HKO A;  5BNQ A;  5FZO A;  1COV 1;  1WD4 A;  3AKR A;  3ZKY A;  3MUY 1;  2RDR A;  3VD5 A;  5FZH A;  2GP5 A;  2JDU A;  3ZN6 A;  4YM0 A;  1TME 3;  2VZT A;  4L92 A;  5FMO S;  1TME 1;  1FI2 A;  3IIA A;  1KFX L;  3BU0 A;  3RGB A;  1SAC A;  2P1B A;  2PHT A;  2BZD A;  2IXI A;  4PHZ A;  2WSV A;  4CU6 A;  1ULD A;  3W21 A;  4YWA A;  1F5J A;  3UKN A;  4CYD A;  1E5R A;  1LEC A;  2OX0 A;  4XJZ A;  5LK7 B;  1X8E A;  3WZ1 A;  4CCO A;  1YIF A;  2EVX A;  1RUI 2;  1HV1 A;  3LOI A;  4N9H A;  3O5S A;  4DY3 A;  3UJQ A;  3ZXE A;  3WSO A;  1Y4W A;  1GOG A;  2WBK A;  4M3C E;  3GBG A;  3ZFF C;  5BUV A;  2G4I A;  5ABJ B;  3UET A;  3NAP C;  4XIK A;  3OGS A;  4OCT A;  4IEZ A;  1MPX A;  1YFU A;  4LIV A;  2WA3 A;  3T09 A;  1VJ2 A;  2J22 A;  4A6S A;  5BYN A;  1XU2 A;  1N3P A;  3NO8 A;  2OS2 A;  1WKY A;  3ENR A;  1W2N A;  2GNT A;  1F5F A;  4WZC A;  3VL8 A;  5LCW L;  1BYH A;  1NUK A;  2QQN A;  2G9G A;  1Y9Q A;  4RYD A;  4TZD A;  4QXH A;  3WEZ A;  2YMZ A;  3IDE A;  2ATF A;  1VAM A;  1XRU A;  3HMY A;  5ABJ A;  2PMW B;  1HB4 A;  3B93 A;  5A7W B;  5I0R A;  3GHN A;  2W52 A;  3OPW A;  4DPN A;  3T4V A;  1TNR A;  1JI6 A;  1HN1 A;  1YHF A;  1RED A;  2DVA A;  4LXL A;  4P14 A;  5F1R A;  5E8A A;  2D3P A;  1OF4 A;  3ACI A;  2ARA A;  1ZZ8 A;  4LUM A;  4UXA A;  2DU0 A;  4HK8 A;  1O3S A;  4HOO A;  3TRS B;  2VJX A;  2QQW A;  4HAN A;  4FPC A;  4AGG A;  2VO5 A;  2ID4 A;  4E2G A;  1DGR N;  2D40 A;  4CPB A;  5A7Q A;  1QJU 3;  1HJF A;  4MOA A;  4ZXE A;  2R04 3;  3PHM A;  5FLH A;  2ZXQ A;  5A7W A;  4BQ2 A;  1QJU 1;  3W20 A;  2R04 1;  4A42 A;  2P17 A;  3JBG 2;  4F3J A;  1W9F A;  3UK9 A;  1ZRC A;  3JZV A;  3QBQ A;  1VB2 A;  2WQ4 A;  2R32 A;  1W6Q B;  3LF7 A;  3WF4 A;  4PBP A;  2ARX A;  4DUW A;  1QXP A;  3FFQ A;  2FCV A;  4SLI A;  2OKX A;  4Q4V 3;  3GCW A;  4CU9 A;  2P3K A;  3LKJ A;  4YZ4 A;  4Q4V 1;  5FP9 A;  4FAH A;  5FIX A;  4WVW A;  3WF0 A;  3P5B A;  2Q1Z B;  4S2H A;  2X29 A;  5JUV A;  1SMV A;  2EXJ A;  4RGA A;  5GM0 A;  4KU7 A;  2Y38 A;  3N9M A;  5IK4 A;  1CX1 A;  1VP6 A;  4LHS A;  1AXY A;  1C57 A;  1DCS A;  1V9U 3;  2VVF A;  2HBT A;  1K5J A;  1VBE 3;  2G19 A;  3AFG A;  1FPN 3;  1V9U 1;  4UAP A;  4Y1U A;  5FZD A;  3FL7 A;  1VBE 1;  3ZYI B;  1FPN 1;  1HW5 A;  4FPL A;  1J58 A;  1VBB 3;  1ND3 C;  1QQP 2;  1W6Q A;  2NN8 A;  2Y6G A;  1TEI A;  3H1Y A;  4GQ7 A;  5LBE A;  1VBB 1;  2OW4 A;  4UWD A;  3FJS A;  4LHL A;  2VZQ A;  2A3X A;  1B09 A;  2BFU L;  2VMI A;  2A6Y A;  2LW8 A;  1LGB A;  5ANQ A;  3MGU A;  4DEV A;  1BBT 2;  2VQA A;  3ME2 A;  5IVY A;  3CIH A;  1UOG A;  1DG6 A;  3KV4 A;  5DPN A;  2XVL A;  3VB9 A;  3KT7 A;  2H0B A;  4S2G A;  1UN1 A;  5JSP A;  2Z79 A;  3M3I A;  2TUN A;  3GAL A;  1FOD 2;  3MIE A;  5CB7 A;  1OQ1 A;  4AVT A;  2KA3 A;  1EAH 3;  1WMX A;  3VD4 A;  1LOE A;  3EHK A;  2VUL A;  1EAH 1;  1PO1 3;  1W2O A;  2C1F A;  1C3H A;  2XBO 3;  1PO1 1;  3SEP A;  2AR6 A;  2XBO 1;  4ET7 A;  2BJS A;  1WA6 X;  2FZ1 A;  4YNI A;  4NWV A;  2H6B A;  4LQR A;  2VGD A;  4QQO A;  5F5C A;  2JIJ A;  4XE9 A;  4PIY A;  1DLC A;  1HX6 A;  3NJZ A;  1G86 A;  2A6X A;  5JOX A;  1W06 A;  4C90 A;  5IFP A;  2HWD 2;  3EB7 A;  1XNK A;  1FT9 A;  3C7E A;  1DQ0 A;  4FSJ A;  2D6L X;  3POJ A;  3OGV A;  4PDW C;  5BNP C;  4DB5 A;  3T3Y A;  3CZU A;  1R09 3;  3KV6 A;  1GR3 A;  4Q1P A;  1R09 1;  3MPP G;  4ZPI A;  4WVZ A;  3VBO B;  1CAV B;  3LDR A;  3HJR A;  3III A;  1RMU 3;  4IE7 A;  4Y5Z 0;  5HI0 A;  4E4D X;  2X5I C;  3CL1 A;  4LJH A;  1PVX A;  1RMU 1;  1RIR A;  2DUR A;  1C8M 3;  4GWN A;  1WW4 A;  4C8D A;  3NL1 A;  1DYK A;  4MV2 A;  4Q4Y 3;  3PU3 A;  4XUR A;  1C8M 1;  1MR5 A;  5FZC A;  3RNS A;  4C1X A;  3Q8A A;  5I91 A;  4Q4Y 1;  4Q5O A;  1MS8 A;  5FAX A;  4XPV A;  5JMC A;  2RV9 A;  3VV1 A;  2YBP A;  4YVS A;  1OLR A;  1VR3 A;  1YQ2 A;  3SHR A;  4RHV 3;  1CVN A;  1CAX B;  1W8N A;  4FI9 A;  4K40 A;  4RHV 1;  3NST A;  1ALY A;  2B5H A;  2VUD A;  2ZA9 A;  5F5A A;  1W3X A;  4P9J A;  4QMA A;  1CAV A;  3VBO A;  4I2O A;  1QY4 A;  5GZC A;  4LO8 A;  1ULO A;  4P9X A;  5BV6 A;  1XSR A;  5E16 A;  2EXK A;  1O8P A;  2IXL A;  3TEY A;  2WQ8 A;  1MZF A;  3KD4 A;  4A7K A;  1PK6 B;  4UOJ A;  1J1T A;  1C1L A;  5FQ0 B;  1JZ2 A;  3URF A;  3WDY A;  3H7J A;  5FUP A;  4LLO A;  4TN7 A;  3RYP A;  4E4Z A;  4M4R A;  2ZGM A;  1UY4 A;  2D5H A;  2ZOE B;  3I4I A;  5FFO C;  1CAX A;  1Y9G A;  2V72 A;  5FJK A;  5FXV A;  1DQ4 A;  3ES1 A;  3NJX A;  1RUE 3;  4QHZ A;  3PL0 A;  5SV5 A;  4JQR A;  4LOR A;  1RUE 1;  1G7Y A;  5IJR A;  4AEJ A;  2FMY A;  1YYN A;  4AI2 A;  4BXS V;  3ZSJ A;  4R4X A;  4CXX A;  4V2V A;  4AI0 A;  1BEV 3;  3NNM A;  1HLC A;  2O8O A;  3KF5 A;  3RZJ A;  5ISL A;  1BEV 1;  1MS4 A;  4CUB A;  1AR6 3;  3KF3 A;  1BK1 A;  5FQ0 A;  1RHI 3;  1AR6 1;  1W8F A;  4Q2F A;  4XXA A;  3VZK A;  2PHW A;  1APN A;  1Q8V A;  1RHI 1;  2HEV F;  1Y9M A;  2WO1 A;  3C7O A;  3R0R A;  5T50 A;  2O1Q A;  2CGP A;  1OUR A;  4LIT A;  5F2W A;  3S0M A;  1FMD 3;  4UW4 A;  4QX7 A;  1W28 A;  2YB7 A;  4LBM A;  3O14 A;  1FMD 1;  2GH2 A;  2A6W A;  5IFT A;  3H9A A;  1DFQ A;  4AVS A;  4B29 A;  3VZL A;  3WG1 A;  4XZU G;  4GUL A;  4CP9 A;  3ST7 A;  5FZ4 A;  1LRH A;  5L36 A;  3POI A;  3HT2 A;  3EXU A;  4D7Y A;  3TN9 2;  4HN1 A;  3VLB B;  2PHF A;  1LHV A;  2HWE 2; 
#chains in the Genus database with same CATH homology
 1YQC A;  1XSQ A;  2BDR A;  1XSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...